LOCUS       AP011117              244997 bp    DNA     linear   BCT 01-NOV-2012
DEFINITION  Rhodococcus opacus B4 plasmid pROB02 DNA, complete sequence.
ACCESSION   AP011117 AB193045
VERSION     AP011117.1
DBLINK      BioProject:PRJDA34839
KEYWORDS    .
SOURCE      Rhodococcus opacus B4
  ORGANISM  Rhodococcus opacus B4
            Bacteria; Actinobacteria; Actinobacteridae; Actinomycetales;
            Corynebacterineae; Nocardiaceae; Rhodococcus.
REFERENCE   1  (bases 1 to 244997)
  AUTHORS   Sekine,M., Hosoyama,A., Kosugi,H., Yamada,R., Matsuo,Y.,
            Tsukatani,N., Fujisawa,T., Takarada,H., Omata,S., Kishi,E.,
            Shimizu,A., Koga,C., Saito,S., Nakazawa,H., Sekigawa,T.,
            Nishiko,R., Takeyama,M., Tanikawa,S., Tago,S., Fujita,N., Kato,J.,
            Na,K.S., Ohtake,H. and Harayama,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (30-MAR-2009) to the DDBJ/EMBL/GenBank databases.
            Contact:Director-General Department of Biotechnology
            National Institute of Technology and Evaluation, NITE Genome
            Analysis Center (NGAC), Department of Biotechnology; 2-49-10
            Nishihara, Shibuya-ku, Tokyo 151-0066, Japan
            URL    :http://www.bio.nite.go.jp/
REFERENCE   2
  AUTHORS   Takarada,H., Sekine,M., Hosoyama,A., Yamada,R., Fujisawa,T.,
            Omata,S., Shimizu,A., Tsukatani,N., Tanikawa,S., Fujita,N. and
            Harayama,S.
  TITLE     Comparison of the complete genome sequences of Rhodococcus
            erythropolis PR4 and Rhodococcus opacus B4
  JOURNAL   Unpublished (2009)
REFERENCE   3
  AUTHORS   Na,K.S., Kuroda,A., Takiguchi,N., Ikeda,T., Ohtake,H. and Kato,J.
  TITLE     Isolation and characterization of benzene-tolerant Rhodococcus
            opacus strains.
  JOURNAL   J. Biosci. Bioeng. 99, 378-382 (2005)
COMMENT     Kato,J., Na,K. and Ohtake,H. are at Department of Molecular
            Biotechnology, Hiroshima University.
            
            Rhodococcus opacus B-4 strain was isolated as a benzene-tolerant
            bacterium (Kyung-su Na et al 2005). The complete genome analysis
            of R. opacus B-4 was carried out by NITE. The genome analysis
            indicated that this strain has one linear chromosome, two linear
            plasmids pROB01, pROB02, and three circular plasmids pKNR, pKNR01,
            pKNR02. Partial nucleotide sequence of the linear plasmid pROB02
            was previously determined by Kato et al, and was registered with
            the accession number AB193045, which is now merged into this
            record with the permission of Dr. Kato.
            
            The differences between the entry AB193045 and this record are as
            follows.
            'C' at position 169867 was inserted.
            'GC' at position 170058-170059 was inserted.
            'T' at position 170676 replaced 'C'.
            'T' at position 171855 replaced 'G'.
            'GCT' at position 173294-173296 replaced 'CTG'.
            'A' at position 173783 replaced 'C'.
            'AT' at position 173819-173820 was inserted.
            'CCT' at position 174725-174727 replaced 'GCC'.
            
            This work was supported by New Energy and Industrial Technology
            Development Organization (NEDO).
            
            Please visit our web site.
            URL:http://www.bio.nite.go.jp/
            
            DOGAN ; Database of Genomes Analyzed at NITE
            The database contains genome sequence data, physical maps and the
            genomic and proteomic data of the microorganisms analyzed.
            URL:http://www.bio.nite.go.jp/dogan/Top
            
            The microbial genomic DNA clones used for the sequencing project
            are available through the NBRC.
            URL:http://www.nbrc.nite.go.jp/e/index.html
FEATURES             Location/Qualifiers
     source          1..244997
                     /db_xref="taxon:632772"
                     /mol_type="genomic DNA"
                     /organism="Rhodococcus opacus B4"
                     /plasmid="pROB02"
                     /strain="B4"
     CDS             944..1294
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00010"
                     /product="hypothetical protein"
                     /protein_id="BAH47014.1"
                     /transl_table=11
                     /translation="MHRRKRRRSSRTACARPPCSGTKRIGTDHLLLALLDDPTSTGAQ
                     ILTDLASLPISEMREHLRRELAQQPTPGPAHRIPIRLSDDEYTRAHAAARTAGQNLET
                     WIHNRITDALEQPE"
     CDS             complement(1702..2253)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00020"
                     /product="hypothetical protein"
                     /protein_id="BAH47015.1"
                     /transl_table=11
                     /translation="MYFTPGWAAILAAGSTLSGIVITQTFNLIWSNRTRGVDQREKQR
                     IALVEAVAAADHAFVGIDAAESEIRMYSTYNDEDEIWEQIASRIRKFREEETALLNAI
                     ARAELVIPSAKTALDELHTALTKFGESVIDWNRTVLSRTVAYIQNNGDLSDEPSPPDV
                     DEPRQGYVQARKNLMDTARAIRD"
     CDS             2243..2770
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00030"
                     /product="hypothetical protein"
                     /protein_id="BAH47016.1"
                     /transl_table=11
                     /translation="MKYILKQLHERSHSRWSGYSGKSSTRCNWQRNPALTVTRWRHRF
                     RVMWLTNPASTVGAALTVYVRRGGAVTFHNHFRWPAITPQRPPAGRQLRLELLTIAAE
                     ADQLVITFTTDKRIATTYNRDGWRAPTPAERHEYTIPTTTKQNGEFTRWDLLFDPHDE
                     KCAATLTAARAELAT"
     CDS             3214..4929
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00040"
                     /product="hypothetical protein"
                     /protein_id="BAH47017.1"
                     /transl_table=11
                     /translation="MTTSTQSARRLTPRSRVIQWTVRNFKALEHATLPLDRLNVLVGP
                     NSSGKSSLIQSLLLLAQSTDDEVILNGPLVRLGDPLDVISADSEFVSLGFVVDGTRIP
                     GADESTSNVLFEVTLSHQHGSLVVCEFTAVEENTDRILIRATSERVNAGIRADVTKDS
                     RVHETVLRVREINGSDSPSSTFITFTGLFPEALVYKSTRQQVLSELRRGIRSARNDSD
                     SELAFSATYEVTQWMRRNIDKMPEEVRGIVTSKSHGAFSQLFELPRTALSELLDAFVA
                     AEVSEIEWARVSITNFRRLGTRRIRSTALLGLSPKRENVVSVLALASDALLAFQSSIR
                     YLGPLREEPQVVSPTGARYRALPAGPKGEYTADLLARMRVSEIRYGDWNGEIRVGTVS
                     EALTLWTAYLGVGDDVSVEDQGKLGRGLRIRVNGIERDLTTIGVGASQLIPVLTVVLT
                     APAGSIVLLEQPELHLHPSVQSRLADFFLRARINIKLVVETHSEYMITRIRRRVVEKT
                     TPARHIAVLFAEQHDGITEMRHLHLDRLGDFSHWPRAFFDTQDEEARALVVAVRKAID
                     SGQKS"
     CDS             complement(6517..7833)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00050"
                     /product="hypothetical protein"
                     /protein_id="BAH47018.1"
                     /transl_table=11
                     /translation="MDVSPWRNRCGQQDRQACAFPRVTAKADGERVPSAVGGRERREL
                     PSALPRGYGDRMQTSADLPDPDVIDESVTDDEGLVDLGDSTLSYLGADFDVAGLVRRL
                     EQGDIVVPRFDPDESAGSEISGFQRQGVWTPKKMEQFIESLLLGWPVPSIFLVLEPDQ
                     RYLVLDGQQRLTALESFYKGKYPNGREFSLNEVAEHLQGATYETLNSESRRRLNNTFI
                     QATVIEPKGPDGRESIYRLFGRLNSGGVSLTAQEIRVALYRGPVVDWIRDLNHDENWR
                     RLFGPAHKRLKDHELILRSLALLRAMSTSGSGNGETSAYRPPMSDFLNNYLKDNRDLK
                     STPTAELSDAFAKSTSALVAASGSNALRYSGTINAAHVDATLANLMSIFLGGGSISPS
                     ELKKSLDKLRDSEEYRAYVTRSTSHRDSVNGRLSVARSIFSEAAEL"
     CDS             complement(8108..9394)
                     /codon_start=1
                     /EC_number="2.1.1.37"
                     /locus_tag="ROP_pROB02-00060"
                     /note="protein synonym:cytosine-specific DNA
                     methyltransferase"
                     /product="modification methylase"
                     /protein_id="BAH47019.1"
                     /transl_table=11
                     /translation="MPAKKKSATPRSDYQVVEICAGAGGQALGLEKAGFSHKLAVELD
                     TNACATLKLNRPDWDVEEGDVADPTVWKPSEHEGVDLLAGGVPCPPFSIAGKQLGASD
                     ERDLFAWAVETAGQIQPRALMLENVRGLSAPRFAAYRQRILDRLTEFGYVADWRLLQA
                     SDYGVPQLRPRFVLVALRQEDAAYFHWPEKTPTQDTVGSALKDLMGVDGWQHVDDWAA
                     LANDIAPTLVGGSKKHGGADLGPTRAKRAWLELGTSGMGIANDPPAADSPHPADVPPK
                     LTLPMVARLQGWKDGEWEFSGGKTAKYRQIGNAFPPPVAQAIGKSIVAAFDKTAARRE
                     ILELAPETVHDAVYRILKSTDGFVTATKLLKLSDGLVEEHDLERRIANLSRDFTVDIK
                     QTKSGVSYRLGEFKGFTGQDDHQRHEYITAFRSRVS"
     CDS             9625..10332
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00070"
                     /product="hypothetical protein"
                     /protein_id="BAH47020.1"
                     /transl_table=11
                     /translation="MTNGEVRRSSRVLVAEFIAGIGEGNKFTKLDLNRAIPFYAQNDR
                     RMRDLRECGWVIDNYKVNPSLAPDEYLVRRIGVRIDLGERPPKPARKTVGGAKRRRIL
                     ERDGHVCAICGVPAGEPFPDAPGRRAVLTIGHLIPVARGGTDDENNLRAECQRCGDES
                     RDNTLDPPTTDFVLTRARNIRSRKEKKRLFAWMVARRKDPDDTELVFLDWCRLPHSEQ
                     LRVMQEFGRQVLADDEG"
     CDS             10445..11371
                     /codon_start=1
                     /EC_number="3.1.21.4"
                     /locus_tag="ROP_pROB02-00080"
                     /note="protein synonym:endonuclease"
                     /product="type II restriction enzyme"
                     /protein_id="BAH47021.1"
                     /transl_table=11
                     /translation="MTTMDAFAAPDPEMEAVADELLRADPDGARWAAVVRHTYDMIYN
                     GAETGRYRWDQLMKTEKTHFGTLFEINAQREFEFDGGDQTDYRIAGHQVDAKWSQKEG
                     SWMLPPEVFGRLALVATGNDERAIWSLGLVRVRQEYRSEGANRDKKTTLNALGRSSVR
                     WLWKDAPMPANILLQLPRPAVDDLFTRKHGTQRTNQLFRLAEGQLVHRSAVRTVAMQL
                     DDQKRVRANGGARSALAPEGYIILSGTWEKQKQIAADLGVPVPSRKEYISVRIVPSDP
                     GTGTEIKGGHWRRATPGENVTEPAPLFVKDDE"
     CDS             11569..11967
                     /codon_start=1
                     /EC_number="3.1.-.-"
                     /gene="vsr"
                     /locus_tag="ROP_pROB02-00090"
                     /note="protein synonym:very short patch repair protein"
                     /product="putative DNA mismatch endonuclease"
                     /protein_id="BAH47022.1"
                     /transl_table=11
                     /translation="MATSAGRSRNMQAIRRADTKPEIRLRSALHALGFRYRKDYPIRI
                     DGRLIRPDIVFTRRKVVVFVDGCFWHSCPEHGRNPAVNERYWSPKLRRNAERDVEQTR
                     LLESAGWRVLRIWEHVPLDDAVATVTASLT"
     CDS             12051..12281
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00100"
                     /product="hypothetical protein"
                     /protein_id="BAH47023.1"
                     /transl_table=11
                     /translation="MYRHHARVSIHPRKDHEMRTLNDWIPALAAKYGTPDVVMHMTAQ
                     RQAGDLGIAWAKDMPASDVQAVIEAVDALYSK"
     CDS             complement(12508..14391)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00110"
                     /product="hypothetical protein"
                     /protein_id="BAH47024.1"
                     /transl_table=11
                     /translation="MSTGNMRRSQLVSPFGVGALSILVNGSSVITAGLDHWYESDDRD
                     NLYPDEFLVPEWRLQERLRVSELRLPPDFRRPRGGGNEQRNLKLSVPVLRFPRWCFCI
                     YCKRLSRTKLSMTQLVRCTDNTHDERRRPVMSQVPFIVICERGHLDDFPFPEWVHHSL
                     SPTCHGTLRLLSQGGGTLAGQLVKCDGCKAQRSLEGITQTAAKRGDEERTILSSHLAA
                     GAEFNCVGSRPWVADEGSGCGLPLRGALRAAGNVYFPKVESSIYLPRHEGGVSAEVLE
                     LLRRPDVQARITAIHEIVGQVTTDSLRKTTPLELLKSFSDDELAAGLDELLGNSQKTD
                     RPSETETLTSTVTWRYPEFKLLRETPNDPDLKASDPGVPDRLVEVLDRVRRVEVLRET
                     RALRGFTRVRDGLLRLSEGKAMLRRTALPPDHDWLPACVVKGEGLYLELNSQALSDWE
                     NRDEVRVRARRISTHYVASRHGTDGPVRDLSPRLILLHTLAHLLINELVFTCGYSSAA
                     LRERLYVSGEPGREMAGVLIYTAAGDSEGTMGGLVRMARPENLGPVFEATIDKARWCS
                     TDPVCMEVGELGQGPESCNLAACHGCALLPETSCEEFNRFLDRGLVIGTFADPTLGFF
                     ARP"
     CDS             complement(14388..17879)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00120"
                     /product="hypothetical protein"
                     /protein_id="BAH47025.1"
                     /transl_table=11
                     /translation="MSGIEARGVMEAAVRRELFGPPPGETRRGKPIDTTTGAVHFDSW
                     PASHGLWYDETTGQEILTETEPLRRYGIGVLYPQGSAARSQAAGETIAGTPGLPTDDE
                     IRDIDPSGTVTPTRQPDPDTDDFDLSDANSFQPSAMAVSFRVRMAPGQSLQIRASFGY
                     YDRLPVHIAGAPREWWLRRPVTMTATASAESLFRGAKQLFPLDAELSRHERVQPQLQA
                     YTRPVPGDPDPACRLVTIVLVNTTSGSGSAAALLQAGFEVRPADGARIEAYPEPDTPG
                     GSGNEEASIALLYRHKRTYAVGHGCAADWDEPGGDTVGAVRAEALPAYEVPSLTPDVY
                     CINGNGQREPVRVSMKSLADGSADGHRQIETVLGLYARWIEDRRNEITGLPDRYRDAA
                     ARHMELCEGALERMRTGQALLESNTAAARAFRLANEAMYYQQIRSRLPLRTVSLNRQG
                     IFEVAGPTPAAVPEPGIGSWRPFQIAFLLASLPDVFDPSTADRELVDLIFFPTGGGKT
                     EAYLGAAAISMFARRLRNPADAGTDVLMRYTLRLLTAQQFLRAASLLCVMDDIRSRAA
                     DLGTERFSIGIWLGSATTPNRWAAAKTALGKLRQDSSQENPFLLLRCPWCGAQMGPPE
                     GATKAGTASNSRRAGGQGPIGYMTVAGSKIRFICPDGNCRFGMRNREGLPVHVVDEDI
                     YDTRPTLVIGTVDKFAMLAWEPNARGLFGLGSDGARQVSPPGLIIQDELHLISGPLGS
                     MVGLYEAIIEDLCTDHRGREPIRPKIIASTATIRRYEQQIRDLYGRTRVALFPPHGLE
                     EGKSFFAETATLPDGTQAKGRRYLGVMSPSLGSIQTVQVRVAAATLQGATKIPEADRD
                     GYWTNLNFLNSLRELGNTVSLLQSDIPDYLTGIRKRDGLIAADIRWPRNTLELTSRRR
                     SDEIPKAIEELQQEYGQDCCVDVCLASNIIEVGVDIDRLGLMTIIGQPKTTAQYIQVS
                     GRVGRRWWERPGLVITIYGAAKPRDRSHYERFRSYHQRLYAQVEPTSLTPFALPVLLR
                     GLHGATVAHIRQSAETRLGPDPFPDARFGVATGLIRDRAAHADPAELPTLDAVIDRRA
                     REWRHGERTEWSANVNGGDPMQGLMRWAGSAQEPGALVPTIWDTPTSMRNVDAECQLR
                     ITAAYAADAASTTEESE"
     CDS             complement(17884..19578)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00130"
                     /product="hypothetical protein"
                     /protein_id="BAH47026.1"
                     /transl_table=11
                     /translation="MARMIPPIVAHDAPPGERQVFERLATDPLAEDWTVLHSLALAEH
                     VRQTQGEADFVVVAPGHGIAVIEIKSHARATCLPDGRWQLGNHPPTARSPFQQSNEAM
                     HSIREYLQKRGADLRAVPIVSGVWFTHLRARASLPASPEWHEWQLLDLTDFRTGAARA
                     VLRLLVKGREHLTGRLPTLRQSPGQPSQESAGALTATLRPRFDVTIAAADLRHDRTTQ
                     LTAFLGEQYEALDAMAENRSVLFTGPAGSGKTFLALEASRREQARGADGRLLCFNRLL
                     GRHLRASTPASAGLQAGGFHSELLRLTRLTPPPHPDRAFWDELLVTAIDRLLDGDFTR
                     DFLIVDEMQDLARPAYLDVLDLMVKGGLAGGRCLFFGDFERQALYDLEDGRDALRERI
                     PGLAHHRLMTNCRNRPRIGSTVELLAAMSPGYKRFRRDDDGATPRYYWYEAPGEQAAE
                     VIKAIGDLKAEGYELDEIVLLSPRRDGSLAATTTDTWLRQILAAEEGTQPRKGRLRFA
                     TIHAYKGLEAPAIILTDIDDASLPGFDALLYVGLTRATDRLSLVGRRSALRPKLEV"
     CDS             complement(19566..21089)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00140"
                     /product="hypothetical protein"
                     /protein_id="BAH47027.1"
                     /transl_table=11
                     /translation="MPMTPLTQIAGRYRAAAVLARAEIALYAVADDAGAQLDAALRRL
                     IARLREEDPEVWQDLLAMARQLRWRLATNPAPPVFRVGEDELVAALGSACDRRIRGAD
                     ETTQLLLSDLADRAERAHLEDRPTGAVLLESLAEVNYESCVVVTASGRTQDATRQWFG
                     ELGIAVPVLCATFREQAFVVEQAYAVGSPSLFGPGLLSAPRASELAYVLPSWVQDRTL
                     PVSPISDYAEGAIRPRRKVFTIGAEPVLAPVPVVVGDQLVPQPSWSPQAPSRPPRPGE
                     VLARKVFLGGGLAIMLDQAGEHIRTLHPQRPPGQRVDLSDVSALTVGSYLVLREGSTV
                     SEMLYDRAIELLGARGSAARASQAEWKAALRRELDRMGTRTAIQSLAQAGVTRADRAP
                     AWTSTTMVRPQNGNDFVFLLRWLGMPKEPHYELATSLRRARLQASQDIREILEEAIST
                     ADLAGLDRDGFLRLELNIPGFRSMIATRVLAISPNLEPVHRGDIRRPSKDRSAQWLE"
     CDS             complement(21080..21763)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00150"
                     /product="hypothetical protein"
                     /protein_id="BAH47028.1"
                     /transl_table=11
                     /translation="MLPTLQRGTPVLLLLAGTCLVAETFYESRVVKGRTQIHGGEMDY
                     QLEKIKYLVPAPRFSRYRKLKVPLAGSLVTSAGRAEAWPAEQVASGSDVVLIGTKTWI
                     TSEMDVRIGLGDSDPGWNSFAELLRPSDGIRPSWRSEILPAARSEEAIMPPEARLTVL
                     DGSSAIGWISDLSCDVTVAIVDRSAAYEFAADSILAARSMGGIPLSLNDIGWHPPPGI
                     EALAFETCR"
     CDS             22482..22847
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00160"
                     /product="hypothetical protein"
                     /protein_id="BAH47029.1"
                     /transl_table=11
                     /translation="MTEDDYIDVVGAQSVLEVAEVVAAVLGARMEMGGEPGRIVVTGA
                     PDPDLRVAIGLAINDRGLPERWTRRITITHNRSSDERHRWAQHLHRALTERRDWTLTV
                     TPGGPPNPHTPPPSNTQGG"
     CDS             22957..23205
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00170"
                     /product="hypothetical protein"
                     /protein_id="BAH47030.1"
                     /transl_table=11
                     /translation="MRNMLGVVLTPKQPHRQRVHARHRGSSRDSARVVTESFTDGEVD
                     SPVALLVGRLGGRGAAAVVAAFTAQRPRRTPEHRLTQS"
     CDS             23366..24379
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00180"
                     /product="hypothetical protein"
                     /protein_id="BAH47031.1"
                     /transl_table=11
                     /translation="MDELDSKNLGRLRRIADARSVWTSESGDFTPWLAENIDVLADAL
                     GMSLIVVDTEVRIGDFRLDIHAKDGNDRSVVIENQLERTDHGHLGQCLVYASGLDAST
                     VIWVAPNFREEFRSALDWLNERTDSELGFFGVEVGIVQIGSGPPAPVFDVVSRPNDWQ
                     KTVKTAGNAAEARASTPVNAARQALFTDILTDANTRQPAISVPTPGKGNWISFASGPF
                     GNWDLTVSDGRLRVDAYIDTYNRDLNNALFDEFAAKAASWQTQTGLDLAWERLDDKRA
                     SRIAAYRPVDLDDPADRDATRQWAADALVAMYNTLNTPLRAAAKVRRAEYAAPAPPPE
                     SQI"
     CDS             complement(24674..25162)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00190"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH47032.1"
                     /transl_table=11
                     /translation="MSVVVPISAVCGIAVPVLMGVAALGERPSTLSWLGIVIAVPALW
                     LVAHTGTHAGPALPAAALAGLVAGLGIAVQYVALAQVGAGSGLWPVAAGRVAAILTIV
                     PLLPTARGTHIRWSLVPALAAGFTGEAAALIAYMLATREHLVVVAVVLSSPYPVVPVC
                     SA"
     CDS             complement(25086..25718)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00200"
                     /product="hypothetical protein"
                     /protein_id="BAH47033.1"
                     /transl_table=11
                     /translation="MNREELEHVIEAACANLDEGQVIVFGSQSILGTYDETELPEYAT
                     LSREVDVFPRSGIDAPASPAVVEKILILNGRLGECSPFHESFGVYVEGIHKGCSGTAE
                     AMGQPLVAVEVQDGSEYGRAGFCLDPVDLCASKAIAGREKDRVFVAALVEDGIVTATQ
                     ILGGIDSYGIEWPDTYPVPRPQPWGDERGCSDQRGLRHCRAGPDGSRCSR"
     CDS             complement(25715..26014)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00210"
                     /product="hypothetical protein"
                     /protein_id="BAH47034.1"
                     /transl_table=11
                     /translation="MQAAILNKVEREHLPLDTVRVRRSLQSVREHVSRSPYFTDFLDR
                     WERIVEDNDVETLRRIVESDDETGNEMRNLSPLHVLLTEDERMKVLDDLRELVLK"
     CDS             complement(26435..26929)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00220"
                     /product="hypothetical protein"
                     /protein_id="BAH47035.1"
                     /transl_table=11
                     /translation="MLELTSNNRYASSVYVYDENEYAEMRMLVTEDGKAGVALKDDEV
                     VSVFSHNDGAHPNAAPSMLRQATVLGGRRLDCFDTVLPNIYADAGFVPVARLAWNDDY
                     APDGWDYDTYRRYNNGRPDVVFMAHDPAAVGSLYDPAAGAYVSDYDDGIAAAKTYRTT
                     TAEM"
     CDS             complement(27067..27243)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00230"
                     /product="hypothetical protein"
                     /protein_id="BAH47036.1"
                     /transl_table=11
                     /translation="MFEPKELTAMNHEPMTQERREAFWRKYRWTPDLLPEQRKAIEQV
                     WTDEKIEEAEALGF"
     CDS             complement(27567..28367)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00240"
                     /product="hypothetical protein"
                     /protein_id="BAH47037.1"
                     /transl_table=11
                     /translation="MNSFSILPGRPSSPVILHVPHASRTIPPHVRAQLLLDDAALDAE
                     LDEATDTDTDLIATLGADHARTHPWIVKNALSRLVVDPERFPDTSEPATVFGRGAVYT
                     RACNGRRLRGEPFAAAEALLDEYFRPYARAVAELVTDRIAACGRAVIIDVHSYPKRPS
                     GFENPVAARPAVCIGTDRLHTPDWLTSATRRAFLPLGEIAENTPYAGCYVPLGRYGHD
                     ERVSAVMIELRRDTYLPDDGRPGKHSVAQLGTYLAELIDTATEVGADV"
     CDS             complement(28509..29231)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00250"
                     /product="hypothetical protein"
                     /protein_id="BAH47038.1"
                     /transl_table=11
                     /translation="MRTMKKPTLGRSTPRHPAVIDLLGTTPTADHPPGARTTALGGPA
                     TPPPPPRSPLPPARGGRGPGKKTIATVAAVAVAVAGGVAVIHLCSGDSETASTAATTS
                     ATTTAADENGLPILNLPEPEQAEQTSTSDGECRADRGDQKSGAGVIAAFNHAYYSQRN
                     GEAARGLATPTSSVLPGPELQKVIDAVPIGTNYCLRTVELSDGVYLVDLSVMQPAQPV
                     KRGTQTVTTHKVDGRWYVDVFT"
     CDS             complement(29246..30475)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00260"
                     /product="hypothetical protein"
                     /protein_id="BAH47039.1"
                     /transl_table=11
                     /translation="MSNDINTGNRAARRARHRRRSATQAATALAVIAAALASGIALSP
                     SAFADPIQGGVTGGETQEGVTGGDTQSGTTAPTPAPEPETAFVPQIPAEPVYWVDPPA
                     EYQNIEYQPLPNYDYDTNAYVEPENYYLAPVAFDQLHLPTPVEPTAPFIAPRDTLRLG
                     ELHIKQPNWISDLDRDRTNNTMSVVQAGVSTGWRSIGVDTNRADRIAAAQVGAGALGV
                     VTGAAAAGVPAAIAGGAAVGTVAGLVGATAGNAFIPGIGWAPVGAIATGAGAAAGAAA
                     FGLPAAALGGVVGGAVAVAAVTPIAAGDKGEPKEIEVPDIDSEAVTAQTETVLTDWEN
                     SGPVGQAAADAVQDTALAAPAIDQQARDFVAAQPGGEQIIEQVDGALNSFFTDATPGL
                     AGNLLSGAIGGGIPAAN"
     CDS             complement(30589..31968)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00270"
                     /product="hypothetical protein"
                     /protein_id="BAH47040.1"
                     /transl_table=11
                     /translation="MTPPTVDVEITSATTARATLADADVPPMNLESNESKTLSTVVHE
                     FLHKMAQTQGADVEVVYRTGKDTRFLTVGPDGKTEERAPSMPLPTVTQTAPEPVAAEP
                     VSTPPGGPVVVAAEQIAYEAAPPPFGVSTPSLVGQRPAEPITGPITGPLDVLPQLSAP
                     RANPAVSDPARLGVRGRLNAMLGLKLAPKKDSLEMRLRDSQTTIARPLPEDAVITFAN
                     LKGGVGKTPMSISLAETLAEHRGPATVTCMDLGEVGGSFADRVAVPPATGKDVVGLLA
                     AVDPAATDVRPSTLARYLTRQPSGSDIIAGRDGADSPLSYDDAAALGAILGRHRDVLV
                     ADTGNSSHDGSWRWAITAAHAVILPVPLRRDAAAAAQRTLATIAAVRPDVLARTVVVI
                     TAGPGDVPMVETEVVNALPALRVCRMPFEPLFASGERIALSQLRRETQDALTVLAATV
                     VDLMAGAVG"
     CDS             complement(31971..32318)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00280"
                     /product="hypothetical protein"
                     /protein_id="BAH47041.1"
                     /transl_table=11
                     /translation="MSRRISQSITPTTEDVAALRGPFVAKGANDPVIKSLREYFKSSV
                     PAWLAKLSEEQELTRERLAEIRDASSKRRVVIEALPEGSARDKALAELETAEAVVDDM
                     DKALSGASTFGVS"
     CDS             complement(32358..33209)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00290"
                     /product="putative FtsK/SpoIIIE family protein"
                     /protein_id="BAH47042.1"
                     /transl_table=11
                     /translation="MTAANPPEGTDMHLPYATAANGETVSWNISSHAAGPHCLIVGPT
                     GGGKTSVIRTLLTEAARRGIPFVGVDPKTIELDGLETEPNCVTIIGDALRAAGFIRAL
                     HREMHARVGWVQENRAQPTDLQPLIVAVDECFILSGKWQRLAKTGDDETREQLKELDP
                     LGAWADLAVLARSAGIRLLLGVQRPDASLFGGASGNARDNFGTRISLGNLSQDGALMM
                     WGDSTVGREVDTSVKGRGIALGDDGRPTAVQMRAPEQTTAEPTFTPMTWYSRELPNFL
                     DNASRGD"
     CDS             complement(33206..35353)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00300"
                     /product="putative FtsK/SpoIIIE family protein"
                     /protein_id="BAH47043.1"
                     /transl_table=11
                     /translation="MSGNHDPLKDWLVATWRDIFGDSGDGRGNQVREDGQPTRIRRFT
                     PLSPITIVAAGLAVYSPRLMSAATDNETVVGVLTKLHDYRVLLVAAAALLVIVDVLRH
                     RMHRWSQMFESVVRQGTGHLPKKIVVSFPPGWRVIRRATITLHRGTVIRPKQFEEVSR
                     AIAAAFPGSDKWEVKVRHKTHHDRIIIARKTITPDTRSDRQKALQGALDDASIFKDPK
                     VTVETVDEAGVETGYRIAFEKSMNAGAKGFQLKVEEALASLAGQHESGRNWTTDWYPD
                     KGYLVMRLVTAMPSRVDHPLELVDENLRHLPYATGAADRIMYWDVSTSSNKPHCLIVG
                     PTGGGKTSVIRTLLTEAARRGVPFVGVDPKMIELDGLEGYPGCGAIIYDALRAAMFVR
                     ALHTEMMARNAYIHQMKIEGSQLPLMIAVLDEFFILSGKWQRLAKTGDDETREQLKEL
                     DPLGAWADLAVLARSAGIRLLLGVQRPDASLFGGASGNARDNFGTRISLGNLSQDGAL
                     MMWGDSTVGREVDTSVKGRGIALGDDGNPVDAQMWWTPNVDRHPNKWNQLAESEKAII
                     DGLKPTEAPQFTCYSQELASFIESERALAKRARKHGSAPEPIVIGATATTDDGPSATS
                     PTADAAPTGDDDFSDVIPASAVVAGQTVLVDDDNGELVPVTVDSVDVRRGAKGEVAET
                     VLTVGTGRVKTRITFDVTGVVVLPEPDLVGAPA"
     CDS             36385..36807
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00310"
                     /product="hypothetical protein"
                     /protein_id="BAH47044.1"
                     /transl_table=11
                     /translation="MTRSRRGHPVEMKSEFDLRSCASTFRCTYRTQRWSVLMSLTSAV
                     VDLATTPPGSVDVLAQNTEVTTGGLRAWIGDNIIFTILALIACVVLLGGLRGNLSKVF
                     TVGGLSLVGIAFFSLASSESAATGIGNWILGLFGIRVV"
     CDS             36852..37250
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00320"
                     /product="hypothetical protein"
                     /protein_id="BAH47045.1"
                     /transl_table=11
                     /translation="MIDNDDLLHRVDQHYLGPTGFTLPVRIRYAALGLGAAFMVTVFV
                     IARGIVHVPLGFKSLVVMVVITVVLTARVTKFVNADRPVRAVIRAAWNDLNAPRPPKP
                     GQTVVLRIPAISRAAGSAHAVTPIEGESSR"
     CDS             37247..40303
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00330"
                     /product="hypothetical protein"
                     /protein_id="BAH47046.1"
                     /transl_table=11
                     /translation="MTLQPDNEIAALFDPNFDEPEPVIVPPGALPPSWAAAMAANRSA
                     ATPAPAQELAWSQAPDSNIAAPTPDVVPSPAPDAEPEPTAKGKRRGKKRGRRSDPEAE
                     FTRQAAAAKKRADRERKAVRLALVGVEGNVTRTRRQSTAWFVQPPGPWNMRPVGKQRR
                     YIQNEGLVVANLAEAGVTGLHRRLVRTPWPVRQWAQAHDGWADPIPDVPGALSWADYL
                     RGQQHAMLWGNPTQKGRYWGVELPPRSVLAQGLDTVGQWLVPVVDWPLLGTFAQLWRK
                     WARDAFLGEQKAIADHLATIERHLSGQGVNAKPATAAQMDYLLLRSATLGLPLDADGV
                     ISGGGDWEESDVAALEDLTTLELTPGDGYTTVRGLVGGRDYTGYAIVLTVGRMAPLPI
                     PEKMLPWQVIGDPSGEPLEWSERISLKTKGQTLRSLRRLTSKIEAQFDHYTVEHDQVP
                     PQELAEQHALAQRVISDIEEDHSGLSVRTQGWYRVLVVGSSPEEAKEKVALLQEMYAP
                     RIRLEQEHGQYQLLREFIPGEPLANIAHCRRMNVEALSAGMAAVGDRIGDRTGVVVGQ
                     TASIAPRPAVWDLFAAHEKKHKSGLTPIVAVPGSGKTFLAGMLVYQAVRAGAYGVVLD
                     PSGPLKKLAQLPEFRGIAEVQALTGRTSRPGSLNPYRVIVDPRREDPEYDPTSPDYTD
                     DADPVAAAQSQYEADLRAAEAERISVAVSVLKMMLTPSRLEHQWTETVLQTAANMVGG
                     DRRHNLSEVLAAIATIGEGKDETNADLISCARSIHQDLAMMSQLSEARVLFPEEGTIG
                     DGEDVDRNVRLTVLTMPGLQLPPEGTDPAQWTPQQRMAGPLMHMAAWMANRLVYELPR
                     YERKVLFLDENKYLEQTGAGRTLNLRIARDSRKYKVRALVCSQLPDDYLGVDGTDDKS
                     ALTYEVIIGDLGGNAHAIEGALKLLNLPLGEGYESLLAGLGGGGEDTLDEDTDTEHLD
                     QARRFIVKMADDIELIRSDWTHYVHLAHVFDALDSRATRAAIGGAP"
     CDS             40300..42441
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00340"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH47047.1"
                     /transl_table=11
                     /translation="MSRLRPKAARIGHSPSPRRFGWRTGLVGRVLVVLMLAAVSLIGL
                     GGAVAAAGGFDCQDVPPPEFPNEVIETTFDSTSADRPTTGGTGYQTYGWAGLKWHTYD
                     LGCGADLVKAPGAVGDTTLGNTFLTIGKSMAAAAFWLDDQTKIGQDATEAGVTPALER
                     FDQIVFSITEGMRGLYGQWVGIGLVVVASMILWKALKADTAGVTKTSAIAAAGLALGA
                     LMVGAPQKALQVADETFGALITETQDQIFAVQFGDDGGTLAGGSTDPRNVLIDKVFLD
                     DWRKGWFGQNYDPEDKDQLGPKLRDALAFSYDQQNTVKDDPKAQAQLAEEKADQFRDI
                     VSKLETDYQLSYYQFQGKDSGRTSTGFMGMTKLAMPSLLWIGASLLKLTALLAIRFAI
                     LFAPIWIPVAIAYGGWLARVMRMLASAYMWGVAGSVIVALYLMALVQLYVNSNGAVDG
                     SWRLWFMVLLTVVCWAIMRPFKRMSQTFTQNSASMVNRKARSAKKSIKRKAFDAASFA
                     VGGPAQAITEKAAERFARRGRDGQEDDGATTVTRPEGRALGNRRQQALTQSRADARKA
                     QGLGRSARLGQASDAAIERDARIAGIAAVASRDIGRGKGGVDGKDANRAVRSGAAAWK
                     RFDQDEADNLVQERRARKELLTASVGQRWDGGDRSAIAPMKVYTPTSGQRAAHHATAS
                     TPHRSPAKAPPNAKVWNAAAPARTTPEDRYI"
     CDS             42441..43274
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00350"
                     /product="hypothetical protein"
                     /protein_id="BAH47048.1"
                     /transl_table=11
                     /translation="MSSSGPHPVLAPIRRWVLYSRTHLAITAAGTVALLFAAGAAFGE
                     NPPPRAVTHQAETTIESVTPAETISYDLDEVSESLVAAKTATWAASSAPATAMAYAHA
                     FVDTTPSDAMWASTIGRHTADKPGEHVVAARPRTPVVITGPTVSTLTDGPDGERTARV
                     TVPTQAGDLRITLTVNEVNGGKRWVVGTPLPTLDLSEVETMARATTTATPLTSTTPTT
                     TAAETTPPQPTSTSSLSTTPQPMFDLDEPATAPSQGNDPTPIPGPIPIPELDTPIPGG
                     R"
     CDS             43271..44872
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00360"
                     /product="peptidase M23 family protein"
                     /protein_id="BAH47049.1"
                     /transl_table=11
                     /translation="MNIGGAQRALLLTGAIGIIIGTSACSLGAPVIPRDPCRTVTSDS
                     ANSAGSIAENLTLTVSGPIRLPVEPGTTTFTSGFGERWGAQHQGVDLAGPVGTKILAA
                     LDGNVVKAGDSGEGPGVGFENWVVIDSNVDGKPVSTVYGHMFADGIHIKPGQQVKAGD
                     HIADIGNAGGSTGPHLHFEYWQGGRLQGGTALDPLTVLPDIAEQNGTSGGDPDTASNS
                     PIQLVAASQSTTDCSGFGMAGGGELAFGIVPAEFEPWLRRAGSVCPEIAPPLLAAQLQ
                     QENGFRHGPHAPVSDTGALGPAQFMPGTWATWGKDYDGDGKADPNSIGDAVMSQAHFM
                     CALYQDVSGYITSGQAKGDPIELTLAAYNAGAGAVQKFGGIPPFAQTENYVPKILQAR
                     AGFTNPNARGRFIPNASGDSSQVVTAAREYLGTPYVWGGGGTGGPSGGGFDCSGLTSY
                     AVHAASAGKVSLPRTSEQQWGVGIEIPIDQASPGDLVFGSWGPNGPGHVGVYSGNGQM
                     VHAPTQGDVVKEAPLQPGLKARRVM"
     CDS             45163..45855
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00370"
                     /product="hypothetical protein"
                     /protein_id="BAH47050.1"
                     /transl_table=11
                     /translation="MSYHRSAPDHPFGARGTCHLSWVMAKFCHGEEGDVRPRKLVIAV
                     LVVAVVGFLAYSYLSRTNDGEDSASVAASMTTSAPTATAAAASPVDVETAELPTSSRD
                     AEEAARQGLTVAFTWYPATDTNQNDAYGRARNWLTGKLADRMLVDARTERGPGVQWDE
                     WAQEQAKVIADVSVECSGCPEDTDTVVSRVATIKQTTIAGSSTDTVEPDTTVWVSVVR
                     EGDRWLIDDIRY"
     CDS             45868..46443
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00380"
                     /product="hypothetical protein"
                     /protein_id="BAH47051.1"
                     /transl_table=11
                     /translation="MNRKNVAAVLIPTVLAVGLTACSSDESTTPTSAPIATTTMSAFG
                     TDEFIANRLRSSSTTIVETVEERGGTPEQAIAALVSSEAETGWQSGLRMAPPATDIRD
                     IFGWRLAYNLPADSAEVVVAATNTFMDNASTVTVSADDPAAYALAAQYADPRGYNEKE
                     HFYRKGETAATEYAVALPKAQAAYAELRGSQ"
     CDS             46866..47291
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00390"
                     /product="hypothetical protein"
                     /protein_id="BAH47052.1"
                     /transl_table=11
                     /translation="MNANSLKHSYRRLSPRYDVRTVEANVLDPVPSNLGPFDSVGVNH
                     VVHCLPGGWREKGAVFQNLAGVLAADGVLFGSTVLGPGVKRNIFGLALSEAYNRLGAF
                     HNRGDVTTVSSKPCGSRSVASRSLRSAMWALFVPSKPKR"
     CDS             complement(47288..47551)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00400"
                     /note="fragment"
                     /product="putative cytochrome P450"
                     /protein_id="BAH47053.1"
                     /transl_table=11
                     /translation="MNARFTTLPAITQTLATQSDIQPRRESAGGPNDRVCAERLTDHE
                     TILALAFLLHRFDFEADPAYQLQVQELITLKPEGLRLRTRRRN"
     CDS             47520..48662
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00410"
                     /product="putative transposase for insertion sequence
                     element"
                     /protein_id="BAH47054.1"
                     /transl_table=11
                     /translation="MAGRVVKRAFKYRFYPTAVQAEQLARTFGCTRYVYNRALAERSR
                     AWSQERRRVTYSDTSKMLTGWKRDTETEWLSEPSKGPLQESLRQLQGAFDKFWRKQSR
                     YPQFKKKAQSKDSATYYSNCFTYRGGQIRLAKQSEPLDIRWSRPLPEGAVPSQVTVSR
                     NARGQYHISILVEDTITEPPSTDRVVGLDAGITSLYTLSTGKKITNPRHERTDRERLA
                     KAQRVLAKKQKGSRNRAKARLKVAKIYGRIADRRRDYLHKLSTRLVRENQVIAIEDLS
                     VRNMVRNRSLSRAISDASWSEFRSMLEYKADWYGRRVVAIDRFYPSSKTCSVCGAIAS
                     TMPLSVREWACRCGVVHDRDVNAARNILAVGLTAAACGDDVRPPRT"
     CDS             48917..49231
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00420"
                     /note="fragment"
                     /product="putative cytochrome P450"
                     /protein_id="BAH47055.1"
                     /transl_table=11
                     /translation="MHYLATNPEIAAKARPELDERWPTGDVTAIRYEDVARLRYLRRV
                     VDETLCLWPIAPGYFRETKEETVIGGKYRFAPGDWVFVLTLQAHRDPVWGPDAEKFDC
                     VR"
     CDS             complement(49164..49457)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00430"
                     /note="fragment"
                     /product="putative cytochrome P450"
                     /protein_id="BAH47056.1"
                     /transl_table=11
                     /translation="MMRGLTYSNSNLPPILQKTIGRRQAAQHQRDIHFVMQVVDDVIK
                     RRKTEDSGTHNDLLARMLTEPGPETGEPLDEVNVRNQTSPHRVPTPGHGEPAT"
     CDS             complement(49650..50723)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00440"
                     /product="hypothetical protein"
                     /protein_id="BAH47057.1"
                     /transl_table=11
                     /translation="MHKADAADRRGWRRSAAVCTLLALGSCLLAVAVLVPTYGAARLK
                     VIPLDVQSATVSVAEDAAVLKATSVAMKGPLKTDRGVPLRIQVYVTTEDPVSAASTTL
                     QAAQKTVRTDWGEGLGLVSAMVDRVTIDRRSGMPLAEPVPTTQAEQGKPPTETPRAGI
                     QYKFPFDVEKVSYPYYDGTARETHPIEYVDDDRVVDGMRLYHFQQTIGPVNLGKSIGS
                     VATTTLPAEKWGLPGTEPTTMDLHYSTTRDVWVEPASGAIVAVEEQPRRWLARSVDDP
                     NAVTTLEAHTHFDNETINGLAQQAKDARTAILWGTRYGPALGAVVGIVLVGTAIILAR
                     RWSRMNPKSLLDGQGLRDTRSIS"
     CDS             50875..52017
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00450"
                     /product="cytochrome P450"
                     /protein_id="BAH47058.1"
                     /transl_table=11
                     /translation="MSVAEADRLHAHLRAAGPVVEATDADGLRVWIITRYDDVSRLLA
                     DPGIVNVRPGGPSGSPGLPLPPALARNLLNMVPDDHRRVRALAAPAFSRRRIGAVRQM
                     VTARADGLLNELDPNETGVVDLFPAYASPLPADIIAEILGVTDTDADEFRTAAATVMA
                     MNPGEPTADDPRIPAMTTIVLVLMRVIAAKRKSPGDDVITDWITARDAEDRLTEEELI
                     SLAFLTFLAGFENSVYQIANAIGILAGLDRDQLLVEIADDQLWRARVTHLVLDAAPGS
                     YAIRRFPVENITVGGIRIPAGSPLYLSLRAATNDPARGERPDLAFGRGPHYCLGADLA
                     VMQLDIATRRLFQRHPGLSLVKPWETLDRRHTWRTHGPTEMPVNLI"
     CDS             52052..53137
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00460"
                     /product="hypothetical protein"
                     /protein_id="BAH47059.1"
                     /transl_table=11
                     /translation="MTADALELTHAEPTHPIREWTTVFVGTGDEHHVVAEGAKIREWR
                     NINNVVRGPARTAVLGLIRQCIADRDLRIEPFDGKVADALGPVGAAHPILTPDKSVVV
                     AVQVWTGDPKKNPPDRPNVGAWEWVLSSEDNPPPPQLQLDPGAIELIGMSARHQDRSV
                     FGPADLYTRSARLSDTLRHVRQIRDCQVKDRFDGTFTIRAETDVTRELRYAERCVEGP
                     AGRRVRGICWDAGTDEARVHEAMLDAWLSTMLASTSGMYIAVGDLSYQYPYWLKWVTE
                     HVPGLGHGVSTGQTFALHEEDWPKIIEWVQQVRKGPVSGTVRARRGGGGWLKAEFRGF
                     LLDPLVSDSIGVAVISPEIETIPDETS"
     CDS             53167..53730
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00470"
                     /product="putative intracellular septation protein"
                     /protein_id="BAH47060.1"
                     /transl_table=11
                     /translation="MWRVFYNAALVVAFMATYKTAGIFAATVVVMAGVVGEIIVTVAR
                     RQRVDKLQWIGLCLVLVLGGSTLLFHNETFIKWRPTGVYWLIAGAFLTSLVVAKRDPV
                     RLIIGRWVSAPDAVWRFLSWSWFMALVAVGAVNIVVAYTMSTDTWVNWRVFVAPGSLL
                     ALAVAQATWHRNYILTAWRDHQSEEAM"
     CDS             complement(54023..54508)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00480"
                     /product="putative Xre family DNA-binding protein"
                     /protein_id="BAH47061.1"
                     /transl_table=11
                     /translation="MSSDDDFSGKAQSVSRRVMRGFQPDQLEKARRSAGVSQRELARL
                     ARLNADTIRRWELGDSSPQVDLLARVTAAIGVSISDLVKVPEGDRYPGDWRILRGLTQ
                     PQLGAAAGVTTQIVGSVERGEISLSDNMARKLSAALQIPESELRASYERVRTRPAGTP
                     A"
     CDS             54822..55523
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00490"
                     /product="hypothetical protein"
                     /protein_id="BAH47062.1"
                     /transl_table=11
                     /translation="MTNGPLREILAKHRSNHDHTSCTACGFVYTPDLPLCPPVAGALR
                     ELSTGAVRPQDLSLGHYTTGRLRAMAREHTGEGRCRRCGFVYSGQVRLCPTSRRIAAE
                     LETRGKAPATQPRTGQGLCAGKGSGWTVTSTKAAAWKRAMAACSVCPLLAQCETQLED
                     RLATGVKVREQIIAGRLFTVTGREVEAAGVDAFAVARGRTKKKQQQKPRAPIPAPAAT
                     PAPARQLALFEDGVA"
     CDS             55520..55858
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00500"
                     /product="hypothetical protein"
                     /protein_id="BAH47063.1"
                     /transl_table=11
                     /translation="MTVRSGFGLSRSVTTVSAVDFHGRQWDLVPIQDVICAMIVADSV
                     AIPTVLSEQLLAECPLVISAEAPTLSVGAREKLTDVIDLVVTNPETASVEQIREVASL
                     ARLLLRRHPA"
     CDS             56007..56723
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00510"
                     /product="hypothetical protein"
                     /protein_id="BAH47064.1"
                     /transl_table=11
                     /translation="MTTSVTCDTPKSAGYPYRLQVRSRVSSWHSTTRGPAVRSLLAHP
                     SDTTRFTRVGQPNSASLLATTPCLSSPSRTDWTSRITSARNFDRNSSGYSKSRLQGRC
                     TRSSSWRWAHERHLNTKQPPGLGGIGGCPFMKFRDLASSLTTTTSKGRGGAFSMITHV
                     RKSALSANFYSVTCLSQQDHTLTAALPHNRDPFDGATSVLAYQGAHYATESADSDLRL
                     PVLLGSAPALPTEEGGGPGE"
     CDS             56939..58291
                     /codon_start=1
                     /gene="rep"
                     /locus_tag="ROP_pROB02-00520"
                     /product="putative replication protein"
                     /protein_id="BAH47065.1"
                     /transl_table=11
                     /translation="MLGTSEDKPCLDAFSTVQHSDLGVSWDKSHNSPISQTTQPDTHP
                     LQTPWIDELRRLNTDTDQRGKSWTLPVKPGQEASIPIWTSRDGWMRQVRYAITKTADG
                     RAAAARHRIGVESMVAVAGAHASSADSKTGRRVTATVQNLAARAGVSEAVVKRGRRVL
                     KALHLGFELVRGRTLTTREFQAAEVHHGGRQHRAASVWALSSPPDLVAATPAPPQPKK
                     RGRSHGRTYRPVEHARHTATRGSNPNPQARDRDPLSLSGLSPKGISCREVITKRACAR
                     ENQTSSSNQTDPRPMNLQRAASALVAAAPAIAPSGHIGAVCDVIERSGIDTTRWTGRD
                     IAQALTADTVSRGELWPNAVRSPIGYLTWRLSRIDWSGPSPSEQRATEAARSAQLRAA
                     RDAERERARRATASPERQKAFMEQIRATLAPKSGQPNDAHPTSAHHPHGNAGRTDRGQ
                     "
     CDS             58327..58965
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00530"
                     /product="hypothetical protein"
                     /protein_id="BAH47066.1"
                     /transl_table=11
                     /translation="MGHILRESPWPTCTERSALVGKNTVSRSTRRHPRVDVSRVQAHP
                     RISRNADSIRERLRNGARTVVVDTAGQLIELDNHTFATAGDEWTLRFTAGSQARIHLD
                     SPLPATAHIVATDAATVEVTGHVHLWAYTHATVTAFDQCRVVAHNHAFIRACDRSSVW
                     ADDNVVVHAYDEATVQAKDHAILALSDEAHAVVETAVVVRGPARKNVTMRDT"
     CDS             58975..59184
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00540"
                     /product="hypothetical protein"
                     /protein_id="BAH47067.1"
                     /transl_table=11
                     /translation="MGRRSSHTAPPAHQQFRDGLVCLTIEVDPLAQPSVHPVFLGEDF
                     STAHNPSGRPHRAQRPSKLFGSQPT"
     CDS             complement(59269..60480)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00550"
                     /product="putative transposase"
                     /protein_id="BAH47068.1"
                     /transl_table=11
                     /translation="MIFVGDDWAEQHHDVHLMDDTGRRLSSRRLPEGLAGICTLHELI
                     AGHADEPGQVVIGIETDRGLWVQALTAAGYQVYPINPLAVARYRDRHHVSGAKSDAGD
                     AKLLADLVRTDRHNHRPIAGDSPDVEAIKVLARGHQNLIWARTRQTNALRSALREYYP
                     AALEVFDDLHDRDTLAVLGRAPTPAEAAHLTLPAIRSALKRAGRQRNLDTRAREIRAG
                     LRVEQLAAPAPVVAAFAATTRAAVGLIVELNRQIIELESTLADHFESHPDADIYRSLP
                     GLGVVLGARVLGEFGDDPDRYTTAKSRRNYAGTSPLTVASGKKRAVLARHVRNRRLYD
                     AIDQWAFCALSSSPGAREFYDQRRDAGDLHHQALRALGNRLVGLLHGCLRHHTHYDEH
                     IAWDHRTIRAA"
     CDS             60871..62106
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00560"
                     /product="hypothetical protein"
                     /protein_id="BAH47069.1"
                     /transl_table=11
                     /translation="MPKSRGRRKGGKSRPVRRPPRQLHPADLLLRDARQLLEIDDALT
                     AETWASGWLGEAWSTAAVTEHEPEHQLCMQVTGRACTTPSPHSLAAIDALARVAPASD
                     TAMLTDTLHILTETQPLPTWHTVEAWTPTAAWRAVDVYDSERVLFIDYDGPHPHTLMA
                     NIYQVGGLMIDKLALLNPGAATTWDQLREPDEAPMPLQPVPVAEVLADLAHALRITDM
                     TWPRTTDEDFRDHQALAWSRCRDYLPEWPEHVGLPEQRRRQLVEDFLTDIGSDDEVSR
                     SLAELFLDYGDGYIGAGALCWSPGEVMLLLTDWLPRKAVLDADQRNALPFVLRRWLTF
                     VLTQQGIDRQWISLVVDAVDTFLPEFHDAFDDETAWGPAKQVAAALAERGVDLTDRCA
                     VDDAIRQLNAEQLAHRLLP"
     CDS             63364..64146
                     /codon_start=1
                     /gene="parA"
                     /locus_tag="ROP_pROB02-00570"
                     /product="putative plasmid partitioning protein ParA"
                     /protein_id="BAH47070.1"
                     /transl_table=11
                     /translation="MTRKCAICNQKGGVGKTATTLGLASAISNAGGHVLIVDVDPQGN
                     ATNGVGVTITDEMLTTYDLMSRTASGTAIDAVIATPWDGVDLIPADQTLANIESDGAN
                     DLIFRLDIAFEGLDLSAYDAVLFDCPPSLGKLLFAVFCAVDGVIAVTEPTIDSVQGVT
                     KLFETVENVQRRPNPNLAIDKIVLSRQRGTGEHRFRESELREVYGDLVARTTIPEYAT
                     RQDAHSARTPIHKFTGGKSLSLQLAYTDLLNELPIKTAGATV"
     CDS             64143..64514
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00580"
                     /product="hypothetical protein"
                     /protein_id="BAH47071.1"
                     /transl_table=11
                     /translation="MSVQREPAIRRPAHPAADLPERPRVVKDPTPAAVDEQPTQLPTE
                     STIRRVADVPVTPVLSPAPEAASPVEKLSEQHNVRLRPSTKARLTRGVDKLRYETGDR
                     SITISSVTDAALIEYLAKNGC"
     CDS             64671..65945
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00590"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH47072.1"
                     /transl_table=11
                     /translation="MNDLSIRAARIQLRALIAALIVAIAIAVGITTGAFVLSFAVQRD
                     LALQAGIPHYLTWIFPAIVDGAILGATIAIVALSKINGSATGKHFFLWLAVVVVFISV
                     FGNAYHAYRAGEAAARSAAAGIDLGYTPLTPTGASLIAVIPPLLVLAFTHGVGILIKA
                     IGTAHTEYTAVVRDTRDREQQDGEDIADHYPTVAAESMPASERNVGHVADIVAPHIAQ
                     DPDVAPRIAQDPDVAPRIAQTVAQFADVATADDSSALDDSRAAAVTGPESSTGVADAA
                     QPTETNPDDRTDVATLTEEHVARNALDGSNAAALKVSNALEDSQEPFVLPDEAQTIEN
                     LLDFIETCADFEPVVKETARLRIIEQHSYAEIATLTRAKAASTAMRRFDKVAQRAVDA
                     GFRTPPLPELEEIADGRNAATLDPQYTLVGTP"
     CDS             66113..66616
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00600"
                     /product="hypothetical protein"
                     /protein_id="BAH47073.1"
                     /transl_table=11
                     /translation="MELQRNADSARLATQRQIRMQRTTGRGPLCRRNNVGALQVGGRR
                     IAGWMLVIYAVHLRRVDEGPVVEWFVSFWDLETQRTSVRAGEASNRVDAMAQVIAAGR
                     ELARRDDGSVVNKTAHVRIGTELAVVAGFDDPHLGDENLSCRIEAAITAKQQHARRMQ
                     QRIPVEF"
     CDS             66759..67442
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00610"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH47074.1"
                     /transl_table=11
                     /translation="MTAVVVHHSPMVERGDPCDDRMWGARDRGRRGRNLTTPLGVPWA
                     ATVGVAVILVLLCGAGGRGRARTSFHHCDVSARAWAVVCFLCRRPDGCRGSGIVMNRA
                     PKRLRDRDRDLEARIANSATLASISICGLRIVQRKVPVVVPRPYRPPRESFSRRVGLW
                     RNWSMTSTQTCPAMRARHQLLVVSAEYEIDLKDENASAFHAALDYCITHSRWPGGGER
                     RSFRGSIRA"
     CDS             complement(67752..68168)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00620"
                     /note="fragment"
                     /product="putative transposase"
                     /protein_id="BAH47075.1"
                     /transl_table=11
                     /translation="MDPPHICSRRVVGWSIADHMRTDLVTDAIEMAVRTRGGDVRGVI
                     FHSDRGSQYTAAAFVDVCRRHGIRPSRGRVGSSYDNALAESFFQGLKREWLHGRSRTS
                     KSQARLELFEWLSYFNRRRRHSALGDTSPRWSSNNG"
     CDS             complement(68508..69452)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00630"
                     /product="hypothetical protein"
                     /protein_id="BAH47076.1"
                     /transl_table=11
                     /translation="MGTTFHGPSPWPHITRAIRTRGARYAAIGYLGQDAPALLPLRAG
                     DVLVVNASKAAVRAHATSPAALAYYVNKGVRVLSSPTLHAKVIVTNTRAVIGSANASE
                     NSTLADDAVVITDDPEIVASVRKFIDGLDEITEVDQVFLDDAILEWEIGRAVPLPGVT
                     GRVRTETDFLPTPVTRMFVKHAVDYEPTRTEQQVLDEQRGRHHSRGGPAAKYQLESLR
                     LDRPSGVRRGDVIVFVSADDEWIYAPAVVVSDPMKIPRSGGAVLYFLRLRTGLSPLPL
                     PGAEKALTNLGHPGSRLRTDHYVRSPGLRSALLGLWDL"
     CDS             69718..69948
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00640"
                     /product="hypothetical protein"
                     /protein_id="BAH47077.1"
                     /transl_table=11
                     /translation="MMSYEAIYDGVRYPLADAAAAHGLEDAIRGIFADNGNGGFVGFV
                     SQNSTVRLLITPATPIAIRGSDEPNPTVVHRW"
     CDS             70076..70246
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00650"
                     /product="hypothetical protein"
                     /protein_id="BAH47078.1"
                     /transl_table=11
                     /translation="MGGVTYGISQTRFEATRELLARFAEGHTLGVAMSLTHDGARHHL
                     FITPGVPITLVD"
     CDS             70436..70828
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00660"
                     /product="hypothetical protein"
                     /protein_id="BAH47079.1"
                     /transl_table=11
                     /translation="MSAHVHGRHTEHEWVGMAKVGNSEGGARRRPTGAGRAAVKAAKR
                     ASGAGDVGGPGTPSPELTAKLEPRKGPAKVPLNTRVLASTEARLNWLVNDRQSTVTNV
                     VDVALQEFFDRYHVPPADHDGRITEQES"
     CDS             complement(70795..71016)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00670"
                     /product="hypothetical protein"
                     /protein_id="BAH47080.1"
                     /transl_table=11
                     /translation="MCGSGRLRIRMIGFDEDISIDRDNVLIGEEKVIVGENIIGGGGR
                     CRQGCLGQCEQGDLFPRTAHDSCSVIRPS"
     CDS             71242..72846
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00680"
                     /product="hypothetical protein"
                     /protein_id="BAH47081.1"
                     /transl_table=11
                     /translation="MGEDADGHALIVTAAGTFTPSGRELTGPVDSVEKLDKLIRWASL
                     TPLGAPAQIWVVGQGACELLGWIIDPGSEDDVDDMEALRNRAAQELTAVLHATLTPML
                     NAGWELRGDPGHVVHLSRSIGNFTSMVDVVIEPYVWTYWNKDFGWRNRVGDMGILGSP
                     TAGTYLPDDDLPAARELGRRLAWCAAHLGVLPGPTPARTGAALVDKIKRERTRSGKGI
                     VVTTPGSVPPLDGAPRGDLEPAVGWTRVPDAQDLEDTTRLVSIDQRAAYLASAGMLEF
                     GYGQPTHLTGDTAAAAAVGEKGAPFGLWRITLPPGQTLSLPGKIPLPHPHMHADQPVQ
                     TWVSTVSLDGLCSPVADGGIGADLDDLDIAEAWVYPQQGRALDKWAKILREARKVAVD
                     TDDDATKRFLGTCYKGYIGRMVNPDMWTAKQMQHHHQPLWRASIIAHCRWRGRRVAMR
                     IAREHNRWPVRTVTDSWVYLLSGGEDIADPSDALGKMSVEKDVVLTDTLLSAFTSAED
                     VHEVNLAIKAAFADNEDTDDEGEGVL"
     CDS             72846..73643
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00690"
                     /product="hypothetical protein"
                     /protein_id="BAH47082.1"
                     /transl_table=11
                     /translation="MALHLPKPRTKKPAQEAVGLDGLKVSVANAATSGVEKSKQVKSG
                     GLAGLTSKVSVKQLRKELGNEGLRQAAIDAGRTPPSARTLRRWAQQGRIPHADVVERA
                     QRRAAIERLGGVDAVAAKIGRSRSAVSRYRSGETNELRADASKKLRNVKAEDIMKRAG
                     VLRPDGTPKKAVIRVKGGVMVRNGADEGYDYRVRTLDFANSDTPFTSEESRELAAALA
                     NDDHARVVALLERHATLDYPENKGFDKYSDQFGFHFDHIDSVHIDWI"
     CDS             73853..75853
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00700"
                     /product="hypothetical protein"
                     /protein_id="BAH47083.1"
                     /transl_table=11
                     /translation="MPARRSRTRRTVALIATATVVVGVALTAPAIANAAPVGCVSTFN
                     LLIPGTWETNEHADPNQPVGMLAPVAEAIRAQNGARAQIYTLPYMASAFDNGHTYADS
                     KLDAVSKATAVLKSYADKCRGAKITITGYSQGADAAGDLASAIGNDQGPVDADQVLGV
                     ALIADPGAGTKGAAPVGPTTSGEGIAGPRSQGMGTLSGRVASICDPKDLYCSIRKGAN
                     PFLGSLGSILSKTPGNTSTGAGADGGTAAVAHALTSDFTDADLPGLGSNVDALGQQLS
                     GNGTGGSIDVNQIADSATSLSKTLSPLVDLLQSGAANTAATSKLAAAPVGTPENAAAQ
                     VLTTASHADLGGALDSVATIANTAAKLANNGATTLPATAPEISQLAGTAASLGSQIAP
                     VAATPADALSSASSVLSVLKPKVVVDQALNVVTGVTALDIPKILNNLIVLPQRIAAGD
                     VRAARDTARELNVQFEPIVKMAAGVDLKWVSQILAIIPDPSGYTQIAALVTSILGNVD
                     VIKLATIAGQAQEIAWAAADKLFPPPGVLPDPVGAAAQTTALIPLGLDLASVAANMLT
                     GKASKTDPALLGKQTNPVGNAITTQAQTLDLAGLAGSVSTMTQSQGAEDLAAVVGEGL
                     NAASFFASGAHQSYQNLVVDNAGRNAIQWVSDWLNLQITRAA"
     CDS             76081..76374
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00710"
                     /product="hypothetical protein"
                     /protein_id="BAH47084.1"
                     /transl_table=11
                     /translation="MARRTHRPTSCWVSCPHCGGKRTYFTRRTARAARTHHEKRHGLA
                     IYPCPHRHQDGDAGMFHVGHRPEGLGRGHIDRDTLADNQRAALQGRAAGGGAR"
     CDS             76371..76715
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00720"
                     /product="hypothetical protein"
                     /protein_id="BAH47085.1"
                     /transl_table=11
                     /translation="MTLMNATGSPTPPISLDVGGRIRFGLEPRRPYTVRALSEHFVVC
                     TRPRDFATTGEFVYTVIDWRNGIRGPVNGQSADVSTDERCRDLLDDLEAGRWEISHRN
                     RVQLDIIESDQS"
     CDS             78349..79653
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00730"
                     /product="putative MFS transporter"
                     /protein_id="BAH47086.1"
                     /transl_table=11
                     /translation="MVSESTLTTRAGSTVTRSARRAIVAASFGTYVEYYDFVVYGYVA
                     VYIAHAYFPSDNPLVGLLLTFGAFAASYVARPLGAVIFSPLGDKYGRKTVLAVVILMM
                     TLATAAIGLLPTYAQIGLFAPILLTVLRVLQGISAGGEYGGATSLIAEFSPPDKRGFY
                     VGFIALTTGLALLTGSIVALSLTRMLPEESMLSWGWRIPLLLSLPLGLVGLYIRFKLE
                     ETPHFAALSSQEKAVNKPLATTVKRDYKTVILTIGLAATNASLLAVYFIYMPSALKQF
                     GNFEAADAQLITFSGLAAYCLAIVPFAKLTDKVGRRPQLIASTIALVLVIYPSFLLVS
                     HGSIALAVLGMVIVTPLMAANVTAVLPLLTELFTTANRYTGLSLGWQIATTLFSGPTP
                     VVLAALAGAAGATMPAFYAMAIVALSACAAFAVRETFDTPLQ"
     CDS             complement(79907..80173)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00740"
                     /note="fragment"
                     /product="putative transposase orfB for insertion
                     sequence element"
                     /protein_id="BAH47087.1"
                     /transl_table=11
                     /translation="MPGEAASALFQVVAQRYLKTSIIVNTNRSVGEWGEVLGDTTVAA
                     AMLDRLLHRSVVLNLDGDSYRLRDHHARAENLRKATTATRQPLQ"
     CDS             80391..81590
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00750"
                     /product="putative integrase/recombinase"
                     /protein_id="BAH47088.1"
                     /transl_table=11
                     /translation="MSGTRRRTGPLSPFVENYRDLLRGLGYRSETIRGMVKVLGQLDR
                     WMISNEMSVSNLDATQMDCFLAYRRADDYRQSPHRRGLRLLLDMLIEMHVVAPLPDDP
                     LTSTEVLLDDYRRWLIEDRGLAEATVQRYERSARKFLLTGSDAGSVDPTALTGSDVSG
                     YLLAEAGRCSVGAVKGRVAEMRALLRYLFVHGMTPTLLSGAIPPVAGWRETSIPRYFA
                     RDDVDALLDTCDRSTALGARNFAMLMLLSMLGLRCIEIARLELDDIDWRSGHLRVRGK
                     ARRLDTLPLPHEVGDAVAGYLRDGRPHTTDRHLFQTYRAPIRGIPPDLLSDVVRRACK
                     RAGLPPAGAHRLRHSVATTLLSEGVALADISQVLRHHDLATTAIYAKVDLASLRTVAQ
                     PWPGALS"
     CDS             81587..82534
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00760"
                     /product="putative integrase/recombinase"
                     /protein_id="BAH47089.1"
                     /transl_table=11
                     /translation="MTTTENPTSLRMHLTQYLLLRNRLGHELAYAARLLPRFVTYLED
                     LGHSTVTIADALAWCQQPPSPPGSSVWPRRMGAVRGFARYLSGIDPATEVPPIGLLPS
                     RRRWRPPFIYSSDDIAALLGAAAALPSPRRAATYSTLFGLLAATGMRVGEALTLDSSD
                     IDWDDGVVLVRESKFGKSRNVPLSDSTTEALARYASLREGFDRTPGNESYFVSLTGRR
                     VIYESVFEVFADLRRSSGIGRQSTVTPRIHDLRHTFAVTVLLQWYRDGGDVAARLPRL
                     STYLGHRDPRSTYWYLSAAPQLLALAAERLEPTLPQVNS"
     CDS             82531..83520
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00770"
                     /product="putative integrase/recombinase"
                     /protein_id="BAH47090.1"
                     /transl_table=11
                     /translation="MTAIAPTVQSFFLERLSTQRRASEHTIAAYRDAMRLLLAFMEQR
                     THRAPSRLDWTDLDADAICAFLDHLEKDRANSARTRNARLTAIRSLFSYAALRHPEHA
                     ALIAQVLAIPPKRFDKAIVCFLDEPEAAAMLAAADRSTWAGRRDHALMTLAMQTGLRV
                     SELLGLNCGDVVTGTSGHVRCVGKGRKERSVPMTESVRSVMNVWLIERAGQRDDAAFC
                     TRTGRRLSVDAVQRRVNIYAAQARQSCPSLVGKHLSPHVFRHTCAMTLLHAGVDTTVI
                     ALWLGHADVRSTTAYLHADLAIKERALAHLASSTSPPGRYRPPDQLLAFLEAL"
     CDS             complement(83490..84182)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00780"
                     /note="fragment"
                     /product="putative transposase orfB for insertion
                     sequence element"
                     /protein_id="BAH47091.1"
                     /transl_table=11
                     /translation="MNTTPAADTPPAPNTAAAASLYQRLRGHLAVLKLHDAAEALPAV
                     LDRAQKTNLSMTAALEELLAIEVDATEARRLAGRLRFACLPTPASLEDFDHDAAPSLD
                     RKLIAELGTCRYLETATNILLVGPPGVGKTHLSVGLARAAVHAGYRTYFTTAADLAAR
                     CHRAAIEGRWATTMRFFAGPTLLIIDLCRPRNYADAGRRSGWAALSCNDLQYFESECA
                     QHIHSASRNASS"
     CDS             complement(84179..85558)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00790"
                     /product="putative transposase orfA for insertion
                     sequence element"
                     /protein_id="BAH47092.1"
                     /transl_table=11
                     /translation="MLTWEDDVEVHALRKRGWSISAIARHTGRDRKTVRAYLNDERTP
                     GVRKRREPDPFEPFVDYVTCRLSEDPHLWARTLCDELEELGYRLSYPTLTRQIRDRGL
                     RPVCEACATATDRANAIIAHPAGEETQWDWVDLPNPPASWGWGGMAHLLVGSLAHSGR
                     WRGILAPAMTQPHLVDGLDRVSRRLGGVTKVWRFDRMATVCHPESGRVTASFAGAAKH
                     YGVAVAICPPKAGNRKGVVEKANHTAAQRWWRTLPDDVTVEQAQQRLDEFCRLRGDTR
                     MRATADGKASVATVAATEPLTALPATPYPAILTEPRTASRQALVSYRGNRYSVPPELA
                     SAQVTVTRVLGAEVIDIVTTAQITIARHRLAPDGAGVTVRDHGHVYALEQAAMAAAGS
                     AGRPHRRKERIPPGPAAIAAAEALRRGTSESNMTTSGAAETSQMPTPPTVIDLSTYER
                     AARGRNTLT"
     CDS             complement(85725..87308)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00800"
                     /product="putative transposase for insertion sequence
                     element"
                     /protein_id="BAH47093.1"
                     /transl_table=11
                     /translation="MRALLPHLVGVAVAGVRRVGSTIRIAAEPKGDGGRCPRCDGESA
                     RVHSRYRRQLADTAIGGHPVMIDLRVRRFFCDTIDCTAKTFAEQVPGLTTSRSRRTPV
                     LGAMVTAIGLAVAGRAGARLAARLGVAVGRDTLLRAVRALSDPKVGEVSVLGIDDFAI
                     RRGHVYGTLMLDMVTSKPIDLLADRTADTVADWLKKHPGTEVVCRDRAGAYAEGVRIG
                     APDAVQVADRWHLWHNLAEAVEKTVTRHRADLRLPDEDADQVSVVPDGIDEIVHAEVE
                     PIDGRLVTRTRERHAAVQQLASQGMSISAIGRKLSLDRRTVRRFARATEVEELLTKTE
                     SRASLLDEFKPHLHERFNAGCTDAARLTREIALLGYRGSDKTVRRYLQPLRSTLNPLP
                     SGPASPSVRQATGWLTRHPDRLSDDERTELESLLERSPALAATRDLVQGFAEIMIERR
                     GRDLGAWMTAVDTNGDRALRSFVAGLRRDLDAVTAGLTLPYSSGPVEGHINRIKMLKR
                     QMYGRANLDLLRKRVIHTV"
     CDS             87467..88447
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00810"
                     /note="fragment"
                     /product="putative transposase"
                     /protein_id="BAH47094.1"
                     /transl_table=11
                     /translation="MRKSPQMNEVLPLYLHGLSTSDFGPAREQFLGSGAGLSAASITR
                     LRDPHQQSGSGDALLRPRPLRSVRATFTAHGSSKPQGRHGLLVPPASLKAASAGGVHK
                     ACRVPLRRVISPVVGEVVGSDCLPDHAEPPAFPFIRGIWRLIGREQVVSAEWTAAVLP
                     SEQAGVVAVERWFDLAPPPDPIVTEVGVVWRRPSRDRGVTDDGSPGELDQVGDDLTVV
                     ATRVVGIAEHPLVVPELVEPAEVAICNPPLRLAGVAAAGPPPCEPPHVVVQRGESLAG
                     HHAPVVGGPAPDDGVEPGDDRQRVRATHTAHLVGEPTMDSLDRIRIRLDE"
     CDS             complement(87692..89509)
                     /codon_start=1
                     /EC_number="2.7.7.49"
                     /locus_tag="ROP_pROB02-00820"
                     /note="protein synonym:reverse transcriptase"
                     /product="putative RNA-directed DNA polymerase"
                     /protein_id="BAH47095.1"
                     /transl_table=11
                     /translation="MNLRGKLDTDEVNGPRDVVLDWDAIDWRAHEQNVVRLRRRIFKA
                     TREQDWAAVRSLQKLMLGSWSNTLVSVRQVTQRNAGRRTAGIDGETALSPEARANMAV
                     RVHESRSSWEPVPVRRVYIPKAGGKRRPLGIPVVMDRCHQARVRTALEPEWEARFEAR
                     SYGFRPGRSCADAIGALYSTLNGSRAKRVWILDADLSAAFDRIDHPRLLDTLGSFPAR
                     ELIGKWLTAGVIENGRFASSEEGTPQGGVISPLLLNVALHGLEEAAGVRYLKAADTLD
                     ARSVPGTPVLVRYADDLVACCHSRQQAELVKDRLAGWLAPRGLAFNEDKTHIVHLEEE
                     GFDFLGYNIRRYRRGTRPAKLLIKPNSDAVKRIHRRLANEMRRMRGSNALAVIARLNP
                     IIRGWTAYYRGVVSSKTFASLDYHMWRLTWRWARRRHPGKPKWWIADRYFGRFHKFRN
                     DQWVFGDPDHPRGDHGEVITHLVKFAWTPIVRHTTVAGRASPDDSDLRDYWIRRRRKV
                     KPPLDSYNAGLLARQNGRCPLCGDHLLTPDQPPDSPDEWERWWLGVVRQAIAADYLTH
                     HGRDDAAKGNSTRLVHASCRRSLQARRRNQQSVTPLRLA"
     CDS             complement(90177..91229)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00830"
                     /product="putative transposase for insertion sequence
                     element"
                     /protein_id="BAH47096.1"
                     /transl_table=11
                     /translation="MIDHAIAELTPLIGVRHACTSTGRAHASYYRAHPKHAGIQGTSP
                     KIPEVGPANASGRESAQPRALSNAERVRVLEVLNSQRFADMAPAQVYATLLDEGMYLC
                     SESTMYRILREKNQTGDRRRQATHPPKVKPELVAHQPNSVWSWDITKLHGPAKWTYYY
                     LYVILDIYSRYVVGWMIAPRESKTLAERLIAETIREQNIGRNQLTLHADRGSSMTSKP
                     VALLLADLGVTKSHSRPHVSNDNPFSESQFRTMKYRPDFPGQFDSIEAARMHGKEFFD
                     WYNFEHRHSGIGLHTAADVHYGRATEVRRRRGIVLDTAYAAHPERFVRNPPEPPALPT
                     TSWINKPRTEEENPTH"
     CDS             complement(91232..91663)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00840"
                     /product="hypothetical protein"
                     /protein_id="BAH47097.1"
                     /transl_table=11
                     /translation="MSSEETADRMDPVGVRPGEVPDPQVAEKAVRRTFTAKYKLAVVE
                     EYERADHGERGAILRRENLYSSLLTEWRRQRDRGALAGLSVPRGPKPAAGPTESGLAA
                     ENARLTAELEQARDVIRIQGELSALLEKLSSSSVENRGSRR"
     CDS             complement(91722..91973)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00850"
                     /note="fragment"
                     /product="putative transposase"
                     /protein_id="BAH47098.1"
                     /transl_table=11
                     /translation="MRATSSFRPSARTPIIPPSTAGAGRGQGLPGSGPLGQFVYLWVD
                     GIHLKVRLEQDKLCRATRSRTHRLSCMDRRSAALSVNLH"
     CDS             91927..92067
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00860"
                     /note="fragment"
                     /product="putative transposase"
                     /protein_id="BAH47099.1"
                     /transl_table=11
                     /translation="MIGVRADGRKELVALTDGYRESTESWADLLRRLPTPRHGRSRPL
                     GR"
     CDS             92039..92479
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00870"
                     /note="fragment"
                     /product="putative transposase"
                     /protein_id="BAH47100.1"
                     /transl_table=11
                     /translation="MAAPVLSVGDDALGFWRALREVLPETREQQRCWFHKQVNVLAAL
                     PKVAHPGALAAMKEIYNAENIDKAQVAIKAFELDYRAKYPKEVAKITDDMDVLLESYK
                     YPAEHWVHLRTTNPIESTFATCGSGRRSLRDPDPVRRDLPWPTS"
     CDS             92134..92493
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00880"
                     /note="fragment"
                     /product="putative transposase"
                     /protein_id="BAH47101.1"
                     /transl_table=11
                     /translation="MVPQAGQCACCATEGGAPRCTCGDEGNLQRREHRQGASGDQSLR
                     TRLPREVSEGGREDHRRHGRAARVLQVSGRALGASTHDKSHRVYFRDVRLRTKVTKGP
                     GSRAAGLAMAYKLIDAA"
     CDS             92536..92751
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00890"
                     /note="fragment"
                     /product="putative transposase"
                     /protein_id="BAH47102.1"
                     /transl_table=11
                     /translation="MRAGAEFHKGRLLERPTDTTPATYLGRSAPRPLSSSRRARHCHQ
                     HFKRIVMVILITSWSWHHVIALIKLGS"
     CDS             complement(93050..94003)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00900"
                     /product="oxidoreductase"
                     /protein_id="BAH47103.1"
                     /transl_table=11
                     /translation="MTGFDVLVETVHEESDGVRSLSLVTPDGRPLPGWDPGAHIDLVL
                     DDGLERQYSLCGSRDDRSHWRVAVLRASESRGGSEWVHDRIRAGDHLRVRGPRNKFPL
                     KSARKYVFIAGGIGITPLLPMIEELHAARPETPWTLVYGGRRRESMAFLSELDRFGDK
                     VEIWPEEERGLIDLDTVLGTPQFGTAIYCCGPEPLIKAVERLSRSWPPGSLHVERFQA
                     PVNPGTDPLRDATFEVVATQSGVTAQIPAGQTIVDVLAGYGIDIPVSCGEGVCGTCET
                     KVLEGIPEHRDAVLTEEQRASGEVITPCCSRSKTPRIVLDV"
     CDS             complement(94044..94556)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00910"
                     /product="hypothetical protein"
                     /protein_id="BAH47104.1"
                     /transl_table=11
                     /translation="MLKPTTTELLGGVRRGLTEDVLPKVSDGGAARQLRAALHILGRL
                     ERSWDRMPANLAADNDDIAATLSIALADVAAAAAGADYSDLFTRLAKATGGNGTNTQQ
                     YRVHDHRLAMEMAVNEALQGLLEDFDQRWRSDQSLDGVLREQLDRRILELYLRMVERE
                     AQAAGTDDDH"
     CDS             complement(94550..95575)
                     /codon_start=1
                     /EC_number="2.7.-.-"
                     /locus_tag="ROP_pROB02-00920"
                     /product="putative phosphotransferase"
                     /protein_id="BAH47105.1"
                     /transl_table=11
                     /translation="MDDSEIGERIEELLRVSITGARDVRADGVERVFGGNARRAWAST
                     VRWTDQSGASRSESVIMLSRTNGSQVDADPKWEFGVLSALGHSATRAPRAFALDADGS
                     VVGAPSILLERMPGRADPLGFLRSEDREGGRKLTLDLARAAAELHSSDWEGLGLGDIL
                     ASGPTDRSPLAQIESWEAQFRTSRMEPHPALGYVFGWLRENLPEPTQISVVHGDFRPG
                     NFLYQDNIVIALLDWEMAHLGDPVEDLAWAYRALWSPEGFVGLEEFVRSYEEFGGPKV
                     TEHALRFYRVFSEVKFATISLKASRSFADGVSGNLRLADRAATVTASLKRSLNWIADD
                     GKGWAWC"
     CDS             complement(95578..96384)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00930"
                     /product="putative oxidoreductase"
                     /protein_id="BAH47106.1"
                     /transl_table=11
                     /translation="MSTQPFTAPPRSNRALQDRTYIVTGAGGGIGGAAVARLLRVGSN
                     VVGVDLSSRRLAETEDKTKDLPGKLKTIKVDVTTESGTQDAVNYALSEFGSVQGIANV
                     AGGMVNINQDVYDLPLSDISLDYFAGTFALNVNSAFLLSKAIEGHFYDEGYGKIVNVA
                     SLAAFANRPELGNAAYNSAKAAVVGLTRSLSMSMGRKGVRANCIAPGLVLSERVKSWI
                     EPGYHERHLAYTALGDLATPEDLGEGIAFFLEPQSDAVTGEVMRVAAGVR"
     CDS             complement(96418..97263)
                     /codon_start=1
                     /EC_number="4.2.1.17"
                     /locus_tag="ROP_pROB02-00940"
                     /product="putative enoyl-CoA hydratase"
                     /protein_id="BAH47107.1"
                     /transl_table=11
                     /translation="MSTPNNTTTAPETPPVVYPNYESLKLDRPAPHVLRVLLSRGKMN
                     SLDFQMHKDLGSIWRRIDEDPTVSAVLLAGEGRAFSAGGDFDMVQRIIDDYDFRCQMW
                     KEGRALVQNMLDCTKPIVSAISGPAAGGGLAAALLADVTVAGRTAKLVDGHTTLGVAA
                     DDHAVALWPLLCGMAKAKYYLMTSDAITGEEAERIGLVSFCVDDDEVDARALEIAIRL
                     SQGAPSAIRFTKLALNNWIRAAWPSFEASLAFGILGFTGPEAKEGLAALQEKRPPVFE
                     QRSYI"
     CDS             complement(97263..98852)
                     /codon_start=1
                     /EC_number="6.2.1.-"
                     /locus_tag="ROP_pROB02-00950"
                     /note="protein synonym:acyl-CoA synthetase"
                     /product="putative fatty-acid--CoA ligase"
                     /protein_id="BAH47108.1"
                     /transl_table=11
                     /translation="MTLEYDFPLMCPDVISHNGRVFTDQTALVCGDTRMTWREVDEAT
                     NRFANTLRELGLDKGDKVALLMPASIDTFIAFWGSAKAGCVTVPLNVLLDGDSLARLL
                     NDSDAEIIFVDSQTAAQIDSVRSTLTNIPADRFFTFGETGTGWSDIRPLIEGASPEAP
                     PVKIKPQDTITILYTSGTTGMPKGIEHTHLSRMMYPYGFGMGLRIDRYSTAILATPPY
                     ASGTWITMIPTMYRGGKIVILEKFTSNAFLAAVERERGTHAFLVPTQYIALLEDPHLS
                     DFDVSSMQCLVTSGQPIAEKTYNAIDRAFENAGIYEVYGFSEGFAYLRIPEDAARGKR
                     TSVGKPIMLEEVRIVGGDGTELPVGETGEIVARSIGMMKGYYNNPELTEAATWYAPDG
                     RSFMRTGDVGHVDADGFLYVSGREKDMIKSGGINIFAVDIEQVFMRHPDVLEVAAIAK
                     PDPKWGETPILIAIPRAGAVITDEELRVWGNDQLAKYQRVSAVIFRDNLPRAVYGKIQ
                     KEALRREFGTGAPIEYVGGTA"
     CDS             complement(99090..100199)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00960"
                     /product="hypothetical protein"
                     /protein_id="BAH47109.1"
                     /transl_table=11
                     /translation="MEHLDEQFPLAPLDDHLIHQTPDPIRVAWSSDPRFYERYWNVFH
                     DEVGDLLIAAGGTFYPNLDLAEAYAIVNYRGIHRSVRAFRPLGVDRMDLEVGPIRPSI
                     VEGLRRWRHVLAPNDWDISYELDWVDRRRQVYSAAYGSLKSATPTGSQKHVTAGFEGF
                     GDVTGWVQIGDVRVEWPKGAARGTRDRHWGIGRGVGGPGMHPGRTVKAGWKGGNWIWF
                     DDFAIWGRTVLYDFGDPRPGAGRVVNVERRLRFEEDTKIFTEGVIDYTFDTGEQRQVH
                     FERLGFQTAYMKCGLYGGSPETGLHHGEYVGEPMVEGDEFDVREASVRSKLSGLNEHH
                     CRIICEDRTTTGILQPLEPDAYESCARGERGWAFL"
     CDS             complement(100204..101433)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00970"
                     /product="cytochrome P450"
                     /protein_id="BAH47110.1"
                     /transl_table=11
                     /translation="MPTSTIKFDPTDPATLRNPYDTFARMRAEAPVHWSAELSAWLAV
                     DAASVQTVLTTPTVFSANRLVPVFDRLKEKDQASAADVMRWLSIWMVFQDPPNHTRLR
                     RHLAEVINPNMTKTLREPIQEITTELLDGLPKHESFDFYTDFGLQLPGYVVMDLLGVP
                     RERLPEVKQWSDEMMLFIGSARSVENKYGRARHGALAMAELFRGLIADRKAAPQDDVL
                     TRMITSEIDGETLTEDELVASMMMIGNGAQETTAHLIGNALLALQEHPETLAELRADP
                     AKVTPGAIEEFLRYDGPVLSTARIVAEDTELGGQHLAEGDRIFAILAAANRDPAVFDR
                     PDELDLQRRPNAHVAFSKGAHFCLGAPVARLEAQIALTEIVRRFPDYRISEPVEEIAW
                     SNSMVTRGPTRLPVKLS"
     CDS             101780..102328
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00980"
                     /product="hypothetical protein"
                     /protein_id="BAH47111.1"
                     /transl_table=11
                     /translation="MSLPIKRVVTGIDSNGKSVAYEAADVEPVELAMMPGAQFFAIWG
                     TEGALESPVVSPQPANKTFFPGPGGTRFGLLRFPPESAAEPDAPAPTEEEISEWAAEA
                     ETKLPGLVGVFEPDAPGMHQTTTVDYSIVVEGELYLELDDGAEVHLPTGATIVQNGAR
                     HAWRNRSDQPATLAYVILDVDK"
     CDS             102405..103178
                     /codon_start=1
                     /locus_tag="ROP_pROB02-00990"
                     /product="oxidoreductase"
                     /protein_id="BAH47112.1"
                     /transl_table=11
                     /translation="MPTNPYKSLDLTDKSLIVTGAGSGIGRASAQLFAARGANVMVAD
                     INEQNAKETAEQIKSGGGRVEYLRIDVSVEEEVEALVHTTVEKFGGLHGAFNNAGIGP
                     QSPLHETSAEDWYRTLGINLTGVFFCLKHEIGYLLQHGGGSIVNTASLAGYKAVPGMP
                     AYVSSKHGVVGLTRAASLDYASQGIRVNVILPGTIATPMLDSVLHDPVLAKSLAEGQP
                     IGHVGNSIDIAEQAAWLLSDASAFSTGSLFFVDGGSSGV"
     CDS             103272..103493
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01000"
                     /product="hypothetical protein"
                     /protein_id="BAH47113.1"
                     /transl_table=11
                     /translation="MPCYTGNIGITFGEFLEDRFAATTFRATGVVPAGAEKRAPARQG
                     VESSSRSVPRKSPTPGRRPLPSATKEVHS"
     CDS             103490..104683
                     /codon_start=1
                     /EC_number="2.3.1.-"
                     /locus_tag="ROP_pROB02-01010"
                     /note="protein synonym:acyl-CoA thiolase"
                     /product="putative acetyl-CoA acyltransferase"
                     /protein_id="BAH47114.1"
                     /transl_table=11
                     /translation="MTNAVIVDAVRLASGKGKPGGALSGTHPVDLLAHVLRAVVDRNN
                     LDPVLVDDVIGGCVSQVGEQALNISRTALLSAGFPESVPATTVDRQCGSSQQAAHFAA
                     QGIIAGAYDIVIACGVESMSRIPLGAASIGQDTSGPGIAARYRQGLVHQGISAELIAA
                     KWKFDREALDAFSAESHRRAAAAAAAGFFDGEIVPIAVPNANGSVIEHTVDETVRAAT
                     TAEGLSGLRPSFRTDGYAARFPEAQWLITPGNSSPLTDGASAVLIMSEQAAAKLGLTP
                     RARFHSFAVAGDDPLFMLTAPIPATRKVVARSGLGIDDIDAFEVNEAFAPVPLMWAHE
                     FGADPARMNPRGGAIALGHALGSSGTRLLTTLVNHLEVTGGRYGLQTMCEGAGLANAT
                     IIERL"
     CDS             104704..105870
                     /codon_start=1
                     /EC_number="1.3.99.-"
                     /gene="fadE"
                     /locus_tag="ROP_pROB02-01020"
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="BAH47115.1"
                     /transl_table=11
                     /translation="MQRTFFEEDHQAYRETVREFLAREVEPHYERWETERLIDRSAWL
                     AAGKSGIVGLAIPEAYGGSGVTDYRFRNVVAEEIARTGTTSFGAGMSLQDDVALPYII
                     DLGTDDQKQRWLPGMAAGELIGAIAMTEPGTGSDLQGIKTTAVRDGDDWILTGQKTFI
                     TNGIHSDVVIVVARTDPSARARGFSLLVVERDMPGFTRGRKLHKVGLAGQDTAELSFD
                     QVRVPGSNLLGTEGRGFLYLMEHLPLERTSIAVTSITGARAAYEWTKNYVFERSAFGA
                     PIGDLQNTRFALAEMLTEIEVTQSHIDRCVLALNAGELTAVDAAKAKWWASELQKRVV
                     DRCVQLHGGYGYMLEYPIGRAYVDTRVHTIYGGTTEIMKEIIGRDIAADMSAPA"
     CDS             106045..106737
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01030"
                     /product="hypothetical protein"
                     /protein_id="BAH47116.1"
                     /transl_table=11
                     /translation="MAKPVLLVHGAFTGAWAWDKVIAELEQRGIRVNTVDLPSRGPDG
                     TLERDAQAVRDSLKVFDEPAVLVGHSYGGAVITRASADNDGVAHLVYVCAALPQTGES
                     VSDLLGRDPEPQGDLGVALEPREDGTATLEREAARETMFNDAPDEQVAHVLDKMGPHA
                     LGTLGETATGLGWQQHPATYVITLQDKMFSVALQHEFASHVDTVVKVDAGHGPMFTKP
                     VEIAEAIAAAAS"
     CDS             complement(107685..108830)
                     /codon_start=1
                     /EC_number="5.1.-.-"
                     /locus_tag="ROP_pROB02-01040"
                     /product="fatty acid-CoA racemase"
                     /protein_id="BAH47117.1"
                     /transl_table=11
                     /translation="MGPLHGLRVLELGGRGPVRFSGMLLADLGAEVISICRPRPADDI
                     TPLGDAGLGRGRRRVSLDLRTHAGRRVVLAIASRVDAVIEGFLPEVAESLGVGPADCM
                     AANPRLVYGRITGWGQTGPLANQPGHDINFLAVSGVLAHLGRAGTLPAPPMNLLADGG
                     GAMLLTLGVTAAVLEARASGMGQVVDTSMLEGHALLSTMSHEMRNEGRWNEDRGSNLN
                     DSGAPFYDVYPASDGRLVAVGAVEERYWKFLLALLDIGDGPDRWDRATWPWWRERLGA
                     AFAQRTQSEWSEHAEAAGACISPVLTGAEAADHPHNRERGVFTRAGDDLLPSPAPRFS
                     RTALRPLGTTARGSDQTRQVLAELEIDETGILDEPSAGGRNGLEPAQ"
     CDS             complement(108910..110541)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01050"
                     /product="Baeyer-Villiger monooxygenase"
                     /protein_id="BAH47118.1"
                     /transl_table=11
                     /translation="MPLQTLSDVDAVVIGAGFAGLRTIHALRKLGLSMQVFEAGTDVG
                     GTWYWNRYPGARTDTESWAYCFSFDREGWEEWDFRERFSAQPDTLDYLRHVADKHDMR
                     KHIRFSTRVTGATFDENTNRWTVVTEDGLEVSCRWLITGLGWLGVAFKPPFPGADSFQ
                     GEFYSTSQWPHEPVDLAGKRVGVIGTGATGVQVIQSVAHVAENLTVFQRTPNFVVPTR
                     NHALSPEQKAELSRDYETVWDKAFKHVFGFPMESPERLGSELSDEELEKVFEAGWEAG
                     GFRFIFETVDDLLVDQRVNDTAAEFVRRKIRTIVKDPHTAELLCPTTHPIGGKRPPLG
                     TFYYETYNRPNVSLVSVREDPIHEITPTGLRTASGAEYELDVIIYATGFDAITGPLSN
                     LDIRGVGGRTIAEQWADGAKMLLGLSAAGFPNLFTILGPQAPFASHPPVIETQVDLIE
                     KILERALAEKATRVEATPEGVEAWSDQCDMVLKATLLEQGLGDRPWFLGANVPGKKPS
                     TLCYLGGLGNYVTAVNQEVEGGFSSYVLDAAPVLA"
     CDS             complement(110605..110766)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01060"
                     /product="hypothetical protein"
                     /protein_id="BAH47119.1"
                     /transl_table=11
                     /translation="MTVPLQRVITGVTTDGMRFPVGGCVQDESGPAGNHGSVPATPCP
                     PDPRRSSSI"
     CDS             complement(111668..113632)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01070"
                     /product="putative CdaR family transcriptional regulator"
                     /protein_id="BAH47120.1"
                     /transl_table=11
                     /translation="MSTAAPLPDKCKSAGTAQGSYRADIRACTAFREVAEALAEGRDL
                     DVVLHVIAEKLCLLTGADRCSIHLVDKETGLLHGRAAHAPTNIDAQVKQLVSGTMQDS
                     FTREILSTRRPVALSNTLSDPRPIKSAMRRWNAQSVLGVPMVLHDEVIGVVYLDSENT
                     PVEFSAADQELAVAFADLGATAIRQTQLTTRLRSSLSTVATQIEQLRQAASLEEQLTE
                     IVLRGSSLREIGDTVARLLGKPCAIYDNAFRRRVLSSPAQSAQNFTPKLLDKDIREAP
                     AVRESLAQLKPGTPTVIQPLPWLGLHHRLLLCAVMLDGDCWGYVVVAEHGRRLSPLDE
                     AVVRRAALNIALERSGERRAGTVQWHTIEAFTGSLLRGDESLAALEERAEVLGLRLDV
                     PRVVCLVAARQKDAPLQISPQMLAKRLTDRESPSAVMAAPSGNDIALILELPESADHR
                     RGVAWAKDRVRAAVTGIASEDALNVAISTVAYAPGEDTRAFNEARQVLSCMHHHLGIP
                     GTQFLTVDELGAGRLLLSSTDPTDALRYAHDALGPLLASDSAKTRELLTTLSVFLDAG
                     WSVRRAARLLGVHANTIRYRTARIEQLTGLDVATDAHAQLTAQLALLILRMNGLLPPT
                     SALPMTDHPTETSDQIEADEADEADDADVE"
     CDS             113818..114162
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01080"
                     /product="hypothetical protein"
                     /protein_id="BAH47121.1"
                     /transl_table=11
                     /translation="MMELAMADRRAVATAIATRRAGYGENLDELCARDRRHSDHARKA
                     LGVALIPKAVHPRTAGPPTYEPNVVAALIFCWAALAMGGKRLAPTLADLVPTSYPLCG
                     RSMNLTAGLRSH"
     CDS             complement(114249..114698)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01090"
                     /product="hypothetical protein"
                     /protein_id="BAH47122.1"
                     /transl_table=11
                     /translation="MTMYPLARLPLDKYPCQRDLSLVFGDIDTVGHVNNVAIARLFEE
                     ARVHLYRMVDSYLSEKRPMRMVLAHVEIDYAAEVSYPGEVQLGIGVHEIGRTSVRQGA
                     ALFQGDRCVAVSRSVDVNTIEGQAGAAGLSEDYRLALHKCLLPQIQL"
     CDS             complement(115024..116217)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01100"
                     /product="hypothetical protein"
                     /protein_id="BAH47123.1"
                     /transl_table=11
                     /translation="MPSSRGRFLWSAFVRVLRRHRRIREFAEAGLLDGLDGTERSTRI
                     RVLQHLADRGISTDSLASATREGQLGHQLLDVTLSPHGAIYSLEQISQSTNISPEDVE
                     RWFRSMGRGVSASTSVDYNDDDLRLAQLLNEYRALGIADAGLFAFARIVGRNTSTLAD
                     ASKSLIQNNLDTNRDRPEIALQFARELQRFAEFQSQLLHGAVATRLRQQISQQIRADI
                     TTEHTSESHVIAACFADMVGFTVLGEQLTPTELGDLADRLDTLTTDLVEPPVQFVKTV
                     GDAVMLLSPDPTRLAAVVLKIVTAAQQEGLPPIHAGIAWGTAVRSAGDWIGQPLNRAS
                     RIATIAEPLEVLVDSEAMRRIDSAEITIESAGTYQLKGLTGGSQLYRIRVKQQRVDLS
                     PAQDR"
     CDS             116607..117410
                     /codon_start=1
                     /EC_number="4.2.1.17"
                     /locus_tag="ROP_pROB02-01110"
                     /product="putative enoyl-CoA hydratase"
                     /protein_id="BAH47124.1"
                     /transl_table=11
                     /translation="MGEDRVRVRVGDNGVATVTMVRSDKHNALDHAMFEGLLEAADEL
                     AANRRVRAVVLHGEGKSFCAGLDVPSFLAGPTGIDVLLVREHGRKANFAQRAAHDWSR
                     VPAPVIAAITGNCFGGGMQIALGADIRIAAPDAKLSIMEVKWGLVPDMAITQSLPRLV
                     GIDVAKELTFTGRILSGDEADALGLVTRTAEDPLASALRLANEITQKSPDAVRAAKRL
                     YDETWSGADAAAALMLETDLQTELYGKPNQVEAVTAGVCKRAPSFADLD"
     CDS             117649..118746
                     /codon_start=1
                     /EC_number="5.1.99.4"
                     /gene="mcr"
                     /locus_tag="ROP_pROB02-01120"
                     /product="alpha-methylacyl-CoA racemase"
                     /protein_id="BAH47125.1"
                     /transl_table=11
                     /translation="MSAPVTEKKGPLAGIRVVEFAGLGPGPHAAALLADLGADVVCVQ
                     RPGVIPPDGPYDQIQRGRRVVEANLKDPEQVEKVLGLIERADVVIEGFRPGVTERMGL
                     GPDVCLERNERLVYGRMTGWGQEGPLAGAAGHDINYISLTGVLHAIGRKGERPVPPLN
                     MVGDFGGGSMFLIFGILSALVERQTSGKGQVVDAAMVDGALALSHMMWAFRGRGVWSD
                     ERGVNLLDTGAPFYDTYETSDGKYMAVGSIEPQFYALLLQGLELDPAELPQQMDVSAW
                     PQMKKVFAEKFLSKTRDEWAAIFLGTDACVSPVLTFAEAPSNEHIAARGSLVDLDGVT
                     QHAPAPRFSRTPAGAPTPPAREGVDIDTVWA"
     CDS             complement(118811..119134)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01130"
                     /product="hypothetical protein"
                     /protein_id="BAH47126.1"
                     /transl_table=11
                     /translation="MRRIEQSRRNRLFRRRGGIGRFTVSSGSGSGSGSGSGTWGLGMA
                     NARAEELARMTALDTGDALHTQARPEIATLANLFRYFAGVAGEIKSKSCPPVTTSSSA
                     RGRRS"
     CDS             complement(119343..119630)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01140"
                     /product="hypothetical protein"
                     /protein_id="BAH47127.1"
                     /transl_table=11
                     /translation="MTAGGRTYRIDSDASAGGGYMAGGGYGGHHGKVRGRDHEELDVY
                     PLDGTVGPKTLDSALTDRCCEFEWNGQTGYGIFEFALSRSSSYTYCPILAG"
     CDS             complement(119627..120358)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01150"
                     /product="hypothetical protein"
                     /protein_id="BAH47128.1"
                     /transl_table=11
                     /translation="MTDGFHDALVTQATSEMPERFFDRFMFNLHPDSGTTPSVILGAG
                     VYPPRNVVDGFVVLTTESEQRNLRYSTEHSETDAASVGPLKWETVDDNSTWRIQLGEN
                     KTGLTLDLLWHARAPYWLGSVDVENTDGNVTSFDHLFHPGRYEGTLTLDGTTTDVAGW
                     YGLRDRSRGVRTMSGARVCTSGTRRSSRTARSDSCSSRIVTAGESCWRVPSCMTTADS
                     TTSPTSGTTWCSPRATTSPVARWRS"
     CDS             complement(120355..120540)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01160"
                     /product="hypothetical protein"
                     /protein_id="BAH47129.1"
                     /transl_table=11
                     /translation="MWSAYETEAFPLEGVSLASLLMRSSYRFTLDHKEVDSIEKSTGD
                     DRACLPLTPAVNQKEHV"
     CDS             complement(120685..121449)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01170"
                     /product="putative GntR family transcriptional regulator"
                     /protein_id="BAH47130.1"
                     /transl_table=11
                     /translation="MVGPVDIEPDWSTVDVEHDTQRHTPFGPVRVPTAAQLFAEHLRT
                     KIFNGEYKSGDHLPPERVLVEQGGLTRAAVRDALAILKQQGLIVTLTGRHGGSVVSRP
                     TQQDLITSLDVFLQAQGWGPETPTLTESREIIEPSCAALAAQRRTTAELDAIHLFQDR
                     QAHSLDNIPEYLSASQAWHVAVSDASHNTLLAAFMHATAEVLMAATNSARFSSHESRL
                     CSLTAHREITEAIADRNSGRARELMTQHIRGSEDQN"
     CDS             complement(121556..122779)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01180"
                     /product="ferredoxin reductase"
                     /protein_id="BAH47131.1"
                     /transl_table=11
                     /translation="MAPEHIVVVGGSLAGLRALETARRAGYAGRLTLIGAETHLPYDR
                     PPLSKEYIDSDQDSHITHFTGVEELADGLGVSLMLGQPATSLDLANGIVHVGDRTVPY
                     DAALIATGAIARTIPAAAHLDGVVTLRTIDDARIVRSALDQGARVVIVGAGFIGAEVA
                     AAVRKRGRSVTVVEALPIPLVRAVGETAGRWLSALHERNGTELICGVAVESISGDHRV
                     EGVRLANGRHLPADLVVVGIGATPATDWLTGSGLTLDNGIVCDATMHAGGNVWAAGDV
                     ARWYSQDFDTPLRIEHWTNAAEQGAHAMRNLLDPSNATPYRHIPYFWSDWYGNRIQLA
                     GRPIGEPTVVTGDTATDVFTALYRDGHRLIGALTLNRRSDIMKYRALIARAATWEDGL
                     KLAQTRNNSLTTNSK"
     CDS             complement(122783..122977)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01190"
                     /product="3Fe-4S ferredoxin"
                     /protein_id="BAH47132.1"
                     /transl_table=11
                     /translation="MKVVVDRAKCTALGNCEAIAPTYFEVGDEGDLLLLREDVPEDER
                     ELVEKAVAACPTAALILEQD"
     CDS             complement(122974..124602)
                     /codon_start=1
                     /EC_number="2.7.9.1"
                     /locus_tag="ROP_pROB02-01200"
                     /note="protein synonym:pyruvate, orthophosphate dikinase"
                     /product="putative pyruvate, phosphate dikinase"
                     /protein_id="BAH47133.1"
                     /transl_table=11
                     /translation="MGDAAPLTAAIYPFDHPHRARPRALTDLLGGKGAGLAEMISTLG
                     INVPPGFTISVPLCQRYRREGWPEGLDEAITLHTSRLGDRMGRRFGDHNDPLLVAVRS
                     GAPVSMPGMLDTVLNLGLNEYTVEGLAKVSGDEKFAWDSYRRFLHMYATTVMGVHCDE
                     LYVGHSGDTTESLREHVVLLRERIRQVAGRDVPAEPTVQLREAVEAVFRSWDSQRART
                     YRAKEGIDESMGTAVNVQAMVFGNRGLNSGTGVVFTRDPSTGEAVLYGDYLPMAQGED
                     VVAGTAHTLPIADLEQLHPAIYTELQETLRRLEVHYRDVCDVEFTIENGRLWLLQTRA
                     GKRSAVAAVRIAVDLVNDPDIRLTPTEAVSRVPAAVRQRARDEALAHVGADDAAHDLV
                     TTGLGASPGRAVGRVVLTSDEAADADDDVILVRPETKPEDVAGMAASVGLLTTKGGLV
                     SHAAVVARGWNIPAVVGAQDLTCSANGIHAPSGLLIRVGDVITIDGTTGQVWRGAVTT
                     PTDEIVIRAIEHELPQLPALEEWARQYAHEGEEQ"
     CDS             124725..125942
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01210"
                     /product="cytochrome P450"
                     /protein_id="BAH47134.1"
                     /transl_table=11
                     /translation="MDKVAATEAASRADLMDISIFGQDREMPVFDELRAHDPVHWNAP
                     SPLGPGFWALTKYADVKSAASDNIRLSSAGGTQILDRKVEGKLASLHNMDDPEHAQLR
                     KIAVPHLRALRVQQWQDAIDEAVKYLLDDVASRAGEFDMVHTVSAKLPMLVLSRVLGV
                     PAADAPRMVDWTNRLTSSDPADEVDQAALASARDEVMAYFEKLTELRRREPTTDLISV
                     LANGKKDGRPLTWEELAAYYILLVAAGNETARHAVSGGTMLLHRHPETWQRLVADQSL
                     LPSAVEEILRWVTPVAAMRRTALEPLRIGDKDIAAGDKVVLWFSAANRDPEVFEAPHE
                     FRIDRTPNEHLTFGWGIHFCLGAHLARAEIRTFFGEVLRRGIRFEVMGEPTRVQHNIF
                     RGWTQLPVRVGKA"
     CDS             125975..127447
                     /codon_start=1
                     /EC_number="1.2.1.-"
                     /locus_tag="ROP_pROB02-01220"
                     /product="aldehyde dehydrogenase"
                     /protein_id="BAH47135.1"
                     /transl_table=11
                     /translation="MPFPPNSVYIAGEWISSPDLERLPVLNPASEEVIGSIVDASPAE
                     VEAAFAAARAALPKWSATAPGQRADVLDRLADAFREHGEELAVLASREIGMPIKESRA
                     GQADLPERVLRSTADIARNFPWEARDASGTTVIREPVGVVLGITPWNFPVHQIVAKLA
                     PALAAGCTIVLKPAELTPLNGLFVAALCERIGVPSGVVNVLTGRGATTGEALVQSGQY
                     DLVSFTGSLAVGRHIGAVAGERVVRATLELGGKSPAVVLDDADVEAAVRATVRNCFTN
                     AGQKCNAPTRLIVPEARREEAVSIAASAAAAYVLGDPLDENSTMGPLASALQREKVLS
                     YVEGARARGARVAGGGAVDGVNRGYFVRPAIITDVEPDDPVVQEEIFGPVLVVLGHEG
                     EDDAVRLANDTPYGLSAEVWSGNPARAADLARRIHAGQVRVNGVRTPALPISPFGGYK
                     ASGLGRELGPFGLEEYVEVKAVLGDPSDSIPSKEEPQCVL"
     CDS             127435..128511
                     /codon_start=1
                     /EC_number="1.1.1.-"
                     /locus_tag="ROP_pROB02-01230"
                     /product="putative zinc-containing alcohol dehydrogenase"
                     /protein_id="BAH47136.1"
                     /transl_table=11
                     /translation="MRAVVIWNPGEPFTIHDNVCRPAPGPGEVVVRIRAAGVCQTDIA
                     LSKGAFGQSTPVVLGHEGAGEITELGPGVTGLIPGDRVLVTWVPPCGRCYHCVRGETY
                     ICSNRRRSSERGDEGSLSVSGVPVQAGMGTATFAEETVVPATGVLPLPDDIPFEYAAL
                     LGCAVPTGCGAALNSARVRAGESVLVIGCGAVGLSAIQGAVIAGAADIVAVDPQDPRR
                     RAALEFGATAALPPGSDPRESLVDAPGFDVVIDAVARSSTIRDGWQAARRGGRVVVVG
                     AGKPDDMVQFSAQELFHDGKQLIGSFYGSSDMRRELPRLIALWRAGRLDLSRMVSEVV
                     DLERINDVVARQTAGEVVRSVLLV"
     CDS             128710..130845
                     /codon_start=1
                     /EC_number="6.2.1.-"
                     /locus_tag="ROP_pROB02-01240"
                     /product="putative acyl-CoA synthetase"
                     /protein_id="BAH47137.1"
                     /transl_table=11
                     /translation="MGNQTLANTPLDREALDRLLRPERIALVGASDKNLFSRRAFAQH
                     HRVAAAKQLILVNPRSRQVHGVHTVPTCGDIDGGIDCAFLMTPQHATGEALIDAAAGG
                     VKAAAVLGQGWAEEGSEGLQRQEELVALAEELGVVLLGPNHLGFANLWDGVAPCALGL
                     DMPVEPGAFALVSQSGAVGSSMVGYAGRQDVRFSFVVTTGNEAMVTVADVVRYLVEDE
                     HTRAIGIFAETIRKPAVFRAAARRAAELGKALIILKAGSSELAAQTAQAHTGALVGDD
                     RVIDAVLRQDGVIRVRSVEDLICTGMLCAGTGPLRASGVGVMSVSGGACDLIADRGQD
                     VGLRLPPLSSATKDQLAQVLPAYGHPQNPLDVTGSAATRPEVWRSAFESLAAEPTIGL
                     IGAVTSLPTPGEPQRDDTFHAVGAAIRATGVPGVIFPQIDQIQNDHVREVKSASGVDI
                     VLPSVERFALAAAGLGRWSDWLRTRPGRPAASSASHGDITLPGSGPLSELAGRDLLER
                     AGIPAVPATLATSTDDAVAAAVRLGEPVALKMCSAQVAHKTELGGVELGVSGTTAVAA
                     AYERLAARAQAAGVELDGVLVSPMRTGGVELLVGVTHDPDWGPVLAVAVGGALVELLD
                     DSALRVLPVGPDEVRSMFEELRGYKLLTGFRGSKPADIDGLVDVVLRLSELALALGPS
                     VESVEINPLLVDGDRIEALDVLVTRSVPS"
     CDS             131014..131979
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01250"
                     /product="hypothetical protein"
                     /protein_id="BAH47138.1"
                     /transl_table=11
                     /translation="MEKAPIGIGAMADTFRIQLTWSEESAGPRSLVIKKPSADPAAAA
                     TAASLGAYEREAKFYVELAPRTAVRAPRLFGVELDDGIPSTVLLEDLSEDYQPGDQFA
                     ELALPLLRRARHQLVLLQAPFWQNADTANLDWLHRRLGVPIPAIVERMQRSWWSARST
                     IGSGLTSDERACVDRFVSHAGEWASGLNGPCSLVHHDFRVDNMLFGQNEIVVLDWQTI
                     GWGPAMFDVAYLLGTSLEPERRRAVERDEIARHVDELAEHGVDWDVAEAWQAYRQAAF
                     AVLLMLVPPIASVKTNARMEAMYRRLIAFGARMAIDLDALDLLPA"
     CDS             132205..134418
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01260"
                     /product="hypothetical protein"
                     /protein_id="BAH47139.1"
                     /transl_table=11
                     /translation="MIVIARGGTTTFLSMALNAGVRGVITLQGAPESHLGILSREYGI
                     PCIMSVAFDKGVRTARGEIIPADGVRVRMDLTSRPTGTVSVETGAPVDDTPTTDSAPA
                     MTAEQLAQIQLLLNKFQGEVPRGREGHEVMVARQGSAVLDLDDTSMNRELTVDEVNDV
                     LHYLVWNEWDALAARATEGESGLIPRQEYEAMGIMDSWFHHPEWLRVIQDHVGADGIS
                     AIATRAHREIGTKINMLHIWACASAPSFGRGIALELGLHDYDYRTRRITEAMSTVRRL
                     YRGLWGSGPMFASMRDYQAPILDPSWIARFESDRIALSDDRGRSTFQRFNGALELLGF
                     LVHFDNRLGLGDSGPYPTADGGFVIVRDLFINEPAYPWSDTTAGLPYAVTIAMFFAGD
                     TDLETKVFDLSTMFTEPSNYLPHVTGVAVYAREKFDTPIDQLRTLSLEDMAQLRAEAE
                     TKSEALYKRIAVMSQQEKVMAGAVVYASGFLLPFARAAGIYDDLVRDHGFMSIHPVVE
                     ACHDRIVGGVASEMIPRLFLTGSWANDVPPHSSDTVSTMPDEFEVLQAIRTRGFATVE
                     QISISSGIPAERVREVVAASEEKGFVKQRTGRINGASLTPVGRARLLLVTEAAVTADQ
                     HAAITSAYAVFLGPNRAFKAIASSWQMDQDLTTTLGSLPPVHHDVAAVIAQAATAQPR
                     FGLYRQRLDHAFEQFRNGNTDALARPMVESYHDIWMELHEDLLATLGRARTDHDE"
     CDS             134429..135244
                     /codon_start=1
                     /EC_number="3.1.3.48"
                     /locus_tag="ROP_pROB02-01270"
                     /note="protein synonym:phosphotyrosine phosphatase"
                     /product="putative protein-tyrosine-phosphatase"
                     /protein_id="BAH47140.1"
                     /transl_table=11
                     /translation="MGARRNQLDPRIPIPGTTNVRDVGGYPTGDGKRTAMGRLYRSEV
                     LGLSGSGAESLWDELRTEDYQCLRLRSIVDLRSHREARMIPSAWDRATGAQLVHAPIP
                     EGVEGSETDFMRLLRDGKITTFDEEDLGRWYQLVLRRRTDVLGEVIRVLSNPHHLPAL
                     VHCHAGKDRTGLVVALVLEVVGVPRNVVTADYALTSRYRPDRAAEHAALLEHLGIHVD
                     DVRSLWEAPARAMESALEFLDITYGGVAAYLTNECSVTPAHIESLRAQMLEDA"
     CDS             135271..136305
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01280"
                     /product="hypothetical protein"
                     /protein_id="BAH47141.1"
                     /transl_table=11
                     /translation="MAGDIAEALRAGGSLPEGGNVEQCRALPLGAGQLADSYRVELTY
                     TPGPSGPSSVFVKLPPSDTHSAATASRIGAFDRERFFYAELRPRLDIRTPRFLGSLPR
                     GDGPPGLILQDLSSSTRPLDQLRDGTIEQVESVADQLAGLQAPFWDDEDAVGGTDRFY
                     NRTEDHITGLAERYEQSWHRHRDTVGALLDPQQRQLIETFGHHCLSWASGIRGPRTLV
                     HQDLRLDNLLWGDAGAWIVDWQTLAWTSPAWDLAFFLGTALDPDTRRRVEQRLLEAHV
                     SALHDRGVQGWDIDTAEREHWRLSGSVLIAMVAALAFVQPTARGFEMFASLIHRGAQQ
                     ALDHDLLSFI"
     CDS             136324..137442
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01290"
                     /product="hypothetical protein"
                     /protein_id="BAH47142.1"
                     /transl_table=11
                     /translation="MLSKWDDYPVHQAALPVAQTASSDLGRYDRHWMAMHDIDLTTQV
                     GFGLSVHPNRGIVDASISIARDGRQDSVFASSRLSRDRDTIAGPLRVEVIEPMRVLRV
                     VLEEHDGISADLTFTGVTQHIEDGRMRRDSGTTLVSERLRTVQFGDWSGEFTVGGETV
                     TCSPDKWRGFRDRSWGSRTTGTVAEGQHGVHKSAIYFAWTLLRFEDECLLVAVNEMPD
                     GRSEARTVAVLPFLKAGDPAYGEEDRILRGDTFQFDIDYRPGTRRAQHVDLTVGPRGL
                     VNRKITIEPEGLFLMQGLGYYHPMWKHGTDHGKDIVGTDSWKLAGLDPSAMENVHAQQ
                     ICRATRADGAIGLGLFEHVAIGPHLPSGLPDGIAPLGQ"
     CDS             137645..137821
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01300"
                     /note="fragment"
                     /product="putative transposase"
                     /protein_id="BAH47143.1"
                     /transl_table=11
                     /translation="MATRGPRPTEIVLTETERVELEGWSRRRKTAAGLAVRSRIILAA
                     PMVDRIPKWRRGWG"
     CDS             137713..138735
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01310"
                     /note="fragment"
                     /product="putative transposase"
                     /protein_id="BAH47144.1"
                     /transl_table=11
                     /translation="MVAATQDRCRFGGTVANHSRCADGGSNTEVAQRLGLNRGTVRRW
                     RDRFVEDRCDGLLDEPRPGRPRTIDDDKIKDLITSTLETTPKNATHWSTRSMAEHLDI
                     SQSTVSRVWRAFGLAPHKQDSWKLSKDPVFTEKVRDVVGLYMNPPERALVLCVDEKTQ
                     IQALDRTQPIFPMLPATPQRASHDYVRNGTSSLYAALDIASGKVIGSLHSRHRAQEFI
                     AFLRKIDAQVPDDLDVHLVMDNASTHKTPAVKRWLLAHPRFVIHFTPTSSSWMNLVER
                     WFAELTTKKLQRSTHTSVQQLNKDIRAWIETWNDNPRPYVWVKTADQILDSIAHYCAR
                     IKDSGH"
     CDS             139271..140053
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01320"
                     /product="hypothetical protein"
                     /protein_id="BAH47145.1"
                     /transl_table=11
                     /translation="MQLSHTRPVTAARFDDPDLVATAGLVPVVALAQASGLLTLADQH
                     LSVPTDKGANTGRKIGSLIGGMVAGADSIADLAILRHGAMGTIFDRPYAPSTLGSFLR
                     QFSFGHVRQLDAVASRFLSNLAAKTPLVTGIDTGRILVDIDDTIIEVHGHGKQGSGYG
                     YFGIRGLNALIATVTRQTAAPVIVTQRLRRGARGSARGAARMVADALATVDRLRTHAG
                     GPSGNGAPKVLMACAQRRVVTYCRASHLVSQRSCSTAERCGP"
     CDS             complement(140847..142349)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01330"
                     /product="putative amino acid transporter"
                     /protein_id="BAH47146.1"
                     /transl_table=11
                     /translation="MDTSENLGPSTAPTNIAGEGETSFRSSLGVGSIVFMVVAAAAPL
                     GVVAATFPVIISVEQSIGAPLFLLMVTALLTVFAVGYTAMSRYVPNAGAFYSYIQAGL
                     GRIIGTGCATLAYVSYLMLLVGSTTYLGVNASNAGRIFLHIDLPWWTWCLIAFALAGY
                     LGYRNVDLSARVLGLVLVLEAAIVIVVDTAIILQGGEEGLSAEPFSPSMLTQGAPGLG
                     FMFAFLCFLGFEATAVFRNEAKDPVRTIPRATYIAVIGIGLFYTVTMWCVIMGIGPSR
                     AVAVTGDDPTVAVLNLASEYVGPIARDVMLVLLVSSQFACTLAFHNVLTRYQYTMGTK
                     GVIPRSLGRISPKHHAPSRSSAVISLITVVSMMMIVALGLDPISEAFTWLSGAATLGI
                     IIMMTTTGIAVIRFFRHHPTSDGTWTTLIAPAVSSIGMVVVLVIAIQNFGLLVGENTA
                     AEVALGVILAVAFAAGVIIAVTMRRYRPAHYESLERDSDKTQQQSKTTNL"
     CDS             complement(142410..143819)
                     /codon_start=1
                     /EC_number="2.6.1.-"
                     /locus_tag="ROP_pROB02-01340"
                     /product="aminotransferase"
                     /protein_id="BAH47147.1"
                     /transl_table=11
                     /translation="MTHLDFMPDAVADDADYRTTAGQHLWRHFAEMAEAERTPLKVIT
                     RGEGSYLFDTDGNRYLDAVSNLFCVNLGYSYGEELGQAALDQYRQLGYHSNWTTTHPR
                     AIELAARLAELAPDDLNHVFLTPSGGESVEAAWKIARQFYQLRGENRWKAIARDMAYH
                     GTTLGALSLGGIHRMRSPFEPLVPAVAHARSTARAGRPAGESEEDFTAFLLDDLEQRI
                     VSEDPSTVAMIILEPIQNHGGSLTPPNGYFAGIRALADKYGILLVSDETITAFGRVGE
                     WFGSTRFDFTPDIITTAKGLSSAHAVIGAVIVNNRVYEPFSEKGVSLQHGNTFGGHPV
                     MAAVALKNLEIMERLQIPEQVRAKENSLRTSLESLRDLEIVSDVRGAGFFWSVELTGT
                     DTNGSPLSQPQRDRLFARPHLAGALEDLGILTRVSLDSVNPIICVSPPLVAEDQEFTL
                     IRNALAKVLSEIDSTRKSL"
     CDS             144475..145314
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01350"
                     /product="oxidoreductase"
                     /protein_id="BAH47148.1"
                     /transl_table=11
                     /translation="MGRIEGKVAFITGAARGQGRAHAVRFASEGAAIVAIDICEAIEG
                     VPYSLSTKDDLDETAHLVREAGGRVITAVADVRNQECLDNIVAEGISEFGGIDILIAN
                     AGILTSEGRAWEISDRAWNDILDVNLTGVWRSVKAVAPTMVERNQGGSIVLTSSYTGL
                     KGEGYIAHYAAAKHGVVGLMRSLAHELGPYNIRVNTVNPGNTATGMVLNDFSFGLLRP
                     DLANPDRADAAETLKHLTLMDVDFIEPEDIANAALWLASDEARFVTGVTLPIDAGWYA
                     KST"
     CDS             145377..146189
                     /codon_start=1
                     /EC_number="4.2.1.17"
                     /gene="echA"
                     /locus_tag="ROP_pROB02-01360"
                     /product="enoyl-CoA hydratase"
                     /protein_id="BAH47149.1"
                     /transl_table=11
                     /translation="MTTEQGESPPITHDDQFVYTEMTTDRVAIVRLERPRANALSLAV
                     LRQLDEAFQALASDLPGAVVIWGGPRIFAAGGDISEMGGPEDAARFVKAFRSTFDRIA
                     SIPRPVIAAVCGYALGGGLELALSADLRVAGEGAKFGLPEVNLGLVPGAGGTQRLSRL
                     VGPSRAKDLVMTGRQVNAEEALRIGIADRVVPDDEVFSESIALARRLATGPSVALATA
                     KSLIDANFDQPLNAGLDAEGRAAVAMHHTEDGRAGVKSFIANGPGQAKFVGR"
     CDS             146293..147930
                     /codon_start=1
                     /EC_number="6.2.1.-"
                     /gene="fadD"
                     /locus_tag="ROP_pROB02-01370"
                     /note="protein synonym:acyl-CoA synthetase"
                     /product="fatty-acid--CoA ligase"
                     /protein_id="BAH47150.1"
                     /transl_table=11
                     /translation="MMDTPLTTQMLFRRMQTICGQRRIVTITDDGRRMSQTFEQVSRR
                     AASFAQALDSLGVCRGDRVGSLLWNTQEHVETYYATMGLGAVLHTINPRLHDEQVIYT
                     INHAGDRVIVVDSSLVDQLDRVLDKLASVEHVVIVGDGASVVSRSAKVHRYSEMLTLG
                     EGVNFEWPALEESWGACLCYTSGTTGNPKGVLYTHRAIVLHALTMAGVGGLQVQEGDR
                     VLALVPMFHSLGWGLPFVVTVTGSDLVLPGRNLGPQAVARVIRDERVTWAGGVPTLWM
                     DLLRHVEDPSNKDAVDLSSLRMVLCGGAKVAVPLMQAYDERLSVTLIQGWGMTETLPG
                     AAMSLDIVAPPAERWQRRGQVGRVSPLYEMRIVDVDGSVLPSDGTSVGEVEISGPIVA
                     GSYYGPEDTSDKFHEGWLRTGDLGTLSSDGWLDITDRAKDAIKSGGEWISSQDLESAL
                     MAHPAVHEAAVIGVPDPRWSERPAAYVVVSPHGPTDDELREHLRSHVANWWIPEEYHR
                     VDTLPRTSTGKFDKKELRRHRADLAGSLQKISPVENA"
     CDS             147952..148581
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01380"
                     /product="putative TetR family transcriptional regulator"
                     /protein_id="BAH47151.1"
                     /transl_table=11
                     /translation="MPSDEQDNRERILAAARRHFNSPGYNSARVADIAKDAGVSRATV
                     YNHFPDKDAILAALVDEYLAGYARIGEAMSATVDVGDTVFAILLRMVEDTLMWRVENA
                     DLRPAIDVARQVLPANLLEANRAADEVLRGHLADVYRRSTAHGIVRDDIDPEFAASAL
                     YSMIEAVLNATDVGSSVDEIKSAALQLALLQWYAVYTIVPEQSPRLDSI"
     CDS             148886..150286
                     /codon_start=1
                     /EC_number="1.2.1.-"
                     /locus_tag="ROP_pROB02-01390"
                     /product="aldehyde dehydrogenase"
                     /protein_id="BAH47152.1"
                     /transl_table=11
                     /translation="MTIDGTLAKSATEFDVVNPATGQVFATAPDCTREQLDQVMDTAH
                     RAWLEWRTDEGARRKALLEAAEVLGSAANELAALVTAEQGKPLSEAAEEVRDAQTWFR
                     YYADVEDQPQIIQDDAIAYVEVVRKPLGVVAAITPWNFPITLAAWKLAPALRAGNTVV
                     LKPSPYTPMATLRLGQLLSGVFPPGVVSVVSGGDELGQWVTSHNVPRKISFTGSVRTG
                     MRVAATAATDLKRFTLELGGNDAAILLDDVDAASIVEKLFWAAFENNGQVCSAIKRIY
                     APASIYDEVVESLASYARSVKVGDGAVEGTRLGPINNRPQLERVRHLVDEALRQGARS
                     ATGGKLIEGPGYFYEPTILADACDGMAIVDDEQFGPALPVVRYDNLDTVIEQVNSSNF
                     GLCGSVWSSDLDRASAVAPRIDSGTVFANTHLALQPNQPFGGSKWSGIGVENGIAGLH
                     GFSEPQVFHRPARSVG"
     CDS             150331..151497
                     /codon_start=1
                     /EC_number="2.3.1.-"
                     /locus_tag="ROP_pROB02-01400"
                     /note="protein synonym:acyl-CoA thiolase"
                     /product="putative acetyl-CoA acyltransferase"
                     /protein_id="BAH47153.1"
                     /transl_table=11
                     /translation="MRSAVIVDVVRTPSGKGKPGGQLSHLHPVNIYADVLNSMIERTG
                     LDPRLVDDVITGCVSQVSEQSSNIARSAVLAAGWPEHVPGTTIDRQCGSSQQALHFAA
                     QGVMAGAYDIVVAGGVELMSRVPMFSPVQGSDPYGDRLTARYNDALVNQGVSAELVAG
                     KWDLSRRQLDEYAAESHRRAAAAASDGGFHNEIIPVGTATHDETVRGNTTSESLAGLK
                     ASFATPETRTRFPDMDWRITPGNSSPLTDGASAALIMGEDTAKSLGLRPRARFHSFAV
                     VGDDPIFMLTAPIPATQKVLNKAGLTISDIDAFEVNEAFASVPLAWLKETGADPAKLN
                     PRGGAIALGHPLGASGTRLMSTMLNYLESTGGRFGLQTMCEAAGMANATVIERI"
     CDS             151565..152254
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01410"
                     /product="putative nitroreductase"
                     /protein_id="BAH47154.1"
                     /transl_table=11
                     /translation="MSTTDVNRAAVLRELMVDRWSCRSYLDKPVTDDVLDELLTMAQR
                     SPSWCNSQPWHVTVIRGDRLDDMRERFVRHAESHTEAPDLPFPLRYEGVYRERRRECG
                     WQLYDSVGIQKGDREASQKQAMENFRFFGAPALAIITTEADLGTYGAIDCGVYIGNFL
                     LAAQSLGLATIPQAALASHSGFLRGELQLPDHRKVVAGVSFGYADENHPANGFRTHRA
                     DIGESSTRVGS"
     CDS             152289..152624
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01420"
                     /product="hypothetical protein"
                     /protein_id="BAH47155.1"
                     /transl_table=11
                     /translation="MSYKIVAFLAKREGLSMEDFVDYYENRHVPLVLGLPETPNSYVR
                     NYIEPSGDDIEFDVISELRFDDEGAYKRWIAAMFAPNSGIPEDEDQFLDRRRTRSHVV
                     RECPISSVQ"
     CDS             153496..153756
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01430"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH47156.1"
                     /transl_table=11
                     /translation="MTAAHAVSIAVTFTWLGMVVISFIEAPLKFPYARVTVRLVLEIG
                     RLGFRALNVTEIVWAALLIAGLVAGDEVPFSRALRLLWSENR"
     CDS             complement(154426..155430)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01440"
                     /product="putative dipeptide epimerase"
                     /protein_id="BAH47157.1"
                     /transl_table=11
                     /translation="MKGRVAVRTVDAIPQTFAINGIFRISRGSKTSAQVIAVSIAESG
                     YIGRGECVPYARYGETIESVMDQIRSMTPAIEAGMDLSELQSAMAPGAARNAVDCALW
                     DLRAQKTRQSLASVIELGHELQPVLTAFTISLDAPAAMGKAAAVHEHLPILKLKLGGD
                     GDLERVRAVRAAAPHARLMVDANEAWSIDHLRAFAPEFAAMGVELIEQPLPADADDFL
                     KSFNSPVPLAADESCRTLMSLSKIVGKYEIANIKLDKAGGLTEALSLQAAARASGLGT
                     MVGCMVATSLSMAPGIILAQRADVVHLDGPLLLAEDRTPSLRYSGATLYPPEPEVWGG
                     "
     CDS             complement(155430..156767)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01450"
                     /product="putative MFS transporter"
                     /protein_id="BAH47158.1"
                     /transl_table=11
                     /translation="MSASAHTSQQEKVEGETSASSPRRAITAAAIGNFAEWYDFAVYG
                     VVASIMALHFFPSSDPVVGLISAYVVFGLTYVSRPIGGLIAGWLGDTLGRRRALSFTI
                     LLMCAGTALIGFIPSYNAIGVLAPILLTLCRLVQGLGTGGEYSSAISFVYEHSQARAR
                     PIRISYLVTTTFLGITSAVLIASLCTTVLGDEAFEDWGWRVLFWLAAPLGLAGMYLRR
                     KVSETPQFKQLAADRETSEVKAAPIRSTFRTQATAMILFFCIVSSYALITPILSSYFI
                     TFIQLSGGLTSGQSYNVSLAINVVMIATTLAAGRVMFRYGLQRTFIVGGLFIAVVSVP
                     AFAISTLGIVGALIGGSLLSIGKGLVAVAAAMAMSYMFPAKVRVTAGAFAYNVCTILF
                     GAAGPSLGIWLNSVTGSNITFSVYLAIVGALSAIAAIIGRQRLKEPADELVTA"
     CDS             157229..158155
                     /codon_start=1
                     /EC_number="2.8.3.-"
                     /locus_tag="ROP_pROB02-01460"
                     /product="putative CoA-transferase alpha subunit"
                     /protein_id="BAH47159.1"
                     /transl_table=11
                     /translation="MVNDQASRSEASAPTRTSKLHSLQSAVELIKDGDFIALGGLWFQ
                     NNPSAAARELVRAGKKGLRLVAAPPASYAVDLLLGAGCVKSAHLAHVSFEHLGMAPNF
                     RRVVEQELTKVFDCDEATILGGLMATLEDLPYHPVPSVKGTDIIDGCAQTSTRLVAGL
                     GTVVSAPAIRPDVCLLHVQEADAYGNVRYHGTPFCDPLFAKASTTVIVTADVIVNNDV
                     IRAEPHRTVIPGYLVDAVVEAPYGAHPCASQGHYPHDEPHLLEYIASGASAHRWNDEY
                     LGPFVHQPANLDDYIELVGGAARIDQLTDTVR"
     CDS             158152..158919
                     /codon_start=1
                     /EC_number="2.8.3.-"
                     /locus_tag="ROP_pROB02-01470"
                     /product="putative CoA-transferase beta subunit"
                     /protein_id="BAH47160.1"
                     /transl_table=11
                     /translation="MIDSYSTDELMTVLMARELHNGDLAVTGATSLVPVAACLLAQQL
                     HAPDLTLIMPSGLVNPRPGRLYRSASDGRWVKCAEAVGTGYDLFEMSENGRLDVMFYG
                     GIQIDKHGNINLTKTGLSQGSPPKFRGPGLANTSFAVVSKRIILFSRSHTSRTFVEEV
                     DFVTASGHLSGGSSRAESGITTEGPVVCITPLATFSFDETKAMQVRSIHPGVNPEDVA
                     NNTGFNLRQGNWDTTRAPTVNELTTLRQCVDTTGELR"
     CDS             158957..160192
                     /codon_start=1
                     /EC_number="2.8.3.-"
                     /locus_tag="ROP_pROB02-01480"
                     /product="putative CoA-transferase"
                     /protein_id="BAH47161.1"
                     /transl_table=11
                     /translation="MNYSNTALKGLRIVDFSRVVAGPFSTMILGDMGAEVIKIERPGT
                     GDDSRGWGPPFLGEVSSYFMGLNRNKKSVAIDLGTPEGASIARELVRSADVVVESFRP
                     GVMKRLGLDYETLRLTNPSLIYCAISAFGQDGPYHERPGYDLMVSALGGLMSVTGPPQ
                     GEPVKVGVAVIDVCTGLHAALGVLSALHHRTVTGEGQRVDVSLLSTELAMLINTASEY
                     LIGGSVAKPQGSAHANVVPYQAFPTEDGWVLLGSPNDKLFRVLAAALGRPEWGTDPRF
                     ITNGERVKHRDEIVAQISAITCTQTTAHWVELLSSTGAPVAPINRMDAVFEDPQVRHL
                     DQVAEVDHPMFGKHKVVTSALRLSATPPIVGDAAPRLGEHTKQVLTELGITNDRIDEL
                     VDHCVVEFRPADEEFTLVD"
     CDS             160241..161470
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01490"
                     /product="CaiB/BaiF family protein"
                     /protein_id="BAH47162.1"
                     /transl_table=11
                     /translation="MAQPSIPFHRGPLTGLRIVDMTTSYAGPTAAMYLADLGADVIKV
                     ERPGHGDEARMWGPPFVTHASAWFASANRNKRSVVLDIRHNEGLDALYSLIGNSDVFL
                     QNLNPAKLRKLKLHPEVLRTRFPRLIYCAISGFGLDGPDAELPGYDLAAQARSGLMSV
                     TGALGGSPQRVSTALSDIVTGMCAALAVSAAAVRQRTDGVGDTIDVSLLDSDLALMAP
                     RIAAYCAGGTEPVPSGGTDSVLAVYQTFRTEDRDIAIAIGNDSMWTRFCRAIGEPDLG
                     TDQAFGTNADRRRHRGQLTQLIERRLIERPASEWLTILAQSGVPCSLVQFLSEVVADR
                     QVIARSSLMPVPESARQMVSVRSPFRLASIPNPRNDRFPEHGAHTEEVLLESGLSPER
                     VAQLLVSGAVSQLEQKE"
     CDS             161475..162299
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01500"
                     /product="enoyl-CoA hydratase/isomerase family protein"
                     /protein_id="BAH47163.1"
                     /transl_table=11
                     /translation="MSTANELQVSTHGPITVVTISRPTVHNALNSALIQQLAAEVRDR
                     SEDGHTRAIVITGLGDKAFSAGADLNELATLDANAAYEVMRAGQTAFRLIERSRIPVI
                     AAVNGIALGGGFELVLACSFSIVSRNASMGLPESGLGLIPGYGGTQRLQRRIGPSTAR
                     FVMLTGRRVDANRAYQIGLTPFPPTDPELLMPVALEVAEEIAHRGPVATETILGLVDQ
                     GYELALDAALALETHHAALAIGGNESTVGIQAFHDRQRPQFAALATTTTTSDDRRN"
     CDS             162301..163179
                     /codon_start=1
                     /EC_number="1.1.1.35"
                     /locus_tag="ROP_pROB02-01510"
                     /product="3-hydroxyacyl-CoA dehydrogenase"
                     /protein_id="BAH47164.1"
                     /transl_table=11
                     /translation="MNLIQSPVAVIGAGTMGSGIATVAARGGYDTVVYDVSEQGLTRG
                     LDTIRSFFEKSRDLGKLTAEEASAANARVRGTTDITDLATAGVVIEAVFEDLAVKKEL
                     MGQVESIVAADTLLHTNTSTLSVTAIASGLKHPDRLVGTHYCNPAPLLSLVEVADGRH
                     TATSARETCIEFLRSVGKTTVVTKDRPGFIVNRFLIPWENSCIQALDSGLGTIESIDT
                     AVTGALGHPMGPFRLLDIVGLDIHQQVATRLYEQLRDPRFFPPPMVERMVSAGNLGRK
                     TGRGFYEYDNTRLFGS"
     CDS             163228..164091
                     /codon_start=1
                     /EC_number="1.1.1.35"
                     /locus_tag="ROP_pROB02-01520"
                     /product="3-hydroxyacyl-CoA dehydrogenase"
                     /protein_id="BAH47165.1"
                     /transl_table=11
                     /translation="MSELQNVAVMGYGTMGAGIAQLIAQSGRTVRILEAEQDRLDAGR
                     RSVEEFTATGVRRGKLSEDQREQLLGRLHGTTQVSDLSDCDLVIEAVTERKDVKQDLF
                     EAVSEHVPTTTLIVTNTSALSITELARSVEAPERFAGLHFFNPAPLMSVVEVVHALQT
                     SDTAVTALSEFVTSLGKAPVVVKDRPGFLVNFLLMPYLNDVVQAYDDALATAEDIDTA
                     LKLGLGYKLGPLELLDMIGLDVHNHATHSAYEATLDPRFAPPPLLRQMVAAGRHGTKT
                     TSGFRTQDGTY"
     CDS             164091..164873
                     /codon_start=1
                     /EC_number="4.1.3.36"
                     /locus_tag="ROP_pROB02-01530"
                     /product="putative naphthoate synthase"
                     /protein_id="BAH47166.1"
                     /transl_table=11
                     /translation="MSAEYDDIQIKHNGAVLTITIDRQESGNKLRAQTCNELIDALQR
                     FRLDPALQAAVLTGAGEKFFCIGGEHDELTRLDQSAVIPIIDVYQSIDTIGKPIIAAV
                     NGFAVGGGNVLHTVCDLTIASESAVFRQVGPMVGSFDAGYGTWYLEDTIGRKRAKEMW
                     YLNKKYSAAQALSIGLVNEVVPIDQLQSRAREVAQDISHRSPLAIGALKGAFSARHNG
                     VSGQARLAHDQLLTLYLATDEAHEVATSFAERRQPDAKTFWT"
     CDS             165731..166522
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01540"
                     /product="putative IclR family transcriptional regulator"
                     /protein_id="BAH47167.1"
                     /transl_table=11
                     /translation="MAKQSTGQTLRSAERMLDVLEAFSLHQPALTAAEVSEQLELAPS
                     TVRRLLNVLEQHGFVRVDPMTGQFAPHYQVVRLAAVALEGNDLISNARVPLDLLHDRT
                     QEAAQLVVLSDHDIVFVDRRESSSLIKIFSAIGQRYPAWDGRASGKVLLAWLPEDDVS
                     AMLPAPEDWAQAGPNAAPTPQTYLEGLAKVRAQGYAVNDEETDRDVWAVAAPVRDHTG
                     RVVAAINVPVLKTRATDPNRVAELIDATTTAAASVSEGLKFFFSH"
     CDS             complement(166531..167982)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01550"
                     /product="hypothetical protein"
                     /protein_id="BAH47168.1"
                     /transl_table=11
                     /translation="MSISVPDRWAVGEESVPDPRVDLVSFREEFYRCLPSRGDALFEL
                     TDALLCSGTAVRTLVELSLAAEHRRGHGALYDAINCGRVDFTRLRRYLGGLTIPCDRG
                     GRIVLAVDVSAWLRPDAPTSPQRGFCHVYGRGKNQAQLIPGWPYSFVAALETGRTSWT
                     SVLDAVRLRPDDDETAVTATQVREVITRLREAGHHRDGDPDILLVFDAGYELARLAFV
                     LADLPVQVLGRMRSDRVLCFPAPPPGRTGRPPRHGPEFRFADPITWPAPETTSSTETD
                     RYGTASASAWNRLHPRLVHRGSWAQHPGPPPIVEGTVIRLTVDHLPGDRHPTPVWLWC
                     SDPGVSADDLDRLWQLFLRRFDLEHTFRFFKQTLGWTAPRLRSPEAADRWTWIVLVAY
                     AQLRLARPLAEDLRRPWERPVPPTRLTPARVRRGFSRTRATMPVPASAPKPSRPGPGR
                     PPGSKNTHRAPHHHVGKRAETKARKPVGAACPG"
     CDS             complement(168145..168999)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01560"
                     /product="putative transposase"
                     /protein_id="BAH47169.1"
                     /transl_table=11
                     /translation="MIRSVVARRKRRKRTPYPSDLTDAQWELIAPMVPAALPGGRPAI
                     HDRRRIVEAILYVNRTGCSWRQLPHDFPPWQTVFGYFQRWNESGVTDRIHDALRAKLR
                     DRSGRDPMASAGMVDAQAVKGADTVGTETRGWDGGKRVHGRKRHVVTDSLGLLVVVLV
                     TAASVQDRDGGRLALSRAKTVMPSMVWADGGYAGRLVAWVAEHCRMTLDIVRKPKGKL
                     GFSVLPHRWLIERTLAWIVRCRRLDHDYERLPAHSEAMIKWAMIGLMTRRLAPARGRH
                     PWQSTRAA"
     CDS             169614..169961
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01570"
                     /product="hypothetical protein"
                     /protein_id="BAH47170.1"
                     /transl_table=11
                     /translation="MCSRPRIPRHHLHAVITAAHCFGQLANEFDDSAPGILQFRCQAL
                     FLHRPCGAVSALHGRASQSHKHSEAFMRSADNSYRTVSTPPPRQCPRSGNMEQVRRSI
                     GPAGSVVFPDVRR"
     CDS             170140..171522
                     /codon_start=1
                     /EC_number="1.14.12.3"
                     /gene="bnzA1"
                     /locus_tag="ROP_pROB02-01580"
                     /product="benzene dioxygenase large subunit"
                     /protein_id="BAD95523.1"
                     /transl_table=11
                     /translation="MTDVQCEPALAGRKPKWADADIAELVDERTGRLDPRIYTDEALY
                     EQELERIFGRSWLLMGHETQIPKAGDFMTNYMGEDPVMVVRQKNGEIRVFLNQCRHRG
                     MRICRADGGNAKSFTCSYHGWAYDTGGNLVSVPFEEQAFPGLRKEDWGPLQARVETYK
                     GLIFANWDADAPDLDTYLGEAKFYMDHMLDRTEAGTEAIPGIQKWVIPCNWKFAAEQF
                     CSDMYHAGTTSHLSGILAGLPDGVDLSELAPPTEGIQYRATWGGHGSGFYIGDPNLLL
                     AIMGPKVTEYWTQGTAAEKASERLGSTERGQQLMAQHMTIFPTCSFLPGINTIRAWHP
                     RGPNEIEVWAFTVVDADAPEEMKEEYRQQTLRTFSAGGVFEQDDGENWVEIQQVLRGH
                     KARSRPFNAEMGLGQTDTDNPDYPGTISYVYSEEAARGLYTQWVRMMTSPDWAALDAT
                     RPAVSESTHT"
     CDS             171604..172167
                     /codon_start=1
                     /EC_number="1.14.12.3"
                     /gene="bnzA2"
                     /locus_tag="ROP_pROB02-01590"
                     /product="benzene dioxygenase small subunit"
                     /protein_id="BAD95524.2"
                     /transl_table=11
                     /translation="MIDAESPTTAFRTKPAPVDPSLQHEIEQFYYWEAKLLNDRRFQE
                     WFDLLAEDIHYFMPIRTTRIMREAEQEYSGAHEYAHFDDNAQMMRGRLRKITSDVSWS
                     ENPASRTRHVISNVMIVDGDNPGEYHVSNVFIVYRNRLERQLDIFAGERKDILRRTGS
                     EAGFELAKRTILIDQSTILANNLSFFF"
     CDS             172176..172499
                     /codon_start=1
                     /gene="bnzA3"
                     /locus_tag="ROP_pROB02-01600"
                     /product="benzene dioxygenase ferredoxin subunit"
                     /protein_id="BAD95525.1"
                     /transl_table=11
                     /translation="MALTKICSSGDLAPGEMLRFEEGPEPILVCNVGGEFFATQDTCS
                     HADWALSDGYLKDDVVECTLHWAKFCVRTGKAKALPACLPLRTFVVKLEGDDVLVDLE
                     GGVTT"
     CDS             172496..173734
                     /codon_start=1
                     /gene="bnzA4"
                     /locus_tag="ROP_pROB02-01610"
                     /product="benzene dioxygenase ferredoxin reductase
                     subunit"
                     /protein_id="BAD95526.2"
                     /transl_table=11
                     /translation="MTSDIVVIGGGVAGVSAVQSLRSEGYDGRLFLIGKERELPYDRT
                     SLSKAVLAGDLADPPPLSPADWYDELQVETVLDRTVLQVDVTRKEVLLDGGRSLEVDR
                     VLLATGASARVPSFSGADLPGVTTLRTVDDAQRLRQDWEPGQRLVVVGGGLIGCEVAT
                     TARKLGLEVSILEASDELLQRVLGRRIGGWCRARLEELGISVMVNTGVAEFDGVDRIT
                     AVIGTDGRRFPADSAIVCVGAEPETAIAEQAGLACSRGIIVNDSGGTAAEGVFAAGDA
                     ASWPLRTGGRRSLETYINSQKEATAVASAMLGKAVHAPQLPLSWTEIAGHRIQMIGDI
                     EGSGEYVMRGAPDDGPALLFRLTDGKLTAALSVDAPREFAMATRLVESGAQVGRDVLA
                     DTSVELRELNRAARERTTAA"
     CDS             174060..175013
                     /codon_start=1
                     /EC_number="1.13.11.2"
                     /gene="bnzC"
                     /locus_tag="ROP_pROB02-01620"
                     /product="catechol 2,3-dioxygenase"
                     /protein_id="BAD95527.2"
                     /transl_table=11
                     /translation="MSVQRLGYMGFEVADVPAWRAFMTEKLGAMEASSSENSARFRID
                     SRSWRLMVEKGPSDDISLSGYEVESEDSLLAIKKRLEAHGIEVTTESGELADDRGVLG
                     LISCTDTANTRVEIYYGATELFEKPFISPTGVSGFTTGDQGFGHYVLAVPDIDAALDF
                     YVKGLGFHLSDIIDWKLNDELTVKLHFLHCNGRHHTLALAGLPGAKKTHHFMLETKHM
                     DDVGLAYDKFDADGTVVMTLGRHTNDHMLSFYGATPSGFAVEYGWGARQVEPGWSVVR
                     YDKISIWGHKFVAERDRQVSSNAIEDELIDIDATLSAPAQA"
     CDS             175051..175863
                     /codon_start=1
                     /EC_number="1.3.1.-"
                     /gene="bnzB"
                     /locus_tag="ROP_pROB02-01630"
                     /note="protein synonym:1,2-dihydrobenzene-1,2-diol
                     dehydrogenase"
                     /product="benzene glycol dehydrogenase"
                     /protein_id="BAD95528.1"
                     /transl_table=11
                     /translation="MGWLEDNVMIVTGGGSGLGRALVERFLGEGARVGVLEKSAEKAE
                     KLANDFGEDVLVVEGDVRKYDDNARVVQETVRQFGRLDTFVANAAIWDFSTKMVDIPV
                     DRLDALFDEMFHINVKGYLHGARAAVEELAATGGSIIYTVSNAGFYPGGGGPLYTASK
                     HAVVGLIKELAFELGPKIRVNGVAPGAMPTDLRGPGSLGMGETTITSVPLGDLVKQCT
                     VLQELPEAADYTGHYVLLASKANSRTATGAIINCDGGMGVRGLAETAGGNDL"
     CDS             176076..176309
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01640"
                     /product="hypothetical protein"
                     /protein_id="BAH47171.1"
                     /transl_table=11
                     /translation="MPTRTTRHPANSCSPVNSENWRRMLVTGELTVNIALVTKQISVK
                     GKMGPLLKDIPQFKYIIVKLSELGPRALDQEAT"
     CDS             176490..181268
                     /codon_start=1
                     /EC_number="2.7.13.-"
                     /locus_tag="ROP_pROB02-01650"
                     /product="two-component histidine kinase"
                     /protein_id="BAH47172.1"
                     /transl_table=11
                     /translation="MEIDTVRVLRQSPGITTTLALSGETRERVVVRRVDLSMTFPWSW
                     HWLEGELEAMRRARLPHVIPTQIAHKGPDHVDLVRPFIAGLDIREWSAQESPQSLDVQ
                     LQLMCNLFYALARLHRMGIAHGGVKPANIMLAEGTNQLVLLDASVTRTQLAAVTHPVE
                     GPEGRYLLPESPGLAHPAAGFTADIFAAGWVLLESTAEGNRTASALRRANPRIGTHAE
                     LSHLVDIVGLPATLRPIFLKLLSPRAAIRYESADEVLAALEAVVATGGGESALASAVA
                     PPRQCGSLAYVEPPLVGRHDELATLTACADGASRSSGAVTCLSGESGVGKSRLLDAVA
                     THASTAGVTVMRAGAFDHAAARPLGLFAGPFRDVVAYLTAHPREAERVRGEMGELLPA
                     ALEQIPELTAAFGDPPAAKNSDSGFGDHAVAAAPTAVARLLRSVFTKEQPGLIVVDDC
                     QWADDLSWQVLAKLASTIAMEETRSQSNVSLICSCRTEAVAQVRAWEISDIEFLDLQP
                     LSAADTEELIRSIGDRIPDEIIPYVTKYSKGNPLETMLVFQALVDSSALTRESGRWVM
                     DENGMASLPLPSQSRDSDAASGRDSVLVSSRLSLLSPDTQQAIRQGAVLGRRFSSRLL
                     YAALAASPTDVDQLLLEATQHGIVRGIADGGHAEFEFTHDRLREAVLRTLTDDARREL
                     HLRAAQALEGVPAVRADYDIAYHFDRSGRAASAVPYALRAGEAGLRHNALDVAEGNFK
                     IAETGLALCESADDTARFRVHEGLGTVHMLLGNYDLAAKELAWAYELTRARSGLDSSR
                     VATLLGELAFKTGRFDDAAEWMRQSMHDIGLRLPRSSILAAVFAVGEVGLLTLGWLSR
                     RIRPGRAGTERDRLAARIHNRLLYEWWFVRSPIWLVLAILRGVRFANAAGSTRERAQA
                     YSTAAVISGVAPVLAPLALRLADRSLRLRQTAGEGWGIAQSHHFRGFVLYAANRYDEA
                     IAAFDTAIAAFDTVGDRWEQVAAMWQKALCLARQGKLHDAGVLARDTYWEGKRRGDRI
                     GAGTALAIWVSCLPGEVSMETISRELRQTNSGDRHTMAMLHAARAWRLFHAEQDVQAV
                     DAFRQADELIRGSGIRNHFLAPILTAHLQVLRLSHDAAPAWWTEERRLQATAARRQLT
                     RARWSAIVFWGERPAVLREWALMSFSRGHKWRGRMILAAASRSAFRYSAQGELAACAL
                     VATLVGLTPRRGPLSALAPVTELCRPLGIRVDRGIVESAHSRDALVGRGSARHQALLD
                     AVSSIVASEDIDEVLDKLRDATFATTTARRVEISRHTPVSVDAIRVPNASPASMLGDS
                     GAAGEAREMKLTERIIKPVVGNDVTETAVVAAFPLGESEHHGPTMEVLAALAGAVIER
                     EGLRRASMERIVEVQEAERGRIARDLHDEFGHLFAGVMDGLSALQNSEDATTRQTATD
                     VRTIVRQGIQVARTVAWSLRPSGLDDLGLTGCIEQYVEDCRQMYPIRIELTATGQPIS
                     VPPAVTTAVFRIVQEALTNIGRHSRAGEASVMIVSSADTLRAVVEDNGTGFDLDLVGQ
                     RRSLGLIGMRERARLVGGRMSVESRPGQGTTIMVEVPIRR"
     CDS             181265..181894
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01660"
                     /product="two-component response regulator"
                     /protein_id="BAH47173.1"
                     /transl_table=11
                     /translation="MISVVVCDDHGIIRSGIQRILETTTDFHLVTSAPTGELLLQAVR
                     DFAPELVVLDIRLSDCNGLDLLEQISAISPETRVVMLSMYGARGYVEKAKTRGARGYI
                     TKECLDEELVSVLYAVMKDEGFVSFRADTTEPGGSEGLLEANIDSLSSRELEVMKLIA
                     SGLTNTEIAEELTVSPRTVESHRASIQRKLLIRTRAELARVARDAGLLD"
     CDS             181941..182318
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01670"
                     /product="putative transposase orfA for insertion
                     sequence element"
                     /protein_id="BAH47174.1"
                     /transl_table=11
                     /translation="MLRADEIPDDLWAVIEPVLPALAGRRGRPWNDHRLTLEGIAWRF
                     RTGSPWRDLPEYFGPWQSIWERHRRWSDDGTYIRMFAAVRAAAPEREEQLERLLSIDS
                     TIVRAHQHSAGALTDAHTGGSVE"
     CDS             182290..182817
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01680"
                     /product="putative transposase orfB for insertion
                     sequence element"
                     /protein_id="BAH47175.1"
                     /transl_table=11
                     /translation="MRTQGARSNDKNLANEPADHALGRSRGGLSTKIHALTDTFCCPL
                     TLLLSPGQAGDNPYLAPLLDAHRAHDTAAFRLLADKAYSHPSTRKNLRERRISHTIPE
                     RCDQIRRRKTKGSDGGRPPAFDKDRYRERNAVERGFGRLKQWRGIATRYDKYATTFLG
                     GVLFAALVIHHRVRK"
     CDS             complement(182859..184397)
                     /codon_start=1
                     /EC_number="6.2.1.-"
                     /locus_tag="ROP_pROB02-01690"
                     /note="protein synonym:acyl-CoA synthetase"
                     /product="putative fatty-acid--CoA ligase"
                     /protein_id="BAH47176.1"
                     /transl_table=11
                     /translation="MHIPFTVTDFLERGAAGFPDSVAVIDEPEQPGESVGQVTFRELA
                     HRVCAWQAGFDRLGIRVGERVAVVSHNSARLLELLYAVPASGRICVPINFRLSPAEVD
                     YIVGDCGASVLLVDPELEEALSGIKVRHRFVLGKHTDADLMRFDTEPAPWASPTEEST
                     ATINYTSGTTARPKGVEMTHRNLWVNAVTLAMHTRAWERDVYMHTLPMFHCNGWGMPF
                     GMAGLGAKQIVLRKVDGTEILRRVEEHGVTLMCGAPAVWNAVLDAARSWHGEIPGRDR
                     VRVVCAGAPPPSRTIARLSSELGWELQQIYGLTETSPLLTFNRSLPADDGLDLEERAH
                     RLTRAGLPALGARLHISNSGEVLARSNVVMNGYWNNPEATDEALRDGWFHTGDGGMID
                     GEGQLTISDRKKDVIVTGGENVSSIEVEECIFSHPGVTQVAVIGVPDEKWGETVKALV
                     VTTGPSTVSEAEIIAHCKQHLAGYKAPTSVEFRDSIPHTATGKIQKFKLRAPYWEGST
                     RGVN"
     CDS             184611..185240
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01700"
                     /product="enoyl-CoA hydratase/isomerase family protein"
                     /protein_id="BAH47177.1"
                     /transl_table=11
                     /translation="MVLPNLVAAEEDTYSRVLCDQHDGVLRVTLNRTTALNAINATMA
                     KRLQQLWSLVRDDASIHSIIVSAAGVEAFCMGFDAEDPPQPLSCGGNALGWEAFAISP
                     KECGVDKHLIVTVNGIACRESFRFLRDADVVVASSNASFFEPPRFTPADDVSNREGGL
                     PAGLRTICATNPTVHNPVTALQAHHAGLVHEVVPLASLRGTAERLAHRA"
     CDS             185302..185493
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01710"
                     /product="hypothetical protein"
                     /protein_id="BAH47178.1"
                     /transl_table=11
                     /translation="MTVTTIGSSSHTIDVDGITTHYHKAGPGDPVLLLHGPWTGGVSL
                     GELAAHDPATRRQPSRFGP"
     CDS             complement(185539..186042)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01720"
                     /product="hypothetical protein"
                     /protein_id="BAH47179.1"
                     /transl_table=11
                     /translation="MSWTSRDSQISETVKPSPQEMRSRRWEQTLSRPIAPTTISTPVI
                     TNAQFITACWALNSVVYSIFHDRSAVKQAWRYLSDNVLCGPACANRPVGVSSRSAVPA
                     MSLSTSEMYLPSAATPARVRRVVKIRSSMTWTSQYVPAVGRIDCKLHGQNVIARGYAG
                     SSVARCR"
     CDS             186172..186969
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01730"
                     /product="hypothetical protein"
                     /protein_id="BAH47180.1"
                     /transl_table=11
                     /translation="MSIALTHAAEVQQSGVNGRISLERNHKRIRVFFAGHVIADTTRA
                     VYLFEKGHLPVYYIPRDDVRTDSLEPLDATTWCPWKGKARYWDLVVDDRRAERSLWGY
                     DEPLKDSLDLSWYVAFYWHKMDAWYEEDQQVFVHPRDPYFRVDVLPSSRHVEVFIGDT
                     LVADTTHPRLLFETSLPVRYYIPRIDVRSEFFTGSDAKTSCPYKGTASYLSFTGSDDS
                     DPVEDAAWYYPFTTAEASGIGDHVSFYPDGARIVVDGAPVEGCPTPL"
     CDS             187429..187845
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01740"
                     /product="hypothetical protein"
                     /protein_id="BAH47181.1"
                     /transl_table=11
                     /translation="MTRPRVRAADSAGERPTPSYELVTSTEILGKMAMEEMLAGLSTR
                     RYTAGLEPVGRRAAETFSATSKSAVSRRFVKLTEAALTELLAADLSGLDLVALMIDGV
                     HYAESCCIVALGIDIDGDKHPLALVESSTENATLVA"
     CDS             187958..188248
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01750"
                     /product="hypothetical protein"
                     /protein_id="BAH47182.1"
                     /transl_table=11
                     /translation="MADTNHADSALEAEAALPALAKELDRTHLAAAASLREGRDGTLT
                     VLRLGVPPTLARTLRSTNATVMYRSHEGQVELFSTHRSRLLRELKRFHLAGT"
     CDS             complement(188151..189134)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01760"
                     /product="putative oxidoreductase"
                     /protein_id="BAH47183.1"
                     /transl_table=11
                     /translation="MRAATYHKSGEASDVLSIIQCEKPEPGPGQVLVRVSFSAVNPSD
                     VKTRSGKTPRPIDDFQIPHMDGCGRIVAVGPGVHEGRIGQRVWLWLAALGSRWGTAAE
                     YTLVPANQAVALPDSASDELGACLGIPAMTAHECLLHAGPVTHKKVLIAGGAGAVGHF
                     AIELARWAGATVIATVSTPDKAKLARQAGADFVVNYRDDDVADQITAFTNGVDIFVEV
                     AIVDNWNIDLAVAAPGASIATYATDGRELSIPIRECMAAGLGLRFFLLYTHSRSALSL
                     AAQSITDALAEQALTPLPHLTFPLDEIALAHEAVENGESRKVLLDLRDSDT"
     CDS             complement(189358..189621)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01770"
                     /note="fragment"
                     /product="putative transposase"
                     /protein_id="BAH47184.1"
                     /transl_table=11
                     /translation="MRDRVATVAVMLESQFPTVAAMLNECKGGDHGVRGPPGGTLAQD
                     MVDQIIERLNKEVKRRTDVVGIFPNPAALLRLARCVLIEAHDE"
     CDS             189861..190685
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01780"
                     /product="putative 2-hydroxy-6-oxo-7-methylocta-2,4-
                     dienoate hydrolase"
                     /protein_id="BAH47185.1"
                     /transl_table=11
                     /translation="MSTEVPPEDNSIVANGIRTNYLEAGSGPPVVLIHGSGPGVTAYA
                     NWRLTIPALAERFRVLAPDMVGFGGTERPPGVVYDLKTWADQVVGFLDAHGIERASLV
                     GNSFGGAIALRVATQHPERVGRLALMGSAGVSFPLTDGLDAAWGYQPSIENMRRLLDI
                     FAYSRELVTDELAEVRYRASIEPGIQEAFSTMFPEPRQNGVDALVTPEEDLARLPHET
                     LVIHGREDRVVPLSSSIRLMEVIPKAQLHVFGRSGHWTQIEWAEKFNQLLNDFLAN"
     CDS             complement(190768..190929)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01790"
                     /product="hypothetical protein"
                     /protein_id="BAH47186.1"
                     /transl_table=11
                     /translation="MIGYTVPEIRRLLVYLILRHAHPDEHTWSWSHWRRRRQHQARTS
                     HYRTRGHLP"
     CDS             complement(190926..191003)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01800"
                     /note="fragment"
                     /product="putative transposase"
                     /protein_id="BAH47187.1"
                     /transl_table=11
                     /translation="MLALAWLAGTKTEAIKGESEPMIRT"
     CDS             complement(190958..191695)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01810"
                     /product="putative transposase"
                     /protein_id="BAH47188.1"
                     /transl_table=11
                     /translation="MENCQIGVFLAYASGAGHALIDRELYLPESWTSDRDRCRAAGIG
                     DEVKFATKPVLAQHMIERALDAQVPFSWATADEAYGQVKYLRVWLEERDISYVLATRL
                     GGDVFTPDGRAGRADEMIAAIPPKQWRRISAGDGAHGRREYSWVRIPIRIAWAPGRGH
                     WLLARRSLSDPTEIAYYICAGPRRTTLTELATVAGSRWRVEECFQQAKNEAGLDQSRY
                     APTGPGTPTSPCRCSPSPGSQARKPKP"
     CDS             191712..193505
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01820"
                     /product="hypothetical protein"
                     /protein_id="BAH47189.1"
                     /transl_table=11
                     /translation="MSGGELAARVYELAAAPDPRNESTPAVIARHADALETYLRLTLS
                     EYGSKNRLFILFEDIKQPQPRRYAQAMVRAIATAFDHWELDDNLVESIQVLTGARAPR
                     PGAVHDDHTTQTAHQQTIDIALDAAWATATIELARVLRASSARDTLMHIGRARTALAP
                     ITGNEDAIDAIVLDSTLKILSDFLTGVTESSTGEWPIEPSAVAELEHLVTRYRIGAHG
                     LHHWVGDRKQSVLTGWGRLAQDLLFLRTHLERASIYRAAVVLDDILDIYTASRAVEVV
                     ARESDLDGVRRMLQPPIVGSFAARAGLLRNLEDHVDELQKCVDNPQSNSHGRAGEVLP
                     VARIVLEAARDQVAKHEPPGKTVGASAPLPPPLADLFGGGNVPNAIAELDPEILKTLA
                     IGITDARDSRGPFQHVAISAVCERIKDNLSASPDYKGDIKDKVDYVLELLVRFLHSRI
                     NIEKKYKPYLYKPNASENDLHLDLFDYLVGSGLAGFAQIELTNVAGGRADIQVGFGAF
                     HIYLELKADATKARQAAKTAYIQQTVSYQGGDIRIGFLIILRLGDGKGAPPHLSDLVT
                     HTTTTIAGSAHPRHVVIVELPGNRTVPSNMK"
     CDS             193607..194065
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01830"
                     /product="hypothetical protein"
                     /protein_id="BAH47190.1"
                     /transl_table=11
                     /translation="MWQATSTVLAVLGTYPWRLRSLRVLTTADFDRLTDALDLPPLGE
                     ILTADEIARFVVRVAYPTCPVVLVDEELALIAPARAYGDWLGALGLPDLAGKARTRLP
                     RNDRIRRAHRPRRQETAPVRFPAACPAVPRDAQLRLFCGGGIVSGVLDAG"
     CDS             complement(194012..194734)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01840"
                     /product="hypothetical protein"
                     /protein_id="BAH47191.1"
                     /transl_table=11
                     /translation="MSTRIAVSINLGPNAPIQILSAALSDLNTICALSTDLEKQITRA
                     NMLYRFNSEDLWYRLMVDKRFNPPSGWKNLADIEREVYFLSLGPLQDLARNAVEAEIS
                     RIINERGWASDGEIYVTSLTYANPLDAVLTAISAAGIRPAGEILYRILVLIRDWKQDR
                     RRKRLSNDDYEDQIQTRKLIRAHVTKQLIEDGVSLSPEIINSLFTDDRTDAFAQLSRA
                     QLSIESTRVEDARDDSSPTEEA"
     CDS             195056..195313
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01850"
                     /product="hypothetical protein"
                     /protein_id="BAH47192.1"
                     /transl_table=11
                     /translation="MTSEGPRPQRDTVHTTSADEIARFVARVAYPTSPVVLVDEEFAL
                     AALARAYGDWLDALGLPDLAEKARTLLPETAGGRAAAGHRP"
     CDS             195391..195909
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01860"
                     /product="hypothetical protein"
                     /protein_id="BAH47193.1"
                     /transl_table=11
                     /translation="MTLRLPTTLATDSDAAAIEALTKYYDRPYLGDDAYVGAHFDSWS
                     STGNRAGEADRFTADDLVAVTFLSVQVPPKAARTILDTQSEALNAFLTAIGPDRDLVR
                     RTGTADPGMARLGPGNGPVGAAGDWTKEGDEVDRPQTSPAVSDLGLTEKSASSRVSSP
                     WNGRIGIRPLMH"
     CDS             complement(195978..196859)
                     /codon_start=1
                     /EC_number="1.13.11.2"
                     /locus_tag="ROP_pROB02-01870"
                     /product="putative catechol 2,3-dioxygenase"
                     /protein_id="BAH47194.1"
                     /transl_table=11
                     /translation="MGISQVSHAELAVGDLEEAVGLHVDVLGMKELGRSDGSVRLTAG
                     VDERCDLVLTSGGTGVRRFALRVDSHDDLEHYGKRLANAGVEHSTRSDEDPGVSQSLQ
                     FRTPTGHVMELSLLTDAEGPQYIHPARAAHRGGIRALDFDHITLQAQDPKPLVEFMVD
                     ILDFQISDIFAPAPGVMGAAWLRASDLHHDVAIISTPEPGKSLHHYALGMESFDHLKV
                     AADELARHGVPIETGPGRHGVGANLYTYFWVAGNRYELSAEMPRVRPGAPGMWDNFPK
                     AFSPWGLTPPESFGHAS"
     CDS             complement(196867..197346)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01880"
                     /product="hypothetical protein"
                     /protein_id="BAH47195.1"
                     /transl_table=11
                     /translation="MTNFDVWMEKLHDMKDFDPERSLPDGLVTGPDSARWLEEEITGN
                     PSRVGVLADVPAKSMEFYLQEIPAGTATDLQRHLHESVHCVVDGSGYSEIGGKTLRWT
                     AGDFVYTPPWVWHRHYNDGTTNVRMILVENSRMLDSLGINRRESAGNIAYHDNIDRS"
     CDS             complement(197357..198121)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01890"
                     /product="putative oxidoreductase"
                     /protein_id="BAH47196.1"
                     /transl_table=11
                     /translation="MTVTGKRALVTAGSSGIGAAVAASLRAGGAEVFITGTRPHTADV
                     ARDLGAAGWAIADFTMPGAATGAVRSALDTLGGVDILVSNTGGSRAAPATELAQADWE
                     SAYRLILDSAISLTNAVLPGMLASEWGRLIYLTSVGVVRPLPRLHTSNVMRAGVAALA
                     RSLAGEVAPNGITTHVIAPAHVDTTRRRALVAAAATSAGTSVEETERRQLAAELPVGR
                     WGRPEEIGELVAYLCSERASFQTGSTHVVDGGMTSI"
     CDS             complement(198118..199614)
                     /codon_start=1
                     /EC_number="1.14.14.9"
                     /gene="hpaB"
                     /locus_tag="ROP_pROB02-01900"
                     /note="protein synonym:4-hydroxyphenylacetate
                     3-monooxygenase, oxygenase component"
                     /product="putative 4-hydroxyphenylacetate 3-hydroxylase"
                     /protein_id="BAH47197.1"
                     /transl_table=11
                     /translation="MTARNGAAYLERLRTHSPELWVGSEKIVDVVGHPATAGAAAEIA
                     RLYDLQFEDGNEDMLFEPADGDGPVGVQFLEPRSREDLEQRHAMHKKWADSTLGMMGR
                     TTDFVSAMLVAWNANADFFGDNADKVRDYFRHVRDNDLFLSHAIADPPVDRSKPASQQ
                     PDPYTYLGVKEQTAEGLIVSGAKMLATAAPYSDEILVWPFSLRKFAPEEKPYAIAFAI
                     PTDAPGVRLICREPFGGGNAFDQPLSSRFDEMDAVVVFDDVLVPWDRVFINQDYERVN
                     RIWEINSNAFTGAQTSVRLMAKLQFVAGLAKRATEVVKTDQFPQVRDALGEISTYIEL
                     TRAAILASEAGATPNQDGVLFPDLRPLYAIRNSGNRWYPRVREILQQILAGGLLYQPA
                     DVSAFDSPIASDLAKFYRGPDNSSVDRISVFKVAADLAVSAFGGRHELYERFYAGDPM
                     FLRINTQFNQYDWTEPLGLIDGLLATSAEHARTAGSAEPDRTEGGAAA"
     CDS             complement(199611..200471)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01910"
                     /product="putative hydrolase"
                     /protein_id="BAH47198.1"
                     /transl_table=11
                     /translation="MEEHVSIWGDLAGVDLVQRTVDVDGVATRVVEAGSGPSLILVHG
                     TGGHLEAYARNVRDLAKDFHLVLYDMPGHGYSDKPDRPYTIDYLSDHLVALMDALSID
                     RADLSGESLGGWVAAWTAAHHPTRVRGMVLNTPGNITNKPEVMAGLKESSMKAVREAS
                     PQTVRARVEWLFHDTSLVTDELVGLRLRIYSQSGFETAMANILAVQDWEYRRPFVWSP
                     TWCDRILAPTLLLWTDHDPTAAVEEASLLETLISGSRLEVIEGAGHWPQWEKPDEFNE
                     AHIRFLKGKS"
     CDS             200639..201082
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01920"
                     /product="hypothetical protein"
                     /protein_id="BAH47199.1"
                     /transl_table=11
                     /translation="MLFFRRGVAWGRQADAVTDTAMPHTCLRRCRQRSGSAPCPGSVS
                     AGGCGARGKPCFPGPHSGVCALLAFCSRNDLGGRLRDHRRRPPRVRPDGHAPFGRIQL
                     TGRGRRSGRSFSGTPEPDGASPPGYGWAAGLHPVEGDPLPRLPWT"
     CDS             complement(201094..201735)
                     /codon_start=1
                     /gene="nimR"
                     /locus_tag="ROP_pROB02-01930"
                     /product="putative regulatory protein NimR"
                     /protein_id="BAH47200.1"
                     /transl_table=11
                     /translation="MTMTMTASGSKTDQIYDALRTRLMQGHYQFGEVLSTYELAQEFG
                     VSRRPVMDAAMRLASEGFISIIPQVGCRVIIPDEERVREHFALAGILEGAGAKLAALN
                     ATEVQLADIDAALGRCAGPAEADDAAAFAAANRDFHSAVLAASGNQRLTELAKHAWDL
                     SDFYIQKNRVSTDLRRSQSEHSDIAGAISRREPGLARELMEGHLSRFWMGVHI"
     CDS             202171..202710
                     /codon_start=1
                     /gene="nimA"
                     /locus_tag="ROP_pROB02-01940"
                     /product="putative monooxygenase NimA"
                     /protein_id="BAH47201.1"
                     /transl_table=11
                     /translation="MEPRRFRNVMGRFTTGVTIIGTKHADGIHAMTANGFMSVSLDPA
                     LAMVSIATKAKMHEMLLASGRYGVSFLGADQETVSRHFSGRPDLLPDFSFDEIAGAPL
                     VRGALARISVEVVDAHRAGDHTLFIGKVHHLDDAPGDPLVFYSGGYRHLLRAAHDTEY
                     SDAWSGFCLEPTGPLTLAG"
     CDS             202765..203727
                     /codon_start=1
                     /EC_number="1.13.11.-"
                     /gene="nimB"
                     /locus_tag="ROP_pROB02-01950"
                     /product="extradiol dioxygenase NimB"
                     /protein_id="BAH47202.1"
                     /transl_table=11
                     /translation="MTLALVCTSHSPLLEFNNPPPEVRTEVDRAFAQARQFIEDYDPD
                     LVVSFAPDHYNGFFYKLMPSFCIGFEASGVGDFGSSAGRLDVPSALAEQMAQSVLDQG
                     VDIAVSLEMEVDHGAVQPLEILLGGIATKPVIPIFVNSVAAPFAPMKRIRLLGEAVGT
                     FLKNFDGNVLLLGSGGLSHDPPVPRLEAATGEQRKMLLGGRHPTAAARAVRQQRVIDT
                     AKAFTRGEAGIMDLAPEWDRQLLDILASGELERLDAWTAKEMAATAGNSAHEVRTWVA
                     AHNALKAAAGQYTVTSEYYRPIPEYIAGFAVTTAVPVHTTAGLT"
     CDS             203994..204599
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01960"
                     /note="fragment"
                     /product="putative 4-hydroxy-2-oxovalerate aldolase"
                     /protein_id="BAH47203.1"
                     /transl_table=11
                     /translation="MQRQLGVDQPDFGFLLDEMIFESDRCVPADRFITPRVEPEVAFI
                     LQEDRAGAGLTIEDAAAAVGRIRRTGPGYPSRSARYRCRCRRSHRHARLRRHRHRLRR
                     HLGCSAHRERRKTRRVREQALTTARLTTLLLPGIGTIDELKLVHSLGVRSVRVATHAT
                     EADVSAQHISAARELGMDVSGVLMMSHMASPTHLAEQAKLM"
     CDS             204166..204378
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01970"
                     /note="fragment"
                     /product="putative acetaldehyde dehydrogenase"
                     /protein_id="BAH47204.1"
                     /transl_table=11
                     /translation="MLQPQWAGSDGLARATRLGVPATAAGVDGLIGMPGFEDIDIVFD
                     VTSAVAHIANAERLAGYGNKLSRRRG"
     CDS             204651..204890
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01980"
                     /note="fragment"
                     /product="putative 4-hydroxy-2-oxovalerate aldolase"
                     /protein_id="BAH47205.1"
                     /transl_table=11
                     /translation="MNDIRARMRAYREVLDPETEIGIHAHQNLSLSVANSGVAVEEGA
                     ARVDASLAGQGVRSGQHPHRSVHRPRRPDRMEAHR"
     CDS             204763..205140
                     /codon_start=1
                     /locus_tag="ROP_pROB02-01990"
                     /note="fragment"
                     /product="putative 4-hydroxy-2-oxovalerate aldolase"
                     /protein_id="BAH47206.1"
                     /transl_table=11
                     /translation="MRSRKELPGSTHPWPGKEFEAGNTPIEAFIALADLTGWKHTGDL
                     FKLQDTADGIVRPLQDRPVQVDRETITLGYSGVYSSFLRHAERAATTYVLDTREILVE
                     VGRRGLVGGQEDMIVDIAPDLSA"
     CDS             complement(205693..207504)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-02000"
                     /product="electron transfer flavoprotein"
                     /protein_id="BAH47207.1"
                     /transl_table=11
                     /translation="MSASGSGRVLVCLKQVPAPGAVSFDERTKRIRRDSDAAITNPAD
                     LCALAHALSLRDALGWEVVAVTMGPPAAQATLVDALRRGADRAVHLLDRRFAGADTLA
                     TARAITRVVEREAPDLVLTGRWTLDGATAQVGPQVAELAGLPQLTQVVALHTGDDGRI
                     RAEVETDVGTEDWAIELPGLVSVGRGIEPPWVVDAADAAAIETVTADDLGGGPRDFGT
                     RGSPTFVVEIRPGRSMRSTEHGADAPAAASMLAAAFAAAREDLRPATYAAGPASPPRE
                     IWAVAEPLPGGGLHPTSLEALACARSIAAELHSTTVAVLPGAHSSDAPRVLHAHGADR
                     VIVLGDAGLEEYATEPFTSALSAAIIAGSPFAVIAPFSARGRDYAPRVAARLGLGLTG
                     DFVALEVRGADSDDPDLLWLKPALAGNVLAPVIAHTTPSMGTLRPGSFPVAAVRDEGD
                     PQVDVLGPAAKAADDRCTPIERRVENPDAPHLTAARVVIGLGPGLDAATRRAAERLAQ
                     ATGGAVAATPAAVAAGDAPRQIEIGPLARTIAPSIYLGLGRHDPGTLRAVSGAGQIVV
                     VDPDAQLDELSGLADAVVTADIEPVLADLLELVAAVH"
     CDS             complement(207501..207761)
                     /codon_start=1
                     /gene="rubA"
                     /locus_tag="ROP_pROB02-02010"
                     /product="rubredoxin"
                     /protein_id="BAH47208.1"
                     /transl_table=11
                     /translation="MKILIATEETQADPATELWVCEVCEDVYDPQLGDPDGGIPPGTA
                     FQDIPDDWVCPVCGARKKEFRKLRPGEEYQDVSEDLVTGELG"
     CDS             208233..208925
                     /codon_start=1
                     /gene="narR1"
                     /locus_tag="ROP_pROB02-02020"
                     /product="putative naphthalene degradation regulatory
                     protein"
                     /protein_id="BAH47209.1"
                     /transl_table=11
                     /translation="MVSQRLNRSGQAYEQLTAEILRGRWQPGDTLSTYALSEELQISR
                     TPVSEALKRLESEGLVEIIPQVGCRVVRPSSTTVTELFAIRGVLEGLAAEVAAKAMSA
                     QQLAELGGVLERMEAAIDHGDEVAYGDLNYEFHLKIIEGSGMPRLIQTVEGVWSLLRY
                     QLARLPFTGDQMGESMTESRTEHRAIFEALERRTAKRARTLAEQHTRRCGDRFVAYLE
                     GVAAPRRGGEKP"
     CDS             208922..209593
                     /codon_start=1
                     /gene="narR2"
                     /locus_tag="ROP_pROB02-02030"
                     /product="putative naphthalene degradation regulatory
                     protein"
                     /protein_id="BAH47210.1"
                     /transl_table=11
                     /translation="MTELSALIARALDDMCEYQERFTRDPGHAQVSLAGIPHALVPTH
                     VVASDLPRELVEILGAELAPAVMYRFGRLIGLSHAAAFFADRKIGMTEPQYRVLTGPF
                     HFAWAGYGDVQLLLWEPKLDEDFLVLWESDNSFSAREALNDGHRSRACHLQAGYAAGW
                     ASEATGLPIDVQEIACRAEGVSYCRFAMAHRDRVSLWMRDPRLHRPTKQYKVMPASMP
                     RAASV"
     CDS             complement(210065..210460)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-02040"
                     /product="hypothetical protein"
                     /protein_id="BAH47211.1"
                     /transl_table=11
                     /translation="MTTPVLSPEWMQTYGELWNNTEATRQGLKKLSMVIEYRLAEDES
                     RAGQIQVVLGEVVRAGAPADGVKPEFVLTANTDTWQRLGLGELPAAKAMVTRKVKFRG
                     PMSVAMANLPSLEAAMKMMGQIDGTDWSV"
     CDS             210713..212119
                     /codon_start=1
                     /gene="narAa"
                     /gene_synonym="nidA"
                     /locus_tag="ROP_pROB02-02050"
                     /product="naphthalene dioxygenase large subunit"
                     /protein_id="BAH47212.1"
                     /transl_table=11
                     /translation="MLSNELRQTLQKGLHDVKSDWTVPASIINDPEVHDVERERVFGH
                     AWVFLAHESEIPERGDYVVRYISEDQFIVCRDEDGEIRGHLNACRHRGMQVCRAEMGN
                     ASHFRCPYHGWTYSNTGSLVGVPAGKDAYGNQLKKSDWNLRPMPNLATYKGLIFGSLD
                     PNADSLEDYLGDMKFYLDIVLDRSDAGLQVVGAPQRWVVDANWKLGADNFVGDAYHTM
                     MTHRSMVELGLAPPDPQFALYGEHVHTEHGHGLGIIGPPPGMPLPEFMGMPENIVEEL
                     GRRLTPEQVEIFRPNAFIHGTVFPNLSIGNFLMAKDHLSPPTPFLTLRLWHPLGPDKM
                     EVMSFFLVEKEAPDWFKDESYKAYLRTFGISGAFEQDDAENWRSITRVLGGQFAKTGE
                     LNYQMGRGVLEPDPNWPGPGEAYPLDYAEANQRNFLEYWMQLMLADTPLHAGNSNGNG
                     KVETSAPAAPKTPAKAEA"
     CDS             212123..212641
                     /codon_start=1
                     /gene="narAb"
                     /gene_synonym="nidB"
                     /locus_tag="ROP_pROB02-02060"
                     /product="naphthalene dioxygenase small subunit"
                     /protein_id="BAH47213.1"
                     /transl_table=11
                     /translation="MSTQTQISATTVREITDWLYMEAGLLDAGRYREWLDLVAEDLSY
                     IVPLRVTREREAVTDVVEGMTHMDDDADSMEMRVLRLETEYAWAEDPPSRSRHFVTNV
                     QVAPGDSEDEFEVTSNLLLYRTRGDVATYDVLSGERKDVLRRAGDGFRLAKRVVLLDQ
                     TTIMTHNLALIM"
     CDS             212655..212927
                     /codon_start=1
                     /locus_tag="ROP_pROB02-02070"
                     /product="hypothetical protein"
                     /protein_id="BAH47214.1"
                     /transl_table=11
                     /translation="MSIIHNDRGEPIIQIANEFTVIQVGYTRTGSGERLVITSPRLGF
                     QTHLDPLQLESLTWQTPDMYSALLDTPYGPGSELKASPLSALFRKD"
     CDS             212933..213748
                     /codon_start=1
                     /EC_number="1.3.1.-"
                     /gene="narB"
                     /gene_synonym="nidC"
                     /locus_tag="ROP_pROB02-02080"
                     /note="protein synonym:1,2-dihydro-1,2-
                     dihydroxynaphthalene dehydrogenase"
                     /product="cis-naphthalene dihydrodiol dehydrogenase"
                     /protein_id="BAH47215.1"
                     /transl_table=11
                     /translation="MGFLDGKVALVTGGGSGIGRAVVELYVQQGAKVGILEISPEKVK
                     DLRNALPADSVVVTEGDATSMADNERAVADVVDAFGPLTTLVCVVGVFDYFTEIPQLP
                     KDKISEAFDQLFGVNVKSNLLSVKAALDELIENEGDIILTLSNAAFYPGGGGPLYVSS
                     KFAVRGLVTELAYELAPKVRVNGVAPGGTITELRGIPALANEGQRLKDVPDIEGLIEG
                     INPLGIVAQPEDHSWAYALLASRERTSAVTGTIINSDGGLGVRGMTRMAGLAQ"
     CDS             213970..214956
                     /codon_start=1
                     /gene="narC"
                     /gene_synonym="nidD"
                     /locus_tag="ROP_pROB02-02090"
                     /product="putative aldolase NarC"
                     /protein_id="BAH47216.1"
                     /transl_table=11
                     /translation="MAQKFGVNDLRGVVAVTPTPALPGAGELAGRDTVDLEETDRMIR
                     RLIADGVDGIITNGTLGEMATLTLTEWQAFTRRVSEVVSEVAPDLPLFIGATTLNTRD
                     TVDRIRFLEDLGIQGVFLGRPMWGGLGADTMAAFYRDIADTFPDMAIVLYDNPEAFKG
                     PIPSPVYAELATLPQVIGAKYIALTPKFAVDIAAVDGKMRLLPLESDWLATRTLYPDE
                     ALGCWSSSALCGPEPVLALRDALASGNLDAARHLTHRIDWTYEPFLARTNFPEFSKYN
                     VTLEKLRFDEAGYINAGPARPPFLTAPEAYAEGARENGRRWRHLVDEITTTN"
     CDS             215404..215931
                     /codon_start=1
                     /locus_tag="ROP_pROB02-02100"
                     /product="hypothetical protein"
                     /protein_id="BAH47217.1"
                     /transl_table=11
                     /translation="MGPGRRRVPFGGTAGPHNPRSTTSVIAALAIKDKEIGSMTDKLK
                     LFSQEWCDAALDAVNANDAVYEGFKDPDTFTNKLEFGVIGRDDVACHLEFKEGKVVSF
                     TPRTFDESELWLIINGSLETWQAAAAGKEEGGKLLMKGQIKFAKGPMSAAIENAGALN
                     NFLLTWGQVPTDWDV"
     CDS             216037..216492
                     /codon_start=1
                     /locus_tag="ROP_pROB02-02110"
                     /product="hypothetical protein"
                     /protein_id="BAH47218.1"
                     /transl_table=11
                     /translation="MTTVESGAYPVSLFDGEDANGVANIVGMLLGQNLENFPSRIKFA
                     RKIARPVSIISTDTDSACTIVFGTDEAVVYNDVVGKPAVTVIATVDQILDVSQLPMKA
                     GGLIPVGFFTGRGMTVLGEIVKHKLVVKGLLTHTVTALRTIALVSVIEP"
     CDS             216489..217142
                     /codon_start=1
                     /locus_tag="ROP_pROB02-02120"
                     /product="hypothetical protein"
                     /protein_id="BAH47219.1"
                     /transl_table=11
                     /translation="MTSLSGRSRPASHASEDPAMQFELPYADDDVVQGGEPPRASKAT
                     NIARGLLLLALIPVSVFYLGPRIYNLTATPYRLDQAVVSAGNYNPALDKIVEHEKVTL
                     SAFASLEKMKTALASVLVTDATVTAELHTLTGQISGDVQATLDQAGANVTDLIASLDT
                     LTTHINSLQPPVDGATAALAADSATLGVILDDARSTAAKVHNARVSAEESANDLSGK"
     CDS             217153..217686
                     /codon_start=1
                     /locus_tag="ROP_pROB02-02130"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH47220.1"
                     /transl_table=11
                     /translation="MIFFGRRGGPARMVLAIVAVGVLGLLTFVVFNLNTRLDNQQRAN
                     VTSIAASQDIVDVNDKVTGQLRQLTELTHTAQTALDATSALGPLLTKLDEAIAPAAAM
                     LASSTAGAQMTNDQLTNIQSILGEVQNTVLPLVSSAEAFGEQGNQLLVIVQGLVSDLR
                     VSVEAAKTINQMLPLPG"
     CDS             217735..218439
                     /codon_start=1
                     /locus_tag="ROP_pROB02-02140"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH47221.1"
                     /transl_table=11
                     /translation="MQQRNDLPPDVLPPRGVTKYQRFDVPAAALPYRKGTKPHRPDVL
                     VPAIPDATGFSVAIEWLGRLAAVIAVVLFALVVASIHKGLQVQHSARTVVDNFRLTND
                     FFAQRADLTAPATARKQLDELTGVLTQLNTATATDVDHLDALLPNARTLLAAGQGDTQ
                     IAGQLEGVATTLQGSAASLHQISAGANTTVTGVDNELTQALDLVNQLNAELTRTTNKL
                     ALVPATDAFIPAPGGN"
     CDS             218439..219086
                     /codon_start=1
                     /locus_tag="ROP_pROB02-02150"
                     /product="hypothetical protein"
                     /protein_id="BAH47222.1"
                     /transl_table=11
                     /translation="MITRKLWTAIVLVLGAGSAVVLCALNGFFPALRDVSDPLGRPSK
                     LSLELIDSAGQFDTLTAILVPKHARLASDIQTLTPLANDLEGLTDKASELSGQAKTLN
                     ASTSTVSEIAAPLPDLIVKVTGRADTASPTVAGLSTAVGSVTTQLEAINHGLTTVQGS
                     LGALGPKASAISATLAIVREEAAHVQEFGPLLAVIGPPVNDLNLPALGVAPAPPS"
     CDS             219139..219663
                     /codon_start=1
                     /locus_tag="ROP_pROB02-02160"
                     /product="hypothetical protein"
                     /protein_id="BAH47223.1"
                     /transl_table=11
                     /translation="MFRLSWAIALSFTIAVLAGILIVTRDLSISNDIFKEGVAQAKIV
                     DSTTDQALDGAQQLPPADQALHEGLPQVVGVLDSLARADRTLGSLGDHLQSLGDALKS
                     ADAPLGGIIDAGQSATDQANAAAAPAADIVNTLSAADTKVQALGPLLDRSLALSQTID
                     SKLRIALTLPKVGN"
     CDS             220058..220393
                     /codon_start=1
                     /locus_tag="ROP_pROB02-02170"
                     /note="fragment"
                     /product="putative integrase/recombinase"
                     /protein_id="BAH47224.1"
                     /transl_table=11
                     /translation="MYERRESALILMGFTGAFWRSELVALNCGDVSVHRLDGIHIRLR
                     QSKTDQEGAGSVKALPFTTSPQWHTVPTLPVGAGRGRLRHRQPSRGDPDAAPHRRSTT
                     KSAAARCRG"
     CDS             220293..220664
                     /codon_start=1
                     /locus_tag="ROP_pROB02-02180"
                     /note="fragment"
                     /product="putative integrase/recombinase"
                     /protein_id="BAH47225.1"
                     /transl_table=11
                     /translation="MAAFDTANRPGVIRMLRRTAVRQPSLPRRAAADEGPVAVVPVDP
                     QERQPRGHRPVRASVHAAIRRRAALAGYDENIVAQLGGHSLRAGFVTQAFRNGADAHA
                     IMRQTGHIRRPWRSTRGRTPR"
     CDS             220390..220683
                     /codon_start=1
                     /locus_tag="ROP_pROB02-02190"
                     /note="fragment"
                     /product="putative integrase/recombinase"
                     /protein_id="BAH47226.1"
                     /transl_table=11
                     /translation="MRARSPLFRSIRKNGNLGGTALSGRRCMRQSAAAPPWPGTTRTS
                     SPNSVGTRCGPGSSPRPSATAPTRTRSCARPGTSGDRGDLRAGERPADRQRRH"
     CDS             220631..220696
                     /codon_start=1
                     /locus_tag="ROP_pROB02-02200"
                     /note="fragment"
                     /product="putative integrase/recombinase"
                     /protein_id="BAH47227.1"
                     /transl_table=11
                     /translation="MEIYARENAPLIGNAVTEIGL"
     CDS             complement(220788..221519)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-02210"
                     /product="putative GntR family transcriptional regulator"
                     /protein_id="BAH47228.1"
                     /transl_table=11
                     /translation="MADEALELEPLTPFAGRRMEQAIAAVRAAIDDGRMKPGVKYSVY
                     QLAEGLGISRTPVRDALLRLEEVGVIKFEARQGFRILLPQPKEIAEIFAVRLALELPA
                     VRKAAAVADPTLSDALQRQRRLMQDAAAGGDEHEFAHHDLGLHDLILDAADNARARAI
                     VKTLRETTRLLGANTADKTRTLTDIDNEHAPIIDAIIAGNPVEAEAAMRAHLENTGRL
                     LVTQSIRSVDDPSLSTEEIWATVNS"
     CDS             221554..224421
                     /codon_start=1
                     /locus_tag="ROP_pROB02-02220"
                     /product="putative FAD-linked oxidase"
                     /protein_id="BAH47229.1"
                     /transl_table=11
                     /translation="MLGACSMLRMISAESLAAELRSSGVSDVLSDGTTRAAYSSDASL
                     YRVRPLVVARPRHADEVAAALAVCRREGVPLTSRGGGTSVAGNAVGTGLILDFSRHMN
                     RVLSIDRDAQTATVEPGTIQTVLQQAVAPQGLRFGPDPSTFTRCTIGGMIGNNACGSR
                     TLGYGRTSDNVKGLHVLTGTGESLQLGSAGEVTASPALSALQQVTRAGLATIRTELGQ
                     FGRQVSGYALEHLLPENRFDVTRMLVGTEGTLAVATRATVRLVSEPAHRVLVVLGYAD
                     IASAGDATPLVLKFDPTACEGIDSRIVDVVRERRGPDAVPPLPAGAAWLFVEVVGDDL
                     DETIARAQQVGRDCGAVDSLVVTDEGRTAQLWRIRADGAGLAGRSPAGLPAHAGWEDA
                     AVPPAMLGDYLRDFDALMDEYGVTGLPYGHFGDGCMHVRIDWPLDKPGGDRIFRDFLV
                     AASTLVAGYGGSLSGEHGDGRARSELLPLMYSPDAMKLFAAVKHVFDPDNILNPGVVV
                     DPRPVDADLRIPAAPLLRRNLALAYHHDDGDFTQAVHRCTGVGKCRADNTATGGVMCP
                     SYQATREEKDSTRGRARVLQEMINGTDIDGGWRSPEVHDALDLCLSCKGCSSDCPTGV
                     DMAAFKSEVLHQSYKGRIRPASHYSLGWLPRWAKIASHAPGLVNATMRVPGIGPLALS
                     SAGVDKRRTIPPFAKQTFRSWFKATENDRATTGDPVLLFVDSFTNYFTPEVGHATVQV
                     LEAAGYRPQLTDKQQCCGLTWISTGQLTAAKKILGRTVDALSGSAAAGIPIVGMEPSC
                     TGVLRSDAAELLGRSAAEPVADATRTLAELLTERGWEPPSLEGKSVVAQPHCHHHSVM
                     GWSPDAQLLEKAGAQVQRLGGCCGLAGNFGVEKGHYEVSVAVAEQQLLPAVAGADADT
                     TILADGYSCRTQLSDLTDRRGDHLAQLLAAQLEGGAARRRD"
     CDS             complement(224508..224894)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-02230"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH47230.1"
                     /transl_table=11
                     /translation="MRTPWLSPETVFAFLLNASGATILMVYLMIALSQIKLRSSMSRD
                     EVAQLKLKMWWFPTLSVLAAAGIVGVLVSMFYVESSRSQISLSVAALILALVAYQIRR
                     RINPENPLAHNISDPAPHTITESSPG"
     CDS             complement(225137..226156)
                     /codon_start=1
                     /EC_number="4.1.3.-"
                     /locus_tag="ROP_pROB02-02240"
                     /product="4-hydroxy-2-oxovalerate aldolase"
                     /protein_id="BAH47231.1"
                     /transl_table=11
                     /translation="MTTRLFIQDVTLRDGMHAVRHRITPDDVGKIVAALDAAGVDGIE
                     VAHGDGLAGGSLNYGPGSNTDWEWIEAAAANLTHARLTTLLLPGIGTIAELEHAFRLG
                     VRSVRVATHCTEADVAAQHIGKARELGMDVSGFLMMSHMTTAPELAAQAKLMESYGAH
                     CVYVTDSGGRLTMDGVRDRVRAYRDVLDEGTEIGIHAHENLSLSVANSVVAVEEGVTR
                     VDASLAGHGAGAGNCPIEPFIAVADLQGWKHNSALFALQDAADDLVRPLQDRPVRVDR
                     ETLTLGYAGVYSSFLRHAEAASQRYGIDVRTILLEVGRRGLVGGQEDLIVDIALDLRS
                     RAGGN"
     CDS             complement(226153..227136)
                     /codon_start=1
                     /EC_number="1.2.1.10"
                     /locus_tag="ROP_pROB02-02250"
                     /product="acetaldehyde dehydrogenase"
                     /protein_id="BAH47232.1"
                     /transl_table=11
                     /translation="MSENTRKVTVAVIGSGNIGTDLMIKVIRHSDVLQMGAMVGIDPD
                     SDGLARARRLGVPTTAVGVHGLLELPNFDEIDVVFDATSAKAHAANAALLEPLGKRLI
                     DLTPAALGPFVVPAVNLDEHRHAANVNMVTCGGQATIPIVAAVSRVTPVAYAEIVASI
                     ASKSAGPGTRANIDEFTETTSHAIETVGGARRGKAIIVLNPADPPLIMRDTVLCLISA
                     RDPATHDAIRNSIQAMVEHVATYVPGYRLKQQVQITPVPDGQPVHTLLASGDTAAPTH
                     QVSVFLEVEGAAHYLPAYAGNLDIMTSAAVRYAESVADTIAAPAATQGATR"
     CDS             complement(227142..227972)
                     /codon_start=1
                     /EC_number="4.2.1.80"
                     /locus_tag="ROP_pROB02-02260"
                     /product="2-hydroxypenta-2,4-dienoate hydratase"
                     /protein_id="BAH47233.1"
                     /transl_table=11
                     /translation="MSTPQGTSLPPTARATADAIAVAAERLSTAAATSTPCTPVRDLI
                     GADDVAAAYAVQERIVADRIAAGASVVGRKIGLTSPAVQQQLGVDQPDFGVLFDDMRC
                     AEAGPIPLSRLLQPKVEAEIAFVLGRDLVDGPLDDAQIRAAVDYAVAALEIVDSRIAG
                     WDITFGDTVADNGSSGLFVLGADRRTLDSFDPVAAQMQMFIGDTEVSTGTGAACLGDP
                     VRALAWLARTAREFGQPLLAGQVILSGALGPMAAIDSAGTVRADITGLGSVTATFTQE
                     "
     CDS             228122..228895
                     /codon_start=1
                     /locus_tag="ROP_pROB02-02270"
                     /product="putative IclR family transcriptional regulator"
                     /protein_id="BAH47234.1"
                     /transl_table=11
                     /translation="MSDQEFDRTTVLGKVMMVLHAFTIDDSTLSLAELVRRTSIPKGT
                     LHRVLSDMVAVRMLDRTDAGYRLGGSLFELGMRASVERSLLEVAIPFMEDLYVRTHET
                     VHLGVLDGTEVVYLSKIGGHRQASAPSRIGGRMPVHCTAIGKVLLAHADNALREQVLS
                     APLARYTPRTIILPGSLRTQLDRITEEGMAYEYEESATGIVCVAAPVRDGEDAVAAIS
                     VTGPSHRFRPDTHATSVRAAADGIGLTLSRRTQLVADTR"
     CDS             complement(229168..229482)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-02280"
                     /product="hypothetical protein"
                     /protein_id="BAH47235.1"
                     /transl_table=11
                     /translation="MNSNDKNSDYDGLAEWAEHEMTLPKNSATAKRGAEAAAAGRELL
                     ERVGAGRPSLAGASGESPKRQVRLPAPLSNKLDELAERQHRKPSELMREAVEEYIQRH
                     SA"
     CDS             complement(229544..229819)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-02290"
                     /product="hypothetical protein"
                     /protein_id="BAH47236.1"
                     /transl_table=11
                     /translation="MAIEWATSADKHGIDRDDALHAIENAVYVEQEFDEPRVPGHSKP
                     WLFIGPPRTLGGPLLEVMVEIVPPRGMVVFHVMQARQKHLDRMKDQP"
     CDS             230317..230694
                     /codon_start=1
                     /locus_tag="ROP_pROB02-02300"
                     /product="hypothetical protein"
                     /protein_id="BAH47237.1"
                     /transl_table=11
                     /translation="MWCGGAGDGQHSAGSGPTSLTRREQQIAELVAEGFTNKSIADRL
                     VISQTHRAGACRARTLQAGIRLSYSNRGLDHRAEAGPEVLIAPSRGRLGVLRRTEWVD
                     HRQQADARRVVTRHRRRRVNQPL"
     CDS             230726..231529
                     /codon_start=1
                     /locus_tag="ROP_pROB02-02310"
                     /product="hypothetical protein"
                     /protein_id="BAH47238.1"
                     /transl_table=11
                     /translation="MYARLCRSGRGAGELAGAVVRLWEVSGSERVVMFDIDGGLADLS
                     KFAHILAGDSAASRRRAWQRFFEHVGQAAVVEPGRDLVEAVAGLGFVPVYSTTRPVSC
                     AGQTRLWLGEHGFPQGRALLCRSRDDVRPAVEVKAGHCRAVGRWLSAFVDDESEVVDA
                     LRSRGVHAHSFDGLSELGVRELRTTLSAGTGATLPVVGRADRAATIAVVSAPQTRHDK
                     AGNGLSRCAGRAEPRRNYAGGAPRTRRRSCVAVWPGSRRAARPARLTLR"
     CDS             231537..232013
                     /codon_start=1
                     /locus_tag="ROP_pROB02-02320"
                     /product="hypothetical protein"
                     /protein_id="BAH47239.1"
                     /transl_table=11
                     /translation="MYNCSWRWCTVALTDVERDLRAIPAEKELLQIKLLRAVAHATDN
                     QVPQRVIAKNLAVTQPEVSRIVKKLRLNPSARDRSPREVLLEHAAKRIDHDRMMAELV
                     AWDYTFGHVPADDPLGASYLRGTWDQIERSRDLLGDDDYRVLLAATADRRARANAL"
     CDS             232003..232887
                     /codon_start=1
                     /locus_tag="ROP_pROB02-02330"
                     /product="hypothetical protein"
                     /protein_id="BAH47240.1"
                     /transl_table=11
                     /translation="MHSDPATAVAAEIEAWCRPGGKLDKDGARASIHLFGPVARRRTR
                     DAIVDAYLAEQTNVGVGRQFLALATAGPPGVGKSSSINRRHLAGQGWRVLDADKLKDF
                     LLRDAVEQGIYTDLLEIDLADGHRLMPRELATLVHTESTKLLDIITEICLARGENLVL
                     EGTFSWPGLGPRLLRDLAYAEYEKFTILDVEAPAHIVRARALTRWWRGRQEALRGGDG
                     FGGRFTPGFVIDALYAGDSEETVCARNARAAFDHPLSAEIPTVELLVEHADDGDETWV
                     KENGVVVYPQIPADRPEP"
     CDS             complement(233050..233340)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-02340"
                     /product="hypothetical protein"
                     /protein_id="BAH47241.1"
                     /transl_table=11
                     /translation="MATDYDAPRVTESDEPDTSLEQLTASRKDTQSPAVDVEDADTAE
                     SFELPGADLSGEEFTVRVIPKQSDEFTCTSCFLVHHRSRLAEHQQLICRDCA"
     CDS             complement(233354..233746)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-02350"
                     /product="hypothetical protein"
                     /protein_id="BAH47242.1"
                     /transl_table=11
                     /translation="MQVAAPYDPAPCRSAEDRPHRGGGERYYDHNHHHGDEGFVIGEK
                     LLHDRKSPSPGSHQSKLASASTDTRTDRMEAPATTCTPQTTANQYTEPNRRLNPLTAQ
                     DVEPPHAAPREPVAPPDPLVWRVQTRRA"
     CDS             complement(233943..234386)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-02360"
                     /product="hypothetical protein"
                     /protein_id="BAH47243.1"
                     /transl_table=11
                     /translation="MVVNRELHLADATSNAAIGFGMTSEISTTTDYALTQQWPQALHA
                     AGFDGIRYWARDEMTHVHACVALFAPSGDQTSTVAVPSGFTVVGTDTFAGSHRPLGFA
                     VRDGRDRSPGHPRQHLKPGRPETSLSVSGWASRGGIEGATPGRAR"
     CDS             complement(234666..235172)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-02370"
                     /product="hypothetical protein"
                     /protein_id="BAH47244.1"
                     /transl_table=11
                     /translation="MSTPLKKVADDQLTASGMAAEQLDDVDAKYVAAGVKNVLSNLKA
                     RRAWENHIGAILTHKQAVDATGWTKQALSQAVKESRVLRLEAADGTIGYWSGGLTDTA
                     PHVPIRGIKDVLKVWAHADVQSWTIASWMSSPRPELDDRTPRQALLDGDTVDVVTLAR
                     QVAERLAS"
     CDS             235314..235475
                     /codon_start=1
                     /locus_tag="ROP_pROB02-02380"
                     /product="hypothetical protein"
                     /protein_id="BAH47245.1"
                     /transl_table=11
                     /translation="MVQKTCQSWRIRAALTSARSVTGEVYAVSVEGRSSLLRPAAVLS
                     HRIVASLQG"
     CDS             complement(235586..236221)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-02390"
                     /product="hypothetical protein"
                     /protein_id="BAH47246.1"
                     /transl_table=11
                     /translation="MTERTITTPDDNSAVNHSRGGSSSRRTRGDGSTTVDHHTRGIAR
                     TIRPLCRAFIAHPHHRRDMLIDIPGVEATHYQFAFKRLRDTRQSLPRERYRRVFYAPL
                     RIFDRPDETDDRTVVTLYAGRRDPAANRLIEPYRLFIDHTGWTDSRIRTLRRDLRDAR
                     DEAEDDYLNHAASKTWAFFIGSQDAGDPSVFLVDTPGHICFITAEITHPRL"
     CDS             complement(236619..237131)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-02400"
                     /product="hypothetical protein"
                     /protein_id="BAH47247.1"
                     /transl_table=11
                     /translation="MTDLPSLVQVVPLALGSSVLGGLLTAGISGLRETAGKRREGYTL
                     ATRTLVARAEYPYRIRRRTSDNPETLTALTQLGGDIQEQLTASRIWVSTESLRLGKIY
                     AKTIANIDAAVGPATQDAWSQPPVTSGNQMNLNGWGPGSQDDHITAFERAVRWRFGIL
                     RLIPFTPALP"
     CDS             complement(237128..237721)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-02410"
                     /product="hypothetical protein"
                     /protein_id="BAH47248.1"
                     /transl_table=11
                     /translation="MGTALTDLFADPGRAIARLTTMQAGIVVDRAWAPRIGGYVLDLT
                     FAPPPETATAGYHKERARISIREYGDPLTFPLGPERRWKHRYPAPLGADNDYWGQLCL
                     WFPNDPRPLKWVPEDGLEDYVDRVHRHLFLEQHWRRTDNWPTEDAPHGTPTTHNLPTP
                     SAMDTYPIASRALRRAVRTWQHRRPTNHEHDDLRKSR"
     CDS             complement(237706..238716)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-02420"
                     /product="hypothetical protein"
                     /protein_id="BAH47249.1"
                     /transl_table=11
                     /translation="MGHTVDGAFAEFDRNLNLDPQQREQAQHKHTAIRDVLDDAGFVA
                     TSFLQGSFARKTMLAPLKDVDIVIVLKDTHWEQLQGPDGPATAMAWFRRAIETVWPEA
                     EFDEGDKPSGKALRVTFPDISFDIDLVPAFDLDGADVLIGDRDQQHWEPSNTRRQLRA
                     VATRNQATGGRFVHQVRQLKALVKNHEEQLGFVKGILVESLAYAAIHTTKTDKRAVAE
                     SLEHAKNAVRGAVIEPAGDDDVTVKWSQSEREVAAGKFSDFAARAAEALDLEADGDTE
                     AAIDIWHSLFGDSFPAATPRSPGAALAAWNTVGSRTSTGRPTTSTSGRQPTRPGRAWA
                     PR"
     CDS             complement(238869..239150)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-02430"
                     /product="hypothetical protein"
                     /protein_id="BAH47250.1"
                     /transl_table=11
                     /translation="MAINITGIRLSGGTDHQHIARLWWTNPSAGKTGENTRAQIVAWI
                     ENEDGKAYVEDARGNRVDVGVVSPARGEKYLRTYADRVWTNNLLALPRR"
     CDS             complement(239298..240029)
                     /codon_start=1
                     /locus_tag="ROP_pROB02-02440"
                     /product="hypothetical protein"
                     /protein_id="BAH47251.1"
                     /transl_table=11
                     /translation="MVHEENGFLEYLDLQGDLPDQVTKSELLAQVREAGFSLSDRQLT
                     FYVTEGLVPRSVRVGTRAGTYPVSVVWLMKWILQARDAGVSIEALKELLPVWKFLIRA
                     QRDELLDIGGLESVARQHVTSYEASLGVPRVVSYVLMRACCPTCRGKIRVVYKDGTER
                     SLNDADATIGFAIARTPTDDADDAAAGTPQWWASARIALSIPSNHSTDPTTVILGVKP
                     NEALPPDPSDHPGHNQASTEEEEHM"
     CDS             240256..241461
                     /codon_start=1
                     /locus_tag="ROP_pROB02-02450"
                     /product="hypothetical protein"
                     /protein_id="BAH47252.1"
                     /transl_table=11
                     /translation="MKMSDAAVAVAEFGAEQWGLITSAQARMLGVTAVQMKRLADRGA
                     LERVHHGIYRMTRLPYDPRQDLRVAWVALDLHTPAWERLSQPFPGGVVSHRSAAHLHE
                     VGDLDADLTELTCRRRIRLRLPDIRIHTGTVAVDDWTVVDGLPVTTARRTIADLAAEG
                     IDGGHLAGIVRDALARELVSVPELESTLASSAFDYGHVLGDGRPFLDSLIAQAGVSQN
                     TLGLADAYRRSTKASAAHFATDHRAGPRLPDRPSAALATRSVADLDRDDRVLPFAFAA
                     STGRFDELLKRSNDARVADALGGLAVTQLAPLGEQLRALAAAAAGPPEMEAARTALLQ
                     SLQTPSTDMMTTSVAKAIEPVARRAAANMAARLRGEQQPPNQAAGTGDPTPDAQDGDT
                     ERTGRPRHE"
     CDS             241472..242389
                     /codon_start=1
                     /locus_tag="ROP_pROB02-02460"
                     /product="hypothetical protein"
                     /protein_id="BAH47253.1"
                     /transl_table=11
                     /translation="MTQSPHQFRASIQQRLKNRSASSGQPLQQLRRTYVMTRFLARVF
                     DADPDGWVLKGGTGMMVRLPKARYSKDVDLMSTAFTDIADAIDKLREILRHEVDPFTY
                     TIARKEDIADDKGARISVQVRLGTTVFDNFPIDLVTHRGLVGPVEIHPIPHVIDLGDT
                     VEPVRVRVYPIADQIADKLCAIYEYHLRNGQPPPGDTSTRYRDLVDLLLISQSLPIPL
                     GQAVEALENQRRVRNHMELPPELRTPGPDWHDNWPAQAKGSPLPDSLHELNAALTAAA
                     GCYNSILAGIPTTSREATWDHLRQQWAER"
     CDS             242520..243290
                     /codon_start=1
                     /locus_tag="ROP_pROB02-02470"
                     /product="hypothetical protein"
                     /protein_id="BAH47254.1"
                     /transl_table=11
                     /translation="MIGTTVPRMPRLTEEQKKQRAADKVMRHALEAEERDRRETLKRL
                     EWEKNGTYLTRAEFEANMPCRGCGRPFIDNRGPWPAQIHMTPAESAEYAAENKYYLDR
                     HRDCQAYRTGIDSSRITHCGFCFPPPPLSSRQIDVIRKEFGRASKTPEHELDIWKSTL
                     TCGHTVQGRQHRTSTSRTIAVEDCPECSARRGVVRAERIGPAAPPPHQTVPDQPIVTA
                     AEFDAIKLVEEHKVALRLAEDRLKQIRRDAHRGVSFED"
     CDS             243955..244311
                     /codon_start=1
                     /locus_tag="ROP_pROB02-02480"
                     /product="hypothetical protein"
                     /protein_id="BAH47255.1"
                     /transl_table=11
                     /translation="MFLSVQVPPRAARAILNVLLTAVGPDRVLVDEPVPLTPGWPAWD
                     LETALRGLRDVGWTKATKLIARKRPRLYPIFGFGGNAPTVSIRTAQSGAGHRAGACES
                     GAGGPLRRRRRWWRGS"
BASE COUNT        44323 a        78519 c        78796 g        43359 t
ORIGIN      
        1 cgcggcgctg ctcccggcgc tccgcgccgg gagacggggc gagtcgcttc gctccccgcc
       61 agggagccgc tgcgcggctc gcggtgggtc cattcccgtt gccgacgatc gagtcgcttc
      121 gctcctctga gtttccgaga ttaggctccc accaaagctt ttcatcggca cgtttgatcc
      181 ggtcccccac agccgaacga ggctgtggag acggggtggt gcgcccggcc cgccgcccac
      241 tcgccttcct gtgccgctcc atgtcatacc cacagcatac cacccacccc cacacaaccc
      301 aaaacatcga aaacctcaaa tcatctaaat ctgttgatga acaacaactt ccaaacctta
      361 caagctgagg tttgtgcaca aaacacgtaa agacctattc accaactaat taccgaaaca
      421 tgttgcaaat caacgtcttt caaaaacgac tcaaaaccgg acgcaacaga cacccgcgcg
      481 cccgccggaa ccccggcgcc gccactcccc gaacaggtcg ccggcgcccc cacatcacaa
      541 accggggaca tgtcatcaca ccaggtcaca gcaccattac ggccgcgagt gccgaggtcg
      601 cgtcgatccc acccataacc acctacacac cgcccagaat gggcagcagg gaattcagca
      661 gcggttcgcg tcgctcgcgg cgacgcctgg ggaggaagta cgtcatggtg ttcgagagat
      721 tctccgatca agcccgtcaa gtggtcgtcc tcgccgccgg cgccgcccgc acccaccacc
      781 agaactccgt cggcaccgaa caccagcccg ccccagatct tcgacgccgg cgccccggag
      841 cggcagcgct gacctcatgg ggtgtcaccg cgccggccct cgagagcaag ctcgcgggtg
      901 ccagcgcacc ggcaggctcc gctccggcgg ttgggcacat cccgtgcacc ggcgaaaacg
      961 aagaaggtcc tcgaggacag cctgcgccag accgccctgc tcgggcacga agaggatcgg
     1021 caccgaccac cttctcctgg ccctgctcga cgaccccacc tccaccggcg ctcagatcct
     1081 caccgacctc gcatccctgc ccatcagcga gatgcgtgag cacctcagac gcgaactggc
     1141 ccagcagccc actccaggtc ccgcacaccg catccccatt cggctcagcg acgacgagta
     1201 cacccgcgcc cacgctgccg cccgcaccgc cggccagaac ctcgaaacct ggatccacaa
     1261 ccgcatcacc gacgccctcg aacaacccga atagcaggtt cagtccacac acccaccggc
     1321 gggcgaccga ggttctacct actgacaccg gcaccgagac tgccgaggca caacacgaac
     1381 ggcccccacc accgcaaacg gtggaggggg ccgccccacg acacagacgc gcctgcatcg
     1441 catcagcccg ttttcacccg actgccaagc gcactagtcg ctccgctggc cggagaagga
     1501 agaccggacc gaacctggac gtcacgctac tgcgaccatc cactcacgca caaccaccga
     1561 aaccagcacc gggctcacac cgggacgtgt catctttcct ggtcagcgcg ctctccgaag
     1621 ccgcggtttt tgccgtccat ccacgcgatg acatcgaaca cccgcagtgc cgagacctct
     1681 tcgggaaggc cggcctccta ttcagtctcg aatggctcgc gcggtatcca ttaggttctt
     1741 tctggcctgc acataccctt gccgcggttc gtcaacatcg ggtggcgacg gctcatcgga
     1801 aaggtcaccg ttgttctgaa tataggcaac ggtccggctc aaaacagttc ggttccagtc
     1861 aatgaccgac tcgccgaact ttgtgagggc tgtgtgcagc tcatctagag ccgtcttggc
     1921 agatggaatt actaactccg cgcgcgcaat cgcgttcagg agcgcggttt cctcctcgcg
     1981 gaacttccga atccgggagg caatttgttc ccatatctcg tcctcatcgt tgtaggtcga
     2041 gtacattcgg atctcgctct cagccgcgtc aatcccgacg aacgcatggt ccgccgctgc
     2101 gactgcctcg acaagggcga ttcgttgctt ttctcgctgg tcgacaccgc gggttcggtt
     2161 cgaccatatg aggttgaagg tctgagtgat aacaatgccg ctgagggtgc tacctgccgc
     2221 aaggattgcc gcccaacctg gggtgaagta catcctcaaa caattacacg agcgatcgca
     2281 ctcacgctgg tcgggatatt cgggtaagtc atctacgcgc tgcaactggc aacgcaatcc
     2341 cgcgctaacc gttacccggt ggcggcaccg gtttcgggtg atgtggctga caaaccccgc
     2401 cagcacagtc ggggcggcgc tcaccgtcta cgtccgccgg ggcggcgcgg taaccttcca
     2461 caaccacttc cgatggcccg caatcacacc ccagcggcca ccggccggcc gccagctacg
     2521 gctcgaacta ctgaccattg ccgccgaggc cgaccaactc gtcattacct tcacgacaga
     2581 taaacgcatc gccaccacgt acaacaggga cgggtggcgg gcacccaccc ccgccgaacg
     2641 tcacgagtac acgatcccga caaccacgaa acaaaacggc gagttcacgc gctgggatct
     2701 gctgttcgat cctcacgacg aaaaatgcgc agccaccctc acagctgcac gagccgaact
     2761 cgctacctga gagacgcagc tgtcggtggc taggcgccgc ggcgggcacg ggcgccctcg
     2821 accacggacc gctgaagcac ccaggtaccg cccacacggg tgaccggcag cccttgccct
     2881 tgatggcctt cagcacgccc tgacgggtca ttccgaggcc gtcggcggcc tcctgcaccg
     2941 acaccagcgg cgggcggcgg tccatcgcgt cggtgaggcg gtcgagatgg aaccggaacg
     3001 gatcctcgac accgcacaga ccagtaaccc gaacgcgacc caggggcaaa tatcgctcga
     3061 gacttccagt tcggggcaag atcgagacct tcacccgtca aacatttcgc ccaccacctg
     3121 tcaatacgct gggtgaatga gtccaacaaa tggtgaagac tagccgcttc gcctgcagac
     3181 cgcggttcgg acgcggagcc gtatattgat gcgatgacca caagcacgca aagcgctcgg
     3241 agactaacgc cacgctcccg cgtcatccag tggacagtcc gcaacttcaa agcgctcgag
     3301 catgcgacgt tgcccctaga cagattgaac gtgcttgttg gcccaaatag ttccggaaaa
     3361 tcgagcctta tccaaagctt gttactttta gcgcaaagca ctgatgatga agtaatcctc
     3421 aacggcccat tggtccgcct tggcgaccct ctcgatgtca taagcgcaga ttccgaattt
     3481 gtatctcttg gttttgtagt agacgggaca agaatccccg gagccgacga atcgacaagc
     3541 aacgtactgt tcgaagtgac tttgagtcac cagcacggat cgctcgtagt ttgcgaattt
     3601 actgcagtcg aggaaaacac tgaccggata cttataagag caacatccga acgagtcaat
     3661 gccggaattc gggccgacgt cacgaaggac tcgcgagtcc acgaaacagt cctccgcgtc
     3721 cgagagatta acggcagcga ctcaccctca tcaacattca ttacctttac cggcctattt
     3781 ccggaagctt tggtctacaa aagcactcgg cagcaggtgc tgtccgaatt gcgtagaggt
     3841 atacgtagcg ccagaaacga ttccgattct gaacttgcat tttctgcgac gtatgaagta
     3901 acacagtgga tgcgccgcaa tatagacaaa atgcccgaag aagtccgtgg catcgtgaca
     3961 tcaaaatcac atggggcctt ctcgcaactg ttcgaattgc cgcgcactgc cttgagcgag
     4021 ctactagacg cattcgtcgc ggccgaagta tccgaaatcg aatgggcacg agtatcgatt
     4081 accaacttcc ggcgccttgg gacccgacgt atccgatcta ccgcactgct tggacttagc
     4141 cctaaacgtg aaaacgttgt ttcggtcctt gcactcgctt cagatgctct gctggccttc
     4201 caatcttcga ttcgctacct tgggcccctc cgtgaagagc cgcaggtggt ttccccgacc
     4261 ggcgccagat atcgcgcgtt accggcagga cccaaaggtg aatacaccgc cgatctcttg
     4321 gccagaatga gggtaagcga gatccgttac ggcgattgga acggcgagat tcgcgtcgga
     4381 acagtgtccg aggctcttac cctatggacc gcctaccttg gggtcgggga cgacgtctcg
     4441 gttgaagatc aaggaaaact gggcagagga cttcgcatcc gcgttaacgg gatcgagcgc
     4501 gaccttacaa caattggcgt gggagcgagt caactaatac ccgtcctaac cgttgttctc
     4561 actgctcctg ccggttcaat agttctcctg gaacaaccgg aactgcatct gcacccttcg
     4621 gtgcaaagtc gtttggcgga ttttttcctt cgtgcacgca tcaacataaa attggtcgta
     4681 gagacacaca gcgagtacat gatcacacgg attaggcgcc gtgtagtaga gaagacgaca
     4741 cctgccagac atattgcggt tctatttgcc gagcaacacg atggcatcac tgaaatgcgc
     4801 cacctacacc ttgaccgcct cggagacttc tctcattggc cacgcgcttt cttcgacact
     4861 caggacgaag aggcacgcgc ccttgtggtc gctgtcagaa aagctattga ttctggacaa
     4921 aagtcatgaa actgttgctc gatccccgat tgctgatttt cccgtcagag accagcgacc
     4981 ggaagcagtt gattgaaata tggggaagaa ttgtagattg gtcttcagac agtcgcatcg
     5041 ctataggcac cgaatcccta gaacatgtgt ggaatcactt cggggaggtc ggatatcccg
     5101 agaaggactt agcaatgtac ccgccggcac tacgaaacga gtacaggcag gcattgaata
     5161 aaataatgtc gcgcattatc gagcactgta atcaccccac cgagcttgat gtgcgtccgg
     5221 agtacgtcgg aagtgaggaa cagaagaatg cgttgactcg cgacgtcgcg ggcacagccg
     5281 gagggtcgat cgtcggcatc gcgagcactc gatcaagctg gagcgaggat tgcgtaaaag
     5341 tgtggttcac accgccacca cctagcgaac tcgaaatatg cgttgatgca cgctcaccac
     5401 ttgcaattga gactcgagcg accgtcgaag ccgccctgcg cggaagacgg gttcacatag
     5461 tcggcggcaa gccgaatcaa cgtatttata aatcgatttt tgaaatgacg gggatccgag
     5521 agtcggacat acactggatc gctgcggaaa agtctaagcc tccacgggat ctagacaaga
     5581 agtggggaag cttaagacca gaccgcgaca tagctatatg catcacgggg aggatcggac
     5641 atgcacagtc agaaagggcc gctacgactg ccgcaaaggc cggggttata tacctcccac
     5701 tggaatcggc taacgaaatt gaatctgcat tagttgaagt gattccgcgc atgagggaag
     5761 cccaaggctg gcgtatcagc gagaaagatt gaattgccag ccttggattt tgttttatac
     5821 gtagagcagc atcctcactc agggacgccg cgagaaatgt cgaggacact ggcgagcggg
     5881 gtagaacaag gtcaacccca ccggctttgt ggtgattcgg cgaccgctca cggcttccgg
     5941 ttgccgagga ttgctagcac aagcgccgga aatcttacct cccaatattc gaatagccca
     6001 cggtcttgcc ttcctcattc aatacttcca cactatcgcc tagaaaattc tcgacaagcc
     6061 agtcatatac ctcctcgcaa attgcgacgt agcgcgccgg gtctagtttt cgaccaccat
     6121 gcatttttcc gtgcgcaacg tcattcctaa cctcaagcaa atccgacaga atatcacgtc
     6181 gattgctgtt caagaatttt tcgaatgcag attttttctc gttcccaaac cgtcctatta
     6241 atgaaataaa tggattcacg cgtaggttag gtgcatagat aaagctcgac tttgagaact
     6301 caagaatcgg cccgctagat ttctgcacta gataggaggt tagtatgaca tgggttacct
     6361 gctcaagaaa cccagcacac cggagacaaa gatatttgcg caggtcttcc tgcaacttga
     6421 gttctgtcat cgggatgtac cgcaaactac gaagataccg ctcgtgctcg gatttcaagc
     6481 ttgtccacag agagtgtgcc tccgcacgtc cagctatcac aactccgcgg cctcagaaaa
     6541 tattgatctt gccacagaaa gacgaccatt cacgctatcc cggtgtgacg tactgcgagt
     6601 aacatacgct cggtattcct ccgaatctcg aagtttgtca aggctttttt tgagctcaga
     6661 tggagaaatt gatcccccac ccagaaagat actcattaaa tttgccagtg ttgcatccac
     6721 atgcgcagca ttgatggtcc ctgagtacct taaggcatta ctgcccgacg ccgccaccag
     6781 cgccgatgtc gatttagcga aagcatccga aagttcagca gttggagtcg acttcagatc
     6841 gcggttgtct ttcagatagt tattcaagaa gtcggacatg ggaggacgat aagcactggt
     6901 ctccccgttg cccgaccccg acgtgctcat tgcccgcagc agcgccagcg atcttaggat
     6961 aagctcatga tctttaagtc gtttatgggc tggcccgaaa agccttctcc aattttcgtc
     7021 atgatttaga tctcgtatcc agtcgacaac cggaccgcga tagagtgcaa ctcggatttc
     7081 ctgagccgtc aaagataccc caccactatt tagtctaccg aaaagtcgat aaattgattc
     7141 gcgaccatca gggcctttag gctcaataac ggttgcttgg ataaatgtat tgtttaagcg
     7201 ccgccgactc tcactattta gggtttcata tgtcgcccct tggagatgct ccgcaacttc
     7261 gttgagtgaa aattcacggc cgttgggata cttgcccttg tagaacgact cgagagcggt
     7321 caatcgttgt tgtccgtcta ggaccaagta acgctggtcg ggttcaagga caagaaaaat
     7381 gcttggaaca ggccatccta atagaagtga ttcgatgaac tgttccatct tcttaggagt
     7441 ccagactccc tgccgctgga atccggagat ctcagatccc gccgattcgt cagggtcaaa
     7501 ccgcggtact acgatatctc cctgctcaag tcgacgcacc aatccagcca cgtcgaaatc
     7561 tgcacctaga taggacagtg ttgaatcacc tagatctact aggccctcgt cgtccgtgac
     7621 actctcgtca ataacgtcgg ggtctgggag gtcggcgctc gtttgcatgc gatcaccata
     7681 tccgcgggga agtgcagatg gtagttctct gcgctcgcgc cctccaactg cggaggggac
     7741 gcgttccccg tcagccttcg ctgttactcg cggaaacgcg catgcttgcc ggtcttgctg
     7801 gccacagcgg ttgcgccagg gactcacatc catatgccga tctggcgccc ttgtcagata
     7861 ctggcaccac agctatctga cgttgctatc tcaatttgtc ctcacctgcg acagcgcaaa
     7921 ttcgtcacaa tggttttttg agctgaccgg acacggccca aaggagttgc cctcgatttc
     7981 acggaaatgc ggcttatgtg agagtagacg ttgctcgaac ataaattact attgaaaatg
     8041 tgacgtagat ccactaggcg cccggcaatc ctgtgttgcc cccgcagtcg ttccatttat
     8101 caggtttcta gctgactcgc gaccgaaacg cggtgatgta ttcgtgacgc tgatgatcgt
     8161 cttgtccggt gaagcctttg aactccccca gccggtagga cacgcccgac ttcgtctgtt
     8221 tgatgtccac ggtgaagtcg cgggacaggt tggcgatccg ccgttcgagg tcgtgctctt
     8281 ccaccagtcc gtcggacagt ttgagaagct ttgttgcggt gacgaatccg tccgtcgatt
     8341 tgaggatgcg gtagacggcg tcgtgcacag tctccggcgc gagctccagg atttctcggc
     8401 gggcggcggt cttgtcgaag gcggcgacga tcgacttgcc gatagcctgc gccaccggcg
     8461 gggggaacgc gtttccgatc tgccggtact tcgcggtctt gcctccggag aattcccatt
     8521 cgccgtcctt ccagccctgc agccgggcga ccatcggcag ggtcagcttc ggcggcacgt
     8581 ccgccgggtg cggggaatcg gctgccgggg ggtcgttggc aatgcccatc ccgctggtgc
     8641 cgagctcgag ccaggcccgc ttggcacggg tgggaccgag gtcggcgccg ccgtgttttt
     8701 tgctgccgcc gaccagggtg ggtgcgatgt cgttggccag cgcggcccag tcgtcgacat
     8761 gctgccaccc gtccacgccc atcaggtcct tcaatgccga cccgacagtg tcctgggtgg
     8821 gggttttctc gggccagtgg aagtaggcgg cgtcctcctg ccgcagtgcg acgaggacga
     8881 acctcgggcg cagctgcgga accccgtagt ccgacgcctg cagtagccgc cagtcggcga
     8941 cgtacccgaa ttcggtcagc cggtcgagga tccgctgccg gtaggcggcg aaccgggggg
     9001 cggagagccc gcggacgttc tcgagcatca gcgcccgggg ctggatctgc ccggccgtct
     9061 ccaccgccca ggcgaacagg tcccgctcat cggaggcgcc gagctgcttg ccggcgatcg
     9121 agaacggcgg gcacggcacc ccaccggcga ggagatcgac tccctcgtgt tcgctgggct
     9181 tccataccgt ggggtcggcg acgtcgccct cctcgacgtc ccagtccggc cggttcagct
     9241 tcagggtcgc gcaggcgttg gtgtccagct cgaccgccag cttgtgcgaa aagccggcct
     9301 tttccaggcc cagagcctgg cccccggcac cggcgcagat ctcgacgacc tggtagtcgg
     9361 acctcggcgt ggcgctcttc ttcttcgctg gcatgggccc catcttccct tacgcggaac
     9421 tgttcgatga tatcccctcg ttcgaacacc cgtttgatgc tgccttgttc ggcgtgtcac
     9481 gccgagcagt gtcgccgaac agcgtcgaat attcgccgga cgttgccgca tctcgaccgg
     9541 cgcatttgct cggacgagca ggtagttgtt gttcggggcc aaccggaccg gagcccaatg
     9601 acccctcgcg aaaggacacc gcccgtgacg aacggagaag tgcgccgctc ctcgcgggtg
     9661 ctggttgccg agttcatcgc cggaatcggt gagggaaaca agttcaccaa actcgacctg
     9721 aacagggcga tccccttcta cgcgcagaac gaccggcgca tgcgtgacct gcgcgaatgt
     9781 gggtgggtca ttgacaacta caaggtcaac ccgtcgctgg caccggacga atacctcgtc
     9841 cggcgcatcg gggtccggat cgacctcggc gaacgcccgc ccaagcccgc ccgcaagacc
     9901 gtcggcggag ccaaacgccg ccggatcctc gaacgcgacg ggcatgtctg cgccatctgc
     9961 ggcgtgcccg ccggtgaacc gttccccgac gcccccggcc ggcgggcggt gctcaccatc
    10021 gggcacctca ttcccgtggc ccgcggcggc accgacgacg agaacaacct ccgcgcggaa
    10081 tgccagcgct gcggtgacga gtcccgggac aacaccctcg acccgcccac caccgacttc
    10141 gtcctgaccc gggcgaggaa catccgcagc cgcaaggaga agaagcggct gttcgcctgg
    10201 atggtcgccc gccgtaagga ccctgacgac accgagctgg tcttcctgga ctggtgccgg
    10261 cttccccact ccgaacaact gcgggtgatg caggaattcg gccgacaggt cctcgccgac
    10321 gacgagggct aaccgccaca cccctattca ccacccctta tgaccgcgag gtgcaacacg
    10381 caccccgcgc gatcacacct gcgccgaacc ggcgcgaatc agtttccgga aaggaacccg
    10441 gcctgtgacc accatggacg ccttcgccgc cccagacccc gaaatggagg ccgttgcaga
    10501 cgaactcctg cgcgccgacc cggacggagc ccgctgggcc gccgtagtcc ggcacaccta
    10561 cgacatgatc tacaacggcg ccgaaaccgg gcgctaccgc tgggaccagc tgatgaaaac
    10621 cgagaagacc cacttcggga cgttgttcga gatcaatgcc cagcgcgaat tcgagttcga
    10681 cggtggtgac cagacggact accgcattgc cggtcaccag gtcgatgcca agtggagcca
    10741 gaaagaaggc tcctggatgc ttccccccga ggtgttcggc cgcctcgctc tggtcgccac
    10801 gggtaacgac gaacgcgcga tctggtccct cggcctggtc cgcgtccggc aggagtaccg
    10861 ctccgagggg gcgaaccggg acaagaagac caccctcaac gccctcggca gatcctcggt
    10921 gcgctggctg tggaaggacg ccccgatgcc cgccaacatt ctcctgcagc tcccccgacc
    10981 cgccgtggac gacctcttca cccgcaagca cggcacgcag cggaccaacc agctcttccg
    11041 cctcgccgaa gggcaactgg tgcaccgcag cgccgtccgc accgtcgcga tgcaactcga
    11101 cgaccagaaa cgcgtccggg ccaacggcgg cgcccgttcc gccctcgccc ccgaggggta
    11161 catcattctc agcggcacct gggagaagca gaagcagatt gccgcagacc tcggggtccc
    11221 cgtacccagc aggaaggaat acatctcggt gcggatcgtg ccctccgacc cgggcaccgg
    11281 cacagagatc aagggcggac actggcggcg ggccacgccg ggtgagaacg tgaccgaacc
    11341 ggcgccgctg ttcgtcaagg acgacgaata ggaagagcca ggggcaggcg aacccggcca
    11401 gcaccggaac agcacgcacg cgattccgga gctgcgggtc tggccacggc ggttctccca
    11461 tgccccgccg gggcatggga gaccgaacgg cactcgcgct agcctgcgga catggcatcc
    11521 gagacgcgac cgccgaggag cggacggggt gcgccgagcg acgacgtcgt ggcgacatcg
    11581 gcgggccggt cacgcaacat gcaggccatc cggcgcgccg acaccaagcc agagatccgg
    11641 ttgcgatcgg ccctgcacgc gctcgggttc cgataccgca aggactaccc catccgcatc
    11701 gacggcagac tgatccgtcc ggacatcgtg ttcacacgcc ggaaggtcgt cgtgttcgtc
    11761 gacgggtgct tctggcattc gtgccccgaa cacggtcgca atcccgcggt caatgagcgt
    11821 tactggtccc ccaagctgcg acggaacgcc gagcgagatg tggaacagac ccggctcctg
    11881 gagtcggcag gctggcgcgt cctgcggatc tgggaacacg tgcccctcga cgacgcggtc
    11941 gccacggtca cggcttcact cacctaagcc gatcaccaag cgaccgctca ccggagacgg
    12001 cagcccttta ttcgctgcca tcccgaccgt gcatttgtca cacaccgcgg gtgtatagac
    12061 accatgctag ggtgtctata cacccacgga aggaccacga aatgcgcaca ctcaacgact
    12121 ggatccccgc cctcgccgcc aaatacggca cccccgacgt cgtcatgcac atgaccgctc
    12181 agcgccaggc cggagacctc ggaatcgcct gggcaaagga catgcctgcg agcgacgttc
    12241 aggccgtcat cgaggccgtc gatgcccttt actccaaatg agcaaaggca caccgcagaa
    12301 ggcgattcgt gtcgacccag agctgtggga gacggcgaag cagatcgcct atcgacgcga
    12361 tgaaacaatt tccgatgtga tccgacggtc acttcaggag tacatacgag atcacagcta
    12421 acgagcgacg gcaccatgcg acctcaccca cgctccggcc gagcgcacgg tgtaccgaaa
    12481 gttgttgaat gccgatcgaa cccggcctta cggtcgtgcg aagaagccca gggttggatc
    12541 tgcgaatgtg ccgatgacta gaccacgatc taggaagcgg ttgaactctt cacaactggt
    12601 ctcgggcagc agcgcgcagc cgtggcaggc ggcgaggttg catgactcgg gaccttgccc
    12661 gagctcgcca acttccatgc agacagggtc ggtcgagcac cagcgggcct tatcgattgt
    12721 ggcttcgaat acgggtccta ggttttcggg tcgggccatg cgcaccagcc cacccatcgt
    12781 gccttctgaa tcaccagctg cggtatagat cagtacacca gccatctcac ggcccggctc
    12841 accggagacg tacaggcgtt cgcgtagcgc tgcggagctg tagccgcagg tgaagaccag
    12901 ctcgttgatc agcaggtgcg ccagggtgtg caggaggatc aggcgtggac tcaggtcgcg
    12961 taccggcccg tccgttccat gccgggaggc gacgtagtgc gtgctgatcc gtctcgcgcg
    13021 cacccggacc tcgtccctgt tctcccaatc ggatagcgct tggctgttga gctcgaggta
    13081 gaggccttcg cccttgacca cgcacgctgg taaccagtcg tggtcgggag ggagggcagt
    13141 ccggcgcagc atcgccttgc cctcgctgag acggagcagg ccgtcacgga cgcgggtgaa
    13201 accccgcagc gcgcgggtct cgcggaggac ttcgacgcgg cgcacccgat cgagtacctc
    13261 gacgaggcga tccggcacgc cgggatcgct ggctttcagg tcgggatcgt tcggtgtttc
    13321 acggagcagc ttgaattcgg gatagcgcca ggtcaccgtt gaggtcaagg tttccgtttc
    13381 gctgggtctg tccgttttct gactgttgcc gagaagctcg tcgagtcccg ccgccagctc
    13441 gtcgtcggag aaggatttga gtagctcaag gggagtggtc ttcctcaagc tgtcggttgt
    13501 cacctgtccg acgatttcat ggatcgccgt gatcctggcc tgaacgtcgg gacgccggag
    13561 tagctccagc acttcggcgc tcacaccgcc ttcgtgtcgt ggcaggtata tcgaggattc
    13621 gaccttcggg aagtagacat tgccggcggc ccgcagcgct ccgcgaaggg gaaggccgca
    13681 gccgctccct tcatcggcaa cccatgggcg actgccgaca caattgaatt ccgcgcctgc
    13741 ggcgagatgg ctggacagta tcgtgcgctc ttcgtcgccg cgtttggccg ctgtctgtgt
    13801 gatgccctcg agtgagcgtt gtgccttgca tccgtcgcac ttgacgagct gccctgcaag
    13861 ggtcccgccg ccctgtgaca gcaggcgcag tgtcccgtgg caggtgggtg agagcgagtg
    13921 gtggacccac tcggggaacg ggaaatcgtc tagatgccca cgctcgcaga tgacgatgaa
    13981 cggtacctgc gacatgactg gtcgccgtct ttcgtcgtgg gtgttgtctg tgcagcgaac
    14041 gagttgggtc atgctcagct tggtccggct gagtcgtttg cagtagatgc aaaaacacca
    14101 gcgcgggaac cgcaggacag gaaccgagag cttgagattg cgctgttcgt tacctccgcc
    14161 gcgggggcgg cggaagtctg gtggcaatcg cagctcgctc accctgagcc gctcttgaag
    14221 ccgccattcc ggtacgagaa actcgtcggg gtacaagttg tcgcggtcgt cggactcgta
    14281 ccagtgatcg agtccggctg tgatcaccga gctgccattg acgaggatgc tcaaggcacc
    14341 gacaccaaat gggctgacca gttgcgatct gcgcatgttc ccggtgctca ttcggactcc
    14401 tctgtcgtgc ttgctgcgtc ggcggcgtag gcggcggtga tccgcaactg acattcggcg
    14461 tcgacgttgc gcatgcttgt cggtgtgtcc cagatcgtcg gtaccagtgc gccgggctct
    14521 tgggccgatc cggcccagcg catcaggccc tgcatcggat cgccgccatt tacgttggcg
    14581 ctccactctg tgcgctcccc atggcgccat tcccgggcgc gccggtcgat caccgcgtcg
    14641 agagtgggta gctcggccgg gtctgcgtgg gcggcgcggt cgcggatgag gccggtggcc
    14701 acaccgaaac gggcgtcggg aaacgggtcg ggtcccaatc gtgtctcggc ggactggcga
    14761 atatgggcga cggtggcacc gtgtaggcca cgtagcagca ccggcagggc gaatggcgtc
    14821 aggctcgtgg gctcgacctg cgcgtagaga cgctggtggt agctgcggaa gcgctcgtaa
    14881 tggctacggt cgcgtggctt ggcggcaccg tagattgtga taaccaatcc gggccgctcc
    14941 caccatcggc ggccgacccg gccgctcacc tggatgtact gagcggtggt ctttggctgc
    15001 ccgatgatcg tcatgagacc gagccggtcg atatcgacgc cgacttcaat gatgttcgag
    15061 gccaggcaga catcaacgca gcagtcctgc ccgtactcct gctggagctc ttctatcgct
    15121 ttcgggatct cgtcactgcg ccgtcggctg gtgagttcta gggtgttccg cggccagcgt
    15181 atgtccgccg cgatgagccc atcgcgcttg cggatgccag tgaggtagtc gggtatgtcg
    15241 gactgcagga gcgagacggt gttgccgagt tcgcgcaggc tgttgaggaa gttgagattg
    15301 gtccagtagc catcgcgatc cgcttccggg atcttcgtgg ctccttggag tgtcgcagcg
    15361 gcgacgcgga cctggaccgt ctggatcgaa cccagggagg gactcatgac accgaggtag
    15421 cggcgaccct tggcctgggt cccgtcgggg agcgtggcgg tctcggcgaa gaaagacttg
    15481 ccctcctcga gcccatgggg tggaaacagg gccacccgtg tacgcccgta caggtcacgg
    15541 atttgctgct cgtagcgccg gatggtggcc gtggaagcga tgatcttggg gcggatcggc
    15601 tcccggccgc gatggtcggt gcagaggtcc tcgataatag cctcgtacag gccgaccatc
    15661 gatccgagcg ggccggaaat caggtgtagc tcatcctgaa tgatgaggcc cgggggggag
    15721 acctggcggg caccatccga accaaggcca aacaggccgc gggcgttcgg ctcccaggcg
    15781 agcatcgcga acttgtctac agtgccgatg accaaggtag ggcgagtgtc atagatgtct
    15841 tcgtcgacga cgtggaccgg gaggccctcc cggttgcgca tgccgaatcg gcagttgccg
    15901 tctgggcaga tgaaacggat cttcgacccg gccaccgtca tatagccgat tggtccctga
    15961 ccgcctgctc tccgagagtt ggacgcggtc ccggctttcg ttgctccctc cggcggcccc
    16021 atctgggcgc cgcaccaggg gcagcgcaac aacaggaaag ggttctcctg actgctgtct
    16081 tgccgcagct tgccgagcgc ggttttggct gccgcccacc ggttgggtgt ggtggcactg
    16141 ccgagccata ttccgatgct gaagcgctcg gtcccgagat ccgctgctcg cgagcgaatg
    16201 tcgtccatca cgcacagcaa tgaggcggcc cgcaggaact gttgtgcggt cagcagccgt
    16261 agcgtgtagc gcatgagcac gtcggtgccc gcgtctgccg ggttgcggag tcgccgggcg
    16321 aacatgctga ttgccgccgc acccagatag gcctcggtct tgccgccccc ggtggggaag
    16381 aagatcaggt cgaccagttc gcggtcggct gtcgacgggt cgaagacgtc cggcaggctg
    16441 gccaggagaa aggcgatctg aaacggtcgc caggacccga tgccgggttc gggtacagct
    16501 gccggtgttg gcccggcgac ctcgaaaatg ccttgcctgt tgaggcttac ggtacggagc
    16561 gggaggcgcg agcggatttg ctggtagtac atggcttcat tggcgaggcg gaacgcgcgg
    16621 gcggcggcgg tgttcgactc cagcagtgcc tgcccggtcc gcatccgttc cagggcgccc
    16681 tcgcagagct ccatgtggcg ggccgcggcg tcgcggtacc gatccggcag gccggttatc
    16741 tcgttgcggc ggtcctcgat ccagcgggcg tacagaccga ggacggtctc gatctgccgg
    16801 tgcccgtccg ccgagccgtc ggcgagggat ttcatgctga cccgtactgg ttcccgctga
    16861 ccgttgccgt tgatgcagta gacatcgggt gtcaagcttg gcacctcgta ggccggcaag
    16921 gcctcggcgc ggaccgcgcc caccgtgtca ccgccgggct cgtcccagtc ggccgcgcag
    16981 ccatgaccga cggcgtaggt ccgcttgtgc cggtacagca gcgcgatgga cgcttcctcg
    17041 ttaccggatc cgcccggggt gtcgggctct gggtaggcct cgatccgggc accgtctgcg
    17101 gggcggacct cgaatccggc ttgcaggagc gcggcagctg aaccgctgcc gcttgtggtg
    17161 ttgaccagca cgatggtcac caggcggcac gcgggatcgg gatcgccggg gacgggccgg
    17221 gtataggcct gcagttgtgg ttgcacgcgc tcgtggcggg agagttcggc gtccagcggg
    17281 aacagttgtt tggcgcctct gaacagtgat tcagcactgg ctgtagcggt catcgtgaca
    17341 ggccggcgca gccaccactc gcgcggcgcg ccagcgatgt ggacaggcag cctgtcgtag
    17401 tacccgaaag aggcccgtat ttgcagcgac tgtcccggtg ccatgcggac acggaaggaa
    17461 acggccatgg cgctgggctg gaaggagttg gcgtcgctca ggtcgaagtc gtcggtgtca
    17521 ggatctggct gccgcgttgg cgtgaccgtg ccgctgggat cgatgtcgcg gatttcgtcg
    17581 tccgtcggaa gtcccggcgt tccggcgatg gtctcgccgg cggcctggct gcgggcggcc
    17641 gagccttgcg ggtacagcac gccgataccg tagcgccgta gcggctcggt ctcggtgagg
    17701 atttcttgac cggtcgtctc gtcgtaccag aggccgtgcg aggcgggcca cgagtcgaag
    17761 tgcactgcac cggtggtcgt gtcgatcggc ttgcctcgtc gcgtctcgcc cggtggaggg
    17821 ccgaacaact cgcgccggac tgccgcttcc atgactccgc gcgcttcgat cccgctcatt
    17881 acttcagacc tccaactttg gtcgcagcgc tgatcgcctt cccacaaggg acagccggtc
    17941 ggtggcgcgg gtgagaccga cgtaaagcag ggcatcgaat ccgggaaggc tggcgtcgtc
    18001 gatatccgtc aggatgatgg ccggtgcttc caggcccttg taggcatgaa tggtcgcgaa
    18061 gcgcaggcgg cctttccggg gctgagtgcc ttcttcggca gccaggatct gtctcagcca
    18121 ggtgtcggtg gtggtcgcgg cgagcgagcc gtcacgccgg gggctcagca gcacgatctc
    18181 gtccagctcg tagccctctg ctttcaggtc gccgatggcc ttgatgacct cggcggcctg
    18241 ctcgccgggc gcctcatacc agtagtagcg cggcgttgcg ccgtcgtcgt cgcgccggaa
    18301 ccgtttgtat cccggcgaca tcgccgccag cagttcgacc gtggaaccaa tgcgcggcct
    18361 gttccggcag ttggtcatca ggcggtggtg ggccaggccc gggatgcgct cgcgtagggc
    18421 atcccgcccg tcttcgaggt cgtagagcgc ctgccgctcg aagtcaccga agaagaggca
    18481 gcgaccgccc gccaaaccgc ccttcaccat caagtcgagc acgtccagat acgcgggtct
    18541 cgccagatcc tgcatctcgt cgacgatgag gaagtcacgg gtgaagtcac cgtcgagcaa
    18601 tcggtcgatg gcggtcacga gtagctcatc ccagaacgcg cggtcgggat gcggcggcgg
    18661 tgtcagcctg gtcaggcgca gcaactcgct atggaagccg ccggcctgca gcccggccga
    18721 cgccggggtg ctggcccgca ggtgccggcc gagcagccgg ttgaagcaga gaaggcgacc
    18781 atcagcaccg cgagcctgct cacggcgtga cgcctcgagc gccaagaagg tttttcccga
    18841 ccctgccggg ccggtgaaca ggacactgcg attctctgcc atggcatcga gggcctcgta
    18901 ctgttccccg aggaaggctg tcaactgcgt cgtacggtca tggcggaggt cggcggccgc
    18961 gatggtgacg tcgaagcggg gacgcagcgt agcagtgaga gcgccggccg actcctggct
    19021 cggctgcccg gggctctggc gcagtgtggg caaccggccg gtcaggtgtt cgcggccctt
    19081 gaccaatagg cgcagtactg cccgggcggc accggtgcgg aaatccgtca ggtcgagaag
    19141 ctgccactcg tgccactccg gtgaggccgg cagggatgcg cgggcccgga ggtgggtgaa
    19201 ccagacaccg ctcactatgg gcaccgcccg caggtcagcg ccccgcttct gcaggtattc
    19261 ccgaatgctg tgcattgctt cattcgactg ctggaacggg ctgcgcgcgg ttggcgggtg
    19321 gttgccgagc tgccaacggc catcgggtaa acaggttgcc ctggcgtgtg acttgatctc
    19381 gatcacggcg atgccgtgac cgggggcaac gaccacgaag tccgcctcac cctgggtctg
    19441 cctgacatgt tcggcgagtg ccagcgagtg cagcaccgtc cagtcctcgg cgaggggatc
    19501 agtggctagc cgctcgaaga cctggcgctc cccaggtggc gcatcgtggg caacgatggg
    19561 cggaatcatt cgagccactg ggcgctccga tccttggacg gacggcggat gtcgccccgg
    19621 tgcacaggtt cgaggttcgg tgatatcgcg agcacacggg tcgcgatcat gctccggaag
    19681 ccggggatgt tgagttctaa gcggaggaag ccgtcgcgat cgagcccggc caggtcggct
    19741 gtcgagatgg cctcttcgag gatctcgcgg atgtcttgac tggcttgcag tctggcccgg
    19801 cgcaggcttg tggccagctc atagtgcggc tccttgggca tgcctagcca gcgcagcaag
    19861 aacacgaagt cgttgccgtt ttgcggtcgc accatggtgg tgctcgtcca tgccggtgct
    19921 cggtcggcgc gcgtgacacc ggcctgcgcg agggactgga tggcagtgcg ggtgcccata
    19981 cggtcgagtt cgcggcggag cgcggccttc cattccgcct gggaggcgcg cgctgccgaa
    20041 ccgcgagcgc cgagtaactc gatggcccgg tcgtagagca tctcggaaac ggtcgatccc
    20101 tcccgcagga caaggtaact gcccaccgtc agggccgaga cgtcactgag atcgacgcgt
    20161 tgtcccggcg gtctttgcgg gtgcagggtc cggatgtgtt cgccggcctg gtcgagcatg
    20221 attgccagtc caccaccgag gaataccttc cgtgccaaca cctcgcctgg tcgaggtggc
    20281 cgcgaggggg cctgcgggga ccagctcggc tgcggcacca actggtcacc cacgacgact
    20341 ggaactgggg cgaggaccgg ttccgcgccg atcgtgaaga ccttgcggcg gggcctgatc
    20401 gcgccctccg catagtccga aattggcgat accggcaacg tgcggtcctg cacccacgac
    20461 ggcagcacgt aggcaagctc actggcccgc ggggccgaca gtagcccggg gccgaacagt
    20521 gagggcgatc cgacagcgta ggcctgctcg acgacgaacg cctgctcgcg aaaggtcgcg
    20581 cacagaaccg gcaccgcgat gccgagttcg ccaaaccatt ggcgggtcgc atcctgagtg
    20641 cgtccagacg ccgtaaccac aacacacgat tcgtaattca cttcagccaa cgattcgagc
    20701 agtaccgcgc cggtcgggcg gtcctcgaga tgtgcccgtt ctgcccggtc tgctagatcg
    20761 ctcagaagga gctgcgtcgt ttcatccgcc ccgcggattc gccgatcgca ggccgatccc
    20821 agcgcagcga cgagttcgtc ctctccaacc cggaagactg gtggggccgg gttcgtcgcc
    20881 aggcgccagc ggagttgccg ggccatggcc agcaggtcct gccagacttc aggatcctcc
    20941 tctcgcagcc gggcgatgag ccggcgcaga gcagcatcca gctgtgcgcc ggcgtcgtcg
    21001 gcgacggcat atagcgcgat ctcggctcgc gctagcaccg cggccgcccg gtagcggccg
    21061 gcgatctgtg tcagcggcgt catcggcatg tctcaaaggc caatgcttcg atccccgggg
    21121 gtgggtgcca accaatgtca ttgagggaga ggggaatgcc gcccatcgaa cgggccgcga
    21181 ggatggaatc ggcggcgaac tcatacgcag ccgaacgatc gacgatcgca acggttacat
    21241 cgcacgacag gtcgctgatc cacccaatcg cactgctgcc gtccaaaacc gtcagcctag
    21301 cttcgggtgg catgatcgct tcttcagacc tggctgcggg caaaatttcg ctgcgccacg
    21361 agggccgaat tccgtcgctg gggcgtaaaa gctcagcgaa gctattccag ccgggatcgg
    21421 aatctcctaa cccaattctg acgtccattt ccgaggtgat ccaagtcttt gtgccgatca
    21481 agacaacatc tgaccccgag gcgacctgtt cggctggcca tgcctcggca cggccggcac
    21541 tggtcaccaa actacccgcg aggggcacct tgagcttgcg gtatcggcta aaccgcgggg
    21601 ccggtaccag gtacttgatc ttctcgagct gataatccat ctcaccgcca tgaatctggg
    21661 ttcttccctt gaccacacgc gactcgtaga aagtctcggc caccaagcaa gtcccggcga
    21721 gtagaagaag gacaggcgtt ccccgttgca aggtaggcag cacggtgtcc ggtgaccccg
    21781 gtagctcaac cggtctggtc agcgcccagc ccgtcgcgac aaggacggcg gccagatccc
    21841 ttgttggcac ggtgatcgcg acaatcaatc gcctatcggc agcgggtggg ggccgacgtg
    21901 caagtcgcgc ccccagcgca agtatcgggg cggcccaggc ggcctccaca ggctcagcgc
    21961 catcattctc tagcagcacc aggccgcctg tcatctgccg tccccttttt gcgccgcggt
    22021 gttcgtcgca tacttaccat cggacgacga ctcgttgtca ttacagcgct gaggccgatc
    22081 agcctgggcg ccgcgccccg tctgccgggg tgcgtgcgtt ccgcgggcac agtctggttc
    22141 gtacagggtt gatgtgcgat cccacccgtt gggttcagtc cgacgcaccg cgaggtggcc
    22201 gcatgttcgc ctcgagtgca gccgtcacta tcggcatcgg ctagtgcccg caccaccgac
    22261 cagccgcaac cgatctggtt cggcccttcg atgctcggca gctgcgggca cgggctcccg
    22321 aaccgatacc gggtttgccg gagacggaaa cacccggacc gttcctgcct gccgatgcac
    22381 gggccgctcg tgccactcga accgccaacc gacgtacgtg atgtgattcg gtcgacggtg
    22441 cccgcgattt acggcccgcc ggcacgaaat ggaggaccac gatgaccgaa gacgactaca
    22501 tcgacgtggt cggggcacag tccgtgctcg aggtggccga agtggtcgcc gcggtgctcg
    22561 gggcccggat ggagatgggc ggtgaacccg gccgcatcgt ggtcaccgga gcacccgatc
    22621 ccgatcttcg ggttgccatc gggctggcga tcaacgaccg cgggctaccc gaaaggtgga
    22681 ccaggcggat cacgatcacc cacaaccgta gtagcgacga acgccaccgc tgggcacagc
    22741 acctacaccg cgccctcacc gaacggcgcg actggacact caccgtcacc cccggcggtc
    22801 caccgaaccc acacacccca cccccttcga atacccaggg gggatgaccc gctccgcgga
    22861 aagacacgcg ctagaaccct agacaccgcc ccctcgtgca cgccggggga gcaaggccgg
    22921 gtacagggcg gccccctgac cggcgggggc atcggcgtga ggaacatgtt gggggtcgtt
    22981 ctgacgccaa agcagccgca ccgccaacgc gtgcacgcca gacaccgagg atcctcacgg
    23041 gactcggccc gcgtggtcac cgagtctttc acggacggcg aggtcgactc gccggtcgcc
    23101 ctgctcgtgg gtcgactcgg cggccggggc gccgcggctg tggtagccgc cttcaccgcg
    23161 cagcgtccac gccgcacccc ggagcaccgg ctcacgcaaa gttgagctga ggtgaccgcc
    23221 gtcgccggtg tcccctgtcc ccgactgcgt tctatctgca acacacacag ctaattccgg
    23281 tcatgaacgc ggcacccaca ctggtcggtc ggccgtacgc tgaccccaca gcgaaggacc
    23341 gggcgcagaa gtggggcgag gcgacatgga cgaactcgac agcaaaaacc tgggtaggct
    23401 gcgccgaatc gcggacgccc gatcagtgtg gacctcagag tccggcgact tcacaccctg
    23461 gctcgccgag aacatcgacg ttctcgccga cgccctcggc atgtccttga tcgtcgtcga
    23521 taccgaggtc cgcatcgggg acttccgcct cgacatccac gccaaggacg gcaacgaccg
    23581 ctccgtcgtc atcgagaacc aactcgaacg caccgaccac ggacacctcg gacagtgcct
    23641 cgtctacgcc tccggcctgg acgcctcgac cgtcatctgg gtcgccccca atttccggga
    23701 agagttccgc agcgccctcg actggctcaa cgaacgcacc gacagcgaac tcggcttctt
    23761 cggtgtcgag gtcggcatcg tgcagatcgg cagcggaccc ccggcgccgg tgttcgacgt
    23821 agtctcgcgc cccaacgact ggcagaaaac ggtcaaaacc gccggtaacg ccgccgaagc
    23881 ccgcgccagc actccggtca acgccgcccg gcaagccctg ttcaccgaca tcctcaccga
    23941 cgcgaacacc cgtcagccgg ccatctcggt tccgacacct gggaagggaa actggatctc
    24001 cttcgcctcc ggaccattcg ggaactggga cctgacagtc agcgacggcc gcctacgcgt
    24061 cgatgcctac atcgacacct acaaccgcga tctcaacaac gccctgttcg acgaattcgc
    24121 cgccaaggcc gcctcctggc agacccagac cggactggat ctggcatggg agcggctcga
    24181 cgacaaacgc gcatcacgca tcgccgccta ccggccggtc gacctcgacg accccgccga
    24241 ccgcgacgca acccgccaat gggcggccga cgcgttggtc gcgatgtaca acaccctgaa
    24301 cacgcccctg cgcgcggccg cgaaagtccg gcgcgcggag tacgccgccc ctgcaccacc
    24361 gcccgagtca cagatctgac ctaaaaggtg ctgccacctg ccctgattac cccgcttctg
    24421 ggggcgatgt gcgaggtgat cggacccgcc cttcaacgcg ggctcacgag tcatcaatgc
    24481 ctggaaccag acctaccgac catggtctac gacccagccg gtctaccggc cgaggggtcc
    24541 gtcgcccggt ggtgtgtggc ggccgcaatt gggtgcgctc gaaaggggtc agctggtggt
    24601 gagaaggcga ccgcggacgc ggcgacgaga agcccggctg cctgtctcgg gatgaagcgt
    24661 tctcgaagaa cggtcacgcc gagcagacgg ggacgaccgg gtagggggag gacaacacaa
    24721 ccgcgaccac gacgaggtgc tccctcgtgg cgagcatgta agcgatcagt gccgctgcct
    24781 cgcccgtgaa gccggcggcc aacgcgggga caagggacca ccggatgtgt gtgcctcgcg
    24841 cagtcggcag cagcggcacg atggtgagga tcgccgcgac ccgcccagcg gcaacgggcc
    24901 acaatcctga ccccgcgccg acctgcgcca acgcaacata ttgcaccgca atgccgagtc
    24961 ccgcgacgag gccggcgagg gcggcggccg gcagcgcggg tccggcgtga gtgccggtgt
    25021 gcgcgaccag ccatagtgcc ggaaccgcga tcacgatgcc gagccaggac agcgtggacg
    25081 ggcgctcacc gagagcagcg actcccatca ggaccggcac ggcaatgccg cagaccgcgc
    25141 tgatcggaac aaccacgctc atcgccccac ggctgaggcc gcggaacagg ataggtgtcg
    25201 ggccactcga tcccgtaact gtcgattccg cccagaatct gggtggcagt gacgatcccg
    25261 tcctccacga gagccgccac gaacacgcgg tccttctcgc gaccagcgat cgccttggac
    25321 gcacacaggt cgacgggatc gagacaaaag cccgcccgcc cgtattccga cccgtcctga
    25381 acctccaccg cgaccagcgg ttgtcccatt gcttcggcag taccactaca tcccttgtgg
    25441 atcccctcga cgtacacgcc gaaagactca tgaaacggtg agcattcacc aagccgtccg
    25501 ttgaggatga ggatcttttc caccactgcc ggcgacgccg gagcgtcgat gccgctccgc
    25561 ggaaaaacat cgacctcacg cgacaaagtc gcgtactccg gcaactccgt ttcgtcgtag
    25621 gtcccgagga tcgactggga gccgaagaca atcacctgac cctcgtcgag gttcgcgcag
    25681 gctgcctcga tgacgtgctc gagctcctcg cggttcactt caggacgagc tcacgcagat
    25741 catcgaggac cttcattcgt tcatcctcgg tcagcagcac gtgcagcggg gaaaggttgc
    25801 gcatctcgtt cccagtctcg tcatccgact ccacgatccg acgaagggtc tcgacgtcgt
    25861 tgtcctcgac gattcgctcc caccgatcca ggaagtcggt gaagtacggg ctgcgactga
    25921 catgctcgcg gacactctgc agactgcggc gaacgcggac ggtgtcgagg ggcagatgct
    25981 cgcgctcgac cttgttcagg atggcggcct gcatgagctt ctgtcgggtg cttcatgttg
    26041 acgacggtca tctctcgctc cctcatcgct caggccaact accgatgcgg tcggtgccca
    26101 cagtgtacgg gtccggccac cgtttacgca ggtcacccca cgctcacgca gcgacgaccc
    26161 gacctccacc cgcctatacg aacaagggct cacaggacca tccgcgctac cgcgatcacg
    26221 ccccgatagc gtcacctgtc ggacgacggc agcgccgtct gctgcgggga tcaggccact
    26281 gcttcgccgc aaccgcggcg agcaccgcgt tggtgcggct gttgctgcga ccaccgcgga
    26341 agaaaaatgt gccgcccagg cgcatggccg tgaggtgccg atcccgtcct gcccgtcctt
    26401 cggtggtatc tcactgccga cgcggcgccg gccgctacat ctccgccgtg gtggttcggt
    26461 aggtcttcgc cgcagcgata ccgtcgtcgt agtcgctgac gtacgcaccg gccgccgggt
    26521 catacagtga gccgaccgct gctggatcgt gggccatgaa caccacgtcg ggccgtccgt
    26581 tgttgtagcg gcggtaggtg tcatagtccc agccgtcggg tgcgtagtcg tcgttccatg
    26641 ccagccgggc gacggggacg aatccggcgt cggcatagat gttcggcaga accgtgtcga
    26701 agcagtcgag tcgcctccct ccgaggacgg tggcctggcg cagcatcgac ggtgccgcgt
    26761 tgggatgcgc gccatcgttg tgggaaaaca ccgagacgac ttcatcgtcc ttcagagcga
    26821 cgccagcttt tccatcctcg gtgaccagca tccgcatttc ggcgtattca ttctcgtcat
    26881 agacgtacac cgaggatgcg tagcggttgt tgctggtcag ttccagcatt tgggtgcggt
    26941 acagatccgc atccgacgac gatagctcgt acagcgtcgg gctggacagt ccgcgcgcag
    27001 cgaagtcggc tttctcggag tcgggccggc tgtatgcggc gagcgggtcg acgcggcggt
    27061 caccaatcag aagccgaggg cttcggcttc ctcgatcttc tcgtccgtcc agacctgctc
    27121 gatcgccttg cgctgctccg gcagcagatc gggtgtccac cggtacttcc gccagaacgc
    27181 ttccctgcgc tcctgcgtca tcggctcgtg attcatggct gtcagctcct tcggttcgaa
    27241 catcgttccc agtgtttcgg gcgcggctca gtgcttcagt ttggttcgca cgcagtctgt
    27301 cacctgcagc caagcggcgc tcgaggtcgc ttcgggcggg cccggcttcg ctcttgatcg
    27361 ccgaccgtag ttcttgttgg ccaccgggtg tggcgtcgta gagggcttga atttcggcgt
    27421 ggttggattc ggccttgttg agccgttgct ggaggtggac ggcgtggggt tgggcgtcga
    27481 ggtcgcggcg ggcttcggtc agccgcgtcg cggcgcgggt gaggcggttg cgcatgtgcg
    27541 gggtgcagcg tggtccgggc ttgggtttac acatcggcgc caacctcggt tgcggtgtcg
    27601 atgagttcgg caaggtacgt gccgagctgt gcgaccgaat gtttgccggg gcgaccatca
    27661 tcgggcagat aggtgtcgcg gcgcagctcg atcatcacgg cggatacgcg ttcgtcgtgg
    27721 ccgtagcggc cgagtggcac gtaacacccg gcgtaggggg tgttctcagc gatctccccg
    27781 agaggaagga aggcccggcg ggttgcgctc gtcaaccagt ccggtgtgtg aaggcgatcc
    27841 gtgccgatgc acaccgctgg tcgtgccgcg accgggttct cgaatccaga cgggcgtttg
    27901 gggtaggagt gcacatcgat gatcactgct cgtccgcatg cagcgatgcg gtcggtgacg
    27961 agctcggcga cagcgcgggc gtacggacgg aagtactcgt cgagaagtgc ctcggcggcg
    28021 gcgaatggtt cgcccctaag ccgccttccg ttgcaggcgc gggtgtagac ggcaccgcgg
    28081 ccaaagactg tggccggctc agaggtgtcg gggaaccgtt cggggtcgac gaccagtcgg
    28141 gacaaggcgt tcttcacaat ccacggatgg gtgcgggcgt ggtcggcgcc gagtgtggcg
    28201 atcaggtcgg tgtcggtatc ggtggcctcg tccagttcgg cgtcgagtgc cgcgtcgtcg
    28261 agcagcagct gtgcgcggac gtgcggggga atcgtgcggg aggcgtgcgg tacgtgcagg
    28321 atcaccggcg atgacgggcg acctggcagg atcgagaagc tgttcatgcg ttcctttcgt
    28381 agatcggctg gcggccaacc ttggcggtag gtctgaaccg tggccggtgg tcgagcgctc
    28441 cgcccggact acgtccccgt tcggtcgggt tcgttggcgg cagcgagcac tcccgccggg
    28501 ccagggactc aggtgaaaac atcgacgtac cagcgcccgt cgaccttgtg ggtggtcacg
    28561 gtctgggtgc cgcgtttgac cggctgggcg ggttgcatca cggacagatc gacgaggtag
    28621 accccgtcgg acagttcgac ggtgcggagg caatagttgg tgccgatcgg gaccgcgtcg
    28681 atgaccttct gcagctcggg acctggcagc accgaggagg tgggggttgc gaggccgcgg
    28741 gcggcttcgc cgttgcgctg gctgtagtag gcgtggttga acgctgcgat cacgcccgcg
    28801 ccgctcttct ggtcaccgcg gtcggcccgg cattccccgt ccgacgtgga tgtctgttcg
    28861 gcctgttcgg gttcgggcag gttgaggatg ggcagtccgt tctcgtcagc tgctgtggtg
    28921 gtggcgctgg ttgtcgccgc ggtagacgcg gtctcactgt ctccgctgca caggtggatg
    28981 acggctaccc cgccggccac agcgacggcg accgctgcga cggtggcaat cgtcttcttt
    29041 cccggcccgc ggccgccgcg ggccggcggt agaggcgacc ggggtggggg cggtggtgtg
    29101 gccgggccgc cgagcgccgt ggtgcgggcg cccggcgggt ggtcggcggt gggtgtggtg
    29161 ccgagaaggt cgatcacggc cggatgccgc ggcgtcgatc ggccgagggt cggcttcttc
    29221 atggtgcgca cccgcctttg tggtttcagt tcgctgccgg aatgccgcca ccgatggcgc
    29281 ccgacaacag gtttccggcc aggccagggg tggcgtcggt gaagaacgaa ttcagggcgc
    29341 catcgacctg ctcgatgatc tgctcgccgc cgggctgggc agcgacgaag tcgcgggcct
    29401 gctggtcgat cgcgggcgca gccagggccg tgtcctggac ggcgtcggcg gcggcctgac
    29461 cgaccgggcc ggagttctcc cagtcggtga gcacggtctc ggtctgggcg gtcacagctt
    29521 cggagtcgat gtccgggacc tcgatctcct tcggttcgcc cttgtccccg gcggcgatcg
    29581 gggtgaccgc ggcgaccgcg accgctccgc cgacgacgcc gccgagcgct gccgcgggaa
    29641 gcccgaatgc ggcggccccg gccgcagcac cggcgccggt cgcgatggcc ccgaccggtg
    29701 cccagccgat gccggggatg aacgcgttgc ctgcggtagc gcccacgagt cctgcgacgg
    29761 tgccgacagc ggccccgccg gcgatggcag caggaacacc ggcggcagca gcaccggtga
    29821 ccactcccag cgcgccggcg ccgacctgtg cggcggcgat tcggtcggcc cggttcgtgt
    29881 ccacgccgat cgaccgccaa ccggtcgaga ccccggcctg gaccaccgac atcgtgttgt
    29941 tggtgcggtc cctgtccagg tcgctgatcc agttcggctg cttgatgtgc agctcaccca
    30001 gacgaagggt gtctcggggc gcgatgaacg gtgcggtcgg ctccaccggg gtcggcaggt
    30061 gcagctggtc gaacgccacc ggcgcgaggt agtagttctc cggctcgaca taggcattgg
    30121 tgtcgtagtc gtagttcggg agcggctggt actcgatgtt ctggtactcg gcgggcggat
    30181 caacccagta caccggttcc gccgggatct gcggcacgaa tgcggtctcg ggctcgggtg
    30241 ccggtgtcgg ggcggtggtt ccgctctggg tgtctcctcc ggtgacacct tcctgggtct
    30301 cgccgcccgt gacaccgccc tggatcgggt cggcgaatgc ggacggggac agagcgattc
    30361 cggaggccag ggcagcggcg atgaccgcga gcgcggtggc ggcctgggtg gcgctgcggc
    30421 ggcggtgccg ggcgcggcgg gcggcgcggt taccggtgtt gatgtcgttg ctcatcgagc
    30481 atcgcctttc atctgggttc gcccctcgtg ggagggccgg atcttcatgg aatgggaagg
    30541 atcggaggta ggacggtcac tcccgacctg gctggccggg ccagcgcatc agcccacggc
    30601 acccgccatc aggtcgacaa cggtggccgc gagcacggtc aacgcgtcct gcgtctcccg
    30661 ccgcaactgg ctgagcgcaa tgcgctcgcc ggaggcgaac aacggctcga acggcatccg
    30721 gcacacccgc agcgcgggga gcgcgttgac aacctcggtc tcgaccatcg gcacgtcccc
    30781 gggcccagcg gtgatgacca cgacggtgcg ggcgagaacg tcgggccgga ctgctgcgat
    30841 cgtggcgagg gtgcgttggg cggccgcggc ggcgtcgcgg cgcagcggaa ccgggagtat
    30901 caccgcgtgc gcggccgtga ttgcccagcg ccaactcccg tcatggctgg aatttccggt
    30961 gtcagcgacc aggacgtcgc ggtgccggcc gaggatcgcc ccgagcgctg cggcgtcgtc
    31021 gtagctcaga ggcgagtcgg ccccgtcccg cccggcgatg atgtcggagc cggacggctg
    31081 acgcgtcagg tagcgggcaa gcgtggacgg ccggacatcg gtggccgccg ggtcgaccgc
    31141 ggccagcagg ccgaccacgt ccttgcccgt ggctggagga acggccacgc gatcagcgaa
    31201 gctgccgccg acttcgccga ggtccatgca cgtgacggtg gcggggcctc ggtgctcggc
    31261 cagcgtctcg gccaggctga tcgacatcgg ggtcttgccg acgccgccct ttaggttggc
    31321 gaaggtgatc actgcgtcct cggggagcgg gcgggcgatc gttgtctgcg aatcgcgcag
    31381 tcgcatctcg agcgagtcct tcttcggtgc gagcttgagt ccgagcatgg cgttgagtcg
    31441 gccacgcaca ccgagccgag cagggtcgct caccgcaggg ttcgcgcgcg gcgcggacag
    31501 ctgcgggagc acgtccagcg ggcccgtgat tgggcctgtg atcggctctg ccggccgctg
    31561 ccccactagc gaaggtgtgg agacaccgaa gggtggcggc gccgcctcgt aggcgatctg
    31621 ttcggccgcc acgaccaccg gcccgcccgg cggcgtggag acaggctccg ccgccaccgg
    31681 ttcgggcgcg gtctgcgtga cggtcggcag gggcatgctc ggggcgcgtt cctccgtctt
    31741 cccgtccggg ccgacggtca ggaaccgagt gtcctttccc gtccggtaga cgacctcaac
    31801 gtcagcgccc tgggtctgcg ccatcttgtg caggaactcg tgcacaacag tggagagggt
    31861 tttgctctcg ttcgactcca aattcatcgg aggcacgtcg gcgtccgcca gggtggcgcg
    31921 ggcagtggtc gcggaggtga tctcgacatc aacggtcggc ggcgtcatcg tcagctgacc
    31981 ccgaaggtac tggccccgga cagcgccttg tccatgtcgt cgacgacggc ctcggccgtt
    32041 tccagctcgg cgagggcctt gtcacgggcg cttccctcag gcagcgcttc gatgacgacc
    32101 cgacgcttgg acgaggcatc ccggatctcc gcgagccgct cgcgggtcag ctcctgctcc
    32161 tcactgagct tggccagcca cgcggggacc gaactcttga agtactcgcg cagcgatttg
    32221 atgacagggt cgttcgcacc cttggcaacg aacggtccgc gcagcgcggc cacgtcctcg
    32281 gtagtcgggg tgatcgactg ggagatacgg cgactcatgg gtgttccctt tcggtggtgg
    32341 tgttggtgga gctgaggtca gtcgccccgg gaggcgttgt cgaggaaatt cgggagttcc
    32401 cgcgagtacc aggtcatcgg cgtaaaggtt ggttctgccg tggtctgctc aggggctcgc
    32461 atctgcacgg cagtgggccg accgtcgtct ccgagcgcga tcccgcggcc cttgacggag
    32521 gtgtcgacct cgcggcccac ggtcgagtcg ccccacatca tcagcgcgcc gtcctgcgac
    32581 aggttgccga ggctgatgcg ggtaccgaag ttgtcgcggg cgttaccgga cgcgccaccg
    32641 aacaaactgg cgtcggggcg ctgcaccccg agtagcagcc ggataccggc cgaacgggca
    32701 agaacggcga ggtcggccca cgcaccgagc gggtcgagtt ctttgagctg ttcgcgggtc
    32761 tcgtcgtcgc cggtcttggc caggcgctgc cacttaccgg aaaggatgaa gcactcgtcg
    32821 accgcgacta tgagcggctg aaggtctgtc ggttgtgccc ggttctcctg aacccatccc
    32881 acccgcgcgt gcatctcgcg gtgcagtgct cggatgaacc ctgcggcacg cagtgcatcg
    32941 ccgatgatcg tgacgcagtt cggttcggtt tcgaggccgt cgagttcgat cgtctttggg
    33001 tcgacgccga cgaagggaat gccgcggcgg gcggcctcgg tcagcagggt gcggatcacc
    33061 gacgtcttgc cgcccccggt cggtccgacg atcaggcagt gcggtccggc tgcgtgggag
    33121 gagatgttcc aggacacggt ttcaccgttg gcggccgtcg catagggcag atgcatgtcg
    33181 gtaccttcag gcgggttcgc ggcggtcatg caggcgctcc tacgaggtcg ggttcgggga
    33241 ggacgacgac gccggtgacg tcgaaggtga tgcgggtctt cacacgtccg gtgccgacgg
    33301 tcaggacggt ttcggcgacc tcgcccttgg cgccgcggcg gacgtcgacc gagtcgacgg
    33361 tgacggggac gagttcgccg ttgtcgtcgt cgacgaggac ggtctggccg gccactactg
    33421 cggaggcggg aatgacgtcc gagaagtcgt cgtcgccggt gggcgcggcg tccgcagtcg
    33481 gtgacgtggc ggacgggccg tcgtcggtgg tggcggtcgc gccgatgacg atcggctcgg
    33541 gagcactgcc gtgcttgcgt gctcgcttgg ccagggcgcg ctcggattcg atgaacgagg
    33601 ccagctcctg tgagtagcaa gtgaactgcg gggcctcggt gggtttgagg ccgtcgatga
    33661 tcgccttctc actctcggcg agctggttcc acttgttggg gtgtcggtcg acgttggggg
    33721 tccaccacat ctgcgcgtcg acggggttgc cgtcgtcgcc gagcgcgatc ccgcggccct
    33781 tgacggaggt gtcgacctcg cggcccacgg tcgagtcgcc ccacatcatc agcgcgccgt
    33841 cctgcgacag gttgccgagg ctgatgcggg taccgaagtt gtcgcgggcg ttaccggacg
    33901 cgccaccgaa caaactggcg tcggggcgct gcaccccgag tagcagccgg ataccggccg
    33961 aacgggcaag aacggcgagg tcggcccacg caccgagcgg gtcgagttct ttgagctgtt
    34021 cgcgggtctc gtcgtcgccg gtcttggcca ggcgctgcca cttgccggag aggatgaaga
    34081 actcgtcgag gaccgcgatc atcagcggca gctgcgagcc ctcgatcttc atctggtgga
    34141 tgtaggcgtt gcgggccatc atctcggtgt gcagcgcgcg cacgaacatc gctgcgcgca
    34201 gtgcgtcgta gatgatcgcg ccgcagccgg ggtagccctc gaggccgtcg agttcgatca
    34261 tcttcggatc gacgccgacg aacggaactc cgcggcgggc ggcctcggtc agcagggtgc
    34321 ggatcaccga cgtcttgccg cccccggtcg ggcccacgat caggcaatgc ggcttgttcg
    34381 agctcgttga cacatcccag tacatgattc ggtccgcggc accggtcgca tacggcaggt
    34441 gccgcaagtt ctcgtcgacc aattcgagcg ggtggtcgac gcgcgagggc atcgcggtga
    34501 ccagacgcat caccaggtag cccttgtcgg ggtaccagtc ggtggtccag ttgcggccgg
    34561 actcgtgctg ccccgccagg gaggcgagag cttcttcgac cttgagctgg aagcctttgg
    34621 cgcctgcgtt catcgacttc tcgaacgcaa tccggtagcc ggtctcgacg ccggcctcgt
    34681 cgacagtctc tacggtgacc ttcgggtcct tgaagatcga ggcgtcgtcg agcgcgccct
    34741 ggagggcctt ctggcggtcg gagcgggtgt ccggggtgat ggtcttacgg gcgatgatga
    34801 tgcggtcgtg gtgggtcttg tggcggacct tgacctccca cttgtcactg ccggggaacg
    34861 cggccgcgat cgcgcgggag acctcctcga actgcttggg ccggatgacg gtgccgcggt
    34921 gcagtgtgat cgtcgcgcgt cggatcacac gccacccggg cgggaacgag acgacgatct
    34981 tcttcggcag gtgtccggtg ccctgtcgga ccaccgattc gaacatctgc gaccacctgt
    35041 gcatgcggtg gcgcaggacg tcgacgatga cgagcagggc agcggcggcg acgagcagca
    35101 cccggtagtc gtgcagcttc gtcagcacgc cgacgacggt ctcgttgtcg gtggccgccg
    35161 acatgaggcg cggggagtac acagcaaggc cggcggcgac gatggtgatc ggcgagagcg
    35221 gggtaaaacg gcggatgcgc gtcggctggc cgtcctccct gacctggttg ccgcgaccgt
    35281 cgccggaatc gccgaagatg tcgcgccacg tcgcgaccaa ccagtccttg agtgggtcgt
    35341 gatttccgct caccgcctgt gcctttcgat cgtttcgatc ctgaacgcct tccggggagg
    35401 cgtctttgag cacagtgaca gaaacccgtg attttcctca acggggtgtc cccctcgtgc
    35461 ggcgcacccc cgccggtgcg gtgaacaccg ctctcgcgca tgatctccag gccggagtgc
    35521 cgaaccctca acgcgttcga ctcgcgccct tgacgggtct ctgatcaccg cctttgtgag
    35581 ctgtggttgc atcggtatgt cgaccgctgc gccgagggga ctctgtcgac cgctgttcgg
    35641 cacgctcgtt cgagcgctct gcgggagcgt tcaccgagtg ccctgcgggg caatgtggga
    35701 cgcgggattc agcgcccgtg cgagtgcttt ttcgagtact tcgccacgcg ggtctgcgga
    35761 cgggtgcgcc cgctcgaccg agtggtgttg tgagcgctgc ggaaggcgtg gacatgcccg
    35821 gtggtgagcg ctcgccgcgg cactggttcg agcactgctc atagcgttct acgtgggtgt
    35881 tccgaatagc gttggcgctg agcgcaattc tggattacac tcccccccaa ggaacgccgg
    35941 gggggagtgg cccccggagg gggtgggcct gggaggcgct ttttcgagcg ctcgaatcca
    36001 ccgccgaaat ccatcgccga atccggcgcc gttttcaccg cgcatctgag cgctgtctcc
    36061 acgcaccggc gcactgggtg ctcgagccgc tcgctacgca cctgccgcga cagcccgtct
    36121 gggcgtggcc tttggacccg ccgtctgccc gagtgcgcac accgcccgac ggtcggtcga
    36181 cgagcaggtg gagcgcctga ctctgatcac cgcgacgaca cacgagccgc ccccatcgat
    36241 cgaatcaccg cggggaatcc ccccacgcgc agcctgattg ccggctgccc atcgagatcg
    36301 ttccggccgc gccgcgccgc cgcttcgcac ccatcgctgg aaacgacatt cccgatgccg
    36361 caccgccccc gttcacctgc accgatgacc cgatcccggc gcggacaccc cgttgagatg
    36421 aaaagcgagt tcgacttacg gtcgtgcgca tccacattca gatgcaccta ccgaactcag
    36481 cgatggagtg tgctcatgtc cctcacgtcc gcagtcgtcg acctggcgac caccccgccc
    36541 ggaagcgtcg acgtactcgc ccagaacacc gaagtcacca ctggcggcct gcgcgcgtgg
    36601 atcggcgaca acatcatctt cacgatcctc gccctgatcg cgtgcgtcgt cctcctcggc
    36661 ggcctgcgcg gcaacctgtc gaaggtcttc accgtaggcg gtctgtcgct cgtcggtatc
    36721 gcgttctttt ccctcgcgag cagtgagagc gccgcgaccg gaatcggcaa ctggattctc
    36781 ggcctgttcg gcatccgagt ggtctgacct gccgtgcccg atcaccaatc gacgatcgaa
    36841 gggagccgac tgtgatcgac aacgacgacc tgctgcaccg ggtggatcag cactacctcg
    36901 gcccaaccgg gttcaccctg cccgtccgga ttcggtacgc ggcgctcggg ctcggggccg
    36961 cattcatggt caccgtcttc gtcatcgccc gcggcatcgt gcacgtgccg ctgggtttca
    37021 agtccctcgt cgtgatggtg gtcatcaccg tcgtgctcac cgcgcgggtg acgaagttcg
    37081 tcaacgccga ccgcccggtc cgggcggtga tccgggctgc gtggaacgac ctgaacgcac
    37141 cgcgcccacc gaagcccggc cagaccgtcg tgctccgcat tcccgccatt tcccgcgctg
    37201 ccggcagcgc gcatgccgtc acgccgatcg aaggtgagtc ctcccgatga ctttgcagcc
    37261 cgacaacgag atcgccgcac tgttcgatcc gaacttcgac gagcccgagc cggtcatcgt
    37321 tccgcccggt gcgttgccac cgtcgtgggc ggcggcgatg gcggcgaacc gatcggccgc
    37381 cacgccggcc ccggcccagg aattggcttg gtcacaggct ccggacagca acatcgcagc
    37441 ccccacacct gacgtggtcc cctcccccgc acctgacgcg gagccagaac ccaccgcgaa
    37501 aggtaagcgg cgcggaaaga agcgcggccg ccgcagcgac ccggaggcgg agttcaccag
    37561 gcaggccgct gcggcgaaga agcgcgcgga ccgcgaacgc aaggcggtgc ggctcgcgct
    37621 ggtcggggtg gagggcaacg tcactcgcac gcgccggcag tcgacggcgt ggttcgtgca
    37681 gccgccgggg ccgtggaaca tgcgtccggt cggcaagcag cgccgctaca tccagaacga
    37741 ggggttggtc gtggcgaacc tcgccgaggc cggtgtgacg gggctgcacc ggcggctggt
    37801 gcgcacaccg tggccggtgc ggcagtgggc gcaggcgcat gacgggtggg ccgatccgat
    37861 cccggacgtg ccgggtgcgt tgtcgtgggc ggattaccta cgcgggcaac agcacgcgat
    37921 gctgtggggc aacccgaccc agaagggccg ctactgggga gtggagctgc cgccgcgctc
    37981 ggtgctcgcg caggggctcg acacggtcgg gcagtggctg gttcctgtcg tcgactggcc
    38041 actgctgggc acgttcgctc agctgtggcg caagtgggcg cgcgatgcgt tcctcggcga
    38101 gcagaaggcg atcgccgatc acctcgccac gatcgagcgg cacctgtccg ggcagggcgt
    38161 gaacgccaaa cccgcgaccg cagcgcagat ggactacctg ttgctgcgct cggcgacact
    38221 cgggctgccg ctcgatgcgg acggcgtgat ctccggcggc ggcgactggg aagaatccga
    38281 cgtcgccgcg ctcgaagacc tcaccaccct cgagctgacc cccggcgacg gctacaccac
    38341 ggtgcgcggg ctggtcggcg gccgggacta caccggctac gcgatcgtcc tgacggtcgg
    38401 gcgcatggcg ccgctgccga tcccggagaa gatgctgccg tggcaggtga tcggcgatcc
    38461 gtcaggcgaa cccctcgaat ggtccgagcg gatctcgctc aagaccaagg ggcagacgct
    38521 gcgcagcctg cgccggttga cgtcgaagat cgaggcccag ttcgaccact acaccgtcga
    38581 acacgaccag gtcccgccgc aggaactggc cgaacagcac gcactcgccc aacgggtgat
    38641 ctccgacatc gaggaggacc actcgggcct gtcggtacgc acccagggct ggtaccgcgt
    38701 cctcgtcgtc ggttcgtcgc cggaggaggc aaaggagaaa gtcgcgctgc tgcaggagat
    38761 gtacgcgccg cggattcgcc tggaacagga gcacggccag taccagctgc tgcgcgagtt
    38821 catcccgggt gagccgctgg cgaacatcgc gcactgccgg cggatgaacg tcgaggcgct
    38881 gtcggctggc atggccgcgg tcggtgaccg gatcggtgac cgcaccggcg tcgtggtcgg
    38941 gcagaccgcg tcgatcgctc cgcggcccgc ggtatgggat ctgttcgccg cgcacgagaa
    39001 gaagcacaag tccggtctga cgccgatcgt cgcggtgccc ggctcgggta agacattcct
    39061 cgctggcatg ctcgtctacc aggcggtgcg tgcgggtgcc tacggtgtgg tgctcgaccc
    39121 gtcggggccg ctgaagaagc ttgcgcagct acccgagttc cggggtatcg ccgaagtgca
    39181 ggcgctgacc ggtcgcacct ctcgtccggg atcgctcaac ccctaccgag tgatcgtcga
    39241 ccctcggcgc gaggatccgg agtacgaccc gacgagcccg gactacaccg acgacgccga
    39301 tccggtcgcc gccgcacagt cgcagtacga ggcggatctg cgagccgcgg aggcggagcg
    39361 gatctcggtg gcggtgtcgg tgttgaagat gatgctcacg ccgtcgcgtc tcgaacatca
    39421 atggaccgag acggttctac agaccgcggc gaacatggtc ggcggcgacc gccgccacaa
    39481 cctgagcgaa gtcctcgccg ccatcgccac gatcggcgaa ggcaaggacg agaccaacgc
    39541 cgacctgatt tcctgcgcac ggtccatcca ccaggacctg gcgatgatgt cccagctttc
    39601 cgaggctcgc gtgctcttcc ctgaggaggg aaccatcggc gacggcgagg acgtcgaccg
    39661 caacgtgcgc ctgacggtcc tgacgatgcc gggcctgcaa ctgcccccgg agggcaccga
    39721 cccggcgcag tggaccccgc agcagcggat ggccggcccg ctgatgcata tggcggcgtg
    39781 gatggcgaac cggctcgtct acgagctgcc gcgttacgaa cgcaaggtgc tctttctcga
    39841 cgagaacaag tacctcgagc agaccggcgc cggacgcacc ctgaacctgc ggatcgcccg
    39901 cgacagccgc aagtacaagg ttcgcgcgct ggtgtgctcg cagctgcccg acgactacct
    39961 cggcgtcgac ggcaccgacg acaagtccgc gctgacgtac gaggtgatca tcggtgatct
    40021 cggcggcaac gcccacgcga tcgagggcgc gctcaagctg ctgaaccttc cgctcggcga
    40081 gggctacgag tcacttctgg ccggcctcgg cggcggcggg gaggacaccc tcgacgagga
    40141 caccgacacc gaacacctgg accaggcccg ccggttcatc gtgaagatgg ccgacgacat
    40201 cgagctgatc cgttcggact ggacgcacta cgtgcacctg gcccacgtgt tcgacgcctt
    40261 ggactcgcga gcgacccgcg cggcgatcgg gggtgcgccg tgagccggct gcggcccaaa
    40321 gccgcaagga tcggccattc cccttccccg cgccgtttcg ggtggcgtac ggggctcgta
    40381 gggcgtgttc tggtggtgct gatgctggcc gcggtgtcgc tgatcggact cggtggcgct
    40441 gtcgcggcgg ccggcgggtt cgactgccag gacgtcccgc cgccggagtt cccgaacgaa
    40501 gtcatcgaga ccaccttcga ctcgaccagc gccgaccggc cgaccaccgg cggcaccggc
    40561 tatcagacct acgggtgggc cgggctcaag tggcacacct atgacctcgg ctgcggcgcg
    40621 gacctggtca aggcacctgg tgcggtcggc gacaccaccc tgggcaacac gttcttgacc
    40681 atcggcaagt cgatggcggc cgccgcgttc tggctcgacg accagaccaa gatcggccag
    40741 gacgccacgg aggccggggt gactcccgcg ctggagcggt tcgaccagat cgtcttctcg
    40801 atcaccgagg gcatgcgggg cctctacggg caatgggtcg gcatcggcct ggtcgtcgtg
    40861 gcctcgatga tcctgtggaa agccctgaaa gccgacacag ccggagtcac gaagacctcg
    40921 gcgatcgccg ccgctgggct cgcgctcggg gcgttgatgg tcggggcccc gcagaaggcg
    40981 ctccaggtgg ccgacgagac gttcggggcg ctgatcaccg agacgcagga ccagattttc
    41041 gcggtgcagt tcggcgacga cggaggcacg ctcgccggcg gcagcaccga ccctcgaaac
    41101 gtgctgatcg acaaggtctt cctcgacgac tggcgcaagg gttggttcgg ccaaaactac
    41161 gacccagagg acaaggacca actcggtccg aagctgcggg atgcgctggc gttcagctat
    41221 gaccagcaga acacggtgaa ggacgatccg aaggcacagg cgcagctcgc cgaggagaag
    41281 gccgaccagt tccgcgacat cgtctccaag ctggagaccg actaccagct ctcctactac
    41341 cagttccagg gcaaggactc cggccgcacc tccaccggct tcatgggcat gaccaagctg
    41401 gccatgccat cgctgctgtg gatcggcgca tccctgctga agctgaccgc actgctggcg
    41461 atccggttcg cgatcctgtt cgccccgatc tggattccgg tcgcgatcgc ctacggcggg
    41521 tggctggccc gggtgatgcg tatgctcgcc tcggcctaca tgtggggcgt cgccggctcg
    41581 gtaatcgtcg cgctctacct gatggcgctg gtccagctct acgtcaactc gaacggggcc
    41641 gtcgacggct cctggcgact gtggttcatg gtgctgctga ccgtcgtgtg ctgggcgatc
    41701 atgcggccgt tcaaacggat gagccagacc ttcacacaga acagcgcgag catggtcaac
    41761 cgcaaggccc gaagcgccaa gaagtccatc aaacgcaagg cattcgacgc tgcaagcttc
    41821 gcggtcggcg ggcccgcgca ggcgatcacg gaaaaggccg ccgagcgctt cgcccgccgt
    41881 ggacgcgacg gacaggagga cgacggggcg accacggtca ctcggcccga gggtcgcgcg
    41941 ctgggcaatc gccgccagca ggcgctcacg cagtcacggg cagatgcccg gaaagcgcag
    42001 gggctcggcc ggtccgcacg cctgggccag gcgtccgacg ccgcgatcga gcgcgatgca
    42061 cgtatcgccg ggatcgctgc cgtggccagc cgcgacatcg gccgcggcaa gggcggggtc
    42121 gacggcaagg acgccaatcg cgcggtcagg tccggcgccg cggcgtggaa aaggttcgac
    42181 caggacgagg ccgacaacct cgtccaggaa cgccgggccc gcaaggaact gctgaccgcc
    42241 agcgtcgggc agcggtggga cggcggtgac cgctcggcca tcgcgccgat gaaggtctac
    42301 acccccacca gcggccagcg agcggcacat cacgccaccg cgtccacgcc gcaccgatca
    42361 ccggcgaagg cgccgccgaa cgcgaaggtg tggaacgccg ccgccccggc ccgcacgaca
    42421 cctgaggacc ggtacatctg atgtcgtcat ccggacctca ccctgtcctc gcaccgattc
    42481 gccgatgggt gctctactcc cgcacccacc tggcgatcac ggcggccggc acagtggcgt
    42541 tgctgttcgc cgccggcgcg gccttcggag agaaccctcc gccgcgcgca gtcacccacc
    42601 aggccgaaac caccatcgaa tcagtcacgc ccgcggagac gatcagctac gacctcgacg
    42661 aagtgagcga gtccctggtc gccgccaaga ccgcaacctg ggccgcatcc agcgcgcctg
    42721 ccaccgcaat ggcctacgcg catgccttcg tcgacaccac gccgtcggat gcgatgtggg
    42781 ccagcaccat cggccgccac accgccgaca agccgggaga gcacgtcgta gcggcccgcc
    42841 cgcggacccc ggtggtcatc accggcccca cggtcagcac gctcaccgac gggcccgacg
    42901 gcgagcggac cgcgcgggtg accgttccga cgcaggccgg ggacctgcgg atcacgctca
    42961 ccgtcaacga ggtcaacggt gggaagcggt gggtggtagg cactccccta ccgaccctcg
    43021 acctctccga ggtcgagacg atggcccggg cgaccaccac tgcgacacca ctcacatcga
    43081 cgacaccgac caccaccgcg gccgaaacga caccgccgca gccgacatcg acgtcgagcc
    43141 tgtcaacgac gccgcagccg atgttcgatc tcgacgaacc ggcaaccgcc ccgagccaag
    43201 gcaacgaccc gacaccgatt cccggtccga tcccgatccc ggaactcgac accccaatcc
    43261 ccggaggaag gtgaacatcg gcggcgccca gcgggcgctg ctgctcaccg gtgccatcgg
    43321 catcattatc gggacatcgg cgtgttcact gggcgcacca gtcatcccga gagatccgtg
    43381 ccggaccgtc acctccgaca gcgccaacag cgcggggtcg atcgccgaga atctgacgct
    43441 gaccgtatcc ggaccaattc gcctgccggt cgaacctggg accaccacgt tcacctccgg
    43501 attcggtgag cgctggggag cccagcacca aggagtggac cttgccgggc cggtcggcac
    43561 caagatcctc gccgcgctcg acggcaacgt cgtcaaagcc ggggactccg gcgaagggcc
    43621 cggggtcggg ttcgagaact gggtggtcat cgactcgaac gtcgacggca agcccgtgag
    43681 cacggtctac ggccacatgt tcgccgatgg aattcacatc aaaccaggcc agcaggtcaa
    43741 ggccggcgac cacatcgccg acatcggcaa cgccggcgga tcgacgggcc cgcacctgca
    43801 cttcgagtac tggcagggcg gccggctgca gggtggaacg gccctcgacc ccctcaccgt
    43861 cctacccgac atcgccgaac agaacggcac cagtggaggc gaccccgaca ccgccagcaa
    43921 tagtcccatc caactcgtgg ccgcatccca gtcgacgact gactgctctg gcttcggcat
    43981 ggccggcggc ggcgagctgg cattcgggat cgtgccggcc gagttcgagc cgtggctacg
    44041 ccgcgccggc agtgtctgcc cggagatcgc ccctccgttg ctcgccgcac agctccagca
    44101 ggagaacgga ttccggcacg gcccccatgc cccggtatcg gacaccggag cgctgggacc
    44161 ggcacagttc atgcccggca cctgggcaac ttggggtaag gactacgacg gcgacgggaa
    44221 ggccgacccg aactccatcg gtgacgcggt gatgtcgcag gcgcatttca tgtgcgccct
    44281 gtaccaggac gtttccggct acatcaccag cggccaggcc aagggcgacc ccatcgagct
    44341 gacgcttgcg gcctacaacg ccggcgccgg cgccgtgcag aagttcggcg gtatcccgcc
    44401 cttcgcccag accgagaatt acgtgcccaa gatcctgcag gcccgtgcag ggttcaccaa
    44461 tcccaatgcc cgcggccgat tcatccccaa cgcatccggt gacagcagcc aagtagtcac
    44521 ggccgctcgc gaataccttg gtaccccgta tgtgtggggt ggcggcggaa ccggcggacc
    44581 ctccggcggt gggttcgact gctcaggtct gacctcgtac gcggtgcacg cggccagcgc
    44641 aggcaaggtc tccctcccgc gcacctcgga gcagcagtgg ggtgtcggca tcgagatccc
    44701 gatcgaccag gcgagtcccg gcgacctcgt cttcggcagc tgggggccga acgggcctgg
    44761 acacgtgggt gtctattccg gcaacggcca gatggtccac gcccccacgc agggcgatgt
    44821 cgtcaaggaa gctccactcc agccagggct taaggcccgc cgcgtgatgt agggggcgtg
    44881 ccatctccgc aggtgtggat tctcacacga cttttcgccc ttctcacgat cttgtcgcca
    44941 cttcgtcgac ggcgaaccgg attgccaacg aacctccagg tcagcgactc atgcggatgg
    45001 ggcgggaggt gccgccgagt gctggaagct ggccgccagc cgaggaaagc gacatttcga
    45061 tgagaagagc taccgacaga gcggtgagaa agctacgcga aactgcaggt tacgagacaa
    45121 ctcggcgaaa aatacgacga agacctccag cttgcgtggt cgatgtcgta tcaccgctcc
    45181 gcgccggacc acccattcgg agcacggggg acgtgtcatt tatcctgggt aatggccaaa
    45241 ttctgccacg gggaggaggg tgacgtgagg ccacgaaagc tcgtcattgc ggtgttggtg
    45301 gtcgctgtcg tcggattcct ggcctactcg tacctctccc gaaccaacga cggcgaggac
    45361 tcggcgagcg tggcagcgtc gatgaccacc agcgcgccca cggccactgc ggccgcggcg
    45421 tcgccagtcg acgtcgagac cgccgagctg ccgacttcct cccgcgacgc tgaagaggcc
    45481 gcgcgacagg ggctgaccgt ggcgttcacc tggtacccgg ctaccgacac caaccagaac
    45541 gacgcatatg ggcgggcccg aaactggctg accggcaaac tcgctgaccg catgctcgtc
    45601 gacgcccgca ccgagcgcgg gcctggcgtg cagtgggacg agtgggcgca ggagcaggcc
    45661 aaggtcatcg ccgatgtcag cgtcgaatgc tccggctgcc ccgaggacac cgacaccgtc
    45721 gtctcgcggg tggccaccat caagcagacc acgatcgccg gcagcagcac cgatacggtc
    45781 gaacctgaca ccacggtgtg ggtctccgtc gtccgcgagg gcgaccgctg gctcatcgac
    45841 gacatacgct attgatccgg agggcccgtg aaccgcaaga acgttgccgc agtactgatc
    45901 cccactgttc tcgccgtcgg cctgaccgca tgcagcagcg atgagtcgac cacccccacc
    45961 agcgcaccaa tagcgaccac gacgatgtct gcgttcggca ccgatgagtt catcgccaac
    46021 cggctgcgca gctcatctac gacaatcgtc gagacagtgg aggaacgcgg cggcacgcca
    46081 gaacaggcga tcgctgctct cgtgtccagt gaagccgaga cgggctggca atccggactt
    46141 cggatggccc cgccggcaac ggacatccgg gacatcttcg gctggcggct cgcgtacaac
    46201 cttccggccg actccgctga ggtagtcgtt gccgccacca acacattcat ggacaacgcc
    46261 tccaccgtca ctgtcagcgc cgacgacccg gctgcctacg ccctggccgc ccagtacgca
    46321 gacccccgcg gctacaacga gaaggaacac ttctacagga agggcgagac cgccgccacc
    46381 gagtacgccg tcgccctacc caaggcccag gccgcgtacg ccgagctgcg cggttcgcag
    46441 taatgagagc ttgggcgtcg ttggtgatgc cggtattcgc acgacttctt tgacgggtct
    46501 gtcttcggtc tcgatgccgt gtacaccttc agggacggcg aagccacggt gcgctgtgcg
    46561 ttccccaccg ttgtaccgtg cagctcctgg cccatatggt gtgacacggt gtaccaccaa
    46621 atgatcggag ttgcgtgtcc aagactgacg acaaggccgt ccaggctgga gctgcgccgt
    46681 ataccgctcc cctcgtgcac atttacgacc tatgggtggt tcacctctcc aacgatctgg
    46741 ccggcgctgc ggccgagagc gattcgtgga gatggatgac cggcacgtcg gccgcggtca
    46801 tcacgaggta ggtccgggga gcggctggta catggccagc gaggaccgag ctcacccgtc
    46861 tggacttgaa cgccaacagc ctcaagcact cctaccgtcg gttgtccccg cgctatgacg
    46921 tgcggacagt ggaagccaac gtcttggatc ccgtgccttc gaatctggga ccattcgact
    46981 ccgtcggtgt caaccacgtc gtgcactgtt taccgggtgg ctggcgtgag aagggtgcgg
    47041 tctttcagaa cctggccggt gtgcttgcag cggatggcgt cctcttcggt tccacagttc
    47101 tcgggccggg ggtgaaacgg aacatcttcg gcttggcgct cagtgaggca tacaaccgtc
    47161 tcggggcttt ccataaccgc ggcgacgtta cgacggtctc gtcgaagccc tgcgggtctc
    47221 gttcggtcgc gtcgaggtct ctcaggtcgg caatgtgggc gttgttcgtc cccagtaagc
    47281 ccaagcgcta gtttcggcga cgggtgcgaa gcctcaatcc ttctggtttg agggtgatca
    47341 gctcctggac ctggagttgg tatgcggggt ctgcctcgaa gtcgaagcgg tgcagaagga
    47401 acgccagcgc gaggatcgtc tcatgatccg tgagtctttc ggcgcaaacc cggtcgttcg
    47461 gcccgcctgc ggactccctc cgaggctgaa tgtcggactg tgtggctagt gtctgggtta
    47521 tggcggggag ggtagtgaag cgggcgttca agtaccgctt ctatccgact gcggtgcagg
    47581 cggaacagct tgctcggacg ttcggatgca cccggtatgt ctacaaccgg gcgttggccg
    47641 aacgctcgcg tgcctggtcg caggaacggc ggcgggtcac ctacagcgac acctcgaaga
    47701 tgctcaccgg atggaagcga gacaccgaga ccgagtggtt gtcggagccg tcgaaggggc
    47761 cgctgcagga atcgctgcgg cagttgcagg gcgcgttcga caagttctgg cgcaagcagt
    47821 cccgctaccc gcaattcaag aagaaggccc agtcgaagga ttcggcgacc tactactcga
    47881 actgcttcac ctaccgcggc gggcagatcc ggttggccaa gcagtccgaa cccctggaca
    47941 ttcggtggtc gaggccgcta ccggaggggg ccgtaccgtc gcaggtgacg gtgtcgcgca
    48001 atgctcgcgg tcagtaccac atctcgatcc tcgtcgagga cacgatcacc gagcccccgt
    48061 cgaccgatcg ggtggtcggg ctcgacgccg ggatcaccag cctctacacg ctctcgacgg
    48121 ggaagaagat caccaacccg cgccacgagc gcacagaccg tgagcggctg gcgaaggcgc
    48181 agcgggtgct ggccaagaag cagaagggat cccgtaaccg ggccaaggcc cgactgaagg
    48241 tcgcgaagat ctatggccgg atcgccgatc ggcgccgcga ttatctgcac aaactctcca
    48301 ctcggctggt gcgcgaaaac caagtgatcg ccatcgagga tctgagtgtg cggaacatgg
    48361 tcaggaatcg gtcgttgtct cgggcgatct cggatgcgag ttggtccgag ttccggtcga
    48421 tgctcgagta caaggccgac tggtacgggc ggcgggtggt ggcgatcgac cggttttatc
    48481 cgtcgtcgaa gacctgctcg gtgtgtgggg cgatcgcgtc gacgatgccg ctgagcgtgc
    48541 gggagtgggc gtgccgttgc ggcgttgtcc atgatcggga tgtgaacgcg gcgaggaata
    48601 ttttggccgt cggactgacg gcggcagcct gcggagatga tgtgagaccg ccccgcacct
    48661 aaagtgtggg gaggcgactg tcggtgaaac aggaacctcg ggacgcgagt ctcgagggga
    48721 atctcggtcg ttcacggccg agaggacgtc aaaggcgaac tggcggccaa tgcacgcacg
    48781 gagaccggta ccgaatggct tgtaaaccac tgagctctgt attagacaca gggtctctca
    48841 aagaaccgat ccggatcaaa tcctcacctt cctcgttgca gggcacgaga catcggcagg
    48901 ggtattcgcc ttcgcattgc attacctcgc aacgaacccc gagatcgctg caaaagcccg
    48961 ccccgaactg gacgagaggt ggccgaccgg agacgtgacc gcgatcaggt acgaggacgt
    49021 cgcgcgattg cgctacctcc gacgggtagt ggacgagaca ttgtgcctgt ggcccattgc
    49081 tccgggttac ttccgagaga cgaaagaaga gacggtaatc ggaggaaagt acagatttgc
    49141 gcccggtgat tgggtcttcg tgctcacgtt gcaggctcac cgtgacccgg tgtggggacc
    49201 cgatgcggag aagtttgatt gcgtacgttg acctcgtcga gcggctcacc ggtttcgggg
    49261 ccgggctcgg tcagcattcg ggcaagcaga tcgttgtgtg ttcctgagtc ttctgttttg
    49321 cgtcgtttga tgacgtcgtc gacgacctgc atgacgaagt ggatgtcgcg ctggtgttgc
    49381 gcggcctgtc tgcggccgat tgtcttctgc aggattggag gcaggttcga gttgctgtag
    49441 gtcaggccgc gcatcatggc aacgagaaca gcgaatgggg acgtgtcgtt tacacaggtc
    49501 aacggtatta atctctctcc agttcatcgc tgctgacgca gtcgcgagga gtagatgaag
    49561 aggcctggcc cggcatcctg gccgccgttt gatgtgaacg ggggtgggtg cgggaccagg
    49621 cctcttctcg taatccggtg attgtcgttt caactgatag accgggtgtc gcgaagaccc
    49681 tggccgtcga gaagactttt gggattcatt cgtgaccagc ggcgagcgag gatgatcgcg
    49741 gtccccacca acacgatgcc gaccacggca ccgagggcgg gcccatatcg ggttccccac
    49801 aggatcgcgg tacgggcgtc cttcgcttgt tgggcaaggc cgttgatcgt ttcgttgtcg
    49861 aagtgggtgt gcgcttccag cgtggtcaca gcattcgggt cgtcaaccga ccgcgccagc
    49921 catcgcctcg gctgctcctc cacagcaacg atcgcaccag atgcaggctc gacccacaca
    49981 tcgcgcgtgg tggagtagtg cagatccatc gttgtcggct ccgtgccagg tagcccccac
    50041 ttttcagcgg gcaaggtcgt cgtcgcgaca ctgccgatcg atttcccaag gttcacgggg
    50101 ccgatcgtct gctgaaagtg atacagccgc atgccgtcga ccacgcgatc gtcgtctacg
    50161 tactcgatcg gatgcgtctc ccgtgccgtc ccgtcgtagt acgggtagct gaccttctcg
    50221 acgtcgaacg gaaacttgta ctgaattccg gcgcgaggcg tctccgtcgg gggcttgccc
    50281 tgctcggctt gagtggtcgg gacgggctcg gcgagcggca tgcctgatcg tcggtcgatc
    50341 gtgacgcgat cgaccattgc cgagaccagg cccaacccct cgccccagtc ggtccggacc
    50401 gtcttctgcg ccgcctgcag agttgtcgaa gcggccgaaa ctggatcctc tgtcgtcacg
    50461 tacacctgaa tccgcagcgg gacaccccgg tcggtcttca gcggaccttt catagccacc
    50521 gaggtggcct tgagcaccgc cgcgtcttcc gcaaccgaca ctgtcgccga ttgcacgtcg
    50581 agcgggatga ccttcaacct ggcggcaccg taggtgggaa ccaagacagc gacggcgagc
    50641 aggcacgagc cgagcgcgag gagagtgcag accgctgcgg atctcctcca accccgacgg
    50701 tcggcggcat ccgccttgtg cacgttttca tccagtacgg tgtcgacctg agcactcacg
    50761 tagcgcaccc tagctgccgg agcaatgcag aatcccggtc agccggtatc ttcgtcctga
    50821 ggtatttgcc acatcgcaga agggaacctg gtgctcgatc cgtttgcgcc tggcttgagt
    50881 gtcgcggagg ccgatcgctt gcatgcgcac cttcgcgctg ccggcccagt tgtcgaggcc
    50941 accgacgccg acggactgcg cgtctggatc atcacccggt acgacgacgt ctctcgactg
    51001 ctcgctgacc ccggaatcgt caatgtccgg cccggcggcc cgtcaggcag cccgggtctt
    51061 cccctaccac cggcacttgc ccgcaacctg ctcaatatgg tccccgatga tcaccggcgc
    51121 gtccgcgctt tggcagcgcc cgcgttctca cggcgacgaa tcggagcggt gaggcagatg
    51181 gtgaccgccc gtgccgacgg actcctgaac gagctcgacc cgaacgaaac cggtgttgtc
    51241 gacctctttc ccgcctacgc ctctcccctg cctgctgaca tcatcgccga gatcctcggc
    51301 gtgaccgata cggacgccga cgagttccgt accgccgcgg cgaccgtgat ggcaatgaat
    51361 cctggcgaac ccaccgcgga cgaccctcgc atcccggcca tgaccacgat cgttctcgta
    51421 ctcatgcgtg tgatcgcggc caaacggaaa tcacccggtg acgacgtcat caccgattgg
    51481 atcaccgccc gcgacgccga agaccggctg accgaagagg aactcatctc cctggcattc
    51541 ctgacgtttc tcgccggatt cgagaactcc gtctaccaaa tcgccaacgc catcggcatt
    51601 ctcgccggac tcgatcgaga ccaactactc gtcgaaatcg ccgacgacca gctctggcgc
    51661 gcccgggtga cgcatcttgt cctcgacgcc gcgcccgggt cctacgcgat acggcgattc
    51721 ccggttgaga acatcaccgt cggcggcatt cgcatccccg ccggcagtcc tctgtatctc
    51781 tccctgcgcg cggcgaccaa cgaccccgcc cgcggcgagc gcccggacct ggccttcggc
    51841 cgcggacctc attactgtct cggcgccgat ctcgccgtga tgcagctcga catcgctact
    51901 cgccgcctgt tccaacgcca cccgggcctg tccctggtga agccatggga aacactcgac
    51961 cggcgacata cctggcgcac tcacggaccc actgagatgc cagtaaacct gatctgaccc
    52021 gcaagccagt acgggagaaa cggataaacc gatgacagct gatgccctcg agctcacaca
    52081 cgccgaaccc acccacccga tccgcgaatg gacgaccgtc ttcgtcggta ccggcgacga
    52141 gcaccatgtc gtcgccgaag gcgccaagat ccgcgaatgg cgcaatatca acaacgtcgt
    52201 tcgcggacct gcccgcacgg ctgtcctggg gttgatccgt cagtgcatcg ccgatcgtga
    52261 cctcaggatc gagccgttcg atggcaaggt cgccgacgcc ctgggaccgg tcggggcagc
    52321 ccaccccatc ctgactcccg acaagagcgt ggtcgtagca gttcaggtct ggaccggtga
    52381 cccgaagaag aacccgccgg accgccccaa tgtcggggca tgggagtggg ttctgagctc
    52441 ggaggacaac ccgcccccac cgcagttgca gttggacccc ggagctatcg agctcatcgg
    52501 gatgtccgcc cggcatcagg atcgatcggt tttcggtcct gcggatctct acacccgttc
    52561 ggcccgcctg tccgacacgt tgcggcatgt gcgccaaatc cgagactgcc aggtaaagga
    52621 caggttcgac ggcacgttca ccatccgggc tgagaccgac gtcacccggg agctgcgcta
    52681 cgccgagcgg tgtgtggagg gcccggcggg tagacgtgtg cgcgggatct gctgggacgc
    52741 gggcaccgac gaagcccgtg tccacgaagc gatgctcgac gcatggttgt cgacaatgtt
    52801 ggcatcgacc tcggggatgt acatcgcggt tggggatctg tcgtaccagt acccgtactg
    52861 gctgaagtgg gtgaccgagc acgttcccgg cctcggacac ggcgtgagca ccggacagac
    52921 cttcgcgctc catgaggaag actggccgaa gatcatcgag tgggttcagc aggtgcgtaa
    52981 ggggccggtc tccggcacgg tgcgggcacg acggggcggt ggcggctggc tgaaggccga
    53041 atttcggggc ttccttctcg atcccctcgt cagcgactcg atcggtgtcg cggtgatctc
    53101 ccccgagatc gaaaccatcc ctgacgaaac ctcctgacgg agaaaatctt tcggaggaca
    53161 aagctcgtgt ggagagtgtt ctacaacgcc gcgttagttg ttgcgttcat ggccacctac
    53221 aagaccgccg gaatcttcgc ggcgacggtc gtggtcatgg ccggcgtcgt cggcgagatc
    53281 atcgtgacgg tggcccgacg ccaacgggtc gacaaactgc agtggatcgg tctatgcctt
    53341 gtgctcgtcc tcggtggttc gactctgttg ttccacaacg agaccttcat caagtggcgt
    53401 cccacagggg tgtactggct aattgccggc gctttcctga cgtcgttggt ggtcgcgaag
    53461 cgtgacccgg tgcgtctgat catcggacga tgggtgagcg caccggacgc tgtctggcgc
    53521 ttcctcagtt ggagttggtt catggcactg gtcgcggtcg gcgccgtcaa tatcgtggtc
    53581 gcctacacga tgtccacgga tacctgggtc aactggcgtg tcttcgtcgc acccggaagc
    53641 ctcttggctc tcgctgtcgc ccaagccacc tggcatcgca actacatcct cacggcatgg
    53701 cgcgaccacc aatccgagga agctatgtaa tatcccctcc gacgttggtt cgacatagag
    53761 ttcgccgagc ggactgactg cgcgatgccc cctctggcac gtgcccggtc ggccgacgtc
    53821 agcgcacctc acccgaggtt gcggcgcgac cttttcgcgt tgcccgcgca gcacgcagaa
    53881 agcccctcct cgaaggggct tttcgtcatg ctcgcgagaa ggtcgaatga ttactcacat
    53941 tgcttactgc accaccacgg acgccaacac ccacgtccag tgcgactgga accgttcact
    54001 tagcatccgc ggcgcccgag ggctacgcgg gagtgccggc ggggcgggtt cgtacccgct
    54061 cgtagctcgc ccgcagttcg ctttcaggga tttgaagcgc tgcagagagc ttccttgcca
    54121 tgttgtcaga cagcgaaatc tcgcctcgtt cgacacttcc aacgatttgg gtggtgacgc
    54181 cggcagcggc gccgagctgt ggctgggtaa gccctcgcag aatccgccaa tcgccagggt
    54241 agcggtcacc ctccggaacc ttgacgaggt cggaaatgga caccccaatc gcggcggtga
    54301 cacgggcgag caaatcaacc tgcggcgacg agtcgccaag ttcccatcgc ctaatcgtgt
    54361 cggcattgag tcgcgccagg cgcgcgagtt cgcgctgcga tacaccagca gatcggcggg
    54421 ctttctccag ttgatcaggc tggaatccgc gcataactcg acggctcaca gactgagcct
    54481 taccagaaaa gtcgtcatca ctagacactg tgcaatcccc tcgttacgat gcgcacataa
    54541 cggtacctat aaatcaatag gtatagattc ggagaaggag cgatgggagt tctcaccaaa
    54601 cgtgaacggt cccccggctg ttagcgcagc caggggaccg tcagaacagc aagtcgactg
    54661 ttagcgcagt cggacaagcc atgagaccag cgggttagcg gcccgcggcc tcgaatgcag
    54721 atcggagcct gcaaatgaac acgttagatg gcgctggtgc tctacgccta gcggctgcaa
    54781 gttctcatgc tggtcgggag aaggtcgacg ggcacgatcg cgtgaccaac ggccctctcc
    54841 gcgagatcct ggccaagcat cgttcaaacc atgaccacac gtcgtgcacg gcctgcgggt
    54901 tcgtctacac ccccgatctc ccgttgtgcc cgcccgtcgc tggcgctctg cgcgagctgt
    54961 ccacgggcgc cgtccggccc caggacctgt ctctgggcca ctacacgacc ggtcgacttc
    55021 gcgcgatggc gcgcgagcac accggcgagg gccggtgccg gcggtgcggg ttcgtttact
    55081 ccgggcaggt gcgtctatgc ccgacgtcgc ggcggatcgc cgccgaactc gagacccgcg
    55141 gcaaggcgcc cgcgacccag ccccgcacag gtcaggggct gtgcgcaggt aagggctccg
    55201 gttggaccgt taccagcaca aaggccgcgg cgtggaagcg tgcgatggcg gcctgctcgg
    55261 tgtgcccgct gctcgcgcag tgcgagacgc aactggagga caggctcgct accggtgtga
    55321 aggtccgcga gcagatcatt gccggaaggc tgttcaccgt caccggccgc gaggtcgaag
    55381 ccgctggggt cgatgcgttc gcagttgccc gggggcggac gaagaagaag cagcagcaga
    55441 agccccgggc cccaatcccg gcccctgctg ctactccggc tccggcgcgg cagctcgcgc
    55501 tcttcgagga cggggtggca tgacggtccg ctcgggtttc ggcctgagtc gcagcgtgac
    55561 cactgtcagc gctgtcgact ttcacgggcg ccagtgggac ctcgtcccga ttcaggatgt
    55621 catctgcgcc atgatcgttg cggacagcgt ggcgatacct actgtgcttt ccgaacaact
    55681 tctcgcagaa tgtcctctgg tgatctcggc tgaggcgccg accctgagtg tgggcgcccg
    55741 agagaagctc accgatgtca tcgacttggt cgtgacgaac cctgagacgg cttccgttga
    55801 acagatccgt gaggtcgctt cgctcgcccg tctacttctc cgccgacatc ccgcgtagca
    55861 gtacagattc agcgcgcttc agagcagggc ggatcggtcc cgatcaccca atcttgtcgc
    55921 gcctcactgg aagcggggtc gctgaaaccc gcggctaagt ccgttcagtc ctgatacgcc
    55981 gaatcgacga aaggcagtca ccttcgatga ccacttcagt cacatgcgac acaccgaaga
    56041 gcgccggtta cccgtatcgg ttacaggttc gatctagggt ttcctcatgg cacagcacaa
    56101 caaggggccc cgcggtcaga tcgctactcg cgcacccctc agacaccaca aggtttacga
    56161 gagtcgggca gccgaactcg gcatccctgc tggcgactac tccgtgctta tcctcgccat
    56221 cacgcacgga ctggacatcc cggattacat cagcgagaaa cttcgaccgg aacagctccg
    56281 gctactcgaa gtcgaggctt cagggtcgtt gcaccagatc gagcagttgg cgatgggcgc
    56341 atgaacgaca cctaaacacg aaacaacccc cagggcttgg cggcatcggg ggttgtccgt
    56401 ttatgaaatt tcgggacctt gccagctccc tgaccaccac tacctcgaaa ggaagaggcg
    56461 gtgctttctc aatgataacg cacgtccgca agtctgcttt gtctgcgaac ttctattcgg
    56521 tcacatgtct gtctcagcaa gaccacacac tgactgctgc actcccgcac aatcgagacc
    56581 ctttcgacgg cgctacctct gtgttggctt accagggcgc ccattacgcg acggaatctg
    56641 cggattctga tctgcgactt ccggtgctgc ttgggagcgc accggccctt ccaactgagg
    56701 aaggcggtgg tcctggcgaa tagcggatcg gaacttcctc gatagctaat tcaagagcgg
    56761 cggtacaagc caaagggacc cccggcgggg gtgggtttat ccaatgaatc ccgatgggag
    56821 gactggcagg tcctccccgt ctagggcgat cgtctggcag gacggtcatt ccctgaggtg
    56881 agtagaagaa gttagcagcc tcttcaactc ggtactgcat tccccgaagg gactacctgt
    56941 gctaggtacg tctgaggata aaccatgcct tgacgccttt tccacggttc aacactccga
    57001 tctcggcgtg tcgtgggata aatcacacaa ctcgccgatt tcccaaacca cgcaaccgga
    57061 cacgcatcca cttcagaccc cgtggattga cgagctgcga cgactcaaca cggacaccga
    57121 tcagcgcgga aaatcctgga cgctgcccgt caagcccggc caagaagcaa gcatcccgat
    57181 ctggacaagc cgcgacggat ggatgcgaca ggtccggtac gcaatcacca agaccgccga
    57241 cggccgcgcc gcagccgccc gacacaggat cggcgtcgaa agtatggtcg ccgtcgctgg
    57301 cgcgcacgcg tcgtcagccg actcgaaaac tgggcgccgc gttactgcca cagtccagaa
    57361 cctcgccgcc cgagcaggtg tgtccgaggc ggtggtcaaa cgaggtcgcc gcgtgctgaa
    57421 agcactacac ctgggcttcg agctggtacg gggccgcacc ctgactacgc gggaattcca
    57481 agccgcagaa gtccaccatg gtgggcgtca gcaccgcgct gccagcgtat gggctctgtc
    57541 ctccccacct gacctcgtcg cagccacccc cgctccccca caaccaaaga agcgcggacg
    57601 ctcccacggc aggacatacc gcccggtgga gcacgctcgc cacaccgcca caaggggttc
    57661 gaatcccaat ccccaagccc gcgaccgtga ccccctatct ttgagtggtc tttccccgaa
    57721 ggggatctct tgtagagaag taatcaccaa acgcgcgtgc gcgcgcgaga accaaacctc
    57781 atcctcaaat cagacagacc cgcgcccgat gaatctccaa cgagccgcct ccgcgctggt
    57841 cgctgcagct ccagccatcg cccccagcgg ccacatcgga gccgtgtgcg acgtcatcga
    57901 gcgttcagga atcgacacca cccgctggac aggacgggat atcgcccaag ctttgaccgc
    57961 tgacacagtg tcgcgaggtg agctctggcc aaacgcggtg cgctcgccaa tcggatatct
    58021 gacctggcgt ttgtccagaa tcgactggtc aggcccctcc cccagtgagc aacgcgccac
    58081 agaggccgcg cgcagcgcac agctgcgggc tgcacgtgac gccgaacgcg agcgagctcg
    58141 tcgcgcaacg gcctcgcctg agcgccaaaa ggcatttatg gaacagatcc gtgccaccct
    58201 ggcgcccaaa agcgggcagc ctaacgatgc tcatccaacc tcggcgcacc atccacacgg
    58261 gaacgctggt cggaccgacc gcggacaatg acaccgcgcc gagcgacatc ccactcgcta
    58321 ccgtgtatgg gccatatcct gcgagaatca ccgtggccga cttgcacaga acggagtgcg
    58381 ctcgtgggta agaacaccgt gtcccgatcg acccgacgcc acccgcgggt cgatgtcagt
    58441 cgagtccagg cgcatccccg catcagccgc aacgcagact cgatccgcga gcgtctccgc
    58501 aacggcgccc gcacagtcgt ggttgacact gcaggtcagc taatcgaact cgacaaccac
    58561 accttcgcga cggccggcga cgagtggacc ttgcgtttta ccgctggatc acaagcacgg
    58621 attcatctcg actcaccact acccgcgacc gcgcacatcg tcgccactga cgcagcgacc
    58681 gtggaagtca cagggcacgt tcatctttgg gcctataccc acgcaacggt tactgccttc
    58741 gatcagtgcc gggtcgtagc tcacaatcac gcattcatca gagcatgcga ccgctcctct
    58801 gtgtgggccg acgacaatgt cgttgtccac gcctacgacg aggccacggt ccaagctaaa
    58861 gatcacgcga ttctcgccct ttccgatgag gcacacgcag tcgtggaaac cgcagtcgtg
    58921 gttcgcggtc cagctcgcaa gaacgtcacc atgagggaca catgatgcct gagcatgggc
    58981 agacgcagct ctcacaccgc accacctgcc caccagcagt tccgagatgg cctcgtatgc
    59041 ctgaccatcg aagtcgaccc tctcgcacag ccgtcggtcc accccgtctt ccttggtgaa
    59101 gacttttcaa cggcgcacaa ccccagcggt cgccctcacc gggcacagcg tccttctaag
    59161 ctgttcggca gccaaccaac ctgacctggc tctgctagca atgcgagcta gcagagccag
    59221 gtaactctag ctattgcgaa tagttagaca tcccagggcc gtaggacgtc aagcagcccg
    59281 gatggtgcgg tgatcccagg cgatgtgttc gtcgtagtgg gtgtggtggc ggaggcagcc
    59341 gtggaggagg ccgacgaggc ggttgccgag ggcgcggagc gcttggtggt gcagatcgcc
    59401 ggcgtcgcgt cgctggtcgt agaactcccg ggcaccggga ctggacgaca aagcgcagaa
    59461 cgcccactgg tcgatagcgt cgtagagacg ccggttgcgg acgtggcggg cgagtaccgc
    59521 gcgtttcttg cccgacgcga ccgtcagcgg ggaggtgccg gcgtagtttc tgcgagactt
    59581 ggcggtggtg tagcggtcgg ggtcgtcccc gaactcaccg agcacccggg cgccgagcac
    59641 aacaccaagt cctggcaggg aacggtagat gtcggcgtcc gggtgtgact caaaatggtc
    59701 ggccagtgtg gactcgagtt cgatgatctg ccggttcaac tcgacgatga gaccgaccgc
    59761 cgcgcgggtg gtggcggcga acgcggcgac gaccggcgcc ggcgcggcga gctgctcgac
    59821 ccgcaacccg gcccggattt cgcgggcccg ggtatcgaga tttcgttgcc gaccagccct
    59881 tttgagcgcg gatcggatcg ccggcagggt caggtgcgcg gcctcggcgg gtgtcggggc
    59941 gcgaccgagt acggcgaggg tgtcgcggtc gtgcaggtcg tcgaacacct ccagcgcggc
    60001 cgggtagtac tcgcgcagcg ccgagcgcag cgcgttggtt tgccgggtcc gggcccagat
    60061 caggttctgg tgtccgcggg cgaggacctt gatcgcctcc acgtccgggc tgtcgccggc
    60121 gatcgggcga tgattgtgcc ggtccgtgcg taccaggtcc gcgagcagtt tggcgtcacc
    60181 ggcgtcggac ttcgcgcccg agacgtggtg acggtcgcgg tagcgtgcga ccgcgagggg
    60241 gttgatcggg tacacctgat agccggcggc ggtcagcgcc tgtacccaca gaccgcggtc
    60301 ggtttcgatg ccgatcacga cctgacccgg ctcgtcggcg tggccggcta tcagttcgtg
    60361 caatgtgcag atgccggcga gtccttccgg cagccgacgc gacgacagtc gcctgcccgt
    60421 gtcgtccatc aaatggacat cgtgatgttg ttcggcccag tcgtctccga cgaagatcat
    60481 cgatcgcctc ctttggtctc ctattcttga tgaaacctgt tcgagcccag aggcacccgg
    60541 catcgaccta atggatcagt gctcatacgg cacgacatcc catcagcgct ataggcgacc
    60601 tcaccgaccg gccggggcac aatctaactc taggaatcaa cctcactcca ggcgagagca
    60661 gtgctcaccg gccggcggct cagtgatcag cttgtcgtgg acgggcagtc acctgtcgaa
    60721 ggctcgccga tcgactccca ttaggcgagc attgatgtcc cggctatcta cagtttctgt
    60781 cacgtgacgg cacatacgga cgtcgccgga atctcgccgg acggcgcgcc gtgatagcgc
    60841 cttggccggt gcctgtggtg gactgcgaat atgcccaaga gccgaggccg ccgcaagggc
    60901 ggcaaaagcc gacccgttcg ccgtcctccc cggcaactcc accccgccga tcttctgctg
    60961 cgcgacgccc ggcaactcct cgaaatcgac gatgcgctca ccgcggagac ctgggccagc
    61021 ggctggctcg gcgaggcgtg gtcgacggcg gcagtgaccg aacacgaacc cgagcatcaa
    61081 ctgtgcatgc aggtcaccgg ccgagcatgc accacaccgt ccccgcactc actggccgcg
    61141 atcgacgcgc tcgcgcgggt cgcacccgcg tccgacacag ccatgctgac cgacaccctc
    61201 cacatcttga ccgaaaccca accactgccg acctggcaca ccgtcgaggc ctggaccccg
    61261 accgcggcgt ggcgcgcggt cgacgtgtac gacagcgaac gggtcctgtt cattgactac
    61321 gacggaccgc acccacacac attgatggca aatatctacc aggtcggcgg gctgatgatc
    61381 gacaagctcg ctctcctcaa tcctggcgca gccaccacct gggaccagct gcgcgagccc
    61441 gacgaggcac ccatgccgct ccagccggtc ccggtcgccg aggtgctcgc cgatctcgcg
    61501 cacgcgttgc gcattaccga catgacctgg ccccgcacca ccgacgagga ctttcgcgat
    61561 caccaggcgc tggcatggtc ccgctgccgg gactacctgc cagaatggcc cgaacatgtc
    61621 ggacttcccg agcaaaggcg ccgccaactg gtcgaggact tcctcaccga catcggaagc
    61681 gacgacgagg tgagccggtc gctggccgag ctgttcctgg actatggcga cggctacatc
    61741 ggcgccgggg cgctgtgctg gagtccgggc gaggtgatgc tgctgcttac agattggctt
    61801 ccccgcaaag cagtcctcga cgccgaccaa cgcaacgcac tgcccttcgt gttgcgccga
    61861 tggctgacct tcgtgctgac ccaacagggg atcgaccgcc agtggatcag cctcgtcgtt
    61921 gatgctgtcg acaccttcct gcccgagttc catgacgcgt ttgacgacga aactgcttgg
    61981 ggccctgcca aacaggtggc cgcggcgctt gccgagcgag gcgtcgacct caccgaccgc
    62041 tgcgccgtcg atgacgccat tcggcaactc aacgccgaac aactcgccca ccgattactg
    62101 ccgtgaaccg tcggcttggc tctgtgcaca cccgattcac acggcctgcc gcggcccagc
    62161 gaatgtgcgc tcgttgggaa agtgatgtaa ccccacagtg cgatgctagt aaggctacct
    62221 agcgtcgata gagacgctag gtatcttagt aacgctattc cagctatttt ggcttgctag
    62281 gcgagcgttg attgctcgcc cgcctactcc tgctaggagt gaagtagtag ctagcagtga
    62341 agcgaccgtt gcactaaggc cgctcgcgga aatagcagtt ctcgctcaca gagataagga
    62401 cgctagccta gctagcggag cgcggctagc ccgagaatcg tgctcggttg atccggggcg
    62461 agatccgctc gggcagcatg tcgaactgcg ataaccagaa gcctggcctg ctccgtttcg
    62521 ccgggttccg ccgcgcctag gcagatgcga tctggctgga gggatgcgtt tcgcgtgacg
    62581 gtgcctcgtg catatttggg gcggcgaccc actgacctgc tgaaatatca atgctagctc
    62641 ctgtagcatt ggcgggatct actttgatag caggaaggga agcataacta tccaggctat
    62701 ctgggctatg gtctctagcc ttcatatcgc ggatattcct gctagggata cgatcacaac
    62761 tactcgttgt agcgcagcaa ttctcgcaat cgtggctatc agagagatgc cagcaacgat
    62821 atctacgtga gctagacgcc gtatgagcgc tacagtagcc ccgttttcta gagacgctcg
    62881 cacgtctaag ctgactcgcc tttctagcct tactaggctg gcaacgcagt ctaggggcca
    62941 tagggttgct tgcagagcta tgagtgcgaa caaaactacg agtgcgatgc ttgctaggga
    63001 agttcaacta tcgatcgttg ctgtcatcgc tataggcaca ttcgtactta acgtcgctat
    63061 gaaaactagt gcagcaagtg ttgcgagcaa tgcgattaca gacaccgtag atacgatcgc
    63121 aaccgtagag gtaatagcta tgtctgcgtc ggcagcgtcg atcgctacga aagcaaaact
    63181 agagaagcta gttgcaatat gcacgctagc tcacctagca aagaacgcta gcgttgctcg
    63241 gcgtgtcgag ctagctcagc agccaagcct ggctatgctc cctacgcgag cgtgcggagt
    63301 tgcactaacg ctcatcgcgc gcatctggaa gtctcctggc ctcgacggaa cggaaaccaa
    63361 gtcatgacac gcaaatgcgc gatctgcaat cagaaagggg gagtgggcaa gaccgccacg
    63421 accctcggtc tcgcgagcgc aataagcaac gccggcggac acgtcctcat cgtcgacgtc
    63481 gacccccagg gcaacgccac caacggcgta ggcgtcacca tcaccgacga gatgctgaca
    63541 acctacgacc tgatgagccg aaccgcgtcg ggcacggcga tcgacgccgt cattgccacc
    63601 ccatgggacg gcgtcgacct gatcccggcc gaccagacgc tcgcgaacat cgagtcggat
    63661 ggggccaacg acctcatctt ccgcctcgac atcgccttcg agggcctcga cctctccgcc
    63721 tacgacgcag tcctcttcga ctgcccaccg tcgctcggca aactcctctt cgccgtcttc
    63781 tgtgcagtgg acggggtcat tgcagtgacc gagcccacta tcgacagcgt ccaaggcgtc
    63841 accaagctct tcgaaaccgt cgagaacgtc cagcgacgcc ccaacccgaa cctggccatc
    63901 gacaagatcg tcctcagccg acagcggggg acaggcgaac accgattccg ggagagcgaa
    63961 ctgcgcgagg tctacggcga cctcgtcgcg cgcaccacca tcccggaata cgccacgcgg
    64021 caggacgcac acagcgcgcg caccccgatc cacaaattca caggcggaaa atcgctgtca
    64081 ctgcagctcg cctacaccga ccttctcaac gaactaccca tcaagaccgc aggagcgacc
    64141 gtatgagcgt ccaacgtgaa cccgctatcc gcaggccggc gcaccctgcc gcagatcttc
    64201 ctgagcgccc ccgggtcgtc aaagacccca ccccggccgc cgtcgacgag cagccgacgc
    64261 aacttccgac cgaatcgacc atcagacgtg tcgccgacgt gcccgtcacg ccggtcttgt
    64321 ctcctgcacc cgaggcggca tcgcctgtcg agaagctcag cgaacaacac aacgtacggt
    64381 tgcggccctc gacgaaggcg cgcctgacgc gcggtgtgga caagttgcgc tacgagaccg
    64441 gggatcggag catcaccatt tcgtcggtca ctgacgccgc gcttatcgag tacctggcca
    64501 agaatggctg ctagcgccaa tagcgacgct agctatcggt gctaggcgga cgctcgtggt
    64561 tcgaggtacc cccaccgaaa aacgctggcc gcaccaacac aaggaggccc ccgccgattg
    64621 cgccggcggg ggcctcgtgg accgggaccc cgtggaagga aaccccgatc atgaacgacc
    64681 ttagtatccg agcagcacga atccagctcc gcgccctcat tgcggcccta atcgttgcga
    64741 tcgccattgc ggtcggtatc accaccggag cgttcgtgct gtcgttcgcc gtgcaacgcg
    64801 acctcgcatt gcaggccgga atcccgcact acctcacctg gatcttcccc gccattgtcg
    64861 acggcgcaat cctcggcgca acgatcgcca tcgttgcgct aagcaaaatc aacggcagcg
    64921 caacggggaa gcatttcttc ctctggctcg cagtggtcgt cgtcttcatc agcgtcttcg
    64981 gcaacgccta ccacgcctac cgcgccgggg aagccgccgc acggagtgct gcagctggca
    65041 tcgacctggg atacacccca ctgactccaa ccggcgcatc gctcatcgca gtcatcccgc
    65101 cacttttggt cttagctttc acccacggtg tcggaatcct catcaaggcc atcggcaccg
    65161 cccacaccga gtacaccgcg gtcgtccgag acacccgcga ccgcgaacag caggacggtg
    65221 aggacatcgc ggaccattat ccgacggtgg cggcagagtc gatgccggca tccgaacgga
    65281 acgttggcca tgttgcggac atcgttgcgc cgcacattgc tcaggacccc gacgttgcgc
    65341 cgcgcattgc tcaggacccc gacgttgcgc cgcgcattgc tcagaccgtt gcgcagttcg
    65401 ccgacgttgc aacggcagac gactcctcgg cactcgacga cagccgtgcg gccgccgtaa
    65461 ccggacctga gagttccact ggcgttgcgg atgccgcgca accaaccgaa acgaacccag
    65521 atgaccgcac cgatgttgcg accctcaccg aggagcacgt tgcgcgcaat gcactggacg
    65581 gaagcaatgc cgctgcactg aaggtcagca atgcgctcga ggactcgcaa gagccattcg
    65641 tgttgccgga cgaggcccag accatcgaga acctcctcga cttcatcgaa acgtgcgccg
    65701 acttcgagcc tgtagtgaag gagacggccc gactgcggat catcgaacag cacagctacg
    65761 cggagatcgc caccctcacg cgggccaagg ccgcaagcac cgcaatgcgc cggttcgaca
    65821 aggttgcgca acgcgcggtc gacgccgggt tccggacgcc cccgttgccg gaactcgagg
    65881 agattgcgga cggacgcaat gcggcaacgc tcgatccgca gtacacattg gtcgggacac
    65941 cctgaacatc cgcccacagc agggcggcga cggccagttc gtactctccg gcgctcgact
    66001 gggagacgac cgaccaacag cgcggggcac gccccacacc cagggactct cgaacggctg
    66061 caacacccag cgcctttgac cgcaatgctg ctcgacgttg cagcacagcc agatggagtt
    66121 gcaacgcaac gccgacagtg cgagattggc aacgcaacgt cagattcgga tgcaacggac
    66181 aaccggacgt gggccgctat gcagacgcaa caacgtcggc gcattgcagg tgggcgggcg
    66241 ccgcattgca ggttggatgc tggtgattta cgcagttcac ctgagaagag tggatgaggg
    66301 accggtcgtg gaatggttcg tatcgttttg ggatctggag actcagcgga catcggtgcg
    66361 cgcgggggaa gcgtccaatc gcgttgacgc catggctcag gtcatcgccg cggggcgcga
    66421 gctggcgcgc cgcgacgacg ggtcggtggt caataagact gcccacgtcc gtatcggaac
    66481 agagctggcg gtggtggccg ggttcgacga tccacacctc ggcgacgaaa acctgagctg
    66541 ccgtatcgag gccgctatca ccgcgaagca acaacacgcc cgcaggatgc agcagcgtat
    66601 acccgtcgag ttctagtcgc ggtctcctct ggggtacctg gtgacgctga cgcccgccgc
    66661 aggcacaccc atcccgccac tcgatctcga agtgggcgag tagatccagg actaatgtcg
    66721 tttcgtcagt cagcgccctc ggcacggaat actcaggtat gacggccgta gtggtgcacc
    66781 acagcccaat ggtggagcgc ggcgacccgt gcgatgatcg gatgtggggc gctcgcgatc
    66841 gtggcagacg gggccgcaac ctgacgactc cgctcggcgt gccgtgggct gcgaccgtcg
    66901 gcgtcgcggt gattctggtg ttgctgtgcg gcgctggtgg cagggggaga gcgcggacaa
    66961 gttttcatca ctgtgacgta agtgcccgag cttgggcggt tgtctgtttt ctttgtcggc
    67021 ggccggatgg ctgccgcgga agtggcatcg tcatgaatcg tgcgccgaaa aggctccgcg
    67081 accgtgaccg tgacctcgaa gcgaggatag ctaactccgc tacgctagct agcatctcaa
    67141 tttgtgggtt gcgtattgtg caacgcaagg tgcccgtcgt ggtgcctcgt ccgtatcgac
    67201 caccccggga gtcgttctcg cggcgagtag ggctgtggcg gaactggtcg atgacatcga
    67261 cccagacatg tccggcgatg agggcgagac atcagctact cgtcgtcagt gccgagtacg
    67321 agatcgatct caaggacgag aacgccagcg cgttccacgc agcccttgac tactgcatca
    67381 cacattcgag gtggccaggt ggcggtgagc gccgctcatt tcgtggcagc atccgcgcct
    67441 agatcgtgca acccttccgt gcgcctactg atccggcatc gcacgtctgg gggatcggtg
    67501 acggatcgag cggcgccgac tgaaatctgt cgtagccggg ccgacggttt gggggtcatg
    67561 gattcgtcag gaccggattt cgggcctcta cttcgtcggt cggctgtgcc atgctggtgc
    67621 cacggttcgg tgacgtcgcg agcgtgaggg tgacatgact gtgcaggtga tccaatccag
    67681 tggacactga ggttgcccct cgggagtgga cacccgattt catgcggcga ctgacagcgt
    67741 agacgacgcg atcagccgtt gttcgaactc caccggggtg aggtatctcc gagggcggaa
    67801 tggcggcgac gtcgattgaa gtacgagagc cactcgaaca actccagccg tgcctgcgac
    67861 ttcgacgtcc ggctccgtcc gtgcagccac tccctcttga gtccttggaa gaacgactcg
    67921 gcgagagcat tatcgtaact cgagccaacg cggcctcgac tcgggcggat cccatgacgg
    67981 cggcacacat cgacgaaagc tgctgcggtg tactgagatc cgcggtcgct gtggaagatg
    68041 acgccacgca cgtcaccacc gcgggtgcgc accgccatct cgatcgcgtc cgtgacgaga
    68101 tcggtgcgca tgtggtcggc gatcgaccaa cccaccaccc ggcgtgagca gatgtggggt
    68161 gggtccacca aggcgcgacg aacgcacgag gctcggtgac gctccagcac cggaaccaac
    68221 acggcagcgg agaaggacat gcgggcagtg tcggagggcg gcgatggtta ggccggcaag
    68281 gccggcgacc gcgacgagca tgaggagggc cagcacgacg gatctgagga cggtgcacgc
    68341 gcggatggtc agcaccgcca ggcagatggt cgcggcgaca cccgcgtccg aggactcgag
    68401 gagcgccgcg ccgtgtcgcg gtatctggtg ccgtccagcg ttttcaccgg tcgggctcgt
    68461 cgggtctgcg gcgctgactc tcacactgac accaggttcg ctgaggatca gaggtcccac
    68521 agccccagca acgcggacct aaggccaggg gagcggacgt agtggtcggt ccgcagccgt
    68581 gacccggggt gcccgagatt ggtcagcgcc ttctcggcgc cggggagggg gagcggagac
    68641 aggccggtgc gcaggcggag gaagtacaga accgctccac cggaccgcgg gatcttcatc
    68701 ggatcggaca ccacgaccgc cggcgcgtaa atccactcgt catcggccga gacgaagacg
    68761 atcacgtcgc cccgtctcac cccgctgggc ctgtcgaggc gaagcgattc gagctggtac
    68821 ttcgccgccg ggccgccgcg gctgtggtgc cggccccgct gctcgtcgag gacctgttgt
    68881 tcggtgcggg tgggttcgta gtcgacggcg tgtttgacga acatccgggt caccggcgtc
    68941 ggcaggaaat cggtctcggt gcggacgcgg ccggtgaccc cgggcagggg gaccgcgcgg
    69001 ccgatctccc actcgaggat cgcgtcgtcg aggaacacct gatcgacctc ggtgatctcg
    69061 tcgaggccgt cgatgaactt acgcacggag gcgacgatct cggggtcgtc ggtgatgacc
    69121 acagcgtcgt cggccagggt ggagttttcc gacgcattcg ccgacccgat caccgcccgg
    69181 gtgttggtga cgatcacctt ggcgtgcagg gtcggcgacg acagcacccg cacccccttg
    69241 ttcacgtagt acgcgagggc ggcgggggag gtggcgtgcg cccggaccgc ggccttggag
    69301 gcgttgacga ccaggacgtc cccggcgcgc agcggaagca gggcgggcgc gtcctgtccg
    69361 aggtagccga tcgcggcgta ccgggcgccg cgggtgcgga tggcgcgggt gatgtgtggc
    69421 cacgggctcg gcccgtggaa ggtggtcccc ataccgacag acggtaaccg gccaggcctt
    69481 gtgccgggtg gcggtccctg gcaacgctaa agaagctaaa cgggggcgcc gccggtgcgg
    69541 cgctccctgg cgaggtcgac ggtggcgcgg gtgaggggct ggccgcaatc gctctggggg
    69601 cagcgatccg gtcgaatgtc ggttgcggac aacgcgtcgg cgtcggcgtc ggccccgacc
    69661 ggcggcccgg cgctcttacg ctggtgagca ccacgaaacg agaccggcgg gagaaggatg
    69721 atgagttacg aagcgatcta cgacggggtc cgatatccac tcgccgatgc ggccgccgcc
    69781 cacggccttg aggacgccat ccggggcatc ttcgcagaca acggcaatgg tggattcgtc
    69841 gggttcgtca gccagaactc gacggttcgc ctgctgatca cgccggcgac tccgatcgcg
    69901 attcggggca gcgacgagcc gaacccgacc gtcgtccacc gctggtagcc ccgccccagc
    69961 agataccccc ctcggaccga gacggtgtgt ccgcccaatg gacgaggggt tgtcagcgag
    70021 actttcggca acgatccacc gtcagcaaag gagggtatgg tgcccagcct catttttggg
    70081 tggtgtcacc tacggcatca gccagaccag gttcgaggcc acccgggagc tgctcgcacg
    70141 gttcgccgag ggacacaccc tgggtgtggc gatgtcgctc acccatgacg gcgcccggca
    70201 ccacctgttc atcacgcccg gggtgccgat cacgctggtg gactgacgac tccgcggtgg
    70261 tcgagtcatg acggtttcct gcgctgacgg cccgggcagt gtctccggcg tcgtcgccgc
    70321 cagcacccgt cgatgccctc ggcgcgaggt aacaccccgt cacagtctgg gcgcaactct
    70381 gcgcgcaaac atgccagcga aaataccggc aacacggcgc gtagtgggta gggtgatgtc
    70441 cgcgcacgta cacgggaggc acaccgaaca cgagtgggtg gggatggcga aggtaggaaa
    70501 ttccgaaggc ggcgcccgcc gccgcccgac cggggccgga cgagcagccg taaaggcggc
    70561 gaagcgcgcg tccggtgcgg gagacgtcgg cggcccggga acgccgagtc cggagctgac
    70621 ggcgaagctg gaaccgcgga agggcccggc gaaggttccg ctcaataccc gcgtcctggc
    70681 ctcgacggaa gcccggttga actggctggt gaacgatcgc caatccaccg tgaccaacgt
    70741 cgtggacgtg gcgctgcagg agttcttcga ccgctaccac gtcccgccgg cagatcatga
    70801 cggccggatc accgagcagg agtcatgagc agtccgtggg aacagatccc cctgttcgca
    70861 ctgcccgaga caaccctgac gacatctccc tcctccaccg atgatgttct ccccgacgat
    70921 gactttctcc tcaccgatga ggacgttgtc tctgtcgatg ctgatgtctt cgtcgaagcc
    70981 gatcatgcgg attctgagcc ggccgctgcc gcacaccctg catcgcccga gcggtcggat
    71041 gtggccgaag ccgccgaccc cgccgaagcc ccgtcccggc cgacacccga gacggacagc
    71101 gaagaagtgg acaacgctgc ggtcgacggc gacgaagtgc acgacgacgc ggctgaaagc
    71161 gacacggctg gcagcgaaga ggctggcagc gaagaggctg gcaatgacgc ggcggatccg
    71221 ccggtgtggg aggcgctgcc agtgggtgag gatgccgatg gccatgcgtt gatcgtgacc
    71281 gccgccggaa ccttcacacc ctccgggcgg gagttgaccg gtcccgtcga ttcggtggag
    71341 aagctggaca agctgattcg ctgggcctcg ttgacaccgt tgggtgcccc cgcacagatc
    71401 tgggtcgtcg gacagggcgc gtgcgagctg ctcgggtgga tcatcgaccc gggcagcgaa
    71461 gacgacgtcg acgacatgga ggccctgcgc aaccgcgccg cccaggaact gaccgccgtc
    71521 ctgcacgcca ccctcacccc aatgctgaac gcgggctggg agttgcgcgg cgaccccggg
    71581 cacgtggtgc acctgtcccg ctcgatcggg aatttcacct cgatggtcga tgtggtgatc
    71641 gaaccgtacg tgtggaccta ttggaacaag gacttcggtt ggcgcaaccg ggtcggcgac
    71701 atgggcatcc tcggctcacc caccgcggga acgtatctcc cggacgatga cctcccggcg
    71761 gcacgggagc tcggtcgccg gttggcgtgg tgcgccgcgc acctcggggt gctcccgggg
    71821 ccgacgcccg cgcggaccgg cgcggccctc gtcgacaaga tcaagcggga acgcacccgc
    71881 agcggcaaag gcatcgtcgt caccacaccc ggttcggtcc caccgctgga cggcgcgccg
    71941 cggggagacc tcgaacccgc ggtcggctgg acccgcgtcc ccgacgcgca ggatctcgag
    72001 gacacgaccc ggttggtgtc catcgatcaa cgcgccgcct acctcgcctc cgcgggcatg
    72061 ctcgaattcg gctacgggca acccacacac ctcactggtg acactgctgc ggccgcggca
    72121 gtgggggaga agggtgcccc gttcgggctg tggcggatca ccctgccgcc cgggcagaca
    72181 ctgtcacttc cgggaaagat acctctgccg cacccgcaca tgcacgccga ccaaccggtg
    72241 cagacctggg tgagcacggt cagcctcgac ggactgtgct caccggtcgc agacggagga
    72301 atcggcgccg acctcgacga cctcgacatc gccgaggcct gggtctaccc acagcagggc
    72361 cgggcgctgg acaagtgggc caaaatcctc cgcgaggcac ggaaggtcgc ggtggacacc
    72421 gacgacgacg cgacgaagcg gttcctcggc acctgctaca agggttacat cgggcggatg
    72481 gtgaacccgg acatgtggac tgcgaagcag atgcaacatc accaccaacc gctctggcgc
    72541 gcgtcgatta tcgcgcactg ccggtggcgc ggccgccggg tggcgatgcg gatcgcccgc
    72601 gaacacaatc gttggccggt ccgcaccgtc accgactcct gggtgtacct cctctccggc
    72661 ggtgaggaca tcgccgaccc gagcgacgct ttggggaaga tgtcggtcga gaaggacgtg
    72721 gtcctcaccg acacactcct gtccgccttc acttcggccg aggacgtaca cgaggtgaac
    72781 ctcgcgatca aggcggcctt cgccgacaac gaggacaccg acgacgaagg ggagggggtg
    72841 ctctgatggc cctacatctc ccgaagcccc gcaccaaaaa gcccgcgcag gaggcggtcg
    72901 gcctcgacgg cctcaaggtc tccgtcgcca acgccgcgac cagcggcgtc gaaaaatcca
    72961 agcaagtcaa aagcgggggc ctggccggac tgaccagcaa ggtctccgtc aaacaactgc
    73021 gcaaggaact cggcaacgag ggcttacggc aggccgcgat cgatgccggc cgcacacccc
    73081 catccgcgcg cacgttgcgc cggtgggcgc aacagggccg catcccgcac gccgacgtcg
    73141 tcgagcgtgc ccagcggcgt gcggcgatcg aacgcctcgg cggcgtcgat gccgtggccg
    73201 ccaagatcgg gcggtcccgc tccgccgtct cccggtacag gtccggtgaa acgaacgagc
    73261 tgcgcgccga cgccagcaag aaactccgca acgtcaaggc cgaggacatc atgaaacgcg
    73321 ccggcgtact gcgccccgac ggaacaccca aaaaggcggt catccgcgtc aagggcggcg
    73381 tcatggtccg taacggcgcc gacgagggct acgactaccg ggtccggaca ctggatttcg
    73441 cgaactcgga caccccgttc accagtgagg agtcccgcga actggccgcc gcgctggcca
    73501 acgatgatca cgcccgggtc gtggccttgc tggagcggca cgccacactc gactacccgg
    73561 agaacaaggg tttcgacaag tacagcgacc agttcggatt ccacttcgac cacatcgact
    73621 ccgtccacat cgactggatc taaaaacgcc tggggaccac cccccaccgg cccgccgcgg
    73681 cacgggtcgg gtggcccctt gttccatcgc ctgtgaaaac acccgactcc ggcccattct
    73741 caccggtcag cacccgaaaa gggagcgggg gcaccccgac accccgttga ggggaaacac
    73801 cgaaatgggt gaaggtaggc agcagtgtcc cttccggcaa ttcgaggtgc ccatgcccgc
    73861 cagacgttcg agaacccgtc gcacggtcgc cctgatcgcc actgcgaccg tcgtcgtcgg
    73921 cgtcgctctt accgcacccg cgatcgccaa cgccgccccg gtgggctgtg tgtcgacatt
    73981 caacctgctc atccccggca catgggagac caacgagcac gccgacccga accagcccgt
    74041 aggcatgctc gccccggtcg cggaggcaat cagggcacag aacggtgccc gcgcacagat
    74101 ttacacgctg ccgtacatgg cgtccgcgtt cgacaacggc cacacctacg ccgacagcaa
    74161 actcgacgcg gtcagcaagg ccaccgccgt gttgaagtcc tacgccgaca aatgccgggg
    74221 cgcgaagatc acgatcaccg gatactccca gggtgcagac gctgcaggcg atctcgcgtc
    74281 ggcgatcgga aacgatcaag ggccggtcga tgcggaccag gtcctcggtg tggcgctgat
    74341 cgccgacccg ggtgccggca cgaagggcgc cgcaccggtc ggaccgacga cctccgggga
    74401 ggggatcgcc ggtccccggt cgcagggcat gggcacgctg tcggggcggg tcgcctcgat
    74461 ctgcgatccg aaagacctgt actgctcgat ccgcaagggc gccaacccgt tcctcggatc
    74521 gctcggatcg atcctgtcga agacccccgg caacaccagc accggtgccg gcgcggatgg
    74581 tggtaccgcg gcggtcgccc acgcgctgac ctcggatttc accgacgccg acctgcccgg
    74641 tctcggatcg aatgtcgacg cgctcggaca gcaactgtcc ggcaacggta ccggcggctc
    74701 gatcgatgtg aaccagatcg ccgactccgc aacctcgctg agtaagacgc tcagcccact
    74761 ggtcgacctg ctgcagtccg gggccgcgaa caccgccgcc accagcaagt tggccgcagc
    74821 cccggtgggt acaccggaaa acgcggccgc acaggtcctc accacagcca gccatgcgga
    74881 cctgggcggt gcactcgact cggtggccac gatcgcgaac accgcagcca aactcgccaa
    74941 taacggcgcc accaccctgc ccgccaccgc acccgaaatc tctcaactcg cgggcaccgc
    75001 cgcatcactc ggtagccaaa tcgcacccgt cgccgccacc ccggcagatg ccctctcctc
    75061 cgcgtcgagc gtgctgtcgg tcctcaaacc gaaagtcgtc gtcgaccagg ccctgaacgt
    75121 cgtcaccggc gtcactgccc tcgatattcc gaagatcctg aacaacctga tcgtgctccc
    75181 gcaaagaatt gccgccggcg atgtccgcgc cgcccgcgat accgcccgag agctgaacgt
    75241 gcagttcgag cccatagtga agatggccgc cggtgtcgac ttgaagtggg tctcccagat
    75301 cctcgcgatc atcccggacc cgtccggata cacccagatc gcagcgttgg tcaccagcat
    75361 cctcggcaac gtcgacgtga tcaagctggc caccatcgcc ggtcaagccc aggaaattgc
    75421 gtgggccgcc gcggacaagc tctttccccc gcccggggta ttacccgacc cggtcggtgc
    75481 cgcggcacag accacggcgt tgatcccact cggcctcgac ctcgcctcgg tggccgcgaa
    75541 catgctcacc ggcaaagcca gcaagaccga ccccgcgctg ctcggcaaac agaccaatcc
    75601 cgtgggcaac gcgatcacca cgcaggcgca gaccctcgac ctcgcaggac tcgccgggtc
    75661 ggtgtcgacg atgacgcagt cgcagggggc cgaggatctc gccgcggtag tcggcgaggg
    75721 cctgaacgcg gccagcttct tcgcctccgg tgcacaccag agctaccaga acctcgtcgt
    75781 cgacaacgcc ggccgcaacg ccatccagtg ggtctcggat tggctgaacc tgcagatcac
    75841 ccgcgccgcc tgacgaaccg acatcgtccc ggtaggacca ccactgcgtg cttcatctcg
    75901 cggccgactt catttgaact tcacctcgac cacggaaccg agaacctggc agatagagcg
    75961 gatgctgtgt cgaaatccga cctggcccgg acgaagaaac gccgcagttc aggtcaccgc
    76021 cccggcgttg acgttcggtc cgagaaccta tatctcccag tcgaatagga gcaccggaaa
    76081 gtggcccgtc gaacacaccg cccgacatcg tgctgggtga gttgcccgca ctgcggcggc
    76141 aaacgcacct acttcacccg caggaccgcg cgtgcggccc gcacccacca cgaaaaacgc
    76201 cacggcctgg cgatctaccc ctgcccccac cgacaccagg acggcgacgc cgggatgttt
    76261 cacgtcgggc accggccaga ggggttgggt cgcggccaca tcgaccggga cacgctcgcc
    76321 gataatcagc gggcagcgct ccaaggcagg gctgcgggcg ggggtgcgcg gtgacactga
    76381 tgaacgccac gggatccccc acacctccga tctcactcga tgttggtggg cggatccggt
    76441 tcggtctcga accacgccgc ccctacaccg tccgcgcact ctcggagcac ttcgtcgtct
    76501 gcacccgccc acgcgacttc gccaccaccg gtgagttcgt ctacacggtc atcgactggc
    76561 ggaacggaat ccgcggcccg gtcaacgggc aaagcgcgga cgtgagcacc gatgagcggt
    76621 gccgcgacct cctcgacgac ctcgaagccg gccggtggga gatcagccac cgcaaccgcg
    76681 tccagctcga catcatcgaa agtgaccagt catgagacca accagccgaa agagcctatt
    76741 gcgctgcgct accgcagacg cagtggtcgt tccaccagcg tggtgaaggg cactgtgacg
    76801 cgtacttcga tggttacagg tccagcagcg ccagcagggc ggtccggagg cggcggggga
    76861 ggtggcagca ccggggatag cggccttgga ggcgttgacg accagaacgt ccccggatcg
    76921 cagcggaagc aggtctggtg cggcctggcc gaggtagccg gtcgccgcat agcggacgcc
    76981 gcgggtacgg atcgcgcggg tgatgtgcga ccacggactc ggcgtggaag gtggtcccat
    77041 accgacagac ggcaacccgt ctcgtccact gcctcattaa gcgccacagg aggcgctgaa
    77101 cctggccgcc gaccctccag cacggctcac tcgagttcga cggcgcagga gccggtcgga
    77161 cgaggacccc acggtgtcgg ccggcaacac tgcaaccagc cctgtgggtg ccgacgcgtc
    77221 gacgaagtcc gacagcatcg tcaccgaggc tcgccacaaa ccgacactct gcagagcaaa
    77281 aatgcggtga cgtggggatc cgggcccgtc gctgcgataa ctgaaattat cgtcgccgag
    77341 tacgcacaaa ccatgagtga cacgatgttg cggcctgaaa tggtctctta caggccgatg
    77401 atgtgtaggt tctcaccgcc ggtgccagtt ttctcgattt cgtttcagta ggacgcgaac
    77461 tttgcgcgtt accccagttc agcgacctgg acgtcatcga aatgtccgag attctgacaa
    77521 cttagtgaga atccctcggc gacaacactt tgcaaaaagg acgcaggtca gcacggcgtg
    77581 cgaccgacaa gaccgacgag acctacacga tgtaagttcc acgtcctttg ccgtttgact
    77641 tgagggcgtt gcacgctcac cggaaggcag cctcgacgtt cctgccatcg agttgaggag
    77701 attgagcctc tacctggcgt ttcgcaacaa tcactcactg atcggcgtcg acgacaggcc
    77761 tcaacttgaa ttaggaatgc agcagaaata tcacctgcgg ccggtcgccc attgtggagg
    77821 gcatccagat cgcggcccgt ttgtgtctca gatcagaatg gcagcggggc ggtttcactg
    77881 ggcgcccatg ggtgaacgac aaggtacacc cggtcacgtg gtttttggac ttgcgcacaa
    77941 tgggtgcatc ccaagaaaag ccgtctcctc ggcgttgatg agacgatcgt cacatgcgag
    78001 cttcgggccc accgcaaaga ccgcgcgttc tcagtgccat ccaaatccag ccgacaccca
    78061 ccagctgtcc gagtacattc gaatacgacg tgtgaagagc gtacggaact ttcgggacca
    78121 cacaccaccg ctgcgccggg tggatgtttc attgaccacc cagggcaaca gcgaaacaaa
    78181 tgccggccgc atcgcgtctc agaatcccac ctgtcagaca tggctcatga acctgccact
    78241 ctccttcaca ggaaacgtgg aaaagagccg aacaggaagt atctccatca acatccatgg
    78301 gctcgtatcg ggctcgagtc ccacgcccct actccagaga gaagccagat ggtatcggaa
    78361 agcacgctta ccactcgtgc gggcagcaca gttacccgca gcgccaggag ggcaattgtt
    78421 gcggccagct tcggcacata cgtggagtat tacgactttg tcgtatacgg gtatgtcgct
    78481 gtgtacatcg cccatgcgta cttcccctcc gacaatcccc tcgtcggctt actgctcacc
    78541 ttcggggctt ttgctgcgag ctacgtcgcg cgtccgctgg gcgcggtaat cttctccccg
    78601 cttggcgaca agtacggacg caaaaccgta ctcgccgtcg tcatcttgat gatgaccctt
    78661 gcgaccgcag cgatcgggct tctaccgaca tatgcacaga tcggtctctt cgccccgata
    78721 ctgctcaccg tgcttcgtgt cctacagggg atctcagccg gtggcgaata cggtggcgca
    78781 acctcgctga tcgccgagtt ctccccaccc gacaagcgtg ggttctacgt cggattcata
    78841 gctctcacaa ctggtcttgc acttcttacc ggatcgatcg tggctctctc ccttacacgg
    78901 atgctgccgg aggaatccat gctctcatgg ggatggcgta tccccttact gctctcccta
    78961 ccgcttggtc ttgtcggcct gtacatccga ttcaaacttg aggagacccc gcactttgct
    79021 gcgctgagct cgcaagaaaa ggcggtaaac aaacctctgg caactactgt caaacgtgac
    79081 tacaagacgg tcatactcac aattggactc gcggccacga acgcaagctt gctggctgtc
    79141 tacttcatct atatgccatc agctttgaag caattcggga atttcgaggc cgccgatgcc
    79201 caactcatca cgttctctgg actggccgcc tactgcctgg caatcgttcc cttcgcaaag
    79261 ctgaccgaca aggtaggtcg ccgcccacag ttgatcgcct cgacgatcgc gcttgtcctc
    79321 gtaatctatc catccttcct gttggtatca catggcagta ttgctcttgc tgtcttgggt
    79381 atggtcatcg tcacgccgct tatggcagcc aatgtaacgg cggtgctccc gctccttacc
    79441 gagctattca ctaccgccaa ccggtacacc ggattgtcgt tgggctggca gatcgcgacc
    79501 acgctgttct cgggccccac tccggtcgtg ctggccgcgc tggccggggc cgctggcgca
    79561 acgatgccgg cgttctatgc gatggccatc gtcgcactgt cagcatgtgc cgcatttgcc
    79621 gttcgggaaa ccttcgatac accactgcag taggtggtga acctgctgag agcagactga
    79681 attgtcgggg gtctctacag aacgactgga catcagacga atcgcccgtg caactcaacg
    79741 gccgtctgca gagcgtcaag catccagctg ctcctccgcc gaccgcacac acccacccgc
    79801 cgacgccggt caagaaggtg cgaagctctc aggccgcggc gaattgacga ggctcagcga
    79861 aattccccac ttctgctcgg cgaaattccc cacctgtgag cggtgtttac tgtagcggtt
    79921 gccgggttgc ggtggtggct ttgcggaggt tttcggcgcg ggcgtggtgg tcgcggagac
    79981 ggtaggagtc gccgtcgagg ttgagcacga cggaccggtg cagcagccgg tcgagcatgg
    80041 ccgcggcgac ggtggtgtcg ccgaggacct caccccattc acccacgctg cggttcgtgt
    80101 ttacgatgat cgaagttttc agatatcgtt gcgccacaac ctgaaacaac gcagacgccg
    80161 cctcgccggg caacgggaga tagcccagtt catcgaccta taccgatgtt cacatagatc
    80221 gctttatgcc gcccccgtaa ctatgccgac atcgtcctgt ggcgaacacg ggatgcactg
    80281 cagcctggtg gttcgttgga gatcacctgc tgatcatgtc ggcataagcc ccaccgtctg
    80341 atcgatgctg atctggacgg agcacggtgc tccgggatgg agacacagcc atgtcaggta
    80401 cccgcagaag gaccgggcct ctgagcccgt tcgtcgagaa ctatcgggat ctacttcgtg
    80461 gattgggcta ccgcagcgag accatcagag gaatggtcaa agtcctcggc caactcgacc
    80521 gctggatgat cagcaacgag atgtcggtat cgaatctcga tgcgacacag atggactgct
    80581 tcctcgcgta tcggcgcgcc gacgactacc ggcaatcacc gcatcggcga ggactgcggc
    80641 tcctgctcga catgttgatc gagatgcacg tcgtcgcgcc gctgccggac gacccactga
    80701 ccagcaccga ggtactgctc gacgattacc ggcggtggtt gatcgaggat cgcggcctcg
    80761 ccgaggcgac cgtgcaacgg tacgagcgat cagcgcgaaa attcctactg accggatccg
    80821 acgccggcag cgtcgaccca acggcgttga ccggcagcga cgtcagcggc tatctcctcg
    80881 ctgaagcggg gcgatgcagc gtcggtgccg tcaaaggccg cgtcgcggaa atgcgagcac
    80941 tcctgcgcta cctcttcgtc catggcatga ccccgaccct gctcagcggc gcgatcccac
    81001 cggtcgccgg ctggcgtgag acctcgatac cccgctactt cgcccgcgac gacgttgacg
    81061 cactgcttga cacgtgcgac cgcagcacag ctctgggagc tcgaaatttc gcgatgctga
    81121 tgttgctgag catgctcggt ctacgatgca tcgagatagc gcgactcgaa ctcgacgaca
    81181 tcgactggcg gtccgggcac ctacgagtgc gtggtaaagc ccgccggctc gacaccctgc
    81241 ccctgcccca cgaggtcggc gacgcggttg ccgggtatct ccgagacggc cgaccccaca
    81301 ccacggaccg tcaccttttc cagacgtacc gcgcccccat ccgaggtatc cctccggacc
    81361 tgctcagcga cgtcgtccgc cgggcatgta aacgcgcggg cctcccaccg gcaggggctc
    81421 accgacttcg gcattcggtg gcgacgacgt tgctctccga gggtgtcgca ctggccgaca
    81481 tcagccaggt tctgcgccac catgacctgg ccacgaccgc catctacgcc aaagtcgacc
    81541 tggcgtcact gcgcaccgtc gctcagccct ggccgggagc cctctcatga ccaccaccga
    81601 gaacccgaca tccttgcgga tgcatctgac tcaatatctg ctgctgcgca accgattagg
    81661 gcacgaactc gcgtacgcag cgcgcctcct gccgcgcttt gtgacctacc tcgaggacct
    81721 cggtcactcc acggtgacca tcgccgatgc actggcgtgg tgtcagcaac caccatcacc
    81781 gcccgggagc tcggtctggc cgcggcggat gggcgcagtc cgaggcttcg ctcgctacct
    81841 cagtggcatc gacccggcta ccgaggtgcc gcccatcggg ttgctgccca gtcgccgccg
    81901 gtggcgtcca ccattcatct acagctccga cgacatcgcg gcactgctcg gcgcagcggc
    81961 cgcgctgccc tccccgcggc gggcagcgac ctactccacc ctgttcggtt tgctcgccgc
    82021 caccggcatg cgagtcgggg aagcgttgac cctcgatagc tccgacatcg actgggacga
    82081 cggtgttgtg ctggttcggg aatcgaagtt cggtaagtcc cgtaacgtcc ccctctcgga
    82141 cagcactacc gaggcgttgg cgcgctacgc atccctacgc gagggcttcg atcgcacacc
    82201 cgggaacgag agctacttcg tctcgctcac cggccgccgg gtgatctacg agtcggtgtt
    82261 cgaagtattt gcagacctac ggcgcagcag cggaatcggg cgccaatcga cggtgacgcc
    82321 gaggatccac gacctccgcc acacgttcgc agtgacagtg ctgttgcagt ggtaccgcga
    82381 cggcggggac gtcgccgctc gacttccgcg gctctccacc tacctcggtc accgcgaccc
    82441 acgatcgacc tactggtatc tgtccgcggc accgcagttg ctggcgttgg cggcagaacg
    82501 gctcgaacca accctgccgc aggtgaactc atgaccgcca tcgcgccgac ggtgcagtcg
    82561 ttcttcctcg agcggttgag cacgcagcgc cgcgccagcg aacacaccat cgccgcctat
    82621 cgagatgcga tgcggctgct gctggcgttc atggaacaac gaacccaccg agccccgtca
    82681 cggttggact ggaccgatct cgacgccgac gcgatctgcg cgttcctcga tcacctcgaa
    82741 aaggaccgcg ccaactccgc acgcacccga aacgccagac tgaccgccat ccgctcgctg
    82801 ttctcctatg ccgccctgcg gcatcccgag catgctgcgc tcattgcaca ggtcctggcg
    82861 atcccaccga aacggttcga caaagccatc gtctgcttcc tcgacgaacc cgaggccgct
    82921 gcgatgcttg ccgctgctga ccgcagcacc tgggccgggc ggcgtgatca tgcgctgatg
    82981 acgttggcga tgcagaccgg tctgcgggtc tcggaactgc tcggactcaa ctgcggcgac
    83041 gtcgtcaccg gaacgagcgg acacgtccgg tgcgtaggca agggccgcaa agaacggtcg
    83101 gtgccgatga cggaatcggt gcgctcagtc atgaacgtgt ggctgatcga gcgagccgga
    83161 caacgcgacg atgcggcgtt ctgcactcgg accggccgac ggttgagcgt cgatgccgtc
    83221 caacgcagag tcaacatcta cgccgcacaa gctcggcagt cctgtccgtc gctggtcgga
    83281 aaacacctca gcccccatgt cttccggcat acctgcgcca tgacacttct gcacgcaggc
    83341 gtcgatacga ccgtcattgc cctctggctc gggcatgcag acgttcgatc caccaccgcc
    83401 tacctgcacg ccgacctcgc gatcaaagag cgtgccctcg cgcacctcgc gtcgtcgaca
    83461 tcgccacccg gacgctaccg gccaccggat cagctgctcg cgttcctgga ggcactgtga
    83521 atatgctgag cacattcaga ctcgaagtac tgcaagtcat tgcaagacag ggcagcccac
    83581 ccggaacgcc gcccggcatc ggcatagtta cgggggcggc ataaatcaat tatcaggagg
    83641 gtggggccag cgaagaaccg catcgtcgtc gcccaccggc cctcgatcgc tgcccggtga
    83701 cagcgggcgg cgaggtcggc ggcggtggtg aagtaggtgc ggtacccggc gtgcaccgcg
    83761 gcccgcgcca accccaccga caggtgtgtc ttgcccaccc ccggcgggcc gaccagcagg
    83821 atattcgtgg cggtctcgag gtagcggcag gtgccgagct cggcgatcaa cttccggtcc
    83881 aggctcgggg cggcgtcgtg gtcgaagtcc tcgagcgacg ccggggtcgg caggcacgcg
    83941 aaccgcaaac gcccggccaa acggcgggcc tcggtcgcat cgacttcgat ggcgaggagc
    84001 tcttcgaggg cggcggtcat cgacaggttg gtcttctggg cgcggtcgag gaccgccggc
    84061 agcgcttcgg cggcgtcgtg cagtttgagc accgccagat gaccgcgcag gcgttggtag
    84121 aggctggccg ccgcggcggt gttcggcgcc ggaggagtat cggcggcagg ggtggtgttc
    84181 atgtcagggt gttccttccg cgggcggccc gctcgtaggt ggacaggtcg ataacggtcg
    84241 gtggcgttgg catctgggat gtttcggctg caccggaggt cgtcatgttc gactcgctgg
    84301 tgccccgacg cagtgcttcc gcggccgcga tcgcggcggg cccgggtggg atccgttcct
    84361 tgcggcggtg cgggcgaccg gctgagccgg cggccgccat ggccgcctgc tcgagcgcgt
    84421 agacatggcc gtggtcgcgg accgtgacgc cggcgccgtc cggggcgagg cggtggcggg
    84481 cgatggtgat ctgcgcggtg gtgacgatgt cgatcacctc ggccccgagc acccgggtga
    84541 cggtgacctg cgccgacgcg agctccgggg gcaccgagta ccggttgccg cggtacgaca
    84601 ccagcgcctg ccgggatgcg gtccggggtt cggtgaggat cgccggatac ggcgtggccg
    84661 gcagcgccgt gagcggttcg gtggcggcga cggtcgccac cgaggccttg ccgtcggcag
    84721 tggcccgcat ccgggtatcg ccgcgcagcc ggcagaactc gtccaggcgc tgctgcgcct
    84781 gttcgaccgt gacgtcgtcg ggcagggtgc gccaccaccg ctgggcggca gtgtgattgg
    84841 ccttctccac cacccccttg cggttccctg ccttgggtgg gcaaatagcc accgcgaccc
    84901 cgtagtgctt cgcggcgccg gcgaagctcg ccgtcacccg gcccgactcg gggtggcaca
    84961 cggtcgccat ccgatcgaac cgccacacct tcgtcacacc gccgagccgt cggctgacgc
    85021 ggtcgaggcc gtcgacgagg tgcggctggg tcatcgccgg cgccaggatc ccgcgccagc
    85081 gccccgaatg cgccagggag ccgaccagca ggtgcgccat cccgccccag ccccaggagg
    85141 cgggtggatt cggcaggtcg acccagtccc actgagtttc ctcgccggca ggatgggcga
    85201 tgatcgcgtt cgcccggtcg gtggcggtcg cgcaggcctc gcacaccggg cgcagtccgc
    85261 ggtcacggat ctgccgggtc agcgtcggat acgacagccg atatccgagc tcttcgagct
    85321 cgtcgcacag ggtgcgagcc cacagatgcg ggtcctcgga caaccggcag gtgacgtagt
    85381 cgacgaacgg ttcgaacggg tccggttcgc ggcgtttacg cactccaggg gtgcgttcgt
    85441 cgttcaggta ggcccggacg gtcttgcggt ccctgccggt gtggcgggcg atcgccgaga
    85501 tcgaccaacc tcgtttacgt agggcatgta cttccacatc gtcctcccat gtcagcatgt
    85561 gaacgcgggt ctccttcgac tggctgatgt gtggtcagag accatcagca tcgagggaga
    85621 cccgccctcg ttggcggagc cacacgggtg gggaatttca gtgagcgtta ctggggaatt
    85681 tcagggatct ggcgcacttt tcgtgattct gttgtcggcc ttagctatac ggtgtggatg
    85741 acgcgcttgc ggagcaggtc caggtttgcg cgtccataca tctggcgttt gagcatcttg
    85801 atgcggttga tgtgtccttc aacagggccg gagctgtagg gcaacgtcag ccctgcggtg
    85861 acggcatcga gatcgcgacg caaacctgcg acgaaggacc gcaatgcccg atctccgttg
    85921 gtgtcaacgg ccgtcatcca ggcgccgagg tcgcgcccgc gccgctcgat catgatctcg
    85981 gcgaagcctt ggacgaggtc tcgggtggcg gccagggcgg gactgcgttc cagcagcgac
    86041 tcgagctcag tgcgttcgtc gtcgctgagc cgatccgggt ggcgggtcag ccagccggtg
    86101 gcctgccgga ccgacggcga agcgggtcct gacggaagcg gattcagagt gctccgcaac
    86161 ggctgcaggt aacgtcggac agtcttgtcg ctgccgcggt atcccaacag ggcgatctca
    86221 cgagtaagtc gggcggcatc ggtgcacccg gcgttgaagc gttcgtggag gtggggcttg
    86281 aattcgtcga gcaggctagc gcgggattcc gtcttggtca gcagctcctc gacctcggtg
    86341 gcgcgggcga accgccgtac cgtcctgcgg tcgagtgaga gcttccgccc gattgcggaa
    86401 atcgacatgc cctgggatgc cagttgctgg actgcggcgt gccgttcgcg ggttcgggtg
    86461 acgagccgac cgtcgatcgg ctcgacttcg gcgtggacga tctcgtcgat gccatccggg
    86521 acgacgctga cttgatcggc gtcctcatcg ggcagacgca ggtcggcgcg gtgacgggtg
    86581 acggtcttct ccaccgcctc ggccaggttg tgccacaggt gccagcggtc ggccacctgg
    86641 acggcgtcgg gagcaccgat ccggacgcct tcggcatagg cgccggcgcg gtcacggcac
    86701 accacctcgg tgccgggatg cttcttcagc cagtcggcaa cggtgtccgc cgtgcggtcg
    86761 gcgagcagat cgatcggctt gctcgtgacc atgtccagca tgagggtgcc gtacacgtga
    86821 ccgcggcgga tcgcgaagtc atcgatgccc aggacgctga cctcgccgac cttcggatcg
    86881 ctcagggccc ggaccgcccg caacagggtg tccctgccga cagcgacccc gaggcgagcg
    86941 gccagccggg cccctgcccg cccggccacg gccaatccga tcgctgtgac catcgcgccg
    87001 agcacgggcg tgcgtcgcga ccgtgatgtg gtcagacccg gcacctgctc ggcgaaagtc
    87061 tttgccgtgc aatcaatggt gtcacagaag aatcgacgca cccgaaggtc gatcatgacc
    87121 ggatgcccac cgatcgcagt gtcggccagc tgccggcggt accgagaatg cacgcgagcg
    87181 gactcaccat cacagcgcgg acaccgtccc ccgtcgccct tcggctctgc ggcgatacgg
    87241 atcgtcgaac ctacccgacg aacccccgcg acagcgacac caaccaggtg aggcagcaac
    87301 gcccgcacgc cctcgaaatc acacgccgac gatcctcacc cgccgcaggt cagcgcaccg
    87361 tggcgacacg ccgaatacct tcacgaaaag tgcgccagat ccaatttcag cgagcgccgt
    87421 cagaatagcc gcggcctgag agtctggcct tcccaacggt gcctgggtgc gcaagtcccc
    87481 gcagatgaac gaggtactgc cgctgtatct gcacgggctc tccaccagtg acttcgggcc
    87541 ggcacgcgag cagttcctcg gatcgggcgc cgggctctcg gcggcctcga tcacccggtt
    87601 gagggaccct caccagcagt cgggtagcgg ggacgcattg ctgcgtcccc gccccctcag
    87661 atccgtgcga gcgactttca ccgcacacgg ctcaagcaag ccgcaagggc gtcacggatt
    87721 gctggttcct cctgcgagcc tgaaggctgc gtcggcagga ggcgtgcaca aggcgtgtcg
    87781 agttcccctt cgccgcgtca tctcgcccgt ggtgggtgag gtagtcggca gcgattgcct
    87841 gcctgaccac gccgagccac cagcgttccc attcatcagg ggaatctggc ggttgatcgg
    87901 gcgtgagcag gtggtctccg cagagtggac agcggccgtt ctgcctagcg agcaggccgg
    87961 cgttgtagct gtcgagcggt ggtttgacct tgcgccgccg cctgatccaa tagtcacgga
    88021 ggtcggagtc gtctggagac gcccttcccg cgaccgtggt gtgacggacg atgggagtcc
    88081 aggcgaactt gaccaggtgg gtgatgacct caccgtggtc gccacgcggg tggtcgggat
    88141 cgccgaacac ccattggtcg ttcctgaact tgtggaaccg gccgaagtag cgatctgcaa
    88201 tccaccactt cggcttgccg gggtggcggc ggcgggccca ccgccatgtg agccgccaca
    88261 tgtggtagtc cagcgaggcg aaagtcttgc tggacaccac gccccggtag taggcggtcc
    88321 agccccggat gatggggttg agcctggcga tgaccgccaa cgcgttcgag ccacgcatac
    88381 ggcgcatctc gttggcgagc ctacgatgga ttcgcttgac cgcatccgaa ttcggcttga
    88441 tgagtagttt ggcgggccgg gttccgcgcc ggtatcggcg gatgttgtac ccgaggaagt
    88501 cgaagccctc ttcttcgagg tgcacgatgt gggtcttgtc ctcgttgaag gccagtcccc
    88561 tcggagccag ccagcccgcc aaccggtcct tgaccagttc ggcttgctgc cgggaatgac
    88621 agcaagccac caggtcatcg gcgtacctca ccagaacggg agtccccggc accgaacgcg
    88681 catcgagcgt gtcggcggcc ttgaggtagc ggactcctgc agcctcctcc aggccgtgca
    88741 gcgccacgtt caacaggagt ggactgatca ccccgccctg tggagtgccc tcctcggacg
    88801 acgcgaaccg tccgttctca atcaccccgg ccgtcaacca ctttccgatc aattcccgtg
    88861 ctgggaacga gccgagtgtg tcgagaagcc gggggtggtc gattctgtcg aacgcggccg
    88921 acaggtcggc gtccagaatc cacacccgtt tggctcgtga cccattgagc gtagaataca
    88981 gggcgccgat cgcatcggcg cagcttcgtc ccggccggaa cccgtacgag cgggcctcga
    89041 accgggcttc ccactcgggt tccagggcgg tgcggacccg agcctgatgg catcggtcca
    89101 ttaccacggg aatgccgagc ggacgccgct tgccgcctgc cttcggaatg tacacgcgcc
    89161 gaactggcac cggctcccac gacgaccgcg actcatgcac ccgcaccgcc atgttcgccc
    89221 gcgcctccgg tgacagggca gtctccccgt cgatcccggc cgttcgacgt ccagcattgc
    89281 gttgggtcac ctgccgaaca ctgaccaacg tgttcgacca ggaacccaac atcaatttct
    89341 gcagcgaccg gaccgcagcc cagtcctgct cccgcgtcgc cttgaagatc ctgcgccgca
    89401 acctcactac gttctgctca tgggcgcgcc agtcaatggc atcccagtcc agcacgacgt
    89461 cccggggtcc gttcacctca tcggtgtcca acttgcccct caggttcatg aggccacagc
    89521 ctcggtgttc aaaggctcac ctgcccacgt cagcaccctc acgggcccga ccgtttccgg
    89581 tcggtatccg gccagttatg ccacggcggt cgacggaggc gtcgaccacg ctgccgcggg
    89641 tttcctgtcg cctttcggct accggcattg gcttcttggg catcctgtcc cgccgaggga
    89701 ttcagctctc cttgcggtcg gcttaccaca cgagcgccga cgtatgtcgg cgctcctgtg
    89761 gaccacggcg aggtttccac gttccgcaca ctcgatatcc gaccggattg ggtgccctct
    89821 ttaccccgag accacgcggt gctcacacga tcggtcatgc ccgcccgatc gtcgcgcgcc
    89881 ccctctgcca ggggccaggt cctgtcaccc cggtcaccat cccatcgccg gagctgagaa
    89941 tgacgaggcg tcgtcaaggg ttcacttgcg ttcacccgcc cggtcttctc cctgacctgg
    90001 tgatccctgg atggaacaag gatccctttg ggtacgatcc tcgggcttcg caccccaccg
    90061 gccaggagcc ggtgacgcac gccgaggcgg gagacgagca gttgagcact cgcccggagc
    90121 tacatgagcg acacagcgga acctgtcaac ctttctgaga cagcgcttcg gcaggtttag
    90181 tgtgtcgggt tctcctcctc ggtgcgtggt ttgttgatcc agctggtggt gggcagtgcc
    90241 ggtggttccg gtgggttgcg gacgaatcgt tcggggtgcg cggcgtacgc ggtatcgagg
    90301 acgatgccac gccggcggcg cacctccgtg gctcggccgt agtgcacgtc ggcggcggtg
    90361 tgtaggccga tcccggaatg gcgatgctcg aagttgtacc aatcgaagaa ttccttgccg
    90421 tgcatccgtg cggcctcgat gctgtcgaac tgcccaggaa agtccggccg gtacttcatc
    90481 gtgcgaaact gcgactccga aaacgggttg tcattggaca cgtgcgggcg tgaatgggac
    90541 ttggtgaccc cgaggtcggc gagcagcaac gcgaccggct tggacgtcat cgacgaccct
    90601 cgatcggcat gcagggtcag ctggttacgg ccgatgttct gctcccggat ggtttcggcg
    90661 atcaggcgtt cggccagcgt cttcgactcg cggggggcga tcatccaccc caccacgtat
    90721 cgggagtaga tgtccaagat cacatacagg tagtagtacg tccacttcgc cggcccgtgc
    90781 aacttggtga tgtcccacga ccacaccgaa ttcggttgat gagcaaccag ttccggtttc
    90841 accttcggcg ggtgtgtggc ctgccggcga cggtccccgg tctggttctt ctcccgcagg
    90901 atccggtaca tcgtcgactc gctacacaga tacatgccct cgtcgaggag ggtggcatac
    90961 acctgcgcgg gagccatgtc ggcgaaccgc tgcgagttca gtacttcgag gacccgcacg
    91021 cgttccgcgt tcgacaatgc ccgcggctgc gcactctccc gcccggaagc gttcgccggc
    91081 ccgacttcgg ggattttcgg tgaggtgccc tgtatgccag cgtgtttcgg gtgtgcacga
    91141 tagtagctgg cgtgtgcacg acccgtcgaa gtgcacgcgt ggcgcacccc gatcagcggc
    91201 gtcaactcgg cgatcgcgtg atcgatcatc gtcaacgcct gctcccgcga ttctccacgc
    91261 tgctcgatga gagcttctcc aagagcgcgg acagttcccc ctggatgcgg atcacgtccc
    91321 gggcctgctc gagctccgcg gtcagccgcg cgttttccgc agccaatccg ctctcggtgg
    91381 gcccggctgc gggcttgggt ccgcgcggca ccgacaagcc ggcgagggca cccctgtcgc
    91441 gttgacgccg ccattcggtg agcaacgacg agtacaggtt ctcccgccgc aggatcgccc
    91501 cccgctcacc gtggtcggct cgctcgtatt cctcgacgac ggcgagcttg tacttcgcgg
    91561 tgaacgttcg ccgcaccgcc ttctcggcca cttgggggtc gggcacctca ccgggtcgca
    91621 caccgaccgg atccatccgg tccgcggtct cttcgctact caatgcttcc tactccgaac
    91681 tcgccctcaa aacctcactg attacagaca cagattgtgt ctcagtgaag gttgacagag
    91741 agggcagccg acctcctatc catgcaactc aatcgatgtg tgcgacttcg tgtcgcacgg
    91801 catagtttgt cctgctcaag cctcaccttg aggtggatgc cgtcgaccca cagatagacg
    91861 aactgcccga gaggtcccga ccctggaagg ccttggcctc gtcctgcccc tgcagtgctt
    91921 gggggaatga tcggggtccg cgcggacggc cggaaggagc tcgtcgccct caccgacggg
    91981 taccgcgagt cgaccgagtc gtgggcggac ctgctgcgta ggttgccgac gccccggcat
    92041 ggccgctccc gtcctctcgg tcggtgacga cgcgctgggg ttctggaggg cgctgcgcga
    92101 ggtgctcccc gaaacccgcg agcagcagcg ctgttggttc cacaagcagg tcaatgtgct
    92161 tgctgcgcta ccgaaggtgg cgcacccagg tgcacttgcg gcgatgaagg aaatctacaa
    92221 cgccgagaac atcgacaagg cgcaagtggc gatcaaagcc ttcgaactcg actaccgcgc
    92281 gaagtatccg aaggaggtcg cgaagatcac cgacgacatg gacgtgctgc tcgagtccta
    92341 caagtatccg gccgagcact gggtgcatct acgcacgaca aatcccatcg agtctacttt
    92401 cgcgacgtgc ggctccggac gaaggtcact aagggacccg gatcccgtgc ggcgggactt
    92461 gccatggcct acaagctgat cgacgccgcc taggcgcgct ggcgtgcggt caacgcacca
    92521 catctggtcg cgctcgtgcg cgccggcgcg gagtttcaca agggcagact gctcgaacga
    92581 cccaccgaca ccaccccggc cacatatctc ggaaggagcg cccctcgccc tctatccagt
    92641 tcacgcaggg caagacattg tcaccagcac ttcaaacgaa ttgtgatggt catattgatc
    92701 acatcatgga gttggcatca cgtcattgcc ctcatcaaac tgggtagctg acgcaatcgc
    92761 cattgccgca aggtagcagt cgggtcgcgg gggacgcatc cgggatccca cacccgaact
    92821 gtgccttcgc ttcaacgcac accgatcgag caagccacct gagcggcccg aagttgaccc
    92881 cctgctcaac cagcacccaa cgagagaagt atgtggaaag cagatccccg aaggatgtca
    92941 ctctcaggag cccacctgct cgcacgcgtt tcctcgttgg ggcgacacgt atcgaccacg
    93001 agagttatca acgcgcgccg aaaacgggct ttgctaactg gggagatggc tatacgtcga
    93061 ggacgatgcg aggggtcttc gacctggagc agcagggcgt gatgacctct ccggatgcgc
    93121 gttgctcctc ggtgagcaca gcatctcgat gctcaggaat gccctcgagc actttggtct
    93181 cgcaggttcc gcagactcct tcaccgcagg agacgggaat gtcgatgccg taaccggcga
    93241 gcacgtcgac gatggtttgg ccggcgggta tctgtgcggt tactccggac tgtgttgcga
    93301 cgacctcgaa cgtcgcatca cggagaggat ctgtccccgg gttgacgggt gcttggaatc
    93361 gttccacgtg cagtgatccg gggggccatg agcgcgagag gcgttcgacg gctttgatca
    93421 aaggttccgg accacagcaa tagatggccg tcccgaattg cggtgtaccg agaacggtgt
    93481 cgaggtcgat caggccccgc tcctcttcgg gccagatctc taccttgtca ccgaagcggt
    93541 cgagttcgga gaggaacgcc atggattcgc ggcgccggcc gccgtagaca agagtccacg
    93601 gtgtttccgg acgggccgcg tggagctctt cgatcatcgg cagcaggggg gtgatgccga
    93661 ttccacctgc gatgaaaacg tacttgcgcg cggatttcag cgggaacttg ttgcgcgggc
    93721 cccgtacccg gaggtggtcg ccggctcgga tgcgatcgtg aacccattcg gagccgcccc
    93781 ggctctcact ggcgcggagc accgctaccc gccaatggga ccggtcgtct cgagacccgc
    93841 acagggagta ctgccgctcg agtccgtcgt ccaacaccag atcgatatgc gcgccgggat
    93901 cccaaccggg caacggccgg ccgtcgggcg tgaccaagga caaggatcga actccgtcgg
    93961 actcctcgtg cacggtctcg acgaggacgt cgaatccggt catgtcatga ggttgggtca
    94021 tgctgtcggt cctgatactt ccgctagtgg tcatcatcgg ttcctgccgc ttgtgcttcg
    94081 cgctcaacca tgcgcaagta cagttctaat attcttcggt cgagttgttc gcgcagaact
    94141 ccgtccagcg actggtctga acgccagcgc tggtcgaagt cttcgaggag gccctgaagg
    94201 gcttcgttga cggccatttc catggccagt ctgtggtcgt gcactcggta ctgctgtgta
    94261 tttgtaccgt tgccgccggt tgcttttgcg aggcgagtaa agaggtcgct gtagtccgcc
    94321 ccggctgcgg cggcggcgac gtcggcgagg gcgatgctca aggttgctgc aatgtcgtcg
    94381 ttgtcggccg ccaaattggc cggcatccga tcccaggagc gttcgagtct gccgaggatg
    94441 tgcagtgccg cccgaagttg gcgggcggcg cccccgtcgg acaccttcgg gaggacgtcc
    94501 tcggtcaggc cgcgacgtac cccgccgagc agttctgtgg tcgtgggttt cagcaccagg
    94561 cccatccttt cccgtcgtcg gcgatccaat tcaagctgcg tttcagtgag gcggtgacgg
    94621 ttgcggcgcg gtccgccaag cggaggttcc cgctgacacc atcggcgaac gaacgtgacg
    94681 cctttaggga gatggttgcg aacttcactt cggagaagac ccggtagaac cgcaacgcgt
    94741 gttcggtcac cttcggtccg ccgaactcct cgtacgaacg gacgaattcc tcgaggccga
    94801 caaatccttc aggactccac agcgcacggt aggcccaggc gagatcttcg accgggtcac
    94861 cgagatgcgc catctcccag tccaacaacg cgatcacgat gttgtcttgg tacagaaagt
    94921 tccccgggcg gaaatccccg tgtaccacgc tgatttgggt cggctccggc aggttttccc
    94981 tcagccaccc gaatacgtaa cccagtgctg gatgaggctc catgcggctg gtccggaact
    95041 gggcttccca ggattcgatc tgtgcgagtg gactgcggtc ggtgggtccg gacgcgagga
    95101 tgtcaccgag gccgagtcct tcccagtccg aggagtgcag ttccgcggcg gcccgggcga
    95161 ggtcgagggt cagctttcgg ccaccttccc ggtcctcgga tcgcaggaag ccgagcggat
    95221 cggcgcgccc aggcatccgc tcgagcagga tcgacggcgc cccgaccacg gagccgtccg
    95281 cgtcgagcgc gaaggcgcgt ggtgcgcggg tcgccgagtg cccgagtgcg ctgagaacac
    95341 cgaactccca ttttgggtcg gcgtcgacct gtgatccgtt cgtgcggctg agcatgatga
    95401 ccgattcgga gcggctggca ccggattggt cggtccaacg gaccgtcgat gcccatgcgc
    95461 gtcgggcatt gccgccgaag acacgctcga cgccgtcggc ccgcacgtcg cgagcaccgg
    95521 tgatcgagac gcgcagcagc tcctcgatcc gctcgccgat ctccgaatcg tccatggtca
    95581 gcgcaccccg gccgcgactc gcatgacctc accggtgacg gcgtcggact gtggttcgag
    95641 gaagaaggcg attccctcgc ccagatcttc cggtgtagcc aggtcaccga gagcggtgta
    95701 ggcgaggtgg cgctcgtgat agcccggttc gatccacgac ttgacacgct cgctcaggac
    95761 caggcccggg gcgatgcaat tggcgcggac acccttgcgg cccatcgaca tgctcaagct
    95821 gcgagtcaat ccgacgacgg cggcctttgc cgagttgtag gcggcgttgc cgagctcggg
    95881 gcggttggcg aaggcggcca gtgaggcgac gttgacgatc ttgccgtaac cctcgtcgta
    95941 gaaatgtcct tcgatcgcct tcgacaacag gaaggcactg ttgacgttga gtgcgaaggt
    96001 tccggcaaag tagtcgagtg agatgtccga caacggcagg tcgtacacat cctggttgat
    96061 gttgaccatg ccaccggcga cgttggcgat gccttgcacg gagccgaact cggacaacgc
    96121 gtaattgacg gcgtcctggg tgccggactc ggtggtcaca tcgaccttga tcgtcttcag
    96181 cttcccgggc agatctttgg tcttgtcctc cgtctccgcc agtcgtcgcg agctcagatc
    96241 aaccccgacg acgttcgaac ccacgcgcag cagtcgtgcc accgcggcgc caccgatgcc
    96301 accacccgct ccggtcacga tataggtccg atcctgcaga gcccgattgg atcggggcgg
    96361 agcggtaaaa ggctgagttg acatgtgtgg tcgtccttct ggtgtggtcg tcggtgatca
    96421 gatgtaggag cgctgctcga atacgggtgg ccgcttttcc tgcagcgcgg cgagcccctc
    96481 tttggcttcg gggccggtga agccgaggat tccgaaggcc agtgacgcct cgaacgacgg
    96541 ccaggcggcc cgaatccagt tgttgagagc aagtttggtg aatcggatcg cgcttggcgc
    96601 cccttgggac aggcggatcg cgatctcgag agcgcgagca tcgacctcat cgtcgtccac
    96661 gcagaacgac accaatccga tgcgctcggc ttcctcgccg gtaattgcgt cgctggtcat
    96721 gaggtagtac ttggccttgg ccatgccgca cagcagcggc cagagtgcga cggcgtggtc
    96781 gtcggcggca acgccgaggg tggtatgtcc gtcgacgagt ttcgctgttc gtcccgcgac
    96841 agtgacgtcg gcgagtagtg ctgcggccaa gccgcctccg gcggcggggc cgctgatcgc
    96901 ggagacgatc ggtttggtgc agtcgagcat gttctgcacc agtgcgcggc cttccttcca
    96961 catttggcag cggaagtcgt agtcgtcgat gatccgctgg accatgtcga agtcgccgcc
    97021 ggcggagaaa gcgcgtcctt cgcctgccag caagaccgcc gagacggtcg ggtcctcgtc
    97081 gatccggcgc cagatggatc cgaggtcctt gtgcatctgg aagtccagcg agttcatctt
    97141 gccgcgggag agcaggacac gcagcacatg aggagcgggc cggtccagtt tcaggctttc
    97201 gtagttggga tagacaaccg gcggtgtttc cggggccgtc gtggtgttgt tgggggtgga
    97261 catcaggcgg ttcctccgac gtattcgatg ggtgcgccgg taccgaattc acggcgcaga
    97321 gcctcttttt ggatctttcc gtacacggcg cgcggcaagt tgtctcggaa tatcaccgca
    97381 ctgacccgtt gatacttcgc gagttggtcg ttgccccaga cccgcagttc ctcgtcggtg
    97441 atcacggcac cggcgcgggg aatggcgatc aggatcgggg tctctcccca cttgggatcc
    97501 ggtttggcga tcgccgcgac ctcgaggacg tcgggatggc gcatgaacac ctgctcgatg
    97561 tccacggcga agatgttgat gccgccggat ttgatcatgt ccttctcgcg cccggagacg
    97621 tagaggaagc cgtctgcgtc gacgtgaccc acgtcgccgg tgcgcatgaa ggaacgaccg
    97681 tccggcgcgt accaggtcgc cgcttcggtc agctccgggt tgttgtagta gcccttcatc
    97741 atgccgatgg agcgggcgac gatttctccg gtctcaccga cgggcagttc ggtaccgtcg
    97801 ccgccgacga tacgtacctc ctcgagcatg atcggcttgc cgaccgacgt ccgtttccct
    97861 cgggccgcgt cctccgggat acgcaggtag gcaaagcctt ccgagaaccc gtagacctcg
    97921 tagatgccgg cgttctcgaa ggcgcggtcg atggcgttgt aggtcttctc ggcgatcggc
    97981 tgcccggaag tgaccaggca ttgcatcgaa ctgacatcga agtcgctcag gtgcggatcc
    98041 tcgagcagcg cgatgtactg ggtgggcacg aggaaggcgt gtgttccccg ttcccgttcg
    98101 accgccgcga ggaaggcgtt cgaggtgaac ttctccaaga tcacgatctt ccctccccgg
    98161 tacatcgtgg ggatcatcgt gatccaggta cccgacgcat agggcggagt ggccaggatg
    98221 gcggtcgagt accgatcgat gcgcagcccc atgccgaagc cgtagggata catcatccgg
    98281 ctgagatgag tgtgttcgat gcccttcggc atcccggtgg ttccggaggt gtaaaggatc
    98341 gtgatggtgt cctgcggctt gatcttcacc ggcggcgcct caggtgaagc gccctcgatc
    98401 aggggccgga tatcggacca tcccgtcccg gtctccccga acgtgaagaa ccgatctgcg
    98461 ggaatgttgg tcagcgtcga gcgaacggaa tcgatctggg ccgcggtctg cgaatcgacg
    98521 aaaatgattt cggcatcgga atcgttgagc agacgggcca gggagtcgcc gtcgagcaac
    98581 acgttgagcg gaacggtcac gcacccggcc ttcgcgctac cccagaacgc gatgaaggtg
    98641 tcgatcgagg cgggcatcag gagtgcgact ttgtcgccct tgtccagtcc cagctcccgg
    98701 agggtgttgg cgaaccgatt ggtcgcctcg tcgacctcgc gccaggtcat ccgggtgtca
    98761 ccgcacacca acgcagtctg atctgtgaag acgcgaccgt tgtggctgat cacgtccgga
    98821 cacatcaggg ggaagtcgta ctcgagggtc atggggtgct ctcctgtgcg gtggtagcgc
    98881 ttcatgcgga ttgggaggtc ggtgcgtgtt gtgccctgcg gtcgtgacac atgcaccggg
    98941 tgcgggagtc acactgtggt ggtagccaca ctagggaacg aaggcgaaat tctttggact
    99001 agtcacctct gacctttgtg cacaagtcca aaatccggtt gccggtcggc cggcacccgg
    99061 gtcgtgggct ctgatcggca caccggtgat cagaggaagg cccacccgcg ctcaccgcgg
    99121 gcacaggact cgtaggcgtc cggttccagt ggttgcaaga ttcccgtggt ggtgcggtcc
    99181 tcacaaatga ttcggcaatg gtgctcattg agaccgctca gtttcgaacg caccgaggcc
    99241 tcccggacat cgaattcgtc gccctccacc atcggctcgc cgacgtattc gccgtggtgg
    99301 aggcctgttt ccgggctccc gccgtagagg ccgcacttca tgtacgcggt ctggaaaccc
    99361 aaccgttcga agtgcacctg ccgctgctcg ccggtgtcga aggtgtagtc gatcacgccc
    99421 tcggtgaaga tcttggtgtc ttcctcgaac cggagtcggc gttcgacgtt gaccaccctt
    99481 cccgctcccg ggcggggatc accgaagtcg tagaggacgg tgcgacccca gatcgcgaag
    99541 tcgtcgaacc agatccagtt cccgcccttc cagccggcct tcaccgtgcg gcccggatgc
    99601 attccgggtc cgccgacacc gcgcccgata ccccaatgcc gatcccgggt cccgcgggcg
    99661 gcacctttcg gccattcgac ccggacgtcg ccgatctgca cccacccggt cacatccccg
    99721 aaaccctcga aacccgcggt cacgtgcttc tgcgaacccg tgggggtggc tgatttgaga
    99781 gatccgtagg cggcgctgta gacctgccgc ctgcggtcga cccagtccag ctcgtaggag
    99841 atgtcccagt cattgggtgc gagtacatgc cgccatcgtc gaagcccctc gacgatagac
    99901 ggccggatcg gaccgacttc caggtccatg cggtcgacgc cgagcggacg aaacgcccgg
    99961 acggagcggt gaatgccgcg ataattgacg atcgcgtacg cctccgccaa gtcgaggttc
   100021 gggtagaagg tcccccccgc ggcgatcagc agatcaccca cctcgtcatg gaagacattc
   100081 cagtaccgct cgtagaaccg ggggtccgag gaccaggcca ccctgatcgg atccggggtc
   100141 tgatgaatga ggtgatcatc gagtggcgcc aggggaaact gctcgtctag gtgctccacg
   100201 ggatcagctc agcttcactg gaagtcgggt ggggccacgg gtgaccatcg agttgctcca
   100261 cgcgatctcc tcgaccggct cactgatccg gtagtccggg aagcgccgca cgatctcggt
   100321 caaagcgatc tgcgcctcga gccgggcgac gggggctccg aggcagaagt gtgcaccctt
   100381 ggagaacgca acgtgggcgt tcgggcgacg ctgaagatcg agttcgtcgg gtcgatcgaa
   100441 cacggcaggg tcacggttgg cggcagcaag gatcgcgaaa atgcggtcgc cctcggccag
   100501 gtgctgtcca ccgagttcgg tgtcctcggc aacgatccgg gctgtcgaga gcaccggacc
   100561 gtcgtagcgt aggaattcct cgatcgcccc gggtgtcacc ttggccggat cggcgcgcaa
   100621 ttcagccagc gtttccgggt gctcctgcaa cgccagcagg gcattgccga tcaagtgcgc
   100681 ggtggtctcc tgggcgccgt tgccgatcat catcatcgag gcgaccagtt cgtcctcggt
   100741 cagtgtctcg ccgtcgattt cgctggtgat catgcgggtg agcacatcat cctgcggcgc
   100801 cgccttccgg tccgcgatca acccgcggaa cagttccgcc atcgccaacg cgccgtggcg
   100861 ggcgcggccg tacttgttct ccaccgagcg tgcactgccg atgaacaaca tcatctcgtc
   100921 cgaccactgt ttgacctccg gcagccgctc ccgagggacg ccgagcaggt ccatcacgac
   100981 atatccgggc agctgcaggc cgaagtcggt gtagaagtcg aacgactcgt gcttcgggag
   101041 accgtcgagc aactcggtgg tgatttcctg gatcggctcg cgcagagtct tggtcatgtt
   101101 cgggttgatc acctccgcca aatggcggcg cagccgggta tggttcggcg ggtcctggaa
   101161 caccatccag atcgacaacc accgcatgac gtcggcggcg gaggcctgat ctttttcctt
   101221 gagccgatcg aagaccggca ccaggcggtt cgccgagaac accgtcggtg tcgtgagcac
   101281 cgtctgaacg gacgccgcgt ccaccgccaa ccaggctgac agctccgcgc tccagtgcac
   101341 gggcgcctcg gcccgcatcc gcgcgaacgt gtcatacggg ttgcgaaggg tcgcaggatc
   101401 cgtcgggtcg aatttaatag tcgaagtagg cactgttttc tccagatcat gtggctgggg
   101461 ccaccacctc tgcccgcggc tgggacgtgg ccggctcgtg tttcgagcat cacacggatg
   101521 agtgcggagc cggtgcggcc agcgtcgaaa actttggaca tcggcacaaa tagtcatcga
   101581 ccctggtgga ggacgagatc caggctcgga tggccggaga gtcgaggacg gcaggcgcgc
   101641 tgcgagggtt ctcctcgccc tgcagtcctt ccggtacgca ggcccgacga caaaggtgtc
   101701 ctcgtctagt tggataaggg cacaaaaatt cgtctcgtgg gcggcacggt aaacgagagc
   101761 gttatgagac tgtcgtcaca tgagccttcc aatcaaacgc gtggtcaccg gtatcgattc
   101821 caatggcaag tcggtcgcct acgaagcggc ggatgttgaa cccgtcgagt tggcgatgat
   101881 gcccggcgcc cagttcttcg cgatctgggg caccgaggga gccctcgaga gtccggtcgt
   101941 ctccccgcaa ccggccaaca agaccttctt ccccggcccg gggggcaccc ggttcgggtt
   102001 gctccgtttc cctcccgagt ccgcggcaga gccggacgcc cccgctccca cggaagagga
   102061 gatttccgag tgggccgcgg aggccgaaac aaagcttccc ggcctggtcg gagtcttcga
   102121 gcccgacgcc ccgggtatgc accagaccac gacggtcgac tactccatcg tcgtcgaagg
   102181 tgagctctac ctcgaactcg acgacggcgc cgaggtgcac cttcccaccg gggcgacgat
   102241 cgttcaaaac ggcgcacgcc acgcctggcg caatcgaagc gaccagccgg cgaccctcgc
   102301 ctacgtgatc ctcgacgtcg acaagtagga gtcggctgga cctcacattg ccgccgagac
   102361 agatcctcac cgcccgggca tcccgggata cctaggagat ggttgtgcct accaaccctt
   102421 acaagtcgct cgatctgacg gataaatcgc tgatcgtcac cggcgccggc agcggtatcg
   102481 gccgcgccag tgcacagctg ttcgctgcgc gcggtgcaaa tgtgatggtc gccgacatca
   102541 atgagcagaa cgcgaaagag accgcagagc agatcaaatc cggcggcggc cgggtcgaat
   102601 acctgcgcat cgacgtctcc gtcgaagaag aggtcgaggc cctggtgcac accacggtcg
   102661 agaaattcgg tggcctgcac ggcgcgttca acaacgccgg aatcgggcca cagtcaccgc
   102721 ttcacgagac cagtgcggaa gactggtacc gcaccctcgg catcaatctg accggtgtct
   102781 tcttctgcct caagcatgaa atcggatacc tgctacagca cggcggcggg tcgatcgtca
   102841 acaccgcatc cctggccgga tacaaggcag ttcccgggat gccggcgtac gtgtcgagca
   102901 aacacggcgt cgtcggactc acccgcgccg cctcactcga ctacgcatcc caaggcattc
   102961 gggtcaacgt catcttgccc ggcaccatcg ccacgccgat gctcgactcg gtgctgcacg
   103021 atccggtgct ggcgaagtca ttggcagagg gtcaaccgat cggacatgtc gggaactcga
   103081 tcgacatcgc cgagcaggct gcctggctac tctccgacgc ctccgccttc tcgacgggtt
   103141 cactgttctt cgtcgacggc ggcagcagcg gtgtctgacc ggcttcctca cttatacgag
   103201 tccaggacat cgtggtggtt gcttgtggga ctgtccaatt ctgccaagcg gccgccgagg
   103261 tgaccgcgcc aatgccctgc tacacaggga acatcggcat caccttcggt gaattcctcg
   103321 aggatcggtt cgctgccacc acctttcgcg ccaccggtgt cgtaccagct ggtgccgaga
   103381 agcgggcccc cgcccgccag ggcgtcgagt cctcgagccg gtcggtgccc aggaaatcgc
   103441 ctacgccggg gcgccgaccg cttccatccg caacgaaaga agttcactca tgaccaacgc
   103501 ggtaatcgtc gatgccgtgc gcctcgcctc cggcaagggc aagccgggtg gtgccctgtc
   103561 cggcacccac cccgtcgacc tgctcgccca cgtgctgcgc gccgtggtcg accgcaacaa
   103621 cctcgacccg gttctggtcg acgatgtcat cggcggctgc gtctcccagg tcggggaaca
   103681 ggcgctgaac atctcccgca ctgcgctgct gtcggccgga ttcccggagt cggtgcccgc
   103741 gacgaccgtc gaccgccagt gcggctcgag ccaacaggcc gcgcatttcg cggcgcaagg
   103801 catcatcgcc ggcgcgtacg acatcgtcat cgcctgcggg gtggaatcga tgagccgcat
   103861 cccgttgggt gccgcgtcga tcggtcagga cacttccggc ccgggcatcg ccgcccgcta
   103921 ccggcagggc ctggtccatc agggcatctc cgccgagctg atcgcggcca agtggaagtt
   103981 cgaccgtgag gccctcgatg cgttctcggc cgaatcccac cgccgggccg ccgccgcggc
   104041 cgcggccgga ttcttcgacg gtgagatcgt gcccatcgcg gtacccaacg ccaacggcag
   104101 cgtcatcgaa cacaccgtcg atgagacggt gcgcgccgcg accaccgccg agggcttgtc
   104161 cggactcagg ccgtcgttcc gcacggacgg gtacgccgcc cggttccccg aggcgcagtg
   104221 gctgatcacc ccgggcaatt cgtcgccgct gaccgacggg gcgtcggcgg tgctgatcat
   104281 gagcgagcag gccgcggcca agctgggcct gactccgcgg gcgcggttcc attccttcgc
   104341 cgtcgcgggc gacgacccgc tgttcatgct caccgccccg attccggcca cccgcaaggt
   104401 ggtggccagg tcggggctgg gcatcgacga catcgacgcc ttcgaggtca acgaggcctt
   104461 cgcgccggtg ccgttgatgt gggcgcacga gttcggtgcc gatccggccc ggatgaaccc
   104521 ccgaggcggc gcgatcgccc tcgggcacgc cctcggctcg tccggcaccc ggttgctgac
   104581 cacgctggtc aaccacctcg aggtcaccgg tggccgctac ggcctgcaga ccatgtgtga
   104641 gggcgccggc ctggccaacg ccaccatcat cgaacgcctc tgaaacgaaa agtcggaaca
   104701 acaatgcagc gcaccttctt cgaagaagac caccaggcgt accgggagac ggtgcgcgaa
   104761 ttcctcgccc gcgaggtcga accgcactac gagcggtggg agaccgaacg gctcatcgac
   104821 cgctccgcct ggctcgccgc cggcaagtcc gggatcgtcg gcctcgccat accagaggcc
   104881 tacggcggtt ccggcgtgac cgactaccga ttccgtaacg tggtcgccga agagatcgcc
   104941 cgcaccggca ccacatcctt cggcgcgggt atgagcctgc aggacgacgt cgcacttccg
   105001 tacatcatcg atctgggcac cgacgaccag aagcagcgct ggctgcccgg catggcggcc
   105061 ggcgaactca tcggcgccat cgccatgacc gaacccggca ccggatcgga cctgcaagga
   105121 atcaagacca ccgccgtccg cgacggtgac gactggatcc tcaccggaca gaaaaccttc
   105181 atcaccaacg gcatccactc cgacgtggtg atcgtcgtcg cccgcaccga ccccagcgcc
   105241 cgcgcccgcg gcttctccct gctcgtcgtc gaacgcgaca tgcctggctt tacccgagga
   105301 cgcaagctgc acaaggtcgg cctggccggc caggacaccg ccgaactgtc cttcgaccag
   105361 gtgcgcgtac caggatcgaa cctgctcggc accgaaggcc gcggcttcct ctacctgatg
   105421 gagcaccttc ccctcgaacg gacctccatc gccgtcacct cgatcaccgg cgcccgcgcc
   105481 gcgtacgaat ggaccaagaa ctacgtgttc gagcgcagcg cgttcggcgc accgatcggc
   105541 gacctgcaga acactcgctt cgctctcgcc gagatgctca ccgaaatcga agtcacccaa
   105601 tcgcacatcg accggtgcgt cctggccctc aacgccgggg agctgaccgc cgtcgacgcc
   105661 gccaaggcca aatggtgggc cagcgaactg caaaagcgtg tcgtcgatcg gtgcgtgcaa
   105721 ctgcacggcg gctacggcta catgctggaa taccccatcg gccgcgccta cgtcgacacc
   105781 cgcgtccaca ccatctacgg cggcaccacc gaaatcatga aggaaatcat cggccgcgac
   105841 atcgccgccg acatgtccgc acctgcgtaa cccgaacacc ggacaacagc tccgtgaccg
   105901 ggctcgtccc aatccaagga agacgtgccc ggcgggccag ttcacgtgaa ctgatccagc
   105961 aacaccacgg gcgaccaagt aaccaactgc cgggcgctgt tttgatgcgg ccacccggcg
   106021 taacgcgaaa ctgaggtgaa acgtatggcc aagcccgtac ttctcgtgca cggtgccttc
   106081 accggagcat gggcatggga caaagtgatc gccgaactgg aacagcgcgg gatacgggta
   106141 aataccgtgg atcttccgag ccgcggtccg gacggaacgc tcgagcgaga tgcccaggca
   106201 gtccgcgact cgctgaaggt tttcgatgag ccggccgtct tggtgggcca ttcgtacggc
   106261 ggtgccgtga ttacccgtgc ctccgcggac aacgacggcg tggcacatct cgtctacgtc
   106321 tgtgccgctc tgccccagac cggcgaatcc gtaagcgacc tccttggccg cgacccggag
   106381 ccacagggcg atctcggtgt agcgctcgaa ccgcgggagg acggcaccgc cacgctcgag
   106441 cgcgaggcag cacgggaaac catgttcaac gacgccccag acgagcaagt cgcccacgta
   106501 ttggacaaga tgggcccaca cgcgctcggc acgctcggcg agaccgccac tgggctcggc
   106561 tggcagcaac accccgccac ctacgtgatc acgctccagg acaagatgtt ctccgtcgcc
   106621 ttgcagcacg agttcgcgag ccacgtcgac actgtcgtca aggtggacgc gggacacgga
   106681 ccgatgttca ccaaaccggt cgagatcgcc gaggcgatcg ccgcagcggc gagctgaccc
   106741 tgtccaaaag tgccgggccg gaacgaattc cgcccggtcc ggcgacgcgt agtcagccga
   106801 tctagaggaa gcccctggcc cttttcgcgg ggacacgcct cgtactcgac gggtcgatgg
   106861 tctggccgaa ggccgtccag cggggtgcct gtccgatact ggcgggcgcg tcgtctcaac
   106921 agcaccgtgg cgtgccatcg agtcaccccc ggcgcgtctg aagggggaca gcgacgacgt
   106981 cgaagcagcg gccgggcgct cggtgtcgat ctaggcgagc gggcgggtgg tctgcctcgg
   107041 tgccgctgtg cgcgggccct cccgactcag tttcgggtca cgtccagcgg cggcgcagct
   107101 ctccgccgat cgcgactgcc cgtcggcgac atctctaccg agccgggctg ttgaggtggg
   107161 tgaagaatcg cgaagacccg gcgtgttggg ggaactgacg ttcaagcgca ttggggatgg
   107221 tgtgggccgg cctgagttcg actggcgagg tgtgcgcatc gatctcggcg gtgggagacg
   107281 acagaagcca cgaatcagcc cgatcgggat gcgcagcagg tgctgagctg gccgggcgag
   107341 cacccgttcg acgcggcatc aggattgcgc tcggtcgacg aagctggtgc ggctcggctc
   107401 ctgctggatc gcctgcgggg ggaggcccca catcccgaga tgcgctcgga ttgctggtcc
   107461 ggaccgtcgg gtcatggccg agcagtttgc tcgaggcccc tggagtcgtt cctcatgtgg
   107521 ggcgggaagc gtgcgctgac cgtgccggcg agctcggcgt tcatgcgaac acggtgcgtg
   107581 agcgttttcg gcggcgtcgc cggctcgctt gccgatcacg acccggcgat cgcgactaca
   107641 tgacggcccg gacggcgttc cccgtccgtg gctcgggcga accgctactg ggccggctcg
   107701 aggccgttcc ggccaccggc tgacggttcg tcgaggatgc ccgtctcgtc gatctcaagc
   107761 tctgcgagca cttgacgcgt ttggtcgctt ccccgcgcgg tggtgcccag cggccgaagc
   107821 gccgttcggc tgaaccgggg cgccggcgag ggaaggagat cgtcgccggc tcgggtgaag
   107881 accccacgtt cccggttgtg cggatggtcc gcggcctccg cccccgtcaa caccggcgag
   107941 atgcaggcac cagcggcctc cgcgtgctcg gaccactcgg attgcgtgcg ctgggcgaaa
   108001 gcggccccga gtcgttcacg ccaccagggc caggtggcac gatcccaccg atccggcccg
   108061 tctccaatgt cgagcagcgc cagtaggaac ttccagtacc gctcctccac ggctccgacc
   108121 gcgacaaggc ggccgtcaga tgctgggtat acgtcgtaga acggggcgcc ggaatcgttg
   108181 aggttcgaac cccggtcttc gttccaccgt ccctcgttgc gcatctcgtg actcatggtg
   108241 ctgagcagcg cgtggccctc gagcatcgac gtgtcgacca cctgtcccat acctgacgcg
   108301 cgggcctcca acacggcagc cgtcacccct agcgtgagca acattgcgcc accgccgtcg
   108361 gcgagcaagt tcatcggtgg tgccggcagg gtgccggcgc gtcccaggtg ggcgagtacg
   108421 ccggagacgg ctaggaagtt gatgtcgtgg ccgggctggt tcgccaaggg cccggtctgc
   108481 ccccaaccgg tgatgcgtcc gtagaccagc cggggatttg cggccataca gtcagcgggt
   108541 cccacaccga ggctctcggc gacttcgggt aagaaaccct cgatgacggc atcgacccgg
   108601 ctcgcgatcg cgagcacgac ccgccgcccc gcatgggtgc gcagatcgag actcactctc
   108661 cgcctgccgc gcccgagccc ggcgtctcct aacggcgtga tgtcatcggc gggccgaggg
   108721 cggcagatgc tgatcacctc ggcgccgaga tcggctagca gcattccgct gaagcgcacc
   108781 ggacctcggc ccccgagctc gagcacccgc agtccatgca ggggtcccac gttgcatcca
   108841 ttcccgtacg gattatcgcg cttcgagggt ccgctcgcgc tactgcacga gcggaccctc
   108901 aaatgtcagc taggcaagaa cgggcgcggc atcaagcaca tagctcgaga acccgccctc
   108961 gacctcctga ttcacggctg tgacgtagtt gcccaagccg cccagatagc acaaggtgct
   109021 cggcttcttt ccgggcacgt tcgcgcccag gaaccacggc cgatcgccca ggccctgctc
   109081 gagcagcgtc gccttgagga ccatgtcgca ctggtccgac caggcctcga ccccctccgg
   109141 agtggcctcg acacgggtgg ccttctcggc tagggcgcgt tcgaggatct tttcgatgag
   109201 atcgacctgc gtctcgatga ccggtgggtg gctggcgaaa ggcgcctgag gtcccaggat
   109261 cgtgaacagg ttcgggaagc cggccgccga cagaccgagc agcatcttgg ccccatctgc
   109321 ccactgctcc gcgatcgtgc gacctccgac tccgcggatg tccaggttgg acagggggcc
   109381 ggtgatggcg tcgaaccctg ttgcgtagat gatcacgtcc agctcgtact cggcgccgct
   109441 cgcagtacgt aggccggtcg gcgtgatctc gtggatcgga tcctcgcgca cactcaccag
   109501 ggacacgttc ggacggttgt acgtctcgta gtagaaagtt cccagcggtg ggcgcttgcc
   109561 accgatcggg tgggtcgtgg ggcagagcag ctcggctgtg tgcgggtcct tcacaatggt
   109621 ccggatcttg cggcggacga actccgcagc cgtatcgttg acgcgctggt ctaccagcag
   109681 gtcgtcgacg gtctcgaaga tgaaccggaa accgccggcc tcccaacccg cctcgaagac
   109741 cttctccagc tcctcgtcgc tgagctcgga accaagccgc tccggggatt ccatcgggaa
   109801 gccgaagacg tgcttgaacg ccttgtccca gacagtctcg tagtcgcgac tgagctcggc
   109861 cttctgctcg ggcgacaacg catgattgcg ggtgggcacc acgaagttgg gggtgcgctg
   109921 gaagaccgtc agattctcgg cgacgtgcgc gacactctgg atgacctgga ctccggtagc
   109981 cccggtaccg atgacgccga cccgcttgcc ggccaggtcg accggctcgt ggggccactg
   110041 ggacgtcgaa tagaactcgc cctggaagga gtccgctccg gggaagggcg gcttgaaggc
   110101 gacacccagc cacccgaggc ccgtgatcaa ccagcggcag ctgacctcga ggccgtcctc
   110161 ggtgaccacg gtccaacggt tcgtgttctc gtcgaaggtt gcgcccgtga cacgcgtgga
   110221 gaaccggatg tgcttgcgca tgtcgtgctt gtcggcgaca tggcgaaggt agtcgagcgt
   110281 gtcgggctgc gcggagaaac gctcacggaa gtcccattcc tcccagccct cacggtcgaa
   110341 ggaaaaacag taggcccagc tttcggtgtc ggtccgtgcc ccggggtacc ggttccagta
   110401 ccaggttccg ccgacgtcgg taccggcctc gaacacttgc atggacagcc cgagcttgcg
   110461 cagggcgtgg atggtgcgca ggccggcgaa gcctgcgccg atgacgacgg cgtccacgtc
   110521 ggacagggtc tgcaatggca taacgggtgg tcccttcgat ctttcaggtt ttgtgttact
   110581 ggtgcgccag cttcggcggt cgacctagat cgacgaactg cgtcgaggat caggtgggca
   110641 aggtgtggcc ggcacgctgc cgtggttgcc agccgggccg gactcgtcct ggacgcagcc
   110701 gcccaccgga aagcgcatgc cgtcggtggt gacgccagtg atgactcgct ggaggggaac
   110761 agtcatgacg caactgtgac acgcatctca gaaccggtca tcctcgtgcc caccacaagt
   110821 ttgtgcacta atacagaagc ggtccgaaca gcgcctccgc tggaattccc gcggtgatta
   110881 gtgcgggtct ggattgaatt acggttcgac tgcggagaag gcgactcctc tgccggcacg
   110941 cgacccgcgg ccccggcgcc cgccggtgtt gtcggccagg ttgagcgggg gctgagggtt
   111001 gacctcgaca gaagatcttc ctggccggtg ccgtcgacct cacctcgacg acggcaccgc
   111061 ccgccagccg cgtcacgggg ctcgaccatc aggtgaccta agcggcggct tccaccaaca
   111121 cttcgggcag cggtctgcat cacggggagt acgacggccc cgagcgggtc gagtcggact
   111181 ggtttgccgt gacggatccg gatgtcgagg ctcagctcgg ggagggaacg agcactacga
   111241 ccgggtcgtc aaagggagcc cgcaccacca ctggcatcct gcagcccctg caacccgaca
   111301 cacgcgtcac ctgcatcgac cggcagttgg gctggtgact gtgggacgac cactgcaccc
   111361 tctttgtatg tatacacaga aatgcagcgt cggaatcatg gcctgcgaac cctggggaga
   111421 ctcgccgccg aggcagacac cgccgcggcc cggctagaac aatcatcggg ccagctcgga
   111481 cttcgacccg gctacctacg gagggagctg gaaagttgag agtccacgac ttctccctga
   111541 tgtgtccaaa cctcatcaaa cacgctcacc agccacaaca ggtccacttc gagccgactc
   111601 tcgtacagca ctttggtgcg cccgtcgaat cggcggacgg tgaatcaatc gattggatta
   111661 agagttgcta ttccacgtcc gcgtcgtcgg cctcgtcggc ctcgtcggcc tcaatctgat
   111721 cgctggtttc ggtggggtga tctgtcatgg gtagggcgga tgtcgggggg agcaggccat
   111781 tcatccgcag aatgaggagt gcgagctgcg cagtcagctg ggcgtgtgca tcggtggcga
   111841 cgtcgaggcc ggtcagctgc tcgatcctgg cggtgcgata gcggatggtg ttggcgtgta
   111901 cccccagaag tcgtgcggcg cgtcgaacgc tccacccggc atccaagaag acgctgagcg
   111961 tggtcaacaa ctctcgggtt ttggcgctgt ccgacgcgag gagcgggcca agtgcgtcat
   112021 gcgcgtagcg caaggcatca gtcgggtcgg tggaggacaa gagcagacgg ccggcgccca
   112081 gttcgtccac tgtgaggaat tgagtgccgg gaatgcctaa atggtggtgc atgcaggaca
   112141 ggacctgacg ggcctcgtta aaggcgcggg tgtcctcacc cggggcgtag gccacggtgg
   112201 aaatggcaac gttcagagcg tcctcggagg cgattccggt gacggctgca cggactcgat
   112261 ctttggccca ggcgacgccg cggcggtgat cggcactctc gggaagctcg agaatcaggg
   112321 caatgtcgtt cccggatggc gcagccatga ccgccgaggg tgattcacga tcggtgagcc
   112381 gttttgccag catctgaggt gagatttgca ggggcgcgtc cttctgccgc gcggcaacca
   112441 gacatacgac gcgcggaacg tccagacgca ggcccaacac ctcggcccgc tcctcgaggg
   112501 ccgcgagcga ctcatcgcca cgtaacagac ttcccgtgaa tgcctcgatt gtgtgccatt
   112561 gaacggtgcc ggcgcgtcgc tcaccggatc tttccagcgc gatgttcagt gcggcgcggc
   112621 gaaccacggc ctcgtcgagc gggctcaatc gacgaccgtg ctcggctaca acgacatagc
   112681 cccagcaatc cccatcgagc atgacggcgc agaggaggag acggtgatgc aatccaagcc
   112741 aggggagggg ttggatcacc gtgggcgttc cgggcttcaa ttgggcgagc gattccctga
   112801 ccgctggagc ctcgcgaata tccttgtcca acaatttcgg ggtgaagttc tgcgcggact
   112861 gggcaggaga ggacaacacg cgtcggcgga atgcgttgtc gtagatcgcg cacggtttgc
   112921 ccagaaggcg ggcgaccgtg tcaccaatct cccttaggct cgaccctcga agcactatct
   112981 cggtcaactg ctcttccagg ctggcggctt gccgcagctg ttcgatctga gtggctaccg
   113041 tggacagact cgagcgcagt cgagtagtta actgtgtctg ccggatcgcc gtggccccca
   113101 ggtccgcgaa cgcgacagcg agttcctggt ccgcggcgct gaactcgaca ggggtgtttt
   113161 cgctgtcgag gtagacgacc ccgatgactt catcgtgaag gaccatcgga acaccgagga
   113221 cggattgggc gttccatcgg cgcatcgcgg atttgatcgg tcgcgggtca gataaggtgt
   113281 tcgatagggc caccggtcgg cgagtcgaga ggatctcccg ggtgaaactg tcctgcatcg
   113341 tgccgctgac cagctgtttg acttgagcgt cgatgttggt cggggcatgc gccgcccgac
   113401 catgcagaag cccggtttcc ttatccacca gatgaatgct gcaccggtcg gcaccggtca
   113461 ataggcacag cttctcggcg ataacatgca atacgacatc gagatcgcgg ccctcggcca
   113521 acgcctcggc cacctcacga aacgcggtgc acgcccggat gtcggcgcgg taggaacctt
   113581 gtgccgtgcc agctgattta catttatcag gcaagggggc tgcagtgctc acacgaatct
   113641 ccgttgatct gggtcacgcc tggaggcaac ccgtaatgtg aagcctgcca catgacccat
   113701 gtagcgccat gctcgcgatg agaaaccctg atgtcaaatc tccgcgcggc ttcatccagg
   113761 atgcccgcat agcggcgtgt ctgtcacgtc ggtgcggtgg tcgaggagta gggccggatg
   113821 atggaactgg ccatggctga ccgtagggcc gtcgccacgg cgatcgcgac ccgacgagcc
   113881 gggtatggcg aaaatctcga cgagctgtgc gcccgcgacc ggcggcatag cgaccatgcc
   113941 cgcaaggcat tgggggtagc tttgatcccg aaggcggtac atccccggac agcaggcccg
   114001 ccgacgtacg agccgaacgt tgttgcggcg ttgatcttct gctgggcggc gctggcaatg
   114061 ggcggcaagc ggctggcgcc gacgttggcc gatctcgtac caacctcgta cccactgtgc
   114121 ggtcgttcga tgaacttgac ggcaggtctg cggagccatt gacggaaggc cgaacgcatg
   114181 aagtagcgtc cttgcgaggc tggatgtccg tgtttcttca tgacaccgcc acacaggacc
   114241 gtgggctctc aaagttggat ctggggcagc aggcacttgt gcaacgcgag ccggtaatcc
   114301 tcactcaacc cggctgcgcc ggcttgaccc tcgatggtat tcacgtcgac agaccgcgac
   114361 acggccacac agcggtcccc ctggaagaga gcagctcctt gccgtaccga ggttctgccg
   114421 atctcatgga cgccgattcc gagctgcacc tcgccggggt aggaaacttc cgcggcatag
   114481 tcgatttcga cgtgtgccag caccatcctc atcgggcgtt tctcggaaag atagctgtct
   114541 accattcgat acagatggac ccgtgcctct tcgaacaatc tcgcgatcgc cacgttgttc
   114601 acatggccga cggtgtcaat gtccccgaac accaggctga ggtcgcgctg acacgggtac
   114661 ttgtcgagcg gcaggcgagc caggggatac atggtcatga agtactccag gcgcccgtgt
   114721 tggtgtgacg aagaagctga ctaccccagg ccgaacgcat tctgcgcgtc gtcggacgtc
   114781 gcggaaccag gtcggacatc gccgactcag atagtggggt gggtctcgga ccagcaagca
   114841 tgtgctgatc ctctcagtaa cgtcagtgac aggttgttcc gcggcgggca cacgctgtgc
   114901 acaactccaa aacccacgtc agcaggatga accggcacga tcaaatcgcc atctggccac
   114961 cactcacgat tgtccgacga ttcttattga ctcacccaac acccaaaatg cgcggccacc
   115021 acatcaacga tcctgcgccg gggataggtc gaccctttgc tgcttcacgc gtattcgata
   115081 tagctgactg cccccggtca atcccttcag ttgatatgtt cccgccgatt caatggttat
   115141 ttcagcactg tcaattcggc gcatggcctc actgtctaca agcacctcaa gaggctcggc
   115201 tattgttgcg atcctgctgg cccgattcag cggctggcca atccaatcgc cagcactgcg
   115261 gacagcggta ccccacgcaa tgccggcatg tatgggcgga aggccctcct gttgggcggc
   115321 ggtaacaatt ttgagcacaa ccgcagccag acgggttgga tcgggcgaga gtaacatcac
   115381 cgcgtcgccc actgttttga cgaactggac cggcggctcg accaaatcgg tagttagggt
   115441 gtcaagtcga tcagccaagt cgcccagttc ggtcggcgtc aactgttcgc ctaaaacggt
   115501 gaatccgacc atatcagcga aacacgctgc aatgacatgt gattcagacg tgtgttcagt
   115561 agttatgtct gcacgaattt gttgactgat ttgctgtcta aggcgagtgg cgaccgcccc
   115621 gtggagaagt tgggattgaa attcggcgaa ccgttgcaac tcacgcgcaa attgtaaagc
   115681 gatttctggt cgatcgcggt tggtgtccag attgttctgt atcaatgact tgctcgcgtc
   115741 ggctaaagtc gaggtatttc tgcccacgat ccgggcgaac gcgaacaacc cagcgtctgc
   115801 gatacccaaa gcgcgatact cgttgagtag ttgcgcaagg cgcaggtcgt catcgttata
   115861 atctaccgaa gtacttgcag acacgccgcg acccatcgac ctaaaccatc tttccacgtc
   115921 ttccggcgat atattggtcg attgtgaaat ctgctccaac gagtatatgg cgccgtgggg
   115981 cgaaagggtc acgtcgagca attggtgacc taactggcct tcacgagttg cggacgccag
   116041 gctatcggta ctgatccctc ggtcggcgag atgttgcagt acccggatcc gggtagatcg
   116101 ttctgttccg tccaggccat ctaacaagcc cgcctctgcg aattcgcgaa tacgccggtg
   116161 tcgtcgaaga actcggacga atgcggacca cagaaatcta ccccttgacg acggcacgtc
   116221 aagattgtct caggccgcgc ccgaggcggc tcaggaccag actccactca gcgccgattc
   116281 catgcccagc ggggggtgcg gtcttctcga gcttccatca tggcgtggtc ggactggggg
   116341 cggtcggctt ccaattcgtg ttgaggttgc gcgtgcgagg gttcgggacg atgacccatg
   116401 agcctgcaca aggcggcgac tgactctgcg agtgatcgta gggtcgccca gcttaaggct
   116461 tgtccggctt acgctgcatg ccgacgagat gggcacgtcg tcgaccgact acccgagtgt
   116521 ttctgtagaa atagttattg gaataccgtc cagggatctt tcgcccggtg ggggatgtaa
   116581 cgtggtagga cggctagatt tcccccatgg gcgaagacag ggtgcgtgtc cgagtagggg
   116641 ataacggtgt cgcgacggtc accatggtcc gcagcgacaa gcacaacgcg ttggatcatg
   116701 caatgttcga aggattgctg gaggctgccg acgagttggc tgccaaccga cgtgttcgag
   116761 cagtcgtgct ccatggggag ggtaagagtt tctgcgcggg tctggacgtt ccgagctttc
   116821 tggctggtcc aacgggtatc gatgtgctac tcgtccgaga acacggtcgt aaggccaatt
   116881 tcgcccagcg cgcagctcat gactggtcgc gcgtccctgc gccggtgatc gccgccatca
   116941 ccggcaactg cttcggagga ggcatgcaga tcgcactcgg cgccgacatc cgtatcgccg
   117001 cgcccgacgc gaaactctcc atcatggagg tcaagtgggg gctcgtgccg gacatggcga
   117061 tcacacagtc gctacccagg ttggtcggca tcgacgtcgc caaggaactt actttcaccg
   117121 gccgcatcct ctccggcgat gaggccgatg cgcttggtct ggtcactcgc acggcggaag
   117181 atccgctcgc atcggcgttg agattggcaa acgagattac ccagaagtcc cccgacgcgg
   117241 tccgcgcggc caagcgcctg tacgacgaga cctggtccgg cgccgacgcc gccgcggcac
   117301 tcatgctgga aacggacttg cagaccgaac tttacggaaa acctaatcag gtcgaggccg
   117361 tcacagcggg cgtctgcaaa cgagctccgt cattcgccga tctagactga ggcctgcccc
   117421 agggagttca agacacagta ggcggaggtc cgacggcgca tccctcacag ggtgggcgac
   117481 aggggcgtgt gctcgttcct gttggtggcc tcagttcgag tgggatgaga atttggacaa
   117541 cacaccaggg ttgagacaac acaccagggt tgatctgccg agccagcggc ccgctcttca
   117601 cctcagatta atgtcggcgg gatacgtcgt ccgtcgggag gaacttgagt gtctgctcca
   117661 gttacagaga agaagggccc cctcgcgggc attcgcgtcg tcgaattcgc aggcctgggc
   117721 ccgggcccgc acgccgccgc gctcctggcc gatctcggcg ccgacgtggt gtgcgtccag
   117781 cgtcccggag tgattccgcc ggacggcccg tacgaccaga tccagcgggg tcgtcgcgtc
   117841 gtcgaggcca atctgaagga ccccgagcag gtggagaagg ttctcggtct gatcgagcgc
   117901 gccgacgtcg tgatcgaggg cttccgcccc ggtgtcaccg agcgcatggg tctcggcccc
   117961 gacgtgtgcc tggagcgcaa cgagcgcctg gtgtacggac ggatgacggg ctggggacag
   118021 gagggcccgc tggccggcgc cgccggccac gacatcaact acatctcgct gaccggtgtc
   118081 ctgcacgcca tcggccgcaa gggtgagcgt cccgtgccgc cgctgaacat ggtcggcgac
   118141 ttcggcggcg gctcgatgtt cctgatcttc gggatcctgt cggcgctggt ggaacgccag
   118201 acgtccggga aggggcaggt cgtggatgcg gcgatggtcg acggcgcgct ggccctgtca
   118261 cacatgatgt gggcgttccg tggacgcggc gtgtggtccg acgagcgggg tgtcaacctg
   118321 ctcgacaccg gtgcgccgtt ctacgacacc tacgagacgt ccgacggcaa gtacatggcc
   118381 gtcggatcga tcgagccgca gttctacgct ctgctgctgc agggcctcga actcgacccc
   118441 gccgaactgc cgcagcagat ggacgtctcg gcgtggccgc agatgaagaa ggtgttcgcg
   118501 gagaagttcc tgtcgaagac ccgcgacgag tgggcggcga tcttcctcgg caccgatgcc
   118561 tgcgtgtcgc ccgtgctgac gttcgcggag gcgccgtcca acgagcacat cgccgcgcgc
   118621 gggtcgctgg tcgatctcga cggcgtcacg cagcacgccc cggcgccgcg gttctcccgc
   118681 accccggccg gcgcacccac cccgcctgcc cgcgagggcg tcgacatcga caccgtctgg
   118741 gcctgacctg gaacaggcgg aagcatgcaa aggcggcggc gcctgtatcg aggctgccct
   118801 tgattactgg ctaactccga cggcctcgag cactggagct ggtcgtcacc ggcgggcagg
   118861 acttgctctt gatctcgccg gcgacgccgg cgaagtaccg gaacaggttc gccagggtgg
   118921 cgatctcggg gcgcgcctgg gtgtgcagcg catcgccggt gtccagagcg gtcatgcggg
   118981 ccagttcctc ggcgcgcgcg ttggccatac ccaagcccca tgttcccgag cccgagcccg
   119041 agcccgagcc cgagcccgag gaaacggtaa accgaccgat cccccctcga cggcggaata
   119101 aacgattcct gcggctctgc tcgatccgtc gcactcgctt gccgcggact gtgcacccca
   119161 gtcctgaacc gggatcgtca gaagtcaact gcagcagtcg caaagtgcca gctagcggtg
   119221 cagtcgtctt ctgaatctga caccgcaggc cggtttccgg ccacttggtc gacaaacgcg
   119281 gctaaggcgt gagcgcgccg acaggtaccg ccgacgcgct ctccgtctct ggacgtgctg
   119341 ggtcagccag ccaggatagg acagtatgtg taggacgacg agcgtgagag cgcgaattcg
   119401 aagatcccgt agccggtctg cccgttccac tcgaactcgc agcaacggtc ggtcagggcc
   119461 gagtcgagag tcttcggacc cacggtcccg tcgagcgggt agacgtctaa ctcttcgtgg
   119521 tcgcggccac gaaccttgcc gtgatgcccg ccgtaaccgc cgcccgccat gtagccaccg
   119581 ccggccgagg cgtccgaatc gatgcggtaa gtcctaccgc cggcagtcac gacctccacc
   119641 gcgccactgg cgaggtcgtt gcccgcggtg aacaccaagt cgtgccggac gtcggtgatg
   119701 tcgtcgagtc ggccgtcgtc atgcatgacg gcaccctcca acaggattcg cccgccgtca
   119761 cgatcctcga cgagcaggaa tccgaacgtg cggtccggga actgcgcctg gtaccagatg
   119821 tgcagaccct ggccccggac atggtgcgaa ccccgcggga acggtcccgc agtccgtacc
   119881 agcccgcgac gtcggtggtg gttccgtcga gggtgagtgt gccctcgtac cggccggggt
   119941 ggaacagatg gtcgaatgag gtgacgtttc cgtcggtgtt ctccacatcc accgacccga
   120001 gccaataggg tgcgcgggcg tgccagagca aatccagtgt gaggccggtc ttgttctcgc
   120061 ccagctggat tcgccaggtg gaattgtcgt cgaccgtctc ccacttcaac ggtccgacgg
   120121 aggcggcgtc ggtctcggag tgttcggtgg agtagcggag attgcgctgc tcggactccg
   120181 tggtgaggac gacgaaaccg tccacgacgt tgcggggcgg gtagacaccg gcgccgagga
   120241 ttaccgacgg tgtggtgccg ctgtccgggt ggagattgaa catgaaccgg tcgaaaaatc
   120301 tctccggcat ctccgaggtg gcctgcgtta ccagggcgtc gtggaatccg tcggtcatac
   120361 gtgctccttc tggttgacgg caggtgtcag cgggagacag gcgcggtcgt ctcctgttga
   120421 cttttcgatg gaatcgacct ctttgtggtc gagggtgaac cggtaggagc tcctcatcag
   120481 cagggaggcg agggaaacgc cctccagcgg gaacgcctcg gtttcgtacg cggaccacat
   120541 cccccgcggc cggaccgtcc gggggggctc aattcggcgg cggtacccag tggcgagatc
   120601 cgccccccca aaccggatca agtcgaccta catagagtcc ggcaactcgc gagagccata
   120661 cacaaaacac tgcatcaagc tcggtcagtt ctgatcttcg ctccctcgga tgtgctgtgt
   120721 catcagttcg cgcgcacggc ccgaattgcg gtcggcgatc gcttccgtga tctcgcggtg
   120781 agccgttagc gagcagagac gggactcgtg cgaactgaag cgtgcactat tggttgccgc
   120841 cattagtacc tcggcagtgg cgtgcatgaa cgctgccaat agtgtgttgt gacttgcatc
   120901 actcactgcg acgtgccaag cctgacttgc tgagagatac tcggggatgt tgtcgagcga
   120961 gtgtgcctgg cgatcctgga agaggtgaat cgcatcgagt tcggccgtgg tccgccgctg
   121021 tgccgccaga gcggcgcatg acggctcgat gatttcgcgg gactcagtca gcgtgggagt
   121081 ctccggtccc caaccctgcg cctggagaaa gacatcgagc gatgtaatca ggtcttgctg
   121141 cgttgggcga gacacaacgg agccgccgtg acgtccggtt aaggtgacga tcagtccttg
   121201 ttgtttcagg atggcgaggg cgtcgcgaac cgccgcacgg gtgagtccac cctgctcgac
   121261 gaggactcgt tcgggcggta ggtgatcgcc ggacttgtat tccccgttga agattttcgt
   121321 acgcagatgc tcggcgaaga gctgcgcggc tgtaggtacc cgcacagggc cgaatggggt
   121381 gtgtcgctgc gtgtcatgtt ccacgtccac ggtgctccaa tcgggttcaa tatcgactgg
   121441 tccaaccata tccggtctac ttcggtgcag ctggtgcagc tagagacttg tgattacttg
   121501 gacactgcct gcaaacgtaa tatccgggac aacgacgcta atagcactgg ttgggtcatt
   121561 tggaattcgt cgtcagtgaa ttgttgcgtg tttgggccag cttcaatccg tcctcccatg
   121621 tcgcggcacg ggcaatgagg gcccggtatt tcatgatgtc gctgcgacgg ttgagggtga
   121681 gcgcgccgat caaacggtgg ccgtctcggt agagggcagt gaacacgtct gtggcagtgt
   121741 ctccggtaac gactgttggt tcgccgatag gccgaccagc gagttgaatg cggttgccat
   121801 accaatcgga ccagaagtag ggaatgtggc ggtagggcgt tgcgttgctg ggatcgagca
   121861 ggttacgcat ggcgtgcgcc ccctgttctg cggcgtttgt ccagtgttcg atcctaagtg
   121921 gtgtgtcgaa atcctggctg taccatcgcg caacatcccc ggcggcccac acattgcccc
   121981 ccgcgtgcat cgttgcatcg cagacgatgc cgttgtcgag ggttagtccc gaacccgtca
   122041 gccagtcggt ggcaggtgtg gccccgattc cgaccactac gaggtcggcg gggagatgtc
   122101 gtccattcgc cagacggacc ccttcgacgc ggtgatcgcc ggagatcgac tcgaccgcga
   122161 caccgcagat cagctcagtt ccgttgcgtt catgcagtgc gctgagccac cgtccggcgg
   122221 tctcgccgac cgcgcggacg agcggtatag ggagcgcctc cacgacggtg actgagcgac
   122281 cccgcttacg aacggcggcg gcaacctcgg cgccgatgaa tccggcgccg actatgacca
   122341 ctcgtgcgcc ctggtccaga gccgaacgca cgattcgcgc gtcgtcgatt gtgcgtaatg
   122401 tgaccacccc gtcgaggtgg gcggcagcgg gtatggtgcg cgcgatggcg ccggtcgcga
   122461 tcagggccgc gtcgtacggc accgtgcggt ccccgacatg tacgatgccg ttggcaagat
   122521 cgagtgaggt ggctggttgg ccgagcatca ggctcactcc gagtccgtcg gccagttctt
   122581 ctacgccagt gaaatgggtg atatgggagt cctgatcgct gtcgatgtac tccttcgaca
   122641 gcggtggacg atcgtagggc agatgcgttt ccgccccgat cagggtgagt cggccagcgt
   122701 atccggcgcg gcgggcagtc tccagtgcac gcaggccagc cagcgaaccg ccgacaacga
   122761 cgatatgttc cggtgccatc gttcaatcct gctcgaggat gagtgcggcg gttgggcagg
   122821 ccgcgaccgc cttctccacc aactcgcgct cgtcctcggg gacgtcctcg cgcagaagaa
   122881 ggagatcccc ctcgtctccg acttcgaagt aggtgggggc aatcgcttcg cagtttccca
   122941 gggcggtgca cttggcgcgg tcgactacaa ctttcactgt tcttctcctt cgtgcgcgta
   123001 ctgtcgtgcc cattcctcaa gggcggggag ttgaggaagt tcgtgttcta ttgcgcggat
   123061 gacgatttcg tccgtcggcg tcgttacggc accacgccaa acctggcccg tggtgccgtc
   123121 gatggtgatg acatctccca cgcgaatcag cagcccggaa ggggcgtgga tgccgttcgc
   123181 gctgcaggtc aggtcttgcg cgcccacgac tgccgggatg ttccagccgc gtgcgacgac
   123241 ggcggcatgg ctcaccaggc cgcccttggt ggtgagcaga cccacggatg cggccatgcc
   123301 cgcgacgtcc tcgggcttgg tttcgggacg gacgagaatg acgtcatcgt cggcgtccgc
   123361 ggcctcatcg ctggtcagta cgacgcggcc gaccgcccgg ccgggagacg ctccgagtcc
   123421 tgttgtaacg agatcgtggg cggcgtcatc cgctccgacg tgggcaaggg cctcgtcgcg
   123481 tgcccgctga cgaacggcgg caggtacacg gctgactgcc tcggtgggag tcagccggat
   123541 atccgggtcg ttcacgaggt cgaccgcaat tcgtacggcg gcgaccgcgc tccgtttgcc
   123601 ggcacgggtc tgcagcaacc acagtcgacc gttttcaatg gtgaactcga catcgcacac
   123661 gtcgcggtag tgcacctcca ggcggcgcag ggtctcctgc aattcggtat agatcgcggg
   123721 gtgcaactgt tctaggtcgg cgataggcaa ggtatgtgca gtgcccgcga ccacgtcctc
   123781 gccttgagcc atcgggaggt agtcgccgta gaggactgcc tccccggtcg acgggtcccg
   123841 ggtgaagacg acaccggttc ccgagttgag ccctcgattg ccgaacacca ttgcttgtac
   123901 gttgaccgcg gtgcccatcg actcgtcgat gccttctttt gcgcggtagg ttcgggcccg
   123961 ctggctatcc cacgagcgga agaccgcctc gaccgcttca cgcaattgca ccgtcggctc
   124021 ggccgggacg tcccggccgg ctacctgacg gatgcgttca cgcagcaaaa cgacatgctc
   124081 gcgtaaagac tccgtggtgt cgccgctgtg gccgacgtac aactcgtcgc agtgcacgcc
   124141 catgacggtg gtggcataca tgtgcaagaa ccgtcggtag ctgtcccagg cgaacttctc
   124201 atcaccggag accttggcca acccttcgac ggtgtactcg ttgagtccga gattgagcac
   124261 cgtgtcgagc atccccggca tggaaaccgg ggctccgctc cgaaccgcga cgagcagcgg
   124321 atcgttgtgg tcaccgaacc ggcggcccat ccggtcaccc agccggctgg tgtgcagggt
   124381 gatggcctcg tccaacccct cgggccagcc ctccctccga tatcgctggc agagcggaac
   124441 cgagatggta aagcccggcg ggacgttgat cccgagtgtc gagatcatct ccgccaggcc
   124501 ggcccctttg ccaccgagca gatccgtcaa tgcccgcgga cgagcacggt gcgggtgatc
   124561 gaacggatag atcgccgcgg tcagcggggc ggcgtccccc aatgcattcg acttatgagc
   124621 aagcggcacg tcagatcctt tggtcatgcc attttcaatg gttgacagaa acgtaacaga
   124681 gatcatagcg tctggggaag agagacgtag aaaacagacg ggaagtggac aaagtggcgg
   124741 caaccgaggc ggcatctcgc gcggacttga tggacatctc aatattcggc caggaccgcg
   124801 agatgccggt cttcgacgaa ttgcgggcgc acgatccggt gcattggaac gcaccgtccc
   124861 ctctcggccc cggattctgg gccctgacga agtacgccga cgtgaagtcg gccgcgtccg
   124921 acaacatcag gctgtcctcc gcgggaggca cgcagatcct cgaccggaag gtcgaaggca
   124981 aactcgccag cctgcacaac atggacgatc cggaacatgc ccagctccga aaaattgcgg
   125041 tcccacacct gcgtgccctc cgcgtccaac agtggcagga cgcgatcgac gaagcggtga
   125101 agtatctgct cgacgacgtc gcgagccgag caggcgaatt cgacatggtg cacacggtct
   125161 ccgcgaagct gccgatgctt gtgctctccc gagtcctcgg cgtgcccgca gccgatgcgc
   125221 cgagaatggt cgactggacc aatcggctca ccagctccga cccagccgac gaggtcgatc
   125281 aagcggcact ggcctcggct cgcgacgagg tgatggcgta cttcgagaaa ctgaccgagt
   125341 tgcgtcgacg tgagcccaca accgacctga tcagcgtcct ggccaacggc aagaaggatg
   125401 gtcggccgct tacttgggaa gaactcgcgg cctactacat cctgctggtc gccgcgggaa
   125461 acgagacggc ccgacatgca gtctccggcg gcaccatgct gttgcaccgg cacccggaaa
   125521 cctggcaacg cctggtcgcc gatcagagcc tcctcccttc ggcggtcgaa gagatcctcc
   125581 ggtgggtcac ccccgtcgca gcaatgcggc gtaccgcgct cgagccactt cggatcggtg
   125641 acaaggacat cgcggcgggc gacaaagtgg tgttgtggtt ctccgcggcc aaccgtgacc
   125701 ccgaggtatt cgaggcgcca catgagttcc gtatcgatcg aactcccaac gagcacctga
   125761 ccttcggctg gggtatccac ttctgcctcg gcgcacacct ggcccgcgca gagatccgca
   125821 ccttcttcgg cgaggtactg cgccgcggga tccgattcga ggtgatgggt gagcctacgc
   125881 gagtgcagca caacatcttc cgaggttgga cccaactgcc ggtccgcgtc ggaaaggcat
   125941 aacgatgtcc acgaccatgc cgggctccga cacgatgccc ttcccaccga attcggtgta
   126001 tatcgctggt gaatggattt catcccccga cctggaacgg ttgccggtgc tgaacccggc
   126061 ctcggaggag gtaatcggtt ccatcgtgga cgcctcccca gccgaggtgg aggcagcttt
   126121 cgccgccgcc cgggccgcgc taccgaaatg gtcggcgacg gcaccgggcc agcgagccga
   126181 cgttctcgac cgacttgccg acgcgttccg tgagcacggt gaggagttgg cggttcttgc
   126241 ctcccgtgag atcggcatgc ccatcaagga gtcccgcgcc ggtcaggccg acctgcccga
   126301 gcgcgtgctg cgtagcaccg cagatatcgc ccggaacttc ccatgggaag cccgcgacgc
   126361 atccggaact acggtcatcc gcgaaccagt cggggtggta ctcggcatca caccgtggaa
   126421 tttccctgtg caccagatcg tcgccaagct ggcgccggcg ctcgcggcag gctgcactat
   126481 cgtgctgaag cccgccgaac tcaccccctt gaacggactg ttcgtcgcag ccctctgtga
   126541 gcggatcggg gtgccgtccg gcgtcgtcaa tgtgctgacc ggtagagggg cgacgacggg
   126601 ggaggcgttg gttcaatccg gccagtacga cctcgtctcg ttcaccggct cactggcagt
   126661 tggtcgccac atcggtgcgg tcgccggtga gcgagtcgtt cgcgcgacgt tggagctcgg
   126721 aggaaagtcg cccgctgtgg tccttgacga cgcggacgtc gaggcagctg tgcgtgccac
   126781 cgtgcgcaac tgtttcacca acgccggcca gaagtgcaac gcccccaccc gcctcatcgt
   126841 tccggaggct cgacgtgagg aagctgtttc tatcgccgcg tcggcggccg cggcgtacgt
   126901 actcggggac ccgctcgacg agaactccac gatgggcccg ctggcgtccg ctctgcagcg
   126961 cgagaaagtc ttgagctatg tggaaggtgc acgcgcgcgc ggtgcacgcg ttgcaggcgg
   127021 tggtgcggtg gacggggtca atcgcggcta cttcgttcgc ccggcgatca tcaccgacgt
   127081 cgaaccagac gacccggtcg tacaggaaga gatcttcggt cccgtcctcg tcgttctcgg
   127141 gcacgagggt gaagacgatg cggtcaggct cgccaacgac accccgtacg gtctgtccgc
   127201 cgaggtgtgg tcggggaacc ccgcccgagc cgcggaccta gcgcgccgaa tccacgccgg
   127261 gcaggtgcgc gtgaacgggg tgcggacacc ggccctgccg atctcgccgt tcggcggtta
   127321 caaggcgtcc gggctcggcc gtgaattggg gccgttcggc ctcgaggagt acgtcgaggt
   127381 caaagccgtt cttggcgacc caagtgattc gatcccatcg aaagaggagc cgcagtgcgt
   127441 gctgtagtca tctggaaccc gggcgagcct tttaccatcc acgacaacgt ctgccgcccg
   127501 gcacctgggc cgggtgaagt ggtggtgcgc atccgcgcgg ccggtgtgtg ccagaccgat
   127561 atcgcgttgt cgaaaggtgc tttcgggcag tcgacaccgg tcgtcctcgg ccacgaaggc
   127621 gccggcgaga tcaccgaact cgggccgggc gtaaccggcc tcatccccgg tgaccgagtg
   127681 ctcgtcacct gggtaccgcc atgtggtcgt tgctaccact gcgtgcgagg ggaaacctac
   127741 atctgctcca atcgtcgccg ctctagtgag cgaggcgacg agggaagtct ctcggtcagc
   127801 ggagtgccag tccaagccgg aatgggcacc gcaaccttcg cggaggagac cgtcgtcccg
   127861 gccaccggag tgctgccgct tccagacgac atccccttcg agtacgccgc attattggga
   127921 tgcgccgtac ccaccggatg cggtgcagca ctgaactcgg cgcgggtgcg agccggagag
   127981 tcggtgctgg tcattggttg cggcgcggtg gggttgagcg ctatccaagg cgctgtcatc
   128041 gccggtgcgg ccgacatcgt tgcggtggac ccacaagatc ctcgtcgccg agcggcgctg
   128101 gagttcggtg cgactgcggc cctgccaccc ggttcggatc cgagggagag tttggtggac
   128161 gcgcccggat tcgacgtagt gatcgacgcc gtcgcgcggt catcgaccat tcgcgacggg
   128221 tggcaagcag ctcgacgcgg cggtcgcgtc gtcgtcgtcg gcgccggcaa gcccgacgac
   128281 atggtgcagt tcagtgcaca ggagctgttc cacgacggga agcaactcat cgggtccttt
   128341 tacggttctt cggatatgcg ccgcgaactt ccgcgactca tcgccctgtg gagggccggg
   128401 cgactcgacc tcagtcgcat ggtctccgaa gtcgtggacc tcgaacggat caacgacgtc
   128461 gtggcccggc agacagcagg cgaagtcgtg cgttccgtcc tattggtttg accagtgtct
   128521 cccggtagac gcgacgcaac cacgcaggtc acgcgattga tcggcgaaac cagtgggcgg
   128581 gcggggcctg ggacggcgtc gacggcgcgg gcacctctga gttcgcagac cgtcgcagcc
   128641 ggtcctacat ctattcagca acgttgcgcg acacggcgtc agccggtccg tttgaaggag
   128701 accacattca tgggcaatca gacgctcgca aacacaccgc tcgaccgtga ggcgcttgac
   128761 cggttgctac ggcccgagcg gattgccttg gtcggcgcga gcgacaagaa cctgttttct
   128821 cgtcgagcat tcgcacagca ccacagggtc gcagcggcca agcagctgat cctggtcaac
   128881 ccgcgcagtc ggcaggttca cggcgtccac acggtgccga cgtgcggtga catcgacggc
   128941 ggtatcgact gcgcgttcct catgacaccg cagcatgcga ccggcgaagc gctgatagat
   129001 gccgctgccg gtggtgtgaa ggcggctgcc gtgctcggcc agggctgggc ggaggaggga
   129061 tccgaaggct tacaacggca agaggagctt gtcgcgctcg ccgaggaact cggggttgtg
   129121 ctgctcgggc ccaatcacct cgggtttgcg aatctctggg acggcgtggc tccgtgcgct
   129181 ctgggtttgg acatgccggt cgagccgggc gccttcgctc tggtttccca gagcggcgca
   129241 gtgggatcgt cgatggtcgg ctacgccggc cggcaagacg tccgattcag cttcgtcgtg
   129301 actaccggta acgaggcgat ggttacggtt gcagatgtag tgcgctacct cgtggaggac
   129361 gagcacaccc gcgctatcgg catcttcgct gagacgatcc gcaagcccgc ggtcttccgt
   129421 gctgccgccc ggcgcgcagc cgagctggga aaagcactca tcatcctcaa ggccgggtcg
   129481 agcgaactcg ccgcacagac tgctcaagca cacaccggtg cacttgtcgg cgacgatcgg
   129541 gtgatcgacg cggtattgcg gcaggacggt gtgatccgag tgcgctcggt cgaggacctg
   129601 atctgcacgg gaatgctctg cgctggtacc ggaccgttgc gtgccagcgg cgtcggagtc
   129661 atgtcggtct ccggtggcgc ttgcgacctc atcgccgacc gcggtcagga cgttggactc
   129721 cggttgccgc cgctctcgtc ggcgaccaag gaccaacttg cgcaggtact gccagcatat
   129781 ggccaccccc agaacccgct cgacgtcacc ggatcggccg cgacccggcc cgaggtgtgg
   129841 cgcagcgcgt tcgagtcgct ggccgccgag cccacgatcg ggctgatcgg cgcagtcacc
   129901 tcgctaccga cgcctggcga accgcaacgc gacgacacct ttcatgccgt cggcgcggca
   129961 atcagggcca ccggcgtccc cggcgtgatc ttcccgcaga tcgatcagat tcagaacgat
   130021 catgtgcgcg aggtcaagtc agcgtccgga gtggacatcg tgctgccgag cgtcgagcgc
   130081 tttgctcttg ccgccgccgg actcgggcgt tggtcggact ggctacggac ccggccgggc
   130141 cggcctgcgg cgtcttcggc gtcgcacggc gatatcaccc tgccgggcag tgggccgctc
   130201 agcgaactgg ccggacggga cctgctcgag cgggccggca ttcctgccgt cccagcgaca
   130261 ctcgcaacca gcactgacga cgccgttgcc gccgcggtcc gattgggtga accggtggcg
   130321 ctcaagatgt gctcagcgca ggtagcccac aagaccgaac tcggaggcgt cgaactcggc
   130381 gtctccggta cgacagcggt cgctgcggca tacgagcgtc tggccgctcg ggctcaggcg
   130441 gcaggtgtcg aactcgacgg tgtgctcgtc agccccatgc gaacgggcgg cgtggaactt
   130501 ctcgtgggag tgacacacga tcccgactgg ggtcccgtcc tagccgttgc ggtcggtggc
   130561 gcattggtgg aactgctcga cgacagcgcc ctacgggtgc tgccggtcgg accggacgaa
   130621 gttcgatcga tgttcgaaga actgcgcggc tacaaattgc tgaccggatt ccggggaagc
   130681 aagcccgcag acatcgacgg tcttgtcgac gtggtactcc ggctgtcgga gttggcgcta
   130741 gcactcgggc catcggtcga gtcggtcgag atcaatccgt tgttggtgga cggcgaccgg
   130801 attgaggcac tcgatgtcct cgtcacacgg tccgttccat cctgagtcag gccctaccct
   130861 tccttgaact gatgattgga aacgaatatg gttagaccgc ctttgacagg aaaccgtatt
   130921 actcccgctg cagccgaaag cgccgaggcg gaccgtatgg tgcacgcgct gcaaagtgct
   130981 gggatggcgg tgccgagtgc cgaattgatc ggcatggaga aggcacctat cgggatcggc
   131041 gccatggccg ataccttccg aatccagcta acttggtcgg aagaatccgc cggtcctcgc
   131101 tcactcgtca tcaagaaacc atccgcagac ccggctgccg cggcgacggc tgcttcgctc
   131161 ggcgcctacg aacgcgaggc caagttctat gttgagttgg cgccacgcac tgcggttcgg
   131221 gcgccgcggc tcttcggtgt cgaactcgac gacggcattc cgagcaccgt gctgctggaa
   131281 gacctgtccg aggactacca gcccggcgac cagttcgccg agctggcgct accgctgctg
   131341 cgccgggcgc ggcatcagct ggtgctgttg caagcgccat tctggcagaa tgcggacacc
   131401 gccaacctgg actggctgca ccggcgcctc ggcgtaccga tcccggccat cgtcgagcgg
   131461 atgcagcgct cgtggtggtc ggctcgctcg acaatcggga gcggcctgac cagcgacgaa
   131521 cgagcctgtg tcgaccgatt cgtgagtcac gctggggaat gggcgtccgg cctgaatgga
   131581 ccgtgttcgc ttgtccacca cgattttcgc gtcgacaaca tgctcttcgg gcagaacgag
   131641 atcgtcgtgc tcgattggca aaccatcggc tggggtcccg cgatgttcga cgtggcctac
   131701 ctgctcggta cctcacttga accggagcgc cggcgcgctg tcgaacggga cgaaattgcc
   131761 cgtcacgtcg acgagctggc cgagcatggc gtggactggg acgttgccga agcctggcag
   131821 gcatatcggc aggcggcgtt cgccgtgctc ctgatgctgg tgccgcccat cgcaagtgtc
   131881 aaaaccaacg cgcgtatgga ggcaatgtac cgccgcctga tcgcattcgg agcgcgcatg
   131941 gcaatcgatc tggatgctct cgatctcctg cccgcttgac caaagatctt gacttacttc
   132001 cgctatctcc atctgggtac gaccatcgga ggaaccatga ccattcccga gcagacagtc
   132061 tgcgcgacgc cgggcgcttt cgagcctgtc ggcaccggac tcaatgtcta tgtaagcccg
   132121 gacgcggttg agggccgcgc acagtggctg gacacacctg aagatgttat ctccttcgtc
   132181 gagagcgggg aggacgtcag cgatgtgatt gtgatcgcac gcggcggaac cacgacgttc
   132241 ctgtccatgg cattgaacgc cggggtgcgt ggtgtgatta ccctgcaagg cgcaccggag
   132301 agccaccttg gaatcctcag ccgcgaatac ggcattccgt gcatcatgtc ggtcgccttc
   132361 gacaagggcg tccgtaccgc tcgcggcgaa attatcccgg cggacggcgt ccgagtgcgc
   132421 atggacctca cctctcgccc gacgggcaca gtgagcgtcg aaacgggtgc gccggtggat
   132481 gatacgccga cgacggacag cgccccagcc atgacggccg aacagttggc acagatccag
   132541 ttgttgctca acaagtttca gggcgaggtt ccgcgcgggc gagaaggtca cgaggttatg
   132601 gtcgcccgcc agggctcggc ggtgctcgac ctcgatgaca cgtcgatgaa tcgtgagctc
   132661 actgtggacg aggtgaacga tgtgcttcac taccttgtct ggaacgagtg ggatgccctc
   132721 gccgcccgtg ccaccgaggg cgagtccggt ctgattcctc gtcaggagta cgaggcgatg
   132781 gggatcatgg atagctggtt tcatcacccg gagtggctca gagtcatcca ggaccacgtg
   132841 ggtgctgacg gaatcagcgc gatcgcgacc cgagcgcacc gggagatcgg caccaagatc
   132901 aatatgttgc acatctgggc gtgcgccagc gcaccgagct tcgggcgggg tatcgctctg
   132961 gaactcggac tgcatgacta cgactaccgt acgcggcgga ttactgaagc gatgagcacg
   133021 gttcgacgtc tgtacagggg cttgtgggga tctggaccga tgttcgcgtc gatgcgcgat
   133081 tatcaggccc ccatcctcga tccgtcatgg atcgcgcgtt tcgagtccga ccgcattgca
   133141 ctctccgacg acaggggccg gtcgacgttc cagcggttca acggcgccct cgaactgctc
   133201 ggatttcttg tgcacttcga caatcgcctc ggactcggcg acagcggccc gtatcccact
   133261 gcggacggcg gcttcgtcat cgtgcgtgat ctgttcatca acgaaccggc atacccgtgg
   133321 tcggacacca cggcgggcct gccgtatgcc gtgacgatcg caatgttctt cgcgggtgat
   133381 accgacctcg agacgaaggt gttcgacctc tcgacgatgt tcaccgaacc gagcaactac
   133441 ctgccccacg tcaccggcgt ggcggtatat gcccgcgaga agttcgatac accaatcgac
   133501 caactgcgca cattgtcttt ggaggacatg gcgcaattgc gggccgaggc ggaaaccaag
   133561 tccgaggcgc tctacaagcg gatagccgtt atgagccaac aggagaaggt gatggccggc
   133621 gcggttgtct acgcctcggg cttcctgctg cccttcgccc gcgcggcggg aatctatgac
   133681 gatctcgttc gcgatcacgg cttcatgtcg attcatcccg tcgttgaggc atgccacgac
   133741 aggatcgtcg ggggcgtcgc cagcgagatg atcccgcggc tcttcctgac cggctcgtgg
   133801 gccaacgacg taccgccgca cagcagcgac accgtatcga ccatgcccga cgagttcgag
   133861 gtacttcagg caatccgaac tcgtgggttc gcaaccgtgg agcagatctc catcagtagc
   133921 ggcatcccgg ccgaacgtgt tcgcgaggtg gttgcggcga gcgaagagaa gggcttcgtc
   133981 aagcaacgca cgggacggat caacggagcc agcctcaccc ccgtgggccg tgcacgtctg
   134041 ctgctggtca ccgaggcggc ggtaaccgcc gaccagcacg cggccatcac gtctgcctac
   134101 gccgtgtttc tcgggccaaa ccgcgccttc aaagccatcg cttcgtcctg gcagatggat
   134161 caagacctca ccaccacgct cggcagcctg ccgcccgtcc accacgatgt tgccgcggtc
   134221 atagcgcaag cggccactgc acagcccaga ttcggtctct atcgtcagcg cctggaccat
   134281 gcgttcgaac aattccggaa cggaaacacc gacgcactag cccgtccgat ggttgagtcg
   134341 tatcacgaca tctggatgga gttgcacgaa gacctgctgg ccacactggg tcgcgcacgc
   134401 accgaccacg atgagtgacg aacgctcggt gggggctcga cggaaccagc tcgatccccg
   134461 gatcccgatt cctggcacta ccaacgtccg agacgtcggc ggatacccca caggcgacgg
   134521 aaagcggacc gcgatgggcc ggctgtatcg atcggaggtt ctcgggcttt ccggatccgg
   134581 tgccgaatcg ctatgggatg agctccgcac agaggattat cagtgccttc gtctcaggtc
   134641 aattgtcgac ttgcggtcgc accgcgaggc cagaatgatc ccgtctgcct gggatcgagc
   134701 gaccggcgca caactggttc acgctccgat ccccgaaggt gtcgaaggta gtgagactga
   134761 cttcatgcgc ctgctgcggg acggcaagat caccacattc gacgaggaag atctcggccg
   134821 gtggtaccaa ctggtgctac gtcgccgcac cgacgtgctg ggtgaggtga tccgagtact
   134881 gtcaaatccg caccacctcc cggctctcgt gcactgccac gctggaaagg atcgaaccgg
   134941 cctcgttgtg gcccttgttc tggaagtggt cggcgtgccg cggaacgtcg tgaccgccga
   135001 ctacgcactg acaagtaggt accgacccga ccgggcggcc gagcatgctg ctctgctcga
   135061 gcacctcgga atccacgtcg acgacgttcg gtccttgtgg gaggcgccgg cgcgggcgat
   135121 ggagtcggcg ctcgaattcc tcgacatcac ctacggggga gtcgctgcct acctcacgaa
   135181 cgaatgctca gtcacccccg cgcacatcga gtcactgcgc gcccagatgc tggaggatgc
   135241 atgaacccca ccaccctaac cgagccctct atggcgggtg acatcgccga ggctctccga
   135301 gctggtggat cgctgcccga aggcgggaat gtcgagcagt gccgagcgct gccactcggg
   135361 gccggccagc ttgccgacag ctaccgcgtc gagctcacct acacccccgg gccgtcaggc
   135421 ccgtcgtccg tgtttgtaaa gctgcccccc agcgacacac actcggcagc aacggcatcc
   135481 agaatcggcg cattcgatcg ggagcgattc ttctatgcag aactcagacc gcgcctcgac
   135541 atccggacac cgaggttcct tggcagcctt ccccgagggg acggtccgcc cgggctgatt
   135601 ctgcaggatc tctcctcctc cacccgtccc ctggaccaac tgcgcgacgg tacgatcgaa
   135661 caggttgaat ctgtcgcaga tcagctggcg ggactccagg cccccttctg ggatgacgag
   135721 gatgccgtgg gtggcaccga ccgcttctac aaccgaaccg aagaccacat cacgggtctc
   135781 gctgaacgct atgaacagtc gtggcatcgg caccgggaca ccgtcggcgc tctcctagac
   135841 ccacaacagc ggcaactcat cgagacattc ggtcaccact gcctcagctg ggcgtccgga
   135901 attcgagggc cccgcacact cgtgcaccag gaccttcgcc tcgacaatct gctgtggggt
   135961 gatgccggcg cctggatagt cgactggcag acgctggcct ggacctcacc cgcctgggac
   136021 ctcgcattct tcctgggcac tgcactcgac cccgacactc gccgccgagt ggaacagcga
   136081 ctgctcgaag cgcacgtgag tgcgctgcac gaccgcggcg tacaggggtg ggatatcgat
   136141 accgcagagc gtgagcactg gcggctcagc ggctccgtac ttatcgccat ggttgccgca
   136201 ctcgcattcg tgcagcccac cgcgcgcggt ttcgaaatgt ttgcctcact catccatcgc
   136261 ggtgcccaac aggcactcga ccacgacttg ctgtctttca tctgaaatcc aaaaggagaa
   136321 cctgtgctga gcaaatggga cgactatccg gtgcaccagg cggcgctgcc tgtggcgcag
   136381 accgcctcga gtgacctagg ccgctatgac cgccactgga tggcaatgca cgacatcgac
   136441 ttgaccaccc aggtcggctt cggcctcagc gtgcatccga accgcggtat cgtcgacgcc
   136501 tcgatcagca tcgcgcgtga cggccgccaa gactcggtgt tcgcctcctc ccgactctcg
   136561 cgcgatcgcg acacaatcgc gggccccctg cgagtcgaag tcatcgaacc gatgcgcgtg
   136621 ctacgtgtag tgctcgagga gcacgacggt atctcggccg acctcacctt caccggtgta
   136681 acacagcaca tcgaggatgg acggatgaga cgagactcag gaacgactct cgtctcggaa
   136741 cgtctccgta cagtgcaatt cggagactgg tccggagaat tcaccgtcgg cggggaaacc
   136801 gtaacctgct cgcccgacaa gtggcggggc ttccgagacc gctcgtgggg cagccggacc
   136861 accggcactg tggccgaagg tcaacacggt gtacacaaga gcgccatcta ctttgcctgg
   136921 acgctgctgc gattcgagga cgaatgcttg ctcgtagccg taaatgagat gccggacggc
   136981 cgcagcgaag cacgaacggt cgccgtcctg cccttcctga aggccggcga cccggcttac
   137041 ggcgaagagg atcggatcct ccgcggcgac accttccaat tcgacatcga ctaccggcct
   137101 gggactcgcc gcgcccaaca tgttgacctc accgtcggac cgcgtgggct ggtcaaccgg
   137161 aagatcacca tcgaacccga aggtctattc ctcatgcagg gattgggcta ctaccacccg
   137221 atgtggaagc acggcaccga tcacgggaaa gacattgtcg gaacggacag ttggaagctc
   137281 gcgggcctcg atccgagcgc gatggaaaac gttcacgcac agcagatttg ccgagcaacc
   137341 cgcgccgacg gtgcgatagg tctgggcttg ttcgagcacg tggcgatcgg accgcacttg
   137401 ccttccggat tgcctgacgg gattgcgcca ctcggccagt gacggccttg aatcaccact
   137461 cgtgctgttg ccgggaggcg gtcggtttcg acgggatgca ccatgttgcc tgtggaagcc
   137521 gccctcatca accgacgtca cgcacggcca cttgttcctg actcaacagg agcgcgaaaa
   137581 aggcggggcg ttgtggcgct agtgtcctga gtcataaata agccatcggt tgttaaggtt
   137641 ggtcatggca actcgtggtc cgcgaccgac ggagattgtg ctgaccgaga ccgaacgcgt
   137701 agaactcgag gggtggtcgc ggcgacgcaa gaccgctgca ggtttggcgg tacggtcgcg
   137761 aatcattctc gctgcgccga tggtggatcg aataccgaag tggcgcagag gttggggttg
   137821 aaccgaggca cggtgcggcg gtggcgggac aggttcgtcg aggaccgatg cgacgggttg
   137881 ctcgacgaac cacgcccggg ccgtccgcgg acgatcgacg acgacaagat caaggatctg
   137941 attacctcga ccctcgaaac gacaccgaag aatgccacac actggtccac acgatcgatg
   138001 gcggagcatc tcgatatttc gcaatcgacg gtctcgagag tgtggcgcgc gttcggtttg
   138061 gccccgcaca aacaggactc gtggaaattg tcgaaggatc cagtgttcac ggagaaggtc
   138121 cgtgacgtcg tcggcctgta catgaacccg cccgagcggg ctctggtgct ctgcgtcgac
   138181 gagaagactc agatccaagc actggaccgg acccaaccga tattcccgat gcttcccgcc
   138241 accccgcaac gcgctagtca cgactacgtc cgcaatggca cctcgagcct gtacgccgct
   138301 ctagacatcg cctcggggaa ggtgatcgga tcactccatt cacgccaccg cgcacaagaa
   138361 ttcatcgcat ttcttcgcaa gatcgacgct caggtgcccg acgatctcga tgtccacctc
   138421 gtgatggaca atgcatcgac ccacaagact cccgcggtca aacgatggct cctcgcgcac
   138481 ccgcgcttcg tcatccactt cacaccgacc agctcatcgt ggatgaacct cgtcgaacgc
   138541 tggttcgccg aactgaccac caagaagctc caacgctcca cgcatacctc ggtccaacag
   138601 ctcaacaaag acatccgagc atggatcgag acctggaacg acaaccccag accttacgtc
   138661 tgggtcaaga ccgccgacca gatcctcgac tccatcgcac actactgcgc cagaattaaa
   138721 gactcaggac actagaacgc cacaacgccg cgatcatgag ggaatggatc caaagcgatt
   138781 agcgcccgca cggacagcct cccgccctga atcgaccgac tgagagggaa cgcgtggcta
   138841 ccgcagtgcg gaagggtcgt ccgacggcct ggcagctcac tgacgacgac atcctggact
   138901 tagcgatcct ttggtaccct atcggcagac cgtccgccgc caggatccgc gcggcattcg
   138961 gaatcgggat gaacgagtac cgccgccgac tcgaagccgc tgtacgcacc caccaacaga
   139021 aaactctcga cacccgcggt tcgtggccgg accgagtcta tgcgcacaac gtcctggaag
   139081 ccgtggtccg gcaggtggta gatgcgccag taggtgctgg cttacttgac cagttggtgc
   139141 attagtttag cctcgataca ccgattcgca tgagtgcctg agggtgtcat aacggcgaaa
   139201 tgccctgtcg tagtggaaga ataatacttc tctagggtca aattcaggca cgccgaaggg
   139261 catttcgtag atgcaactat ctcacacccg acccgttacg gcggccaggt tcgacgaccc
   139321 cgacctcgtg gcgaccgcgg gactggtccc ggtggtggca ttggcccagg ccagcggcct
   139381 gctcacgctc gccgatcagc acctgagcgt gccgaccgac aagggcgcca acacgggccg
   139441 caagatcggg tccctgatcg gtgggatggt cgccggcgcc gacagcatcg ctgacctggc
   139501 gatcctgcgg cacggggcga tgggaacgat attcgatcga ccctatgcac cgtcgacgct
   139561 gggatcgttc cttcgccagt tcagcttcgg gcacgtccgg caactcgacg ccgtcgcctc
   139621 gcggttcctg agcaacctcg ccgcgaagac cccgctggtc accggcatcg acaccgggcg
   139681 aatcctggtt gatatcgacg atacgatcat cgaagtccac ggccacggca aacaaggctc
   139741 cggatacggc tacttcggga tccgcgggct caacgccctc atcgccaccg tcaccaggca
   139801 gaccgctgcg ccggtgatcg tcacccaacg cctgcgccga ggagcgcgcg gctccgcacg
   139861 tggggccgcc cggatggtcg ccgacgccct ggccaccgtc gaccggctgc gcacccacgc
   139921 cggcggaccc agcggcaacg gggcaccgaa ggtgctgatg gcgtgcgccc agcggcgggt
   139981 ggtgacgtat tgccgggctt cgcatttggt gagccagagg tcttgttcga ccgcggagag
   140041 gtgcgggccg tgaagtgcgg cggtggtgag ggtgacggtg agggcggtca gggtgcggcc
   140101 ggccacggcg gaggcagaac gatcctcgca gtggtggggt ccaaggggag gacccggcag
   140161 atggtttcgg cgatcgaacc ctttgcatgg agcatattct cgatatatcg aagccgcagt
   140221 tcatgttctc gatcatgctg tgactgcgcc gcactcacgt catgatgtcc aagttgccca
   140281 aggcgacctg acgccttatc tgcagtgacg ttgcttgtgg cctccacctc cgcaactggt
   140341 ggtcgtcgcc atccggtcga tatgcgaacg aggaacgagc attgattgct ggctcgtgcg
   140401 tcgatcgcgg gtcccgagga gatcgcttct tggcatctgc tctggagccg ctgacattcc
   140461 cgactcgggg tcttgcgggt ggccagcggt cgattggcct acttcgtcat ctcgctcggc
   140521 caactgctgg tgagcccacc tcgcgagcag cttctgcttc tgcgattagc ctcttttctg
   140581 aaagtctcag caagttcgtc cgcgtttcgg tgtcaagcga gtgttgtgat gtgtgtagca
   140641 cccgtgttag ccgcttatag aagatggatg gcgtgacacc gaagttgacg aatatctctt
   140701 cccgggttcc gccaccgaag tagtgccaac gccgtgcgaa gtcgatcatt cgtgacgtct
   140761 ctgtgatcga ggtgggcttc atctgagatg tcgaatcctt tgctgggtga gacgcgcttg
   140821 agcgagtcct cggctcttct cgcagttcac aagttcgttg ttttgctttg ttgttgggtc
   140881 ttgtccgaat ccctctcgag ggattcataa tgcgctggtc gatagcggcg catggtgact
   140941 gcgatgatga caccggcagc aaacgcaacc gcgagtatga cgccgagggc tacctcggcg
   141001 gcggtgttct caccgacgag tagtccaaag ttctgtattg cgataacgag gacgacgacc
   141061 atgccgatcg aggagactgc cggtgcaatc agggttgtcc acgtgccgtc ggacgtcgga
   141121 tggtggcgga agaagcgaat gacggcgatg cctgttgttg tcatcatgat gatgatgccg
   141181 agtgttgctg cgccggagag ccaggtgaat gcttccgaga tggggtcgag tccgagagcg
   141241 acgatcatca tcatgctgac gacggtgatc agggagatca ctgctgatga gcgtgatggg
   141301 gcatgatgtt tgggactgat tcgtccgagc gagcggggta tgacaccttt ggtacccata
   141361 gtgtactggt agcgggtcag gacgttgtgg aatgccaatg tgcatgcgaa ttgactgctc
   141421 accagcagta ccagcatcac gtcgcgggct atgggtccca catactcgct ggcgaggttg
   141481 agcactgcca ctgttgggtc gtcgcctgtg accgcaacgg cgcggctggg gccgatgccc
   141541 atgatcacgc accacatggt gactgtgtaa aacagtccga taccgatgac ggcaatgtag
   141601 gttgcgcgag ggatggtacg gacggggtcc tttgcctcgt tgcggaacac tgcggttgct
   141661 tcgaagccga gaaaacacaa gaaggcgaac atgaacccga ggccaggggc gccttgggtg
   141721 agcatggacg ggctgaaggg ctctgccgag agtccctcct cgccgccctg gaggatgatc
   141781 gcggtatcga cgacgatgac gatggcggct tctaggacga ggaccagtcc gagtacgcgt
   141841 gcggagaggt cgacgtttcg atatccgagg tagccggcaa gtgcgaacgc gatcaggcac
   141901 catgtccacc agggcaggtc gatgtgcagg aatattcggc cggcgttcga tgcgtttacc
   141961 ccaagatacg ttgtactgcc caccaggagc atcagatacg agacgtatgc aagtgtcgcg
   142021 cagccggtcc cgatgatcct gcccaatccg gcctggatat aggagtagaa ggcaccggcg
   142081 ttgggcacat acctgctcat ggctgtgtag ccgacggcga agacggtgag tagcgctgtg
   142141 accatgagca ggaacagggg tgcgccgatg ctctgctcga ctgagatgat gaccgggaag
   142201 gtagcggcca caacaccgag tggggctgcc gcggcgacga ccatgaacac gatggagccc
   142261 acgccgagac tgcttcggaa tgaggtctcg ccttccccag cgatgttggt cggtgcggtg
   142321 cttggtccta gattctcaga tgtatccatt gcctgctccg ctgttctggg ccgtgtaggt
   142381 atagggaaga agtttcatgt ggactgtcct cacagggatt tgcgagtgga gtcgatctcg
   142441 gacaggacct tcgccagagc gttccggatc agggtgaact cctggtcttc ggcgacgagt
   142501 gggggtgata cacagatgat cggattgacg ctgtcgagcg aaacccgcgt gaggatgccg
   142561 aggtcctcca aggcgccggc gagatggggg cgggcgaaca gacgatctcg ctggggttgg
   142621 ctcaacggcg aaccgttcgt gtcggtaccg gtcaattcga cggaccagaa gaatccggcg
   142681 ccgcggacgt cactgacgat ctcgagatca cggagggact ccaagctggt gcgcagcgag
   142741 ttttccttcg cacggacctg ttcggggatc tgaaggcgtt ccatgatctc gaggttcttg
   142801 agggctacag cggccatgac agggtgtcca ccgaaggtgt tcccgtgctg cagggaaacg
   142861 cctttttcgg agaagggctc gtacacacgg ttattgacga tcactgcgcc gatcactgcg
   142921 tgcgctgacg acaatccctt ggcggtggtg atgatgtcgg gggtgaagtc gaatcgcgtt
   142981 gatccgaacc attctccgac gcgcccgaag gcggtgatgg tctcgtccga gacgagcagg
   143041 atgccgtact tgtcggcaag cgcacgaatg ccggcgaagt agccgttcgg tggggtcagc
   143101 gatccgccgt ggttctggat gggttccaga atgatcatgg cgacggtgct gggatcctcg
   143161 gacacgattc gttgctcgag gtcgtcgagg aggaatgcgg tgaaatcttc ctcggattcg
   143221 cctgcggggc ggcctgcccg agctgtactc cgcgcgtgtg ccacggccgg tacgagtggc
   143281 tcgaagggtg agcgcatccg atggatgccg ccgagggata gtgcgccgag cgtcgtcccg
   143341 tggtatgcca tgtcgcgggc gatcgccttc cagcggtttt cacctcggag ctgatagaac
   143401 tgtcgtgcaa tcttccaggc ggcttcgacg gattctccgc cgctgggcgt caggaacaca
   143461 tggttgaggt cgtcaggggc gagctcggcg aggcgtgcag ccagttcgat cgcgcgcggg
   143521 tgtgtggttg tccagttgct gtgatagccg agctggcgat actggtcgag cgcagcctgt
   143581 ccgagttctt caccgtacga gtagccgagg ttcacgcaga acaggttgga gactgcatcg
   143641 aggtagcggt tcccgtctgt gtcgaagagg taacttccct ctcctcgggt gatcactttg
   143701 aggggggtac gctcggcctc cgccatttct gcgaaatgcc gccacaggtg ctgtcctgca
   143761 gtcgtgcggt agtcggcgtc atcggccacg gcgtcgggca tgaaatcgag gtgtgtcaca
   143821 ggctctcctt ggggtgtctg gatcttccgc ggcagattcg cgcgtgtctc ataccggcga
   143881 gaggcaggca ccgtgacatg tcgaccttcg tgtgatcgct ggtgcaatcg ccggcctggg
   143941 tcggtggcta ctgggcgcgc tgacgtcgcc atcgtctggt ctcggaccag gcggcgcttg
   144001 cgttcatgct gcgttgaagt ggataagacg ctagccatcg ttggacacgg tgtcaaccgt
   144061 cacactgggc gagcatgtgg tggaaaatcc ggcggatcgt gcgtggtcat gggcagggaa
   144121 gtcccatttc atacccgtcg cgagagggat gatctaccta cttgtcgttg aggttcgcac
   144181 agagacgttc gatccaggct ccgcggcctg acgcactgcc gattccaccg ttcggccgga
   144241 ccttcgccca ggaaaaccgg gccttgacac ggtgtctaac gcgtggttag tttgtccagt
   144301 gtgagtccgg caacaatcac cgttggttga gtggatgccc cggagcgtcg gaccaagcga
   144361 cgattcgtga gagctgccga tcgcagtcac aactttaagg agcgcaatgc cgaaatttga
   144421 tggcttcagc gctccggcgc agcacgaaga atctcgagaa acggagtccc cgttatgggc
   144481 aggatagaag gcaaggtcgc gttcatcacg ggcgctgcgc gtgggcaagg gcgcgcccac
   144541 gcggtacgtt tcgcttccga gggagccgcc atcgtcgcca ttgacatctg cgaggcgatc
   144601 gaaggtgttc cgtattcgct gtcgaccaaa gatgatctcg acgaaacggc acatctggta
   144661 cgcgaggccg gaggtcgtgt gatcaccgcc gtcgctgacg tacgaaacca agaatgtctt
   144721 gacaatattg ttgcagaagg tatttcggag ttcggtggca tcgacatcct catcgcaaac
   144781 gccggcattc tgacatcgga agggcgtgcg tgggaaatct ctgaccgagc ctggaacgac
   144841 atcctcgatg tgaatctcac aggcgtgtgg cgcagcgtga aagctgtcgc acccacgatg
   144901 gtcgagcgga accagggcgg ctccattgtc ctgacgagtt cgtacaccgg attaaagggc
   144961 gaaggataca tcgcacacta cgccgccgcc aagcacgggg tggtcggcct catgcgctcc
   145021 ctcgcccatg agctcgggcc gtacaacatt cgtgtcaaca cggtaaaccc gggcaatacc
   145081 gccacgggaa tggtcctcaa cgacttcagc ttcggcctcc tcaggcccga cctcgccaac
   145141 ccggacaggg cggatgcggc cgagaccctc aagcatttaa cacttatgga tgtcgacttc
   145201 atcgagccgg aagacatcgc caatgccgcc ctatggctgg catcggacga ggcccggttc
   145261 gtcacgggcg tcaccctgcc gatcgacgcc ggctggtacg ccaagagcac ctagacagca
   145321 tctggatccc gagctctggg gtcctacctg ccactgagct actgatagga accacaatga
   145381 cgaccgaaca aggcgagtcg cccccgatca cccacgacga tcagttcgtc tacaccgaaa
   145441 tgaccaccga cagagtcgcg atcgtcaggc tcgagcgacc aagagccaac gcattgtcgc
   145501 tcgcagtcct gcgccagctc gacgaggcgt tccaggcgct cgcgagtgac ttgcccggtg
   145561 cagttgtcat atgggggggc cctcgcatct tcgccgccgg cggcgacatc tcggagatgg
   145621 gcggacccga agatgcggcg cgcttcgtga aagcattccg ctcgaccttc gacaggatcg
   145681 cctccatccc tcgtccggtg atcgcggccg tgtgcggcta cgcattgggt ggtggactcg
   145741 aactcgcgtt gtcagccgat ctgcgtgttg caggcgaggg agcaaagttc gggttgcccg
   145801 aggtcaatct gggactcgtg cccggagctg gagggaccca gcgactgagc aggttggtcg
   145861 ggccatcccg cgcgaaagat ctggtgatga ccggtcgtca ggtgaatgca gaggaagccc
   145921 tccggatcgg cattgccgac cgagtcgtgc ccgacgacga agtgttcagt gagtcgatcg
   145981 ccctcgcgag gcgcctggcc accggaccca gtgttgctct ggccacggcc aaaagtctca
   146041 ttgacgccaa cttcgatcag ccgttgaatg ccgggttgga tgccgagggc cgggccgcag
   146101 tggccatgca tcacaccgag gacggccgcg cgggtgtgaa gtcgtttatt gcgaacggtc
   146161 cgggccaggc aaagttcgtg ggcaggtagg tccgacgtga cgaatgtgaa cagctcggtc
   146221 cttgatgacg caacgttccc caacggtggc ggtaccagac cgtcgaaaga ggcttcgacg
   146281 gtcgacggac tgatgatgga cacccccctg acgacccaaa tgctgtttcg gcgtatgcag
   146341 actatatgcg gacagcgcag gatcgtcacg atcaccgatg acggcaggcg gatgtcccaa
   146401 acgttcgaac aggtatcccg tcgcgcggcg agcttcgcgc aagcactcga cagcttgggc
   146461 gtctgcagag gcgaccgcgt cggaagcttg ctatggaata cgcaggaaca cgtcgaaacc
   146521 tactatgcca caatgggatt gggtgcggtc cttcatacga tcaacccccg cttgcacgac
   146581 gagcaggtca tctacacgat caaccatgct ggtgatcgcg tgatcgtcgt tgattcgtcg
   146641 ctggtcgacc aactcgaccg tgtgctcgac aagctcgcca gtgtggagca tgtagtcatc
   146701 gtcggtgacg gcgcgagtgt ggtgtcgagg tcggcgaagg tacatagata ctctgaaatg
   146761 ctcaccctcg gtgaaggggt gaacttcgag tggccagcgt tggaggagag ctggggggct
   146821 tgtctgtgct acacctccgg taccactggg aatccgaagg gcgttctgta cacccatcgc
   146881 gcgatcgtcc tgcacgcatt gacgatggct ggcgtcggcg gtctccaggt gcaggagggc
   146941 gaccgagtcc tcgcgctggt cccgatgttc cattcgttgg ggtggggtct tcccttcgtc
   147001 gtcactgtca ccggatcaga cctggttctt cccggacgca atctcggtcc ccaggccgtt
   147061 gcacgggtga tccgtgacga gagggtcact tgggccggcg gtgtcccaac cctctggatg
   147121 gatctcctcc gccacgtcga ggatccctcg aataaggatg ctgtcgacct ttcgagcctg
   147181 cggatggtcc tctgcggggg tgcgaaggta gcagtgccgc tcatgcaagc gtacgacgag
   147241 aggctgtccg tgacgctgat tcaggggtgg ggcatgaccg agacattacc cggcgccgca
   147301 atgagtttgg acatcgtagc gccacccgcc gagcgctggc agcggcgcgg tcaggtagga
   147361 cgggtgtccc cgctatacga gatgcggatt gtcgatgtgg acggcagtgt tttgccctcc
   147421 gacggcacat ctgtcggcga ggtcgagatc tcgggtccga tcgtggctgg cagctactac
   147481 ggaccggagg acacctcgga caagttccac gaaggttggc tgcgcacagg agacttggga
   147541 acactctcgt ccgacggctg gctggacatc accgatcgcg cgaaggacgc gatcaagtcc
   147601 ggaggagaat ggattagctc gcaggacctt gagtcggcgc tcatggctca tccggccgtc
   147661 cacgaagcgg cggtcatcgg cgtcccagac ccgcgatgga gtgaacggcc ggcagcctat
   147721 gtcgttgttt caccccacgg acccacagat gacgaactgc gagagcatct gcgttcccac
   147781 gtcgcgaact ggtggatacc cgaggaatat caccgcgtcg atactcttcc tcgcacaagc
   147841 acagggaagt tcgacaagaa ggaactgcgg cgccaccgtg cggatttggc aggtagcctg
   147901 cagaaaatct ctccggtaga gaacgcctag aggcagagaa ggattgtcag catgccatca
   147961 gatgagcagg acaacaggga acggatcctg gcggcggcac ggcgccactt caactcgcca
   148021 ggatacaact ccgctcgcgt cgccgacatc gcgaaggatg ctggtgtttc tcgggcgact
   148081 gtgtacaacc acttcccgga caaagatgca atcctggcag cgctcgtcga cgagtacctt
   148141 gcaggctacg ccagaatcgg cgaggcgatg agcgcaaccg tcgacgtcgg cgatactgtg
   148201 ttcgccatcc tgttgagaat ggtcgaagac accttgatgt ggcgggtgga gaatgcggac
   148261 ctgcgaccag cgatagacgt ggcgcggcag gttcttccag cgaacctgct ggaggcgaac
   148321 cgggccgccg acgaggtact gcgaggtcac ctggccgatg tgtatcgacg aagtaccgcc
   148381 cacgggattg tccgcgacga catcgatccc gaattcgcgg cctccgcgct gtattcgatg
   148441 atcgaagcag tgctcaacgc cactgacgtc ggttcgagtg tggacgagat caaatcagcg
   148501 gcattgcagc ttgcgcttct gcaatggtac gcggtgtaca cgattgttcc cgagcaatcc
   148561 ccgaggttgg acagcatctg agactttcgt cgcccgtcgg cgatagcagt ttcgatcgca
   148621 tcgaatcggc tacacgtgac gccgatggag atcctaccga cccgaacaac cttcgatcga
   148681 ctcagtgatc tccgaacgga gtcagcatcg cgggtccggt caaccgtcac cgtttcctgc
   148741 gcgaactggc accaccggtg gttgtgcccc tgatcgttgg cgacgcactc ctctgctcga
   148801 ggtcctcggg cggccagcca cacagcaaaa ctcatcctac gaggcccgag cctccgattg
   148861 gacggacatg atgaccgaat atgcaatgac catcgacggg acgctggcga agtcggctac
   148921 agaattcgat gtggtgaacc cggcaaccgg ccaggtgttt gccaccgccc ctgattgcac
   148981 acgcgagcag ctggatcagg tgatggacac ggctcatcga gcttggcttg aatggcgaac
   149041 ggacgagggc gctcggcgca aggctctcct ggaagctgcc gaggtgcttg gatccgcggc
   149101 gaacgaactc gctgcccttg tcaccgcaga gcaaggaaag cccctcagcg aagccgcgga
   149161 agaggtacgc gacgcacaga cgtggttccg ctattacgcg gacgtcgaag atcagcctca
   149221 gatcattcaa gacgatgcca ttgcctacgt cgaagtcgtg cgcaagccgc tcggggttgt
   149281 cgctgccatc acaccgtgga acttcccgat caccctggcc gcatggaagt tggcaccggc
   149341 gttgcgggct ggcaataccg tcgtgctcaa gccatctccg tacacgccca tggcgacgct
   149401 gcggctcggt cagctcctct ccggggtgtt cccgcccggt gtcgtcagcg tcgtgagcgg
   149461 aggcgacgaa ctcggccaat gggtgacttc gcacaacgtg ccgcgcaaga tctccttcac
   149521 cggatctgtc agaacaggca tgcgtgttgc cgccaccgcc gcgaccgatc tcaagcgttt
   149581 cacactcgag ctcggcggaa atgatgcagc gatcctgctc gacgacgtcg acgccgcgtc
   149641 catcgtggag aagctcttct gggctgcgtt cgagaacaac ggccaggtgt gttcggcgat
   149701 caaacggatt tacgcgcccg cgtccatcta tgacgaagtc gtcgaaagct tggcttccta
   149761 cgcccgatcg gtcaaggtcg gcgacggtgc cgtcgaaggc acccgcctgg gcccgatcaa
   149821 caatcggccg caactcgaga gagttcgcca tctggttgac gaggcactga ggcaaggggc
   149881 gaggtccgcc acggggggaa agctcattga gggtccgggc tacttctatg aaccgacaat
   149941 cctggcggat gcctgcgatg gcatggccat cgttgacgac gagcagttcg ggccggccct
   150001 tcccgttgtg cgatatgaca atctcgacac cgtcatcgag caggtgaact catcgaattt
   150061 cgggctgtgc ggctcggtct ggagcagcga tctcgatcgc gccagcgcag tcgcgccccg
   150121 aatcgacagc ggaacagtgt tcgcgaacac gcatctcgcg ctccaaccga accagccgtt
   150181 cggtggatcg aaatggagtg ggatcggcgt cgagaacggg attgcggggc tccacggctt
   150241 cagtgagcct caagtctttc accggccggc gcgcagcgtc gggtagaccg tcccgcttct
   150301 gataatcgaa cgtcaatgaa ttgagagcct atgagatccg cggttatcgt agatgtggtc
   150361 cggacaccat ccggcaaggg caagccgggc ggccagctgt cacatctgca ccccgtgaac
   150421 atctacgccg atgtcctgaa ctccatgatc gagcgaacag gactcgatcc gcgacttgtc
   150481 gacgacgtga tcaccggctg cgtgagccag gtctccgagc agtcctccaa catcgcccga
   150541 agtgcagttc tggcggcggg ttggcccgag cacgtcccgg gcacgaccat cgaccggcag
   150601 tgcggctcca gccagcaggc gctgcacttc gcagcacagg gtgtgatggc cggcgcctac
   150661 gacatagtcg tggccggcgg tgtcgaactg atgagccgag tcccgatgtt ctcacccgtg
   150721 caggggagcg acccatatgg ggacaggctg actgcccgct acaacgacgc gctcgtcaac
   150781 caaggtgtgt cggcggaact ggtcgccggc aaatgggacc tgtcacgccg acagctcgat
   150841 gagtatgcgg ccgaatcgca ccgccgcgct gccgccgcag cctcggacgg cggcttccac
   150901 aacgagatca tcccagtggg tacggcgacc cacgatgaga cggtccgggg taacaccacc
   150961 agcgaaagtc tcgccgggtt gaaggccagc ttcgcgacgc cggaaacacg cactcgcttc
   151021 ccggatatgg attggcgcat cacacccgga aactcctcac cgctgacgga cggggcctcg
   151081 gccgcattga tcatgggtga ggacaccgcg aagtcgctag ggctgcgtcc acgtgctcgt
   151141 ttccactcgt ttgccgtcgt cggagacgat cccatcttca tgctgactgc ccccatcccg
   151201 gccacgcaga aggtgctgaa caaggcgggg ctcacgatca gtgacatcga tgctttcgag
   151261 gtcaacgagg cattcgcttc cgttccactg gcatggctga aggaaactgg cgccgacccc
   151321 gccaaactca acccccgcgg tggtgcaatc gccctcgggc atcctctcgg ggcatctggt
   151381 acgcgcctga tgtccacaat gctcaactac ctcgaatcca ccggtggccg tttcggcctc
   151441 cagacgatgt gcgaggccgc tggtatggcg aacgccactg ttatcgaacg gatttgacgc
   151501 tcggatgaag cgtctgggtc acaccaaacg gactctgatc cgtgcgaacc atgaaggaga
   151561 agcaatgtcc acaactgatg tgaaccgcgc agcggtccta cgagaattga tggtcgatcg
   151621 atggagctgc cgctcctacc tcgacaaacc cgttaccgat gacgtcctcg acgagctcct
   151681 caccatggca cagcgcagtc cctcctggtg caactcgcag ccctggcacg tcacagtgat
   151741 ccgaggcgat cgcctcgacg acatgcgaga gaggttcgtt cgccacgcgg agtcgcatac
   151801 cgaggcgccc gaccttccct ttcccctccg gtacgaaggt gtgtaccgtg agcgtcgccg
   151861 tgaatgcggc tggcagctct acgacagcgt cggaatccag aaaggtgacc gcgaagcctc
   151921 gcagaagcag gcgatggaga acttccgatt cttcggcgct cccgccctcg cgatcatcac
   151981 caccgaggca gaccttggca cctatggtgc aatcgactgc ggcgtctata tcgggaactt
   152041 cctccttgca gcccaatcgc tggggctggc gaccattccg caagccgctt tggcatcgca
   152101 ctcagggttc cttcgcggcg aactgcagct tccggaccac cgcaaggtcg tcgcaggtgt
   152161 ctccttcgga tacgccgacg agaaccaccc cgccaacggc ttccgcaccc accgtgcaga
   152221 cattggtgaa agcagcaccc gagtcggcag ctgaccgatc cggcgcaacc acaccacacg
   152281 gagacaccat gagctacaag atagtcgcct tcctcgccaa acgagagggc ctcagcatgg
   152341 aagactttgt cgactactac gaaaatcggc acgttcctct tgtcctgggt ctgccagaga
   152401 ctccaaacag ctacgtacgc aattacatcg agccctccgg agacgatatt gaatttgacg
   152461 tgatcagtga actgaggttc gacgacgaag gcgcatacaa gcgctggatc gccgccatgt
   152521 tcgctccgaa ctcgggaatc cccgaagacg aggaccagtt cctcgaccgt cggcgcacca
   152581 ggtcacacgt cgtacgcgag tgcccaatct cgtccgtgca gtgacaatca caaagagtgt
   152641 ggtgccgtgc cgacactcaa cggtgagaag ctccaaaacc atcacgagag gtccagcacc
   152701 tgaaatacgt cggttcgggc agcactcggc tccctttggt ccgagggcct acccacaggt
   152761 cgtgcgtagg tcgatgcacc gtggcgtgga aggcgatccc cgatcgtcga tgcggacagc
   152821 aagtcgattc agtgcgacgt cgacatcaca cctgcggatg gacgtcgagt gacgacgtgc
   152881 cctcctgtgg aggattgaga caccaactca cgcagtgcca ttcacgcgtg aatgccgccc
   152941 cgggattcca gagtccttgg tgggggtccg ctgtcggaca ccctcgcggt ggagaacgca
   153001 ttccgtggtc cgtgtgatcc ccagcgagtc cccgatcggg ctatgtccgg ttcgtggagt
   153061 gtcgatgggg tgagcccgcc ggcatcggac acagtgtgtg ttcacccgcg ggccccggcc
   153121 atacgaatag agtgtggctc gtaggaattc aggtgggggc gaacgtttcc tactgccgtg
   153181 cgagccctgc tgcgacgctt ggccagtgta catccggttc ccgatgtgat ggcacggagt
   153241 cgttgcgtgc ttggcgtggg cgaagctcgg ctggacgggg agattgcgct catgatgtgt
   153301 tctgtcctgg cggctgggtc actgccctgc accatgccgc cgccacccca atgctcaggc
   153361 gtagtgctgc tgctgtcgat gtgcccgttg aacaatgtgc cgtgacgccg gagcgccgcg
   153421 catcgacgac aacgggtgca gactgttgga gatcgatgtc gccgtatcgg cgagtgcagg
   153481 agaaaaggag gccggatgac cgcagcccac gccgtctcga tcgcggtgac cttcacctgg
   153541 ctggggatgg tggtcatctc gttcatcgaa gcgccgctaa agtttccgta cgctcgggtg
   153601 acggttcggc tcgtactgga gatcggtcgg ctcgggttcc gggccctgaa cgtcaccgag
   153661 atagtctggg cggcactgct cattgcaggg ctcgtcgccg gtgacgaggt cccgttctca
   153721 cgcgcactac gtctactttg gtctgaaaat cgttaaggtc gttgcgctgc tggtgacgga
   153781 tcttgttgct cggtgtggga ggtgcctgcg gtgacctgtg tccggggaag gtgcactacg
   153841 ggttgccgag gggtgggtgg agccgccgag ttcgtacggg acgtcgaggt caggtccgct
   153901 ttctcgcgga tttgggcgct ggagtcgcag cggaaggatt tcttcaccgt tcagcctctc
   153961 aacgaacaat tgctagagga ttctagatgt gcgctcgccg ctatggctaa ccatcttgca
   154021 ttggctcgtg cgacggcgaa actcgtaagg atccgttgga tcgatgcggt ggcgcggcgg
   154081 ggtgtgatca gactggcgaa cgcaatcgcc gcatgaatga tgagcaatgg cattgggatc
   154141 tcctaagtct gcggcgaggt gacgatttgg acatcggata cttcgtgaac ggaggatctg
   154201 atggttgcag tgtcggatgc ggttggtgtc cgtcaatcgg tgagccggat tgcgccgacg
   154261 acgaatgccc gttgtgatgc gctcaaggag ccgcggtagg cggaagtgag cagggtgagc
   154321 gatgatcgtc atgagccgca ccgccgacgc gaacctgatc agcccgggat caaaagagac
   154381 ggattccgat cgggcgcacg gacggggtgc ttcgtcttgc ccggctcacc ctccccagac
   154441 ctcgggctct ggggggtaca acgttgcccc gctgtacctg agtgagggtg tacggtcttc
   154501 tgcaagaagc agtggcccgt cgaggtgcac cacgtcggcc cgttgcgcaa ggatgattcc
   154561 cggagccatg gacaaagagg tggcgaccat gcaaccgacc atcgtgccca ggccgctagc
   154621 ccgtgctgcg gcctgcaacg acaaggcctc cgtcaagccg ccagccttat ccagcttgat
   154681 gttcgcgatc tcgtacttcc cgacaatctt cgacaggctc atgagtgtcc gacacgattc
   154741 gtccgccgcc aatgggactg ggctattgaa gctcttgaga aaatcatcgg cgtccgctgg
   154801 caatggctgc tcgatgagct cgactcccat tgcagcgaat tccggagcga acgcgcgcag
   154861 atggtcgatg ctccaggctt cattggcgtc gaccatcaat ctggcatgag gggccgcggc
   154921 gcgcacggct cgaacccgct ccaagtcacc atctccacca agtttgagct tcaggattgg
   154981 aaggtgctcg tgcacggcgg cggctttccc catcgctgca ggggcgtcga ggctgatcgt
   155041 gaatgccgtg agcacaggtt gtagttcgtg gccgagctcg atcactgatg ccagagactg
   155101 ccgtgttttc tgtgctcgaa ggtcccacaa tgcgcaatcg acggcattgc gcgccgctcc
   155161 gggtgccatc gctgactgca gttcactgag gtccattccc gcctcgatcg cgggtgtcat
   155221 ggacctgatc tggtccataa cactctcgat cgtctcgccg taccgggcgt atggcacaca
   155281 ttctccgcgc ccgatataac cgctctcggc tatggagacc gcgatgacct gagcggatgt
   155341 cttggatccg cgactgattc gaaaaattcc attgatcgcg aaggtttgcg gtatggcatc
   155401 gacggtgcgc acagcaactc gccccttcat caagctgtta ccaactcgtc ggcgggctcc
   155461 ttcaaacgct ggcgcccgat gatggctgcg atagcggata gggctccgac aatggcgaga
   155521 tagacgctga aggtgatgtt actgccggtg acgctgttga gccagatgcc gagggaaggg
   155581 cccgctgcgc cgaaaaggat tgtgcagacg ttgtaagcga atgctcctgc tgtcactcgg
   155641 actttggcgg ggaacatgta ggacatcgcc atcgcggcgg ctacagcgac aagtcccttt
   155701 ccgatggaga ggagtgatcc gccgatgaga gctccgacga taccgagggt cgagattgca
   155761 aaggcgggca cgctgaccac cgcgataaag agaccgccaa cgatgaatgt gcgctgcagc
   155821 ccgtatcgga acatcacccg accggcggcc agggtagtgg cgatcatgac cacgttgatc
   155881 gcaagcgaca cgttgtagga ctggccactg gtcaatccgc ctgacagctg aatgaaggtg
   155941 atgaagtagg aagacaggat cggcgtgatc aaggcatacg acgagacgat gcaaaagaac
   156001 agaatcatcg cggtcgcttg ggtccggaac gtggacctaa tcggtgcggc tttgacctcc
   156061 gacgtctctc ggtcggctgc gagctgcttg aactggggtg tctccgatac cttgcgccgc
   156121 aggtacatgc ctgcaaggcc aaggggcgcc gcgagccaga acaggacgcg ccagccccag
   156181 tcttcgaatg cttcatcacc gaggactgtg gtgcacaggc tggcgatcaa tacggcgctg
   156241 gtgatgccga ggaaggtggt ggtgacgagg tagctgatcc gaataggcct cgcccgcgcc
   156301 tgactgtgtt cgtagacgaa gctgattgcg gaactgtatt cacctcctgt gccgagtccc
   156361 tgcacgagcc gacagagggt cagcaggatc ggcgccagaa ctccaatcgc gttgtaggaa
   156421 ggtatgaatc cgatgagtgc ggttcccgcg cacatcagaa ggatggtgaa cgagagtgca
   156481 cgacgtcgtc cgagggtgtc gccgagccaa cccgcgatca atccgccgat ggggcgactc
   156541 acataggtca gtccgaatac gacgtatgca ctgatcagtc cgacgactgg atcgcttgat
   156601 gggaagaagt ggagggccat gattgaggcg acgaccccgt agacagcgaa gtcataccac
   156661 tcagcgaagt tgccgatcgc agctgcggtg atggctcgcc tgggggaact agctgaagtc
   156721 tcgccttcca ctttttcctg ctgtgacgtg tgggcactgg cactcatggt cgatctcctg
   156781 tcttgacaat aacgccggga accccgatcc gataccttct gaatagaaca tacgttcgat
   156841 tcggccggga gcgatcaagg ctccaaaccc atatactggg tgagttatgt aatggaaaac
   156901 cattctatgg ctcacgtcga tagtgaacct cggtgtgacc catgtcaacc caacgaatag
   156961 aagcggcctg catgacggca gtccgagccc ggcgcggccg tcacgtccgt tccacgaccg
   157021 cgcataccgc ggccaagcat cggcacatgc gcggcagggc cccacgctcc agtgattcgc
   157081 acgccgtgcc cgggtcggcc atggccgccg cggtcgagtc aaaacccctc aagggctctg
   157141 tgccaagcgc cgtgcagcgc aaccccttga tgatcagttc actgtgggcc atactatggt
   157201 ttgtgaaacc atataatgat cggaggttgt ggtgaacgat caggcgtccc ggtccgaggc
   157261 ctcagcgcca actcgcacat cgaaactgca cagcctgcag tcggcggtcg agttgatcaa
   157321 ggacggtgac ttcatcgctc ttggcgggct gtggttccag aacaatccgt ccgcagcggc
   157381 ccgcgagctg gtgcgggccg gtaagaaggg cctccggcta gtggcggcac caccggcaag
   157441 ttatgcggta gacctgctct taggggcagg ctgcgtcaaa tcggcgcact tagcgcatgt
   157501 gtccttcgag cacttgggca tggcgccgaa cttccgacgc gttgtcgagc aggaactgac
   157561 caaggtgttc gactgtgatg aggcgacgat cctcggagga ctgatggcaa ccctggagga
   157621 tctgccgtac cacccagttc cgtcggtgaa gggcacggac attatcgatg gctgcgctca
   157681 aaccagcacg cgtctggtag cgggactggg cacggtcgtg tcggcgccgg caatccggcc
   157741 cgatgtgtgc cttctccacg ttcaagaggc ggacgcctac gggaatgttc gttatcacgg
   157801 aactccgttc tgcgatccgc tcttcgctaa agcctctaca accgtgattg tgacagccga
   157861 tgtcattgtg aataatgacg tgattcgggc cgaaccgcac cggacggtga tccctggata
   157921 tcttgtcgat gctgttgtcg aagcacccta tggcgcccac ccctgcgcaa gtcagggaca
   157981 ctacccccac gacgaacccc accttctcga gtacatcgcc tcaggagcgt ccgctcaccg
   158041 atggaacgac gaatacctcg ggcccttcgt tcaccagccg gccaacctcg acgactacat
   158101 cgaattagtt ggcggcgcag cacgaatcga ccaactaaca gacacagtcc gatgattgat
   158161 tcctactcga cagacgaact gatgaccgta ttaatggcac gggagttgca caacggcgac
   158221 ttggcggtca ccggcgcaac ctccctagtg ccggtcgctg cgtgtctcct cgctcaacaa
   158281 cttcatgcac ccgacctcac actgatcatg ccctcgggcc tcgtcaatcc ccgaccagga
   158341 cgcctgtatc gctccgcttc cgacgggcgg tgggtaaaat gcgccgaggc agtgggaacc
   158401 ggatacgacc tcttcgagat gtcggaaaat ggccggctcg acgtcatgtt ctacggcgga
   158461 attcagatcg acaaacacgg caatatcaac ctcactaaga cgggactctc acaggggagt
   158521 ccaccaaaat ttcggggacc cggcctcgcc aatacatcct tcgccgtggt atccaagcga
   158581 atcatcctct tcagccggtc gcatacctct cgtaccttcg tggaagaagt cgacttcgtg
   158641 accgcttccg gtcatctgag cggcgggtcg tcccgggccg agtccggcat cacaaccgag
   158701 ggtccggtcg tttgcatcac accgcttgcc accttctcgt tcgacgagac caaggcgatg
   158761 caagtacgca gcatccaccc tggagtcaat ccggaagacg ttgcaaacaa cacaggattc
   158821 aatttgaggc agggaaattg ggacacaacc agagctccaa cggtcaacga actgacgaca
   158881 ttacgtcaat gtgtcgatac cacaggagaa ctccgctgaa cgtctcactg gcctagtcgg
   158941 aaagggctaa aaccaaatga actacagcaa taccgcgctc aaaggtctcc gcatcgtcga
   159001 cttctcacgt gttgttgcgg gaccgttctc gacgatgatt ctgggtgata tgggcgccga
   159061 agtcatcaag atcgagcgac cgggaaccgg tgacgacagt cgcggatggg gcccgccgtt
   159121 cctcggggaa gtcagctcat acttcatggg cttgaatcgc aacaagaaaa gcgtagcgat
   159181 cgacttggga actcctgagg gagcatcgat cgcgcgtgaa ctcgtccgga gcgcagacgt
   159241 cgtcgtcgag agcttccggc ccggggtcat gaaacggctc ggactggact acgaaacact
   159301 ccgattgacg aacccaagcc taatttactg cgcgatatcg gctttcggtc aggacggtcc
   159361 ttaccacgag cggccgggct acgacttgat ggtctcagcc ctgggtggac tgatgagcgt
   159421 cacgggacca ccgcagggtg agccggtcaa agtaggtgta gccgtgatcg atgtgtgcac
   159481 ggggctacac gctgcgctgg gtgtcctctc cgccttacac caccggacgg tgacgggcga
   159541 ggggcagcga gttgacgtgt cgcttctgag caccgaattg gcgatgctca tcaacaccgc
   159601 cagtgagtac ctcatcggcg gcagcgtcgc taagccgcaa ggttcagcac acgcgaacgt
   159661 cgttccctat caggcatttc ccaccgagga cggatgggtg ttgctcggtt ctcccaatga
   159721 taagctcttc cgagttcttg cggcagcact cggaagaccc gagtggggaa ccgacccacg
   159781 gttcatcacg aatggcgagc gagtcaagca ccgcgacgag attgttgcgc agatcagtgc
   159841 gatcacatgc acccagacaa cggcacattg ggtggaactt ctgtcttcca ccggcgcgcc
   159901 ggtcgccccg attaaccgga tggatgctgt tttcgaggat cctcaagtac gtcatctcga
   159961 tcaagtggca gaagttgacc atcccatgtt cggtaagcac aaagtggtca catcggcact
   160021 aaggctctcc gccacaccgc ccatcgtcgg tgacgctgct ccgcggttgg gtgaacatac
   160081 gaaacaggtt ctgaccgaac taggcatcac gaatgatcgc atcgatgaat tggtggacca
   160141 ctgtgttgtg gaattccgtc cggccgatga agaattcacg ctggtcgatt agagccacga
   160201 tggcgatctt ggcgtgcaca cttccttgag gagatatctc gtggcacaac cctccatccc
   160261 gttccaccgt gggccactca ctggtctacg aattgtggac atgacaactt cctacgccgg
   160321 ccccaccgcg gcgatgtatc tcgcagatct cggtgctgat gtcataaagg tcgaacgccc
   160381 tggccacggc gacgaggccc gcatgtgggg tcccccgttc gtcacgcacg cctccgcatg
   160441 gttcgcctca gccaaccgca acaaaaggtc agttgtcctc gacattcgtc ataatgaggg
   160501 tctcgacgcc ctgtacagct tgattggtaa ctctgacgtc ttcttgcaga acttgaatcc
   160561 tgcgaaactc aggaagctaa agctgcatcc tgaagttcta cgtaccagat tcccgcgctt
   160621 gatctactgt gccatttcag gattcggcct cgacggaccg gacgccgaac ttcccggtta
   160681 cgatctggct gcgcaggcca gatcggggtt gatgtcggtg acaggtgcgc ttggcggatc
   160741 gcctcagcga gtgtcgaccg cactctcgga catcgtgacc ggaatgtgcg cggctctggc
   160801 ggttagtgcg gcagcggtga gacagcgcac cgatggtgtc ggcgatacga tcgacgtttc
   160861 gttgctggac tcggacctgg cactgatggc gccgcgaatt gctgcttact gcgctggcgg
   160921 gaccgagcca gtaccgagcg gcggcacgga ttccgtcctg gcggtttacc agacattccg
   160981 aacggaagac cgggatatcg cgatcgcgat cggcaacgat tccatgtgga cacgcttctg
   161041 ccgagcaatc ggagagcccg atctcggtac cgaccaggcc tttggaacta acgccgatcg
   161101 acgccgccac cgagggcagc tcacacagct aatcgaacgc cgcctcatcg agagaccagc
   161161 cagcgaatgg ttgacgattc ttgctcagtc cggggtgccg tgctcgctcg ttcaattcct
   161221 ctccgaagtc gtcgccgatc gccaagtcat tgcgcgttcg agcctgatgc cagttcccga
   161281 gtctgcaagg cagatggtga gcgtgcggag cccattccga ctcgcttcca taccgaatcc
   161341 gcggaatgac cgcttccctg agcatggagc ccacaccgaa gaagttcttc tcgaaagcgg
   161401 cttgagcccg gaaagggttg cgcagctact cgtatcgggg gcggtctccc agctagagca
   161461 gaaagaatga tttgatgagc accgcaaatg agttgcaagt cagtacccat ggtccaatca
   161521 cggttgtcac aatctcccga ccaacagttc acaatgccct caacagcgcc cttatccagc
   161581 agctcgcggc cgaagttcgt gatcgttccg aggacggtca cacccgagcg atagtaatca
   161641 ccggcctcgg tgacaaggcc ttcagcgccg gagccgacct caatgaactg gccacgctcg
   161701 acgcaaacgc cgcgtacgag gttatgcgtg ccggacagac agcattccgc ctgatcgaaa
   161761 ggagccgcat cccagtgatc gctgctgtca atggcatcgc gctgggtggg gggttcgagt
   161821 tggtcctggc atgctctttc tcgatcgtca gtcggaacgc ctccatgggg ctacctgagt
   161881 ctggtttggg tctcattccg gggtatggcg gcacccaacg tctgcagcga cgtatcggcc
   161941 ccagcaccgc taggttcgtc atgttgacgg gccgacgggt ggatgcaaat cgcgcctacc
   162001 agatcggtct caccccgttc ccaccaacgg atccagagct gctgatgccg gttgccttgg
   162061 aagtggcgga agagatcgcc caccgcgggc ccgttgctac cgaaaccatt ctcgggctcg
   162121 tcgatcaggg ctacgaactc gcccttgacg cagcacttgc actcgagacg catcatgccg
   162181 cgctggcaat cggcggcaac gagtcgacgg tgggtatcca ggcatttcac gatcggcaga
   162241 gaccacagtt cgctgcgttg gccaccacca ccaccacatc cgatgacagg agaaactgac
   162301 atgaatctga tccaaagccc ggttgcggtc atcggggccg gaacgatggg ttccggaatc
   162361 gcaaccgtcg cggcccgggg aggctatgac accgtcgtct atgacgtcag cgagcaggga
   162421 ctgacccgtg ggctcgacac aattcgttcc ttcttcgaga agagccgaga tctagggaaa
   162481 ctcaccgcgg aggaggcctc cgctgcgaac gctcgtgtga ggggtacgac cgacattact
   162541 gatttggcaa ccgccggagt agtcatcgag gcggtcttcg aagacttggc ggtcaagaag
   162601 gaactcatgg ggcaggtgga gtccatcgtg gccgcggaca cgcttcttca caccaacacg
   162661 tcaacgctgt ccgtcaccgc gatcgcgtca ggtctcaagc atcccgaccg tctcgttgga
   162721 acgcactact gcaatcctgc gcctctgctc tcgctcgtcg aagtcgcgga tggacgacac
   162781 accgcaacga gcgcacgtga aacatgtatc gagttcctgc gatcggttgg taagacgacg
   162841 gtcgtaacaa aagatcgtcc tggtttcatc gtcaatcgct tcttgatccc gtgggaaaac
   162901 agctgcattc aagccctcga ctcgggtctc ggaacgatcg agtccatcga caccgcagtc
   162961 accggggcac tcggccatcc gatggggccg ttccgacttc tcgacatcgt cggattggat
   163021 atccaccagc aggtcgcgac ccgactgtat gagcaactgc gcgatccccg cttcttcccg
   163081 ccgcccatgg tcgaacggat ggtctccgcc ggcaacctcg gacgaaagac gggacgcggg
   163141 ttctacgagt acgacaacac ccggctgttc ggatcgtgag cgacaacaac attcctggtt
   163201 tcttccaagc ccagcaaagg agtaccgatg tctgaactac agaacgtggc agtaatggga
   163261 tacggcacga tgggagccgg aatcgcgcaa ctcatcgctc agtccgggcg cacagtgagg
   163321 atcctcgaag ccgagcagga ccgtctagac gccggtcggc gatcggtgga ggaatttacg
   163381 gccaccggtg tacggcgcgg aaagctgagc gaagaccagc gcgaacaact actcggccgt
   163441 ttgcacggca caacccaagt ttcggatctc agtgactgtg acctcgtaat cgaagcggtg
   163501 accgagcgga aagacgtcaa gcaggacctg ttcgaggccg tatcggagca cgtgccgacg
   163561 actactttga ttgtcacgaa cacttcggct ctctcaatca ccgaactggc gcgcagcgtc
   163621 gaggcacccg agcggttcgc aggactccat ttcttcaatc cggcaccact aatgtcggtt
   163681 gtcgaggttg tgcatgctct ccagacctcc gacactgcag tgacggccct gtcggaattc
   163741 gtcacctcac taggcaaagc ccctgtcgtc gtgaaggatc gtccgggctt cctcgtgaac
   163801 tttctgctca tgccctatct gaacgacgtc gttcaggcat acgacgatgc actcgcaacc
   163861 gccgaagata tcgacaccgc cctgaagcta ggtctcggct ataaactggg gccgctcgaa
   163921 ttgctcgaca tgattgggct cgacgtacac aatcacgcaa cccacagcgc gtacgaggcg
   163981 acgttggacc cccgattcgc tccgccccca ctccttcgcc agatggtcgc ggcgggtcgc
   164041 cacggaacta agaccacgtc ggggtttcgc acgcaggatg gtacgtactg atgagcgctg
   164101 aatacgatga catccagatc aaacacaacg gagcggtgct gacgatcacc atcgatcggc
   164161 aagagtcggg caacaaactc cgcgcacaga cgtgcaatga gctcatcgat gccctccagc
   164221 gctttcggct cgatcccgct ctgcaggctg ctgtgctgac cggcgccggc gagaagttct
   164281 tctgcatcgg cggggaacac gacgaactta ctcgactcga ccaatcggcg gtcattccaa
   164341 ttatcgacgt ataccagtcc attgacacga tcgggaaacc gatcatcgcg gcggtgaacg
   164401 gcttcgcggt cggcggtggc aacgtcctcc acaccgtttg cgacctgacg atcgcctccg
   164461 agtcagcggt gtttcgtcag gtagggccta tggtcggcag cttcgacgcc ggctacggca
   164521 cttggtacct ggaagacact atcggccgga agcgggccaa ggagatgtgg tacctgaaca
   164581 agaagtattc ggcagcgcaa gcgctcagta taggcctcgt gaacgaggtc gttccgatag
   164641 accaactgca gtcgcgcgca cgcgaagtgg cgcaagatat ttcgcaccgc agcccgctcg
   164701 ccatcggagc actcaaagga gcgttctcgg cacggcacaa tggtgtttcc gggcaagcgc
   164761 gcctggcaca cgaccagttg ctgaccctct acttggcgac cgacgaggcg cacgaagtcg
   164821 cgacgtcgtt cgccgagcga cgtcagcccg atgccaaaac cttctggacg taggggtccg
   164881 ggggagcacc tcgctccagg cagtactagg cccggcagcc agactccggg cggtgtcttc
   164941 agtactggca ccatcgactt caaccagcac gacgagtgcc attggcaagg gactctcacc
   165001 tcctcgctac acgctcgcaa tcgtgcatcg ctggaggttc gttactcttg atctgtccat
   165061 gcggtacgcg aattacgaga ccgaagtgag gttgtttggc ggtgtgcgcc cgtatcgcat
   165121 gccgccaaac aactgcgcgg tgacggtgta tattctggcg ccgagtaaat actcagccgc
   165181 ttcgtgtggc cccaccgaaa ggcgcaccga gatgcaccgt cgccgagatc cgtcagggtc
   165241 gcagctcaag ggtatctcgg ggcggcggtt ctgcactgaa gaagggtgca agtccggtga
   165301 ccgggacaat tcagcagcgt gatcgaggac ctgtcgaatg ccgtggcatc cgcaggacgc
   165361 cggggggtga accgcgctgc cgaccgcctt cctgtacgtc tggtggaacg gcgacgttga
   165421 gtgcctacgg ccggaaattt cgactcacgc ctactccacc ggccctgcag tggaaacggc
   165481 atcgaaccct cgaccacgtt ctcctaccaa tcaaccaacg ctctcggtcc agccaccagg
   165541 cgacaacttt gagccaggtg cgggcacagg cgcgttccgt accgtcctac tacctttggg
   165601 cctggcccgc gcgagggagt gcggcggctc caaaacgaga cgcgaccgct cgaatccaac
   165661 accggtgaac tcccgccaat cctgtgccgg ttgtatgatt aagtaacgaa agttacaagg
   165721 aaggtcacca gtggcgaagc agtctacggg gcaaacgctc cgctcggctg aacgaatgct
   165781 cgacgtactc gaggcattct cacttcatca gccagcgtta accgcagcgg aggtaagcga
   165841 acaactcgag ttggctccga gcactgttcg ccgactcctc aacgttctcg aacagcacgg
   165901 tttcgtacgg gtcgacccga tgacaggtca gttcgctcct cactaccagg tcgtacgact
   165961 ggccgctgtt gccctcgagg gcaacgatct gatctccaat gcacgagtcc ccctcgacct
   166021 gctccatgac cgcacccagg aggcggccca gctggtggtg ctatctgatc atgacatcgt
   166081 cttcgtagat cgacgtgaaa gctcgagcct gattaagatc ttcagcgcga ttgggcagcg
   166141 ctaccctgca tgggacgggc gcgcttcagg gaaagtcttg ctggcgtggc ttcctgaaga
   166201 cgacgtaagc gcaatgctgc cagcccccga ggattgggct caagcgggcc cgaatgcagc
   166261 gccgactccg cagacatatt tggaggggtt ggcaaaggtc cgggcgcagg gatatgccgt
   166321 caatgatgaa gaaactgacc gcgacgtctg ggccgttgcg gcccccgtcc gagaccacac
   166381 gggacgcgta gtcgccgcga tcaatgttcc ggtcctgaag acgcgagcaa cggaccccaa
   166441 ccgagtcgcc gaactgatcg acgccacgac cacggcggca gcatccgtat ccgaaggctt
   166501 gaagttcttc ttctctcact agcttgattt ttaacctggg caggcggccc cgacgggttt
   166561 tctagctttg gtttcggcgc gtttgcccac gtggtgatgc ggtgcgcggt gggtgttttt
   166621 cgatccgggt gggcgtccgg gtccgggtcg actgggtttc ggtgcactgg ccggaacagg
   166681 catcgtcgca cgggtgcgcg aaaaccctcg acgaacccgt gccggcgtca atcgtgttgg
   166741 tgggacaggc cgttcccacg ggcggcgtag gtcctcggcc agaggacggg cgagccggag
   166801 ttgggcgtag gccaccagca cgatccaggt ccagcggtcg gccgcctcgg gactgcggag
   166861 ccgaggtgcg gtccacccca acgtctgctt gaagaatcgg aaggtgtgct cgagatcgaa
   166921 tcgccgcaga aacagctgcc acaaccggtc gagatcgtcg gcactgacgc ccgggtccga
   166981 gcaccacagc cacaccgggg tgggatgccg gtccccagga aggtggtcga cggtcaaccg
   167041 gatcaccgtg ccttccacga tgggtggcgg ccccgggtgc tgagcccacg agccacgatg
   167101 aacaagtcgc gggtgcaacc gattccacgc cgaagcggag gctgtgccgt atcggtccgt
   167161 ctcggtgctc gaggtggtct cgggtgcagg ccacgtaatc gggtcggcga atcgaaactc
   167221 ggggccgtgc cggggtgggc gcccagtacg gcccggtggc ggcgccggga agcacagcac
   167281 ccggtccgaa cgcatccgac ccaacacctg caccgggaga tcggcgagca cgaacgccaa
   167341 ccgcgccaac tcgtatccgg cgtcgaacac cagcagaatg tccgggtcgc cgtcgcggtg
   167401 gtgcccggcc tcgcgcaacc gcgtgatcac ttcacgcacc tgggtcgccg tcacagcggt
   167461 ttcgtcatcg tcggggcgca agcgaaccgc gtcgagcacc gacgtccacg aggtacgccc
   167521 ggtctcgagt gcggcgacga acgagtacgg ccaccccggg atcagctgcg cctgattctt
   167581 cccgcggccg tagacgtggc agaacccgcg ctgcggactc gtcggtgcat ccgggcgcaa
   167641 ccaggcactg acatcgacgg ccagaacgat ccggccgcca cgatcacacg ggatcgtcag
   167701 cccgccaagg tagcggcgca gccgagtgaa atctactctg ccgcagttaa ttgcgtcgta
   167761 caaggcgccg tgaccgcgcc gatgctcggc ggccagtgac aactcgacca gggtgcgaac
   167821 cgcggtgccg gaacacagca gcgcatcggt caactcgaac aatgcatcac ctcgggacgg
   167881 aagacaccgg tagaactctt cgcggaacga caccaggtcg acacgcggat cggggaccga
   167941 ttcttccccg accgcccacc gatcgggcac actgatactc acggccaccg cctgttttcg
   168001 tctcgaaagt tctctggaag gaacctcaag atgatcaggc ggtggtcgcc tcatgccgcg
   168061 gcgacacgcc gaacaacacc agcaccaact gccccacgcg atggccgagg ttaaacgaca
   168121 agctaagaaa gtgttctgaa agtgtcacgc cgcgcgggtc gactgccagg ggtgtcgtcc
   168181 gcgtgcgggg gcgagtcgtc gggtcatcaa tccgatcatt gcccatttga tcatcgcctc
   168241 cgagtgcgcc gggaggcgtt cgtagtcgtg gtcaagtcga cggcaacgca cgatccacgc
   168301 cagggtccgt tcgattagcc aacggtgcgg cagaacactg aatcccagct tccccttggg
   168361 tttccgcacg atatcgagcg tcatccggca atgctccgcg acccacgcga cgagacgtcc
   168421 ggcgtagccg ccgtctgccc acaccatcga cggcatcact gtcttcgccc gagacaacgc
   168481 caggcgcccg ccgtcgcggt cttgcacgct cgccgcggtc accagcacga ccaccaacag
   168541 gcccagcgag tccgtgacca cgtgtcgctt cctgccgtgg acccgtttcc cgccgtccca
   168601 tccgcgggtt tccgtgccga ccgtgtcggc gcccttgacc gcctgcgcgt cgaccatccc
   168661 cgccgacgcc atcggatccc ggccgctacg gtcacggagc ttcgcccgca gcgcgtcgtg
   168721 gatgcggtcg gtcaccccgg actcgttcca tcgctggaag tacccgaaaa cggtctgcca
   168781 gggcgggaag tcatgcggga gctgccgcca cgagcaaccg gtgcggttga cgtagaggat
   168841 cgcttccacg atccgccgac gatcgtggat cgccgggcga ccgcccggca gcgccgcggg
   168901 caccatcggt gcgatcaact cccattgggc atcggtcaga tcggacggat acggcgtccg
   168961 cttgcgacgt ttcctgcgag caacgacgga cctaatcatg ccgccaccgg gccggtccgc
   169021 cgcgcccgaa tcgaaaactt tcaaaacact ctctgagtat cgcgagagtc ctagccgttg
   169081 gtatcgaacc gacctaatca tggccgcgaa ggggcgtgca aggcttgttc gtatccagca
   169141 gctgctcaag ggagtctcca gaatcggact gttcgggcga ccatgacttc ggcgcagttg
   169201 gtgcctgaca agctgcggcg ctgatcatga gtgggcgctt ctgacctcag gcgcgatcac
   169261 gaccatattg gttgccgtaa ggaattccag ccgggtgggc aggtcaacag gcgagccccc
   169321 acagatcgtc aagaagcgca gagaagattg gccggagctg acgcgatcgg cgagctcgcg
   169381 gctcatctcg acgatgtgaa cagcgaagga caccatcggc aaggtcaccg acacggtcgt
   169441 cacctaggtc cgccatcggg tcctgtgcag cggagtcggc gctccgggcg ctcgcccgca
   169501 aggcactcga acgccgacat cggtacacgc tggtggatct cgcaaacctg atccgcccga
   169561 ccacgtggct gtagtacgag cacccgaact cgtgtcacag caccccgaat ccgatgtgct
   169621 cgcggccccg cattccacgc catcacctgc atgcggtgat cacggctgcg cactgtttcg
   169681 gccagctggc taatgagttc gatgattcgg cgccgggcat cctccagttc cgttgccaag
   169741 cgctcttcct ccatcgacct tgcggcgcgg tttctgccct acatggtcga gcttcccagt
   169801 cccacaagca ttccgaggcg ttcatgcggt ccgctgacaa ctcctaccgt acggtctcga
   169861 cacccccgcc gcggcagtgt cctcgcagcg gaaacatgga gcaggtccgt cgatccatcg
   169921 gaccggcggg ttccgtagtt ttcccggatg ttcgccgatg agatctggat cactatggat
   169981 gccagcgagt gagcacggcg aatggatcgg aagtttttcc gtcgggccgt ggttcaccgt
   170041 cggcgacgta gccgaaggca tttacgacgc agacctgagt tccattgaac gcactaacga
   170101 ccgtacaagt gtgatttgcc gacgagaaag gaaagccgca tgactgacgt gcaatgtgaa
   170161 cccgcgcttg cggggagaaa gcccaagtgg gccgacgcgg acatcgctga actcgtagac
   170221 gaaaggaccg gccggctaga cccgcggatc tacaccgacg aggcgctgta cgaacaggaa
   170281 ctggagcgga tcttcggtcg ctcgtggttg ctgatgggcc acgagacgca gattccgaag
   170341 gccggcgact tcatgacgaa ctacatgggc gaggatcccg tgatggtcgt tcgtcagaag
   170401 aacggggaga tccgcgtctt cctcaaccag tgtcgccacc gcggaatgcg gatctgccgc
   170461 gcggacgggg gcaatgccaa gtcattcacc tgcagctatc acggctgggc ctacgatacg
   170521 ggcggcaact tggtgagtgt gcctttcgag gagcaggcct tccccgggct gaggaaagaa
   170581 gattggggcc cgctacaggc tcgcgtcgag acctacaagg gcctgatttt cgcaaactgg
   170641 gacgctgacg ccccggacct ggacacctat ctgggtgaag cgaagttcta catggaccac
   170701 atgttggata gaaccgaagc gggcaccgaa gcgatcccgg ggattcagaa gtgggtcatt
   170761 ccctgcaact ggaagttcgc agcggagcaa ttctgcagcg acatgtacca cgcgggcacc
   170821 acatcccatc tttccggcat tctcgcgggc ctgcctgatg gcgtcgatct gtcggagctc
   170881 gcgcccccca cggaaggcat ccagtaccgc gcaacctggg gcgggcacgg tagcggcttc
   170941 tacatcggcg atcccaacct gttgctcgcc atcatggggc cgaaggtcac cgagtactgg
   171001 actcagggca ctgccgcaga gaaggcttcc gagcgcctgg gaagcacaga gcgtggccag
   171061 caactaatgg cgcagcacat gaccatcttc ccaacctgtt cgttcctgcc aggcatcaac
   171121 accatccgag cgtggcaccc tcgcgggccg aacgagatcg aggtctgggc cttcaccgtc
   171181 gttgatgccg acgcacccga ggagatgaaa gaggaatacc gccagcagac actgcgaacc
   171241 ttctcggcag gtggtgtctt cgagcaggac gacggcgaga actgggttga gatccagcag
   171301 gtgctgcgcg gacacaaggc ccgcagtcgg ccgttcaacg cggagatggg actcggccag
   171361 accgacacgg acaatcccga ttaccccggc acgatcagct acgtctacag cgaagaagcg
   171421 gcgcgtgggc tgtatacgca atgggtccgg atgatgactt cgccggactg ggctgcactg
   171481 gacgccaccc gacccgcagt gtccgagtcg acccacacgt gaccgcggcg gggcgagcgg
   171541 accgcggtgg aaccatcgcc gggtctccac ctgaacagaa ctcccgactg attaggaaga
   171601 attatgattg acgccgaatc gccaaccacg gcatttcgaa caaaacccgc accagtagac
   171661 cccagcctgc agcacgagat cgagcagttc tactactggg aggcgaaact tctcaatgac
   171721 cgccgcttcc aagaatggtt cgatctgttg gccgaagata ttcattactt catgccaatc
   171781 cgaaccacgc gtatcatgcg agaagccgaa caggagtatt ccggcgccca tgaatacgca
   171841 catttcgacg acaatgcgca gatgatgcga gggcgcctgc gcaagatcac ttccgatgtg
   171901 agctggtcag agaacccggc ctcgcgcacg cggcacgtga tttccaacgt catgatcgtc
   171961 gacggtgata accctggtga ataccacgtc tcgaacgtct tcatcgtgta cagaaatcgg
   172021 ctcgagcggc agctcgatat cttcgctggg gagcggaagg acattctgcg tcgaactggt
   172081 agcgaagcgg gtttcgaact cgcgaagcga acgatcctga tcgaccagag cacaattctc
   172141 gccaacaacc tcagcttctt cttctaggag tgacgatggc cctcacaaag atatgcagct
   172201 ccggcgattt ggcgccgggt gagatgcttc gcttcgagga aggtccagag ccgattctgg
   172261 tctgtaacgt gggcggagag ttcttcgcga ctcaggacac ctgcagccat gccgattggg
   172321 cactctcaga cgggtatctc aaggacgacg tcgtggagtg cacactccac tgggccaagt
   172381 tttgcgtgcg cactggcaag gcgaaggcgc tcccggcctg tctgccgttg cggacctttg
   172441 tggtcaaact cgagggagac gacgttctcg tggacctcga gggcggagtg acgacatgac
   172501 ttccgacatc gtggtcatcg ggggcggggt cgctggcgtg agtgccgtgc agtcgctgcg
   172561 ttcggaaggc tatgacgggc gtctgttcct gatcggcaag gaacgcgaac tcccatatga
   172621 ccgcacctcg ctttccaaag cggtcttggc cggggatctg gccgatcccc cgccgctgtc
   172681 accggctgac tggtacgacg agctacaggt agagacggtg ctcgacagga cggtcctgca
   172741 ggtggatgtc acccgcaagg aggttctgct cgacggcggc cgctcgctcg aggtcgatcg
   172801 tgttctcttg gcgaccgggg ccagcgcgcg cgttccctcc ttttccggcg ccgaccttcc
   172861 tggcgtcacc accctgcgaa cggtggacga cgcgcagcgg ctgcgccaag actgggagcc
   172921 aggacaacgg ctcgtcgtcg tcggcggagg cttgatcggc tgtgaggttg ccaccaccgc
   172981 tcggaagctc gggctcgagg tcagcatcct cgaggcctca gacgagttgc tacagcgcgt
   173041 tctgggccgc cggatcggtg gctggtgccg ggcgcgcctc gaggaactcg ggatttcggt
   173101 catggtgaac acgggagtcg ccgagttcga cggggtggac aggatcaccg ccgtgatcgg
   173161 caccgacgga cggcgtttcc cggcagatag tgcaatcgtg tgcgtcggcg cggaacccga
   173221 gacggcgata gccgagcagg ctgggcttgc gtgcagccgc ggcatcatcg tgaacgattc
   173281 cggcggcacc gccgctgagg gggtcttcgc ggccggcgac gcggcatcat ggccgctacg
   173341 gacgggcggc cggcggtcgc tcgagaccta catcaacagt cagaaagagg cgaccgcagt
   173401 tgcgtccgcg atgttaggga aagccgttca tgcgccgcaa ctaccgctgt cgtggaccga
   173461 gatagccgga catcgcatac agatgatcgg cgacatcgaa ggttcagggg agtacgtcat
   173521 gcgaggcgct cccgacgacg gcccggcact gctcttcagg ctcaccgacg gcaaactgac
   173581 tgcggccctt tcggtggatg ctccgcgaga gttcgccatg gcgacccgcc ttgtcgagag
   173641 cggtgctcag gtgggccggg acgttctcgc cgacacaagc gtggagttgc gcgaactgaa
   173701 tcgggcggca cgcgagagaa caacagcggc atgacagaga gccctgatcg cggagtgatc
   173761 agcggtgccg ctagggccga tcactcatcc gctccgccgc gccactggtt cggcgacgat
   173821 atgcaccaac ggtcgcctgc tctgctggat cgagaacatg tcgaagactg ggtaggacgc
   173881 caacgcaggc accgcgatcg agtcgcatct cccaaccagc ggtcaagtcg gctcgggacg
   173941 ccgggtggcc aatctccttc ggccatcaca cacggcaaca ggaaagccat acccgaggtc
   174001 cctgggtgat tcacagcctg cggccgacgg cgcaaatcac actccaagaa aggtaagaaa
   174061 tgagcgttca gagacttggt tacatgggct tcgaggttgc ggatgtgccc gcatggcgcg
   174121 ccttcatgac ggaaaaactg ggggccatgg aggcctcgag cagcgagaat tcggcgcggt
   174181 tcaggattga ctcccgcagc tggcgcctga tggtcgaaaa gggaccgtcg gatgacatct
   174241 cgctctcggg ctacgaggtc gagagcgagg actcgctact cgcgatcaaa aagcgtctcg
   174301 aagcgcatgg aatcgaggtg acaacagaga gcggcgagtt ggcggacgat cgcggtgtcc
   174361 tcggactgat ttcgtgcacg gacacggcaa acacccgggt cgagatctac tatggcgcga
   174421 cggagctgtt cgagaagccg ttcatctcgc cgaccggggt ctcgggcttc acgaccggcg
   174481 accaggggtt cggccactac gtgctggctg tgccggatat agatgctgcc ctggatttct
   174541 atgtcaaggg cctgggcttc catctctccg acatcatcga ctggaagctc aacgatgaac
   174601 tgacggtcaa actccacttc ctgcactgca acggtcgaca ccacaccctg gcgctcgccg
   174661 gtctcccggg agcaaagaag actcaccact tcatgctcga gaccaagcat atggatgacg
   174721 tgggccttgc ctacgacaag ttcgatgcgg acgggacagt ggtcatgacg cttggccgcc
   174781 acaccaatga ccacatgctc tcattctacg gcgcgacccc ctccggattt gccgtcgaat
   174841 acggctgggg cgctcgccag gtcgaaccag gctggtccgt cgtgcgctac gacaagatca
   174901 gcatctgggg tcacaaattc gttgccgagc gcgacaggca agtgagcagc aacgcaatcg
   174961 aggatgaatt gattgacatc gatgccacgc tgagcgcccc ggcgcaagcg taagacgaac
   175021 cgaactcaca agacgaagaa agggattcag atgggttggc tggaagacaa cgtcatgatc
   175081 gtcaccggcg gagggtcggg cctaggccgg gcgctggtcg agcgattcct gggagaagga
   175141 gcccgggtgg gtgtcctgga gaagtcggcg gagaaggctg agaagcttgc caacgacttc
   175201 ggcgaggatg tcctcgtggt cgaaggcgac gtgcgcaagt acgacgacaa tgcgcgcgtc
   175261 gtccaggaaa cggttcgcca gttcggtcgc ctcgacacgt tcgtcgcgaa cgccgcgatc
   175321 tgggacttct cgacgaagat ggtcgatatc ccggtggacc gactggacgc cctcttcgac
   175381 gaaatgttcc acatcaacgt caagggctac ttgcacggtg cacgtgcggc ggtcgaggag
   175441 ctcgccgcca ccggaggctc gatcatctac accgtgtcga acgccggctt ctaccccggc
   175501 ggcggcggcc cgctctacac cgcgtcgaag cacgcggtag tcgggctgat caaggaactg
   175561 gccttcgaac tcggccccaa gatccgcgtc aacggggtgg ctccgggcgc aatgcccacc
   175621 gatctgagag gacctggttc gctcggaatg ggcgaaacca ccatcacctc agtgccgctc
   175681 ggcgatctgg tcaaacagtg caccgtgctg caggagctgc ccgaggcggc ggactacacc
   175741 gggcactacg ttctgctggc ttcgaaggcg aactcgagga cggcaaccgg cgcgattatc
   175801 aactgtgacg gcgggatggg ggtgcgcggc ttggccgaga cggccggcgg aaacgacctg
   175861 taaaaagcag ccctcggaaa ggaagaaaca acagcgaacg acaccaggcc cactttcggt
   175921 acccgacgcc ctcgccgaaa cactcaacaa tgaccacgtt tggctgaaga aggccgacaa
   175981 gatgaccttc ggggtgacac atgtgtacac cgggaagcta accctcgtcg tccgcatgga
   176041 cttcggcagg ggcgtcatgt ccgacgtcgt cgaacatgcc aacgcggacg acgcgccacc
   176101 cagcgaattc gtgctcaccg gtgaacagcg agaactggcg gcgcatgctg gtgacaggcg
   176161 agctcaccgt caacatcgcg ctggtcacca agcagatctc ggtgaagggg aagatgggac
   176221 ccctgctgaa ggacatccca cagttcaagt acatcatcgt caagttgagc gagctcgggc
   176281 cccgcgcatt ggatcaagag gccacttgac ctggctacct tccgaagtct cgggtaggtc
   176341 cttcccgaac ctccgggata gcagtcggtg accacggtgc cgggatcccc tccgggccca
   176401 cattgtggtt acccagccgc tcatggcgcg agtctggttt gttggggaga ctggaccgtg
   176461 acagcgaagt cgctgatcta gggaacaaca tggaaatcga caccgtgagg gtgctgcggc
   176521 agagtccggg catcacgacg actctggccc tgtcgggcga gacccgtgaa cgtgtggttg
   176581 tccggcgggt ggatctatcc atgacgttcc catggagttg gcactggctc gaaggtgagc
   176641 tggaggccat gcgcagggcg aggctgccac acgtcatccc cacccagatt gcacacaaag
   176701 gacccgacca cgtcgatctc gtccgcccat tcatagctgg tctcgacatt cgagaatggt
   176761 ctgcgcagga gtcaccccaa tcgctcgacg tccagctcca gctgatgtgc aacctgttct
   176821 acgcactggc tcgtctgcac cgaatgggaa tcgctcacgg cggggtgaag ccagcgaata
   176881 tcatgctcgc ggagggcacc aatcagctcg ttctcctcga cgccagcgtg acgcggactc
   176941 aattggctgc cgtgacccat cccgtcgagg ggccggaagg tcgatatctg cttccggaaa
   177001 gtcccggact cgcacacccg gcggcgggct tcacggccga catcttcgca gcggggtggg
   177061 tactcctcga gtcgaccgcg gagggaaatc ggacggccag cgcgttgcgt agggcgaacc
   177121 ctcgtatcgg tacccacgca gagctgtcac acctggtcga tatcgtcggc ctcccggcta
   177181 cgctgcgccc gatatttctc aagctgctga gcccacgggc agcgatccgc tacgaaagcg
   177241 ccgacgaggt gctcgcagcg ctcgaggcgg tggtcgcgac cggcggtggg gagagcgctc
   177301 tcgcgtctgc tgtcgcgccg ccccggcagt gcggatcgct cgcctacgtg gagccgccgt
   177361 tggtaggcag gcatgacgaa ctcgccaccc tcaccgcatg tgccgacggc gcgagccgat
   177421 cgtccggcgc ggtcacatgc ctgagcggtg agtcaggagt cggcaagagc cgcctgctcg
   177481 acgccgtcgc cacgcacgcc tcgacggccg gggtgaccgt gatgcgtgcc ggcgcgttcg
   177541 accacgcggc ggcccgtccc ctcggcctgt tcgccggccc tttccgcgac gtggtcgcct
   177601 acttgaccgc gcacccgcgc gaggccgagc gggtgcgcgg agaaatgggt gagctgctcc
   177661 cggcagcact cgaacagata ccggagctga ccgctgcctt cggcgatcca cccgcggcga
   177721 agaactccga cagcggattc ggcgatcacg cggtagccgc cgccccgact gccgtcgctc
   177781 gacttcttcg ctccgtcttc accaaggaac aacctggact gatcgtggtc gacgactgtc
   177841 agtgggccga cgatctcagc tggcaggtgc tcgccaaact agcttcgacg atagcgatgg
   177901 aggaaacgcg atcccagtcg aacgtgtcgt tgatatgttc gtgccgaacg gaagctgttg
   177961 cgcaagtgag ggcctgggaa atcagtgata tcgagtttct cgaccttcag ccgttgtccg
   178021 cagccgatac ggaggaattg atccggtcga tcggtgaccg tatccccgac gagatcatcc
   178081 cctatgtcac gaagtactcc aaaggcaatc cgctcgaaac catgctggtt ttccaggcgc
   178141 tcgtcgactc gtcggcgttg acgcgcgagt cgggtcgatg ggtgatggac gagaatggga
   178201 tggcgtcact cccgctgccg tcgcaatccc gcgattccga cgccgcgtcg gggagggaca
   178261 gtgtgctcgt ctcgtcacgg ctgagtctat tgtcgccgga cacacagcag gcgatacgtc
   178321 agggcgcggt gctgggacgc cggttctcgt ccaggcttct gtacgcggca ctggcggcga
   178381 gccccacgga cgtcgatcag ctcctcctgg aggcaaccca gcacggaatc gtgcgcggca
   178441 tcgcggacgg cggccacgcc gagttcgaat tcacgcacga tcggctccgc gaagccgtgc
   178501 tgagaacctt gaccgacgac gcccggcgcg agctgcatct gcgcgccgca caggcactcg
   178561 aaggcgtccc tgcggttcgg gccgactacg acatcgcgta tcacttcgac cgctccggcc
   178621 gagccgcatc tgcagtgccg tacgccctac gtgcgggcga ggcgggactg aggcacaatg
   178681 cgctcgacgt cgcggaaggc aacttcaaga tcgctgaaac gggactggcc ctgtgcgagt
   178741 cggccgacga caccgcgaga ttccgtgttc acgaaggact cggcacagtc cacatgctcc
   178801 ttgggaacta cgatctggcc gcgaaggaac tggcgtgggc atacgagctg acccgtgcgc
   178861 gctcgggact cgactcttca cgggttgcca ctctgctcgg cgaactcgcg ttcaagacag
   178921 gccgattcga tgatgccgcg gagtggatgc gacagagcat gcacgacatc gggcttcgct
   178981 tgccccggag ttccatactc gccgccgtat tcgcggtcgg cgaggtgggt ctgcttaccc
   179041 ttggttggct ctctcgccga atccggccgg gccgagccgg aacagagcgt gaccgcctgg
   179101 ccgcccgcat ccacaaccgg ctgctatacg aatggtggtt cgtcaggtca ccgatctggc
   179161 tggtattggc catcctccgt ggcgtgcgtt tcgcgaatgc cgcaggaagc acgcgtgagc
   179221 gggcacaggc atactccacc gctgccgtga tttccggtgt agcccccgtc cttgcgccgc
   179281 tggcgttgcg cctcgccgac cgctcgctgc gactgcgcca gacggcgggc gaaggctggg
   179341 gcatcgccca gtcgcaccat ttccggggat tcgttctcta cgctgccaac cggtacgacg
   179401 aggcgatcgc ggcgttcgac accgcaatcg ccgccttcga cactgtcggg gatcgttggg
   179461 aacaggtagc cgcgatgtgg caaaaggcgc tgtgtctggc tcgacaaggg aaacttcacg
   179521 atgcgggagt gcttgcgcgt gacacctact gggagggcaa gcgcagaggc gatcggatcg
   179581 gcgcggggac cgccctcgcg atctgggtct cgtgcctgcc gggtgaggtg agcatggaga
   179641 cgatctctcg tgaactgcgg cagacgaatt cgggcgaccg ccacacgatg gcgatgttgc
   179701 atgcggcgcg ggcctggcga cttttccacg cggagcagga cgtgcaggct gtggacgcgt
   179761 ttcggcaggc agacgagctg atccgcggtt cgggcatcag gaatcatttc ctcgcaccga
   179821 tcctgaccgc gcacctgcag gtccttcgcc tctcgcacga cgccgcacct gcctggtgga
   179881 cggaggaacg ccggctccag gccacggccg cacgacggca gctcactcgt gcccggtggt
   179941 cggccatcgt cttctggggc gagcggcccg cggttctgcg ggaatgggcg ttgatgtcgt
   180001 tttcgcgggg acacaagtgg cgcggccgca tgatcttggc cgcagcatct cgcagcgcat
   180061 tccgatactc ggcgcaaggc gaactcgccg catgcgctct ggtcgctaca ctggtggggc
   180121 tcacaccccg acgagggccg ctcagcgcgc tggcgccggt gaccgaactg tgccgaccgc
   180181 tgggtatccg ggtggatcgc gggatcgtcg agtcggcgca ctcgcgagac gccctcgtcg
   180241 gcaggggctc agcccggcac caggccctgc tcgacgctgt gagcagcatc gtcgcctccg
   180301 aagacatcga cgaggttctc gacaagctcc gagacgcaac tttcgcgacg accaccgcgc
   180361 gccgagtcga gatctcgcgc catacaccgg tgagcgtcga tgcgatcaga gttccgaacg
   180421 cgtctccagc gtcgatgctc ggggattcgg gggcggccgg tgaggcccgc gaaatgaagt
   180481 tgacggagcg catcatcaag ccggtcgtcg ggaacgatgt caccgaaacc gcggtcgtcg
   180541 cggcctttcc cctcggtgag agcgagcacc acgggccgac catggaggtg ctggccgcgc
   180601 tggcgggcgc cgtcatcgag cgggagggcc ttcggcgagc gtccatggaa cggatagtgg
   180661 aagtgcagga ggccgagcgc gggagaatcg cacgtgatct gcacgacgag ttcggccacc
   180721 tcttcgcggg cgtgatggac ggactcagtg ctctacagaa ctccgaagac gccaccacac
   180781 gccagactgc gaccgatgtc cgcacgatcg tccgacaagg gatacaggtg gcccggactg
   180841 tcgcgtggtc attgcggccc tcggggctcg acgatctagg gctcaccggc tgcatcgagc
   180901 agtacgtgga agattgccgg cagatgtacc cgatccggat cgaactcacc gcaacgggac
   180961 agccgatatc cgttccgccg gcggtcacga ccgcagtctt tcgtatcgtg caggaagcac
   181021 tgaccaatat cggccgacac agtcgcgccg gggaggcgag tgtcatgatc gtgtcctcgg
   181081 cagacaccct gcgggccgtg gtcgaggaca acgggaccgg attcgacctc gacctggtcg
   181141 gacagcgcag gtcgctggga ttgatcggaa tgcgggaacg ggcccggctg gtaggcggac
   181201 ggatgtccgt cgagtcccga ccaggacaag gtacgacgat aatggtggag gtgccgatca
   181261 gacgatgatc agcgttgtgg tgtgtgacga ccatggcatt atccggtccg ggatccagag
   181321 gatcctcgag accacgacgg actttcacct ggtgacgtcc gcaccgaccg gagaacttct
   181381 cctgcaagca gtgcgagact tcgcgccgga actggtggtg ctcgacatcc gactgtccga
   181441 ctgcaacggc ctcgacctgt tggaacagat ttcagccatc tcgcccgaga cccgtgtcgt
   181501 gatgctcagc atgtacggcg ccagggggta cgtcgagaag gcgaagacgc ggggtgcgcg
   181561 agggtacatc acgaaggaat gcctcgacga ggagctcgtg tctgtcctct acgccgtgat
   181621 gaaggatgaa ggatttgtct cgtttcgagc cgacaccacc gaacccggcg gctccgaagg
   181681 cctgctcgag gccaatatcg actctctttc ttcaagggag ctcgaggtaa tgaagctgat
   181741 cgcctccggc ctcaccaaca ccgagatcgc ggaggaactg acggtctccc cgcgcaccgt
   181801 cgagagccac cgagccagca ttcaacgcaa gctgctgatc cgcacccgcg ccgaactggc
   181861 ccgagtagcc cgggacgcag gccttttgga ctagagcgtg tctgcttaat gttcgggaat
   181921 tgatgcgtga tgctgggtat gtgttgcgcg ccgacgagat ccccgatgac ctgtgggctg
   181981 tgatcgagcc cgtcctaccc gcactggcgg gccgaagggg gcgtccgtgg aacgaccacc
   182041 ggttgaccct ggaaggaatc gcctggcggt tccgaaccgg atcaccgtgg cgcgatctgc
   182101 ccgaatactt cggcccgtgg cagtcgatct gggaacggca tcgccgctgg tcggacgacg
   182161 gcacctacat tcggatgttc gccgcggtgc gggcggcagc ccccgaacga gaggaacagc
   182221 tcgaacgtct gctgtcgatc gactcgacga ttgtccgcgc acaccaacat tcggctggcg
   182281 ccctgaccga tgcgcacaca gggggctcgg tcgaatgaca agaatctggc caacgaaccc
   182341 gcagaccacg cactcggccg ctcccgcggc gggctgagca ccaagatcca cgccctcacc
   182401 gataccttct gctgcccgct gacgctgctg ctctcgccgg gacaggcagg cgacaacccc
   182461 tacctggcgc cgctgctcga cgcgcaccgc gcccacgaca ccgcagcgtt ccgcctgctg
   182521 gccgacaagg cgtactcgca cccgagcacc cgaaagaacc tgcgggaacg cagaatctcg
   182581 cacaccatcc ccgaacgctg cgaccagatc cgacgccgca agacgaaagg atcggacggg
   182641 ggtcgaccgc cggcgttcga caaggaccgc taccgcgaac gcaacgccgt cgagcgtggt
   182701 ttcgggcgtc tcaagcagtg gcgtggcatc gccactcgat acgacaagta cgccaccacc
   182761 ttccttggtg gcgtactctt cgctgcgctc gtcattcatc atcgtgtccg taaatagcag
   182821 acacgctcta gaaactagac tgtgccggac tgcctgcgtc aattcacgcc gcgcgtcgac
   182881 ccttcccaat acggcgctcg gagcttgaac ttctggatct tgcccgtcgc ggtatgtgga
   182941 atcgagtcac gaaactccac cgaagtcggc gccttgtagc ccgccaggtg ctgcttgcag
   183001 tgtgcgatga tctcggcctc ggagactgtg gagggacccg tggtgaccac cagcgccttg
   183061 acggtctcgc cccatttctc gtccggtacg ccgatcaccg cgacctgggt cacaccggga
   183121 tggctgaaga tgcattcctc cacctcaatc gacgacacat tctcgccacc ggtgacgatc
   183181 acatccttct ttcggtcgga aatcgtcagt tggccctcgc cgtcgatcat cccgccgtct
   183241 cccgtgtgga accaaccatc acgcagcgcc tcgtccgtcg cctcggggtt gttccagtat
   183301 ccgttcatca cgacgttcga acgcgccaga acttcacccg agttggagat atgaagccgt
   183361 gcaccgaggg cgggaagtcc ggcgcgggtc agtctgtgcg ctcgttcctc aagatcaaga
   183421 ccgtcatccg caggcagcga ccggttgaaa gtcagcagcg gcgatgtttc cgtgagcccg
   183481 tagatctgct gcagttccca ccccaactcg ctgctcaggc gcgcgatggt acggctgggc
   183541 ggaggagcgc cggcgcacac cacccgcacc cgatcgcgac caggaatctc tccatgccag
   183601 gaccgggcag catcgagcac cgcgttccac accgccggag ccccgcacat caacgtcaca
   183661 ccgtgttcct ccacccgccg gaggatttcg gtgccgtcga ccttgcgcaa cacgatctgc
   183721 ttcgcgccca gtcccgccat cccgaacggc atcccccaac cgttgcagtg gaacatcggc
   183781 aacgtgtgca tgtacacatc gcgttcccac gcacgggtgt gcatcgcgag tgtgacggca
   183841 ttgacccaaa gattacgatg agtcatctcg acacccttcg ggcgcgcggt ggtgccggag
   183901 gtgtagttga ttgttgccgt cgactcctcc gtgggcgacg cccagggggc cggctccgta
   183961 tcgaagcgca tcagatccgc gtctgtgtgc ttcccgagta cgaaccggtg ccgaaccttg
   184021 atacccgaca acgcctcttc cagctcggga tcgacaagaa gcactgacgc gccgcaatct
   184081 ccgacgatgt aatcgacctc cgccggagac agacggaaat tgatcggaac acaaatccgg
   184141 ccgctcgccg gcaccgcgta caagagctcg agcagtcggg ccgaattgtg gctgacgacg
   184201 gcgacccgtt cgccgaccct gatgcccaga cggtcgaatc ctgcttgcca ggcacacacg
   184261 cggtgggcga gttcccgaaa agtcacctgc ccgaccgact cgcccggttg ttccggctcg
   184321 tcgatcacgg ccacgctgtc agggaaaccg gccgctcccc gctccagaaa gtctgtaacc
   184381 gtaaatggga tgtgcatcgg tccacctcca cgacaacgtc aacgtcactg ccacaccgcg
   184441 tggccacacc acacggtatc gagcggcagc cgagttaact tccgtagttt tcccggatgt
   184501 tcgtgggcgg ccgtggatcg ttgaatggtg gaacacgatc tgtcgccgca ctgttgagca
   184561 cgcacacgaa gccgtgtcga acagtggatc gacaggaacc ggaggttgtg atggtgctgc
   184621 caaacctcgt tgcggcagaa gaggacacct acagccgcgt gctgtgcgat cagcacgacg
   184681 gagtgttgcg cgtgacgttg aatcggacca ctgcgctcaa tgccatcaat gcgaccatgg
   184741 ccaagcggct acagcagctg tggtcgctgg ttcgggacga cgcgagcatc cactcgatca
   184801 tcgtgtccgc ggctggtgtc gaagcattct gcatggggtt cgacgcagaa gacccgcccc
   184861 agccactttc ctgcggcggc aacgccctgg gatgggaagc ttttgccatc agcccgaagg
   184921 aatgcggcgt cgacaaacac ctgatcgtga ccgtgaacgg catcgcctgt cgagaatcat
   184981 tccgattctt gcgtgatgcc gatgtcgtcg tcgcgtccag caacgcctcc ttcttcgagc
   185041 cgcctcgttt cacccctgca gatgatgtga gcaacaggga gggtggattg ccagcaggac
   185101 ttcgcacgat ctgcgccaca aacccgaccg tgcacaaccc tgtgacggca ttacaagcgc
   185161 accatgcggg cctggttcac gaagtggtcc cgctggcgtc gctgcgaggt accgccgaac
   185221 gccttgccca cagggcatga ccgtcgactc ctgacccctt acttccccaa tgactgcaat
   185281 cttctacgga agacaccgcg catgactgtc acgacgatag ggagttccag ccacacgatc
   185341 gacgtagacg gcatcacgac gcactatcac aaggcaggac ccggcgatcc cgtgttgctg
   185401 ttgcacggac cctggaccgg gggtgtcagc ttgggcgaac tggcagcaca cgatcctgcc
   185461 actcgccgcc aaccatcacg ttttggcccc tgatgttgtc gggtcggcgg cccgtagctg
   185521 acggacaaga accgggtgtc agcgacacct ggcgaccgac gatcccgcat atccgcgcgc
   185581 tatcacgttc tgtccgtgca gtttgcaatc aatccggcct accgccggaa cgtactgaga
   185641 ggtccacgtc atgctcgacc gaatcttcac aaccctcctc actctggctg gcgtcgcggc
   185701 cgacggcagg tacatctcgc tcgtcgacaa cgacatcgcc ggtaccgcag acctggacga
   185761 gacgcccact ggtcggttgg cgcaggccgg accgcagagc acgttatcgg acagatagcg
   185821 ccaggcctgt ttcacggcgc tccgatcgtg aaatatgctg tacaccacac tatttagggc
   185881 ccaacacgcg gtgatgaact gcgcattcgt tatgaccgga gtgctgattg tcgtcggagc
   185941 gatcgggcgt gagagagttt gttcccatcg ccgactacgc atttcctggg gggacggctt
   186001 gactgtctcc gagatctggg aatcccggga cgtccacgac aacccttcga cgaggtgatc
   186061 cgaccgaagc tacctcatca gatccctccg cccgccgtct tcgagttgat caacacgatc
   186121 acccggtagg gcgcggagcg cccgacccac ccacgaactt tggagaagtc gatgtccata
   186181 gctctgacgc acgctgccga ggtccagcag tccggcgtga acggccgcat ctcgctcgaa
   186241 cgcaaccaca aacgaatccg ggtgttcttc gcaggtcacg tgatcgcgga caccacccgc
   186301 gcggtgtacc tgttcgagaa ggggcacctg ccggtctact acatcccccg cgacgacgtg
   186361 cgcaccgact ccctcgagcc cctcgacgcc accacgtggt gcccgtggaa aggcaaggcc
   186421 aggtactggg atctcgtcgt cgacgatcgg cgggccgagc ggtcgctgtg gggttacgac
   186481 gaaccgctga aggactccct cgatctcagc tggtatgtcg ctttctactg gcacaagatg
   186541 gacgcctggt acgaggagga tcagcaggtg ttcgtgcacc cgcgcgaccc ttacttccgc
   186601 gtcgacgtcc tgccgtcctc ccggcacgtg gaggtcttta tcggcgacac cctcgtcgcc
   186661 gacaccaccc atccacgctt gctgttcgag acctcactac cagttcgcta ctacatccct
   186721 cgcatcgacg tccgctccga gttcttcacc ggctccgacg ccaagacctc ctgcccgtac
   186781 aagggcacgg cctcgtacct gtcgttcacc ggatcggacg acagcgaccc cgtcgaggac
   186841 gccgcctggt actacccgtt cacgaccgcg gaggcttcgg gcatcggcga ccacgtgtcg
   186901 ttctaccccg acggcgccag gatcgtcgtc gacggcgccc cggtggaggg ctgtccgacg
   186961 cctctgtgaa cttcgtacct tgaccggtgt cgctgcggcc ggttcatggt cgtttgctct
   187021 ggtttcggtc gggtggtgcg ggtttcgcga tgtagtcctg gcccggcatg atcccggagt
   187081 tgccccgggc gtcgtagaag ttgaggtggc ggtccccagc tcgagacctg ccatgtcgta
   187141 agtgtcgggc gttcctccaa gaactccgac agcaggggac cgccgtgaag aagaatagcc
   187201 agaaccagac cgtgcccgcg atcccggagc gggtgagcgt ggcgatggcc aagatcgccg
   187261 aaacatgcac gagggccgcc gtcggcggcc tgcaggcgat gcaggcgatg atggacgccg
   187321 aggtgaccgc cccggccggg ccgagaggcc gtcgcgaccg gcagcgcatc gcgggtgcgc
   187381 catggccgcg aacgcggctc ggtgaccctc agcgggcgtc ggatgcccgt gacccggccg
   187441 cgggtgcggg ccgccgacag cgccggggaa cggcccaccc cgtcgtacga gctggtcacc
   187501 tccaccgaga tcctggggaa gatggcgatg gaggagatgc tcgccgggct ctcgacccgc
   187561 cgctacacag ccggtctcga accggtcgga cggcgagccg ccgagacatt ctcggcgaca
   187621 agcaagtccg ccgtctcacg caggttcgtg aagttgaccg aagccgccct gactgagctg
   187681 ctcgccgcgg acctgtccgg gctggatctg gtagcgttga tgatcgacgg ggtccactac
   187741 gccgagtcgt gctgcatcgt cgccctgggc atcgatatcg acggggacaa gcacccgttg
   187801 gcgctggtgg agagctcgac ggagaacgcg acgctggttg cgtaaggcgg tggtcgacgt
   187861 cctcgatcac ccggtgatcc aacattgtca gctacacaag atacgagacg tgaaaaatca
   187921 tctgccgcga cgacttcgga gcagtgtcgg gcggaatatg gcggacacca accatgccga
   187981 ttcggcgctc gaggccgagg ccgcgctgcc cgccctggcg aaggaactcg accgtaccca
   188041 tctcgcggcg gccgcgagcc tgcgcgaggg acgcgacggg acactcacgg tgctgcgatt
   188101 gggtgtgccg cccactctcg cccgtacgct gcgctcgacc aacgcgaccg tcatgtatcg
   188161 gagtcacgaa ggtcaagtag aacttttctc gactcaccgt tctcgactgc ttcgtgagct
   188221 aaagcgattt catctagcgg gaacgtgaga tgaggcagtg gggttagtgc ctgctcggca
   188281 agtgcgtcgg tgatgctctg cgcggcgagg gagagggctg aacgactatg tgtataaaga
   188341 aggaagaaac ggagcccgag acctgcagcc atgcactcgc ggatagggat cgagagttcg
   188401 cgaccgtcgg tggcataggt ggcgatgctt gcaccaggtg ccgcgacagc taggtcgatg
   188461 ttccagttgt ccacgatggc gacttctaca aagatgtcca cgccgttggt gaaggctgtg
   188521 atctggtcgg caacgtcgtc gtcgcggtaa tttacgacga agtctgcgcc tgcctgtcgt
   188581 gcgagtttag ctttgtcggg cgtgctcact gtagcgatga cagtggcacc cgcccatcgc
   188641 gcgagttcga tcgcgaagtg gcctacagcg ccggcgccac ctgcaatcaa gactttcttg
   188701 tgcgtcaccg gtcctgcatg cagtaggcac tcgtgggcgg tcatggccgg aattcccaga
   188761 cacgcaccca gttcgtcgga agctgagtcg ggcaacgcca cggcttgatt cgcgggaacg
   188821 agggtatatt cggcggccgt accccatctg ctgcccagcg ccgcaagcca aagccataca
   188881 cgttggccga tacggccttc atggactcct ggtcccactg caactatccg accgcacccg
   188941 tccatatgag gaatttggaa gtcgtctatc gggcgcggag tcttgccgct gcgggtcttt
   189001 acatcagagg gattcactgc ggaaaaggag actcgaacga gaacctgccc gggacccggt
   189061 tcaggcttct cgcattggat gatggagaga acatcggaag cctctccgga cttgtggtac
   189121 gtcgctgcgc gcatctgcat ttcttaactg ccgttcgatc gggtagggat agagccccgt
   189181 gaagtggtgt aaatcgttgt gcgccgggaa ctgtgatgtt ggggagtatg ccgtaagtgt
   189241 ggttgtttcg tccagcacca tcgcctgggc gggtgcgtca gccgcgatga ctgtcggcgc
   189301 aggcgggcgg agcccggcag tggattcctc ggacaggtag cggcgttggg atacctgtca
   189361 ctcgtcgtgc gcctcgatca acacacacct cgccagacgc agcagcgctg cagggttggg
   189421 gaagataccg acgacgtcgg ttcgacgttt gacctcttta ttcaggcgct cgatgatttg
   189481 gtcgaccata tcttgcgcca gtgtgcctcc gggaggtccg cgaacgccgt ggtctcctcc
   189541 tttgcattcg tttaacatcg ctgccaccgt ggggaattga gattccaaca tcactgcgac
   189601 ggtagcgaca cgatcacgca ccagcggccc ccgtcggctg gctgaaaatg acgcgtacag
   189661 cggccgcgac catctcggat tgacactgtc accgattcgc ggaacccgat ttacaccacc
   189721 ccatgggact cacccttgga gtactcggtg gactgacttc gatgcgtggg tattccgtag
   189781 tttttacgga tgtccgggat tgggaccaag cccacactgg tcaaaacagc gccacggcaa
   189841 gctcggtcgg agggaaagtt atgagcacgg aagtgccccc agaggataat tcaatcgtcg
   189901 cgaacggtat caggacgaac tacctcgagg ctggtagcgg tcctcctgtc gtgctgatcc
   189961 acgggtcggg tccgggggtc actgcctatg cgaactggcg gctcacgatc ccggcactcg
   190021 cggaacggtt ccgcgtgctt gcccccgata tggtcgggtt cggtgggacc gaacggcccc
   190081 ctggcgtggt gtatgacctc aagacctggg cagaccaggt ggtgggtttc cttgacgcgc
   190141 acggcattga gcgggcgtcc ctggttggca acagcttcgg cggggcaatc gcgctgcggg
   190201 tcgccacgca gcacccggag cgtgtcgggc ggctggcgct catgggcagt gcgggtgttt
   190261 ccttcccgct caccgatggc ctcgatgcgg catggggtta ccagccatcg attgagaaca
   190321 tgcgtcgact gctcgacatc ttcgcgtact cgcgcgagct cgtgaccgac gagctggccg
   190381 aagtgcggta ccgcgcgagc atcgaaccgg gcattcagga ggcattttcc acgatgtttc
   190441 ccgaaccgcg gcagaacggc gtggatgcac tggtcactcc cgaggaggac ctggcacgcc
   190501 tgcctcatga aacgctcgtc attcacggcc gcgaggaccg cgtcgtacca ctgtcgagct
   190561 ccattcgact catggaagtc atccccaagg cccagctaca cgtcttcggc cgctctggac
   190621 actggacaca gatcgaatgg gccgagaagt tcaaccagct actcaacgac ttcctcgcca
   190681 actagcccaa tatcgcatgc cttgggttgc gtgttcccgt tcattcccgg cccccgggga
   190741 gtgcgtgggc tagtactgca acggcactta tggcaggtga ccgcgggttc gatagtggga
   190801 ggtgcgggcc tggtgttgtc ggcgtctccg ccagtgtgac caggaccagg tgtgctcgtc
   190861 ggggtgggcg tgtcgcagga tcagatacac gagtaggcgg cggatctcgg gtaccgtgta
   190921 gccgatcatg tcctgatcat cggttccgat tcccctttta tggcttcggt tttcgtgcct
   190981 gcgagccagg cgagggcgag catcgacagg gtgatgtggg cgtaccaggc ccggtaggtg
   191041 cgtacctaga ctggtcgagg ccggcctcgt tcttggcctg ttggaagcat tcctcgaccc
   191101 gccaccgcga gccggcgacg gtggcgagtt cggtgagcgt ggtgcggcgg ggtccggcgc
   191161 agatgtagta cgcgatctcg gtcggatccg acagtgatcg gcgggcgagc aaccagtgcc
   191221 cgcgcccggg tgcccaggcg atccggatcg ggatccggac ccaggagtac tcgcgtcggc
   191281 cgtgggcgcc gtcgccggcg gagatgcggc gccactgttt cggcgggatc gcggcgatca
   191341 tctcgtcggc gcggccggcg cggccatccg gggtgaacac gtcgccgccc aggcgggtgg
   191401 ccagcacgta ggaaatgtcg cgttcctcga gccagacccg caggtacttc acctgcccgt
   191461 aggcttcgtc ggcggtggcc caggagaatg ggacctgtgc gtcgagggcg cgttcgatca
   191521 tgtgctgcgc cagaacgggt ttggtcgcga acttcacctc gtcgccgatc ccggcggcgc
   191581 ggcaccggtc ccggtcggag gtccaggact cggggaggta gagctcccgg tcgatgagcg
   191641 cgtgcccggc gccggacgcg taggcgagga acaccccgat ctgacaattc tccacgcgcc
   191701 cgatcctcgc gatgagcgga ggcgaactgg cggcgcgcgt atacgagcta gctgctgccc
   191761 cagaccctcg caacgaatca acccccgccg tcattgcaag acatgccgac gctctggaaa
   191821 cgtatctgcg actgaccctc tccgagtatg gatccaagaa tcgcctattc atcctcttcg
   191881 aggacatcaa gcaaccacaa ccgcggcgct acgcacaggc gatggttcgt gcaatcgcca
   191941 ccgcgttcga ccactgggaa ctcgacgaca acctcgtcga atccatccag gtgctaaccg
   192001 gggcacgcgc accccgtccc ggtgcagtcc acgacgacca cactacccag actgcgcacc
   192061 aacagaccat cgatatcgca ctcgatgcag cgtgggccac agccaccatc gaactcgccc
   192121 gagttttacg cgcatcgtcg gcccgcgaca ccctcatgca catcggccgg gccagaaccg
   192181 ctctggcgcc aatcacgggt aacgaggatg cgatcgatgc catcgttctc gactcgacgc
   192241 tgaagatcct cagtgacttc cttactggtg ttaccgagtc cagcaccggc gagtggccga
   192301 tcgaaccttc tgcggtcgct gaactggaac atctcgtgac gcgctaccga atcggtgcac
   192361 acgggctcca ccactgggtg ggagaccgca aacaaagtgt cctcaccggg tgggggcgcc
   192421 tcgcccaaga tctgctgttc ctgcgaaccc accttgaacg cgcaagcatc taccgcgcag
   192481 ccgtcgtgct cgacgacatc ctcgacatct acaccgcctc tcgggcggtc gaagtcgtcg
   192541 cccgcgaatc cgatctcgac ggtgtgcgga gaatgcttca gccgccgatc gtcggcagct
   192601 tcgctgcccg cgctggatta ctccgcaatc tcgaagacca cgtcgatgaa ctgcaaaagt
   192661 gcgtcgacaa cccgcaatcg aatagccacg ggcgggcggg ggaggttctt cctgtcgcgc
   192721 ggattgtctt agaagcggcc cgcgaccagg tcgcgaagca tgagccgccg ggaaaaactg
   192781 ttggggcgtc ggcgccgctt ccgcccccgc tcgctgacct gttcggcggc ggaaacgtgc
   192841 ccaacgctat cgccgaactc gatcccgaaa tcctaaagac ccttgcgatc ggaatcaccg
   192901 acgcgcgaga ctcccggggc cccttccaac atgtagccat ctccgcggta tgcgagagga
   192961 tcaaagacaa cctcagcgct agcccggact acaagggcga tatcaaggac aaggtcgact
   193021 acgtcctcga actcctcgtc cgatttctac actcgcgcat caacatcgag aaaaagtaca
   193081 aaccctacct ttacaagcca aacgcgagtg aaaacgactt acacctggac ctgttcgact
   193141 atctcgtggg tagtggtctg gccggattcg cccaaatcga actaacgaat gttgccggcg
   193201 gtcgagccga tattcaagtc ggcttcggcg ccttccacat ctacctagaa ctaaaggcag
   193261 acgcgaccaa agcacgacag gccgccaaga ccgcctacat acagcaaaca gtctcctatc
   193321 aaggcggcga cattcgtata ggattcctca taatcctccg cctcggtgac ggcaagggcg
   193381 cacctccaca cctcagcgac ctggtcacac acaccaccac gacaatcgct ggaagcgccc
   193441 accctcgcca cgttgtcatc gtggaactgc ccggaaaccg cacggttccc tcaaacatga
   193501 aatagagcga cgacatccga ataactttcg ggctcaacgc cgcgcggcac ggccgcgcgt
   193561 tcggagctcg gccacgccga ggtcgtttac catccccgcg gaatcggtgt ggcaggccac
   193621 ctcgacggtg ctggcggtcc tggggaccta cccgtggcgg ttgcggtcgc tgcgggtgct
   193681 taccaccgcc gatttcgacc gcctcaccga cgccttggac ctcccgccgc tcggggagat
   193741 cttgaccgcc gacgagatcg cgcggttcgt ggttcgggtc gcgtacccca cgtgtccggt
   193801 ggtgctggtg gacgaggagc tggccctgat cgccccggcg cgggcctacg gtgattggct
   193861 cggcgcgctg ggcctgccgg atctggcggg gaaggcccgc acgcgcctgc cccgaaacga
   193921 ccggattcgg cgcgcgcacc ggccgcggcg acaggagacc gccccagtac ggttccccgc
   193981 cgcctgcccc gctgtcccca gggatgctca gctacgcctc ttctgtgggg gaggaatcgt
   194041 ctcgggcgtc ctcgacgcgg gttgattcga tcgacaactg tgcgcggctg agttgagcga
   194101 acgcatcggt gcggtcgtcg gtgaagagtg aattgattat ttcggggctg agcgagaccc
   194161 catcctcgat gagttgcttg gtgacgtggg cgcgtatcag cttccgagtc tggatttggt
   194221 cttcgtagtc atcgtttgaa aggcgctttc ggcgccggtc ttgtttccaa tcgcggatca
   194281 gtacaaggat ccggtagaga atttcgccag cgggtcgtat gcctgcagcg ctgatggcgg
   194341 tgagtactgc gtcgaggggg ttggcataag tgaggctggt gacgtatatc tccccgtcgg
   194401 aggcccagcc tcgttcgttg atgattcgac ttatctctgc ctcgacggca ttcctggcaa
   194461 gatcctgtaa cggacctagg cttaggaagt aaacctctct ttcgatgtcg gcgagattct
   194521 tccatccgct gggagggttg aacctcttgt cgaccatcag tcgataccac aaatcttctg
   194581 agttgaacct atagagcatg tttgcgcgcg tgatctgttt ctccaggtca gtgctcagcg
   194641 cgcaaatggt gttgagatcg gatagggccg cgctgaggat ctggatggga gcattcggtc
   194701 ccaggtttat cgacacagcg attcgtgtgg acatctgacg aacgtacttc ggtcaggtgt
   194761 caggtgggcc ctggatggca ccgatacctg ggtgatcgat ctcgccgttg acggagacgg
   194821 gctggtctgg agcttaaatc atgcccgcaa cgtcgaggtg ggagggcgag aaccatgcct
   194881 gcccccgacc cccgggtgct ggctgtttcg ggtggtccgg gcggcgggtt cgcagtcctc
   194941 gagcggtcca tgccgtcgaa gaagccagtg gtggtgcact cgccttcagg ccatcctttg
   195001 cgcgcatcga tcaccgcgca ttcctatcac tgaactgggc agatgaaacg tccctgtgac
   195061 gtccgaaggg ccacgcccac aacgcgatac tgtccacaca acgtccgccg acgagatcgc
   195121 ccggttcgtg gcgcgggtcg cgtatcccac cagtccggtg gtgctggtgg acgaggaatt
   195181 cgccctggcc gccctggcgc gggcctacgg tgattggctc gatgcgctcg gcctgccgga
   195241 cctggcggag aaggcccgca cgcttctgcc ggagaccgcc ggcggccgcg ccgcggccgg
   195301 acaccgcccc tgattccggg cccggcgcgt agcgcccacc tcggttcggt tcccggtcgc
   195361 cggcacctgg ggggtgaggg ggtgcggggt atgacattgc ggctgccgac caccctcgcc
   195421 accgactcgg acgccgcggc gatcgaggca ctgacgaagt attacgaccg cccgtacctg
   195481 ggcgacgacg cctacgtcgg cgcgcacttc gactcctggt ccagcaccgg taatcgggcc
   195541 ggggaggcgg accggttcac cgcggacgac ctggtcgcgg tgacgttcct gtccgtgcag
   195601 gtccccccga aagcggcgcg gacgatcctc gacacccagt ccgaggcgct gaacgccttt
   195661 ctgacggcga taggcccgga ccgggacctg gttcgacgaa ccggaaccgc tgaccccggg
   195721 atggcccgcc tgggacctgg aaacggccct gtgggcgctg ccggggattg gacgaaggaa
   195781 ggcgacgaag ttgatcgccc gcaaacgtcc ccggctgtat ccgatctggg actcacggag
   195841 aagtccgcca gctcgcgggt ctcctcacct tggaatgggc ggatcgggat ccgccccttg
   195901 atgcattgat cgacctgtgc aaggcattgg tgccggtgcc gccgctgacg gggaaggtca
   195961 agggcggcac cggttcccta ggaggcgtgt ccgaacgact cgggtggggt caggccccag
   196021 gggctgaacg ccttcgggaa gttgtcccac attccgggcg caccggggcg cacccggggc
   196081 atttccgcgg acagttcgta acggttaccc gcgacccaga aatatgtgta gaggttggcg
   196141 cccacaccgt gacggccggg tccggtctcg atcggcacac cgtgccgtgc gagttcgtca
   196201 gcggccacct tgaggtggtc gaaggactcc attcccaggg catagtggtg cagcgacttt
   196261 ccgggctcgg gtgtggagat gattgccacg tcgtggtgca ggtcgctggc gcggagccag
   196321 gcagcaccca tcacgccggg tgcgggagcg aagatgtcgg agatctggaa gtccaggatg
   196381 tcgaccatga actcgaccag tggtttcggg tcctgcgcct ggagtgtgat gtggtcgaag
   196441 tccagtgccc ggatcccgcc gcgatgggcg gctcgcgccg gatgaatgta ctgcggcccc
   196501 tcggcgtcgg tgagcagtga cagctccatc acgtggccgg tcggcgtccg gaactgcaag
   196561 gactggctca cgccgggatc ctcgtcgctg cgggtgctgt gttcgacgcc ggcgttggcg
   196621 aggcgtttgc cgtagtgctc gaggtcgtcg tgcgagtcca ccctgagggc gaaccggcga
   196681 acgccggtgc cacccgaggt cagtaccagg tcgcaccttt cgtcgacgcc cgcggtgagc
   196741 cggacggaac cgtcggaccg gccgagttcc ttcatgccga gcacgtcgac gtgaaggccg
   196801 accgcttctt cgaggtcgcc tacggcgagt tcggcgtggg acacctgtga gattcccatg
   196861 attggatcaa ctcctgtcaa tgttgtcgtg gtaggcgata tttccggcgc tctcccgccg
   196921 attgatgccg aggctgtcga gcatccgcga gttctctacg aggatcattc ggacgttcgt
   196981 cgtgccgtcg ttgtagtgcc ggtgccagac ccatggcggg gtgtagacga agtcccctgc
   197041 cgtccagcgc agggtcttcc cgccgatctc ggagtagccg ctgccgtcaa cgacgcagtg
   197101 cacggattcg tgcaagtgcc gctgaaggtc ggtcgccgtt ccggccggaa tctcctggag
   197161 gtagaactcc atggacttcg ccggcacgtc cgcgagtacc ccgacccggc tggggttgcc
   197221 ggtgatctcc tcctcgagcc agcgcgcgct gtccgggccg gtgaccaggc cgtccggcag
   197281 cgaacgctcc gggtcgaaat ccttcatgtc gtgcagcttt tccatccaca cgtcgaaatt
   197341 cgtcattctt tccgccttag atcgaggtca ttccgccatc gacgacgtgc gtcgacccgg
   197401 tctggaagct ggcgcgctcc gagcagagat aggccacgag ctcaccgatc tcctccggcc
   197461 gcccccagcg gccgacgggg agctcggcgg cgagctgccg ccgctccgtt tcctccactg
   197521 aggtacccgc cgacgtggcg gccgccgcca ccaatgccct ccgccgcgtg gtatcgacgt
   197581 gcgccggggc gatgacgtgg gtagtgatcc cgttcggcgc aacctcaccc gcgagggacc
   197641 gagccagcgc cgccacgccg gcacgcatca cgttggacgt gtgcaggcgg ggcagtggcc
   197701 gcaccacacc aaccgaggtg aggtagatca gccgacccca ctccgaggcc aacatgcccg
   197761 gcaggaccgc gttggtcagc gagatggcac tgtcgaggat caaccggtag gccgactccc
   197821 agtccgcttg tgcgagttcg gtggccggag cggcccgcga gccgccggtg ttggagacga
   197881 ggatgtccac accgccgaga gtgtcgaggg cagaccggac cgcgccggtg gcggcgccgg
   197941 gcatggtgaa gtccgcgatc gcccagcccg ccgccccgag gtcccgggcg acgtcggccg
   198001 tgtgcggtcg ggttccggtg atgaagactt ccgcgccgcc cgcccgcagc gatgccgcga
   198061 cggcggcacc gatcccgctc gacccggcgg tcaccagcgc ccgcttgccc gtgacggtca
   198121 tgccgcggcg cccccctcgg tgcggtccgg ctctgcggag ccggcggtcc gtgcgtgttc
   198181 ggccgaggtg gccagcaacc cgtcgatcag tcccagcggt tccgtccagt cgtactggtt
   198241 gaactgggtg ttgatgcgca ggaacatcgg atcgccggcg tagaagcgtt catagagttc
   198301 atggcgtccg ccgaaggcgg agaccgccag atccgctgcc accttgaaga cggaaatgcg
   198361 gtcgacgctg ctgttgtcgg ggccgcggta gaacttggcc aggtccgacg cgatggggga
   198421 gtcgaacgca ctgacgtcgg ccggctggta gagcagtccg ccggcgagga tctgctggag
   198481 gatctcgcgc acccgtggat accagcggtt tccggagttg cggatggcgt acagcggccg
   198541 gaggtcgggg aagaggacac cgtcctggtt gggcgtggcg ccggcctcgg acgcgaggat
   198601 cgcggccctt gtcagttcga tgtaggtgct gatctccccg agggcgtccc ggacctgcgg
   198661 gaactgatct gtcttgacca cctcggtggc ccgcttcgcc agcccggcga cgaactgcag
   198721 cttcgccatc aggcggaccg aggtctgggc tccggtgaaa gcgttggagt tgatctccca
   198781 gatccggttg acccgctcgt agtcctggtt gatgaagacc cggtcccagg gcacgagcac
   198841 gtcgtcgaag acgaccaccg cgtccatctc gtcgaaccgg ctcgacagcg gctggtcgaa
   198901 cgcattgccg ccgccgaacg gctcccggca gatcagccgc acgccgggtg cgtcggtcgg
   198961 gatggcgaag gcgatggcgt agggcttctc ctccggggcg aacttgcgca gcgagaacgg
   199021 ccagacgagg atctcgtcgg agtagggtgc ggccgtcgcc agcatcttcg cgccgctgac
   199081 gatcaggccc tccgcggtct gctccttgac cccgagatag gtgtaggggt cgggctgctg
   199141 tgacgcgggc ttggaccggt ccacgggcgg gtccgcgatc gcgtgggaca ggaacaggtc
   199201 gttgtcccgc acgtgccgga agtagtcgcg taccttgtcg gcgttgtcgc cgaagaagtc
   199261 ggcattggcg ttccaggcca ccagcatggc gctcacgaaa tccgtggtgc gacccatcat
   199321 gcccagggtg gaatccgccc acttcttgtg catggcgtgt cgttgctcca ggtcctcgcg
   199381 ggagcgcggc tcgaggaact gcactccgac cgggccgtcg ccgtcggcgg gttcgaagag
   199441 catgtcctcg ttgccgtcct cgaactggag gtcgtacagg cgggcgatct cggcggcggc
   199501 accggccgtg gccgggtgcc cgacgacatc gacgatcttc tccgatccca cccacaactc
   199561 gggactgtgc gtgcgcaacc tctcgaggta cgctgcgccg tttcgtgcgg tcatgacttt
   199621 cctttcaaga atcgaatgtg tgcctcgttg aactcgtccg gtttctccca ctgcggccaa
   199681 tgcccggccc cctcgatgac ttccaggcga cttcccgaga tgagtgtttc gagcagggag
   199741 gcctcttcga cggcggcggt cgggtcgtgg tcggtccaca gcaacaaggt cggggcgagg
   199801 atgcggtcac accatgtcgg tgaccacacg aaggggcgcc ggtactccca gtcctgcacc
   199861 gcaaggatgt tggccatcgc cgtctcgaag ccggactggg aatagatccg cagccgcagg
   199921 cccacgagtt cgtcggtgac cagggacgtg tcgtggaaga gccactcgac cctggctcgc
   199981 acggtctgcg ggctggcctc acgaaccgcc ttcatgctcg attccttcag gccggccatc
   200041 acctcgggct tgttggtgat gttcccgggt gtgttgagga ccatcccgcg gacgcgagtg
   200101 gggtggtgcg cggccgtcca ggccgcgacc cagccgccga gggactcgcc cgagaggtcg
   200161 gcccggtcga tggacagcgc gtccatcaac gccacgagat gatcgctgag atagtcgatg
   200221 gtgtacggcc ggtcgggctt gtccgagtaa ccgtgcccgg gcatgtcgta caggaccaga
   200281 tggaaatcct tggccagatc ccgcacgttg cgcgcgtacg cctccaggtg cccgcccgtc
   200341 ccgtgcacca ggatcaggct cggtccgctc ccggcctcca cgacccgcgt cgcgactccg
   200401 tcgacatcga ccgttcgttg aaccaggtcg acacccgcga ggtctcccca gatgctcaca
   200461 tgctcttcca cggcaatcct tcctgttgca accaggcccg gctggttcgg ctcggcggca
   200521 gtcatgccgc cccgatacat ttcgccggcc ggatgcctat ccccggtacc tgactgatat
   200581 ccgaccagtg actgcgatca cacgtaacat gctggcatac taagatctca atgacaagat
   200641 gctgtttttc cgccgcggtg tcgcgtgggg ccgccaggcg gatgcggtga ccgacacagc
   200701 gatgccccac acatgcttgc gccggtgcag acagcggagc ggctccgcgc cctgcccggg
   200761 ctcggtgtcc gcgggcggat gcggcgcacg gggtaagccg tgcttccccg gcccgcacag
   200821 cggagtgtgc gcgctactcg cgttctgctc tcggaacgat ctcggcggtc gcctcagaga
   200881 tcatcgccgt cgacctcccc gtgttcgccc tgacgggcac gcgccattcg gccggattca
   200941 actcacgggg cggggacgcc gctcgggtcg gtctttctcc ggcactccgg agcctgatgg
   201001 cgcttcgccg cccggctacg gctgggccgc gggcttacac cctgtcgagg gtgacccgct
   201061 gcctcgcctg ccgtggacgt gaccggcgag tggctagatg tgaacgccca tccagaatcg
   201121 cgagagatgc ccttccatga gctctcgcgc aagccctggt tcccggcgcg agatcgcccc
   201181 tgcaatgtcg gagtgttcac tctgagatct gcgcaggtcc gtgctgactc ggttcttctg
   201241 gatgtaaaaa tcgctcagat cccaggcgtg tttggcgagc tcggtcagtc gctggttgcc
   201301 gctggctgcc agcacggcgg agtggaagtc gcggttcgcg gccgcgaagg ccgccgcatc
   201361 gtccgcctcg gctgggccgg cgcagcggcc aagtgcagca tcgatgtcgg ccagttgcac
   201421 ctcggtggcg ttgagggctg ccagcttggc gcccgcacct tcgaggattc cggccagggc
   201481 gaaatgctca cggaccctct cttcgtcggg gatgatcacc cggcacccca cctgggggat
   201541 gatggaaatg aatccctcgg acgccagccg catcgcagcg tccatgaccg gccggcggct
   201601 cacgccgaac tcctgagcga gttcgtaggt gctcaggacc tccccgaact ggtaatgccc
   201661 ttgcatcagc cgggtgcgga gggcgtcgta gatctggtcc gtcttgctcc ccgacgcggt
   201721 catggtcatg gtcatggaac atccagcctc tcgacgatca ctgcacggga ccaaaccgat
   201781 gagggttgac cctgtcagat tctagtattt caataccata tctcgctcga gaatacggct
   201841 cacacgatcg tactcgaggc gctcgatgat gcggtccaac cgaacgcggc gacggaacag
   201901 atggcgccca gaggatccat caaacgccct ctgggctagg tgaatgcggc cgaccgtggg
   201961 gctgccttac cggcggtcga cgacgacgta gatcgccggt ggaccggaac agcttccggt
   202021 cgcctttgac ggagaggctt gtcaggtcga tcacacaccc ctaagctgac atactaagat
   202081 ctcagttcga gaggtggagc aatgagcaca tcgacgtcga ctactactac tactactact
   202141 actactaccg gcccggatgc ggcgccccct gtggaacccc ggcgtttccg taatgtcatg
   202201 gggcgcttca ccaccggagt gacgatcatc ggtaccaaac acgccgatgg catccacgcc
   202261 atgaccgcca acggattcat gtcggtgtct ttggacccgg ctctggcgat ggtgtccatt
   202321 gctaccaagg cgaagatgca cgagatgctg ctcgccagcg gccgctacgg ggtgagcttt
   202381 ctcggtgccg accaggaaac cgttagccgg cacttcagcg ggcgccccga cctccttccg
   202441 gatttcagct tcgacgagat cgccggtgcc cccctggtac ggggcgccct ggctcgcatc
   202501 agtgtcgagg tggtcgacgc ccaccgcgcc ggggaccaca ccctcttcat cgggaaggtc
   202561 caccatttgg acgacgcccc gggcgaccca ctcgttttct actccggcgg ctaccgacac
   202621 ctactgcgcg cagcgcacga caccgaatac tccgacgcct ggtccggctt ctgcctcgaa
   202681 ccgaccggcc cgctcaccct tgccggctga gtgctggccc gccgctgagg cgaagaccat
   202741 attgttcacc gaagggaacc gataatgacg ctcgcgctgg tctgcacgtc acacagtccg
   202801 ctgctggagt tcaacaaccc cccgcccgag gtccgcacag aggtggacag ggccttcgcg
   202861 caggcccggc agttcatcga agactacgac cccgacctcg tcgtttcctt cgcccccgat
   202921 cactacaacg ggttcttcta caagctcatg ccgtcatttt gcatcggctt cgaggcctcg
   202981 ggcgtggggg acttcggcag ctccgccggc cggctcgacg tgccctcggc gcttgccgag
   203041 cagatggcgc agtcggtgct ggaccagggc gtggacattg cagtctccct cgagatggaa
   203101 gtcgaccacg gtgcggtcca gcccttggaa atcctgctcg ggggcatcgc gacgaagccg
   203161 gtgatcccga tcttcgtcaa ttccgtggcg gcaccgttcg cgccgatgaa gcgaatccgc
   203221 ctgctcggcg aggccgtggg cacattcctg aagaatttcg acgggaacgt tctgctcctc
   203281 gggtccggtg gtctgtccca cgacccgccg gtaccgcggc tcgaggcagc gaccggggaa
   203341 caacggaaga tgttgctggg tggccgccac cccaccgccg cggcgcgagc ggtccgccag
   203401 cagcgggtta tcgacaccgc caaggccttc accaggggtg aggccggcat catggacctc
   203461 gccccggagt gggaccggca acttcttgac atcctggcct ccggggagct ggaacggctc
   203521 gatgcgtgga ccgccaagga gatggccgcc acggcaggca actccgccca cgaagtgcgc
   203581 acctgggtcg cggcccacaa cgccctgaaa gcggccgccg gccagtacac ggtgacctcc
   203641 gagtactacc ggcccattcc cgagtacatc gccgggttcg ccgtgaccac ggccgtaccc
   203701 gttcacacga ccgccggcct cacgtaaaca gcggtcgctg ccggaacggt gcgcgcatga
   203761 atgacgccga cacgccggaa caccatcgac caggcgcagc cggccgacct cggcgctctc
   203821 gccgcgatct cctcgctgcc gcaagcaggc gtatcccgat ctccccgctc tccgaacgct
   203881 gtccgggctg accatcgacg gggcctacct ggatccagac cagcgtgcgc gctcacctgc
   203941 tcggctcggg cagaatgctg tgtgggcaca aagtgggggt gacctcgcag gtgatgcagc
   204001 gtcagctcgg ggtcgaccag ccggacttcg gattcctgct cgacgagatg atcttcgagt
   204061 ccgatcggtg cgttcctgcg gaccgattca tcaccccacg tgtggaaccc gaggtggcat
   204121 tcatcctcca ggaggatcgt gcgggcgcgg gcctcaccat cgaggatgct gcagccgcag
   204181 tgggccggat ccgacggact ggcccgggct acccgtctcg gagtgcccgc taccgctgcc
   204241 ggtgtcgacg gtctcatcgg catgcccggc ttcgaagaca tcgacatcgt cttcgacgtc
   204301 acctcggctg tagcgcacat cgcgaacgca gaaagactcg ccgggtacgg gaacaagctc
   204361 tcacgacggc gcggctgacc acactgttgc tgcccggtat cggaacaatc gacgagctga
   204421 agctcgtgca ttcactcggc gttagatcgg tccgcgtcgc cacacacgcc accgaggcgg
   204481 acgtctccgc gcagcacatc agcgcggcac gagaattggg catggacgtt tccggggttc
   204541 tgatgatgag ccacatggcg tcaccgacgc acctcgccga gcaagccaag ctgatgtaag
   204601 cctacggcgt ccactgcgcg tacatcaccg actcgggtgg ccgtctgacc atgaacgaca
   204661 tacgagcgcg gatgcgcgct taccgagagg tcctcgatcc cgagacggag atcggaatcc
   204721 acgcacacca gaatctgtca ctgtccgtgg ctaactccgg ggttgcggtc gaggaaggag
   204781 ctgccagggt cgacgcatcc ctggccgggc aaggagttcg aagcgggcaa cacccccatc
   204841 gaagcgttca tcgccctcgc agacctgacc ggatggaagc acaccggtga tctgttcaag
   204901 ttgcaggaca cggctgacgg catcgtccgg ccgctgcagg accgtccggt gcaagtggac
   204961 agggagacaa tcactttggg ctactcgggc gtttactcca gcttcctccg gcacgcggag
   205021 cgtgcggcca ccacctacgt actcgacacc cgcgaaatcc tcgtcgaggt cgggcggcgc
   205081 ggactcgtcg gcggtcaaga agacatgatc gtcgacatcg cacccgacct ctcggcctag
   205141 atcttacggg gcttcgcccg cccgacgagt cgtgtggtgg cggctgcgct caggggcacc
   205201 ggcgggtcgg ggtggtgacc ctggtcgacg acgtcgatcg ggtgcatgga tcgtcgtagc
   205261 ggttggttgg cctactggcc gcccgaccca ccggagccca ccatcaccga gaaaagccgc
   205321 gacgccgacg gtcggagcta tccgtggagc gtcaggtcca ctggcatggt caaccactac
   205381 tacttctact gcgtcgccgc cgacttcggc ccgttcttcc tcgagttctg ctcgtccttt
   205441 tcctgcaacg ccaaactctg tatcaacggc cgccactggg cccagcgtca ggccgcgggg
   205501 gcagggctcg ggttcaccgc actggcactc gacaacgggt tcgccgcggt cgacgatccg
   205561 gccgtgctgc aggcgatctg cgaccggctc accggggcac ggatcgatgc gctgctgcgc
   205621 aagtggctgg cgatgctgcc cgatccgttc accggcgccg accgggacgg tgagccagtt
   205681 ccggaggagg gattagtgca ccgccgcgac aagctccaac agatcagcaa gtaccggttc
   205741 gatatccgcg gtgacgactg cgtcggcgag gccggacagt tcgtcgagct gggcgtcggg
   205801 gtctaccacg acgatctgcc ctgctccact caccgcacgg agggtcccgg ggtcgtgtct
   205861 ccccaggccc agatagatcg agggggcgat cgtgcgggcg agtggcccga tctcgatctg
   205921 ccgcggtgcg tcgcccgcgg ccaccgccgc tggggtggcc gccaccgcgc cgccagtcgc
   205981 ctgagccaac cgctcggccg cccggcgcgt cgccgcatcg agcccggggc ccaggccgat
   206041 gaccacccgc gccgctgtca gatggggagc gtcgggattc tcgacgcgcc gctcgatcgg
   206101 cgtgcaccgg tcgtcggcgg ccttggcggc cggcccgagg acgtcgacct gcggatcgcc
   206161 ctcgtctcgg acggcggcga ccgggaagga cccggggcgc agtgtgccca tcgatggggt
   206221 ggtgtgcgcg atgacaggcg cgagcacgtt ccccgcgagc gccggcttga gccagagcag
   206281 gtccgggtcg tcgctgtccg cgccgcgtac ctcgagcgcg acgaaatccc cggtgagccc
   206341 gaggcccaac cgggccgcga cgcgcggcgc gtagtcgcgg ccccgggcgc tgaacggggc
   206401 gatcaccgcg aacggcgagc cggcgatgat cgccgcactg agggcgctcg tgaacggctc
   206461 cgtggcgtac tcctcgagcc cggcgtcacc gagcacgatc acccggtccg ccccgtgcgc
   206521 gtgcaggacg cgcggcgcgt cgctgctgtg cgcaccgggg aggacggcaa cggtcgtgga
   206581 gtgcagctcg gcagcgatcg agcgggcgca ggcgagggcc tcgaggctgg tggggtgcag
   206641 cccgccaccc ggcagcggct cggcgaccgc ccagatctcc cgcggcgggg atgccggacc
   206701 ggcagcgtag gtcgcgggcc ggaggtcctc gcgggccgcc gcgaacgcgg cggccagcat
   206761 gctggcggcg gcgggggcgt cggcgccgtg ctccgtggag cgcatactgc ggccgggacg
   206821 gatctcgacg acgaaggtcg gcgagccgcg ggtcccgaag tcgcggggcc ctcctccgag
   206881 atcatcggcg gtgaccgtct cgatggccgc ggcgtcggcg gcgtcgacga cccagggcgg
   206941 ctcgattcca cgtccgaccg acaccaaccc cggcagctcg atggcccagt cctccgtgcc
   207001 gacatcggtt tccacctcgg cccggatgcg accgtcgtcg ccggtatgca gggccacgac
   207061 ttgcgtgagt tgcggcagcc cggccagttc ggcgacctgc ggaccgacct gtgcggtggc
   207121 gccgtcaagc gtccagcggc cggtgaggac gaggtccggc gcttcacgtt cgacgacccg
   207181 ggtgatcgcg cgcgccgtcg ccagcgtgtc ggcgccagcg aaacgccggt cgagaagatg
   207241 gacggcgcgg tcggcgcctc ggcgtagtgc gtcgacgagg gtggcctggg cggcgggcgg
   207301 ccccatcgtg acggcgacca cctcccagcc gagcgcgtcg cgaagcgaca gcgcgtgcgc
   207361 gagagcacac agatcggcgg ggttggtgat cgcggcgtcg gaatcgcggc gaatgcgctt
   207421 ggtgcgttcg tcgaaggaga ccgcccccgg ggcgggtacc tgcttgaggc agacgaggac
   207481 gcggccgctg ccggaagcgc tcatcccagc tctcccgtca cgaggtcttc gctcacatcc
   207541 tggtattcct cgcccggcct gagcttccgg aattccttct tgcgcgcccc gcagaccgga
   207601 cagacccagt cgtcggggat gtcctggaag gcagttcccg gggggatgcc accgtccggg
   207661 tcacccagct gggggtcgta cacgtcttca cagacctcgc agacccacag ctcggttgcc
   207721 gggtccgcct gtgtctcttc cgtcgcgatc agaatcttca tgaaccctcc acggtgcgtt
   207781 tgatactagt atgctagcgc gctattggac atagtggaag gcagtttgcc acagacctcc
   207841 ccgtcggtgg acacggctgg tccacggatc gggggtgggg actcggcagg catcgtgcgg
   207901 cgctccggcg ggcgcacgga tgcttgctcg cggacgtcga tcacccggga ggccctcgac
   207961 ctggcctcgg cgaaatcaca cccccgccac gcaccctcgg ctcggttgtc cctagcggcg
   208021 cggcatcgaa gaagcgttgc agagcttgat gttccggcgc gtgtgacgtt catggtgtcg
   208081 gccaagccgt cggcgtgggt tcgggtgatc caccacaccg cagtggcatc aaccgcaccc
   208141 aactagcgta gtaacattct agccggatcg ggtacgcgtc caccggtgca atacactgga
   208201 gtgaatcgat cacttcgcac acctaggatc ccatggtcag tcagcgcctc aatcgaagcg
   208261 gtcaagcgta tgagcagctc accgcggaga tcctccgcgg tcgctggcag ccgggcgaca
   208321 cgctctcgac ttacgcgctg tccgaggagc tgcagatcag tcgcacgccg gtgtccgagg
   208381 ccctcaagcg actggagtca gagggactcg tggagatcat cccgcaggtc gggtgtcgcg
   208441 ttgttcggcc gagttccacg accgtcaccg agctgttcgc gatacgtggc gtgctcgagg
   208501 gcctcgccgc cgaggtggcc gccaaagcga tgagcgccca gcagctcgct gagctcggtg
   208561 gcgtgctcga gcggatggaa gcggccattg atcatgggga cgaagtggcc tacggtgacc
   208621 tcaactacga gttccacctg aagatcatcg agggtagcgg catgccgcgg ctcatccaga
   208681 ccgtcgaggg cgtgtggtcg ctgctgcgct atcagcttgc gcggcttccg ttcacgggcg
   208741 accagatggg ggagtcgatg acggaatcca gaaccgagca tcgggccatc ttcgaggcgc
   208801 tcgagcgacg taccgccaag cgtgcccgga ccctcgcaga gcagcacacc cgtcggtgcg
   208861 gcgaccgctt cgtcgcctac ctggagggtg tcgccgcccc gcggcgagga ggagagaagc
   208921 catgaccgag ctgtcggcat tgatcgctcg tgccctcgac gacatgtgtg agtaccagga
   208981 gcgcttcacg cgcgacccgg gccatgccca ggtgtcgctc gccggcattc cacatgccct
   209041 ggttccgacc cacgtcgtgg ccagcgacct gccgcgcgag ctggtcgaga tcctcggtgc
   209101 cgagctggca cccgcggtga tgtaccggtt cggtcggctc atcgggctca gccacgcggc
   209161 ggcgttcttc gcggaccgca agatcggcat gaccgaaccg cagtatcgcg tgcttaccgg
   209221 cccgttccac ttcgcatggg cgggctacgg agacgtgcaa ctgctcctat gggagcccaa
   209281 gctcgacgag gacttcctcg tgctgtggga gtcggacaac tcgttcagtg cgcgagaggc
   209341 gctgaacgac gggcaccgca gccgggcctg ccatctccag gcgggatacg cggcgggctg
   209401 ggcctcggag gcgacaggcc tcccaatcga tgtgcaagag atcgcctgtc gggcagaggg
   209461 cgtgtcgtac tgccgcttcg cgatggccca ccgcgatcgt gtgtcgctgt ggatgcgcga
   209521 tccgcgcctg caccgcccga ccaagcagta caaagtgatg ccggccagta tgccccgcgc
   209581 cgcgtccgtc tgacgacgcg tcggcaaggt cgccggctga cgagcggcga ccccttgcgt
   209641 gcgccacagt tcatgcgagc cctgggtact ggagctgacc acacgccttt caccctgacg
   209701 cagcagcgtc caaccgcggc gcgcgcaagg gaaagacgaa cgatgtgggc agccgacgag
   209761 cacgggcacg cgctccgcca acgagaggtc cgcaccgccc gcccgtcgct tcaggttgga
   209821 atgatcaagg gccgcagcgg gtcccaacct cgctgcggca gggcgaggaa acgcgccctc
   209881 ggcatcatcg gtggagtgcc gtccgtacac gacccgcgca tgtccaatgc tgatgatgtg
   209941 acctggccca gggcggcgtc ccggtcgcgc gtcgaccggg acggtcctca tctgctgttc
   210001 cgcggcggcg tcggatgctc gatgcagggc ggacatttca ccgtcgtgcg cgagggcttt
   210061 ccggttacac cgaccagtcg gtgccgtcga tctggcccat catcttcatc gctgcttcca
   210121 gggatggaag gttcgccata gcgaccgaca tggggccgcg gaacttgacc ttgcgggtga
   210181 ccatcgcctt ggctgccggg agttcgccca ggccgaggcg ctgccaggtg tccgtattgg
   210241 ctgtcagcac gaactcgggc ttgacgccgt cagccggggc gcccgcccgg acgacctcgc
   210301 cgaggaccac ctggatctga cctgcgcggc tctcgtcctc ggcgagtcgg tactcgatga
   210361 ccatgctcag tttcttgagt ccctggcgtg tcgcctcggt gttgttccac agctcgccgt
   210421 atgtctgcat ccactcgggg gaaaggacgg gtgttgtcat gttgcgctct ccttgttggt
   210481 ggcccacgac acacaatccg gtcgtcggtg acctacgaca caaaaatacg ttgaccgatg
   210541 tgagcaaaga tactaacatg gtagaacgtc agtcaagtag ctggctttgc gcgggatcga
   210601 attcgcttcg taggaccaca ctttcagggt tcgatggccc gcactttcag ggttcgtagg
   210661 cccgcacttc cagaaggaga aagagaatgt ctgactcgag aaagccgaaa gcatgctgag
   210721 caacgaactc cggcagaccc tccagaaggg tttgcacgac gtgaagtccg actggaccgt
   210781 ccccgcctcg atcatcaacg atcccgaggt gcacgacgtc gagcgcgagc gggtcttcgg
   210841 tcacgcgtgg gtctttctcg cgcatgagag tgagatcccc gagcgcggtg attacgtcgt
   210901 gcggtacatc tccgaggatc agttcatcgt ctgccgcgac gaggacggcg aaatccgcgg
   210961 gcacctcaac gcttgccgcc accgcggtat gcaggtgtgc cgcgcggaga tggggaacgc
   211021 ctcacacttc cggtgcccgt accacggctg gacctacagc aacacgggaa gtttggtcgg
   211081 cgtgccggcc ggcaaggacg cgtacggcaa tcagctgaag aagtccgact ggaacctgcg
   211141 gccgatgccg aacctggcca cctacaaggg cctgatcttc ggctcgctgg acccgaacgc
   211201 cgattcgctg gaggactacc tcggcgatat gaagttctac ctcgatattg ttctggaccg
   211261 cagtgacgcc gggttgcagg tcgtcggcgc cccgcagcgg tgggtggtcg acgcgaactg
   211321 gaagctcggc gcagacaact tcgtcggcga cgcctaccac accatgatga cccaccgctc
   211381 gatggtcgag ctggggctcg ccccgcccga cccgcagttc gcgctctacg gagagcacgt
   211441 ccacaccgag cacggtcacg gcctgggcat catcggtccg ccgccgggta tgccgctgcc
   211501 ggagttcatg ggcatgccgg agaacatcgt cgaggagttg gggcgtcggc tcacgccgga
   211561 gcaggtcgag atcttccggc ccaatgcctt catccatggc accgtgttcc cgaatctgtc
   211621 gatcggcaac ttcctgatgg ccaaggacca cctctcccca ccgacgccgt tcctgacgct
   211681 gcgcctctgg cacccgctcg gaccggacaa gatggaggtg atgtcgttct tcctcgtcga
   211741 aaaggaggcg cccgactggt tcaaggacga gagctacaag gcctacctgc gcaccttcgg
   211801 gatctccggc gccttcgaac aggacgacgc cgagaactgg cgcagtatca cccgtgttct
   211861 gggtggtcag ttcgccaaga caggggagct caactaccag atggggcgcg gcgttctcga
   211921 gcccgacccg aactggcccg gacccgggga ggcctacccg ctggactacg ccgaggccaa
   211981 ccagcgcaac ttcctcgaat actggatgca gctcatgctc gcggacacac cgctgcacgc
   212041 cggcaacagc aacggcaacg gcaaggtgga gacgtcggcg ccggccgccc ccaagacccc
   212101 agcgaaagcg gaggcgtagg ccatgagtac gcagacacag atctcggcca ccaccgtccg
   212161 tgagatcacc gactggctct acatggaggc cgggctgctc gacgccggta ggtaccggga
   212221 atggctggac ctcgtcgccg aggacctgag ctacattgtg cccctgaggg tcacccggga
   212281 gcgtgaggcc gtgaccgacg tcgtcgaggg aatgacccac atggacgacg acgcggactc
   212341 gatggagatg cgcgtgctgc gcctcgagac cgagtacgcg tgggcagagg acccgccgtc
   212401 gcgctcacgg cacttcgtca ccaacgttca agtcgcgcca ggcgatagcg aggacgagtt
   212461 cgaggttacc tcgaacctgc tgctctaccg cacccgcggt gacgttgcta cctacgacgt
   212521 cctctcgggc gaacgtaagg acgtgctccg gcgcgcgggc gacggcttcc gtctcgccaa
   212581 acgtgttgtg ctgcttgatc agaccacgat aatgacacac aacctcgccc tgatcatgtg
   212641 acggaggagc ctacatgagc atcatccaca acgaccgcgg agaaccgata atccagatcg
   212701 ccaacgagtt cacggtgatc caggtcggct acacccgcac cggcagtggt gagcgcctcg
   212761 tcatcacctc gccgcgcctc ggattccaga cccatctgga tccgctgcaa ctcgagagcc
   212821 tcacctggca gacgccggac atgtactcgg cgctgctcga cacgccctac ggaccgggct
   212881 cggaactcaa agcgagcccc ctgtcggctc tattcagaaa ggactgattc ccttgggatt
   212941 cctggacggc aaggtggcgc tcgtcaccgg cggcggatcg ggtatcggcc gcgctgtggt
   213001 cgagctctac gtgcaacagg gcgcaaaagt ggggatcctc gagatctccc cggagaaggt
   213061 gaaggacctg cgcaacgcac tgcccgccga ctccgtcgtg gtgacggaag gcgacgccac
   213121 gtcgatggcc gacaacgaac gcgccgtcgc cgacgtcgtg gacgcgttcg ggccgctcac
   213181 cacgctcgtc tgcgtggtcg gcgtattcga ctacttcacc gagattccgc aactgcccaa
   213241 ggacaagatc agcgaggcgt tcgatcaact cttcggcgtc aacgtcaaga gcaacctgct
   213301 cagcgtgaag gcggcgctcg acgagctgat cgagaacgag ggcgacatca tcctcaccct
   213361 ctccaacgct gcgttctacc ccggtggcgg cggcccgctg tatgtgtcgt cgaagttcgc
   213421 cgtacgcggc ctcgtgaccg agctcgcgta cgagctggcg ccgaaggtgc gcgtcaacgg
   213481 cgtggcacca ggcggcacca tcaccgagct gcgcggcatc cccgctctgg ccaacgaggg
   213541 ccaacgtctc aaggacgtgc cggacatcga gggtttgatc gagggcatca atccgctggg
   213601 catcgtcgcc cagcctgagg atcactcatg ggcatacgcg cttctcgcct cgcgggagcg
   213661 gacctcggcg gtgaccggca ccatcatcaa cagcgacggc ggtctcgggg tccgcggtat
   213721 gacgcggatg gcgggtctcg cgcagtgagg gtcggcgcgt gggcgggcca ctcctcccac
   213781 gcgccgtgac gggttcgggc gtccaccagc acggcgacgg tccccgccgt cgggctggtg
   213841 tccgctgcga tcattcctgc ccagcccgac cgttcctgac cttcagcggc caccgtggag
   213901 ggggcgcttc ccgaaccgtt aggacgtcaa cgacgacatt ggaaacgaca ccttcacatc
   213961 ggagatggca tggcacagaa attcggagtc aatgacctgc gcggcgtcgt cgcggtcacg
   214021 ccgaccccgg cgctccccgg cgcgggggag ctcgccgggc gcgacacggt cgacctcgag
   214081 gagacggacc ggatgatccg gcggctgatc gccgacggcg tcgacggcat catcaccaac
   214141 ggcacgctcg gcgagatggc aaccctgacc ctcaccgagt ggcaggcatt cacacggcgc
   214201 gtgtccgaag tcgtgtccga ggtcgccccc gacctgccgc tgttcatcgg ggcgaccaca
   214261 ctgaacaccc gtgacaccgt cgaccggatc cgcttcctgg aagatctcgg gatccagggg
   214321 gtgttcctcg gtcgtccgat gtggggcgga ctcggcgccg acacgatggc cgccttctac
   214381 cgcgatatcg ccgacacgtt ccccgacatg gcgatcgtgc tctacgacaa ccctgaagca
   214441 ttcaaaggcc cgatcccatc accggtctac gccgagctcg ccacgctgcc ccaggtcatc
   214501 ggcgcgaaat acattgcgct caccccgaag ttcgcggtgg acatcgccgc ggtcgacggc
   214561 aagatgcggc tgctgccgct cgaaagcgac tggctggcga cccgcaccct ctacccggac
   214621 gaggcgcttg gctgttggag cagcagcgcg ctgtgcggcc cggagcccgt gctcgccctc
   214681 cgggacgcac tcgcatccgg aaacctcgat gcggcgcgac atctgaccca tcgcatcgac
   214741 tggacctacg agccgttcct cgcccgtacc aacttccccg agttctccaa gtacaacgtc
   214801 accctggaga agctccgctt cgacgaggct ggctacatca acgccgggcc cgcccgtccc
   214861 ccatttctga cagcacccga ggcctatgcc gagggcgcgc gcgaaaacgg acgtcggtgg
   214921 cgccatctcg tcgacgaaat caccaccacg aactagcggc ccgtgctaga agttctttaa
   214981 tggtacgcct ggtccagttt cccccagcag ataccgcgtt cgcgacgtaa ccgatgcctc
   215041 gactcgggac ctcgccgaaa gcctggaagg ttcgatagat gcccgtactc atccttcatg
   215101 ctgcgatcgc atgcgccaga ctgctgacgc cccggcgtcc cacggagacg atccaacgca
   215161 tgctcacgaa tatcgcggtc gcgctggcca ctacgagatg ggtggccatg gctgcgagcg
   215221 aacagcagga gggccctgtg tccatctcga ttgagagata gaccttccga gttcgaacag
   215281 cacgacccag tacgccgacc actgcctgga tcgcgacaat tggtcggcga tgctcaagct
   215341 ggacggagag gcgcgaggcc gtgatgcctt cgctggtatg aacggtctca gggtgattga
   215401 acggtgggtc cagggaggcg ccgtgtcccc ttcggcggca cggcaggtcc gcacaatccg
   215461 cgcagcacga ccagcgtaat tgccgcgctg gccatcaagg acaaggagat tggatcgatg
   215521 accgacaagc tgaagctctt ctcacaggag tggtgtgacg cagcactcga cgcggtcaat
   215581 gccaacgatg cggtgtacga gggtttcaag gatcctgaca cgttcaccaa caagttggaa
   215641 ttcggcgtca tcggccggga cgatgtcgcc tgccatctcg aattcaaaga gggcaaggtc
   215701 gtctcgttta cgccgcggac gttcgacgag agtgagctgt ggctgatcat caacggcagc
   215761 ctcgagacct ggcaggccgc cgccgcgggt aaggaagaag gcggaaagct gctgatgaag
   215821 gggcagatca agttcgccaa gggcccgatg tccgcggcga tcgagaacgc gggagcactc
   215881 aacaacttcc tgcttacctg gggtcaggtc cccaccgact gggacgtctg atcccacgaa
   215941 actctcgcac ggggcacgcg cccgacccct catccgggtg agtcgtccgt gcaggaccgc
   216001 acgaaacgcc gtcaccctgt ctgaaaggcc cactccatga ctactgttga atccggcgcg
   216061 taccccgtca gtttgttcga tggtgaggac gcgaatggcg tcgccaacat cgtcgggatg
   216121 ttgctcgggc agaacctcga gaactttccg tcgcgaatca agttcgcacg caagatcgct
   216181 cgaccggtct ccattatcag cacggacacc gacagcgcct gcacaatcgt gttcggcacc
   216241 gacgaggcgg tcgtctacaa cgacgtcgtc gggaaaccag ccgtgaccgt catcgccacc
   216301 gtcgatcaga tcctggatgt gtcacagttg ccgatgaagg ccggcgggct gatcccggtg
   216361 ggtttcttca ccggccgggg catgacggtg ctcggggaaa tcgtgaagca caagctggtc
   216421 gtgaagggtc tactcaccca caccgtgacc gcgctgcgca ccatcgcgtt ggtctcggtg
   216481 atcgaaccat gacctcgctc tcgggccgca gccgcccggc cagtcacgcc tccgaggacc
   216541 cggcgatgca gttcgaattg ccctatgcgg acgacgacgt cgtgcagggc ggggaaccgc
   216601 ctcgggcgtc gaaggccacg aacatcgcca gggggttgct cctgctcgcc ctgatcccgg
   216661 tctcggtgtt ctacctgggc ccgcggatct acaacctgac cgccaccccc taccgcctgg
   216721 accaggcggt ggtttccgcc gggaactaca acccggcgct ggacaagatc gtcgagcacg
   216781 agaaggtgac cctgtccgcg ttcgcgtcgc tggagaagat gaagaccgcg ctcgcgagtg
   216841 ttctcgtcac cgatgcgacc gtcaccgccg agctccatac cttgaccggt cagatcagcg
   216901 gcgatgtgca ggcgacgctc gatcaggccg gcgcgaacgt gaccgacctc attgcctccc
   216961 tcgacactct gaccacgcac atcaactcgt tgcagcctcc cgtcgacggc gccaccgcgg
   217021 ccctcgcggc cgacagcgcc acgttggggg tcatcctcga cgacgcccgt tcgacggcgg
   217081 cgaaggtgca caacgcccgg gtctccgcgg aggagtccgc gaacgacctg tcaggaaaat
   217141 aggagaagtt ctgtgatttt cttcggacgc cgcggcggtc ccgcccggat ggttctggcg
   217201 atcgtggcgg tcggtgtact cggtctgctc acgttcgtgg tgttcaacct caacacccgc
   217261 ctcgacaatc agcagcgcgc caacgtgacg agcatcgccg cttctcagga catcgtcgac
   217321 gtcaacgaca aagtgaccgg ccaactccgg caactgaccg agctcaccca cacggcacag
   217381 accgcgctcg atgccacctc cgcgctcggt ccactgctga cgaagttgga tgaggcgatc
   217441 gccccggcgg cggcgatgct ggccagcagc accgcgggcg cacagatgac caacgaccag
   217501 ctcaccaaca tccagtccat cctcggcgag gtccagaaca ccgtgctccc gttggtgtcc
   217561 tccgcggaag cgttcgggga gcaaggcaac cagctgctgg tgatcgtgca ggggctggtg
   217621 agcgacctga gggtctcggt cgaggcggcg aaaacgatca accagatgct tccacttccc
   217681 ggctgagcac cctttcaccg tcgacgatcc gacactactt ccactggacg tgatatgcag
   217741 cagcgcaacg atctacctcc cgacgttctc ccaccccgag gtgtgaccaa atatcagcga
   217801 ttcgatgtgc ccgcggcggc gctgccctac cggaaaggca ccaagccgca tcggccggat
   217861 gtgctggtgc ccgcgatccc cgacgcgacc gggttctcgg tggcaatcga gtggctgggc
   217921 cgcctcgccg cggtcatcgc cgtcgtcctg ttcgcactgg tggtggcctc catccacaag
   217981 gggctgcagg tgcaacacag cgcgcgcacc gtcgtggaca acttccgcct caccaacgac
   218041 ttcttcgccc aacgcgcgga cctgaccgcg cccgccaccg cccgcaaaca actcgacgaa
   218101 ctgacaggag tcttgaccca gctcaacacc gcgaccgcga ccgacgtcga ccacctcgac
   218161 gccctcctgc cgaacgcgcg cacgttgctc gccgccggcc aaggtgacac acagatcgcc
   218221 ggccaactcg agggggtcgc caccacattg cagggctcgg cggcatccct gcatcagata
   218281 tcggcaggcg cgaacacgac cgtgaccggc gtcgacaacg aactcaccca ggcactcgac
   218341 ctggtgaacc agctcaacgc ggaactcacc cgcacgacga acaagctcgc gctcgttccc
   218401 gccaccgacg ccttcattcc tgcccccgga gggaactgat gatcaccaga aagttgtgga
   218461 ccgcgatcgt actcgtgctg ggtgcggggt cggcggtggt tctgtgcgcc ctcaacgggt
   218521 tctttcccgc gctgcgtgat gtgagcgatc cgctggggcg gccgtcgaaa ctcagtctcg
   218581 agctgatcga ttccgcaggc caattcgaca ccctgaccgc gattctcgtc cccaagcacg
   218641 cgcgtctggc ctccgacatc cagaccttga cgccgctcgc gaacgatctc gaaggactca
   218701 ccgacaaggc cagcgaactc tccggtcaag ccaagacact gaacgcctcc accagtaccg
   218761 tcagcgagat cgcggcgccg ctgcccgacc tcatcgtgaa ggtgaccggt cgtgccgaca
   218821 ccgcgagccc gacggtggcc ggattgtcca ctgcggtggg atcggttacc acccagctgg
   218881 aggcgatcaa ccacggattg accaccgtcc agggatccct cggtgcgctc ggcccgaaag
   218941 cctccgccat ctctgcgacc ctcgcaatcg ttcgggaaga ggccgcacac gtgcaggagt
   219001 tcggccccct cctcgcggta atcggccccc cggtcaatga cctgaacctc cccgccctcg
   219061 gtgtcgcacc cgcaccgccc tcatgaccgc ccgcaccggc ttgtggccga ccactgagcg
   219121 agtgaaaggc agaacttgat gtttcggctc tcctgggcga tcgccctgtc ctttaccatt
   219181 gcggttctcg ctggcatcct gatcgtgacg cgcgatctga gtatctcgaa cgacatcttc
   219241 aaagagggag tggcacaagc gaagatcgtc gacagtacaa ccgaccaggc actggacggt
   219301 gcgcagcagt tgccccccgc tgatcaggcc ctccacgagg gtctacccca ggtggtgggg
   219361 gtactcgact ccctcgccag agccgaccgg actctgggtt cgctcggtga tcacttgcag
   219421 tctctggggg acgccttgaa gtccgcggac gccccgctcg gcgggatcat cgatgccggc
   219481 cagtccgcaa ccgatcaggc gaacgcggcg gccgccccgg ccgcggacat cgtgaacacc
   219541 ctgtccgcgg ccgatacgaa ggttcaagcc ttgggcccgt tgctcgaccg atcactcgcc
   219601 ctcagccaga cgatcgactc gaaactgcgc atcgcgctca ccctgccgaa agtaggaaac
   219661 tgaggtccga cgatccgata cgcagtccga gcggtcgcgc tccccggctt ctacggtagg
   219721 catccacggt gaagcgaatg tgcgcccctc tcccgtgctc gtcgcgcagg agcgcatcct
   219781 cgaatcaata cgctcacaac ctatgtctgc ctgggccgaa caagaactct cagcgtcgac
   219841 cttctacgac ttcacagaac tcgatcgtgc tcgcgactgt gtgccgggag tgtcggcgag
   219901 atgagcaacc tgcgattcca ttcgcgtagt tggtcgattg tgtctttgcc ttgctaaagc
   219961 taaagagtcg gccgcactca attggacata gcggtttccc gccggaccgc ctggggagct
   220021 gaaggactgg gcggaagaca ctggctgggc ggccgaggtg tacgagcggc gtgagagtgc
   220081 cctgattttg atggggttca ccggcgcctt ctggcgcagc gaactcgtcg ccctgaactg
   220141 cggcgacgtc agcgtgcacc ggctagacgg tatccacatc cgcctgcgcc aatcgaagac
   220201 cgaccaggag ggcgccggat cggtcaaggc gctgccgttc accacctcgc cccagtggca
   220261 caccgtgccc acacttccgg tgggcgcagg tcgtggccgc cttcgacacc gccaaccgtc
   220321 ccggggtgat ccggatgctg cgccgcaccg ccgttcgaca accaagtctg ccgcggcgcg
   220381 ctgccgcgga tgagggcccg gtcgccgttg ttccggtcga tccgcaagaa cggcaacctc
   220441 gggggcaccg ccctgtccgg gcgtcggtgc atgcggcaat ccgccgccgc gccgccctgg
   220501 ccgggtacga cgagaacatc gtcgcccaac tcggtgggca ctcgctgcgg gccgggttcg
   220561 tcacccaggc cttccgcaac ggcgccgacg cgcacgcgat catgcgccag accgggcaca
   220621 tccggcgacc gtggagatct acgcgcggga gaacgccccg ctgatcggca acgccgtcac
   220681 tgagatcgga ctctgacgcc gatgagcacg gactgttacc cgcaagcacc ggcgggtaac
   220741 agtctggtgg tcgcgggacg gtacgccccg tctggggacg gctaccgtca ggaattgacg
   220801 gtagcccaga tctcctccgt ggacaggctc gggtcgtcaa cgctgcggat agattgtgtc
   220861 accagcagtc ttcctgtgtt ctccagatgt gcccgcatgg ccgcctctgc ctcgactgga
   220921 ttgccggcga tgatcgcgtc gatgatgggc gcgtgctcgt tgtcgatgtc ggtgagtgtt
   220981 ctggtcttgt cggcggtgtt ggccccgagt agccgggtgg tctcgcgaag ggtcttgacg
   221041 atcgcgcggg ctcgggcgtt gtcggcggcg tcgagaatca ggtcgtgaag cccgagatca
   221101 tgatgggcga actcgtgttc gtcgccgccg gcggcggcgt cctgcatcag gcgtcgttgc
   221161 cgctgcagtg cgtccgagag cgtggggtcg gccacggctg cggccttgcg gaccgcgggt
   221221 agttccaggg ccaaccggac tgcgaagatc tccgcgatct ccttcggctg ggggagaaga
   221281 atgcggaagc cctggcgtgc ttcgaacttg atgactccca cttcttccag gcgcagcaaa
   221341 gcgtcccgca ccggggttcg ggagatcccc agaccctcgg cgagttggta gaccgagtac
   221401 ttcactcccg gtttcatgcg gccgtcgtcg atggccgccc gcaccgccgc gatcgcctgc
   221461 tccatccgtc gtcccgcgaa cggggtgagc ggttcgagtt cgagcgcttc gtctgccacc
   221521 cgatcactgt aacaacacgg ggctgttcgt agcatgctag gtgcatgtag catgctacga
   221581 atgatctccg ctgaatcact ggccgctgag ctgcgcagtt cgggagtgag cgacgttctc
   221641 tccgacggca ccacccgcgc tgcctattcg tccgatgcgt ccctgtaccg ggtgcgaccg
   221701 ctggtcgtcg cgcggccgcg ccatgccgac gaggtggcgg ccgccctcgc ggtgtgccgc
   221761 cgagagggcg tgccgctgac ctctcgcggt ggcggcacct ccgttgcagg taacgctgtc
   221821 gggaccggac tgattctcga cttcagccgg cacatgaacc gggtgctgtc gatcgacagg
   221881 gacgcacaga ccgccaccgt cgagccgggc acgattcaga cggtgctgca gcaggccgtc
   221941 gcaccgcagg gcctacgatt cgggcccgac ccatcgacgt tcactcgatg caccatcggc
   222001 ggcatgatcg gaaacaatgc ctgcggttcg cgcacgctcg gatacggccg gacctcggac
   222061 aacgtgaagg gcttgcacgt tctgaccggg accggggagt cgttgcaact gggttcggcc
   222121 ggtgaggtga cggcctcccc ggcgctgagt gcactacagc aggtcacccg cgccggtttg
   222181 gcgaccatcc gcaccgagct cgggcaattc ggccgtcagg tgtccggata cgccctggaa
   222241 cacctgttgc cggaaaatcg gttcgacgtg acccgcatgc tggtcggcac ggagggcacc
   222301 ctcgcggtgg caacccgcgc gacggtccgc ttggtgtccg agcccgccca ccgcgtcctg
   222361 gtcgtgctgg ggtacgccga catcgcgtcg gcgggtgacg cgaccccgct ggtgctgaag
   222421 ttcgatccga ccgcctgcga gggtatcgat tcccggatcg tcgacgtggt gcgcgagcgc
   222481 cgcggtccgg atgcggttcc gccgttgcct gcgggggcgg cctggttgtt cgtcgaggtc
   222541 gtcggcgacg acctcgacga gacgatcgcc agggcccagc aggtcggacg ggactgcgga
   222601 gccgtggaca gcctcgtcgt caccgacgag ggccgcacgg cccagctgtg gcggattcgc
   222661 gccgatggcg ccggactcgc cggccgcagt cctgccggcc ttcccgcaca cgcaggatgg
   222721 gaggacgcgg ccgtgccacc ggccatgctg ggcgactatc tacgcgactt cgacgccctg
   222781 atggacgagt acggcgttac cggcctgccg tacgggcact tcggtgacgg atgcatgcac
   222841 gtgcgcatcg attggccgct cgacaagccc ggcggggacc gcatcttccg ggacttcctg
   222901 gtcgcggcga gcacactcgt cgccggctac ggcggatccc tgtccggtga gcacggggac
   222961 ggccgcgccc gcagcgaact attgccgctg atgtactcac ccgacgcgat gaaactcttt
   223021 gctgccgtca agcacgtctt cgacccggac aacatcctca atcccggagt cgtggtcgac
   223081 ccccgcccgg tcgacgcgga cctgcgcatt cccgcagccc cactcctgcg ccgcaacctg
   223141 gccctggcct atcaccacga cgacggagat ttcacccagg cggtgcaccg ctgcaccggc
   223201 gtcggaaaat gccgggccga caacaccgcc accgggggag tgatgtgccc gtcgtatcag
   223261 gcgacccggg aggagaagga ctccacccgc ggccgcgcgc gcgtgttgca ggagatgatc
   223321 aacggcaccg acatcgacgg tggctggcga tcgcccgagg ttcacgacgc cctcgacctg
   223381 tgtctgtcct gtaaggggtg ctcctcggac tgcccgaccg gtgtcgacat ggccgcgttc
   223441 aaatccgaag tgctgcacca gagctacaag ggccgcatcc gccccgcctc gcactactcg
   223501 ctgggatggc ttccgcgttg ggcgaagatc gccagccacg cgcccggtct ggtcaacgcc
   223561 acgatgcgcg ttcccggcat cggaccgctg gcgttgtcgt cggccggagt ggacaagcgc
   223621 cgcaccattc caccgttcgc gaagcagacg ttccggtcct ggttcaaggc caccgaaaac
   223681 gaccgtgcca cgaccggtga cccggtgctg ctgttcgtgg actcgttcac caactacttc
   223741 acccccgagg tcgggcacgc cacggtgcag gtgctcgaag ccgccggcta ccggccgcaa
   223801 ttgaccgaca agcagcagtg ctgcggactc acctggatct ccaccgggca actcaccgcg
   223861 gcgaagaaga tcctcggccg caccgtggac gcactgtccg gtagcgccgc ggccggaatt
   223921 ccgatcgtcg gaatggagcc gtcctgcacg ggtgtgctgc gctcggacgc cgcggaactg
   223981 ctcggtaggt cggcggccga accggtcgcc gacgcaaccc gtaccctcgc ggaactgctg
   224041 acggagcgcg gctgggaacc gccgtcgctc gaaggcaagt ccgttgtcgc acaaccacac
   224101 tgccaccacc attcggtgat ggggtggagc ccggacgcgc aactcctgga gaaggccggt
   224161 gcacaggtgc agcggttggg cggatgctgt ggtctcgccg gtaacttcgg tgtggagaag
   224221 ggacattacg aggtgtcggt ggccgtggcc gagcagcagt tgctccccgc ggtggccggg
   224281 gcggacgcgg acaccaccat cctcgccgac ggatactcct gccggacgca gctgtcggat
   224341 ctgaccgacc gccgcggtga ccacctggcg caattgctcg ccgcgcaact cgaaggtggg
   224401 gccgcgcgcc ggcgggactg accctcgtcg accgctggac acacggaaag gggcggtggc
   224461 ggagaccaca gtcggtctca ctcgccaccg cccccggcgg tcgtgcgtta ccccggagaa
   224521 gactcggtga tcgtgtgcgg agcaggatcg gagatgttgt gcgcgagcgg attttccgga
   224581 ttgatgcggc gccgaatctg gtaggccacc aacgccagga tcagggctgc gacactcagc
   224641 gagatctgcg agcgagagga ctcgacgtag aacatcgaca ccagcacccc gacgatgccg
   224701 gcggccgcga gaacggacag ggtcgggaac caccacatct tcaacttgag ctgcgcgacc
   224761 tcgtcacggc tcatgctgct gcgcaacttg atctgcgaca gcgcgatcat gaggtacacc
   224821 atcaggatgg tggcgccgga cgcgttgagc aggaaggcga agaccgtctc gggcgagagc
   224881 cagggtgtgc gcaccaccaa acgtgcggtg aagaagtttc gacaccaacg aatcgctcga
   224941 cgacgcgacc cggcagggca tcgaccacgc caacgccgcc gcactgttca cccgctgaat
   225001 ccctgcagct gcccgtcccc tcgacactgt cgtcacggtg acggtcgcca gcagatcccg
   225061 ccgccgcgta ccggaacagg tatctgcatg atcgtgccgt gacggtagac ctcgccaccg
   225121 tcacggcgcc gcagtctcag ttgccgcctg ctcggctacg caggtcgagg gcgatgtcga
   225181 cgatgaggtc ttcctgtccg ccgacgaggc cgcggcggcc gacctcgagg aggatggtgc
   225241 gcacgtcgat gccgtaccgc tgggacgcgg cttcggcgtg ccggaggaac gacgagtaca
   225301 caccggcgta gccgagggtg agggtttccc ggtcgacgcg cacgggccgg tcctgcagcg
   225361 gccggacgag gtcgtcggcg gcgtcctgga gggcgaacag ggcgctgttg tgcttccagc
   225421 cctgcaggtc cgcgaccgcg atgaacggtt cgatcgggca gttgccggcg ccggcgccgt
   225481 gcccggccaa cgaggcgtcg acccgggtga caccctcttc gacggcgacg acggagttcg
   225541 cgaccgacag cgacaggttc tcgtgggcgt ggatcccgat ctcggtgccc tcgtcgagca
   225601 cgtcccggta ggcgcggacc cggtcgcgga ccccgtccat ggtcaaccgg ccaccggagt
   225661 cggtgacgta cacgcagtgc gcgccgtagg actccatgag cttggcctgg gcggcgagct
   225721 cgggtgcggt ggtcatgtga ctcatcatga ggaagccgga cacgtccatg ccgagttccc
   225781 gggccttgcc gatgtgctgg gcggcgacgt cggcctcggt gcaatgggtc gcgacccgga
   225841 cggaccgcac gcccagtcgg aaggcgtgtt cgagttcggc gatggtgccg atgccgggca
   225901 gcagcagggt ggtcagccgg gcgtgggtga ggttggcggc ggcggcttcg atccattccc
   225961 agtcggtgtt gctgccgggg ccgtagttca gcgatccgcc ggcgagtccg tcgccgtggg
   226021 cgacctcgat gccgtcgacc ccggcggcgt cgagcgcggc cacgatcttt ccgacgtcgt
   226081 cgggggtgat gcggtggcgg acggcgtgca tgccgtcgcg gagggtgacg tcttggatga
   226141 acagcctggt ggtcatcggg tggctccctg ggttgccgcc ggggcggcga tcgtgtcggc
   226201 gacggactcg gcgtagcgga ccgcggccga ggtcatgatg tcgaggttgc cggcgtaggc
   226261 cggcaggtag tgtgcggcgc cttcgacttc gaggaacacc gacacctggt gggtgggtgc
   226321 cgccgtgtcc ccggacgcga gcagggtgtg cacgggttgg ccgtccggga ccggggtgat
   226381 ctggacctgc tgcttgagcc ggtagccggg cacgtaggtc gcgacgtgct cgaccatcgc
   226441 ctggatcgag ttccggatgg cgtcgtgggt ggccgggtcg cgggcggaga tcaggcacag
   226501 gaccgtgtcc cgcatgatca gcggcgggtc ggccgggttg aggacgatga tggccttgcc
   226561 gcggcgggcg ccgccgacgg tttcgatggc gtgggaggtg gtttcggtga actcgtcgat
   226621 gttcgcccgg gtgcccggtc ccgcggactt cgaggcgatg gaggcaacga tctcggcgta
   226681 ggcgaccggt gtcacgcggg agacggcggc gacgatcggg atggtggcct gaccgccgca
   226741 ggtgaccatg ttgacgttgg cggcgtgacg gtgttcgtcg aggttgaccg ccggcaccac
   226801 gaacgggccg agggcggccg gggtgaggtc gatcagccgt ttgccgagcg gttcgagcag
   226861 ggcggcgttg gcggcgtgtg ccttggcgga ggtggcgtcg aagaccacgt cgatctcgtc
   226921 gaagttcggc agctccagca ggccgtggac gccgacggcg gtggtgggga cgccgaggcg
   226981 gcgggcgcgg gcgaggccgt cggagtcggg gtcgatgccc accatcgcgc ccatctgcag
   227041 gacgtcggag tggcggatca ccttgatcat caggtcggtg ccgatgttgc cggatccgat
   227101 caccgcgacg gtgaccttac gggtgttctc gctcatggtg ctcactcctg ggtgaaggtt
   227161 gcggtgaccg atccgagacc ggtgatgtcg gcgcggacgg tgccggcgct gtcgatggcg
   227221 gccatcggcc cgagggcccc ggacaagatc acctgaccgg ccagtagtgg ttggccgaac
   227281 tcgcgggcgg tgcgcgcgag ccaggccagc gcccgcaccg ggtcaccgag gcaggcggca
   227341 ccggtgccgg tcgacacctc ggtgtcgccg atgaacatct gcatctgcgc ggcgaccggg
   227401 tcgaaggagt cgagggtgcg ccgatcggca ccgaggacga acagcccgct cgacccgttg
   227461 tcggcgacgg tgtctccgaa ggtgatgtcc cacccggcga ttcggctgtc gacgatctcg
   227521 agggcggcca ccgcgtagtc gacggcagcg cggatctggg cgtcgtcgag cggcccgtcc
   227581 accagatcgc ggccgaggac gaacgcgatc tccgcctcca ccttcggctg cagcagacga
   227641 gacagcggga tcgggccggc ctccgcgcag cgcatgtcgt cgaacagcac cccgaagtcc
   227701 ggttggtcga cgccgagctg ctgctggacc gccggggagg tcagcccgat cttgcggccc
   227761 accacactcg caccggcggc gatccggtcc gcgacgatcc gctcctggac ggcatacgcc
   227821 gccgcgacgt cgtcggcacc gatcaggtcg cggaccgggg tgcacggcgt ggaagttgcg
   227881 gcggcggtgc tcaaccgctc ggcagcgacg gcgatagcgt cggcggtggc tcgcgccgtg
   227941 gggggcaggc tggtgccctg aggtgtgctc atctgacttc ccgatgtgat cgtggcgaat
   228001 ggactgtggg ttccactgtc gccgcggggt gatcgtccgc caagcattgc gttccactga
   228061 gccgaacacg cgccgtatcg tggacgacgt cgccggtagc agcggaaggg aggagccggc
   228121 agtgtccgat caggagttcg accgcacgac ggtgctgggc aaggtcatga tggtgctgca
   228181 tgcgttcacc atcgacgact cgaccctgtc gctggccgaa ctggtccggc ggacgtccat
   228241 cccgaagggc acgctgcacc gggtcctctc cgacatggtg gcggtgcgaa tgctggaccg
   228301 caccgatgcc ggttaccggc tcggcggctc gttattcgag ctgggcatgc gggcgtcggt
   228361 cgagcgcagc ctgctcgagg tggcgatccc gttcatggag gacctctatg tccgcaccca
   228421 cgagacggtg cacctggggg tcctcgacgg gacggaggtc gtgtacctgt cgaagatcgg
   228481 cggccatcgg caggcgagcg caccatcgag gatcgggggc cggatgccgg tgcactgcac
   228541 cgcaatcggc aaggtgctgc tcgcccacgc cgacaacgcc ctacgggagc aggtgctctc
   228601 cgctccgctg gcccgctaca ccccgcggac catcatcctg cccggatcgc tgcgcaccca
   228661 gctcgaccgc atcacagaag agggcatggc ctacgaatac gaggaatccg ccaccggaat
   228721 cgtgtgcgtg gccgcccccg tccgcgacgg cgaggacgcc gtcgcggcga tcagcgtgac
   228781 cggcccgtcc caccgcttcc gccctgacac gcacgccacg tcggtccgcg cagcggctga
   228841 cggcatcggc ttgacacttt ctcgccgtac tcagcttgtt gccgacactc gatgaagttc
   228901 gtaccactct ctgcgtcttc aggaatccag tgacccgttc cgaccccgtc tggcccaagc
   228961 cacacttggc atgaaaccgc cgcagcggcc gcgggtgtat aacgccgtca cctgagggag
   229021 agcgtgtccg cgtggataat tcgtggtcgt ggcgacgcgc ggtgtgctgc gcggtggctc
   229081 accgaagcga gggacgaggg cagagcgaat ctaaatttca cgcccacatt gaccgcctcg
   229141 ctgatacggg tcggtcgcgg gttgtggtca ggcggagtgc ctctggatgt actcctcgac
   229201 ggcctcacgc atcagttcgc tgggcttacg gtgctggcgt tcagcgagtt cgtcgagctt
   229261 gttgctcagc ggcgccggca gtcggacctg ccgcttgggt gattcgccgc tggcgccggc
   229321 caaggacgga cggccggcgc ccaccctctc gagcagttcg cgccccgctg cggcggcctc
   229381 ggcgccccgc ttggcagtgg ccgagttctt cggcagcgtc atctcgtgct ccgcccactc
   229441 ggcgagcccg tcgtaatcgg agttcttatc gttgctgttc atcggtattt caccccttcg
   229501 agtgtggttg gaccggatgc ctgcgcaacc ggggatcggg cggtcacggc tggtccttca
   229561 tgcggtcgag atgcttctgc cgcgcctgca tcacatggaa aaccaccatg ccccgcggcg
   229621 gaacgatctc caccatgact tcgagcaacg gacccccaag tgtgcgcgga ggaccgatga
   229681 acagccaagg ctttgagtgc ccgggaacgc gtggttcgtc gaactcttgc tcgacgtaca
   229741 cggcgttctc gatcgcgtgc aacgcgtcgt cgcggtcgat gccgtgtttg tctgcgctgg
   229801 tcgcccattc gatcgccaca tcaatactgt actacagaaa taggtattct gtactacgaa
   229861 attacaagtt cgacccttgg atcgagtgag aaaccgcctg ttggaaagcc gttgggtcat
   229921 cgggcgtgag gtctcgttgc ggcaggtccc gcaccgtctg tcgtcttgga gttggtcgag
   229981 gggcttggcc ttcgcgaaat cgcgctactg gttgctaatg gcgccctgcg tacgaagttc
   230041 ttctcgtctg ctcgtggcga cgatctgcgg tcgtgcagtc cacccgtgtt tcgtggggag
   230101 cggttcgtgg ggtacatgat gttcctggtg gtggagggga actactcacc gtcacttgcc
   230161 tgctcgaggc gctcccgctg tcgtggagcc gtcgatcccc gtccagcgga ttcacacacg
   230221 cactagtcgg gtgggacttg ctcgggtagc gctcagggcg tgtcggccgg ctcgtcgtaa
   230281 tggttctgtg acctggtgtg acgacatgtc cctggtttgt ggtgtggggg tgccggcgac
   230341 ggtcagcact ccgcgggatc ggggcccacg agtctgaccc gccgggaaca gcagatagcc
   230401 gaacttgtcg ccgagggctt caccaacaag tcgatcgccg acaggctcgt catttcgcaa
   230461 acgcaccgcg caggggcatg tcgagcgcgt actctccaag ctgggattcg cctctcgtac
   230521 tcaaatcgcg gcctggatca tcgtgcagaa gcagggccag aagtcctgat cgcaccgagc
   230581 cgaggccgac tcggcgtcct tcgccgaacc gaatgggtcg atcatcggca acaagcagat
   230641 gcgcgacgcg ttgtaacacg acatcgcagg cgaagagtga atcaaccttt gtagcaacaa
   230701 tattcggaca cctattcgct agagcgtgta cgcgaggttg tgtcggtctg ggcgtggcgc
   230761 cggggagttg gccggcgcgg tggttaggct ctgggaggtg agcggtagtg agcgggtggt
   230821 gatgttcgac atcgatggtg ggctggcgga cctgtcaaaa ttcgctcaca tcttggccgg
   230881 cgactcggcg gcgagtcgcc gacgggcatg gcagcggttc tttgaacatg tcgggcaagc
   230941 ggcggtggtc gagccgggcc gggacctggt ggaggcggtg gccggtctgg gattcgttcc
   231001 ggtgtactcg acgacccgac cggtctcgtg cgcggggcag acccggttgt ggctcggcga
   231061 gcacggattt ccgcaagggc gagcgttgct gtgccgctct cgtgatgatg tccggccggc
   231121 cgtggaggtc aaggctggcc attgtcgggc ggtcgggcgg tggttgtcgg cgttcgtcga
   231181 cgacgaatcg gaggtggtgg acgcactacg atcccgcggt gtccatgcgc attcgttcga
   231241 cggtttgtcc gagctcgggg tgcgcgagtt gcgaacgacg ctgtccgcgg ggacaggcgc
   231301 cacgctgccc gtcgtgggcc gcgccgaccg cgcggccacg atcgccgtgg tgtccgcacc
   231361 gcaaacgcgg cacgataaag cggggaacgg actgagcagg tgtgccggca gggctgaacc
   231421 acggcggaac tatgcgggcg gtgctccgcg tacacgacgg cgctcttgtg tcgcagtgtg
   231481 gccgggtagc cgccgagccg ctcggccggc gaggctaact ctgcggtgat acaattttgt
   231541 ataactgcag ttggaggtgg tgcacggtgg cgttgacgga tgtggagcgt gatctgcggg
   231601 cgatcccggc ggagaaggaa ctgctgcaga tcaagttgct gcgtgcggtg gcgcacgcga
   231661 cggacaatca ggtgccgcag cgggtgatcg cgaagaacct ggccgtgacg cagccggagg
   231721 tcagccggat cgtgaagaag ctgcggttga acccgtcggc ccgggaccgc tccccgcggg
   231781 aggtgctgct cgagcatgcg gcgaagcgga tcgatcatga tcggatgatg gccgagttgg
   231841 tggcctggga ttacaccttc gggcatgtcc cggctgacga cccgctcggt gccagttatc
   231901 tgagggggac gtgggatcag atcgaacgct cccgcgacct gctcggtgac gacgactatc
   231961 gggtgcttct cgcggccacg gccgaccggc gtgcgcgggc gaatgcactc tgatccggcc
   232021 accgcggtcg ccgccgagat cgaggcctgg tgccggcccg gcgggaaact cgacaaggac
   232081 ggtgcccgcg cctcgatcca tctcttcggc ccggttgccc gtcgccgcac gcgggatgcg
   232141 atcgtcgatg cctacctggc cgagcagacc aacgtcggtg tcggccgtca gttcctggcg
   232201 ttggcgaccg ccggaccacc gggggtgggg aagtcgtcga gtatcaaccg ccggcacctc
   232261 gccgggcagg gatggcgggt gctcgatgcg gacaagctca aggactttct gctgcgggac
   232321 gccgtcgagc agggcatcta caccgacctc ctagagatcg acctcgcgga cgggcaccgc
   232381 ctgatgccgc gtgaactcgc caccctggtg cacaccgagt cgacgaagct cctcgacatc
   232441 atcaccgaga tctgtctggc ccgtggggag aacctggtcc tcgagggcac gttcagctgg
   232501 cccggcctcg gcccgcggct actgagagat ctcgcgtacg cggagtatga gaagttcacg
   232561 atcctcgacg tcgaggcacc ggcgcacatt gtgcgggccc gtgccctcac ccgttggtgg
   232621 cggggcaggc aggaagcgct gcgtggcggt gacgggttcg gtggccggtt caccccgggg
   232681 ttcgtcatcg acgccctcta cgccggcgac tccgaagaga cggtgtgcgc gcgtaacgcg
   232741 cgggctgcgt tcgatcatcc actgtccgcg gagatcccga cggtcgagct gctcgtcgag
   232801 cacgccgatg atggagatga gacgtgggtg aaggagaacg gtgtcgtggt ctacccgcag
   232861 attccggccg accgacccga gccctgacct ttccgtccgt gccacgtgcc acccgccagg
   232921 atttgaatcc gcaacgcctc ggccgcgagc ccacgggcga cgtgagaggt tgctcggcga
   232981 cgacgatgac gtccgaatcc gggaagccgg gattccggag atgcgaggca ctccgattga
   233041 tcgacgttct caggcgcagt cccggcagat cagctgctga tgttcggcga ggcggctgcg
   233101 atggtggacc agaaagcaac tggtacaggt gaattcgtcc gactgcttgg ggattacgcg
   233161 gacggtgaat tcttcaccgg acaggtcggc gccgggcagt tcgaaggact cggcggtgtc
   233221 ggcgtcctcg acgtccacgg cgggggactg ggtgtctttc cggctggcgg tcagctgttc
   233281 gagggacgtg tccggctcgt cggattcggt gactcggggg gcgtcgtagt cggtggccat
   233341 gactgctgct tcctcatgct ctgcgggttt ggacccgcca cactagaggg tccggcggcg
   233401 cgacaggctc tcggggtgcg gcgtgcgggg gctcaacatc ctgggcggtg aggggattta
   233461 ggcgtcggtt cggctccgta tactggtttg ccgtcgtctg gggcgtgcag gtcgttgccg
   233521 gtgcttccat gcggtcagtg cgcgtgtcgg tgctcgcgct cgctagcttg ctctgatggg
   233581 aaccgggact gggagacttc ctgtcatgca gcaacttctc gccgatcacg aacccctcgt
   233641 caccgtggtg atggttgtgg tcgtagtagc gctcgccgcc gccgcggtgt ggacgatctt
   233701 ccgctgaccg gcacggtgcc ggatcgtatg gcgcggcgac ctgcacccag gaccctgcgt
   233761 gagagcgccg gccaccgccc gggcgaccag atcgtcggct gttcccgccg aactcggcgt
   233821 cgggggtctc agagtccacc ggagagctgc tcgacctcct cgtggacagt gcactccttc
   233881 acgcgatcgc agagtcggat gggtggttcg gtgaccaccg ttgttgcgtt ctctacggct
   233941 ctctagcgcg cacggcccgg ggtcgcgcct tcgatgccac cccgagacgc ccatcccgag
   234001 acgctcagcg atgtctcggg acggcctggc tttagatgct gccggggatg tccaggactt
   234061 cgatcccggc cgtctcgtac agcgaatccc agaggtcggt gcgatccggc aaacgtgtcg
   234121 gtgcccacca ctgtgaagcc gctggggact gccaccgtgc tggtctggtc cccactgggt
   234181 gcgaacaggg cgacgcaggc gtgcacgtgg gtcatttcgt cccgcgccca gtatcggatt
   234241 ccatcgaagc cggctgcgtg tagtgcctgt ggccattgct gggtgagcgc gtagtcagtg
   234301 gttgtcgaga tctcggacgt cattccgaat ccgatcgcgg cgttcgaggt cgcgtcggcg
   234361 aggtgcagtt ctcggttgac taccaccgcg gagatgactc gttgtgcgat ctccgggctc
   234421 gggatgagtt ggattccgca ccaggtctcg aggagggtga tcagttcgga ctcggcggtg
   234481 tagcaggtcc cgtcggggcc gggaatgtcg aagcggcccc cgaggctggt gccgaacccg
   234541 agcgaacttg gccccgtgcg tgcggtgcat cgtcgtgccg gcgggcacag cgtaaacagg
   234601 gaaccgtccc cggagcgtgt ccggggacgg cgggtcggcg aggtgttgtg tcgctcggga
   234661 agcgctcacg aagccagccg ttcggctacc tgccgggcga gcgtcacgac atcgacggtg
   234721 tcaccgtcga ggagggcctg tctcggggtg cggtcgtcga gttcgggtcg tgggctcgac
   234781 atccacgagg cgatggtcca ggactggacg tcggcgtgcg cccacacttt caggacgtct
   234841 ttgattcccc ggatcgggac gtggggtgcg gtgtcggtca atccgcccga ccagtagccg
   234901 atcgtcccgt cggcggcctc gaggcgcagg acccgagact ctttgacggc ttggctgagg
   234961 gcctgcttcg tccagccggt ggcgtcgacg gcctgcttgt gggtcaagat cgcgccgatg
   235021 tggttctccc atgcgcggcg ggccttgagg ttcgagagca cgttcttcac gccggcggcg
   235081 acgtatttgg cgtcgacgtc gtcgagctgc tcggcggcca tcccgctggc agtgagctgg
   235141 tcgtcggcga ctttcttgag tggtgtgctc atgccaccgt gatcctcggt caaggaggtc
   235201 aagtcaaggg gtcaagcatt cctctgagca acgaccctgc agcggtctga acgggcagtt
   235261 tcttcacaag cagcgggtga gtgagggaac cgagtagggc gaggtgaacc ctcgtggtgc
   235321 agaagacttg tcagtcctgg cggatccgcg ccgcgctgac gtccgcccgc agcgtgacgg
   235381 gtgaggtgta cgcagtcagc gtggaaggtc ggtcgtcgct attgcggcca gcggctgttc
   235441 tgtcacaccg catcgtcgcg tcccttcagg ggtaggcggc tcttcgttgc ggcccgcttc
   235501 cgctgccgcc gcggcccacg atccgcaggc tccgctgatc ggcgctgatg gacaagccgt
   235561 cgtgcaccga caatgggacc cgacttcaga gacggggatg tgtgatctcg gcggtgatga
   235621 agcagatgtg gcccggagtg tcgaccagga agacggaggg gtcgccggcg tcctgcgatc
   235681 cgatgaagaa ggcccaggtt ttcgatgcgg catggttgag gtagtcgtcc tcggcttcgt
   235741 cgcgggcatc gcgcaagtcg cgccgaaggg tgcggatgcg gctgtcggtc catccggtgt
   235801 ggtcgatgaa cagtcgatac ggctcaatga gccgattggc cgcggggtcg cgtcgaccgg
   235861 cgtagagggt gacgaccgtg cggtcgtcgg tttcgtcagg ccggtcgaag atacgcaggg
   235921 gcgcgtagaa gacgcggcgg taccgctccc gcgggaggga ctggcgggtg tcgcggagcc
   235981 gcttgaacgc gaattggtag tgggtggcct cgacgccggg gatgtcgatg agcatgtccc
   236041 tgcggtggtg ggggtgggca atgaaggcgc ggcagagcgg gcggatggtg cgggcgattc
   236101 cccgggtgtg gtgatcgacc gtggtggagc cgtcgcctct ggtccggcgt gaggatgacc
   236161 cgccgcggga gtggttgacg gcgctgttgt cgtcgggtgt ggtgatggtc cgctcggtca
   236221 tgggtaccag ccggcttggg taagagtgct ggccggtgag tgggttgtcc ggttcgcctc
   236281 ccgttgctgg tggattcgat gacgacgtcg gcgtacagac agtgcggttc gtgcaccgag
   236341 tcggggtggg accggaagtg cggtgcacgg cgcaggggtg gggtgcggcc gatgacggcg
   236401 atgacgcgtg cgtggcagcc gtcggtttcg cagacgaagt ttttccggac cgattcgacc
   236461 cagtcgctgt cgaggttgac caggtcgtcg gcgaggagga cgccgagggc gggcattgtg
   236521 atgatgtgtg cgctgtccat tggcccggca gtgtattcgg ctggtcggac acgcccgggc
   236581 aggtgggctg cgttgcgccc gggacgttcc cgcaacggct acgggagggc aggggtgaag
   236641 gggatgaggc gcaggatccc gaatcgccac cggactgccc gttcgaacgc ggtgatgtgg
   236701 tcgtcttggc tgcctgggcc ccacccgttg aggttcatct ggttgccgct ggtgaccggt
   236761 ggctgcgacc aggcgtcctg ggttgccgga ccgactgcgg cgtcgatgtt cgcgatagtt
   236821 ttcgcgtaga tcttccctag gcggaggctt tcggtgctga cccagatccg ggaggcggtg
   236881 agctgttctt ggatatcgcc accgagttgg gtgagtgcgg tgagggtttc ggggttgtcg
   236941 gaggtgcgtc gtcggatgcg gtaggggtat tcggctcggg cgacgagggt gcgggtggcc
   237001 agggtgtatc cctcgcggcg ttttccggcg gtttcgcgta ggccgctgat gccggcggtg
   237061 aggaggccgc cgagcacgga ggagccgagt gcgaggggga ctacttgtac gaggctgggt
   237121 aggtcggtca tcggctcttc cggaggtcgt cgtgctcgtg gttggtggga cggcggtgtt
   237181 gccatgttcg gaccgccctg cgcagtgctc ggctggcgat tgggtaggtg tccatcgccg
   237241 agggggtcgg aagattgtgc gtggtggggg tgccgtgtgg tgcgtcctcg gtaggccagt
   237301 tgtctgtgcg gcgccagtgc tgttcgagga acaggtggcg gtgcacgcgg tcgacgtagt
   237361 cctcgagtcc gtcctccgga acccatttca gcggtcgcgg atcgttggga aaccacaggc
   237421 agagctgccc ccagtagtcg ttgtccgcgc cgagcggtgc gggatagcgg tgcttccatc
   237481 ggcgctcggg tccgagggga aacgtcaggg ggtcgccgta ctcgcggatg ctgatacggg
   237541 cccgctcctt gtggtagccg gcggtggcgg tttccggggg cggggcgaag gtgaggtcga
   237601 gaacgtatcc gccgatgcgt ggtgcccagg cccggtcgac gacgatgccg gcctgcatcg
   237661 tcgtcagccg ggcgatcgcc cgcccgggat cggcgaacag gtcggtcagc gcggtgccca
   237721 tgcccgcccc ggacgggtcg gttgccggcc actggtggag gttgtcggcc ggccggtgct
   237781 ggtccgactg cccacggtgt tccacgccgc gagcgcggcg ccgggtgacc ggggtgtcgc
   237841 ggcggggaag ctatcgccga aaaggctgtg ccagatgtcg atcgcggctt cggtatcgcc
   237901 atctgcttcg aggtcgagtg cctcggctgc ccgggcggcg aagtcggaga acttcccggc
   237961 ggcgacttca cgctcagact gggaccactt gacggtgacg tcgtcatcgc cggcgggttc
   238021 gatcaccgca ccgcggaccg cgttcttcgc gtgttcgaga gactccgcga cggcacgttt
   238081 gtcggtcttc gtggtgtgga tcgccgcgta cgcgagggat tccaccagga tccccttgac
   238141 gaagccgagc tgctcctcgt ggttcttgac cagcgccttg agctggcgga cctggtggac
   238201 gaagcgtccg ccggtggcct ggttgcgggt ggcgacggcg cggagctggc gtcgggtgtt
   238261 gctgggctcc cagtgctgct gatcccggtc gccgatcagc acgtcggcgc cgtcgaggtc
   238321 gaacgcgggg accaggtcga tgtcgaagct gatgtcggga aaggtcaccc gcagggcctt
   238381 tccggacggc ttgtcaccct cgtcgaattc tgcttccggc cacaccgttt cgatcgcgcg
   238441 gcggaaccag gccatcgccg tggcgggacc gtcggggcct tggagttgtt cccagtgagt
   238501 gtctttgagg acgatgacga tatcgacgtc cttgagcggt gcgagcatag tcttgcgggc
   238561 gaaggaccct tgcaggaagc tcgtcgcgac gaagccggca tcgtcgagga cgtcgcggat
   238621 ggcggtgtgc ttgtgctgag cctgctcgcg ttgttgcgga tcgaggttga ggttgcggtc
   238681 gaattcggcg aatgcgccgt cgacggtgtg gcccatgggg ctattccttc ccagaaaaga
   238741 gggccggcca gtgatgtggc cggaagggag aacggtgttg tggggcagca gaactgatct
   238801 ggctgctcac cggaatgtcc ggcgacgcgg acgggatcct gtctgcgtcg ccggtgtcgg
   238861 tgtcggtgct accgccgagg cagggcgagg aggttgttgg tccacacccg atctgcgtag
   238921 gtccgcagat acttctcacc ccgggcgggg ctgacgacgc cgacgtcgac gcggttgccg
   238981 cgggcgtcct cgacgtaggc cttgccgtcc tcgttctcga tccacgccac gatctgtgcg
   239041 cgggtgttct cgccggtctt gccggccgac gggttcgtcc accacaggcg ggcgatgtgc
   239101 tggtggtcgg tgccgccgga caggcggatg ccggtgatgt tgattgccac gagaataatt
   239161 tcctcactct tgtgtgccga tgtttcgtcg ggtgagtgag ggcgttacgc tgggtctgcg
   239221 aagacgggtt gcgtagcggc cctcgggttg aggcggtcat gtccagtgcc cgcctcacct
   239281 gttactccgg gttgatgtca catgtgttcc tcctcttcgg ttgaggcttg attgtggccg
   239341 gggtggtcgc tcgggtccgg aggtagcgcc tcgttcggtt tcaccccgag gatgaccgtc
   239401 gtggggtcgg tcgagtggtt gctcggaatc gacagggcga tccgggccga ggcccaccac
   239461 tgcggcgtcc ccgccgccgc gtcgtcggca tcgtctgtgg gggttcgggc gatcgcgaaa
   239521 ccgatcgtcg cgtcggcgtc gttgagggac ctctccgtcc cgtccttgta cacgacccgg
   239581 atcttcccgc ggcacgtcgg gcagcaggcg cgcatcagca cgtaggacac cacccgcggc
   239641 acgccgaggg acgcctcgta ggaggtgacg tgctggcggg cgacggattc gagtccgccg
   239701 atgtcgagta gttcgtcccg ttgggcgcgg atgaggaact tccacaccgg cagcagttcc
   239761 ttgagcgcct cgatcgatac gccggcgtca cgggcctgga ggatccactt catcaaccag
   239821 accacgctta ccgggtacgt cccggcccgc gtcccgaccc gcacgctgcg gggtacgaga
   239881 ccttcggtca cgtagaacgt caattgccga tcgctcagcg agaacccggc ctcgcggacc
   239941 tgcgccagca attccgactt ggtgacctgg tcggggaggt cgccctgaag atccagatac
   240001 tcgaggaagc cgttctcttc gtgtaccacc accctgatca ccccctcgca ttgtctatct
   240061 acagtgctgc tgtagtcgcc tacctgactc tggagtaagg gtacgcttcg ctgtcgagac
   240121 gatgttaccg acaagtagtt atgtgaatca catccgaact tgagccctgc ggggcacccc
   240181 ctcgagacgt gcgcagcacc ccgaccgcac cggaataggg caagaaaatt gcattctggg
   240241 tgatattatt gtgccgtgaa gatgagtgat gctgccgtgg cggtggcgga gttcggtgcc
   240301 gagcaatggg gcctgatcac ctcggcgcag gcccggatgc tcggtgtcac cgcggtgcag
   240361 atgaaacggc tcgcggaccg cggcgcgctc gagcgtgtgc atcacgggat ctaccgcatg
   240421 accagactcc cgtacgaccc ccgccaggac ctgcgcgtcg cgtgggtcgc gctcgacctg
   240481 cacacccccg cctgggagcg cctgtcccag ccgtttcccg ggggagtggt ctcccatcgc
   240541 agcgccgcgc acctgcacga ggtcggcgac ctcgacgccg acctgaccga gctcacctgc
   240601 cggcgacgga tccggctgcg cctgcccgac atccgcatcc acaccggaac cgtcgccgtc
   240661 gacgactgga ccgtcgtcga cgggctcccg gtgaccacgg cacggcgcac gatcgccgac
   240721 ctcgccgccg agggaatcga cggcggccac ctcgccggca tcgtccgtga cgccctcgcc
   240781 cgcgaactcg tctcggtccc ggaactcgag agcaccctcg cctcgtccgc cttcgactac
   240841 ggccacgtcc tcggcgacgg caggcccttc ctcgactccc tgatcgccca agccggggtc
   240901 tcccagaaca ccctcggcct cgccgacgcg taccggagaa gcacgaaagc atcagctgcc
   240961 cacttcgcta ccgaccatcg ggcgggtccg cgcctacccg accgcccctc ggccgcactc
   241021 gcgacccggt cggtcgccga cctcgaccgc gatgaccgtg tgctgccctt cgcgttcgcc
   241081 gcctccaccg gccggttcga tgagctactg aagaggtcca acgacgcgcg cgtcgcggac
   241141 gcactcgggg gcctcgcggt tacccaactc gcaccactgg gcgagcagct ccgcgctctc
   241201 gccgcggccg ccgccggccc tcccgagatg gaggcggccc gcaccgcgct cctgcagagc
   241261 ctgcagacac cgtccacaga catgatgacg acatcggtgg cgaaggccat cgaaccggtg
   241321 gcccgccgtg ccgccgcgaa catggccgcg cggctgcgtg gcgaacagca accgccgaac
   241381 caggcggcgg gcaccgggga cccgactccg gatgcgcaag atggcgatac cgaacgcaca
   241441 ggccggcctc gacacgaatg agactcccta aatgacgcag tccccccatc aatttcgggc
   241501 ctcgatccag caacgactga agaaccgctc cgcgagcagc gggcaaccgc tgcagcaact
   241561 gcgccgcacg tacgtcatga cacgctttct ggccagggtg tttgacgccg accccgacgg
   241621 ctgggtgctc aagggcggca ccggcatgat ggtgcggctc ccgaaggccc gctacagcaa
   241681 ggacgtcgac ctgatgtcca ccgccttcac cgacatcgca gacgccatcg acaaactacg
   241741 agagatactc cgccacgagg tcgacccgtt cacctacacg atcgcgcgca aggaggacat
   241801 cgccgacgac aagggcgctc ggatcagtgt gcaggtacgg ctcgggacga cggtgttcga
   241861 caacttcccc atcgacctgg tcacccaccg agggctggtc ggaccggtcg agatccatcc
   241921 gatcccgcac gtgatcgacc tgggcgatac cgtagaaccc gtccgggtcc gcgtctaccc
   241981 gatcgccgac cagatcgccg acaaactctg cgccatatac gaataccacc tgcgcaacgg
   242041 tcaaccgccg cccggtgaca cctcgacccg gtaccgcgat ctcgtcgatc tcctcctcat
   242101 cagccagagc ttgccgatcc ctctgggaca ggcagtcgag gcgctcgaga accaacgccg
   242161 ggtgcgcaat cacatggaac ttccaccgga gctacgaaca cccgggcccg actggcacga
   242221 caactggcca gcacaggcaa aaggcagccc gctacccgat tccctccacg agctgaatgc
   242281 tgcactgacc gcggccgccg ggtgctacaa cagcattctc gccgggatac ccacgacgag
   242341 ccgagaggca acgtgggatc acctgcgcca gcagtgggcc gagcgctgac cctttccgac
   242401 gaatcggagg cgagcccgcg caacagggcc acttgccggc gaatgttgtc gatgacaatc
   242461 gatgacaatg ggacagatga aggggttcaa gcgcgtttag gggccgtagc ggcgacaacg
   242521 tgattggcac taccgtcccc cgcatgccca gactcacgga ggaacaaaag aaacagcgcg
   242581 ccgccgacaa agtcatgcgt cacgcactcg aagccgagga acgggatcgg cgcgaaaccc
   242641 tgaagcgact cgaatgggag aagaacggaa catacctgac ccgtgccgag ttcgaagcga
   242701 acatgccctg ccgaggatgc ggcaggccgt tcatcgacaa ccgcggtcca tggccggcac
   242761 agatccatat gaccccggct gaaagtgcgg aatacgctgc cgagaacaag tattacctcg
   242821 atagacaccg cgactgccag gcctaccgaa ccggcatcga tagctcacgg atcacacact
   242881 gtggattctg cttcccgcca ccgccgctca gctcccggca gattgacgtc atcagaaaag
   242941 agttcgggag ggcctcgaag acgcccgaac acgaactcga catctggaag tccacactca
   243001 cgtgtggaca cacagtccag ggtagacagc accgcacttc cacatcccgg acgatcgcag
   243061 tcgaggattg cccggaatgc tcggcgcgac gaggggtggt ccgggccgaa cggatcgggc
   243121 cagcagctcc gccaccacat caaacagttc ctgatcagcc tattgtgacc gcagcagagt
   243181 tcgacgcaat caagttggtg gaagaacaca aggtggcctt gcgactagcg gaagatcggc
   243241 tgaagcagat ccgccgcgat gcccatcgtg gtgtcagttt cgaagactga attcaaccag
   243301 agccccagat gcgaacccgg ctgtagagcg gcgacgtgat cgactaccgc gaaagttgca
   243361 gccagctggt ggccgccggg gatcttcgcg gctcgaggcc gccgacaaga tgacctaccg
   243421 actgtcgccg gatcccgatg gtggaacgcg aactgcttca ggtcgcgacc cgcagacccg
   243481 gcccttgtcc tcgccgggtg agtgcagggg tgcgggcgga tgcagacgtc gtctatttgt
   243541 aaccgctgcg gggttgttgc ggccgggtcc gccgcgaccg cttgccctgg accacggaca
   243601 tccccgcgga gccggtcgat cacctccgcg aaaccacacg aattactcgg acgcccaggt
   243661 cggtggggtg tgcgaccgca tcatcctggt ggccccgcac ggccgcactt cggctcggct
   243721 cccggtcgcc ggcacctgaa gggtgggagg gtgcgggtat gacattgcgg ctgccgaccg
   243781 ccctcgtgac ggattcggac gctgcggcaa tcgcggccct gaaccggtat tgcgaccgcc
   243841 cgtatctggg cggcgacggc gcctacgtcg gagtgtactt cgactcgtgg tcgaggaccg
   243901 gggaccgggt gagggaggcg gaccggttca ccgcggacga tctggtcgcg gcgggtgttc
   243961 ctgtccgtgc aggtcccacc gagggcggcg cgggcgatcc tgaacgtcct tctgacggcg
   244021 gtgggcccgg atcgggtctt ggtcgacgaa ccggtcccgc tgaccccggg atggcccgcc
   244081 tgggacctgg aaaccgcgct ccgcggcctg cgggacgtgg gctggacgaa ggccacgaag
   244141 ttgatcgccc gcaaacgccc ccggctgtat ccgatcttcg gtttcggggg caacgctccg
   244201 acggtgtcga tcaggacagc tcagtcaggt gctgggcacc gagcgggcgc atgtgaatcc
   244261 ggtgcgggag gccctttgcg ccgacggcgg cgatggtggc gtggttcatg atcgggatgg
   244321 agctgttctt cacccccgac tgaaccgccg gcgaagctag gggatctgcg tgggctggcg
   244381 gcggcccgcg cccgacttcc ggggtgcggg cggtgtactt gtgtgggggc gtaatggtgc
   244441 tgtgacctgg tgtggtgaca tgtccccggt ttgtgatgtg ggggtgtcgg cgacgtgccg
   244501 ggggagtgcc ggcgccgggg tgcgcgtggg tgtctgtttc atgtggtttt gggctgattt
   244561 tgaaagttgt tgattagcaa tatatttgag taatcagttg gtgaataatc ttttacatga
   244621 gttgtgcaca aatggcagat tataagattc gtaatatgtt gtaaatcaac aaatttggag
   244681 attatgagat tttcgactgt ttcgagttgc atgaaggatg ggtggtatgc tgtgggtatg
   244741 acaatgggtg gcgcgggaag gcgagtggtc ggtggggagg gcccccgccc ccagcctcgt
   244801 tgggatgtgg ggggactgaa tcgagctttc cgatgaaaag agcagttgag aacctaattt
   244861 cggaaactca gaggagcgaa gcgactcgat cgacggcaac gggaattgac ccactgcgag
   244921 ccgcgcagcg gctccctggc ggggagcgca gcgactcgcc ccgtctcccg gtgcggagca
   244981 ccgggagcag cgccgcg
//