LOCUS       AP011115             7913450 bp    DNA     linear   BCT 08-MAY-2009
DEFINITION  Rhodococcus opacus B4 DNA, complete genome.
ACCESSION   AP011115
VERSION     AP011115.1
DBLINK      BioProject:PRJDA34839
KEYWORDS    .
SOURCE      Rhodococcus opacus B4
  ORGANISM  Rhodococcus opacus B4
            Bacteria; Actinobacteria; Actinobacteridae; Actinomycetales;
            Corynebacterineae; Nocardiaceae; Rhodococcus.
REFERENCE   1  (bases 1 to 7913450)
  AUTHORS   Sekine,M., Hosoyama,A., Kosugi,H., Yamada,R., Matsuo,Y.,
            Tsukatani,N., Fujisawa,T., Takarada,H., Omata,S., Kishi,E.,
            Shimizu,A., Koga,C., Saito,S., Nakazawa,H., Sekigawa,T.,
            Nishiko,R., Takeyama,M., Tanikawa,S., Tago,S., Fujita,N., Kato,J.,
            Na,K., Ohtake,H., Nagayasu,K. and Harayama,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (30-MAR-2009) to the DDBJ/EMBL/GenBank databases.
            Contact:Director-General Department of Biotechnology
            National Institute of Technology and Evaluation, NITE Genome
            Analysis Center (NGAC), Department of Biotechnology; 2-49-10
            Nishihara, Shibuya-ku, Tokyo 151-0066, Japan
            URL    :http://www.bio.nite.go.jp/
REFERENCE   2
  AUTHORS   Takarada,H., Sekine,M., Hosoyama,A., Yamada,R., Fujisawa,T.,
            Omata,S., Shimizu,A., Tsukatani,N., Tanikawa,S., Fujita,N. and
            Harayama,S.
  TITLE     Comparison of the complete genome sequences of Rhodococcus
            erythropolis PR4 and Rhodococcus opacus B4
  JOURNAL   Unpublished (2009)
COMMENT     Kato,J., Na,K., Ohtake,H. and Nagayasu,K. are at Department of
            Molecular Biotechnology, Hiroshima University.
            
            Rhodococcus opacus B-4 strain was isolated as a benzene-tolerant
            bacterium (Kyung-su Na et al 2005). The complete genome analysis
            of R. opacus B-4 was carried out by NITE. The genome analysis
            indicated that this strain has one linear chromosome, two linear
            plasmids pROB01, pROB02, and three circular plasmids pKNR, pKNR01,
            pKNR02.
            
            This work was supported by New Energy and Industrial Technology
            Development Organization (NEDO).
            
            Please visit our web site.
            URL:http://www.bio.nite.go.jp/
            
            DOGAN ; Database of Genomes Analyzed at NITE
            The database contains genome sequence data, physical maps and the
            genomic and proteomic data of the microorganisms analyzed.
            URL:http://www.bio.nite.go.jp/dogan/Top
            
            The microbial genomic DNA clones used for the sequencing project
            are available through the NBRC.
            URL:http://www.nbrc.nite.go.jp/e/index.html
FEATURES             Location/Qualifiers
     source          1..7913450
                     /db_xref="taxon:632772"
                     /mol_type="genomic DNA"
                     /organism="Rhodococcus opacus B4"
                     /strain="B4"
     CDS             899..1303
                     /codon_start=1
                     /locus_tag="ROP_00010"
                     /product="hypothetical protein"
                     /protein_id="BAH48248.1"
                     /transl_table=11
                     /translation="MPAHRQAPPLPQGTSRTPAKTKKVLEASLRQTTLLGHEKIGTNH
                     LLLALLDDPASTGTQILTDLASLPISEMHEHLRRELAQQPTPGPAHRIPIRLSNDKYT
                     RAHAAAHTAGQNLETSGPRPHHRRPRTTRIAG"
     CDS             1300..1557
                     /codon_start=1
                     /locus_tag="ROP_00020"
                     /product="hypothetical protein"
                     /protein_id="BAH48249.1"
                     /transl_table=11
                     /translation="MTQKIDMVDPRHGRREMSAHALRIPRRRPLSDTLAEAFPELHRA
                     ALPDQTLFYGNHVHFGIPSGTLTPPSFRLPCGRRRERRVSG"
     CDS             complement(1496..1861)
                     /codon_start=1
                     /locus_tag="ROP_00030"
                     /product="hypothetical protein"
                     /protein_id="BAH48250.1"
                     /transl_table=11
                     /translation="MADGSHYTYRVTWSEPDSEFVGIVAEFPSLSWLAETQNEALDGI
                     VAVVRDVLEDMASTGEQPPVPIADRSYSGIFTVRTSPRVHRTLAVEAEEQGVSLNLLV
                     NQKLSAPVGGRTGAETKAG"
     CDS             2534..3160
                     /codon_start=1
                     /locus_tag="ROP_00040"
                     /product="hypothetical protein"
                     /protein_id="BAH48251.1"
                     /transl_table=11
                     /translation="MDLIRPLQTVTPTLDGDVLSALAAASEATFTTGQLHRVLHHHSE
                     EGIRKVLQRLSKQGTVLSSRVGNAFVYQLNREHLAFPHVVGLADLSGEFLRRLEARLA
                     GWEIPPVYAAVFGSAARGTMTIDSDIDIFLVRPDDVAEEEWDEQVAELMAEVTRWTGN
                     DARDLQFAQSEIAGRGTDEPVLRDVVKEGLTVAGSRAGFTRLLRRGNR"
     CDS             3160..3567
                     /codon_start=1
                     /locus_tag="ROP_00050"
                     /product="hypothetical protein"
                     /protein_id="BAH48252.1"
                     /transl_table=11
                     /translation="MGRTRPCDQAVRRGRLKKAEQFFHLAEIGRDFADEPDGVDDAVV
                     TLWVHAGIAASDVICCARLGKHAQGEDHKDAVTVLGSVDPTTAKHLSVLLGLKTRSGY
                     TDMPTSRTESKRAERAAEALIEAARRAHAQAGT"
     CDS             complement(5167..6435)
                     /codon_start=1
                     /locus_tag="ROP_00060"
                     /product="putative MFS transporter"
                     /protein_id="BAH48253.1"
                     /transl_table=11
                     /translation="MADTSALPQTTPTLDRGGLRRVLTVLCLTEITSWGILYYAFPVL
                     SVSISADTGWSLPVIVAAFSLSQLAAALTGIPVGRIIDRIGPRAVMTAGSVLAVPSLL
                     VVAAAPNLPIFYAGWIAAGIAMGAVLYPPAFAALTRWYGDGYVKALMILTLAAGLAST
                     VFAPLTAALVDLYDWRATYLALAAILAVVTVPGHLLGLRGRWPHPLVPTGTHPVDHRD
                     ASRSWAFLALVIALSLGAFAAFAGVFNLVPLLIEQGFSPSLAALTLGLGGAGQVLGRI
                     GYLPLAARTTARTRIVMILAATAVTTALLGIVSTMVALIAVAIGAGLVRGIFTLIQAT
                     AITDRWGATHYGRLNGLMSAPVVIVMALAPWAGTALSAWTGSYAHAYLILAGAAVLAA
                     MVATASIPRVGERGRGRRVLNPARELPEVT"
     CDS             complement(6440..7825)
                     /codon_start=1
                     /locus_tag="ROP_00070"
                     /product="putative oxidoreductase"
                     /protein_id="BAH48254.1"
                     /transl_table=11
                     /translation="MNVDGRIFEMNTLPVVVVGAGPVGLAAAAQLRERGLTALVFERG
                     ESAGAAIAEWNHVRLFSRWGELIDPAARRLLDATGWIAPDDDAYPTGQDWTRDYLVPL
                     ANALGDDIVQLNTEVVGVARRGRDRVVDAGRDTEPLSVHLRRADGTEDRITAQAVIDA
                     SGTWTTPNPLGGEGLPALGERDAVDVIEYRVPNLADEAVRARYAGKHIVIAGSGHSAM
                     TAIVALADLEKQTPGTRISWVLRRGDVGSTFGGGDDDQLPARGALGLRAKAALDAGLL
                     TVVPGFRTATIEPADDDDRVVLVSDTGARIDDVDRVVVLTGFRPDLSWLSEIRLGLDP
                     VLQAPTQLAPLIDPNVHSCGTVYPHGVAELSHPEPNVFLAGMKSYGRAPTFLAMTGYE
                     QVRSIAATLDGDHDAAARVELTLPETGVCGGAGVFDDPDTPADAVDAPAGCCPAPDLA
                     LISLTTTRAGG"
     CDS             7856..8770
                     /codon_start=1
                     /locus_tag="ROP_00080"
                     /product="putative ArsR family transcriptional regulator"
                     /protein_id="BAH48255.1"
                     /transl_table=11
                     /translation="MSMNATIDVYRYSEPMTSLDMPDVRTAAVDSVDALAPDDAATYA
                     GWFACLADPTRVRLLHQVASHPAGITVGELAEALGIGQPTVSHHVRKLADVGFVTAEK
                     NGTSTVVVVNPSCCTGLPHAADAVMGVLTPRPCCPDDLPDDVTVRPMREQDWEAVRRI
                     YGEGIATRTATFTTEVPTRETLDAQWLPRHRWVAEIDDVVVGWAALTPTSGRDCYQGV
                     AENSIYVADGMRGRGVGKALLRTQVIAADEAGIWTLQTSIFPENRASIALHHSAGFRT
                     IGVRERIAQLDGIWRDTVFLERRSALTV"
     CDS             8841..9614
                     /codon_start=1
                     /locus_tag="ROP_00090"
                     /product="putative MerR family transcriptional regulator"
                     /protein_id="BAH48256.1"
                     /transl_table=11
                     /translation="MSTYRISQLAELSAVPATTLRFYETAGLLPAARTASGYRVYDDA
                     AVDRLEFISSAKHLGLPLEEIRELLEVWEQGVCAHVRQRMLPMITDRITDADRRIAEL
                     SAFSAHLTRVRTELSQPPPAGACGPDCGCLSTAPAAPVAVAFTRTRPDPVPKSDGRPE
                     MPVACTLGGDEQGERIQQWRQVLDSATGREDIDGGLRLRFPADPDLVADVARLAAAEQ
                     GCCAFFDFTMQLTPDALVLSVRAPGAAEPLVTELFGVRA"
     CDS             9611..9928
                     /codon_start=1
                     /locus_tag="ROP_00100"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH48257.1"
                     /transl_table=11
                     /translation="MTATGRPGAARWKAVGVGGAAVGACAVCCAGPILSVLGGLTAAF
                     ALGALWVPALAVVALVAAVALGWTLRRRRSAPASCPPAPAADLPMPTIPGALEERTAP
                     EPR"
     CDS             10019..11014
                     /codon_start=1
                     /locus_tag="ROP_00110"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH48258.1"
                     /transl_table=11
                     /translation="MTQPQGVVARMEHHQVAIYLAAMVAGAGIGWAAPAAGPGLEHAI
                     NPVLGALLFVTFLQVPVAELLRSLRDGRFLTAILAVNFVVVPLVVAAMFTFLPADQAV
                     RIGVLLVLLCPCVDYVIVFSGLAGGSSRRLLAATPLLLLTQMLLLPVFLVLFLGSDLS
                     DIVEVGPFVTAFIVLIVIPLALAWATQFWASRAESGRRTSEAATSLMVPLMAATLLVV
                     VASQVPKLEGRVADVAAVVPFYVVFLVVMAFAGMLVARLFRLDPPSGRAVVFSGATRN
                     SLVVLPLALALPDQLAVAAVVVVTQTLVEVVGMVVYVRLVPRLLPAATDTSPAPA"
     CDS             11115..11645
                     /codon_start=1
                     /locus_tag="ROP_00120"
                     /product="hypothetical protein"
                     /protein_id="BAH48259.1"
                     /transl_table=11
                     /translation="MPEKQPVDRAEIAADLDRARRTLHELLDHATAADFERRSNGTRW
                     TNEQLLFHMVFGYMVVRRLLVLVRVFSRLPDRVGRGFARALDATTPVFHQINYLGSCA
                     AATVFDRRRMGRHCDRVIAKLQRSLAKESETNLRRSMAFPVRWDPFFDEVMTAEQVYR
                     YPGKHFDFHRDQLTLG"
     CDS             complement(11665..12669)
                     /codon_start=1
                     /locus_tag="ROP_00130"
                     /product="alkylmercury lyase family protein"
                     /protein_id="BAH48260.1"
                     /transl_table=11
                     /translation="MRLEILQVPGCPHVALLEQRLENVLAGQQSEVEISHRVIDDPAV
                     AADAGMTGSPTLLVDGADPFAAPGLVPSVSCRLYPAEGGGVGGAPSVAALRQALHAAA
                     ADTADEPADGRGGCCSAGTAAESPLAGLGGWRDAARPRTPAERAIHYAILRAFADRGA
                     PPEHAELDSVAAEFGEPGRRVLARLHTADVIRLDPAGRIASAYPFSTSPTPHRVRIGG
                     GAGVYAMCAVDALGMSAMLAAEVVIESADPVTGEHITVTVHGESAVATPATVVVFVGA
                     DAGHGPSADTCCTTLNFFTDRGTARSGADEHPQVGGIVVDLADATRLGATIFGGALTT
                     "
     CDS             complement(12666..13097)
                     /codon_start=1
                     /locus_tag="ROP_00140"
                     /product="putative MerR family transcriptional regulator"
                     /protein_id="BAH48261.1"
                     /transl_table=11
                     /translation="MGYGVENGGMRSSEVAARTGVNVQTLRYYERRGLLTPPPRSPAG
                     YRAYPADAVAVVRFVKRAQGHGFSLDEIEDLLHLAEGGPDDCNTARELAEAKLAQLAE
                     KIADLQRMQRSLSDLVATCERPRTDRCCPLLHTLHTEGDDR"
     CDS             13196..13588
                     /codon_start=1
                     /gene="arsR"
                     /locus_tag="ROP_00150"
                     /product="putative arsenic resistance operon repressor
                     ArsR"
                     /protein_id="BAH48262.1"
                     /transl_table=11
                     /translation="MSKQEVSESGACCSPLAREPLTEDWAGDLARMFKALGDPVRLRL
                     LSLIASHAGGEACVCDISATIDLSQPTISHHLKVLRAAGLLDCERRGTWVYYWVIPSA
                     LQQLSAVLLTESGPVVPSETCTSTEVPA"
     CDS             13585..14700
                     /codon_start=1
                     /gene="arsB"
                     /locus_tag="ROP_00160"
                     /product="putative arsenite resistance protein"
                     /protein_id="BAH48263.1"
                     /transl_table=11
                     /translation="MSEETTTDHPAVVGKLSTLDRFLPVWIGVAMVGGLLLGRMIPGL
                     GDALSAVEIDGISLPIALGLLIMMYPVLAKVRYDRLDTVTGDRKLLIGSLVLNWVLGP
                     ALMFALAWLLLPDLPEYRTGLIIVGLARCIAMVIIWNDLACGDREAAAVLVAINSVFQ
                     VIMFAVLGWFYLSVLPGWLGLEQTTIDTSPWQIAKSVLIFLGIPLLAGYLTRRFGEKA
                     KGRTWYETKFIPKIGPWALYGLLFTIVILFALQGDRITSQPWDVVRIAVPLLAYFAIM
                     WGGGYALGATMGLGYERTTTLAFTAAGNNFELAIAVAIATYGATSGQALAGVVGPLIE
                     VPVLVGLVYVSLALRTRFTHSAGFTDTPASASVTKES"
     CDS             14700..15383
                     /codon_start=1
                     /EC_number="1.20.4.-"
                     /locus_tag="ROP_00170"
                     /product="putative arsenate reductase"
                     /protein_id="BAH48264.1"
                     /transl_table=11
                     /translation="MSENPLDEELRSQVHRAQPELLMPQAVLSRTAEDLAAKYTGVFS
                     PQTVERYVFESYTALRRTARVHTHLTTLAGRFAADRLTALAQSRGAAPKDVPEVLFVC
                     VHNAGRSQMAAALLDHHAQGRVHVRSAGSAPIHAINPTVAEAMTELGLDLGAEYPKPL
                     TDDVVAAADVVVSMGCGDACAVYPGKRYLDWALDDPEGQPLEAVRVIRDDLDTRVRQL
                     LRELTTVPA"
     CDS             15442..15852
                     /codon_start=1
                     /EC_number="1.20.4.-"
                     /gene="arsC"
                     /locus_tag="ROP_00180"
                     /product="arsenate reductase"
                     /protein_id="BAH48265.1"
                     /transl_table=11
                     /translation="MSTTPSVLFVCVHNAGRSQMAAGFLTHLAGDQIEVRSAGSAPAD
                     QVNPAAVEAMAELGIDISAESPKILTVDAVQASDVVITMGCGDTCPVFPGTSYRDWVL
                     EDPAGQGVDAVRPIRDEIKAKVQALIAELVPATA"
     CDS             15870..16289
                     /codon_start=1
                     /EC_number="1.20.4.-"
                     /locus_tag="ROP_00190"
                     /product="putative arsenate reductase"
                     /protein_id="BAH48266.1"
                     /transl_table=11
                     /translation="MSTPSVLFVCVKNGGKSQMAAGLMRKAARDTVEVYSAGTKPGTA
                     VNALSAESLLEVGVDITGETPKLIDPQLVRDVDLVVTLGREARVDPVDGTRFENWDTI
                     EPSERGIDGIERMRLVRDDITARVNQLAAQLRTTHQS"
     CDS             16310..16729
                     /codon_start=1
                     /gene="arsD"
                     /locus_tag="ROP_00200"
                     /product="putative arsenic resistance operon repressor
                     ArsD"
                     /protein_id="BAH48267.1"
                     /transl_table=11
                     /translation="MSTIEIFEPALCCNTGVCGDDVDQALVTFSADMDWVRSQGGDIA
                     RFNLASEPLAFAEREPVKGFLQVAGSEGLPLVLVDGVTAQTGRYPDRAQLAKWAGIGT
                     DTPYAGAPAGISTLGLTDTTDAGSCCAPTDTGSTSCC"
     CDS             16747..18513
                     /codon_start=1
                     /EC_number="3.6.3.16"
                     /gene="arsA"
                     /locus_tag="ROP_00210"
                     /note="protein synonym:arsenite resistance pump catalytic
                     subunit"
                     /product="arsenite-transporting ATPase"
                     /protein_id="BAH48268.1"
                     /transl_table=11
                     /translation="MKFLLAPPRFLFFTGKGGVGKTSIACATAITLARAGKRVLLVST
                     DPASNVGQVFGLTIGNTVTEVLTVPGLSALEIDPEQAADAYRERIIGPVRGLLPEKEL
                     ASITEQLSGSCTTEIASFNEFTALLTDHDTLADFDHVLFDTAPTGHTIRLLQLPGSWT
                     DFLNEGKGDASCLGPMSGLDKQRSIYEGAVAALADPQRTRLVLVARAQRSPLAEIART
                     HTELADIGLTRQHVVINGVLPTPTGGDELAAAIHQREQAALADLPTELAGLPLDLVEL
                     KATNMVGISALEGLFTTNPDTPQPDSAPAPAVPEAPLSALVDELADDGHGLIMCMGKG
                     GVGKTTLAAAIAVALAQRGHQVHLTTTDPAAHLTDTLDGNLAGLTVSRIDPAEATDAY
                     RQRVLATKGAALDEQGRATLAEDLASPCTEEVAVFQAFSRIIHESRRKFVVVDTAPTG
                     HTLLLLDATGSYHREIARQMGDNSNFTTPLMRLQNPQETKVLLVTLAETTPRLEAEGL
                     QTDLQRAGIAPWAWVVNNSLAAAAPTSPLLRQRAATELEEIGAVTAAHPRFSVVPKLA
                     TDPVGVDALTAMVGAAQTMPVN"
     CDS             complement(18699..20000)
                     /codon_start=1
                     /gene="nhaA"
                     /locus_tag="ROP_00220"
                     /product="Na(+)/H(+) antiporter"
                     /protein_id="BAH48269.1"
                     /transl_table=11
                     /translation="MMNAPLSRLPLLSRGSWPETARVAEILRKETVGGVLLLIAAAAA
                     LIWANTPWSDAYHSLREVTVGPPSLHLNLTLGTWAADGLLAIFFFVVGLELKREFVAG
                     DLRDPRRAALPVMAAIGGMIAPALIFVAINLGTGGGALNGWAIPTATDIAFAVAILAV
                     IGTHLPAALRTFLLTLAVVDDLLAVTVIAIFYTDDLDFTYLGLALIPLAAFGFAVQKR
                     IRSFWILLPLAAATWWLVHESGVHATIAGVLLGFTVPVVRSAAAGGPDAGPGLAEHFE
                     HRIRPLSAGFAVPVFAFFAAGVTIGGLDGFVDTLGDRVALGIVAGLVIGKVVGITGMS
                     VLIAKFTRAELDEDLSWLDVIAVAMLGGIGFTVSLLIGELAFAGDVLRSDHVKIGVLT
                     GTLTAALLAAILLRLRNRAYRRIADRETADMNHDGIPDIYQ"
     CDS             complement(20157..20417)
                     /codon_start=1
                     /locus_tag="ROP_00230"
                     /product="hypothetical protein"
                     /protein_id="BAH48270.1"
                     /transl_table=11
                     /translation="MPHAAVRDCARRMMIVQLKYATARSGSDAALAHSDVSAAVGTPG
                     TFHEPSMVFFEENLRPGGTNGYTTSWGTNAHGKLAGCPPSAH"
     CDS             complement(20443..20883)
                     /codon_start=1
                     /locus_tag="ROP_00240"
                     /product="putative MerR family transcriptional regulator"
                     /protein_id="BAH48271.1"
                     /transl_table=11
                     /translation="MTGRVEVSTDRHMQIGEVAERTELSIKTIRHYDEVGLVTPSERS
                     AGGFRLYTDADVQRLLVIRRMKPLGFTLDEMRQLLDSLDILDTTGSGHDRVAAQAFVT
                     DCHTRAEESCRKLRKQVAYAEELTALLADHAAGETAAAAVVDEP"
     CDS             complement(20926..22425)
                     /codon_start=1
                     /locus_tag="ROP_00250"
                     /product="putative SulP family transporter"
                     /protein_id="BAH48272.1"
                     /transl_table=11
                     /translation="MPVQLDLPPEDVSVRAALRSPRRLKTEILAGVVVALALIPEAIS
                     FSIIAGVDPRVGLFASFTMAVTIAIVGGRPAMISAATGAIALVVAPLSREYGLDYLIA
                     AVLLAGVLQIVLSLLGVAKLMRFVPRSVMVGFVNALAILIFTAQLPHLIDVPVLVYPM
                     VAVGLLIMVLLPKVTTVVPAPLVAIVLLTAATVLFALNVPNVGDEGELPSSLPSWLIP
                     DVPFTMDTLSIIAPYALAMALVGLLESLMTAKLVDDITDTHSDKTREGWGQGIANLVT
                     GLFGGMGGCAMIGQTMINVKVSGARTRISTFLAGVFLLILVVGLGDVVALIPMAALVA
                     VMIMVSVGTMDWHSIAPKTLRRMPRSETTVMLATVAVTVATHNLAYGVIVGVITAMVL
                     FARRVAHLTEVVDIAHPDENTRVYAVRGELFFASSNDLIYQFDYVGDPENVVIDLSDS
                     HIWDASTVATLDAITTKYAAKGKTVTIVGLNAASSERHVRLSGQMGAGH"
     CDS             22815..23573
                     /codon_start=1
                     /locus_tag="ROP_00260"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH48273.1"
                     /transl_table=11
                     /translation="MSTGASIGVLGGMIGLGGAEFRLPVLIGLFGFVALQAVIVNKAM
                     SLIVVLTALPARLMSVPYADLVPHWSVVVNLLCGSLVGAWVGATWATKMRSATLYKVL
                     AVLLVVIAIALGASHFGELGTLDLGPLSRTIAGLIAGFGIGVVAALMGVAGGELLIPT
                     IVLLYGVDIKIAGSLSLAVSLPTMLVAFARYSRDRSFGVLKANGRFVIAMSLGSIIGT
                     VIGGLLLGVVPETVLIPLLMLLLLASAVKVWRHH"
     CDS             complement(23623..24150)
                     /codon_start=1
                     /locus_tag="ROP_00270"
                     /product="hypothetical protein"
                     /protein_id="BAH48274.1"
                     /transl_table=11
                     /translation="MTKKENHHATRDNLRDWRTPLRVDGPTAPQPAVCHLVVGFDRHP
                     ASHAALTYAMDLAGRLDAFLHVAHIVDVDDMPVEPDRDDWEQRFADAVEAERTEACTM
                     LATLPGNWTYYSREGNPAQLLTTIAEANDALMIIIGTSRGGVMSLFERFLGESVSSKL
                     VHHARRPVLLVPVAG"
     CDS             complement(24162..24527)
                     /codon_start=1
                     /locus_tag="ROP_00280"
                     /product="CrcB protein homolog"
                     /protein_id="BAH48275.1"
                     /transl_table=11
                     /translation="MVMLWIACAGSAGAIARFVIDGAIKHRKASEFPWATATINVTGS
                     LLLGFVTGLILFHGVPREIQLIVGVGFCGGYTTFSTASFETVRLIQRQKYAAGIANAV
                     GTLTVTVIAGGAGLALASV"
     CDS             complement(24521..25015)
                     /codon_start=1
                     /locus_tag="ROP_00290"
                     /product="CrcB protein homolog"
                     /protein_id="BAH48276.1"
                     /transl_table=11
                     /translation="MDGRRDPNPTLPVDPDTAPRTPGPLHVRPAAIAAVGAGGLIGAP
                     LRYQFGVWFPQAAGGWPVTTFAINIVGAFLLGLLLEALTRLGPDDRWRQRVRLGVGTG
                     VLGSFTTYSTLAVDTDLLLRSHQWWEAGSYAAGTVLVGLVATTAGIAVGAQLRSRRTE
                     AERW"
     CDS             complement(25363..26238)
                     /codon_start=1
                     /locus_tag="ROP_00300"
                     /product="hypothetical protein"
                     /protein_id="BAH48277.1"
                     /transl_table=11
                     /translation="MTLHRHIPRFLCTPKRVALAGDWHANTDYAVEAIAHARRRNADV
                     VIHLGDFGFNFKPDYLNALDRALAQHHLVLGFVDGNHENFDWLLAQPVAADGLRYLRQ
                     RIVHLPRGLRWRWGNTRCLAVGGAHSIDTFLRTPQVTWWPQEEITAEQARSITDGGQG
                     VDAMFCHDCPAGIAVPGMERDRYGFPAEAVAASEHHRQVLRGIVDGVQPIRLWHGHFH
                     HRYQAVLDGDGYRAVIDGLGRDKDPIDNNMVVVNLAALGNHQAASRDGQIRPEHAILY
                     PEEEGEPPTLSAVPG"
     CDS             26585..27451
                     /codon_start=1
                     /locus_tag="ROP_00310"
                     /product="putative site-specific recombinase"
                     /protein_id="BAH48278.1"
                     /transl_table=11
                     /translation="MAAENIHIDHAGGAKASRPQLDLVLQRLRGDDVLVITRLDRLGR
                     SMLHLITLGADLRERGIGLKVLEQGIDTATAEGRAMFGTLSVLAEFQRELIVANTRDG
                     LAAARARGRKGGRPSKLSPDQIELAQRLYDAGDHTVVQIADMLKVPRTTVYGHLDKKA
                     RRPPHAAPSEPTPPVRSSRICPTCGHEPTTRAEAAHQRADLAVTWLHPDPQHRGTLIS
                     RHHCRHCEPGQPAFDIACSICGDGPILAGALAEEARHCDLTKPVERWLTAAGWTVAPG
                     LSCPDHASRGRR"
     CDS             complement(27480..27632)
                     /codon_start=1
                     /locus_tag="ROP_00320"
                     /product="hypothetical protein"
                     /protein_id="BAH48279.1"
                     /transl_table=11
                     /translation="MMLHPQGVSKFKIKILSIDEDGHALIESLLASPGTYPFSVQTKF
                     LVPADS"
     CDS             complement(27845..28666)
                     /codon_start=1
                     /locus_tag="ROP_00330"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH48280.1"
                     /transl_table=11
                     /translation="MISAHDAHTTGTLGSGTVVALLLIAAVAAGYLVLAVRRRREARG
                     WSIWRSASFLTGIALLALAVTPTLSPYPVGDFRGHMHQHLLLGMYAPLGLVLGAPITL
                     LLRSIPPRHGRPIGRVLRSRPAHLLAHPVVALTLSVGGLAALYFTPLYTATTTDEALH
                     LLVHTHFLLAGYLFAWVIAGPDPAPHRPSVPVRLVVLGVAIAGHAVISQLMYAGLFVQ
                     IPVPPDQRQGAGELMYYGGDVAELLLAVALLLTWRPDRHRPARPTDQISAPTAAT"
     CDS             complement(28663..29208)
                     /codon_start=1
                     /locus_tag="ROP_00340"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH48281.1"
                     /transl_table=11
                     /translation="MVAPQRETTAIPARGIGLPGIILGIGLGGFVDGILLHQLLQWHH
                     MLTSTDTDNVGIDTYPADTVHGLEINTVWDGLFHTFTWLAVLIGLGLLYSRVTHSHGR
                     IWASRVLWGWVLVGWGLFNLVEGVIDHHLLGIHHVRGGDHQLWWDLGFLALGAVLVAG
                     GWLLQHSAAPAQPSADTTAPR"
     CDS             complement(29291..30643)
                     /codon_start=1
                     /locus_tag="ROP_00350"
                     /product="hypothetical protein"
                     /protein_id="BAH48282.1"
                     /transl_table=11
                     /translation="MDVSIIETSSLGDRSYLISDGAVGVVVDPQRDIDRVLALARDRG
                     VRITHVLETHIHNDYVTGGLELSRTTGAEYVVPTGDDVGYQRRAVSDGDLIDAGPILL
                     QVLHTPGHTHHHVSYVLRETTGGIRGVFTGGSMLFGTTGRTDLLGKEHTEELTHAQYH
                     SVRRLADELPPDTEVYPTHGFGSFCAATPATGDSSTVGEQSKTNPALTRDEQSYVDEL
                     LAGLADYPAYYAHMGVLNTEGPPPVDLSLPKPVDPDELRRRIEDGEWVVDLRERTAFA
                     AGHLGGTLGFELSDSFVTYLGWLYTWGAPLTLIGDNEDQVADARRELVRIGIDDLDGA
                     AVGEIHTLVAGTALRSYRVADFAALSEALREKDITVLDVRQRNEYDDSHIDGAINIPL
                     HELADRQSTLPNREIWVHCASGYRASVAASMIDRPDRTTVLINDEFDNANDTDLTSTT
                     "
     CDS             complement(30731..31504)
                     /codon_start=1
                     /locus_tag="ROP_00360"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH48283.1"
                     /transl_table=11
                     /translation="MTLTVALALGAIIGVLLGLLGGGGSILAVPALVFGLGLGLEEAI
                     PISLIVIGVASLVGAIPKIREHQVNWRMAGVFAACGIPATFAGSAVGRLLPQPVVMIG
                     FAAVMIVAGIRMLMDRGDTGTACEVGDSGIDWRRCAPRSIPAAALVGFLTGLFGVGGG
                     FLIIPALVLMLGLEMPVAIGTSLVIIVANSAAGLISHLSGASIDWAITAAFAGTAIAG
                     SLIASHFGTRVDTDRLQRWFAYLVFVVAAYVLVDTILLR"
     CDS             complement(31545..31958)
                     /codon_start=1
                     /locus_tag="ROP_00370"
                     /product="hypothetical protein"
                     /protein_id="BAH48284.1"
                     /transl_table=11
                     /translation="MTLALSTTLHTSFADAVDRTRKALADQGFGVLTEIDMKATLKAK
                     LGEDMEDYLILGACNPPLAHRAVTVDRQIGLLLPCNVVVRADPNNPGAVLIDAMNPQV
                     MVQVADQPGLGGVADDATAALQAAIDSLGAGAAKD"
     CDS             complement(32016..32264)
                     /codon_start=1
                     /locus_tag="ROP_00380"
                     /product="hypothetical protein"
                     /protein_id="BAH48285.1"
                     /transl_table=11
                     /translation="MTDALHAPRWTIERVVPLLAGTVVLASLALTLVFSSGWLLLTGF
                     VGANLLLFGAVGWCPASLLLRRLGVPRRTASCPAPAGR"
     CDS             complement(32301..32570)
                     /codon_start=1
                     /locus_tag="ROP_00390"
                     /product="hypothetical protein"
                     /protein_id="BAH48286.1"
                     /transl_table=11
                     /translation="MVGDEDSIALVLNRLRRAHGQLAGVISMIEQGRDCKDVVTQLAA
                     VSRALDKAGFKIVATGLRECLTGEAPEGKEPMTEAELEKLFLALA"
     CDS             complement(32665..34821)
                     /codon_start=1
                     /locus_tag="ROP_00400"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH48287.1"
                     /transl_table=11
                     /translation="MTRSTALGGDAPPADTITAGGVLGRMGAAMAGHAKWVFGIWLIL
                     LVVLGAAAPSVFSSLAGAGWQANGSESVQVRELAQQHFGGNSSAAVQVVVHSDTQTID
                     GPQMQQTLGEVGAVFAGDPRFGAVIAPQPGMSISPDGHTGILIAGANASTDEMVKAVD
                     DHKAALTALTGDGIEVYPTGASALWSDFNKANHDAMIQAELFSWPVTLAIMVLAFGSL
                     VAAGLPLLLTLAGLVASAGGLVLLNEITPISVWAMNFAMMFALALGIDYALFIVARFR
                     DALTNGGGPRAAVAETMDTAGKAVVLSGITVLVSLSAVLLVPAPAVRTMAVGIMLAVF
                     FVLVASMTLLPAVLGALGGRVNAGSLPYAKRQQHRSPRFAAWGELLHRHPWPFAIGSL
                     LVLIALAAPVLGLKVAMPSIEVVPTDAPVRQGYELVQAQMGEGAPGMLQIIGPAGEGT
                     DAAAAAAATDGIAMVTPPQPAPDGSDYVMLQAMPTVDPSDGQMGTIVDALRAGLPDGA
                     VVGGAPAENLDLQQALNDYLPLIVGIILILGFVLLLVALQAPLIAVLGTVVSLLSTAA
                     AFGVAKLIFQDGHGASLLGFTPQGFLDGWGPVFFFAMIFAIAMDYTVFLLATAKEHYE
                     RSGDPKVAHVDGLAHSGRVIFAAAAVMVAVFFTFALADPLPPKEMGIILGVAVLLDAV
                     LIRLVLLPVLLRLTGHAAWWSPAWLRKVLPNISFSH"
     CDS             complement(34898..35314)
                     /codon_start=1
                     /locus_tag="ROP_00410"
                     /product="hypothetical protein"
                     /protein_id="BAH48288.1"
                     /transl_table=11
                     /translation="MGLRGAVDTCARVYPLGYGGEVLGDTPSGMKELEMREVDLDEFA
                     VRWADGVPVVDVRERWEYVDGHVPGALLMPLGQLAARTAEIPAGEVVYVICASGNRSR
                     EGARIVEAAGRGAVSVAGGTSGWAAHGRPLDRGDGS"
     CDS             complement(35316..36029)
                     /codon_start=1
                     /locus_tag="ROP_00420"
                     /note="fragment"
                     /product="putative sulfite oxidase"
                     /protein_id="BAH48289.1"
                     /transl_table=11
                     /translation="MLDAAGAHTGDDLHVAFTAPDVSSLADPPQPYGSSIPAAKARSD
                     EVLLAWEMNSAPLPRVHGGPVRVVVPGYIGARSGKWVTGITVQPHPSDNYFQATAYRI
                     LPPDADPDTAGPGDGISLSSVALNCDILEPDDGATVPAGPLTVRGYAFAGDDRGVARV
                     DVSLDGGRTWCQADLEPEQSPWSWRLWSLCATVAGPVTITARAWDTTGAMQPESAAAL
                     WNPKGYANNSWARVHLHAN"
     CDS             complement(35873..36397)
                     /codon_start=1
                     /locus_tag="ROP_00430"
                     /note="fragment"
                     /product="putative sulfite oxidase"
                     /protein_id="BAH48290.1"
                     /transl_table=11
                     /translation="MWGKRDGFVVHDRAPFNAEPSRSALAEGAITAIDTFYSRNHGPV
                     PDIERREWRLVVTGLVGQDLTLTFDELTSRFIPRSVVATLQCAGNGGPVSPRSGKSPA
                     RIRGVRVRPRPRSGGVFGCAMCWMRRAPIPVTTCMWRSPPRMSPLWPTRRSRTAARSR
                     RRRRGRMRCCWRGR"
     CDS             complement(36522..37019)
                     /codon_start=1
                     /locus_tag="ROP_00440"
                     /product="hypothetical protein"
                     /protein_id="BAH48291.1"
                     /transl_table=11
                     /translation="MSGAGNRLITPMLATPGEPPVEMDGWAAEMKYDGFRLLAGVGGA
                     HPVLWTRNLNVVTSSYPEVTEALTEAFGGHGRIVFDGEIVALTQGRPSFARLQKRANT
                     LRPTTTLRRQVPVTFLPFDVLYRTSELGHPRLVWLLLRDAHFRCASADSGLLDVDWRV
                     PGVNG"
     CDS             complement(37305..37838)
                     /codon_start=1
                     /locus_tag="ROP_00450"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH48292.1"
                     /transl_table=11
                     /translation="MTGTNEDTPMTRRPARRISVLQAITEGIPTSSRWGRVDVTPLQI
                     AQQQRSIRATLSIYPPGVTSRERTLMHLRKLGTTWVGLLGYLAVLVVAGIVLGVLGAA
                     MAIAVLIALWAGIALATSGVNKDTRCLRIYARPGSVGGEMARLEEIATELDALDTANL
                     DPVSYEAEWGRIYRQLA"
     CDS             complement(38198..38449)
                     /codon_start=1
                     /locus_tag="ROP_00460"
                     /product="hypothetical protein"
                     /protein_id="BAH48293.1"
                     /transl_table=11
                     /translation="MNPADNPPPLASRLHRAEDLLPLAATTPAAESDTARRKKLMFAP
                     GLSHDALARRRTVRIDPTTKTPAGDTQIVHLSPSHAEPE"
     CDS             39058..39471
                     /codon_start=1
                     /locus_tag="ROP_00470"
                     /product="putative WhiB family regulatory protein"
                     /protein_id="BAH48294.1"
                     /transl_table=11
                     /translation="MPDHFHHSPDRDWPHRASCRGTDTNLFFSPDGERGNVRARRERA
                     AKQICQDCPVLAQCRAHALTTTETYGIWGGMSETERTRHTRRTRVPARHRDATPAPAP
                     QPPPLYLLAHVTNACAAKPVPPVTAPPSEPANVSP"
     CDS             39538..40362
                     /codon_start=1
                     /locus_tag="ROP_00480"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH48295.1"
                     /transl_table=11
                     /translation="MSGTIESSPHDGARVLVVILSAVAAVVGSIIGSGALVGTPISQV
                     ADGALAADATAVAPGGPAFSIWTLIYLGFLALAIWQALPAHRTDPRQRRAGWWLAAAM
                     ILNAAWIACVQFEQLWLSVLTILALLAVLVVVFHILTNTKPSSRAEAIVVDATAFVYL
                     GWVCVAVVANIAAALAAAEIDPFALGADTWAVLVLTAVALVAVVLAVAGHGRFTVTAA
                     IVWGLVWIAVARTTGDGFTSQPAAIAALTAAALAIAATAIARLPRARSGEASVTKP"
     CDS             complement(41126..41503)
                     /codon_start=1
                     /locus_tag="ROP_00490"
                     /product="hypothetical protein"
                     /protein_id="BAH48296.1"
                     /transl_table=11
                     /translation="MSAATDRQWAVRDAVLRWLLAKTTEGYRSPILDADAIGEEVGWA
                     ASPLSDDEVYDASNYLFKEGYVTGMPVKDVGIPRPMLTLVGRRVAKTGNPLRSKANAR
                     DAKPRRRPGTFAEASVTTAGTAK"
     CDS             42310..42867
                     /codon_start=1
                     /locus_tag="ROP_00500"
                     /product="hypothetical protein"
                     /protein_id="BAH48297.1"
                     /transl_table=11
                     /translation="MRVLNVMQRPVRVVRQSDSMRTAAVLLAEYGFAAVPVVDDHDRL
                     VGMLNSGDVLRAGTASSETVGEVMTAPAVAAPMYQYVADVSKMLLHQGLRSLPVVDID
                     GRVVGILSRSDVVRLMLKPDETIAVGAQRRLDDYTGDGRWHVTVEEGCVTLAGPFADE
                     SERRIAIALSKTVPGTRMVSIAAGE"
     CDS             43113..43325
                     /codon_start=1
                     /locus_tag="ROP_00510"
                     /product="hypothetical protein"
                     /protein_id="BAH48298.1"
                     /transl_table=11
                     /translation="MYRSRTPAAAIHRSFAHGGSMSTRQIKAHLEVMFAPETDHGTPP
                     ENAGSVFAHQLSEAEENTALPLADIA"
     CDS             43480..44001
                     /codon_start=1
                     /locus_tag="ROP_00520"
                     /product="putative DNA-binding protein"
                     /protein_id="BAH48299.1"
                     /transl_table=11
                     /translation="MTPTPITTTLDTEQQRIAGKALQGTVVDLIDLSLIAKQAHWNVI
                     GPHFLAIHPALDELATVARKFTDEAAERATAIGVSPDGRAATVAADAGTTGFAEGWTS
                     DGEVVETIAANLAAVIARLRASIESTEKADPVTQDLLIGITARLEQLHWRWQAQSTQP
                     SAQRPRLGQVLVG"
     CDS             44146..44832
                     /codon_start=1
                     /locus_tag="ROP_00530"
                     /product="hypothetical protein"
                     /protein_id="BAH48300.1"
                     /transl_table=11
                     /translation="MIGCGRFQRLRQRVFENPIWHACASENRLLIGSVITRSPTQREP
                     NVIIVDFVVPGDMVARSTRRRSPTQSGPLDSRFLHQWLGRSREVTREVVLPLILDGIQ
                     YIMRGGTAWWRLPVEFWSTGTVSAVFARKRPVHETRPETHRKGLRIWISTNPSALDGT
                     PESARSGAACGTRSALSTVREAHAPVLLCLAEASDGANPPRSRSAWGVTGRWGDPSTP
                     HRCTHRHTNR"
     CDS             complement(44768..45133)
                     /codon_start=1
                     /locus_tag="ROP_00540"
                     /product="putative WhiB family regulatory protein"
                     /protein_id="BAH48301.1"
                     /transl_table=11
                     /translation="MNGWRAAAPNCRCSFSPDGERRGAPDRCEARARQICQVCPGLVR
                     CRDHALTSGESYGVWGGMTESDRRKHTNRSRRGERRPLGSFQERPVGAASGVRGATFT
                     GSYGGAYTGGASRGRPTAR"
     CDS             45145..45558
                     /codon_start=1
                     /locus_tag="ROP_00550"
                     /product="hypothetical protein"
                     /protein_id="BAH48302.1"
                     /transl_table=11
                     /translation="MTAAGNGSLKIGNGGFLSIDTVGVAARQHCGTGMLLLTATAIRR
                     RPRQDTDSCGGGADMVPAGHIEESIEAGVIATGALLGQDRRRGGQQLRVRRLRRMSSS
                     GYCGGVGRHEGPFATSARTAGQVRSARGRGLASHC"
     CDS             46705..47097
                     /codon_start=1
                     /locus_tag="ROP_00560"
                     /product="hypothetical protein"
                     /protein_id="BAH48303.1"
                     /transl_table=11
                     /translation="MFAIVARFSVLWIDEVGMASVRDRTHPAARLHFKCAGTGSAGAP
                     VPDPPHRMIAHTHVLLTPLDRAPRTFDQPLTWNAVPPAAVGGTAPRGLDGGGATDSAG
                     ENKQEQGDIEVHGTGPSRGAECCCRCGS"
     CDS             complement(47795..48211)
                     /codon_start=1
                     /locus_tag="ROP_00570"
                     /product="hypothetical protein"
                     /protein_id="BAH48304.1"
                     /transl_table=11
                     /translation="MSAATDRQWAVRDAVLRWLLAKTTEGYRSPILDADAIGAEVGWV
                     ASPLTRDEVVDASMFLFKENYVTGVPVMGIGIPRPMLTVAGRRVAKAGKPLRYKVDAH
                     EAKVRRHLGGTAGRDIRDDDGGSEVKERMARPVTRR"
     CDS             49076..50764
                     /codon_start=1
                     /locus_tag="ROP_00580"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH48305.1"
                     /transl_table=11
                     /translation="MCRELMEQKMNRPGLVTRRPAPASLSSKRGRAMLRVILLPLDIV
                     ESADPVPVPAVDEVEPFLPARISAPTATGDDGPQAQLLAFRHIVDRRSPPVTFGLALD
                     GQRAPDGRRRPYVGPPATCLSLWEVPGNGLVLACEELTPDRAGSLIDRHHDPLRGGGS
                     PEFWAAIEAFLRPFGLTPDASPMDVFPRLNTRLPSSAVYRPLRSLTIHGPHRTDSDTL
                     EGLIIEVHTDGVDTVRRLVDEPGTSPCGGAASRSYRGLLRWHRVPLIDRASRLGSGIA
                     IREDARALAVDVGAPVIGRQYVDRGTREMLYCLIGWVALRAQHSADHRRVLSLLRNRR
                     QLSEGGALAGLGDIAAARTRMIETRLLQAHPADDHRLPPRIESTHLRSTLVHRTADEI
                     AFLHTELGKLCDSAESSLLPHAVASARERRSTLVSVAAAGALFVTSLHAAVAASPVDL
                     QRWGFTVAVAAAIGAVALLEVVSRRRPSRTPLKPTPVAPPHASPVVTPVRDLERRRLE
                     SIFPFETQVWRTVPSRRGMTPTFRECLEANDLSVGEPSNSLLVMASPTFRPAPK"
     CDS             50864..51622
                     /codon_start=1
                     /locus_tag="ROP_00590"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH48306.1"
                     /transl_table=11
                     /translation="MLVTSYPSWWQMLAVLSVAVVLSTAVGMERQLRQKSAGMRTHTL
                     VGLGAALFMIVSKYGFSDVLTEGLVTLDPSRVAGQIVSGIGFIGAGLVFVRRNKVRGL
                     TTAASIWLTAAIGTASGAGLILPAMFVTGCHFVIAFAYPVVVRYSRLGKSSQHLLRVR
                     YADGTGALRRIISACTEHGLAVQGFATRHPDADAGAGGVLTRLRDNLDTAMPLASGVE
                     VELELYGTTNLSELMTQLSVLDHVDGVHCDDPLE"
     CDS             51675..51905
                     /codon_start=1
                     /locus_tag="ROP_00600"
                     /product="hypothetical protein"
                     /protein_id="BAH48307.1"
                     /transl_table=11
                     /translation="MTGNTENVNRMMTFALHWFPHRGGPAAEIVAVLGMDTGEFFRCL
                     NAQLHPNPPTPLRPEIVQKMKAVARRRLWLAG"
     CDS             complement(52161..52730)
                     /codon_start=1
                     /locus_tag="ROP_00610"
                     /product="putative signal transduction protein"
                     /protein_id="BAH48308.1"
                     /transl_table=11
                     /translation="MSAPFDITDTIIGSGARAGSGIRDDAHRLLRECRAKAALVTELS
                     LDGPLSAKTYAGVNLPAARRRRHPAASEPPWGRDEVEALPSGSALLVVTRGPNRGEWF
                     LLDQPVTTIGRHIDSDIYLDDTTVGRRHAQIRCDNDTFRVTDVGSLNGTYRNRAPVDT
                     ALLADGDEIKIGKFRLAFLITPPSAATDQ"
     CDS             52957..53649
                     /codon_start=1
                     /locus_tag="ROP_00620"
                     /product="putative SufR family transcriptional regulator"
                     /protein_id="BAH48309.1"
                     /transl_table=11
                     /translation="MSEQTLTDPTPATALGETRNRVLELLCVAAEPMGVQDIAERVDL
                     HPNTARFHLDGLVDTGLAERRAEDRRRPGRPRMVYAATTSDASTGRRSYRLLAEMLTG
                     LIGDTLPEPGQAAETAGEAWGRYLAERPAPSQRVDAADGVRRLSTVLAESGFAPGVVD
                     DLTRPVIPLRHCPFREVAERHRDVVCSLHLGLIRGALAEVRAPLAADRLEPFVEPSLC
                     LAYLTPTPDEPS"
     CDS             53730..54014
                     /codon_start=1
                     /locus_tag="ROP_00630"
                     /product="hypothetical protein"
                     /protein_id="BAH48310.1"
                     /transl_table=11
                     /translation="MPVFVVEYTYSPETSSGRDDHRTDHHAWLAELVRRKVVLSSDPL
                     ADHTGVQFIVDAADEDTVTRLFTHDPFAQANLVSKVLISKWHPVIGEIHD"
     CDS             complement(54271..54684)
                     /codon_start=1
                     /locus_tag="ROP_00640"
                     /product="hypothetical protein"
                     /protein_id="BAH48311.1"
                     /transl_table=11
                     /translation="MCAAKVASSVMQVAELDRSVKYYCDVFGCRVAVREPDAALLLTP
                     DNFQIYMYAKKGASTRRGVSVIGVHYVMWAADTEDELERITERLHAYDATTYTQTVGG
                     VTFVDGCDPDGIRVIVAYPGPEQLPRELIAQRFRG"
     CDS             55023..55382
                     /codon_start=1
                     /locus_tag="ROP_00650"
                     /product="carboxymuconolactone decarboxylase family
                     protein"
                     /protein_id="BAH48312.1"
                     /transl_table=11
                     /translation="MPESLYQPTTTEISERRKALAPGIHDAFENFSRAVFADGALPEK
                     TKQLIAVAVAHVTQCPYCITGHTKLARRKGAEPEEIMEAIWVAAEMRAGGAFAHSTLA
                     LNAMNHSGHTSTGEPEP"
     CDS             55379..58177
                     /codon_start=1
                     /EC_number="4.2.1.3"
                     /gene="acn"
                     /locus_tag="ROP_00660"
                     /note="protein synonym:aconitate hydratase"
                     /product="aconitase"
                     /protein_id="BAH48313.1"
                     /transl_table=11
                     /translation="MSGNSFGARSTLTVADQTYGIYRLDAIETDVQLPYSMKVLLENL
                     LRNEDGRLVTAGQVSALASWSPRNPGHTEIQFTPARVLMQDFTGVPCVVDLVAMRDAM
                     TALGGDPRKINPLIPTELVIDHSVIADVFGRPDAYRVNADLEFSRNKERYQLLRWAQQ
                     AFDDFLVVPPDTGICHQVNLEYLARVVFTQETPDGPLAYPDTLVGTDSHTPMINGLGV
                     LGWGVGGIEAEAAMLGQPMSMLLPQVLGLKLTGALPEGTTATDLVLTIAELLRKTGVV
                     GKFVEFYGPGVANVPLANRATLGNMSPEYGSTCAIFPIDDETLNYLRLTGRPEQQVRL
                     VEAYAKEQGMWHDPDQEPAYSHTVELDLATVEPSIAGPKRPQDRIPLASAPHAVGSLL
                     AGQPLPTALDAGLDEASGESFPASDPIAVDHDRASDGPAAPCRCGKSHVWPSDPVEVV
                     LDGEVHSVDHGHVVIAAITSCTNTSNPSVMIGAGLLAKKAVQAGLTRKPWVKTSLAPG
                     SRVVTDYYDRAGLTPYLERLGFGLVGYGCTTCIGNSGPLISQVSDAVTGHDLTACAVL
                     SGNRNFEGRIHAECKMNFLTSPPLVITYALAGTMLADVLHDPIGTGSDGRPVYLRDIW
                     PSTEEVKAVIDECLQSQMFTDGYSNVFAGDDNWRGLDVASGEIFEWHEDSTYVRRPPY
                     FDGIQPEPQPISDITGARVLVMLGDSVTTDHISPAGTIRRGSPAGIYLREHGVEPPDF
                     NSYGSRRGNHEVMIRGTFANIRLRNLLAPGTEGGVTRHLPDGQEMSIFHAANAYAAEG
                     TALIILAGAEYGSGSSRDWAAKGTLLLGVKAVLATSFERIHRSNLIGMGVLPLQFPPG
                     HTRESLGLTGEEEYSITGLEGGDPGADFPTEVTVRAHHHGQVQEFRATVRIDTPAEAG
                     YFRHGGILQYVLRQLLVT"
     CDS             complement(58342..59136)
                     /codon_start=1
                     /EC_number="1.3.99.1"
                     /gene="sdhB"
                     /locus_tag="ROP_00670"
                     /product="succinate dehydrogenase iron-sulfur protein"
                     /protein_id="BAH48314.1"
                     /transl_table=11
                     /translation="MSVPMNSEGPGSVALPPVPEGAVMVTLKIRRFSPEDPGKAGWAS
                     FEVPCLPTDRLLNLLTYVKGYLDGTLTFRRSCAHGVCGSDAMVINGVNRLACKVLMRD
                     ILHKDGKNTTVTIAPLKGLPVEKDLVVDMEPFFSAYRQIKPFLMTSGQEPTRERIQSQ
                     ADRARYDDTTKCILCACCTESCPVYWADGSYFGPAAIVNAHRFIFDSRDEGAGERMDI
                     LNGIDGVWRCRTTFNCTDACPRGIKVTQAITEVKRTLLFNRKAVVR"
     CDS             complement(59204..59482)
                     /codon_start=1
                     /locus_tag="ROP_00680"
                     /product="hypothetical protein"
                     /protein_id="BAH48315.1"
                     /transl_table=11
                     /translation="MTVPTTNDKPAVHCGGEDRGHRAGNRVVVAAGAFAGHATMSIGM
                     LVHELSVLVAIVNPMRLFVGGVSAPHITRRPRRARGSEPGFPIRRSNR"
     CDS             59502..59858
                     /codon_start=1
                     /locus_tag="ROP_00690"
                     /product="hypothetical protein"
                     /protein_id="BAH48316.1"
                     /transl_table=11
                     /translation="MGPIELVRAYDARGTKKTSPTFLVDRLWPRGIAKADLDCDAWIK
                     EVAPSTELRTWFGHQADRFPEFRTRYLQELDTNRTAAQPIVEAARNGTVVLLYSAKDL
                     EHNQAVVLREWISNQF"
     CDS             complement(60197..61093)
                     /codon_start=1
                     /locus_tag="ROP_00700"
                     /product="stomatin family protein"
                     /protein_id="BAH48317.1"
                     /transl_table=11
                     /translation="MILYAVAVIVGLGLLGLSSSIRVVTQFERGVVFRFGRVQPAVRG
                     PGLMLLIPIADRLEKVNMQIITMPVPAQDGITRDNVTVRVDAVVYFNVADPVRVAVDV
                     QDYVSAIGQVAQTSLRSIIGKSELDDLLSNREGLNQGLELMIDSPALGWGVQIDRVEI
                     KDVVLPDSMKRSMSRQAEAERERRARIITADGELQASAKLAQAAETMTEHPAALQLRL
                     LQTVVEVAAEKNSTLVLPFPVELLRFLERATPHTAHAPTRTAEPTTTTTPANVNDEPS
                     TRHTQHTPVDARGFALEQSRFG"
     CDS             62973..63413
                     /codon_start=1
                     /locus_tag="ROP_00710"
                     /product="putative MarR family transcriptional regulator"
                     /protein_id="BAH48318.1"
                     /transl_table=11
                     /translation="MTADEHVESEPLTKRDFEALARFRFGIRRYLRFSEDTVRDHGLT
                     PQHYQLLLALKGFPGREWATMRELADRLQLRHHSVVELVDRAQKHGLVERAPHPSDAR
                     AVRVELTEHGQLILARLSAMHRDELLRLGPTLELPIWDDPPQDP"
     CDS             complement(63621..65201)
                     /codon_start=1
                     /locus_tag="ROP_00720"
                     /product="hypothetical protein"
                     /protein_id="BAH48319.1"
                     /transl_table=11
                     /translation="MIRWLVIAGAWVLGVASLLLIFLVSSWWLLVTVIAAAIAMVGTW
                     DLLQRRHSVLRNYPVIGHARFLLERIRPEIQQYFIERSTDGTPFDRDTRTTVYERAKG
                     TKDVEPFGTERDVTATGYEFVTHSLRAHTASDDTPHVRIGGPQCTMGYDIALYNVSAM
                     SFGSLSGNAIEALNGGAARGGFAHDTGEGGISPYHLAHGGDLIWEIGSGYFGCRDPDG
                     HFDPGEFAAKAALPQVKCISIKLSQGAKPGLGGVLPAAKVSPEIARTRGVPVGQTVIS
                     PPSHSAFCTPLELIDFITTLRALSGGKPIGFKLCVGSRTEFLAICKAMLETGITPDFI
                     IVDGSEGGTGAAPLEFEDHVGMPLTEGLMLVHNALVGTGLRDRIKIGASGKVANGIDI
                     IKRLIQGADFTLAARAMMFAVGCIQAQRCHTNRCPVGVTTQDARRARALHVPDKTTRV
                     YNLQRSTVASAQQILASMGLDDFCDLDPSMLNRRIQGHRTMTYADLHEWLQPGDLLTE
                     DPPTSWLRDWTNADSSRF"
     CDS             complement(65274..65429)
                     /codon_start=1
                     /locus_tag="ROP_00730"
                     /product="hypothetical protein"
                     /protein_id="BAH48320.1"
                     /transl_table=11
                     /translation="MVRGDTHAPAAGTDANTRDTAPVSVVVVSTALLELVRTSWIHRR
                     RLRFGRT"
     CDS             complement(65416..66672)
                     /codon_start=1
                     /locus_tag="ROP_00740"
                     /product="ferredoxin reductase"
                     /protein_id="BAH48321.1"
                     /transl_table=11
                     /translation="MATAEQTFVIVGAGLAGAKAAEALRTGGFDGRIVLIGDETDRPY
                     DRPPLSKSYLQGTTERQKIYIHPAGWYTEHDIELRVGTPVTALDTAEHEVVIDGVERL
                     GYDKVLLTTGSSPRRLQVPGADLGGVHYLRRVTDCETLKAAFAAADRVAIVGAGWIGL
                     ETAAAARAAGCDVTVVGRSKLPLLAVLGAEVAETYAALHRDHGVELRLNSGVREIAGK
                     DNQATGIRLTDGTVIEADTIVVGVGIVPNTALAETAGLAVDNGIVVDEHLATTDPDVY
                     AAGDVANTYYPLLGTHLRLEHWSAALNQGPVAAANMSGRVTAYDQVPYFFSDQYDSGM
                     EYSGYAPHGSYDSVVFRGDVAAGEFIAFWMRDGRVLAGMNVNTWGVTDAIEALVRSGE
                     RVDPAKLADPDELLRYLADPVPGGAR"
     CDS             complement(66810..67955)
                     /codon_start=1
                     /EC_number="2.2.1.2"
                     /gene="tal"
                     /locus_tag="ROP_00750"
                     /product="transaldolase"
                     /protein_id="BAH48322.1"
                     /transl_table=11
                     /translation="MMTRFPPAPVGATVSRLHRLYREQGQSPWLDNLTRPYLRDGTLA
                     EFVAAGIRGVTANPTIFARAIAGSDAYDAQFAALIAQGRAVEDAYWELAAADVVDAAA
                     VLRPVYDTSGGTDGFVSIEVAPELARDTDATIAAAGRLHERIARPNVFVKIPATAEGI
                     PAIADMIGKGVSINITLIFSLARYEQVIEAYLQGLEARAARGADLAAVRSVASFFVSR
                     VDTEVDKRLEHSGDPEAPALRGRAAIAQARLAYRIFQDRFTGTRWETLAARGARVQRP
                     LWASTSTKNPDYPDTRYVDSLIGPDTVNTLPEATITAFEDHGTLTRSIDTVPAGAAAV
                     LDELAAAGIDMDDVGRTLEDQGVAAFHQSFADLLTELRAKAHQLAQR"
     CDS             complement(68027..68752)
                     /codon_start=1
                     /locus_tag="ROP_00760"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH48323.1"
                     /transl_table=11
                     /translation="MGQGGPHRSKPYLCKGLHPMGVYRILWWVVTVPLGLVGFAVAIF
                     TVHPDVLVSAAFAAAVTGGGLPAMVADRSAATPRSWLPAAALHAATAGAALICVVGLI
                     ALSGAAAVPLVLVLTVTAGPVARRLRRWPPLAQLLSPQPAALSDPDEASAPGSLPTPP
                     SCAELSDDALCRGWRTSFAELQNATSVTDRLQLARIRRQYLDEIERRDPQGFAAWFTS
                     GARAGSDPSKFLAPREQPPTDRQ"
     CDS             complement(68973..69686)
                     /codon_start=1
                     /locus_tag="ROP_00770"
                     /product="hypothetical protein"
                     /protein_id="BAH48324.1"
                     /transl_table=11
                     /translation="MSTPRSAAPAVLAALSNLDDPLRRRLYDYVTESGAPVSREQAAA
                     AVDVGRTLAAYHLDKLADADLVTVSYQRPAGRGGPGAGRPAKLYTRATTEMTVSVPPR
                     DYELLARLLVTSVEQDTSGTVRAAVNEAALDAGKRAAADTGGDLLAALRGCGYLPQVG
                     DDGRIDLRNCPFHHVARDHLDVVCGLNLRLVQGVIAGSAGHDAHAELDPRPDRCCVVV
                     HHAASAHAHSPPPPGPARP"
     CDS             69778..70260
                     /codon_start=1
                     /locus_tag="ROP_00780"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH48325.1"
                     /transl_table=11
                     /translation="MTTPTPDSSATAPTPGTALQRARSDPAYGAFLLLRIGFTVLPIV
                     MGIDKFTNVLTTWEDYLAPWIVDLSPFSAHQTMLVVGVIEIVVGIAVAIKPRYAAYIV
                     AAWLAGIVINLLSYPGFYDVALRDFGLMLAALTLGRLAYVYDPAWHRRTALAPKLSAA
                     "
     CDS             70390..70986
                     /codon_start=1
                     /EC_number="3.5.4.16"
                     /gene="folE"
                     /locus_tag="ROP_00790"
                     /product="GTP cyclohydrolase I"
                     /protein_id="BAH48326.1"
                     /transl_table=11
                     /translation="MPSTATLHVLHQAPGRDLAAAEEAAAAFLDALGIDLDSESLRET
                     PRRMAHGYAELFTPRAFDLTTFPNDEDYDELVLVRNVPLRSVCEHHLLPFAGTVHIGY
                     LPGDRIIGLSKLARVAEHFACRPQVQERLTKQIAGWLDEHLHPRGVGVVIEAEHSCMT
                     LRGVQSVGSATVTSALLGALRDDPRSRQEFFALAGVHA"
     CDS             complement(71131..71700)
                     /codon_start=1
                     /locus_tag="ROP_00800"
                     /product="hypothetical protein"
                     /protein_id="BAH48327.1"
                     /transl_table=11
                     /translation="MWSPVGGGGEAMLLSVGHGRLGREELTTLLNRAGVDAVVDIRRY
                     PGSRRNRDVGSEMMTHWLPDAGIGYRWESRLGGRRRLSPGEPREDPWWQVDQFAAYAA
                     HTRTTEFAVALTELLDRAARQRTAMMCSESVWWRCHRRLVADVAVLRRGVSVEHLMHD
                     GRRTPHLPAEGARVRADGQVVWDRHRARS"
     CDS             complement(71746..72435)
                     /codon_start=1
                     /locus_tag="ROP_00810"
                     /product="putative SufR family transcriptional regulator"
                     /protein_id="BAH48328.1"
                     /transl_table=11
                     /translation="MAIQKGTGAERAGTHAVLASRRRVQLLDALRASPTPMAIGELAA
                     LCELHVTTVRFHLDALTSAGLVSAEPERNPARGRPRRLYRALAPLEPGHADSGYQRLA
                     RVLAAHWASSEDDPVARAEAAGRAWARDDLTETPGSPRSIEDAASTLTTLFAEMGFDP
                     ELEASEDEMRIRLHACPFESVARQSPNVVCALHLGLMRGVLDRLGAPESDNRLIPWET
                     PRTCVAHLARR"
     CDS             72497..72883
                     /codon_start=1
                     /locus_tag="ROP_00820"
                     /product="7Fe ferredoxin"
                     /protein_id="BAH48329.1"
                     /transl_table=11
                     /translation="MTYVIAEPCIDVLDRACVEECPVDCIYEGGRSLYIHPDECIDCG
                     ACEPVCPVEAIFYEDDLPARWVAFTDDNARFFHSPLPGASAALGMPGGAGKLGPLAAD
                     TELVSGYPPSGPAATGGASPCGGGAS"
     CDS             72880..74625
                     /codon_start=1
                     /EC_number="1.9.3.1"
                     /gene="ctaD"
                     /locus_tag="ROP_00830"
                     /product="cytochrome c oxidase subunit I"
                     /protein_id="BAH48330.1"
                     /transl_table=11
                     /translation="MTPLTVEVVPVRPFPARRGIKGSFLYKAATTTDPKMLGLMYMVT
                     SFVFFMVGGLMALLIRTELAVPGLQFLSNEQYNQLFTMHGTIMLLLYATPIVFGFANY
                     ILPLQIGAPDVAFPRLNALSYWLYLFGAIITVSGFLTPGGAADFGWTGYSPLTSAVHS
                     PGVGADVWITGLALAGVGTILGGVNMITTVICLRAPGMTMFRMPIFTWNIFITMILVL
                     IAFPILAAALLGLLVDRHLGAHLFDPATGGALLWQHLFWFFGHPEVYIVAIPFFGIVS
                     EIFPVFSRKPLFGYTGLVYATIAIAALSTAVWAHHMFATGAVLLPFFSLMSFFIAVPT
                     GVKFFNWIGTMWKGQLTFETPMLFSIGFLVTFLFGGLSGVLLASPPLDFHVTDSYFLV
                     AHFHYVLFGTIVFATYAGIYFWFPKMTGRLMDERLGRWHFWTTFIGFHTTFLVQHWLG
                     AEGMPRRYADYLPSDGFTTLNTVSTIGSFVLGGSVLPFVWNVFKSYRYGQVVTVDDPW
                     GYGNSLEWATSCPPPRHNFTELPRIRSERPAFELHYPHMVKRMRAETYVGRRPKSVAV
                     TAGTVSGPEREAGRR"
     CDS             74622..74816
                     /codon_start=1
                     /locus_tag="ROP_00840"
                     /product="hypothetical protein"
                     /protein_id="BAH48331.1"
                     /transl_table=11
                     /translation="MSDTVDRSYSFLRCRVADAADKHARSSSSAATSPTTRAPLHPST
                     GDRPANPNPNPNRPREVDGP"
     CDS             74833..75279
                     /codon_start=1
                     /locus_tag="ROP_00850"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH48332.1"
                     /transl_table=11
                     /translation="MTEVARYTQLILPVFWLGMVVAISFLEAPIKFRAPGVTLAIGLG
                     IGRKVFLALNAVELVLALALLASCVAAPPGATALTVLALVTVVLVVQIAVVRPPLSKR
                     SDRILAGEHLPRSRIHLVYIGLEVAKVALLIALIFQLFRAVASCLH"
     CDS             75267..75932
                     /codon_start=1
                     /locus_tag="ROP_00860"
                     /product="hypothetical protein"
                     /protein_id="BAH48333.1"
                     /transl_table=11
                     /translation="MPSLTPGEPTRTDLATRTDIEDVLRRFYGRVLVDDLLAVPFAEI
                     RESGLESRLPIMCDFWETVLFGARLYQGSAGRVHRSVHTRHRFEAWHFLRWLTLWSTT
                     VGQMFHGPSAAHATVHATRIARAMHRNLTGTDSAELDALTTREPHRVRDDHPSDRSPG
                     GDLDDGTASHRRVHGEATDLPEDHHTPRRTDQTVAADKPPGVASVDSDGPRRRIRKEV
                     LQP"
     CDS             75929..76240
                     /codon_start=1
                     /locus_tag="ROP_00870"
                     /product="hypothetical protein"
                     /protein_id="BAH48334.1"
                     /transl_table=11
                     /translation="MNEKTWSVNIVIDEHKSAETGAQTRARARLRTSGRAAFVGTGLA
                     RRNPHHTDVPEVSDDMAAARALADLSHQLYEAAAQREAVTRSALTSARAADFGRRRSS
                     A"
     CDS             76333..76743
                     /codon_start=1
                     /locus_tag="ROP_00880"
                     /product="hypothetical protein"
                     /protein_id="BAH48335.1"
                     /transl_table=11
                     /translation="MSEHLFHIALADDWEGAARFGEYEASTRAHTLDQIGFIHAATAE
                     QLEHVLATVYGDVNLPLAVIVIDQDALRDAGVDVRWDERAGPSDTPGRWVPRIMGAVP
                     LDPDIVVATIPLEKHGENWTVPDLSGYSVDEAAS"
     CDS             complement(77092..77880)
                     /codon_start=1
                     /locus_tag="ROP_00890"
                     /product="hypothetical protein"
                     /protein_id="BAH48336.1"
                     /transl_table=11
                     /translation="MKGDEVDEASDARGPRRNFLPRNRQRERVLRMVREHEGAVDAVE
                     LASQIGVHVTTVRFHLDALCDDGAITRTRMNRPGAGRPRTGYLAIEERVDYRTLADVL
                     AMELGQTVQTRARRAEHAGHEWATRMAASRSAGTGDGGHTPESDAGDALDHAAARTTN
                     AFARMGFGPELVSAPDPSTPPSADSGGPAGERERIIRLHACPVRDLARSHPEVVCGVH
                     RGLLQGLLNTSTTEGNRKPHQPALSAHLEPFVEPELCVARLVAG"
     CDS             77945..78847
                     /codon_start=1
                     /locus_tag="ROP_00900"
                     /product="hypothetical protein"
                     /protein_id="BAH48337.1"
                     /transl_table=11
                     /translation="MTVDTICDPDIPMTTQVELFGPEFTQFVLPYQCAISTMTTKVHI
                     LRKGFTHLDRHCPIEHVSARVKSPDSIMAKAQRLRCPLTVSHIRQNIRDIAGVRITCG
                     LISDTYRVADLIGGQPDVTVLEVEDYIAKPKSNGYKSLHMAIEIPVFLSDRVVQVPVE
                     LQIRTIAMDFWASLEHKIYYKYKRSVPRRLLQELTEAADVAHRLDRKMERLHNEVAGL
                     KSVVDSDGPLSLEATDHDHGDRSQNRCGKPHNSTAGPLVRNPPAGGVDVCRNTTHLTD
                     AVLQGNTRVGPSTAPTACRRNPNP"
     CDS             78917..79477
                     /codon_start=1
                     /locus_tag="ROP_00910"
                     /product="hypothetical protein"
                     /protein_id="BAH48338.1"
                     /transl_table=11
                     /translation="MDASKATPSTSRGLRLRLKPVQSRGFVQGAWWPRSTHLTDELPA
                     LLTALSRRLGHIDRIIYDENGWAPAPSRIDHAGNTVDLRHSSDQSSNTLAITGEKFGR
                     LVLLVVPPYTDPVFAYATIMTAASPRDVSTADELLAIGAREAEDRRLALRAQHRWESE
                     GGALHHRGDKSVRPRRTGDSDRVRHG"
     CDS             80188..80616
                     /codon_start=1
                     /locus_tag="ROP_00920"
                     /product="hypothetical protein"
                     /protein_id="BAH48339.1"
                     /transl_table=11
                     /translation="MGIVHGRSVLAAGLGITVELIDLLRYPAGVELRLALTAYGHAAQ
                     QARYETRPLTDPGDPSPRWSFLRTHVRAGDLTGEADPYQAPILSTGTTRLIDFRTTPR
                     YWIDGIPAPVSLMVTVEWARIGLAATSSTIEIGPVPHPLP"
     CDS             complement(80671..80919)
                     /codon_start=1
                     /locus_tag="ROP_00930"
                     /product="hypothetical protein"
                     /protein_id="BAH48340.1"
                     /transl_table=11
                     /translation="MVTGWCEQVTRAFRWRIEHDHRELKPVLGLDHYDEPSWLGGHHH
                     AALVTAAHLFLATLRLTHPNSVRQNRPATPPAANVHAH"
     CDS             complement(80933..81427)
                     /codon_start=1
                     /locus_tag="ROP_00940"
                     /product="putative MarR family transcriptional regulator"
                     /protein_id="BAH48341.1"
                     /transl_table=11
                     /translation="MRKRGGDDESVSTSPEDLRAFEVATRDLVGVALRSIEGGDVDVT
                     LPQLRLLMVLSEEGTVSSSQAARALDVAASTVTRLADRLLASGHLRRGADRSNRSVVT
                     LESTARGRAVVEQVNARRQGELRRILDQLDPTERSDCAATLRRIHECLDGTSTPPALS
                     SLLR"
     CDS             81600..82241
                     /codon_start=1
                     /EC_number="4.2.1.1"
                     /locus_tag="ROP_00950"
                     /product="carbonic anhydrase"
                     /protein_id="BAH48342.1"
                     /transl_table=11
                     /translation="MHTDSPHPTTPASAWRVLRQGNERFVNGTPLHPNQGIADRAALS
                     DGQHPTAMLFGCGDSRVAAEIIFDQGLGDVFVVRTAGHVLDDAVLGSIEYAVEIVNVP
                     LIIVLGHDGCGAVKATLDALDNGAVPDGFIRTVVERVAPSVMTGRREGLCTADELEVR
                     HVVETGELLAQRSRIIAGRIEVGTCAIAGVTYKLSDGRIHLQGTVGDIGEPGD"
     CDS             82395..82679
                     /codon_start=1
                     /locus_tag="ROP_00960"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH48343.1"
                     /transl_table=11
                     /translation="MSTALYFAGLSLIGIGGLGDGLIRGLNPSAHPGTHKVSMGLALA
                     GVLCWTVGAVVSDQPLWWKIVASVFVLTIGFLLTMRSRFLPSHQWCEPDE"
     CDS             82693..82881
                     /codon_start=1
                     /locus_tag="ROP_00970"
                     /product="hypothetical protein"
                     /protein_id="BAH48344.1"
                     /transl_table=11
                     /translation="MYRQYILVEPPVVQHVATANTDRVGLHVPRNPVVGGSYSLRGQS
                     VGVIGVTTGPATRTPATC"
     CDS             83006..83371
                     /codon_start=1
                     /locus_tag="ROP_00980"
                     /product="putative ArsR family transcriptional regulator"
                     /protein_id="BAH48345.1"
                     /transl_table=11
                     /translation="MAANSRQPLYQMKADFFKTLGHPARIRVLELLSEREHAVSEMLP
                     EVGIEPANLSQQLSILRRAGLVTARREGLSVSYALTSPRIAELLRVARGILTGVVAGQ
                     AEVLEDLPAPPALVGETAG"
     CDS             complement(83202..83861)
                     /codon_start=1
                     /locus_tag="ROP_00990"
                     /note="fragment"
                     /product="putative monooxygenase"
                     /protein_id="BAH48346.1"
                     /transl_table=11
                     /translation="MSIPVDDADRYDVVIIGGGISGIGAAAYITREFPKKKVALLEAR
                     DSVGGTWDLFRYPGIRSDSDLHTFAYEFKSWRHETAIAPTRSCWASGWRTRRAPRQRF
                     PSTRPRTRRAARWRDRRDCSSPPTSLSGSERRISAANDSNVCTLENSQLILVLSDSGW
                     VGPVSPRSRPPRREVREGPRAPRPARRPPPSKSRARRVAARRCGGTSARRTPTGPRGG
                     R"
     CDS             83492..83647
                     /codon_start=1
                     /locus_tag="ROP_01000"
                     /product="hypothetical protein"
                     /protein_id="BAH48347.1"
                     /transl_table=11
                     /translation="MTNNHDDRASGPPDGSEVALTGIAVAVLAVSATRSPSTTGSARL
                     QSRDANS"
     CDS             84249..85691
                     /codon_start=1
                     /locus_tag="ROP_01010"
                     /product="putative amino acid transporter"
                     /protein_id="BAH48348.1"
                     /transl_table=11
                     /translation="MSATNPPSKSMGAGIADSSATAATADETSAEDTGRLSPTALVSL
                     SLASFFPAVSFAMVPFLVFTTSGTNAWQSSLLATIGVICIGRAVIAFARRYVASGSLY
                     SYVGEVFGPWARHLTAASLLAGFIVGVAALAAVVGVFVGSFLHARGIHGALNFDTQVI
                     VFGLALVLAAAVAIRGLDTSVMVAVTLAVIALPLVLIITVASAAHTGLDLGTQFSFTG
                     FEVGPVFQGIAVGAAFLVGFESCAALATETKDPKHSVPTAIMAVPVILGGLFPIVTIL
                     QVPGLIATSDELAAGVSAPAALAQLSGLGHGVATATDLVLAAASFASLVGFLNYAARF
                     TMTLSEDGLLPSVFSRLHPKHKSPSAAVLLMTLCAFLTISGMLLWTGDIISAYTPNAT
                     LLVYMWVVPYVIICVGAIRLSIRLREFRPGLWIAAVAGAATMTWAYTNGLVNPPPAPA
                     DSMIWVAPVAIALLFGVVRINVSRTRHIAE"
     CDS             85894..87123
                     /codon_start=1
                     /locus_tag="ROP_01020"
                     /product="putative CdaR family transcriptional regulator"
                     /protein_id="BAH48349.1"
                     /transl_table=11
                     /translation="MTEALWPTPSESVRTLIRDIAESLIPRYHEVVDELVAASLADPR
                     YHEIAADPVLAEADARLSVANLKHWLTSNIADPGRRVPTHASQEIKIYARDVVLRELT
                     TDDVASWRATHRVTWHWWLNECFAATDDTDVLHELVEVSANSLTAFVDDSIAALADYI
                     QAVREELAGGPQLQRYATVELLLHGSNIEPSRAEAQLGYALTGSHVGAIIWADSEEDV
                     GGLEPAAEQIMRACGAVSRLTVVAGTAALWLWMPSRLVPEVSDVADRIKHIKGIRVAF
                     GRMSASVAGFRRTHMDAAAAQRLLARLNSRLSIVRYEDVQLVDLMSADPALAAQYVLD
                     VLGEFADADPVLHQTVLTCVQAGFNRSSAAERLYTHRNTIDRRLARIDELLPKPLASD
                     PAGVVAALTLLNIRTGH"
     CDS             complement(87242..88183)
                     /codon_start=1
                     /locus_tag="ROP_01030"
                     /note="fragment"
                     /product="putative flavin-containing amine oxidase"
                     /protein_id="BAH48350.1"
                     /transl_table=11
                     /translation="MTFMSWVTRTTKTVFARTLWSIIGALTIGSQPGEMSLLYVLRHV
                     RALGGMDSLFASLSGGNERSFTGGSARLAEMMAADLGDRLAVDCPISSVRYHDQSVEV
                     TTVEGEVLRARHVIIAMSPADRESIRFDPPLPAAHRTLGERMSMAHAYKVHVVYSSPF
                     WRDRGLNGSIMTDTGPLILTFDDTPPDSQEGVIVGFGRADGGPNCYLPDAMPSDPAER
                     KRAVLAGLARACGEQAMSPTEYHEFDWTQEPYTVGCIPVWPPGLVTAVGAGFTDPVGP
                     LHWAGSELSPRWAGTMEGAIVTGERAATEVVVRMCTG"
     CDS             complement(88180..88635)
                     /codon_start=1
                     /locus_tag="ROP_01040"
                     /note="fragment"
                     /product="putative flavin-containing amine oxidase"
                     /protein_id="BAH48351.1"
                     /transl_table=11
                     /translation="MNTDTDFVDVIVIGGGLSGLTAARRLIQAGITSIRVLEAKDRVG
                     GRTRLRTLGGGRVVEDGGQLIGPEYHRLQALGEERGIETWPHYDAGKSIIERDGRVLE
                     FSGSMPWSSDPIGSADFAQSLLRLGRLVKSAPADDELGTLEAARLDSTR"
     CDS             complement(88632..89075)
                     /codon_start=1
                     /locus_tag="ROP_01050"
                     /product="hypothetical protein"
                     /protein_id="BAH48352.1"
                     /transl_table=11
                     /translation="MTEKSESTEMLDRYCAVIRELCDAVAAHDTDHMLRYFDDSCVFV
                     NGVDGRHTAKDGLVEFFQQVWESFPDYAPVPVEMHLNGDVLAVIFRTTATVRVGESEQ
                     IVSWLMTSFSTFDPETVTIVRDVYFADEEALEETIQRLHEAATVQ"
     CDS             complement(89089..90495)
                     /codon_start=1
                     /locus_tag="ROP_01060"
                     /product="putative NCS1 family transporter"
                     /protein_id="BAH48353.1"
                     /transl_table=11
                     /translation="MKAESHGIEFIPQSERYGHPRRLFSIWFSANMQVTTMVVGALGV
                     VAGLGLTWVVLGLVLGNLVGGIFMAGHSAQGPHLGIPQMIQSRAQFGVYGAGIPLAAV
                     VVAYVLFFAANAVMMRDAVERALPVGDNTALILFGTVTLVVAFFGYELIHRLGVVMAW
                     ASGLLFAAVFVIVSLSDEPGAAIVESIPSTSFSLPIFLLVFTQALSWSLGFGPFVADY
                     SRYLPETVSSRATFMYSYAGQVLGASIVMVIGAVVTSAAVDVQASPAIGIAALFGPLG
                     SVGLIVLLLGVVMFNVLCLYSGFMSTVTIFSSMRGSNTIRPGTKLLIMSAIAAVGTVV
                     AIATQHDFYTFFGDILVAQVYFLVPWTAINLVDFYVVRKGKYRIRDVFDPDGTYGRFN
                     VPTIAIFVVSVLAQLPFMNLNVYHGPAARWIGADISCVVGLVVPVVLYLAMARIGRLD
                     SRGPADDVSAESSAVPSP"
     CDS             complement(90492..91703)
                     /codon_start=1
                     /locus_tag="ROP_01070"
                     /product="putative oxidoreductase"
                     /protein_id="BAH48354.1"
                     /transl_table=11
                     /translation="MGKTRVVIVGAGVVGLSAALQLSEAGNYDITVAETDHIGSGSSS
                     RSVGIVETQYIEHFDIEVRAYGHRFIRALAEQSDLQLHMNGYLRLADSDATLGQYELS
                     VARQRECGVGDAQVLDVDDVKALIPFMEMSDRAGALLGASDFYLDGYLFANLMAARAR
                     DNGVTVLQRARVLECEWTADGEAELRTERGTLHADLVVNAAGAWAGRVGEILGAPVTL
                     YPELHHAVTVVSKTAAASRIPSVMDYVPGDGAEGVYLRPEGESEFFAGLHSEQASRSA
                     VDLDDVPLSAVDGDFVAALAESFSTRFPGLEDAQLGSGWSGLFPMSFDSRPLVGPHPA
                     NEQVICALGSGGNGIQLSPAIGRTVVEYVRGERPSMAAPGSDWDPQRMPANPGDIAGI
                     QQSTPTSGVRE"
     CDS             complement(91762..93309)
                     /codon_start=1
                     /EC_number="6.2.1.-"
                     /locus_tag="ROP_01080"
                     /product="putative acid--CoA ligase"
                     /protein_id="BAH48355.1"
                     /transl_table=11
                     /translation="MYRTILSTLDDAVEREPDTPALVFEGRTYTNEQLKTAALVRLGA
                     IQAAGLLPSTPVLVMLDNTDEAVITWLALALGGYTEVPVNTAYIGETLAHLCRDSGAP
                     TIITEGRFVERLSSTLLGDVTSILLVPTGTEAASGLGEESVLRDDPSSLGSIVVRDEL
                     DETAVMYTSGTTGPSKGAVITERHAYTYASSVAETIDLKRGDVYYAPLPLFHIAGRWA
                     VVYAALQRGACTVLVRRFSITSFWQDVRHHQVTATFLLGAMAQFVLSAPPRPDDDDNP
                     LERVLMVPLIEGVDDFRARFGVQVATCFGSTEANVPLASGWDAGIDDGVGRPRAGFRL
                     RLVTAEGEDAIQGERGELLVSTDEDGICLARYHHNPDATSRAVIDGWLHTGDIFVLDE
                     QARYHFVDRLKDALRKRGENISTFEVEREVRSHPGVAECAVVGVASEHTEEDVVAFVQ
                     LRSESGPVTPQEIREHVLARAPKFLAPDHVILVSDFPTTPTGKIQKFELRETAHRMMA
                     APTAAAD"
     CDS             complement(93353..93766)
                     /codon_start=1
                     /locus_tag="ROP_01090"
                     /product="hypothetical protein"
                     /protein_id="BAH48356.1"
                     /transl_table=11
                     /translation="MKAASTDHETNYGEGIVVENNPQPVVAIQQDRYTFDNGPMKLEL
                     RSARTGIDQLAGGILRFDDGGAGEPWKLPYDEMLYVITGTLRLRFADQILSLAPGEVA
                     AIPRGAEVVYEGEPGTTAFYALTPADWHVEHPDGL"
     CDS             complement(93767..94567)
                     /codon_start=1
                     /EC_number="1.1.1.69"
                     /locus_tag="ROP_01100"
                     /note="protein synonym:5-keto-D-gluconate 5-reductase"
                     /product="putative gluconate 5-dehydrogenase"
                     /protein_id="BAH48357.1"
                     /transl_table=11
                     /translation="MPISEALAPDETGPGIFDLTERRVIVTGASRGLGRQLARGLAAF
                     GASVACVARDQAALDETVALIEAQGGKASAYVADLGDPDAVTSLIERVAIDMGGIDVL
                     LNNAGVDHDSPIEETSLETWEKVIEVNNRSVFLMIQAASPYLRASGGYGKVINIASIL
                     GTVAMRDNSAYVMSKHAAIGLTKSIALEWGRRGVQVNALCPGFLVTDMTIHSVSDEAS
                     SKWITSRTPMGRWGQPSDYVGAAVFLASRASDFMTGQTLYIDGGWTAQ"
     CDS             complement(94567..95397)
                     /codon_start=1
                     /locus_tag="ROP_01110"
                     /product="putative hydrolase"
                     /protein_id="BAH48358.1"
                     /transl_table=11
                     /translation="MDLAGTDSEGYTRVYGQGFTGGRSLDHLVGELEQHDVAGVMQAE
                     WEEDDPAKVNTRVAEAIATHPDHLVAGIATTDPRLPNALEILKHAHDEQGLRGWNFQP
                     GFLKVAANDPSVAPLLDYCQENGHPVTIHSGINFSETGPIKFGHPGALCEVACAYPDL
                     TIVASHGGWPWVTEMLAVMWKHSNVYADFGAIAPKRMVGPRGGWEPIAHWMNTMVADQ
                     VLMATDWPMIRHERLLAELDYLELSDESRAKFTFLNAARLLDKHWGIKLTNNDQVGEL
                     "
     CDS             complement(95509..96621)
                     /codon_start=1
                     /EC_number="1.1.1.-"
                     /locus_tag="ROP_01120"
                     /product="zinc-containing alcohol dehydrogenase"
                     /protein_id="BAH48359.1"
                     /transl_table=11
                     /translation="MKVKAAVFERVGEPIHVEELDLEDPKRGEVLVRLEAAGVCHSDY
                     HVVKGEWESAGPLVLGHEGAGVVEKIGPGVTSVSVGDHVVLSWVPYCGTCAYCMAGKP
                     ALCPKVEETAYQNVQYDGTSRLSRGDESVPSYLATGAFADRVIVHETGAVPIRKDAPL
                     DRAALVGCAVATGVGAVLNTADVQPGDTVLVFGCGGVGLSVIMGAGLVSAGQIIAVDM
                     SDKALELAKSLGATAIINPSRDDVATTVRGLVDERGVDWAFEAIGLKPTIEQAYELIS
                     PGGTVVVVGQSADGVTIEIDPMVMSDREKSIIGCNYGSSRPAIDFPRLIDLYMQGKLD
                     LDRLVGHTSSINEVNEAFTRMGQGEGGRTVILYDHA"
     CDS             complement(96675..98174)
                     /codon_start=1
                     /EC_number="1.2.1.-"
                     /locus_tag="ROP_01130"
                     /product="aldehyde dehydrogenase"
                     /protein_id="BAH48360.1"
                     /transl_table=11
                     /translation="MLTSDTLTAARDRIKTMRVTHFIDGAFVESESGCDTTDIVNPAD
                     ESVLATAPRGGREEVGRAVDAARRARRRWAKTTPGERAAVLLHIADVIDANVELLAAV
                     ESLNVGKPLAAVMEEIPVASDCLRFMAGAVRTAQAPATAEYVSGHLSTIRREPVGVVG
                     AVVPWNYPLMMAAWKIAPILAAGNTLVLKPSELTPLSMVLLAELVSDVLPEGVLNVVL
                     GPGRVVGDALGRHPGIDMIALTGSTRAGQEVAAGASGTVKRLHLELGGKAPVVVFDDA
                     DLEAAVEAVVAAGFVNAGQECGAATRVLVHRDVHDELVERLSRAAAALIMGDPADGSS
                     IELGPMVSGAQRARVAAMVERAIVAGAVAVAGGAVPECRGFFYPATVLTGIEAGSEMA
                     REEVFGPVVTVETFETESEAIAKANDVVYGLAGSVWTRDHGRALRVVDQLDFGSVWTN
                     AHLIFSSEMPWVGFSQSGYGRDNSTYALDDYTRTKHITMSMGMPADQAR"
     CDS             98567..100549
                     /codon_start=1
                     /locus_tag="ROP_01140"
                     /product="putative oxidoreductase"
                     /protein_id="BAH48361.1"
                     /transl_table=11
                     /translation="MTASASADRIAEETEEFPLLFSPLRIGPIDLPNRIVNAPHQTGF
                     ARDKGYSPQLIEYHRERARGGAALIMSQANSVVPGYLDMHNVSDEIIPQYREAVRAVG
                     EFGAHYGVELYHPGSQGSYEGTGTDVYVGPSGVPSNYFHAGWRVPHALTEREILQIVD
                     AFAAAARRCSDAGVSVIEIHLGHGNLIEQFISPRTNRRTDEWGGPLENRLRFAEHVLN
                     AVRNAVGPNVAVGARMTATGLEPDDPGVMDSTEIIGTVGSWDLLDYVSLTMGRYSDAL
                     NTARNIPNMTFPPGLWQRYGRAIKSVLEVPTFMVGRINHPRIAEEMIESHSCDAVAMV
                     RALIADPYLPQKSKTGKVEQIRPCVGAMNCLHRLDQGRGIRCIHNPAVGHEGELSEDV
                     GSSPKPGTVLVVGAGPAGLEYARVAARRGHQVTVVEQSRIGGRALAVSKAPTRGELSS
                     ITEWLHEQCLELGVEFRIGTTASRESILDLSPDIVALATGSRLPENPFAGDSLPIIDA
                     ESVLSTPSFTGRIAVFDSFGDWHGISLTHVLAARGAKVEYISPTPYPGSSLEMTNWRI
                     EYANLVAAGVEFHPVSEIVGVEPSAVRLRAGFSKTELRIEELDGLVWVAPPVAEDGLF
                     HQLSDTNLRIDLIGDAYAPRGIEQSIFEARQAAAKI"
     CDS             101378..101827
                     /codon_start=1
                     /locus_tag="ROP_01150"
                     /product="hypothetical protein"
                     /protein_id="BAH48362.1"
                     /transl_table=11
                     /translation="MTNTENRVDTEACVERIESVCMAVVARDLEGVLDHFAEDCVFVN
                     GVTGTTVPGKAELVNFLNDIWASFPEYTPRPVAAHLEQTTLGMLFETTVELPATDEKA
                     SPDGTKVRWLTSSFFTFDPTSMKIIRDVYYADEAAVEQMINEAGRAG"
     CDS             complement(102807..102995)
                     /codon_start=1
                     /locus_tag="ROP_01160"
                     /product="hypothetical protein"
                     /protein_id="BAH48363.1"
                     /transl_table=11
                     /translation="MPPRRDSDETRFDSDEPAKKPETAGLFAGWAKADRFGIVVAKPL
                     RCPHSHSACRLGLPRSVR"
     CDS             complement(103043..105289)
                     /codon_start=1
                     /locus_tag="ROP_01170"
                     /product="putative ATP-dependent Clp protease ATP-binding
                     subunit"
                     /protein_id="BAH48364.1"
                     /transl_table=11
                     /translation="MRSGFTTRALEALDWAQAQSIPVATRPEHVLMALLDQDATIVEP
                     VFEALGVDADDLRRSSPSVTVRRGAAASAAAPGIDADMASLLRAAEHEARQLSDHLVS
                     IEHLLIALAGRRDGVGEALRAAGADRSSMLEAVRRVRGPAAVVDAEPERTYLGVRWRP
                     PAVSSQVLRYSRDLTELAFRAELDPVVGRDAEIERVIQVLSRRRKNNPVLIGDPGVGK
                     TAIAEGLAQRIVAGDVPAALLNRRVIALDVGALVAGATYRGEFEDRVKSLLKDVVGAD
                     GGIIVFIDELHTIVGAGAAEGAVDAGNLLKPMLARGEFRTLGATTLDEYRKHVESDGA
                     LERRFQPVRVDEPSSANALEMLRGLRSRYESHHGVAITDAALSAAVSLSDRYIADRFL
                     PDKAIDLIDEACSRRRIQSDSLSSVTRGAGSCTPPLVDDDDIARLVGQWTGIPVSRLQ
                     EEELERLVHMEHRLAERVVGQAKAVVGVSAALRNSRTGLSDPNRPIASLMFCGPLGVG
                     KTYLARVLADVMLDSGEALVQLDMSDYAEKHSVTRLVGASPGYVGYEEGGQLTDAVRR
                     RPYCVVLLDDIEQAHPDVHGLLRQVIDDGSLTDGQGRVVSFRHVILVMTSSLPDLGAV
                     NQHFRAEFLTRLDDVLEFAPLRRKDLEQLVDIQVRSVAARLSDRGIALELTHEARALI
                     AELGDDSRQGARPLVRVVQKELISAVSRSILLGDACPGDTIRVDQEGTSVTLTVLSRP
                     AEAVPQLS"
     CDS             complement(105364..106773)
                     /codon_start=1
                     /locus_tag="ROP_01180"
                     /product="putative oxidoreductase"
                     /protein_id="BAH48365.1"
                     /transl_table=11
                     /translation="MNAAKFDYDTVVIGGGFAGVSACRDLADQGYSVLLLEARHRLGG
                     RTWSEQRTVGDFEGVIELGGQWVWPDRQVNMMAEIERYGLNLTHSAMPERYPTFLAGK
                     YNEGPLPVPVEDVYDFEKAAFKFLTDAHRIQRGVPLDRQNLDDLDIPFSEYLDNLGVS
                     DATRGFFTFFGTVFQGRNPEDISALLPLAFIAQMDHSLIGAWGILDAYIVEGTSALIN
                     AMAEDSGADIRFETPVARVVQDEDGVTVTTQAGDAFTARTVVVATPVACWADIQFEPP
                     LSEVKFIVSSDGGVAKVCKVYAQVKNAPRLPYMIADAPAANGAAIISGAYDLDEDGQL
                     MIGFFIDDPDNVDRFGADFAGIERFVKTMCPEAELVAYECHEWVSDPWAGYGGYPAYK
                     PGRLSKGHSELTRPEGRLFFATADIANTFMVWMEGAVEMGKKAALDSQRRMERDALEI
                     KVHARARASSDAASARNNA"
     CDS             107239..107475
                     /codon_start=1
                     /locus_tag="ROP_01190"
                     /product="hypothetical protein"
                     /protein_id="BAH48366.1"
                     /transl_table=11
                     /translation="MSSSPAEPDPGGHRASQPYLDHLLDPADATISTLRASRLLALAN
                     SHDPHLIATTYGMSAEGVLAYFADRVDRTLLADL"
     CDS             complement(107521..107991)
                     /codon_start=1
                     /locus_tag="ROP_01200"
                     /product="hypothetical protein"
                     /protein_id="BAH48367.1"
                     /transl_table=11
                     /translation="MSRRESRSAILRSMKVGLDQSMRIDTWNALDDLRYDRSLLSDLV
                     SLRFAEAGHSVLVLGPVGVGKTHLATALGHVAIRRRMTVLCARADKLFALLRAARLDN
                     SVEAEMRRIATVDLLVRRFCVAAPGRHRDQRLLRVGHLAPSPQGDDRQLERGAF"
     CDS             complement(108408..109019)
                     /codon_start=1
                     /locus_tag="ROP_01210"
                     /product="site-specific recombinase"
                     /protein_id="BAH48368.1"
                     /transl_table=11
                     /translation="MGEPFRVGSARCSTDEQDVGIQTEQLLALAVPRERIFIDKGFSG
                     TTRKNRAGLDNALAAVTSAAAAVTGRQVVLTTTKFDRFARNMAEAGEILTGLREREVL
                     FGLGNSVYDWNDPFGKLFLQTLAMVAEANLNHLRTREGMAKARAKGRLKGKQPKLPLA
                     ARKTIHRRYHDPDDDASLADLADEYSVGRSTIHRIVSGTTPRA"
     CDS             complement(109178..111496)
                     /codon_start=1
                     /locus_tag="ROP_01220"
                     /product="putative LuxR family transcriptional regulator"
                     /protein_id="BAH48369.1"
                     /transl_table=11
                     /translation="MPLLTLSRVGNLPSELSSFVGRRSEVSEVKHLLSAFRLVTLTGF
                     GGVGKTRLALRVATDVSRAFTDGVWLIELGEQQDDTRFTETVARALGIEMPSATMPLE
                     ALTEYLAPRQLLLVLDNCEHVVDGIAAPATTLLRKCPRLRILATSRETLAIAGEAALP
                     LRPLTFPDPNPSCSAQDLSSYEAVRLFTERARAAVPGFGVTEDNKAVIARICQRLDGL
                     PLPIELAAAGLRVLSAQQILLRLSDRYRPPSITNRGTPARQQSLRRCIDWSHELCTAR
                     EREVWRRVSVFTGGFELDGAEALCAGEFSPNELLEVLAALVNKSILIPEQTHGVIRYR
                     MLETVRDYGRDRLRESGEYSTFQRRHRDWFEQLTVRAHAEWLGPRQAEWTTRLDRELP
                     NLRDAMTYCLADPIHAPVGLHIANALRRFWISRGLLSEGRQWLRRALTSQVEQPTTSQ
                     VTALCTEGMLAAMQGDVTDPVALVAKARHYAAGVADPGLEQLVTRTEAQLALSSGDAA
                     LAVTHFEKVLDACRASEDLDTQLEVLLGLGVACGRCGDRARAMTCFEEILAITEPLGD
                     TVHRAQALAALGSTISCTDPVQAAHLLTRGLQLSRSLNTPGTATSCLYTCAWIAATEH
                     RTEHAAVLIGAVEKLAESTEAHWLNGYTIDTGQESSLARVRLVLGERAFSKAVEHGRG
                     LTLREAVAYALGENTAADDPSRSGPSKDLTPRERQVADLVAQGLTNRAIADKLVISQR
                     TAQGHVEHVLAKLGFGSRAQIAAWVAPNAGER"
     CDS             complement(111984..112535)
                     /codon_start=1
                     /locus_tag="ROP_01230"
                     /note="fragment"
                     /product="aldehyde dehydrogenase"
                     /protein_id="BAH48370.1"
                     /transl_table=11
                     /translation="MQVTHFIDGAFVDPESGCDSTDIVNPADESVLATAPRGGPEEVG
                     RAVDAARRARRRWAKTTPGERAAVLLHMADVIDANVELFAAVESLNVGKPLAAVMEEI
                     PVASDCLRFMAGAVRTAQAPATAEYVSGHLSTIRREPVGVVGAVVPWNYPLMMAAWKI
                     APILAAGNTLVLTNLGALWRSTR"
     CDS             113319..113927
                     /codon_start=1
                     /locus_tag="ROP_01240"
                     /product="putative TetR family transcriptional regulator"
                     /protein_id="BAH48371.1"
                     /transl_table=11
                     /translation="MARLPAGQRRKDFIAAAVQIIAERGMHGATTRRIAERAQAPLAS
                     LHYCFHTKEELFLAIYEDMAASQLREGFHVREGSGLGRAAAGLLRQIEAWFGKEDTYA
                     QAQLELFFWVFRQDGDLAKRLYQLHLDVLEGLLRQGLRPDDNVKLVEVLARAIATVVD
                     GLVPQWLTFKDRVMHDTTVDVIAESLERLADAHRITQAAAAG"
     CDS             complement(114052..114234)
                     /codon_start=1
                     /locus_tag="ROP_01250"
                     /product="hypothetical protein"
                     /protein_id="BAH48372.1"
                     /transl_table=11
                     /translation="MITEVVLIPNIASVTEPLRGHDLGVWLVAETIHRMLPAGIVLMW
                     PYPVLSVDAEPDPELG"
     CDS             complement(114231..114497)
                     /codon_start=1
                     /locus_tag="ROP_01260"
                     /product="hypothetical protein"
                     /protein_id="BAH48373.1"
                     /transl_table=11
                     /translation="MPRVQFRSVGLSDLDACLDWFAELTMTVDLDDADDVVVGSLDFT
                     LIRLGTEDPIALCLGQFDGDREIMACSMAINSPNRSRSSTRRWP"
     CDS             complement(114923..115267)
                     /codon_start=1
                     /locus_tag="ROP_01270"
                     /product="hypothetical protein"
                     /protein_id="BAH48374.1"
                     /transl_table=11
                     /translation="MVARTAGFVKQVISSTLYRPDGTVETTRDPAVWTLAHRGYSGSA
                     RLDVWAYRTKDDALRAGARLAMDCGMDEDARCRELFDAGRWTAVMERYEELSPDGHLL
                     RVQAAFLQLDDE"
     CDS             115545..115790
                     /codon_start=1
                     /locus_tag="ROP_01280"
                     /product="hypothetical protein"
                     /protein_id="BAH48375.1"
                     /transl_table=11
                     /translation="MGEEFLARAVAAALADGASWAEIGARLGVPTPHTTGAGGTPSDA
                     DWQNAIAEHENTHVTRRHPKPPGTQETTTPTDATGNH"
     CDS             complement(115975..116223)
                     /codon_start=1
                     /locus_tag="ROP_01290"
                     /product="hypothetical protein"
                     /protein_id="BAH48376.1"
                     /transl_table=11
                     /translation="MAHRSSTRRVHGPELKVGARVLVRRHAEADVIGEVVEDYGPLTE
                     SGGRGHEWAPAHRWAVALDDGRLIFADTDEVTVDPGNR"
     CDS             116454..116879
                     /codon_start=1
                     /locus_tag="ROP_01300"
                     /product="hypothetical protein"
                     /protein_id="BAH48377.1"
                     /transl_table=11
                     /translation="MHDRLPLTRNTDLMLELVRITSYPSGLAVQLALTATGRPARRAW
                     HETRPLTDPTDLSAHWSYLEVWAGSGDLAAADPYFPRPDLQAAASGICSYRSEPLYWL
                     PTAPAWALTLATGWPQIGLPTAVTTMHLDPITPPTSRRA"
     CDS             117247..119745
                     /codon_start=1
                     /locus_tag="ROP_01310"
                     /product="hypothetical protein"
                     /protein_id="BAH48378.1"
                     /transl_table=11
                     /translation="MRRYHRSVTDPTDPTAEAAMSLLREHGPLHPDEWARRLVAEGHG
                     YLADMEELTEYIGHPRLGYLADGRSAALDALLDGRVLTHRLTEMEISSGILDANPDLM
                     PLLPFDDDDPAAGGLRILFRDLDDDVFDERGALDADWPADAALLLEPDALTGLRPGDL
                     VALTFTGGVLRLTAAENPPAPAPDLTAALTGLVTEDRPEPLDGVIWQLMADDPSLLTA
                     PTTPLGELITAAGYVCDGDDIAAAGFDFAAHRGKAHMATVAAAHHLTDDQTDAVLAFL
                     ALIGVLERTPDDQRAAAVDAVAANFGDRFAGLAHPNAARAAFGEAYATAHAGTDTLRS
                     AAAVLRDRGPRRIAPTAHWLAGKAAELDGWTADAERHYERALAVDPNWDEALEALARF
                     ASDRGDAVRAIGLLDRVEGAYREPMYDLLQSFLPVDRPDLGRNDRCWCGSGRKYKACH
                     LGTAEHSLEQRAGWLYQKAGSFAQGIEWRPLLLSLAQIRSVHNDDPFALYHALDDPLV
                     ADVVMFECGAFARFVAERGVLLPADELLLAQQWSLTERSVHEVETVRPGEGLTLRDVR
                     TGDRHEVTERTASRQLRVGDFFCARVVPAGSTTQIFGGIEPIAPGQRGQLIELLDSNA
                     TDPEELVEFLSARFAPPRLITPDGHPMVACRAVFEIADTTGIRRKLSRRFGAADNDRW
                     TWTEQNSVLGVLTLTRSTDRWELEAEAMNEPRFESLIDAVRAADPGGRLREQTRTPAA
                     ELIAQTQDNGAHPHQPVDPEDPEIAATLDEHIRRYEQQWLDEAIPALGGHTPRQCAAD
                     PTRRDELIRLLDSFPQQDRPGAMSAHRLREALGL"
     CDS             120018..121892
                     /codon_start=1
                     /EC_number="3.1.-.-"
                     /locus_tag="ROP_01320"
                     /product="putative ribonuclease"
                     /protein_id="BAH48379.1"
                     /transl_table=11
                     /translation="MTSPTTTDMATLLMIDSQHARDRDDAFAVTPPAGGRGWAVDVHI
                     AGVADVVGLGSVADEQAFLRAETRYLRSRTIAMLGETAEQAATLTSEAARTSLRVTGT
                     LTTDGRLVDVTVARGQIPSGRCVAVDHAQAPGILTDPQHPLHAWLAAADAAAQVLLGA
                     RRDGGALAFYDLTRGWASNEDGAIVAIPDALRTVAYVIVQELMIATNEAVALWCVERG
                     LPILFRNHRPNPVAGSTDELMTEIAAAAGDPDLFAKLRGRLLSTLRAATYDPTVHGHY
                     GLRLSAYTHVTSPLRRVADLINQRVILAHLDSSPTPYTSDQLAALGDDLNRRTRAARE
                     AKKNHFKHADQRIIAQEAARDLTALDARTFHKVLKSAAAAPLRDEIATELARRVDADL
                     MTAPDVAVLIDAADPTWLPLQLRVLDTLADTHPEMGPSVASVWRQTHPDHPATDLETR
                     RGGADHHPLFAARATHLGIHGPWTIAAAKKLAEQAALWAGLRAQLTGTNHPDPEPEWL
                     AAPQNPQPPATPAAADPGPAIASPPHDTATLTVLNLDGAKKSKALSNPIAWLMSLAQN
                     NRQAPPEWEIRTDGPAHAPRFTATVHLAGHTATADATTKTAAKTASAAALVEALFARQ
                     "
     CDS             123061..123699
                     /codon_start=1
                     /locus_tag="ROP_01330"
                     /product="hypothetical protein"
                     /protein_id="BAH48380.1"
                     /transl_table=11
                     /translation="MRPSSSPMIGEVVAAVRAFIDGIDEITEVDQVFLDNATAVWQIG
                     RAVPLPGIGGRNRGEPDFLPTPVTRMFLWHITHYQPGAAEQHERAAHISRHRTSAGPA
                     AKYQLDWFRIDTPGSRGRGRLQRDDVLLQVTADNEWLYSPAVVDSDPNAIPHTRTAVA
                     YHLRTRVDLEPIAVTDAEVLLADAGHPGPRLRTDHRIVSASLRAALLRLWNL"
     CDS             124043..124543
                     /codon_start=1
                     /locus_tag="ROP_01340"
                     /product="hypothetical protein"
                     /protein_id="BAH48381.1"
                     /transl_table=11
                     /translation="MISMRARPPAASPLQLYAEFRRRHPALVMPANYVTECGFRLGRW
                     QNRQRVARMLGTLPPQRITQLDAIGFVWTDDSAPLPAVPPAEGKRRRMLTEIAAYREE
                     HGDALVPANYVTADGEQVGQWLYRAVKKWRANALPDNERRPLAVLGVSPGPRPRGPRL
                     SAHPMR"
     CDS             125346..125726
                     /codon_start=1
                     /locus_tag="ROP_01350"
                     /product="hypothetical protein"
                     /protein_id="BAH48382.1"
                     /transl_table=11
                     /translation="MRGTADVREFLDHGWRAFPDLTFELAAGPTHNERRPPRRLLVKT
                     TATHQGPLDPPGIPATGTHIEFDGVDIHEYRDGKIATADHHQHDDIALQEGLLPAPGS
                     KAERVMTGLQKLRSRLTRSRTSST"
     CDS             125853..126185
                     /codon_start=1
                     /locus_tag="ROP_01360"
                     /product="hypothetical protein"
                     /protein_id="BAH48383.1"
                     /transl_table=11
                     /translation="MNTNETTGTECAPWCTNEDARGRNDHTCTGDNSNCIELTAALDY
                     LTLDDDGIESSFCFVTPVREADRRPRVSMTWEVGNHPEFRPRLTPEEARRIAAELVAA
                     ADVIEGRR"
     CDS             126384..126932
                     /codon_start=1
                     /locus_tag="ROP_01370"
                     /product="hypothetical protein"
                     /protein_id="BAH48384.1"
                     /transl_table=11
                     /translation="MRITDSARKHHISNTDITHAFENAIRYAEYEDDGEERLLIIGTD
                     TAGRLLEPVAAPAGEPNRRVRAAIAAAASETTREGGRQPHCHTPHPLTPRRRRPGTEA
                     GRLLRGGTKIRGAAGGAGAGSLRHNGLRARHGQRQGFSTAWGPWQRRGRPRYLARPTI
                     ARCGAVRGLEPATSTPDLRLAD"
     CDS             complement(126965..127318)
                     /codon_start=1
                     /locus_tag="ROP_01380"
                     /product="hypothetical protein"
                     /protein_id="BAH48385.1"
                     /transl_table=11
                     /translation="MSPKRGERVAPPAAGELWDLRFATSDAAKGWDELCRQAPANTLV
                     AYEELRRRAVGQESTTRHHRLKGRLATGVHNGVEMEQWQYEVTAGGRVWYVVDVEHRT
                     LWLKYAGTAHPKQTE"
     CDS             complement(127315..127782)
                     /codon_start=1
                     /locus_tag="ROP_01390"
                     /product="hypothetical protein"
                     /protein_id="BAH48386.1"
                     /transl_table=11
                     /translation="MSVGEVPFSDIQNKGKATLAEWQRSGARPLRVTRRDDEDLVLMT
                     AVRADQEREVLAAATAMVEALLHSDDRVLVRKVVAAAFPWVSYLSGEELADFVDELIA
                     SLRAGSSLDNPAPPARTIETWRHTAEVYADPDLARILSAPSGGDFGVVPVPEL"
     CDS             complement(127811..128017)
                     /codon_start=1
                     /locus_tag="ROP_01400"
                     /product="hypothetical protein"
                     /protein_id="BAH48387.1"
                     /transl_table=11
                     /translation="MSQGVSFSLSTRFVQNDSVMESELYERCLSLELLPILLLCAGGG
                     GVGFSFVSTVGGASSVPERSPSPC"
     CDS             complement(128075..128374)
                     /codon_start=1
                     /locus_tag="ROP_01410"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH48388.1"
                     /transl_table=11
                     /translation="MFVMLGLPSSGGTIPLEATPSLYRWLGGFEPMHQIYRGVRAIIF
                     FGASGAAGLIHAVWMTFAGLVIGLVVGAVITRFYDRKGLHRRLEAQAPVPVEARS"
     CDS             complement(128365..129435)
                     /codon_start=1
                     /locus_tag="ROP_01420"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH48389.1"
                     /transl_table=11
                     /translation="MARTGGSGTDDPVVNRSAWSVLRTPRLVMAPVVLVCIVMSLLAV
                     LYMGAMLDPTKHLHHFPIALVDQDEGDTVPGSDPPVQRKLGDQIAAGLIDGVDPEKIQ
                     FRRMGIVEARSLLDDGKIYGAIGIPSDFTKRTFVLAQASVVPGDVDRPVITVYTNPRA
                     GTISANIVRAVGATALDEANRALGEQLTAQVNEQLAAGGGGTQLSGASRLVLADPIDV
                     RTVAHNPLPFGTGFGLAAFYYALLLVLAGFTGANLVNALVDGMLGFTPTEVGPLYLYR
                     AAVPISRFHTLLVKWAIVVALGMIVSGLYLGIGSALGLPVTDPLALWGYGAFAIAAVG
                     ITAVSVVAAIGNLGLLAICSCS"
     CDS             129716..129982
                     /codon_start=1
                     /locus_tag="ROP_01430"
                     /product="hypothetical protein"
                     /protein_id="BAH48390.1"
                     /transl_table=11
                     /translation="MRYGQCGMGGAVWAVQTISMELGTLVVDPGTGHDTTITVVQVAT
                     DRDTFTRLDLSRVEARATLDHLRAGVSKNPHDLVPVAHSRGVRG"
     CDS             130002..130337
                     /codon_start=1
                     /locus_tag="ROP_01440"
                     /product="hypothetical protein"
                     /protein_id="BAH48391.1"
                     /transl_table=11
                     /translation="MTTPAPAVTITALREMLVIKEREANTLLDRIAGLERDPAHATEN
                     AAAPPRHPPRIVHPPAAAPIPASSRPTIASCCKKSGSTPTTTPRERRPIPRPTRHPAS
                     PDQGRGHQW"
     CDS             130357..131244
                     /codon_start=1
                     /locus_tag="ROP_01450"
                     /product="hypothetical protein"
                     /protein_id="BAH48392.1"
                     /transl_table=11
                     /translation="MFSSNNSLANGRKKTADLSKLMLRAYNAEADICVRTLRAGNLTT
                     AITRLNKAATTITKLGAMMDMHLADTYHALRIRELELTADYLMKAQEEKEAARAEREH
                     LREERKVEQELAAQREKLDNERAHYRKVLTSIGGTDPQEKQRILDKIADLDKAIEDND
                     HRQANIRAGYVYVISNQGAFGPNVVKIGMTRRLDPTDRVRELGSASVPFPFDTHALYF
                     SDDAITLENKLHNAFTGQRLNHANPRREFFFATPAQVRDVLAAHVGNLLEYTETPEAT
                     QYFQSRSNWPAGAAIGPTT"
     CDS             complement(131307..131858)
                     /codon_start=1
                     /locus_tag="ROP_01460"
                     /product="hypothetical protein"
                     /protein_id="BAH48393.1"
                     /transl_table=11
                     /translation="MTFTVLYDANVLYPNVLRDVLIRLAQTGLVHARWTDRILNETFE
                     NLAEDRPDIPAATLTKLRELMNRAVPDCLVTGYEKLIPALTLPDADDRHVLAAAIRAG
                     AQVIVTANLRDFPDAELAQFGIEAKHPDEFVMDLFHLDGVRVHQAVSATAAAWRNPPG
                     TPADVCDRLAAAGLPISAAALRR"
     CDS             complement(131860..132300)
                     /codon_start=1
                     /locus_tag="ROP_01470"
                     /product="hypothetical protein"
                     /protein_id="BAH48394.1"
                     /transl_table=11
                     /translation="MMAAAHDQPTVVEQEQARQALQLLRDVDPAGETLDVTVAGTSES
                     VHLPRAALDLIREVLANMAAGQGVTVVPAHAELTTQQAAQMLNVSRPHVIKLLDEGHI
                     EYRMVGRHRRILTSSLLAYQRTQLGASRAAADELAALTEDLGLY"
     CDS             132429..132776
                     /codon_start=1
                     /locus_tag="ROP_01480"
                     /product="hypothetical protein"
                     /protein_id="BAH48395.1"
                     /transl_table=11
                     /translation="MKKTTLAMAALAISALLSGCRWRHAVQQHIDHHHGIGGPAGRRI
                     ERTAHDHHGPAPTTATAALPVTRSAAVAPPITPVTPTTTVAVAPPPAPAVIPANPRRR
                     STPSRISESVHSR"
     CDS             complement(133005..133856)
                     /codon_start=1
                     /locus_tag="ROP_01490"
                     /product="hypothetical protein"
                     /protein_id="BAH48396.1"
                     /transl_table=11
                     /translation="MDNPRHWVGHLRVLSGIQDRIGGFTEFVPLPFVHQSAPLYLAGA
                     SRPGPTNRDNRAVHALARIMLHGRIPNIQTSWVKLGVTGTQVMLQGGANDLGGTLMEE
                     TISRMAGSEHGSEKTVEELRAIAEGIGRPARETHHHTRPPAPPPRAVMSTIGVDGYAV
                     VVPIRSLRMAKSRLRTSDTMRSQLALAFFLDTITALERKHRGGADRGGLRRRHHPGVG
                     AGALRRPDGRRNGPPRRNQSRHRKAPKDKPFRAGGRRPPGTALCDRWRVRHASRLCTR
                     TPAGLPG"
     CDS             complement(134019..134603)
                     /codon_start=1
                     /locus_tag="ROP_01500"
                     /product="hypothetical protein"
                     /protein_id="BAH48397.1"
                     /transl_table=11
                     /translation="MRTRGGGRNGFCTDVVADVADRFVVSAGGIPRASDARGWAGGVH
                     PARGRRRRGGAGDVRGRCRRRAGGIVVPQAGPPVADLTGPVGLGHRRPRRSRPSRPPG
                     RAAPARGHRGAADPGVPAACDPAGSVPAAVGDAPDRGPGRRPVRGLHQDPPRPRRRRD
                     GDDPAATQHDRGSVPPRHVRPWQPTRAENESSRV"
     CDS             135032..135304
                     /codon_start=1
                     /locus_tag="ROP_01510"
                     /product="hypothetical protein"
                     /protein_id="BAH48398.1"
                     /transl_table=11
                     /translation="MAASLHSPHTHPRGTGSRTRALDTAEGVLIGIRRIPAADPFDEL
                     VGAARRHGVSLFALAEALVALAGGTESPDAAADDAARTEWGALFRP"
     CDS             135456..135671
                     /codon_start=1
                     /locus_tag="ROP_01520"
                     /product="hypothetical protein"
                     /protein_id="BAH48399.1"
                     /transl_table=11
                     /translation="MTPKPARLDHVDAAEVTEAADLAGRHVTSRIDRRDGLGTRLTRS
                     RSPTQRARLSSSSAGPPVWTGTGEIAG"
     CDS             complement(135730..136125)
                     /codon_start=1
                     /locus_tag="ROP_01530"
                     /product="hypothetical protein"
                     /protein_id="BAH48400.1"
                     /transl_table=11
                     /translation="MMDDTEFLSRVREYGEYDSLGQATRVTTVVLRKLGARLTPGKVR
                     ALAAQLPPLARNALGPIEDGRSAPDFGVEEFRHRIAQALDAHPATAEWDTSAVLATVA
                     QAVDDDCLRAVLGSLPEGFAPLFGRPETV"
     CDS             complement(136349..136537)
                     /codon_start=1
                     /locus_tag="ROP_01540"
                     /product="hypothetical protein"
                     /protein_id="BAH48401.1"
                     /transl_table=11
                     /translation="MTDETLVALKNYEYLILEHGCENVSLVWHTDSVVFGDDGWADID
                     MLTQPGFTPATECFAHRD"
     CDS             136963..138834
                     /codon_start=1
                     /gene="dnaK"
                     /locus_tag="ROP_01550"
                     /note="protein synonym:Hsp70"
                     /product="chaperone protein DnaK"
                     /protein_id="BAH48402.1"
                     /transl_table=11
                     /translation="MARAVGIDLGTTNSVVCVLEGGDPVVVANSEGSRTTPSVVAFAK
                     SGEVLVGQPAKNQAVTNVDRTVRSVKREIGTDWTVAIDDKNYTAQEISARVLMKLKRD
                     AESYLGEDITDAVITVPAYFNDAQRQATKEAGQIAGLTVLRIINEPTAAALAYGLDKG
                     GKEQTILVFDLGGGTFDVSLLEIGEGVVEVRATSGDNHLGGDDWDDRIVRWLAEKFKA
                     SSGFDLTKDKMALQRLREAAEKAKIELSSSHSTSINLPYITVDADKNPLFLDEQLSRS
                     EFEKITSDLLGRTRAPFDSVIKDAKISVGDIDHVVLVGGSTRMPAVTNLVRELTGGKE
                     PNKGVNPDEVVAVGAALQAGVLGGEVKDVLLLDVTPLSLGIETKGGVMTKLIERNTTI
                     PTKRSETFTTADDNQPSVQIQVYQGEREIASHNKLLGSFELAGIPPAPRGVPQIEVTF
                     DIDANGIVHVTAKDKGTGKENRIRIQEGSALSKEDIDRMIRDAEAHAAEDSRRREEAE
                     TRNQAESLVYQTEKFIKDNDNKVPADVTDKVRSAIAQVQDALAGTDIAAIKTAMEKLG
                     TESQALGQAIYAAQAQQDGASAGGDGGPGAGAGASGDGHGADDVVDAEVVDEPREGR"
     CDS             138841..139632
                     /codon_start=1
                     /gene="grpE"
                     /locus_tag="ROP_01560"
                     /note="protein synonym:nucleotide exchange factor"
                     /product="GrpE protein"
                     /protein_id="BAH48403.1"
                     /transl_table=11
                     /translation="MNTPYDEQQRSGTAGRGRGNGRQPPREPIAITDRRRIDPVTGRV
                     RQDTPGSHSPQDRGASTLSGKASPGEKAGTSSLDTGAARPEPRQVDSDRVAELTADLQ
                     RLQAEYANYRRRVERDRAAAAENAKASVVAEFLGVLDDLDWAREHGDTAREPRHSLSR
                     KIRTILARMGVAAFGERGDRFDPTLHEAASHDGHGTDLVVDTVLRRGYTFGVHTVLRT
                     ALVTVIDRDRYENTSNPGPPADTDARPESGGAGDPGDDPNPYRCG"
     CDS             139725..140915
                     /codon_start=1
                     /gene="dnaJ"
                     /locus_tag="ROP_01570"
                     /product="chaperone protein DnaJ"
                     /protein_id="BAH48404.1"
                     /transl_table=11
                     /translation="MTQQEWIERDFYADLGVPSTASAEQIKRAYRTLARRLHPDANPD
                     DAAAGERFKAVSEAHAVLSDPATRAEYDRTRQLYRSGSFRQAGTRAGAAARSGGGMGG
                     FDLSDLFGSGSAAFTSGDAGFGDVFGDLFRRSGTRTTTASSRPRRGSDVEAQTRLPLR
                     QAVTGVVLPLQVSGPTVCTTCHGSGARPGTRPRRCPSCGGAGTLTRNQGGFGFSEPCD
                     DCRGTGMIVDHPCADCQGTGVGHRTRTINVRIPPGVTDGQRIRLPAHGEPGLRGAPAG
                     DLYVTVTVDPDPVFGRDGDDLTVTVPVGFGELALGTTISVPTLDGRVSVKIPAGTPSG
                     RTFRLRGRGVHRGGGPAGDLRVTVQVAVPTRLDRSAVDALRAYDKAEKATGFDPRAAW
                     PGHR"
     CDS             complement(140844..141416)
                     /codon_start=1
                     /locus_tag="ROP_01580"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH48405.1"
                     /transl_table=11
                     /translation="MISTQPAQRGSRSPPRFRRRPCWWGRCSWWSGCSGSSPGVTTDY
                     DTLTFAGHHTEAALLGIFQVSVLHNIVHLLFGVAGIAAARTAGAAKGFLVGGGLIYLV
                     LWIYGLVIDQDGSAYFVPVNTADNWLHLVLGAGMVVLGLLLPRLRTTAPRLIPPPLPG
                     RGAVALRLSVAGPGGAGVESGGLLGLVVGA"
     CDS             complement(141662..142153)
                     /codon_start=1
                     /locus_tag="ROP_01590"
                     /product="hypothetical protein"
                     /protein_id="BAH48406.1"
                     /transl_table=11
                     /translation="MGSDLGGRFGPDAEVAGHLLALVSEHRYPALGRELSSLMAPPDP
                     AAGGGSCYGGVLAWLTGAIADVAVARLGPAAQDESFILEVRTAAGQLVDARKLPPRQA
                     RVARSVLALLAGDRAAARVHLGAAEREPDSQVRVTTLIEALTWLNALLDAPTPALPDP
                     PPQ"
     CDS             142211..142708
                     /codon_start=1
                     /locus_tag="ROP_01600"
                     /product="hypothetical protein"
                     /protein_id="BAH48407.1"
                     /transl_table=11
                     /translation="MRPRPAPRGRFDIAADGCMVPRMKDVSTMSSGVGAGDNPDSSAY
                     VFAVARALSAETIRRWDEVTFDAVVVLSKQSRYCSGRRILLAWNHHFGWSLGIEGQGP
                     DRVLIIGGLGLGRQPLPECIADRADEVITDLLHLECRSPERFPVPTVVHRRGAGPADH
                     RPPLR"
     CDS             complement(142845..143081)
                     /codon_start=1
                     /locus_tag="ROP_01610"
                     /product="hypothetical protein"
                     /protein_id="BAH48408.1"
                     /transl_table=11
                     /translation="MSVGVAVIPGSPTPREQVLRPGGRPSDVWSGLLDQQQDILGVLE
                     RLHPGCPGRHAWAQVVGDRPPQRLGVVEEGGWRP"
     CDS             complement(143425..143712)
                     /codon_start=1
                     /locus_tag="ROP_01620"
                     /product="hypothetical protein"
                     /protein_id="BAH48409.1"
                     /transl_table=11
                     /translation="MTTSPHITTDHAEIRRWIQAHRGGPARDGTGSLRIDFLGVATGL
                     EHLSWKQWFTAFEDQNLALCYPQPHVHGGTSAWCELAPRTRTATGAAGSVR"
     CDS             complement(143732..143980)
                     /codon_start=1
                     /locus_tag="ROP_01630"
                     /product="hypothetical protein"
                     /protein_id="BAH48410.1"
                     /transl_table=11
                     /translation="MTHRTACVRQLSGTQRGERRRTRDDILAPASVHSSAAAAGSSRQ
                     LNVNVGESVVRLRLHLTGVCCTAGSIGPVGIAWCADDP"
     CDS             complement(144294..144782)
                     /codon_start=1
                     /locus_tag="ROP_01640"
                     /product="putative MerR family transcriptional regulator"
                     /protein_id="BAH48411.1"
                     /transl_table=11
                     /translation="MSEESGRRDRESPSVRGVYGISVAAELSGFGVAALRLYEEYGLI
                     TPGRTGGGTRRYSDFDLARLRRIAELIDAGVNLVGIGRVLDLEHRTGELERDNRRLEA
                     DNAQLRADQDPDAASADDPAGETAPEPGTGRTGRRRSPTSQGRTCVGGGAAREQAGGD
                     HH"
     CDS             144915..145340
                     /codon_start=1
                     /gene="hsp18"
                     /locus_tag="ROP_01650"
                     /note="protein synonym:18-kDa antigen"
                     /product="putative heat shock protein Hsp18"
                     /protein_id="BAH48412.1"
                     /transl_table=11
                     /translation="MLMRTDPFRDLDRLTQQIFGTAARPAVMPMDAWREEDRFVVEFD
                     LPGVNADSLDLDVEKNTLTVHAERAALNENREMVAAERPRGVFSRQLFLGENLDVDKI
                     EANYDAGVLRLTIPIAEKAKPRKIEISSNGHSEQKAVNA"
     CDS             145410..145718
                     /codon_start=1
                     /locus_tag="ROP_01660"
                     /product="hypothetical protein"
                     /protein_id="BAH48413.1"
                     /transl_table=11
                     /translation="MTSTNPVAEVNATDTRERTERETMWPWHELDYALLVADSDRILA
                     DALTPQAVVLLHRVATAPAGRARPSPPTPVGWTALPPPLPEIRATQRSPPRPEKPGKV
                     "
     CDS             146105..146512
                     /codon_start=1
                     /locus_tag="ROP_01670"
                     /product="hypothetical protein"
                     /protein_id="BAH48414.1"
                     /transl_table=11
                     /translation="MATERDPYRVLGLSPSASQADIASAYRRLLRRHHPDTRTRHPAD
                     PAADEYLQQVMTAYALLRDPDHRAAHNQAEADRTEADRVDAEAIVPEPRGRRRGRAPW
                     AAAPPLIRVVVADAPPPHPPATGLWVGPVRRHR"
     CDS             complement(146930..147970)
                     /codon_start=1
                     /locus_tag="ROP_01680"
                     /product="hypothetical protein"
                     /protein_id="BAH48415.1"
                     /transl_table=11
                     /translation="MSTPTTGNVASGVSATRRGLGICVTPLETRRDVILHVARRAEDL
                     GYDGFFLAEGWSQDAAVLLTEIATKTERITIGTGVLSVWGRTAGTLAMLATSLDQVSH
                     GRFVLGLGASSPQLVEGLHDQSFTAPVAKLRAVTAQVRRLLDGERVSPTTTHDHRSLR
                     LGVAARTGLPIYLAGLGNKSIQLAGELADGWMPFLVPRSWLPHGIDLLQQAGARSGHT
                     TRPLVCPAVPTAVAADQAKAHEIASWWIAFYLTSMGSLYRRSLSERGYHHQVEAVLAS
                     NPTHDTTDVPAAAHALLDELTVWGTPDTAHDHLQRWYTAGAETPILTLTLPPHRTTAE
                     LDYMLETMRPHP"
     CDS             complement(147967..148605)
                     /codon_start=1
                     /locus_tag="ROP_01690"
                     /product="putative TetR family transcriptional regulator"
                     /protein_id="BAH48416.1"
                     /transl_table=11
                     /translation="MAQKRNTTPGAKTRETVLHAAADVASIDGLDGLTIGHLASLTGM
                     SKSGLFAHFGSKQDLQLATIEVARQRYVREVVTPALESGPGMQRLTALCESFLSYVER
                     GVFPGGCFFAAAMAEFDGKTPGPVRDAVTECQRQWMETLAQSAHEAQQSGELCIDTDP
                     DQLAFELEGTLLAANSYFHLFADTRYLDRARLAVRTRLSSGASTPERTATRA"
     CDS             148688..149890
                     /codon_start=1
                     /locus_tag="ROP_01700"
                     /product="putative oxidoreductase"
                     /protein_id="BAH48417.1"
                     /transl_table=11
                     /translation="MFDVIVVGARCAGASLAMLLARGGHRVAVVDRASFPSDTMSTHF
                     LWQRAAFRLRDWGLLDRLHARGCAPIEQITFDVGPVQMSGIGPGVEGQTAVYCPRRTV
                     LDAVLVEAAVEAGAELIDGVVVDDVVWADGRVSGVRGRCRGVGGSLSLRAPLVVGADG
                     LHSTVARRVAARVYNHHPPLTCVYYSYWSGLGNVRASFHARTGQLILVWPTNDGLTCI
                     YVGWPRREFARVRTDLDRSFQAALDLVPGLRDTVASGHREQRFVGTADLPNQYRTSVG
                     PGWALLGDAGHHKDPSTGMGIADAFLSADLLAKAIQSARAGRSVDDALGDYQRQRDQL
                     TANGFELALNTARLAPLSNGLTAFYRAAATQPEVVERIFGVLGGSVPIRDVYSAPRIA
                     SVLAQANA"
     CDS             149909..150151
                     /codon_start=1
                     /locus_tag="ROP_01710"
                     /product="hypothetical protein"
                     /protein_id="BAH48418.1"
                     /transl_table=11
                     /translation="MVDGRHARHGGGKRKSNAEEIVADGRSILAIIWHPLDGAGATFH
                     GLGTEHSSRNVKPGHEDTQSHRQLETLRHVTLIPAA"
     CDS             complement(150240..151577)
                     /codon_start=1
                     /locus_tag="ROP_01720"
                     /product="hypothetical protein"
                     /protein_id="BAH48419.1"
                     /transl_table=11
                     /translation="MTTRIGHRAVVLGASIAGLLAARVLSEAYAQVIVVDHDHLPGTA
                     APRRCVPQARHTHVLIERGQQVLEELFPGFTDDLAARGVPTLDNLRDVRWCLSGHRFP
                     QPESGMTVVSASRSYLEGCVRARVSELPGVTLVDCCDAAGLTMTPDRRRVTGVRVLRR
                     ADGSAEEVLDADLVVDATGRGSRAPTWLAELGFESPEEEKLQVGLGYTTQIYRAPAPG
                     LGNDLGVVIGPTPDAPRGGALQLLEGNRFLVTLMGMLGDYPPTDPDGFLDFARTLPIP
                     DLCDVIRDAEPLERARSFRFPASVRRRYERLSRFPAGFLVTGDALCSFNPIYAQGMTV
                     AALEAITLRRHLQRATEPHPRTFFRDVAKMIDVPWDMSVGADLAFPDVIGARSPKMRI
                     ANAYIPRLHAAAAHDPVLATTFIRVAALVDRPERLMSPGTVLRVLRQILPRPR"
     CDS             complement(151668..153749)
                     /codon_start=1
                     /locus_tag="ROP_01730"
                     /product="hypothetical protein"
                     /protein_id="BAH48420.1"
                     /transl_table=11
                     /translation="MEGTGPSSIPLGDLLNSRRRRTYVGREGERELVRARLESADPQW
                     SVLYLHGPGGIGKTALLDVLAEIAEDVGATVVRLDGRDLSPSPSAILAALSDAVEVPV
                     TGVITSTEERLCVLVDSYEVLGPIDEWMRTRLLPRLPATALTVIAARTPPSPQWRADA
                     AWSALLRVVSLRNLTPGECREFLRAVAVSTQLHDRICQVTHGHPLALSLLADVASRGG
                     EVAADPLTPDLIGVLMQRFIEVVPSPVHRRALEVCALARVTTESLLRDVLELDDAHEV
                     FAWLRQLSFVEAGPEGLFPHDLARDVVDVDLRWRDLDFYTEVFHRVWRHLRRRLTSCS
                     GREQQRVIFDLKFVFRNLPGVLSPVDWESWGHHYPEPACEEDRETIVELVRSHEGAES
                     AEIAAAWFRRQPEGFYIVRRPDGTARGFFGLLDLSRASADDIAADPGAAAAWDFARTQ
                     SPPREGEAITQTRFVIDATAYQDPSPTLNAIPIMTMQRYLCTPRLSWDFLTLAEPDRW
                     NEYFAVADLPRAGGADFEVGARRYGLFSHDFRRVPVDAWFEQVAVRALSDNPVAPKRP
                     APQLLVLSQPEFEQAVRQALHDWRRPDLLRRNPLMRTRVVCDRGGAEPDVAELDTVLR
                     DAVDALADDPRDDKMVRAVDRTYLRPAATQEAAAQILGLPFSTYRRHLTQGVAQVVSW
                     LWDREIYGRHE"
     CDS             complement(153931..154140)
                     /codon_start=1
                     /locus_tag="ROP_01740"
                     /product="hypothetical protein"
                     /protein_id="BAH48421.1"
                     /transl_table=11
                     /translation="MTSIQPAGSGGGGVSGGPRSGSLADVIDKVAVAGICHFRRSLRD
                     LDTVASADAGLSRSPSQHRLARRAS"
     CDS             154172..154399
                     /codon_start=1
                     /locus_tag="ROP_01750"
                     /product="hypothetical protein"
                     /protein_id="BAH48422.1"
                     /transl_table=11
                     /translation="MAGGFARAATACRRRRCLLFLRLLVLVLVTRIGLRFVLGRFLVV
                     LGLVGFDNLAIPDLSAPPSISSGWRTDWVMT"
     CDS             complement(155001..155600)
                     /codon_start=1
                     /locus_tag="ROP_01760"
                     /product="hypothetical protein"
                     /protein_id="BAH48423.1"
                     /transl_table=11
                     /translation="MKIMKARSKVEVAAAVGAGYLLGRTHQLRMAVKIAGAGGRCPMG
                     PEDLLAQGSEFLAASPEIADLGDSVRDELLDTAAATAEASSEHVGSFRDRVRSGGAHF
                     VAGGGNLVAGVKRIGRRGHAHPRDPEDSTVDGALDHGKGEDGPSSPAVQEERQPKPRR
                     RRKPRITTPSDSAGASRDESAPEARPDTAARRKGTAKAH"
     CDS             155832..156035
                     /codon_start=1
                     /locus_tag="ROP_01770"
                     /product="hypothetical protein"
                     /protein_id="BAH48424.1"
                     /transl_table=11
                     /translation="MRTTDHERRRHTGGLALVEGREAGIAIPLGLALLVILVWAAVLG
                     SSPLVLVILVAVAGIAALTAAAL"
     CDS             complement(156378..156554)
                     /codon_start=1
                     /locus_tag="ROP_01780"
                     /product="hypothetical protein"
                     /protein_id="BAH48425.1"
                     /transl_table=11
                     /translation="MCSVGVALDQDVTARGGPPRRMPVVVSSRNHSRWDVARPGVMGA
                     DQVAALRVAVLAYL"
     CDS             156877..157236
                     /codon_start=1
                     /locus_tag="ROP_01790"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH48426.1"
                     /transl_table=11
                     /translation="MPAAAPVAGAFRATFFFTAVVFAAVVSASAADSTADSTAAVFAP
                     EVFAGAFLATFFFTAVISAAVVFGAAVFAVAFFAATFFAADAFFATVFFATDVSAGAF
                     SATTFFTGVFFAGIASA"
     CDS             157342..157596
                     /codon_start=1
                     /locus_tag="ROP_01800"
                     /product="hypothetical protein"
                     /protein_id="BAH48427.1"
                     /transl_table=11
                     /translation="MVVVFAGALPTVAALFAGAFVATVFSEAVVFGAVAFVAAAFLTA
                     TFFAGGAFLATAFSAAVFFTAVFFAADDFAATFLAGADFV"
     CDS             157687..157911
                     /codon_start=1
                     /locus_tag="ROP_01810"
                     /product="hypothetical protein"
                     /protein_id="BAH48428.1"
                     /transl_table=11
                     /translation="MVVVFAGALPTVAALFAGAFVATVFSEAVVFGAVAFFAAAFLTA
                     TFFAAGAFLATAFSTAVFFTAVFFAGADFV"
     CDS             complement(158423..158701)
                     /codon_start=1
                     /locus_tag="ROP_01820"
                     /product="hypothetical protein"
                     /protein_id="BAH48429.1"
                     /transl_table=11
                     /translation="MSSQSVIDLGAAGAASVAQTEPIGPNGPTGGPCPIVTTYSQGNE
                     TVTYGKPGDRNGALVCGADGEWTIGRSKGNPGQIQTQPGLSVGWEMTP"
     CDS             complement(162527..163714)
                     /codon_start=1
                     /locus_tag="ROP_01830"
                     /product="hypothetical protein"
                     /protein_id="BAH48430.1"
                     /transl_table=11
                     /translation="MTVEAEEFALSGSCCSSGSEPGLSRRGLLGALGIGAVAAGVAAC
                     SGPSAGAGAQTGPVSNLDADGPFGPLELVLLGTKAGPPIVPSRAGISTALVIDGATYV
                     IDCGRSSTTQFARAGLRFDGLRSIFITHLHADHIADYYNYFLLAGSIPNQETRDALAN
                     PVSVFGPGPAGGLPEKFGGGQAPTVSAEDPTPGLAAFTEKCHDAFAYSSNVFLRDTGI
                     RDIRTLVDVHEIAVPDVGASYTMTSPRMDPFPVMEDDHVAVTAVLVPHGPVFPSFAFR
                     FDTAHGSVTFSGDTSYSDNLIALARGSDVLVHEAINVQGPNVSLPPAAMDHMLQSHVE
                     VQKVGAIARAAGVRTLVLSHLSDFDEEPLDPVRWRKWIEPEFDGEIVIGDDLQRIPIP
                     SSL"
     CDS             163999..164205
                     /codon_start=1
                     /locus_tag="ROP_01840"
                     /note="fragment"
                     /product="putative transposase"
                     /protein_id="BAH48431.1"
                     /transl_table=11
                     /translation="MKRSDRDIMEILEAYDTTGTAHSAASLAGVDPKTVRHYVTVRRR
                     HAGDRPVAATPHHRRSSTPDRAMG"
     CDS             164132..164506
                     /codon_start=1
                     /locus_tag="ROP_01850"
                     /note="fragment"
                     /product="putative transposase"
                     /protein_id="BAH48432.1"
                     /transl_table=11
                     /translation="MPVTGPSRRPRIIDDHLPQIEQWVERSKGRVRADIVHERLLALC
                     FDGTEHATRRAVAEAKAAWRAGHHRTYRPGGYLPRVGESPNPGCGCNSTGVKARKYPE
                     RAEPCARRCCSAPGWPGHATGW"
     CDS             164317..164964
                     /codon_start=1
                     /locus_tag="ROP_01860"
                     /note="fragment"
                     /product="putative transposase"
                     /protein_id="BAH48433.1"
                     /transl_table=11
                     /translation="MAGRAPPHLPTWGVPPTSGRITEPGLWMQFDWGEGPKVPGAGGA
                     LRSTLLFCAWLAWSRYRVVIPVGDQTLPTLIACLGAPLRCGADLRVDRQPAHGQHRPR
                     RRDRGAASADRRNRPPLRRSRPGGPPRRHATSRDGADRTLGMATPRVSAGAPPGHGRR
                     RLVRFCIYDRVRTPGMRVDTVLVTANDQQPSRRCRFISTLRRNGSNPVRESLPRR"
     CDS             164552..164845
                     /codon_start=1
                     /locus_tag="ROP_01870"
                     /note="fragment"
                     /product="putative transposase"
                     /protein_id="BAH48434.1"
                     /transl_table=11
                     /translation="MRRFGVVPTYALTDNPRTASIDHVAGIAVRRPQIVETGRHCGVR
                     DLVDPPDGTQPVGMVRTARWGWRRRGCRLAHHLVTVGGDSSDSASMTACAHRA"
     CDS             165068..166054
                     /codon_start=1
                     /locus_tag="ROP_01880"
                     /product="hypothetical protein"
                     /protein_id="BAH48435.1"
                     /transl_table=11
                     /translation="MDSTIPDENVVRIAVDLACRAPSVHNSQPWQWTYTDGQLDLYTA
                     RGRVLASTDPTGRQLVVSCGAALHHLQTALTALKWAADVRRVPEGPHSGHLATIRFRH
                     EARPQSHDFDLLAAIRHRHSDRRPFGPVSVKTPLPAALNDVVHRRDVNLTVLRQEARP
                     TLARATETTAAARKYDTAYQAELHWWAGHSIAQGGIPPDALATADDRDRVDIGRRFPA
                     GLDAGATTEPDRSTVLVLSTAADGRGEWLRAGEALSAVLLEATVGGLSTCPLTHMTEL
                     RQGRDIIRDLLPDRGFPQALIRVGTTEKKSAPRQTPRRPVESVLSVGRRIPH"
     CDS             complement(166082..166426)
                     /codon_start=1
                     /locus_tag="ROP_01890"
                     /product="hypothetical protein"
                     /protein_id="BAH48436.1"
                     /transl_table=11
                     /translation="MNTPIRDFDVEGSTEWTIPALLNETTWLVEVVVDEHDSDEGGSR
                     IRAQARLRTRDTRTFVGSGLARRNPDDAEISEIGEVLATARALSDLAHQLIEATAADV
                     ETATHSRVHLAG"
     CDS             166462..167073
                     /codon_start=1
                     /locus_tag="ROP_01900"
                     /product="hypothetical protein"
                     /protein_id="BAH48437.1"
                     /transl_table=11
                     /translation="MPAGKLRLHGVAVLMPDEEPEPTNVVRSPSLHVRSNELMDQRDL
                     LNRFLAEGRRYEIDGFFSDMSDLLGGRLRDAALKRGRLYRLMHGGRGLLLDQTGGLSV
                     AGRTSGRPRGGICSVCYPGGSAPPTSEDGRVTFGPGIALPVIAPLYEGRRKTQAAGEG
                     TRTPCSNTPPHRRARIVTGGRTNPANSCTCIPRGSRSRWCRGR"
     CDS             167028..167237
                     /codon_start=1
                     /locus_tag="ROP_01910"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH48438.1"
                     /transl_table=11
                     /translation="MHPAGFALAVVSGAVTAGLVVLLGAWLATPLVGVGAAATLVATV
                     GLAAAMLMPHRPRRRGSGPFRPAAR"
     CDS             167313..167960
                     /codon_start=1
                     /gene="devR"
                     /locus_tag="ROP_01920"
                     /product="two-component response regulator DevR"
                     /protein_id="BAH48439.1"
                     /transl_table=11
                     /translation="MIRVFLVDDHEVVRRGIADLLASDPALTVIGEAASYAQAMARVP
                     ALKPDVAVLDVRLPDGNGIELCRELHSLMPDLHCLILTSFTDEQAMLDAILAGASGYV
                     VKDIRGMELAQAVHDVGAGKSLLDSRAAGVLMDKVRADADGKDGIFAHLTNQERTLLA
                     LLGEGLTNRQIAARMFLAEKTVKNYVSRLLTKLGVERRTQAAVLATKMPPKPTCT"
     CDS             168009..169739
                     /codon_start=1
                     /EC_number="2.7.13.-"
                     /gene="devS"
                     /locus_tag="ROP_01930"
                     /product="two-component histidine kinase DevS"
                     /protein_id="BAH48440.1"
                     /transl_table=11
                     /translation="MRRVTRLPDERDRGPLLGSLSELRLRELLTEVQDRIAQIVDVRD
                     HVDGLLEAMLAVTSGLDLDNTLRTIVHAAIDLVDARYGALGVLAPTEGLSEFVYEGID
                     QETRERIGDLPRGRGVLGFLITDPKPVRLVDLSRHPVSVGFPPDHPPMKTFLGVPIQV
                     RDEVFGNLYLTEKANGAQFTEDDEVLLRALAAAAGIAIENARLYEESRTRQAWLEATR
                     EIATELLAGSETADVLQVIADDALALTAADSAFLAVPDDPDIPSDEVTELVVTASAGT
                     VSDRIIGRAIPVERSTSGEAFRERTPLRVSALAFDPGFETGARFGPALALPLRAAQSV
                     SGVLVTLRHVDASPFTDDQLALMSGFADQAAVALQLANSQRRMHELDVLSDRDRIARD
                     LHDHVIQRLFAVGLSLQSTLQRAKAPVVKDRLEQSIDDLHDIVRDIRTAIFDLHGGSG
                     GITQFRRRLHEIVAETTADSGLRTTVHMSGPLSVIDATLAEHAEAVLREALSNAVRHA
                     GADTVTVSISVYDDLAIEVADDGKGFEGSVLTSGLDNLAARAREVNGHCAVDSTLGGG
                     TTLRWSAPLP"
     CDS             complement(169993..170739)
                     /codon_start=1
                     /locus_tag="ROP_01940"
                     /product="putative response regulator"
                     /protein_id="BAH48441.1"
                     /transl_table=11
                     /translation="MNSVSSPAVARPRVLLIDADVESSLVERLRDGGFFVTRTYAEPV
                     RSRIEPPDVVIVDARSPHLDADTTVRGLKAMRFALAIVVIGRFCSGNRRSDLLEAGAD
                     DVLEIPVGADELVARLRAILRRVKPDVPAPAPVGSHDVCLCEERHDTDYDGLRTTLTR
                     TEFILFTVLAQNVDRVVTRRDLMLMVWGVTVESKTNVLNAYICSLRRKLVAVGSPYVV
                     HTVRGVGFALGENVRPGSIDPAREVSVAVS"
     CDS             170896..171744
                     /codon_start=1
                     /locus_tag="ROP_01950"
                     /product="putative hydrolase"
                     /protein_id="BAH48442.1"
                     /transl_table=11
                     /translation="MPELRHIALHGDDIAYRLSGEGETLLLVHGMAGSSAAWRAILPE
                     LAQRYRVLAPDLPGHGDSAKPRGDYSLGAFAAWLRDLLHELAIERVTVVGQSLGGGVA
                     MQFSYQHPELCERLVLIGSGGLGPDVNWTLRLLAAPGSEFLLPLMAPPAIRDAGNKVR
                     SWLAAIGVQSVRGDEMWHAYSSLSDPETRQAFLRTLRAVVDHRGQAVSALSRLYLNAG
                     LPTQLIWGDSDGIIPVSHGYAAHEAMPGSRLAVLDGIGHYPHLEDPAAVVDIIDAFVT
                     TTPARR"
     CDS             complement(171751..172407)
                     /codon_start=1
                     /locus_tag="ROP_01960"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH48443.1"
                     /transl_table=11
                     /translation="MADMQREKQFRRLRTPRSAAVAGIVFAAFFSASLVLLHTALPAD
                     PFDETPWVGSGETRIKTALVLAPFAGIAFLWFIGVIRDRLGDLEDRFFATVFLGSGLL
                     FLAMGFISMGVAGGVLAIARHSGSSADEIVYFGREIMLQINHVYALRMAAVFMLSLGT
                     IWLRTGLMPRFLVVTTYLLALALLLVVSFSLWTTLAFPAWVLLVSIYILVTGRRIRAA
                     "
     CDS             172740..174248
                     /codon_start=1
                     /locus_tag="ROP_01970"
                     /product="putative drug resistance efflux protein"
                     /protein_id="BAH48444.1"
                     /transl_table=11
                     /translation="MMVTHAPDGGSARTRQQDATDERWTPRLIFSLASIVLLLEMLAV
                     SYMMISIALPQIVTHYRTTQGAWLLTSFLLVGAITCPLIGKLADTHGKRKLLLTAVGL
                     SALGSLISAIAPTYAVLIAGRSLTGLLVPCLFLSYSLIRDVFPARTVALAVSIATSGM
                     GLIAIPAPFFTGWLIDNFGFRSIFWFFLAGLVVLAVLIRATTGESPVRLRSRIDLIGA
                     ALLGAGLAGILVGVSFGPSWGWTSGSTLGFVAGGVALLVAWIGSALLLSDPLIDIRFF
                     GKRPVFLTALGAGFCYGTSSVFTIMLPMMCMTPAILGLGYGFGISAEGFAIFQAPLGG
                     AVVLGGLIVGTLVPRNVRPRILMVVGMLVMAAACLLTATIHDDKALLIGFAALLGVGM
                     GMGYASIPNLLIAAVPPQLQATTASMVAVFQSILPAILPVIAFTVLNSHIATVMQGAV
                     FYTDTGITIAFVIGAISALLGAMVAVALPRRISQLSAPGAESTTATDVVLAH"
     CDS             174413..174883
                     /codon_start=1
                     /locus_tag="ROP_01980"
                     /product="hypothetical protein"
                     /protein_id="BAH48445.1"
                     /transl_table=11
                     /translation="MRSGEAAACLNVSVVGVRKAASAGRLPSRRTGSGQRVFDRADLD
                     VYLGRPTWKNVRADRAEASYCRVSGSTGQKSSLADQEKMLRESATGTVYRVYKDRGSG
                     LRETRTGLNRMLDDATKGRFTVVRVVWRDRLARFSGGVDRTLPVGGRRQGRGPA"
     CDS             174920..175681
                     /codon_start=1
                     /locus_tag="ROP_01990"
                     /product="hypothetical protein"
                     /protein_id="BAH48446.1"
                     /transl_table=11
                     /translation="MTSWHCSPRFPAASAQLRSKRNQRRLRWRCGSTVGEDYLMADAG
                     LPAVRQFSFTARPYLAVDDVTGEPIGLDGVDTRVGWLLDLISGAEAQMLSRLWQPATF
                     DVLAAGVDRQDRRLPAQGHVAASRLGWTPHYPDGVYIPSRVTRVVTAQVMATLRTLAF
                     RDTAITSLSERFDPATGQIAPPTCAADWVPLGFARGVRRQLIARSRREGNAVPSGRVR
                     ITDMQAPPKTSVMARLSAADRQLAQLAVTDVVMTL"
     CDS             175678..176772
                     /codon_start=1
                     /locus_tag="ROP_02000"
                     /product="hypothetical protein"
                     /protein_id="BAH48447.1"
                     /transl_table=11
                     /translation="MKLPTTPVPTGRAQWRRVRLTATLPAHLHDRPISDWHLPTLVLD
                     HRGLLLRCAATETVPAAELTSGTTAVGVDWSPATLGAAAITTETPDGLSSDFQGWTYD
                     DDRGLGTKLARLQAEGHMLHRKAARLTQLATNAEPEVRTQLEAKIALLDAHRTAVGAK
                     RGKINRELGFHFARQVTDYATAASATVIAVEDLTTLESRGHGRVNNNRAAQSARRKAV
                     IALAHTAAGVGITVVSVPARGSSARCPGCDAPLARPGGYHTAWCQGCRVGGNRDHIAG
                     VNRAKRALLGKTKVTRRRGQMPAIRVAEHAPVRKSRDKTGPTPRPPRHRRVRRSLPTV
                     TPRAGVTPKQICSCTSSVGVGHGPTRTTSE"
     CDS             176891..177316
                     /codon_start=1
                     /locus_tag="ROP_02010"
                     /product="hypothetical protein"
                     /protein_id="BAH48448.1"
                     /transl_table=11
                     /translation="MRLTTLGDLPGRIATGSFILHSGLQKWSADEQTAQGIHGMAAGA
                     FPFLNAIPPQRFVKLLSVAEISTGAALLAPFVPTAVAGAALTGFSGGLVAMYARTPGL
                     RNPGSIWPNENGIAVAKDTWMLGMGLGYVLDGWTRLRSR"
     CDS             complement(177345..177881)
                     /codon_start=1
                     /locus_tag="ROP_02020"
                     /product="hypothetical protein"
                     /protein_id="BAH48449.1"
                     /transl_table=11
                     /translation="MSVLGQMDSFRRVFPTARRNRADLFRWLRRRPQLLAAVGFHEVA
                     LAASARVDPRLKALAEIKAAALTNCEYCLDIGSAFSRALGVSDAQLRALPAFRESSAF
                     DDTEKLVLEFADAMTRTPAHISDDLRGSLLAAFSESQVTELAAAIAWENHRGRLNQAL
                     GVRPSGFSDSDFCAVPEQ"
     CDS             178008..178193
                     /codon_start=1
                     /locus_tag="ROP_02030"
                     /product="hypothetical protein"
                     /protein_id="BAH48450.1"
                     /transl_table=11
                     /translation="MKAVVCTETRLEFGDVPDPVPARGQVLIDVSRCGICGSDLHART
                     HADEMAELAAQISAAAL"
     CDS             178207..179076
                     /codon_start=1
                     /locus_tag="ROP_02040"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH48451.1"
                     /transl_table=11
                     /translation="MNPNHPRLRWVAPALLLALIYAASLTVYGLSSRTEDEGPFAGND
                     DEVVVLVTAKSLQPTTDRVQAEVTIAVGEEYLHANGDTLNRDITLLLFPSTSHEEIVF
                     RAGAAPTTFDTEFIATGNAAYWPFDRFEVNPMVVEAYEGAGADRALLPTGLLVDGRVD
                     GWKARADAVAVDTDLSRNGTGAALLFARTGGNLIYAGILLLMMTILAGLAAFVALQTF
                     RRKRAVNTDMLGWMAAMLFAVVPLRGILPGSPPIGSWVDIALTVWVVSTLVASLALFV
                     FCWWRDSEQPAQP"
     CDS             179127..179579
                     /codon_start=1
                     /locus_tag="ROP_02050"
                     /product="hypothetical protein"
                     /protein_id="BAH48452.1"
                     /transl_table=11
                     /translation="MVRRTGRVLPPWYLGPVNKVIVGLHRLGVPMPMPALTVPGRETG
                     VLRSTPVSPYEVDGRTYVVAGYAESDWAKNARAAGRGELTRGRRRERVRLVPLPVSER
                     ARILREFPIRVPHGVTMFLKAGTVANSSPEAFAAAADRCEVFRVEPLD"
     CDS             complement(179586..180002)
                     /codon_start=1
                     /locus_tag="ROP_02060"
                     /product="putative copper-binding protein"
                     /protein_id="BAH48453.1"
                     /transl_table=11
                     /translation="MKRVPTLVLPILLAILALAACGNDSDDSSASSESEHGGNHMMTD
                     MPSMSMPMSMPAGAREIVISDFKYTLPGTFAPGEQVTVRNDDTAEHTVTADTGDLFDV
                     EVEPGAVATFTVPGQPGTFAFHCTYHPNMVGTLEVR"
     CDS             complement(180112..180822)
                     /codon_start=1
                     /locus_tag="ROP_02070"
                     /product="enoyl-CoA hydratase/isomerase family protein"
                     /protein_id="BAH48454.1"
                     /transl_table=11
                     /translation="MPYLERSGDVFVLYFGEEGERDSENAFHPDWIVSVDGLLDRVEQ
                     HDGPAALVTTAVGKFYSTGLDTAWVLANTDKLNSYIDRVQALFARILTFPLPTVAALT
                     GHTFGGGAILAAAHDHRVMREDRGYFCLPGITIGASYAPGSIALLAARLPARAVHTAL
                     VTGRRYGGVAAKELGFVDEVAPEQQVLADAVAHAQGLVATRGRTLGEIKSSLYADAVV
                     SLRTPVANLETQEALNGG"
     CDS             180907..181380
                     /codon_start=1
                     /locus_tag="ROP_02080"
                     /product="hypothetical protein"
                     /protein_id="BAH48455.1"
                     /transl_table=11
                     /translation="MSIVKQLRRWTMKSGTGIADTRTVRDYIHTVARSVHADSIDWWE
                     CDGFDAVLVLPFRLHYLPGRNAVLAWNRTFGWSLGVEGLGRRSVIVIDGLGLGRMPSP
                     AGCAERAAELIDDYCRSTPALPGPHSAVAPAAADRCPRIGNAAGGGRRDRVVRRP"
     CDS             181377..182543
                     /codon_start=1
                     /locus_tag="ROP_02090"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH48456.1"
                     /transl_table=11
                     /translation="MTGGAEGHDDNVAQPHSSAQEQPIVAAEQGAARISTAAHPLGRP
                     GPRFDRRSPFFIGMAGAAGVAVTYALIEVVLAARGVLVLIAVAAFLAIGLEPAVSWLV
                     RHGFPRWAAVATVFVVAFAMLAGFLAAAIPPMVTQGAALVHNAPDYLGHLEQRYPVLQ
                     ELSARFHLQDELRRALDAGNAPMVLGGIVGAGKFVFSAISGTVIVVVLTAYFLADFGH
                     IRASLYRLAPNSRRPRTILIGDEIFAKVGGYVLGNLLISLITAVLTFVWLVAFDVPYP
                     LLLAVLVAVLDLIPVVGSTLAGVVVALVALTVSLPVSLATVVFFIALRLFEDYLLVPR
                     IIGRTVKVPPMVTVVAVLIGGALLGIVGALLAIPVAAAVLLLARETVFPQLDRG"
     CDS             182664..184049
                     /codon_start=1
                     /EC_number="2.3.1.20"
                     /locus_tag="ROP_02100"
                     /note="bifunctional protein"
                     /product="putative wax ester synthase/diacylglycerol
                     acyltransferase"
                     /protein_id="BAH48457.1"
                     /transl_table=11
                     /translation="MSVMSPTEAMFVLFETPSHPMHMGALELFEPPRESGPDHARLMF
                     EALISQEGASDTFRRRAVRPLRGASYPWWSVDDRVDLGYHVRHTAVPGRGRMEDLLSL
                     VSQMHGMPLDPQHPMWEIHVIEGLADGRTAVFSKIHLSLMDGPAGLRLLHHALSTDPD
                     ARDCPAPWTPGVSGTSRRESALPVAAVRAGVRAATSIVGVLPALAKVAYDGVRDQHLT
                     LPLQSPPTMLNVPVGRARKLAARSWPIRRLVSVAAAARTTINAVVLAMCSGALRHYLV
                     EQYALPEAPLTAMLPVPLDLGGTMIGPRGRDHGVGAMVVGLATDEADPAARLARISES
                     VEHTNRVFGALSHTQFQVMSALAISPILLEPVRRFVDDTPPPFNVMISYMPGPSRPRY
                     WNGARLDAVYPAPTVLGGQALSITLTSRSGQLDVGVVGDRQAVPHLQRIITHLETSLT
                     DLENAVAASGT"
     CDS             complement(184057..185127)
                     /codon_start=1
                     /locus_tag="ROP_02110"
                     /product="hypothetical protein"
                     /protein_id="BAH48458.1"
                     /transl_table=11
                     /translation="MTTLHSRSASGTAPQAGTSMPCPAPRGPVSGLLFPILRGDTAEA
                     EPFVTAALALASAERDDPRAFLFDEDAQICLTALYELHLQGIAGVDDRWEWDSDLIFA
                     RSALEVPFDAAIRALADPPTAVGDVVAALWEMTAPSTAPGLSGYMAHDADLSQFRELL
                     IHRSLNQLREADVHTLGIPRLAGAPKAALVEVQSDEYGGGRPERMHSALFATTMRELG
                     LSDGYAHYVDAVPAVTLASLNALSLFGLHRSRLGALVGHLCAVETTSALPSKKYAAGL
                     RRLGFGKAATLFFDEHVEADSVHEQIVCRDLAGGLVAARPAAADDVLLGAAACLAFDD
                     LVGDHVTRCWERNRTSLRQPAG"
     CDS             185128..185349
                     /codon_start=1
                     /locus_tag="ROP_02120"
                     /product="hypothetical protein"
                     /protein_id="BAH48459.1"
                     /transl_table=11
                     /translation="MNSIPLSGAGESDVTITVCPDGPLLVRGAARILDTEGNPIGGDR
                     ATVALCRCGRTSIAPFCDSSHKKKRRRPQ"
     CDS             185567..186022
                     /codon_start=1
                     /locus_tag="ROP_02130"
                     /product="hypothetical protein"
                     /protein_id="BAH48460.1"
                     /transl_table=11
                     /translation="MKTVLGARPTRRAPAEKPALFSWAVEPEHGRLSVDSAPAADGIL
                     VVRISGDIDVTTLPSFGSHLEEAIDERLPFVLDLTDVQFFCASALPVLEIMSARAHRL
                     AVPWAVTGNNALRRPLTAMNMAAAIPFCTDLEDAFRLVAGGMRQGGRSA"
     CDS             186019..187461
                     /codon_start=1
                     /EC_number="2.4.1.15"
                     /gene="otsA"
                     /locus_tag="ROP_02140"
                     /note="protein synonym:trehalose-6-phosphate synthase"
                     /product="putative alpha,alpha-trehalose-phosphate
                     synthase"
                     /protein_id="BAH48461.1"
                     /transl_table=11
                     /translation="MNDSAPHGTSDFVVVANRLPVDMETLDDGTTRWKRSPGGLVTAL
                     EPILLGRERGSWVGWPGVPDTKVEPIVSGGVDLFPVELSSDEVARYYEGFSNATLWPL
                     YHDVLVAPVFDRDWWHTYLEVNRHFAEETARTAAEGATVWVQDYQLQLVPRLLREMRP
                     DLTIGFFLHIPFPPVELFMQLPWRKEIVEGLLGADLIGFHLPGGAHNFLFLARRLLGL
                     DATTAGVGVRGALGTVTLDDRVVHVGAFPISVDARKLVEQATEPAVVERAAEIRRELG
                     NPRKILLGVDRLDYTKGIDLRLSALGELLDEGRLDPSDTVMVQLATPSRERVEHYMKM
                     RSSIEEQVSHINGDHGQIGRPVVHYLYQPVDRSELIALFLAADVMLVTPMRDGMNLVA
                     KEYVACRADLGGALVLSEFAGAAAELRGAYLVNPHDLDGVKNTIVAALGQEREQGRRR
                     MSRLHRQVLDHDVHRWAQSFLGALDPNAAD"
     CDS             complement(187482..188252)
                     /codon_start=1
                     /locus_tag="ROP_02150"
                     /product="hypothetical protein"
                     /protein_id="BAH48462.1"
                     /transl_table=11
                     /translation="MSETAGERPESMSPDLDGGTIAAQLGSLATALDEFNWNSGSQVE
                     MGLLLQRVCEQVVDAIADADMAGVSLLRDGLVETVAYADETVRQIDIQSFQAIDGDDY
                     FGVAGSRKVVKATRGEAAARWPSLADNLDQAGMRSFLSAPLAVDEALAGTLDIYGRGD
                     HGFSELDAVVLLVYTTAIEGLLRSARSVELARNEVTGLTRAMKTRAVIEQAKGIVMAL
                     RGVSADRAFEILVAQSQQEHVKLAEVARRIVESVTNPE"
     CDS             complement(188430..189227)
                     /codon_start=1
                     /locus_tag="ROP_02160"
                     /product="RNA polymerase sigma factor"
                     /protein_id="BAH48463.1"
                     /transl_table=11
                     /translation="MSPVSERSERHRPGRDDYKDVAPAVARLRILEESSGEASALRDE
                     IITRCLPLADHIARRFGGRGEAHEDLLQVARLGLVKAVDRFDPDRGFDFVSYAVPTIM
                     GEVRRYFRDTGWSMRVPRRMQELHALIAKAVDELSQELGRSPSASEIAAELELDVREV
                     SEGLLAKNAYQTLSMDAAMGDDPDDLPLAETLGEEDPELANVESHASVRPALEKLPPL
                     ERRVLMLRFFGSMTQTEIAQRVGVSQMQVSRILARTLSGLREQLGGG"
     CDS             complement(189227..189658)
                     /codon_start=1
                     /locus_tag="ROP_02170"
                     /product="putative anti-sigma factor"
                     /protein_id="BAH48464.1"
                     /transl_table=11
                     /translation="MAEVGEVRRMKTRSGVPVELRVAAEFEQLPVVRAVAETLAVLGD
                     FTLDDVADIKLAVDEVCSELIAATPGSAELTCSFAVTETGLHVTISAPLSRRGVPNRE
                     SFGWHVLETLMNAVSVSEGPVGNGSVERTVAVELVKYRGTN"
     CDS             complement(189795..190040)
                     /codon_start=1
                     /locus_tag="ROP_02180"
                     /product="cold shock protein"
                     /protein_id="BAH48465.1"
                     /transl_table=11
                     /translation="MSAGDTLPARPSTALRTGTVRWFNADQGFGFLAPADGSDDVFVH
                     VSEIAGDGHRILVEGQRVSFTVCRTDTGNQARDVRIA"
     CDS             190514..191053
                     /codon_start=1
                     /gene="dps"
                     /locus_tag="ROP_02190"
                     /product="DNA-binding protein Dps"
                     /protein_id="BAH48466.1"
                     /transl_table=11
                     /translation="MSKFTVPGLSDDQGARVADILQKRLSAYNDLHLTLKHIHWNVVG
                     PNFIGVHEMIDPQVELVRGYADAVAERIAALGKSPDGTPAAITRDRTWDDYSVNRDTA
                     QAHLGALDLVYSGVVEDNRKAIAETGDLDPITEDLLIGQTGELEKFQWFVRAHLENSG
                     GGLSTNGANTEKQAASQAR"
     CDS             191096..191332
                     /codon_start=1
                     /locus_tag="ROP_02200"
                     /product="hypothetical protein"
                     /protein_id="BAH48467.1"
                     /transl_table=11
                     /translation="MAENNSGPAEAVKGVVEDVKGKAKEAAGAVSGQDDLTREGKAQQ
                     DKAAAQREAAAKEAEAEKARGKAEAQEARQRAEQ"
     CDS             191379..191642
                     /codon_start=1
                     /locus_tag="ROP_02210"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH48468.1"
                     /transl_table=11
                     /translation="MLGLGILGWIIIGGLAGWIGSKIMKTDAQMGIVLNIVVGIVGGL
                     LGGFILSLFGTDVEGGGLWFSFFTCLLGAVILLFLVKLVTGRR"
     CDS             191969..192118
                     /codon_start=1
                     /locus_tag="ROP_02220"
                     /product="hypothetical protein"
                     /protein_id="BAH48469.1"
                     /transl_table=11
                     /translation="MIVSESTRDEKDEPKGGRPGPADHGKDGGMATRENAPELTEDSA
                     DAEND"
     CDS             192157..192480
                     /codon_start=1
                     /locus_tag="ROP_02230"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH48470.1"
                     /transl_table=11
                     /translation="MTYQPDNGPSRELNSEFRPQDDAHTMRNHVGEAITDGRNWPGYI
                     LIATGIAVLGLTLVAAGYGFEGWALIGGIACVLCLVLGTVLVLLERRRVKALEGETLT
                     DQEGH"
     CDS             192477..193058
                     /codon_start=1
                     /locus_tag="ROP_02240"
                     /product="hypothetical protein"
                     /protein_id="BAH48471.1"
                     /transl_table=11
                     /translation="MTDPKADLHDYLQAARDALLWKLDGLSEYDIRRPMTATGTNLLG
                     LIKHLTGVEIGYFGEPFGRGVDFPPWVTDDAEDNVDMWATADESRDYVVGQYRQAWEH
                     TDATVRALPIDAPGRIRHWPEDRRDVTLHRILVHVIAETHRHAGHADIVRELVDGTAG
                     LRADNDNLPTAERTWWESYRARVERAAREAGQG"
     CDS             complement(193065..194798)
                     /codon_start=1
                     /locus_tag="ROP_02250"
                     /product="hypothetical protein"
                     /protein_id="BAH48472.1"
                     /transl_table=11
                     /translation="MKRRVSARKVAHRRRIAGSLVAPGALGLAALLATPWSNPGSPAT
                     TATALTAAASDACYDMVSIAVAGRGDSPRPGTHQMLVAPDGTPLPASYSSNYTSPWID
                     EVVNAPQQSVGGGSYAAVYIEYPANMNSYEDAVNAGVDNTETVMRSIHASCPDTKFSI
                     VGYSEGADVARRVAMEVGNQDGQDGSYDILDPASVVGVVILADAGRNLGEGAFPGAEN
                     EFRNPDGFDLAYQSGQTSTSGRGALPGTSGSFGALDGKVASFCSEGDLTCSAPENIAL
                     LQLAINVGRQLNVDALQKEGLTPATGQDLAVVLGQIALAAFADIQSQDNWMQSDETFL
                     DVLVKVSDPAYKPADPVAAQSDTPTGPISSNQAVDLVYLPTKVRNEIIGFIADNQNTI
                     QVAMSDPYQQTLGEGTGHHFDYWRDANAGNGRPLTSAQYAAAWLTHLAQEAEKGEARS
                     AASQQATAKLAAASTPDTEAAQVAPTTTAGAKKPALASDAVSATTTTTGSPAPTTVAS
                     TTSPEPTTAEPTTAVEVATPNTTSPPAAQAVSESSAVATTTAEPAASTATESATTTPV
                     VTTTTVQPAAG"
     CDS             195299..196024
                     /codon_start=1
                     /locus_tag="ROP_02260"
                     /product="hypothetical protein"
                     /protein_id="BAH48473.1"
                     /transl_table=11
                     /translation="MSNDPSEAAHVGRDSPSAVFAKLAEMVYNGDDFDHVYQAICDAA
                     ATLVPGCAHASLMLKQKDRHITVAASDEVAAHVDALERAEQEGPCLDAIENDAPQVEA
                     ELARSTQWPRLARRAIAETPVRGAAGFRLLIHGRKVGALNLFADNPGEFTDESIDQAI
                     LITAFAAVTLTALHEHQEAQTLRDGLASNREIGKAIGLLMAFHDISEDRAFELLRKTS
                     QDMNIKLTSVAREVIVHHNSKFD"
     CDS             196338..196670
                     /codon_start=1
                     /locus_tag="ROP_02270"
                     /product="hypothetical protein"
                     /protein_id="BAH48474.1"
                     /transl_table=11
                     /translation="MTVEFAAEADATVGRISGEIDVLAAPSFALALARLTDGVSSARV
                     IVDMTAVDFVGTSGLSILSEFAESARRQHITWALAGNRAVLRPIEAIGLSATIPTCST
                     LHDAVDRV"
     CDS             196701..197372
                     /codon_start=1
                     /locus_tag="ROP_02280"
                     /product="hypothetical protein"
                     /protein_id="BAH48475.1"
                     /transl_table=11
                     /translation="MPGKQPTRGRSTSGAGETVRMLLDKAGPTYASASHITLKDTPTP
                     LFQLLTLSLLLSTRISSEIAVSAARELFRARLRSPRAMREADRRTVISALGRGNYVRY
                     DESTATRLHAAAVRVDEEYGGDLRRLASACDHATSAAVRLLTEFDGIGPVGADIFLRE
                     VQDVWSWVRPYFDTRARESARDLGLPDDPHALYDLAPPGRVAELAAALVRVSLDSQLR
                     DEVRG"
     CDS             complement(197622..197843)
                     /codon_start=1
                     /locus_tag="ROP_02290"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH48476.1"
                     /transl_table=11
                     /translation="MIRTTVQQHDQRTMSPPAEEPAAKHTLRPTVYIASISAATATAP
                     AIVVTGSILVAVATSVTVLAAVALAALLI"
     CDS             complement(198083..199066)
                     /codon_start=1
                     /locus_tag="ROP_02300"
                     /product="putative metal ion transport protein"
                     /protein_id="BAH48477.1"
                     /transl_table=11
                     /translation="MDVRFVSDDGVRSCAATELKELLDRPDGLVWVDIPTWDDQAHDT
                     LTTVFDCHPLAVRDSKNRNQVPKVHRYVDQLFVVLHAPQSGAHGHVHYVELDQFIGAR
                     YLVTVHGPVNPAIDPSTAMVEVNVVLSRLESGKLRPGTAFELSFALLAALTARMRAYT
                     AELTKDVWKLEQQVTGGHLGDPETFLDEMFRVRHGLLTVGTMAALSGEVYGRMVTIEA
                     FGAGKGQDLLLDAVDQFQHLTVMARGQKDYLQGTIEFYQARTNTKMTIAAERLAVIAA
                     VTLPITALSSIIGMNVIVNERTQWPAVAVIVLVMLAMSGALLVWAKRKGWF"
     CDS             199173..199586
                     /codon_start=1
                     /locus_tag="ROP_02310"
                     /product="hypothetical protein"
                     /protein_id="BAH48478.1"
                     /transl_table=11
                     /translation="MADNRTGLIVVDAANVVGSRPDGWWRDRAGAARRLLVQLDALEQ
                     HLDQPAEVVVVIEGAAKAAVAGDPNRELNGLRVVSAHGSGDDAIVDVVAAEKDGERQI
                     TVVTADRGLRARVEALGAVTVGPRWLFARIDAASS"
     CDS             complement(199590..201212)
                     /codon_start=1
                     /locus_tag="ROP_02320"
                     /product="putative oxidoreductase"
                     /protein_id="BAH48479.1"
                     /transl_table=11
                     /translation="MTVQTVDAVVIGAGPNGLAATATLAAAGWDVVLLEQQPEPGGAV
                     RSAELFPGFRTDLFSAFYPLAAVSPAIRHLDLGGVGLRWSRAPAAVGHPRHPDDDDAP
                     LIRRDPADTAADLERRQPGDGQAWLRLFEQWKDVKEPFLDTLFRPFPPVRGPRRLLSQ
                     LGTAEALRFVRFLMLPARRMTHELFDGDAARVLLLGNAMHADTPVDSPGSGVMGYLLT
                     MLAQDDGYVVPVGGAGALSAAMAERARRDGAHVRCGEEVTSIEVSGGAATEVRTAGGD
                     RYLARRAVLADVSAPALYGRLLDSSVVPVGVRADLEKFEWDTPVVKVNYALDRKIPWR
                     SRNLESAGTVHLGADDDGLVRWMADLTTGVVPERPFLLFGQMTTSDPSRSPDGTESAW
                     AYTHLPRGVTDDESAERLAHRVDAMLESHAPGFAERVVGRNVQRPGDLEASNANLHGG
                     AVNGGTAQLYQQLVFRPTPGSSGPYTSIDRLYLASSATHPGGGVHGMCGYNAAHAALA
                     DDGRWGWARKKVRGRILDLVAAPDGQQSPRHR"
     CDS             complement(201217..201729)
                     /codon_start=1
                     /locus_tag="ROP_02330"
                     /product="hypothetical protein"
                     /protein_id="BAH48480.1"
                     /transl_table=11
                     /translation="MTHVFDRVAEGKREESVQYSFEGVVVIEAHRDTSASASEVWSVL
                     ANGWLYPSWVVGATRMRAVSADWPAVGSRLHHSVGSWPALIDDSTEVLFAEENRELRL
                     LAQVSPTKAVVRLRLEPRESGCHLEMSEAAASAPLTWVPRIAQDLAVLPRNLECLRRL
                     SFLAERNTKP"
     CDS             201773..202462
                     /codon_start=1
                     /locus_tag="ROP_02340"
                     /product="putative hydrolase"
                     /protein_id="BAH48481.1"
                     /transl_table=11
                     /translation="MSSETPSSTRAALFDVDGTLVDSNYLHVRAWQRAFREVGHDVDA
                     WRVHRAIGLDSSLLLESLLGDDARMLGQRAKDLHSTYYLGARDSMRPLAGARDLIREL
                     HGRGVQVVLATSAPEEELDVLREVLSVDSFIAHATSSEDVDDAKPDPGVLRAAMDRAS
                     VSADSAVMVGDAVWDAKAASRAGVTFVGVLSGGISRAELTEAGAVAVFEDAQDLLDHL
                     ESSPLSALLGN"
     CDS             complement(202459..202680)
                     /codon_start=1
                     /locus_tag="ROP_02350"
                     /product="hypothetical protein"
                     /protein_id="BAH48482.1"
                     /transl_table=11
                     /translation="MMSDSKKEFVALRLDEVIHEWEANAPAGGSGSEGPLVTAQRHRA
                     EIDSASDDRVDEIAEAYPEIAQAWSSRGA"
     CDS             complement(202699..204027)
                     /codon_start=1
                     /EC_number="1.6.99.3"
                     /locus_tag="ROP_02360"
                     /product="putative NADH dehydrogenase"
                     /protein_id="BAH48483.1"
                     /transl_table=11
                     /translation="MTYESAGEPTRVVVVVVGSGFAGFECARALARRLRGTEARVIMI
                     SPHDYMLYTPLLPEVAGGILDARFVTVPLSEALPDVELVTGRVDAVDFEARTVHVTDC
                     EQGFEQVAWDRVVLTPGSVTRLFDIPGLAEHARGLKTPAEALYFRDQLLTQIELAERD
                     TDPRVADARRTVVVVGASYAGTELTAQLRALADEAASRRNLDPAKIRFLLLDVAGSVM
                     PEVGEKLGDKVLDVLRSRGIDVRLDTTLTELGPEHVTLDDGTVVPTRTVAWVTGVTAS
                     PLVDTLGLPTEKGRLTVRPDLSVDGHPDVFAGGDAAAVPDPKNSGSITPPTAQHAVRQ
                     GQALARNVAASLGVGDAKPYTHRDMGLVVDLGPGFAVANPLGIQLSGFLAKVVTRAYH
                     LYAMPNAANRWAVALAYLTDLIFPRPLVSIGLVTDSESPFAAGEEIGAQA"
     CDS             204160..204429
                     /codon_start=1
                     /locus_tag="ROP_02370"
                     /product="hypothetical protein"
                     /protein_id="BAH48484.1"
                     /transl_table=11
                     /translation="MSAASKAMYKPLALAASVAGGIAASAVFGQVWKRLAGESEVPDP
                     KDLSRSTREVLIAAAVQGTVFGLVKAAVDRAGAQGYRKLAHADPR"
     CDS             204469..205116
                     /codon_start=1
                     /locus_tag="ROP_02380"
                     /product="PhoU family protein"
                     /protein_id="BAH48485.1"
                     /transl_table=11
                     /translation="MRTRFAENLDSLSGDLASMCRLSVTAMSEASDALLEADLGLAEH
                     VIDASGELDDAAAHWEKRAFALLALQAPVAHDLRFMVGGLHISADLHRMGGLAVHIAK
                     IARRRHPEHVVPDEVRDVFTEMGSVAVAQARETEQVLQHRDPERARGLLTADEAMDDL
                     HRSLFTITQAEDWPHGVQSAVDITLLGRFYERFCDHTVEIGRRVIFLETGSLPEQ"
     CDS             complement(205201..205902)
                     /codon_start=1
                     /locus_tag="ROP_02390"
                     /product="putative oxidoreductase"
                     /protein_id="BAH48486.1"
                     /transl_table=11
                     /translation="MLSTGDGRCVDLGGGSGHRGGRGGHREAVPGSSLTVSLPRNNFD
                     LGAGAEYVFVAGGIGITPLLPMIAAAEAAGAAWTMHYGGRSRQSMAYLDEVAVYGDGV
                     GVLPQDEYGVLPLADILARSAPRAQVYCCGPEPLLAAVESVIGPRDAQRLHVERFRPR
                     PTDEESAPDRDFTVRIESTGATVRVGEGQSIVDAPEGVDDRRGDVVPRGHVRELRDLG
                     SRRRGMPSRFGAFRR"
     CDS             205986..206438
                     /codon_start=1
                     /locus_tag="ROP_02400"
                     /product="hypothetical protein"
                     /protein_id="BAH48487.1"
                     /transl_table=11
                     /translation="MFVLLRHAHAIGQQDWTASDALRPLSDLGRDQATGLIGTLAGVD
                     LHVLYCSPTTRCLDTLAPLAAARGLHVQEHPLLAPDAATDELCAALDAIDLAGTLWCT
                     HGEILTALAAITRADGTPAFPIGHTAKGGAWLLNARTPLRYLDPDPPQ"
     CDS             206954..207991
                     /codon_start=1
                     /locus_tag="ROP_02410"
                     /product="putative hydrolase"
                     /protein_id="BAH48488.1"
                     /transl_table=11
                     /translation="MNAARMRRLRPVPDTRPQMMFRTIHGYRRAFRMIGEGPALLLLH
                     GIGDNSTTWTEIIPHLAENYTVIAPDLLGHGRSDKPRADYSIAAYANGMRDLLSTLGI
                     DHVTVIGHSLGGGVAMQFAYQYPQMVDRLVLVSPGGVTKDVHPVLRLAATPIVNEALK
                     LLRLPGAVPVMRWAGALLTRLHGTPLRPGAALHDTPDLVRILTDLPDPTAHEAYLRTL
                     RAVVDRRGQMVTILDRCYLTESIPVQLIWGGRDTVIPVGHAHLAHAAMPDSRLEIFEA
                     AGHFPFRDDPMRFLHTVEKFLSDTRPLPFDEARWRQLLSTGTAENPVTTDPAMRTDVL
                     DAVGSSQRSAT"
     CDS             complement(208036..209244)
                     /codon_start=1
                     /EC_number="3.4.-.-"
                     /locus_tag="ROP_02420"
                     /product="putative S12 family peptidase"
                     /protein_id="BAH48489.1"
                     /transl_table=11
                     /translation="MGDRPLHRFRTRQRSSRQTLRVLGMAVAVVLSAVTGCAQSAGTA
                     ETDSTAGLSQHVVSSASAMLDKFVADGRTPGAVVEVSTPDGVWTHTAGRSATSPDTPM
                     YAQLQHRIGSITKTFTTTLILQLVQEGKVGLDDPVSRYVEGVPNGDRITLRMLGTMTA
                     GLSEYLANPDFRNRFFEDPMRVWTPSELLDASYALGAQFPPGTDSDYSNANTVLLGLV
                     VEKVAGAPFGDVLTDKILRPRGLDHTVWPVDASFPQDHVLGYTTLDPVRGVTDSTSWS
                     PTQAYSAGQMISTAGDLTQWIRLLGRGDLLTPELQAERLRWQPLGDNDDNWHYTFGLE
                     ENSGWIGHNGAIPGYMSYAVYHPALDATIVLLINSDAAIDGEPPVNVLLRDLSPVLFP
                     EQPVRVPVVR"
     CDS             complement(209467..210372)
                     /codon_start=1
                     /EC_number="4.2.1.52"
                     /gene="dapA"
                     /locus_tag="ROP_02430"
                     /product="dihydrodipicolinate synthase"
                     /protein_id="BAH48490.1"
                     /transl_table=11
                     /translation="MTVSSAPAAPFGRVLTAMATAFTEDGELDEEATARIALHLVDHG
                     HDGLVVSGTTGEAATTTTAEDGRILRVVKDAVGNRAKVVAGVGTNDTRHTLELARQAV
                     VHGADGLLLVTPYYNKPSQGGVLQHFRYVVDAVDTPVMVYDIPSRAGTKLAPSTFEAM
                     AGWPSVVAVKDAAGDPTQAILLRELGFAVYSGDDSLTLGFLAYGACGVVSVLGHVAGD
                     EIRAMIDAFFSGDVESAREINARLQPALRAVMGVPNYGATTVKGALQLLGVLQDRTVR
                     SPLLALDDVEYEALRAGLSASELLP"
     CDS             complement(210421..211026)
                     /codon_start=1
                     /locus_tag="ROP_02440"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH48491.1"
                     /transl_table=11
                     /translation="MRSAHGCGDRSFENSGLDMSDGSVERDQDDEWNYRARHETETQR
                     LDRNWAALLQELRVVQTGVQLLTGFLLTLPFQQRFTDLTDFEVIVYLMTVALSVLSTM
                     LLVAPAGFHRVLFRRHALPALVSAAHKLTVCGIATFGAALVGVVLLIFSFVVSPRVGL
                     VAAVVAAGIFCGLSVLAAILRLRNRVDDDPPTSDQRRSDRD"
     CDS             211185..211454
                     /codon_start=1
                     /locus_tag="ROP_02450"
                     /product="hypothetical protein"
                     /protein_id="BAH48492.1"
                     /transl_table=11
                     /translation="MRSSQRARTKLTRVDTGEHHLFMNSAEEARQILQVTTRLITKFP
                     AVPRESVEAAVQDAVVQFEGGRIRDFVPLLIERTATANLVSSVNA"
     CDS             complement(211503..212117)
                     /codon_start=1
                     /EC_number="2.1.1.-"
                     /locus_tag="ROP_02460"
                     /product="putative methyltransferase"
                     /protein_id="BAH48493.1"
                     /transl_table=11
                     /translation="MSAMDPGYFESMYAESADPWGFDERWYERRKYALTLAALPRPHY
                     RRAFEPGCSIGVLTAQLARRCDRVVATDVVSGAVERARDRLRREGVAGRVELCLASLV
                     GPWPPGTFDLVVFSEVLYYLTPAELGTTLNRAVDSLEDGGTLIAVHWQHHVPEYPQTG
                     RAVHDAIAATDGLDPAGSYRDTDFHLDVYTRGPVPSVAAADGLS"
     CDS             complement(212114..212887)
                     /codon_start=1
                     /locus_tag="ROP_02470"
                     /product="hypothetical protein"
                     /protein_id="BAH48494.1"
                     /transl_table=11
                     /translation="MGNGTRFRDTPVAARGTPEEVWQSWLGSVHCPPIPLKDCDRMVV
                     VAPHPDDEVLGVGALMATTATAGVPVQVVAVTDGGASHPQSPTLPPAALAAARIAESN
                     RATALLGVGEPLRFGLPDGGVSAHEHELTTRLVDVLTATCRAGERVWVLATWRGDGHP
                     DHEATGRAAAEACSITGHRMVEYPVWMWHWARPGEASVPWNRIRVLAPTADILARKRR
                     AVDEFRTQILPLSDDPRDAAILPPWVLARLMRPTERVLW"
     CDS             complement(212890..213855)
                     /codon_start=1
                     /locus_tag="ROP_02480"
                     /product="hypothetical protein"
                     /protein_id="BAH48495.1"
                     /transl_table=11
                     /translation="MSTDVTHDSTPTSAAVRAIIRSGEAELPLPGDGSTAVRWGRLTE
                     WCRRDLSIGRLLEAHADADAILAEIDGTRAGRNEWWGVWASEPPQPVLDAAHDSSGWR
                     LRGTKAWCSGASMCTHALITARVDGRPRLFAVDLREPGVTPGRGGWRNPGMAATDTEA
                     VTFDSVPARPVGSADRYLDRAGFWHGGIGVAACWFGGALAVAEPLRVRARGGRADSHQ
                     LAHLGAIDVAVSAARWALASAAAEVDSDPLDRRSAQVRAFRVRGLVERTASEVIDRVG
                     RALGAAPLASDADHASTVADLLVYIRQSHAERDLATLGELVAGED"
     CDS             complement(213852..214535)
                     /codon_start=1
                     /EC_number="2.4.-.-"
                     /locus_tag="ROP_02490"
                     /product="putative glycosyltransferase"
                     /protein_id="BAH48496.1"
                     /transl_table=11
                     /translation="MIGKDVMRVEHITVVVPAHDEEALLPRCLDGVRTAARAVSVPVT
                     VVVVLDGCTDGSEAVARAADVDVVVLGARNVGAARRAGFGSVAPRPHEWFATTDADSV
                     VPAHWLSSHLQHAGHGAQLVAGTVSVTDWSGWPDHVRSRYGSAYRAGAAHGHVHGASL
                     GFSADLYRAVGGFASLPAHEDVDLVQRMVEHGADVVWSIDAPVETSARSDARAPLGFA
                     TYLEGLQDR"
     CDS             214631..215158
                     /codon_start=1
                     /locus_tag="ROP_02500"
                     /product="oxidoreductase iron-sulfur subunit"
                     /protein_id="BAH48497.1"
                     /transl_table=11
                     /translation="MNAADSPRYRKIVLTVDGEERTLDVDTRTTLLDALRDHLGVTAP
                     KKGCDHGQCGSCTVLLDGRRATSCLTFAVAHDGARVVTAHGLADGDVLHSVQQAFVEQ
                     DGLQCGYCTPGQICSAIGMFDEFLALQPSAVTENLTAPPELTDDEIRERMSGNLCRCG
                     AYPNILAAIRQAAEA"
     CDS             215155..216147
                     /codon_start=1
                     /locus_tag="ROP_02510"
                     /product="oxidoreductase FAD-binding subunit"
                     /protein_id="BAH48498.1"
                     /transl_table=11
                     /translation="MIPFDYERASDVDSAVATVTADPGASYLAGGTNLVDHMKLGVAR
                     PHLLVDVSRLPLDDVEALPGGGLRIGAAVRNSDLAAHEVVRARYPMLSRALLSGASGQ
                     LRNLATTAGNLLQRTRCVYFQDVTTPCNKREPGTGCSALGGYVRYHAILGASEHCVAV
                     HPSDMAVAMTALDAVVVVRTADGERRIPLREFYVLPGDRPDRDTVLGHGDLVTAVELP
                     APPAGNRSTYRKVRDRASFAFAVTSVAAELTVDDRSITSARVALGGVAHRPWRATRAE
                     EVLLGSPPTENTFTAAAEAELAAAQPLPGTEFKVVLTRRVLVSVLRSLAEEARR"
     CDS             216144..218240
                     /codon_start=1
                     /locus_tag="ROP_02520"
                     /product="oxidoreductase molybdopterin-binding subunit"
                     /protein_id="BAH48499.1"
                     /transl_table=11
                     /translation="MTLVEPKVIGTPAERLDAHDKVTGTASYAFEHTVDDPAHLYPIP
                     STIGRGRVTAVHTTDAEALDGVLAVLTVFDAPRLADTSDGELAILQDPEVHFRGQFVG
                     AVVAESPEVARHAAGLVRVDYDEASHDTDFRSGRDDLYAPDEVNAGFPTDTDDGDVDA
                     ALAGSTVTVDQVYSTAMEHNNPMEPHATIAQWTPGGSGPVLTLHDSTQGVHSVRKTLA
                     PLFGLEVEQVRVIAPYVGGGFGSKGLPHAHNVLVVLAAQRVAGRPVKFALTRQQMFAL
                     SAYRAPTVQRVRLGADADGRLTALSHEVITQSAKIKEFAEQAAVSSRMMYSAPTRRTT
                     HRLAALDVPAPSWMRAPGETPGMFAAEVALDELAAACRLDPIELRIRNEPEVDPSTGR
                     PWSGRRLTDCLREGARRFGWADRDATARSRSDSEWQVGLGVAAATYPANTMPGSVARI
                     VYQSDGTYTVQIGSVDIGTGAWTALTQIAADALGCPLDSIVLQIGDTNLPPATVAGGS
                     TGTTSWGSAIVAAARAFRAEHGTNPSPGAEAAAGTLDNPDAAEFALHSFGAHFVEAHV
                     RRDSCEIRVERMLGVFAIGRVVNARTVRSQLIGGMTMGVSMALHESSVNDPRFGHVVT
                     QDLASYHVSTHADIGYLDAVCLDDVDEHAGPMGSKGAGEIGIVGAAAAVANAVHHATG
                     VRVRKVPIHLDDLLPG"
     CDS             complement(218251..218580)
                     /codon_start=1
                     /locus_tag="ROP_02530"
                     /product="hypothetical protein"
                     /protein_id="BAH48500.1"
                     /transl_table=11
                     /translation="MTAVATETEGEPEEAFGTEWLRLALRRCELLAQMHSVSSDARWM
                     ISFAIQWAPFGGASAAELLERFGVNRRRFMELVLDGLAPKAGDIQKIRAMKAQLRTSL
                     VQAWGVQ"
     CDS             complement(218577..218966)
                     /codon_start=1
                     /locus_tag="ROP_02540"
                     /product="hypothetical protein"
                     /protein_id="BAH48501.1"
                     /transl_table=11
                     /translation="MTTDGMTRWQGIAQKCELMIQRCLNCTTLLAPLMATCSACQGSN
                     LERVPSCGVGSIVSSKVVDRGLSGLDRGRVPCTIAIVELDEGPWVYTWIDGDVPAPSD
                     CPVRVEFRPASTAEQLPVFAVRAGDQR"
     CDS             complement(219245..221602)
                     /codon_start=1
                     /locus_tag="ROP_02550"
                     /product="putative LuxR family transcriptional regulator"
                     /protein_id="BAH48502.1"
                     /transl_table=11
                     /translation="MRRGLRVESDGVMPAAVKGTVGNLPHELTSFVGRRREVTEARRL
                     LSMSRLVTLAGIGGVGKTRLALRVAADASRAFEDGVWLVELGELDDDTTLVDAVSSAL
                     RLREQRTGNPEVLLTEYLADRQLLLVLDNCEHVVAAAAALSETLLRSCPELRILATTR
                     EPLAIGGEAVLRVPPLTVPEPERTSLQGLPQYEAVTLFVERAATAVPEFELTDENHVA
                     VARICRQLDGLPLAIELAAVRLRVMSAEQILQRLTDRYRLLTVGSRGAPSRQQTLRLC
                     VDWSHELCTDEERELWARLSVFAGGFELDAVEGICAGDLPVENVLDVVASLIDKSILI
                     REEVGPAVRYHLLETVRDYGREKLQETGELVALRRRHRDWYEQLVVRCEAEWIGPRQA
                     MWIGRLDAEKLNVRAALHFCLTEPGEAEPGLRTAAALYPYWRARGLLREGRRWLGQLL
                     GRHPGGASRERIEALYVDSVLAGMHGDREAAKALVDEGAVLAQRNGDPLLGALVVHAA
                     GCCAMFAGDLPRARACFEEALPVFRDRGSLLQLTWGLLGVALVSGMQGDGAVAKMCGS
                     EIFALTEAHGESVYRGWSLWAAGMAAWQRGHLALADDYVKQGLRLSHLVDDRISACGA
                     LEVLAWVAVGSGRARNAAELMGAAEAVAQAVGNPSTVYPNLLVHHAECEQQARAVIGD
                     RAFDAAFDHGMHTSFDDAVALALDERRPDAAASSNGTPHLTKRESQVAELVADGLTNK
                     AIAARLVISQRTAQGHVEHILAKLGFTSRTQIAAWIVEHAQDPHP"
     CDS             complement(221697..222383)
                     /codon_start=1
                     /locus_tag="ROP_02560"
                     /product="hypothetical protein"
                     /protein_id="BAH48503.1"
                     /transl_table=11
                     /translation="MHPSTRTAVVTGSDSPMGRAVALALADDGFDVGLAYVADRDSAE
                     ATAADVESRSVRAAVQHMDLADLPGSADAVDEFARDLGGIGVLVSCPGSTAVECIQRA
                     VRYMIAGGGGGRVVNVTTSSSGLGGLTGLLAAELARYSITVNSVVVPAVEPDFAAPGP
                     GDREVAAVASYLCAPAGMFVTGAAYVVDGARIAMIPHSLTEAGALRPPRRAGRIRSYT
                     GRWAPTRWTR"
     CDS             complement(222505..223725)
                     /codon_start=1
                     /EC_number="3.1.1.-"
                     /locus_tag="ROP_02570"
                     /product="putative lipase"
                     /protein_id="BAH48504.1"
                     /transl_table=11
                     /translation="MKRSRITSLTASALCAAFVACSAVANAGVATALPIYPASDPDPF
                     YGQPQGLAEAAVGEPLAVRPMPPLLAFPDTDVWQVKYRTTNSEDHPISSVTTVLVPRD
                     RPVNGPLLSYQHIINALGPRCAPSRTLYSNDPDLQIKEAPALNLALQRGWTVALPDHL
                     GPNSAYGAARLGGTITLDGIRAVQRVPELAVAESPVALAGYSGGGMASAWAAALAPTY
                     APELNIVGVAEGGVPMNIGKMANGLGMQPHPAFGLAMAAALGLEREYPDKLPISEQLN
                     DRGLAMRDEMVNACTNGILAAGAGRSATEVAKTTDLMSSPQAWEVLNENSVELYPGVP
                     TAPIFEWHSPTDVLIPVDSIEATVARYCAAGAKVQSDLFPSPDHLTTAVLGLPTALDY
                     LDARFRGDPAPSNC"
     CDS             complement(223844..250627)
                     /codon_start=1
                     /locus_tag="ROP_02580"
                     /product="non-ribosomal peptide synthetase"
                     /protein_id="BAH48505.1"
                     /transl_table=11
                     /translation="MTSVNSPQPNDGAGDVNVPEGAFPLSSVQRSMWFAQQLSPTVPK
                     FIAQYIELRGEIDLDLLSDAAVRAGQEFQSPFLRLLDVDGEPYQAVDFSIDPSIGFLD
                     FRGESDPMDAARRWIDEDYATPLRLTRDRLVQMNVLQVGEQHYLWYTRIHHVALDGYS
                     GMTMVNRIAALYTAAIEGTEPEPNRALDLRELYELDQKYRKSSRFENDRLYWAERIVG
                     IEHGSTLATHDAPAAAQSRLESARISESALGFLGESDQRVGATSAAVLLAGFACYLSR
                     MTGKRDVLINLPVSARTTAPLQRSGGMLVNVAPLRITVRPEDTVAELVQRTQLELMGA
                     LRHQRCSLEDIRRDAGLAGTAEGLAGPMVNVMLFHQAFTLGTVSGEYHIVTSGPVDDL
                     LVNIYQGGDGETLLDFRGNPNRYGSEELRAHHRRFVELIEEFVAAEPQARTADIHAES
                     ARLGARFLEQESQLAFWKRELAGLPEVTGLPLDRPRPAERAGAGEVVGFAVDAEVRHR
                     AALLAEEAGTGIFTTLHAALAVLLGRLGDTDDVVVGTPIVGRDTTDSEDPEAGAFFNK
                     AVLRSQVDGASSFTDHLSRVRDADRAAFSHAALPFDDLVAAVVADPDPSHTPLFQVML
                     EFTDGGHPHDSSGTVTVSPIQREHRALGLDLVFSLTESENGGINGRLRFATDVWDRDS
                     AEALAARFVRILHAVTADPAAPIGDVDLLEPAEYAELAPVRDEPAVEPRTLPGLLAGA
                     VTAGGDGDALVYEGRTLTYPELDELSNRLARMLIGRGVGPGSVVALAIARSIESVLAT
                     WAVAKSGAAFVPVDPNYPADRIEHMLTDSGAVVGLTATAHRSSLPTITPWLVMDDPSF
                     SRELEQHTAGAVTDADRLRPLRTADPAYLIYTSGSTGTPKGVVVTHVGLANFAEDERQ
                     RFDVTAEARTLHFSSPSFDASILELLLAVGAGATMVVAPSTVYGGTELADLLRRERVT
                     HAFVTPAALASVDPTGLDHIRCVVTGGESCPPALVQQWAPGRVMFNAYGPTEATVVAS
                     VAGPLTVGEPVTIGRPSRGCGLLVLDSRLHPVPAGVPGELYITGDGVARGYHDRSVPT
                     AERFVADPHGTPGERMYRTGDLARWNAAGQLEYLGRTDFQVKIRGFRIELGEIDAVVR
                     SHPSVAFATTVGRTAPSGDTALVTYVLPEDGAQIAVGDILEHAAAALPAHMVPARVME
                     LLEVPLTPAGKLDRKALPEPQFEATSTVYRAPVTPTEMQIAEVFATLLGVERIGVDDS
                     FFDLGGDSLVATRVVSRVNSALGTEIGVLDLFEAPSVALLSARVDAAGPRTSARPVLA
                     PRAGSGPVQVSLAQQRMWFINQLDTASPAYNIPVGIRLRGTLDVNALRTAVSDVLTRH
                     ESLRTVFPNTPNGPIQVVLPAAEVSPRLDVIEVAESELESRLIDDAATGFDVTVEPPI
                     RAELYRTATDDHVLVFVVHHIAADGLSMTPLTRDVMVAYHARAAGEAPQWAPLEVQYA
                     DFAVWQRELLGSPDDPTSLLSRQLAFWARTLDGAPEVMDLPTDRPRPARQSMIGATAD
                     FTIPARIHTALLDIAAANDASLFMVVHAALAVLLSRSSGSSDVSIGSPVSGRGERQLD
                     DVVGMFVNTVVLRTTVDPDRNFPEILSHTRSVDLEAFSNTDLPYERLVDELKPTRSEA
                     HSPLFQVMLVLQGFANTRLELPGLDVEVEALETGAAKFDLQVILTEHIEDSGAPGAID
                     VQFSYASELFDPPTMTALAARFVTLLETVTAGSDAKVGDLDLIGADETHRMLEQWIDT
                     DVPVPDSATLVSLFESQVARTPDAVAVVFAEEELLYAEFDARANRLARELLARGVGPE
                     SRVAVALRRSLELMIAIYAVEKTGAAYVPLDPDHPASRIAYVIESAEPACVLTASRDR
                     CEGVDSADAAVIEIDTLNLSQRPSTPITDAERGGPIHPDSTAYVIYTSGSTGRPKGVA
                     VSHRAIANRLLWMQDTYRMDHTDVVLQKTPVTFDVSVWELFWPLEVGARLVLAAPDGH
                     RDPTYLSHIIADHQVTTMHFVPSMLAVFTAGAEPDLCGSLRQVFCSGEALPPATADSF
                     REFGSAALHNLYGPTEAAVDVTFWECTEGDRASVPIGAPVWNTQLYVLDSRLHPVPVG
                     VHGELYLAGVQLARGYVGRSDLTSDRFVANPFGAPGQRMYRTGDVVRWRADGNIEYIG
                     RRDFQVKLRGQRIELGEVEAAVLAHPSVAQAVVTVHRSEATGESLVGYVIPVAGADID
                     TAVVRDAAAEALPAYMVPTRIIVLDRFPLGATGKLDRGALPEPEFLSPSAEFVTPRNP
                     IEEILASIFADLLDAPRIGVYDSFFDLGGNSLVATRLVARVNAALGSRIGVREIFDAP
                     TVAALATRIESEAGQGAERPPLVAGVRPAHLPVSLAQKRMWFINQFDLDSPAYNIALA
                     VRLTGDLDEDAMQDAVADVMDRHESLRTRFPMVEGEPLQVILPTEDVVPDLTPIDSTE
                     GQLPEHISRLAGAGFDVTVSVPVRAALYRTDPGEHVLVIVVHHISADGFSMAPLARDV
                     MTAYAARTGGQAPDWTPLPVQYADFALWQHRVLGNADDPDSLLAAQLDYWTHTLAGLP
                     ELLALPTDHPRPTQQSMRGGIHSFSIDRQIHSRLITTAREHNSSVFMAVHAALAVLLA
                     RLGDTDDVAVGTPIAGRGDAALDDMVGMFVNTLVLRTPVEPSGTFTDLLSTVRDADLN
                     AFHHADLPFERLVDAISPERATSHSPLFQVVLEFRNNERPRLELPGLTVTGLDLATDI
                     SNFDLQLTLTEEFGVSGEPAGISVAFTYASSLFDASTIAGFADYLQRIFDAVTSEPGM
                     AVGDIDLMVASERAALTPVMDGPDAEPRTLPELLASAASVDPKAAALSYEGSEVTYRE
                     LDERSNRLARLLIGRGIGPESVVALAMARSPESVLSLWAVAKTGAAFVPVDPNYPTDR
                     IVHMLSDSGAALALTVAEFRPTLPDCTPYVVVDAPGFGDQVSAHSAAVVTDADRTHPL
                     ALENPAYLIYTSGSTGTPKGVVVTHRGLANFATDERVRFGVTPRSRTLHFSSPSFDAS
                     ILELLLAVGSGATMVIAPASVIGGTELADVLREGRVTHAFITPAAMASVDPAGLDQLE
                     CVATGGDVCPPELVAQWVTGGRRMFNAYGPTEATVVSSVTGPMLPGEGVTIGRPPMGT
                     GEMVLDSRLHPVPNGVTGELYVTGSGLARGYKDRAGTTAERFVANPYGGLGARMYRTG
                     DLARWNTDGQLEYLGRSDFQVKIRGFRIELGEIENALTRYPGVARSVVSAHRGSTGAN
                     RLVGYLVPTAGAELDPEAVLDFVGGFLAPYMVPSALIVLDQLPLTPAGKLDRRALPEP
                     DFGARVSTGRAPVSEMEEVLAGLFAEVLGLESAGVEDSFFALGGDSIMSIQLVARAKA
                     AGVVLTPRDVFEAKTVAGLAAVASWIGAADIVVLDELPGGGVGDMPTTPITKWLLERG
                     GEFNRMSQSALLTAPPNLRELEPLIGTFQAVLDRHDMLRAQLMVSADESHLAVRPIGA
                     VEAQDLIRRVAVSAAPGTPAFAATVIADLDAALDRLDPAAGVMMQVVWFDAGESGGRL
                     LVVAHHLVVDGVSWRILVPDLATAWAQISAGQEPALEQVGTSMRRWAHGLVDEAANRA
                     GELDLWQRILDCEDPLVGSRPLDPDVDVNATVGRVTVQLPAEVSEAVLTALPEAIHGS
                     VNDGLLTALAMAVTQWRRTRGHTLHGRSVDGTLVSLEGHGREDQVVPGADLGRTVGWF
                     TAMFPVRLDLSGIDLDDAFDGGRAAGSAIKAIKEQLLAIPDHGMGYGMLRYLNADTAP
                     LLAARSLPQISFNYLGRFAADLSEAATRAGWTPTGEVDMDRAQDLDTPVTSAIDVNAV
                     TTEVDDRPQLRATWAYAAGVLTVAEVRELAELWVRALTALTTYAARPDAGGVTPSDLE
                     LVSLDQDAIDRIESRFPALSDIWSLSPLQSGLLFHALLADESIDSYTVQVTLELRGAV
                     SSRLRVAGQALLDRHANLRASFVYDEGGTPVQAVHGYAELPWTEIDLSALDEDSREAE
                     ITELLDTDRRRGFDMATPPLLRFMLIQVGADEQRLIITNHHILLDGWSMPLLIRDLLT
                     LYATEGDATALPRVHPYRDYLAWMSHRSTEDSLGVWHRALAGVEEPTLLAPADAAAKS
                     DTQSSELIVELDVDRTDQLSVLAREHGLTLSTLIRTAWGIVLGGLVGRSDVVFGGTVS
                     GRPPQIAGIESMVGLFINTLPVRVTLDPRETLGELLERIQGEQAALLDHHYVGLTDIQ
                     SVAGPGAGFDTLTVFESYPVDREGLTEQTDIAGMHVLDVHDSANAAHYPLALIASAHE
                     NLQLKLEYVEDLFDRAAVERIGDRVVRALIALAEHPGMKLAQLRLLTDVEEAELVPAR
                     GKPGRSVRTLPQMFADTAAASGDATALVFGDRRMSYRELDERSNQLARLLIGRGVGPE
                     DIVALGISRSIESVLAVWSITKTGAAFVPVDPTYPRERVEHMVTDSGCTFGVRVGADR
                     DRLPAAVTWLTLDDAETDAAVGAMSTDTVTDDERVVPLRFAHPAYVIYTSGSTGKPKG
                     VVVSHRGLDNFAEEQRDRYATDSASRALHFSSPSFDASVLEYLLAFAVGATMVIVPPS
                     VYGGEELAELIRAEGVTHGFVTPAALASVDPEGLDVFQNVVAGGEAVPPELVTRWAPG
                     RTLYNGYGPTETTIMSNLSDHLQVGETVTIGGPVRGVSEVILDSRLQPVSVGVAGELY
                     ISGEGLARGYHARAGLTSERFVANPYGEAGDRMYRTGDLARWRSDHTVEYLGRTDFQV
                     KIRGFRIELGDIDSALAGHPSVAFAVTLGRPGPAGDTVLVSYVLPEAESVLEPPELKE
                     WTANLLPAHMVPSSIMILDEIPLTPVGKLDRAGLPEPQFLPTSDAFRPPSTVLEHTIA
                     DVVTTVLGIERVGIDDNFFDIGGNSLIATRVAARLTAELDTDIGVRTLFEAPTIHQLA
                     RLIESTAFAPAQDGDHVRLPLGPMAQPAHVPVSLAQKRMWFLNQFDTSSAAYNIPLAV
                     RLTGHLDVESLRAAVTDVFVRHESLRTVFPSHDGEPTQVVLSPGQWTPNLEITEVSEA
                     ELREHIAGLATAGFDVTADVPMRSALFALAPDDHVLVIVVHHICADGFSLTPLARDVM
                     TAYAARIAGSAPQWNPLSVQYADYTLWQLQLLGDESDSESLISQQLRYWTDQLADLPE
                     LLQLPTDRARPVQQSFRGAQVDFTIPADVHRALSALARKHNSTMFMAVHAALSVLLSA
                     LSSTEDIAVGTPIAGRGDAALDDMVGMFVNTLVLRSAVDPAAGFGALIDQVRGTDLAA
                     FHHSDLPFERLVDVLAPERSTAHSPLFQALLEFRNNETPRLELPELTAAAVDFDLEVA
                     KFDLQLSVEEGFDADGVASGITAAFIYATDLFDAGTVRTFADRFLRILTAVTADPQAP
                     VGDIVITDAAERSAMATVWNTAGVEAGTDTLADRFAQSVARFPGATAVTSEDVALTYA
                     ELDARANRLARLLIAQGVGPETLVAVALPRTCDLIIALLAVIKSGGGYLPVDITYPAD
                     RLAFVFEDAAPNCVITTTGDVSALPDSETPAILLDDPETTADLAQQSPATITDADRVT
                     PLDAASVAYVIYTSGSTGRPKGVVVSHRNVLTLFANTQPLYGFDENDVWTMFHSYAFD
                     FSVWELWGPLLYGGRLVVVDYYTARSPEMFHELLRNEQVTVLNQTPTAFYQLAETDRI
                     VSEIDVNAAALALRYVIFGGEALDLGQLGRWYSRHDDAAPTLANMYGITETTVHVSYL
                     ALDRAFAESASASVIGRGIAGLHVHVLDRRLHPVPPGTIGEMYVSGDQVTRGYLGRAG
                     LSSTRFVADPLRPGARMYRTGDLARWNTDGQLEYLGRSDFQVKIRGFRIELGEIESAL
                     LRYRGIAQAVVLTRDDGHGGHRLIGYVVPESGATVEVSSALEFVGTQLTSYMVPATLV
                     VLDALPLTSNGKLDRRALPEPDFGARVSAGRAPATEMETVLAGLFAEVLGLESVGVDD
                     SFFALGGDSIMSIQLVARAKAAGVVLTPRDVFEAKTVASLAEAASWAGAADVVVLDEL
                     PGGGIGEMPVTPITTWLLERGGDFRRYTQTALLSLPAAADETLLKRTIAAVVDHHDML
                     RARLVGAAPQWRIEVQATGAVDVDDVLHRVEVPSVVGSAFADVATRELDSAAERLDPE
                     AGVMLQMVWFDAGTEGGRLLVVAHHLVVDGVSWRILVPDLATAWAQVSAGQEPALEPV
                     GTSMRRWSHGLVDATRERGAEIELWRRVLEADDPLIGSRPLDPAIDVAGTVEKVTVEV
                     PADVTDALLTRVPEAFHGGVNDGLLTALALALAQWRRGRGDLTRESLVSLEGHGREDQ
                     VLPGADLGRTVGWFTAMFPVRLDLSGIDLDDAFAGGRGAGSAIKAIKEQLLAIPDHGI
                     GYGMLRYLGQDSADQLRALAKPQVTFNYLGRLGGATSTDVHGHAWVPVTDTKLDDIPA
                     SDIPVASALDINAVTGTGPDGNRLRATWAFPTGVLTPSEVRALADLWVQALTALTTHV
                     ARPDAGGVTPSDLDLVTLDQDAIDRLEARFPALSDIWSLSPLQSGLLFHAQFSDATVD
                     PYLVQLALKLRGDVNPDRFRRAGQALLDRHPNLRAAFVHDSAGASAQIIQQHVELPWS
                     EFDLSALGPEETTREYERIVARDRSVKFDMADAPLLRLALVRLTDDEYRLILTNHHIL
                     LDGWSTPLVLRDLLTLYALDADGSLLPRVHSYRDYLTWMKRHDTTDSLDAWRAALDGV
                     EEPTLLAPLERGEAHSAVAEETAFTLSEEHTTRLRDLSRERGLTLNTVVQTAWGIVLG
                     GLVGRSDVVFGGTVSGRPPQISGIESMVGLFINTLPVRVTLDPWESLGELLERVQREQ
                     ATLLDHHYVGLTDIQSAVGGGGTFDTLTVFESYPVDEAGLTEQTDIAGMFVLGIDGKD
                     SAHYPLAVVASGDARLNFKFEYLPDVLEESAVDEIADRLRRVLDALADRPEIPLAHMQ
                     LLTEAELAEFAPVRGRPGFSVRTLPQIFEDAAALDPNRTALTFEGRNVSYRELNERSN
                     QLARVLISRGAGPETFVALGIPRSIESVLAVWAVAKTGAAFVPVDPNYPMDRIEHMLT
                     DSGATIGLTMAAYEKSLPDSVPWLQLDSPKFEKACQAKPALPVADSDRRSPISLDNAA
                     YIVYTSGSTGKPKGVVVTHEGLDNFAEDQRQRFAAAQTSRTLHFSTPSFDGSVFEYLQ
                     AFGVGATMVIAPPTVYGGAELAELIRSEHVTHAFVTTAALSTVDPEGLDEFQHVVFGG
                     EACPPELVTRWAPGRQLSNAYGPTETTVMANISDPMTVGEPITLGGPIRGVGELVLDS
                     RLQPVPVGVPGELYITGAGLARGYHRRPELSSQRFVANPFGEAGERMYRTGDIVRWRA
                     DHTVEYVGRSDFQVKIRGFRIELGEIDNEIATFPGVGFAATLGAPGPSGDTVLVTYLL
                     PVTEGGVDPAELTAHLSTRLPAHMVPTSIMFLDEIPLTPVGKLDRSALPAPEFHVTTT
                     EFQPPTNDLERKIVDIFTDVLGLERIGIDDNFFDLGGNSLVATRVTARLRDALDTDIG
                     VRALFEAPDARSLAERVADSVSGGARPALAPVERPDRIPLSLAQKRMWFLNQFDTSSP
                     AYNIPLAVRLTGTLDEDALRLAMADVLDRHETLRTVFPTVDNEPTQRILAAADAQPGV
                     DTVPVDAADLPRHIMDLVSRGFDVSTDVPVRAALFRTAPDHHVLTIVVHHICADGFSL
                     APLARDVMVAYTSRLAGAGPQWAPLHVQYADYTLWQHAGLGSENDPESMINRQLRFWS
                     EALAGLPDVIQLPTDRPRPIQQTFEGDRVEFAIDADLHQRLTALARANNATMFMAVHA
                     ALAVLLSRLGSTDDVVIGTPVAGRGEEALDEMVGMFVNTLVLRNRIDPSATFTELVQQ
                     IRESDLAAFAHADLPFERLVEELNPTRSTSYSPLFQVALEFQNNENPTLELPDLRVEN
                     VDLETRVVKEDLEVILAERFDQDGAPAGVAGGLDFAVSLFDPDTARSIADRFVRILAA
                     VVADPDRPIGTVPMLDDAEIDEMVPARGKPDVRPEVWPDLLTAAAALDPDSVALSFED
                     RQVTYRELDEWSNRLARVLCAQGAGPETFVAIGMPRSIEEVVSIWSVAKSGAAFVPVD
                     PTYPRDRIDYMLTDCRASIGLTVAGRRDNLPDTVPWLVLDDHAFAKQVADVSSAPVTD
                     ADRTAPLHLAHPAYLIYTSGSTGKPKGVIVTHRGMANLTAEEHERFQVTHDSRVSHLA
                     SPSFDASIFELMMAFGASARVVIVPPTVFGGAELADLFRRNEVTHAFITPTALSSIED
                     VGLESLRVLAVAGEACPPELVEIWGKHRNMHNGYGPTETTIQASVSAPMRPGGVVNIG
                     APALGFGSLVLDERLQPVPAGVPGELYITGPGLARGYHNRSALTSERFVACPYGEPGR
                     RMYRTGDVVRWRGDHTIEYIGRTDFQVKVRGFRIELGEIDAVLARHPAVAFAATIGHT
                     GPSGDTLLASYVRAAEGHDLEPAELRTHASDRLPAHMVPSAVVVLDQIPMTPVGKLDR
                     KALPAPEFGTTGAAFRAPTTATERIIVEAFAEVLGVDRVGTADSFFDLGGNSIVATRV
                     ITVLQDRLGRQIPLQSMFLDPTPAGLALRVDTENAAGSPVDEALGVVIPLRPTGDKAP
                     LFCIHPGIGLSWGYAGLLQHLSPDRPAFGLQLPIISGGTAVDSIEQLAHRYVLEMRKV
                     QAHGPYHLLGWSLGGVIAHAMAVELRREGEAVDTLALMDSYVANGTEQGPETLTVAEL
                     LHGLGLDLESVSGEELTYERAVELLDDAFGQKTGLTPRHLERISAGFTNSSRIMNNFR
                     PQVFDGDLLFFTAAGSASTGEHSPEEWRDSVTGGIREVKIECEHNQMIEPEVLAVVGP
                     VLEDYLGTH"
     CDS             complement(250843..251175)
                     /codon_start=1
                     /locus_tag="ROP_02590"
                     /product="hypothetical protein"
                     /protein_id="BAH48506.1"
                     /transl_table=11
                     /translation="MTSASRRPDSCVWCGREVAETGMGRRRRYCRQSCRQRAYEQRNQ
                     VKGTSIPADAVMLTAEEASAMVDRVFQVRCAAEDVATAVAEGAAAHEVESLCADLVQL
                     AREAERFR"
     CDS             251348..251686
                     /codon_start=1
                     /locus_tag="ROP_02600"
                     /product="hypothetical protein"
                     /protein_id="BAH48507.1"
                     /transl_table=11
                     /translation="MADRVLRGSRLGAVSYETDRDHDLAPRRMAKYRCDNGEVFDIPF
                     ADDAEIPGTWLCRNGLEGTLVEGTAPEAKKVKPPRTHWDMLLERRSKEELEELLKERL
                     DLLKAKRRGA"
     CDS             complement(252246..281813)
                     /codon_start=1
                     /locus_tag="ROP_02610"
                     /product="putative non-ribosomal peptide synthetase"
                     /protein_id="BAH48508.1"
                     /transl_table=11
                     /translation="MGSFPPPEWEMRTNKVVEAVPGGEVTAHGRIPDGAFPLSAAQRG
                     MWFAQQLDPSVPVTIAQCVELVGALDVALLSESLITAGRELGSAFLRLVEVDGVPYQL
                     IDPTLEASVSVVDLQHEPDPRAAATEWMRQEYTTPLDVCRDRLVTSAVLRIGPNHHYW
                     YCRVHHVALDGMGSVTLVDRTAELYTAAVEGRAVAPSKAAELTDVARVDDEYRTSSRY
                     LADGEYWSERVSSIGEPHSLVDRTAPARARSRTTGGQILGPLADHLDAATNRHDSSAA
                     FEVIAAFAAYLARMTGREEVAVSLPVTARTTALLRRSGGMVSNVVPLRLDVRPDMTNT
                     DLVAAVRLEVTGALRHQRYPHMDIRRDAATDHQGFYGPLINVMLFHNEITLGSIVGRL
                     ELLSTGPISDLAVNVYHGVAGTSINLDLEANPDLYSDDALAAHHARFTRFLGAFLTSD
                     TGTPRRIGDLEILDEDECRILVPAAGRAGFAPVALPDLLAGAVRSNPDGDALVAPGHG
                     TPDVTLSYRALDEESNRLARLLIDLQVGPEVSVALALPRSVESVSSVWAVAKSGAAFV
                     PVDPGYPFERIVHMLEDCGAPIGITTAALRAGLPDSTLWLVLDDDEFVSAVAAYPADP
                     VTDADRTGVLMVDHPAYVIYTSGSTGRPKGVAVSHRGVVNLAADERDRLGVSADSRVL
                     HFASPSFDASVFELVMAVCAGAALVVAPTTMFGGVELAEFLAEHEVSHAFCTPAALAS
                     LDHRGLDHLTTVVVAGDVCPPELVAKWAPGRIMVNAYGPTETTIMSSATGPMVPGQPV
                     TIGSATVGVDLVVLDHRLRPVPVGVRGELYVLGSSLARGYVHRAGLTAERFVASPFGT
                     GGRMYRTGDVVRWGTVPDGPPVLEFLGRSDFQVKIRGFRIELGEIDAALSAHPVVEFA
                     HTVGYDDGSGRSRLVSYVLPAPGTDVETRVLSEFVGTRLPGYMVPSSIMVLNMLPLTP
                     AGKLDRNALPAPVFAARSADIVRPRTVSEEILLGIFRDVLGLPELSVDTSFFELGGNS
                     LMATQVVSRVNAALDVRIGVRDLFQSPSVSKLAATVANAGPQSDPRPALEPRERPDRM
                     PLSVAQQRMWFLNQFDTASAAYNLPIALRLAGALDREALRAALGDVQERHEALRTVFP
                     DSADGPHQLIKPAVSVLADTDPLDVDPESLTAAVTALGSTGFDLTADTPLRAGLFREA
                     PERHVLVLVVHHIAADGWSMTPLAADVMVAYAARAAGHAPIWAPLPVQYVDYSLWQRD
                     LLGSEDDPNSLSAKQIAHWRAALAGVPQLIELPTDRTRPAEMSHRGGRVEFTIPADVH
                     GRLVDLAQSTGTTPFMVTHAALAVLLRRLGAGSDIVIGTPVAGRGEEALDHLVGMFVN
                     TLALRTTVDLGDTFEDVLARTRAADLAAFQHGDVPFERLVEVLSPARSSAHHPLFQVM
                     LTFQNTANTRVELDGLEVEAAEIDVQVAKFDLHLTVAENVDAAGNAAGLAVQLSYATD
                     LFDHSTVVSIGERFGRLLDAVSGNPPVAVGDLDLLDSREHAALTAANATHRPVPADTL
                     ASLFAAQAAATPDAVALVFDDRRLTYAEFDERTDRLARHLIRTGVGPESVVAVGMRRS
                     IDLLVAVYAIVKAGAAYLPIDPDHPAERTAYVLDTAQPVCVLTRAADDTTFRTAAPVV
                     NIDTLDLPDQDPTPISTALTAGNTAYVIFTSGSTGRPKGVAVTHGAIVNRLLWMQHEY
                     GLTPDDAVMQKTPVTFDVSVWELFWPLQVGASMVIAAPDGHRDPDYLATLIRRHRVTT
                     MHFVPSMLSVFTAEPAVAVCDSLRLVFCSGEALTPEQVSRFRAVSGAGLHNLYGPTEA
                     AVDVTYWETGAADALSVPIGRPVWNTQVHVLDARLHPVPNGVAGEVYLAGDQLARGYL
                     NRADLSSDRFVANPFVAGGRMYRTGDLVRRRGDGALEYLGRTDFQVKLRGQRIELGEI
                     ESALEAHPDVVQAVVVVHRDERGDEALVAYLVGRRAAEWSDVRAHLSTRVPSYMIPAR
                     VVHLDTLPLSVNGKLDRKALPPPTLDTATAEYIAPQTPAEVVVAGVFAEILGVERVGT
                     HDHFFDLGGNSLVATRLVSRLRIALGVPVSLRDVFDAPTVGALAHRLDRVDPAAHPAP
                     PALTPQERPEQVPLSPAQQRVWFLNQFDTSSPVYNLPLAVRFSGGLDVTALRRALRAV
                     LHRHESLRTVFPASDSSPWQRILDEHDVDLDLTVVEATDAELAAAIRGFALAGFDVTT
                     EIPVRARLLRVRNDEHVLVLVVHHIAADGWSFAPLSRDLMVAYAAHSGGRDLQWAPLP
                     VQYADYTLWQRELLGEKHDPDSRAARQLAYWATTLAGLPDSLDLPTDRPRPSVASKHG
                     ATVSWEISTELHERLLTLARTQDTTLFMVAHSALSVLLSRLSATTDIAIGTPVAGRGD
                     RDLDDLVGMFVNTLVLRAQLDPASSFAELLQQVREVDLAAFAHTDVPFERLVEHLNPT
                     RTAAHHPLFQVALFFQNHAPAHLELPGLSVSSQPILPDVAAFDLQLVLTDTRDADGTP
                     GPITAEFNYATELFDESTIRSFGSQFVRILDAVTMAPHTPVGDIAIAHPAARIRELSG
                     WNATDHDVPDTTLPDLFGAQAARTPDAPAVVFDGASLTYREFDEHANRLARYLISCGV
                     GPESRVALAMRRSLDLVVGMYAVVKAGGAYVPVDPDHPADRIGYVLQSAGPVCVLTTT
                     ADRGALPSGDVVTLDCLDLSDFSGAPVTDADRVYPLRADNTAYVIYTSGSTGKPKGVA
                     VPHAAIVNQLLWMQSQYALTGRDVVLQKTATTFDVSVWGFFWPLQVGAALVLAGPDGH
                     RDPDYLARTIDELGVTVTDFVPSMLDVFVASVPADSCSSLRHVFVIGEALPPETASRF
                     RDLSSAGLHNLYGPTEAAVSVTYWETSDADTVTVPIGVPEWNTQAYVLDSRLHPVAAG
                     VPGELYLGGVQLARGYLGRVDLTSDRFVANPFGGAGARMYRTGDLVRRRRDGVLEYIG
                     RTDFQVKFRGQRIELGEIETVLRSHPGVTGAAVVVYSDATTGDHLVAYVVPAPDRVAD
                     TAEIRRHASGSLPSYMVPSAVVLLDEFPLNTSGKLDRKALPAPEFTSDATEYVAPSTS
                     VERAVASVFCAVLGLERVSVRDSFFELGGNSLIATQLVSRLRGELDVPVTVRDLFETP
                     TVAELAARLSQSTGADTRPALIRRERPERIPLSPAQQRMWFLNQFDPSSPAYNLPFAV
                     RFTGPLDRVALEAAVADLVERHESLRTVFPDSATGPHQVVRDTADAPPNLTVADIAED
                     ELETVLARFFTTGFDVTTDLPVRVTLLRVSAHEHVLALVVHHICGDGWSMAPMVRDVM
                     VAYTARTRGERPAWTPLPVQYADYALWQRELLGDESDPDTLAARQLDYWTDTLAGIPD
                     ELELPTDHPRPAEQSYRGSHVDFDIDASAHRALAALAQSRRATLFMVMHTALAVLLGR
                     LSASSDVTIGTPVAGRGEPELDDLIGMFVNTVALRTHVDPGSAFTDVLDHVRDVDLAA
                     FSRADVPFERLVEVLSPTRHAARHPLFQVMLTFQNLEQTALELDGLTLRGLGTDIDVA
                     KFDLHLTLVERFDPAGRPDGMTAQLTYATDLFDADTADSIAARFTTILGAVTTDATTR
                     VGDIALLGADERAALTLWNSTEHAVPATTLPVLFDAQVARTPGAPALVLDGASLTYRE
                     FDEHANRLARYLVSCGVGPESRVALAMRRSLDLVVGMYAVVKAGGAYVPVDPDHPADR
                     IGYVLQSAGPVCVLTTAADRGALPSGDVVTLDCLDLSDFSGAPVTDADRVYPLRADNT
                     AYVIYTSGSTGKPKGVAVPHAAIVNQLLWMQSQYALTGRDVVLQKTATTFDVSVWGFF
                     WPLQVGAALVLAGPDGHRDPDYLARTIDELGVTVTDFVPSMLDVFVASVPADSCSSLR
                     HVFVIGEALPPETASRFRDLSSAGLHNLYGPTEAAVSVTYWETSDADTVTVPIGVPEW
                     NTQAYVLDSRLHPVAAGVPGELYLGGVQLARGYLGRVDLTSDRFVANPFGGAGARMYR
                     TGDLVRRRRDGVLEYIGRTDFQVKFRGQRIELGEIETVLRSHPGVTGAAVVVYSDATT
                     GDHLVAYVVPAPDRVADTAEIRRHASGSLPSYMVPSAVVLLDEFPLNTSGKLDRKALP
                     APEFSSDATEYVAPRNEVEQALAGVFADVLGAGRVGVHDSFFDLGGNSLSVTRLAARI
                     TETTGTRLSVRDVFEAPTVADLAVRIDPTARDVRPALTAAPRPARIPLSLAQQRMWLL
                     NQFDADSPAYNLPFAVRLSGVVDTAALAAAFDDVVERHESLRTVFPDGGDGPEQVVLA
                     VTDVSVTLPPVDVTEADLPGRMAALASRTFDVTAETPVRATLFRTAPTEHVLAISLHH
                     IAADGWSFGPLGRDVMVAYAARTDGHAPQWAPFEVQYADFSVWQRDVLGSEDDPESVL
                     ATQLGFWTRTLAGAPDELPLPFDRPRPAQPTFAGGSVGFDIDPETHRRIRSLARDHGA
                     TTFMVAHTAFALLMARLSATDDVAIGTPIAGRGERALDDLVGMFVNTLVLRTAVNGGA
                     TFAEMLRTVRDTDLAAFAHADVPFERLVDALAPTRTAARHPIYQVALSMNPLQSPDYE
                     LPGLRIGVEDVDPGVAKIDLQLTLGEELDHTGAPSGMRAEFIYATDLFDESTISDVAS
                     RLQRILEAVTSDPDTLVGDLDLLHDAERDALVPASGRPGLIPVTLPDLLAGAVRSNPD
                     GDALVAPGHGTSDGTLSYRALDATSNRLARLLIDLQVGPEVSVALALPRSRESVVATW
                     AVTKSGAAFVPVDPNYPADRIAFMLEDCGAPIGITTAALRENLPDSTLWLVLDDDAVI
                     EALTSYSSEPVQDSDRVAALSVDHPAYLIYTSGSTGRPKGVAVSHRGVVNLAADERVR
                     LGVLSESRVLHFASPSFDASVFELMMAVSAGATLVVAPTTIFGGEELAEFLAEQEVSH
                     AFCTPAALASVNHRGLDSLTTVVVAGDVCPPELVARWAPGRVMVNAYGPSEATIMSSA
                     TGPLVPGQPVTIGSPTVGVDLVVLDSRLRPVPAGVRGELYVLGSSLARGYVRRSGLTA
                     ERFVASPFGSGGRMYRTGDVVRWVTAPDRPPVLEFLGRSDFQVKIRGFRIELGEIDAA
                     LTAHPVVEFAHTIGFDDGSGHDRLVSYVLPAPAAEVDSRVLSEFVGERLPGYMVPSSI
                     MVLDSLPLTPAGKLDRNALPTPVFAQRSEFTAPQTPAEQAIAAVFADVVGEPSIGLDD
                     NFFDLGGNSLSATQVVSRVGSALGTRISVRTLFDNPTVRALATAAASDTTAERPALVA
                     GERPATIPLSPAQQRMWFLNQFDTTAAAYTIPLALRMSGRIDVATLRTALGDVLARHE
                     ALRTVYPATENGAHQVIVPVESIPLDLTPTRLSGEDLSGAILRHASAGFDVTTDLPLR
                     VHLFRESRSEHVLLFVVHHISADGWSFIPLASDVMTSYAARTAGDAPVWNALPVQYAD
                     YAMWQRHLLGDSDDPQSLAASQIAYWKRTLAGLPDQVALPTDRPRPPAPSNLGGTARL
                     TLDGDLHRQLHELARAHHASLFMVVHTALAALLSRLGAGPDVAVGTSVAGRGEQSLDG
                     LVGMFVNTLVLRTDVHPDSTGAALLEQVRRVDLEAFSHVEVPFEQLVDAINPTRSTAF
                     HPLFQVALALQNLQTPTLELPGLEVSALDIESPIAKFDLNFVLGERHDEDGNPAGLDL
                     ELGYAKDLFDADTASRIGESFVRVLSGLAHDPRTPVGDLDLLGDDARLRLLAQSHGAT
                     RETVHSTLVGLLDEQVRATPSAPAVRWRDTALTYAEFDACANRLARKLIADGVGPDAV
                     VAVEIPRSLDLLVAVHAVVKAGGAYTPLDPGQPEQRNRDIVEQSGASLVLTSSELLRQ
                     TGATRHGVRAIAPDALDPAEFGGEPIRAAERIAPLRPDNTAYVLFTSGSTGRPKGVAV
                     SHAAITAQLEWLREQYALGTADTMLLKTPVTFDVSVWECFAPLAAGARLVIADPDGHR
                     DPEYLAEIVRTHGVTVVHFVPAMLAALTSGPGLTDMPALRHVLVGGEAVSPETIDDFR
                     ASHPAEIDNTYGPTEAAVTTTFFAARSDNSDTVPIGLPVWNTSTLVLDDRLRPVPAGV
                     AGELYLGGVQLARGYLGRPDLTAERFVADPFSTSGARLYRTGDLVRWTAAGRLEYLGR
                     TDFQVKVRGFRIELGEIVSALLRHEDVDQAVVVPHSDPHTGEHLVGYVVPRGAVALDC
                     DAVLAEAAGSLPSYMVPSLLVPLTELPLTPNGKVDRNALPAPVFAGKAEYTAPRTESE
                     RVVAAVFAELLGVSRVGVDDNFFELGGNSLSATKLSTRIGVATQTRIAIRDVFDAPTV
                     AALARRLDQHGPSTAIAPLTAAVRPGRIPLSLAQQRMWFLNQFETSSPAYNLPAAVRL
                     TGSLDTAALAAAIGDLIARHESLRTVFPDSRGGPHQVILEPGDFTPDVAPVHVSETGL
                     RADLQEFLLAGFDVSEAVPLRVKVYSLGPAEHVLALVVHHISADGASMEPLIRDVMIA
                     YGSRAAGHPPTWAPLPVQYADYALWQRTVLGSESEPGSLAAAQLDYWTRALAGVPDQL
                     YLPGDRGRPAVPTHRGAATRFTLDAGTHRALTELARAHGASLFMVAHAALSVLLGRLS
                     TTADIAVGTAVAGRGRVELDDIIGMFVNTLVLRTTLDPGASFVALLAQTRTVDLEAFA
                     HADLPFERLVEVLSPVRSTSHHPLFQVALGVQAVSADGLELDGLSVTPLTLDASIAKF
                     DLHFTLTERLDDTAEPAGIDAELIYATDIFDESTAAGYATRLRRIFEAVVADPQRPIG
                     DIPVLGEDEHAALTPVRGADPRPVQMLPEILADAVAAAPDGLAVVFDGAGLTYRDLDE
                     RSNQLARLLVDRGVGPETSVALALPRSFESVVAVWAVAKTGAAFVPVDPGYPADRIVH
                     MVQDSGAMVGITVSAKRALLPDSIRWMLLDDPALEVRCTHESRLPLTNRDRMRPILSD
                     QVAYVIYTSGSTGRPKGVAVTHRGLMNLVTDERELLAVTSRSRTLHFASPSFDASVFE
                     MLMALGAGATMVIAPPTIYGGSELAELLAAERITHAFSTPAALASVDHHGLDELAVVV
                     VAGDVCPPELVARWAPGRRLVNAYGPSEATIMSSITEPLRAGEPVTIGGPSRGVRALV
                     LDGRLRPVPVGVPGELYVGGPSLARGYLGRPGLTAERFVADPYGEPGDLMYRTGDLVR
                     WREDRVLDFVGRTDHQVKIRGFRIELGEIDAALTAHPQIEYATTIGYEHPNGETSLVA
                     YVLPFTGEDVDRVEVANFVGRTLPAYMVPASVTLLDALPLTPAGKLDRSALPEPIFAA
                     AATTFEAPRNPMEVIVAGIFADILALPEIGIHDSFFDLGGNSLLATQVVSRINAALDV
                     HVGVREVFESPTVAALAARITETTTHGARRPALTARARPEHIPLSLAQQRMWFINQFD
                     TASPAYNLPVALRLSGEVDLRAMQIAIADLVGRHEALRTVYPDSGDGPHQVIVPAADA
                     VPDLTPVTAHPDDVLERVLALVTTGFDVTSDVPLRARMYRVGADDYVLVMVAHHISGD
                     GWSLAPLARDVMLAYTARTEGHVPLWTPLPVQYADYSLWQRELLGDEADPESVAAEQI
                     AYWTRTLDGLPDRLSLPTDRPRPAVASHRGAHVPFTIDAATHRALLTLARGRNTSLFM
                     VMHTALAVLLARLSNESDIAVGAPIAGRGEESLDELVGMFVNTLVLRTHVDLASSFAD
                     SLNVARSTDLSAFAHSDIPFERLVDVLNPARSRSHHPLFQVAFSFQNLATATLELPGL
                     HVEGLDVPNTISTFDLHLTLSEKHDADGTPDVIEAQFTYATDLFDDTTVRAFAERFTR
                     ILESVVRDPDLAVGAIDLLGGAERQSVIAEFNDTAVDLPPTTLADLFSAQAVRTPDYP
                     AVFFEGTELTYSEFDRRVDALAHRLIDSGVGPDTVVGLAMNRSIELLAGMYAVLRAGG
                     AYLPIDLGHPADRLAYVLETARPVCVLTTSPDGFTAENVPVIEIDTLDLTGSPRGPVT
                     DAHRRAPLRPENTAYLIFTSGSTGRPKGVAVSHAAIANQLRWKQHEYPLDTTDAVVQK
                     TPVTFDLSVWELFWPLMSGARLVISRPDGHRDPAYLADLMRQQRVTTAHFVPSLLEAF
                     IPDAGEQPTLRRVLCIGEALPVDTAARFRSRFASVALHNLYGPTEAAVSVTAWTHTDV
                     DTDTVPIGGPEWNTQAFVLDARLNPVPVGVAGELYLAGDQLARGYVARTDLTAERFVA
                     NPFGAPGARLYRTGDVVRWRIRGTTGVLEYLERSDFQVKVRGFRIELGEIESALIRSA
                     GVGQAVVVAHRNPHTGTALVAYVVPEDGSTVDPTAVLADVGAAVPSYMVPAALVVLAE
                     LPLTANGKLDRKALPAPDFASAAAEYRAPATPTEEIVAAVYADVLGVEQVGTAANFFD
                     LGGNSLVATRVVARLSETLGRRVEIRSLFEAPAVGALAALLDSTDATAPTRPALTPAV
                     RPELLPLSSAQQRMWFLNRFDPDSAVHNIPVAVRLSGVLDVDALQHAVADVLHRHESL
                     RTIYPDSADGPHQVILSTDRVGAETSVDAADEAALPALIADLVTTGFDVTAEVPVRVR
                     IFRISATEHVLAVVVHHISGDGWSMAPMVRDVMAAYSARSAGTSPDWAPLPVQYADYA
                     LWQRDLLGDETDPDSVAARQLAFWTQTLAGAPDQLDLPTDRPRPAVASYRGGTVDFTV
                     PADLHGTVVGAARDANASVFMVVHSALAVLLSRLAGSGDISIGTPVAGRGERELDDLI
                     GMFVNTLVLRQHVDGGRTFAELLADVRETDLAAFSHADVPFERLVEVVNPSRSTGRHP
                     LFQVMLTFQNLDQESLELGDLSVSGVDLDVDIAKFDLQLTLMEQFDSEGGPDGIAARL
                     TYAADLFDEPSAHVFGQRFLQVLRAAVDGPDTAVGDLDVLGRGERKQIAGTNATAHPV
                     LAGTLASLFDTAVAADPDRIAVVFDRDELTYANFDARVNRLARRLIEQGVGPESVVAV
                     AMRRSIDLLVGIYAVVKAGGAYLPIDPDHPVERTAYVLDTARPACVLVSGAGLADSGS
                     VPVVDIASEDLSRYGSAPVTDRDRLRPLTAANTAYVIFTSGSTGRPKGVAVTHGAIVN
                     RLLWMQHEYALTSADVVLQKTPVTFDVSVWELFWPLQVGASMVIAAPDGHRDPRYLTG
                     LVQERHVTTMHFVPSMLSVFTAEPAVAVCDSLRLVFCSGEALTPEQVSRFRGVSGAGL
                     HNLYGPTEAAVDVTFWETGESDTHSVPIGRPVWNTQVHVLDARLHPVPNGVAGELYLA
                     GEQLARGYLGRVDLTSDRFVANPFVAGGRMYRTGDLVRRRGDGALEYLGRTDFQVKLR
                     GQRIELGEIESALEAHPDVVQAVVVVHRDERGDEALVAYLVGRRAAEWSDVRAHLSTR
                     VPSYMIPARVVHLDTLPLSVNGKLDRKALPAPEVRSAAAEYQPPRSAAERAVATVFGE
                     VLEIDRVGATDSFFDLGGNSLIATRVAAALGSELGIDFPLQWMFSDPTPRSLGQRIQN
                     AAIDGVPGAGASLDVLLPIRTRGTAEPVFCVHPFIGLAWSYAGLSRELTEDRPIYGLQ
                     SPALTEAEPHPGTITDFADRYVREIRSIQPHGPYHLVGWSLGGVIAHEMAVQLQEAGE
                     EVRLLGLLDSYVGLDRSVENTATTADLLGGAGLDLPEDGVLDELSPDGQFDAERAAAL
                     LRVVGGPLAALTAPELDRIYRNAQQAPDLIDAHRPRVFDGELVFFTAALDDGFHVDPV
                     TCWGPYVRGRIDEHPVDATHWTMTTPDALAAIAPHLARTQRRPRHAAPDPGRDTDPDD
                     SANRPHSVR"
     CDS             complement(282037..282765)
                     /codon_start=1
                     /EC_number="2.4.1.-"
                     /gene="ppm1"
                     /locus_tag="ROP_02620"
                     /product="putative polyprenol-phosphate
                     mannosyltransferase"
                     /protein_id="BAH48509.1"
                     /transl_table=11
                     /translation="MIIPTYDERENLGLIVRRLHAALPRTHVLVVDDGSPDGTGDVAD
                     ALASNDDAGRIHVMHRTEKNGLGAAYIAGFRWGLDRDYTVLVEMDADGSHAPEQLHRL
                     LDQVDAGADLVLGSRYVPGGTVVNWPKHREWLSRGGNIYSRLALGVKIKDITGGYRAY
                     RREVLEKLDLAAVESHGYCFQVDLAWRAIQEGFTVREVPITFTEREIGESKMSGGIVR
                     EALLKVTQWGLRNRLARIKGVAAR"
     CDS             complement(282746..284449)
                     /codon_start=1
                     /EC_number="2.3.1.-"
                     /gene="ppm2"
                     /locus_tag="ROP_02630"
                     /product="apolipoprotein N-acyltransferase"
                     /protein_id="BAH48510.1"
                     /transl_table=11
                     /translation="MSGSATARWTTGKRGVLLRSVLSVAAGFLVFAGFPPRPLWFLAP
                     LGIALLTLILTGAGGAAPRLRAGFGYAYLAGLGLLVPLLPWIGVFVGALPWLALAAVE
                     SLFIGLFGTLAVLVSRLRWAPLWIAACWSLTEWLRASVPFGGFPWGRLAFGQSEGWFL
                     PLASIGGSPLLSFAVALTGAGLASVAVTVRARASGAANWARPLAGGLVAALAATVASL
                     ALWPTLPDMDSGDRTITVAAIQGSVPKLGLDFNDQRKRVLDNHVNRTLELADDVASGA
                     APQPELVVWPENASDIDPLRNADAGADISRASEAIGAPILVGAVLVNADRTTTNSVIV
                     WDGNSGPQERHDKKIIQPFGEYLPYRGFFRHFSSYADRAGNFVPGDGDGVVHANGIAV
                     GVATCYEVAFDRAFEQSVRSGAELLAVPTNNATFGDTEMTYQQLAMSKVRAVEHGRAV
                     VVAATSGVSAIIGPDGSTVQQTPLFVPAALVSQVPLSTGTTLASRLGPIPEVLLCLAA
                     VAAVAFAVVQRRRTDRTPISSSTEKAPAVAGREDPHGIGDRFRAERGTERTDSGDHSD
                     V"
     CDS             complement(284439..286037)
                     /codon_start=1
                     /locus_tag="ROP_02640"
                     /product="hypothetical protein"
                     /protein_id="BAH48511.1"
                     /transl_table=11
                     /translation="MTTQLLVGGRIYSSFAPDATSMAVTDGLVSWVGDDRAARALHPG
                     AEVVDLGGAFVTPAFVDTHVHVTALGLNIVGLDLVGVGSLRECLDRLASFARTHSDAV
                     IWGHGWDESAWPEGTGPTTAQLDEAAPGRTVYLSRIDVHSAVCSTALRRSVPGLSEAS
                     GFSSEGPLTFEAHHAARTVARSLLTAEQRSAARVAALDAIASRGIVAVHECGGPDIAG
                     LDDFRELLATAHGVEVRGYWGEAVTDADEARKLLDTAGAHALGGDLFIDGSLGSHTAW
                     LSAPYADLDGGTGKSYLGVDEIAAHVRACTIAGIQAGFHVIGDAAVRAAVDAFAVVAD
                     ELGGPAVAAAGHRLEHAEMMTGDDAARLAQWGVIASVQPAFDALWGGTDGLYAQRLGT
                     ERALTLNPFAAAASAGVSLALSSDAPVTPVEPWAMLRAAVHHRTPGSGISPRAAFSAA
                     TRGAWRAGGVRDGLAGTLAPGAPASYAVWDAGELVVSAPKDSVQRWSTDPRSRVPALP
                     RLEDDAPTPVLLRSVHRGSVVHER"
     CDS             complement(286056..286562)
                     /codon_start=1
                     /locus_tag="ROP_02650"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH48512.1"
                     /transl_table=11
                     /translation="MYAALFLLYVVVEIAALVLVGHAIGAVWTVLLLLGGTLIGLLLM
                     RSQWRRVMDGLRRAAGGDGSPGAAVADGALVALGSALMFVPGLVTSVLGLLFLIPPTR
                     WALRPVVVLLAGRRAATVAAGAEAFARAPRRGRGEVIEGEVVDEFFEGEVIDEEHRTP
                     TRDPRVLP"
     CDS             286766..287383
                     /codon_start=1
                     /locus_tag="ROP_02660"
                     /product="hypothetical protein"
                     /protein_id="BAH48513.1"
                     /transl_table=11
                     /translation="MTRSTVFRRAAIVLASAAALGMLSSGPASAAPVADFAKGAAELQ
                     ALATEVSPAATAAVDALLGASVFIPKDVLEVGLTTPQDFMYPSPTLGCGVADKPATVT
                     LASAQGGPNLFPQISATQLRFQAIPAYVAIPQSSELSVAWINLTTFQGGIVKLDDKLP
                     IINTPLLSKIVDTGKGTVLATMFGTVGYADAVTCTVVPTVGTFTV"
     CDS             complement(287411..288070)
                     /codon_start=1
                     /locus_tag="ROP_02670"
                     /product="putative NarL family two-component response
                     regulator"
                     /protein_id="BAH48514.1"
                     /transl_table=11
                     /translation="MPITVLLVDDQELMRMGLNMVLDAQDDITVVGEASDGAAAVAAV
                     RKLEPDVVLMDVRMPVVDGVSATAQILESGVASRVLVMTTFDLDEHAMGALRAGASGF
                     LLKDTPSEDLVSAIRSVAAGDAVVSPKVTRRLLSRFLDDGPAPLRDPEVLDVLTERER
                     EVLQLVATGLSNTEIAAQLFLSESTIKSHVGRILTKLNVRDRVQAVVLAYETGLVRPG
                     S"
     CDS             288248..288676
                     /codon_start=1
                     /locus_tag="ROP_02680"
                     /product="hypothetical protein"
                     /protein_id="BAH48515.1"
                     /transl_table=11
                     /translation="MRISDVLRNKGPAVVTVDPEMSVSTLIGELARHNVGALVVTEND
                     AVVGIVTERDVVRRIHERGPDILNARVVDIMTTSVFACLPTDTVDSLAETMTERRIRH
                     LPVIVDGQLVGIVSIGDVVKSRIGELQTERDQLESYIDHG"
     CDS             288688..288972
                     /codon_start=1
                     /locus_tag="ROP_02690"
                     /product="hypothetical protein"
                     /protein_id="BAH48516.1"
                     /transl_table=11
                     /translation="MPLFVVEYTYSPETSALRDDHRTQHRAWLTELLRRKIMRSSGPL
                     ASGHGALFIVDAEDEDAVARLFAHDPFAEEKLVANVQIREWAPAMGEFSE"
     CDS             289150..290763
                     /codon_start=1
                     /locus_tag="ROP_02700"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH48517.1"
                     /transl_table=11
                     /translation="MVFGFGGCAAPPPALYDVAVSTGLLNPPLDRSTPPPVENPYRAP
                     AILAASGAVVAAVLFWVVSGSLTDDAYISLSAARNLAVHGEWAIVHGLTANTSTSPLN
                     VLVLGALTFLTRLWGPGDPLLALGMLNVAVTALLGWVLARIGRRLGLGTFWAALAGAL
                     VVFNPFVLSAVGLEVLLIPAAVAVMVWFALDGRAAWFGAAAGMAALVRLDLLVFVLVI
                     AALSPAIRGQVRRALGGFAAIAGPWYLFSWLVLGSALPDTFLIKQGQASDVGGYNYLT
                     GPIMYFESNPWRTVAAFGPAALGLVLLLLALFSYARYRTRPLSVPGAVLALGLSGALY
                     YVAYVVLDTVPYHWYYVAPATTLAMFAVLAAGIHWTAARNTTDRAAVGALAGLLAVLG
                     AGAVYFDVEGGLPWEAPPIFGNWASAQDYERVGRAVGTLVGDAPVRSPGEIGTLAYFC
                     ECVIVDEFSDRGLVVEDRLVPRLAEASEPARTLLRANYAFFDYRLAPVNPAFDLRYGE
                     GRGPGGPMSWEVFSAARGVGHFTLVPLAG"
     CDS             complement(290874..291620)
                     /codon_start=1
                     /locus_tag="ROP_02710"
                     /product="hypothetical protein"
                     /protein_id="BAH48518.1"
                     /transl_table=11
                     /translation="MSEHTHELTPTPRGPVCCVHVHGAAAYRVGYPPTSWEWTPWEFA
                     TDGRFTGRWDDPAGVWRTLYVGATRLSCYLEVLAYARKSDELSTALDEIVDNDGDDEW
                     PTIAPGRVPRSWMAARITGSGVISGWFVVPGDAETMATLRIGFRALAIRLGLADLDTA
                     AIRDGRPRVLTQAISQWINTLTGPDGEPVAGVQFDSRHGDGLVLWALYERPGDRRVSS
                     RVTPLEYGPVRENDPDLIEAMRLHNLVWED"
     CDS             complement(291617..292009)
                     /codon_start=1
                     /locus_tag="ROP_02720"
                     /product="hypothetical protein"
                     /protein_id="BAH48519.1"
                     /transl_table=11
                     /translation="MTTAHPRPDLAAYNDAARMTQSQLVTELRALLGAKLVAYLGKVK
                     ETRAVRQWADGTRTINNDTDVERLRIAYRAARLIAERDTSAVAQTWFQGLNPILDDQP
                     PALLLREGDLNDVGPKVLAAARQFAAVG"
     CDS             292382..293845
                     /codon_start=1
                     /EC_number="1.2.1.12"
                     /locus_tag="ROP_02730"
                     /product="putative glyceraldehyde-3-phosphate
                     dehydrogenase"
                     /protein_id="BAH48520.1"
                     /transl_table=11
                     /translation="MSTAELTQWNSEEALAEAMIPIIGGLHRRHSVTILLHSRSLVNK
                     SVIKILRTHRFARQIRGDELSVEETFPFLEALTSLDLRPSKIDLGLLVTAYHAHGGGA
                     PIPEFVAESLADLVGGAHTSPAQPQDVVLYGFGRIGRLVARLLIEKSGSGNGLNLRAV
                     VVRKGGKDDLVKRASLLRRDSVHGQFNGTIKVDDENNALIANGNVIKFIYSNDPTTVD
                     YTEYGIDNAILIDNTGIWRDRDGLSQHLRPGVAKVVLTAPGKGDVPNIVHGVNHRDID
                     PNERIVSCASCTTNAIVPPLKTMDDEFGVVRGHVETVHSFTNDQNLLDNFHKADRRGR
                     SAPFNLVLTETGAASAIAKALPDLKAKITGNSIRVPTPDVSVAILNLQLHREATKDEV
                     LEHLRQESLTGALSRNLDYTAATDAVSSDFIGSRAACIVDANAAIVDGDTAILYVWYD
                     NEFGYSCQVVRTVQYLSGVEYPIYPTVDAAAVAGAIA"
     CDS             293973..294377
                     /codon_start=1
                     /locus_tag="ROP_02740"
                     /product="hypothetical protein"
                     /protein_id="BAH48521.1"
                     /transl_table=11
                     /translation="MGDNRPFGFDPDDLDRVIREAGEELQGVKDRIVRFLEQADSQIP
                     WTGVFADFARPPRAAPKPETTGETGDGVWAIYTVDGDGVARVEQVYATELDALRAHKH
                     NIDPHRSVRFLPYGVTVSVLDQQEESTPRETE"
     CDS             294628..295134
                     /codon_start=1
                     /locus_tag="ROP_02750"
                     /product="hypothetical protein"
                     /protein_id="BAH48522.1"
                     /transl_table=11
                     /translation="MSGTDPPPLVVVPPGSGHTGDLGPIGVEFKLWGRDTGGVLSVVE
                     HPFPVGALVPPHLHTREDEFSIVTQGAIGFRSGDREAVLESGGYITKPRGEMHAMWNA
                     GTVPARMIEIISPAGFEHCFLEMSELIAAGGPDVTQIAAVAERYGLQFGEPDWLPDVI
                     ARYSLTPP"
     CDS             295445..295885
                     /codon_start=1
                     /locus_tag="ROP_02760"
                     /product="hypothetical protein"
                     /protein_id="BAH48523.1"
                     /transl_table=11
                     /translation="MAHVQRFDHIGITVADLDSATAFFVGLGLEVEGTGSVEGEFVET
                     VCGIPGAHCEIAMLRPPGGGSRLELSAFVTPDHVPGSPTAMANELGLRNVSFEVRDLQ
                     AAVDAVAADGYGLIGGIGEYENSVRMAYVRGPEGIIVSLFEQIG"
     CDS             complement(296134..297174)
                     /codon_start=1
                     /locus_tag="ROP_02770"
                     /product="hypothetical protein"
                     /protein_id="BAH48524.1"
                     /transl_table=11
                     /translation="MDPSAAPAVKVTHGAPAVMDTAPVMLTKRTCFSAISMVILAVAG
                     LLVATPGNSAAAPPAWRYTMVAFSNTSDRDMDVYESGDGTGFQPVGLSAFRPPSGLVR
                     DPSIFRNADGLYYLTYTTGGGANIGFARSSDRINWTPLGNYPVPFCCALMPGTGDGTG
                     SASPPGFSGSAGFRDGPSLSPFVTKAWAPEWFVDGDRVNVILSLSTGGGFVPYLMTAL
                     EPSLRLWSPPVPLAGIGADHIDTTVVKVGATYHAFTKNETKKVVEHAVASSVTGPYSF
                     VPAGNWGSLVEGPALAQLPNGAWRIYLDAYTEGKYLYSDSTDGLRTWSPVQELPGLSG
                     TARHFGVMTEPA"
     CDS             complement(297356..298519)
                     /codon_start=1
                     /EC_number="2.7.13.-"
                     /locus_tag="ROP_02780"
                     /product="putative two-component histidine kinase"
                     /protein_id="BAH48525.1"
                     /transl_table=11
                     /translation="MRRFSLWLRGKPTVADSMLAAILFTLEVFVFTASGDRSPWVQLV
                     LGFLLCLPIAWRRKYPRAAAGAVLVMSITITFISYSIGDLDAEHPGLLALAVSLYTLV
                     AYVDRRTAAVYAVGLVVDSALSIWLLEQELLAAGLFSVLVFALSWITAEFLGARRAYD
                     EEVAARLVVADYDRDRRAEDAVAAERTRIARELHDVVAHAVSVMIVQADGASYALTSN
                     PDIAKQALTNIASTGREALAELRRTVSLLRTEPATDDMPQHGTAGLARVVDMMRSAGL
                     PVELELTGELDDISPAVSLGVHRLVQESLTNVLRHAGERPRAKVRVRRRETDVLVEIT
                     DNGNSSGQFSLGSGNGLLGMRERVAVLHGTLEAGRQTDGSWRVTAELPLELED"
     CDS             298566..299333
                     /codon_start=1
                     /locus_tag="ROP_02790"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH48526.1"
                     /transl_table=11
                     /translation="MNAGDWALLLTAATAAGWVDAVVGGGGLILIPALFLVAPQLTPQ
                     AALATNKLTAFTGTSAAVVTFARRIPMNWRLLVPAGLLAAVASALGAATVSRIDKDVF
                     IPLIMAVLVGVAVFVTIRPQLGTTLAKDPPTRRKVVAVVLLSAGLLGFYDGLFGPGTG
                     TFLIISFATFLGTEFVRSAAMAKVINLGSNLGALVFFAATGHVLWALGLSMAVCNVIG
                     AVTGSRMALSKGAGFVRITLLIVVIAMVIRLGWQQFG"
     CDS             299356..300876
                     /codon_start=1
                     /locus_tag="ROP_02800"
                     /product="TldD/PmbA family protein"
                     /protein_id="BAH48527.1"
                     /transl_table=11
                     /translation="MTAPRQVDPEFLALPLRSLADAALTAARAAGASHADLRVHRLAS
                     QSLRLRDGEVQSAVDTDELGFAVRVVVDGTWGFASHAELTPATAAATAEQAVAVARAL
                     RGLNREHVELADEPVYSDVHWVSDYDLDPFEVAASEKISLLGEYSRRLLASDGVDHVT
                     AGCLQVKEQTFYADLAGSSIVQQRVRLHPQLEATTVDQSAGVFETMRTLAPPVGRGWE
                     YVAGDGVWNWTDELTRIPDLLAEKVKAPSVVAGPTDLVIDPTNLWLTIHESIGHATEY
                     DRAIGYEAAYAGTSFATPDKLGTLRYGTPIMRVTADRTERHGLATVGYDDDGVETQSW
                     DLVADGILVGYQLDRAFAPRLGLARSNGCSYADSPHHVPIQRMANVSLQPDPDTDRST
                     DDLISGVEDGIYVVGDKSWSIDMQRYNFQFTGQRFYRIRGGRLDGQLRDVAYQATTTD
                     FWGSMDAVGGRSTWQLGGAFNCGKAQPGQVAAVSHGCPSALFRGVNVLNTRTEGGR"
     CDS             300873..302234
                     /codon_start=1
                     /locus_tag="ROP_02810"
                     /product="hypothetical protein"
                     /protein_id="BAH48528.1"
                     /transl_table=11
                     /translation="MIAPQQLVEQVLARATVDETIVIVTDASEASLRWAGNSMTTNGV
                     STSRSWTVISIVRSGQDAKVGIVTSASVDAADIDGVVRSAEISARAATPASDAMPLLT
                     GTGTDERWEDSAQRTEIGAFEQLAQDLSMGFDGDDQLYGFAHHQLHTTWLGTSTGIRR
                     RFVQPTGSVEINGKRGDASAWVGTSTKDFTDVAGVKLLQDLSTRLDWAGNRVELPAGR
                     YETILPPSAVADLMIYLMWTMEGRAAEEGHSALSAPGGTRIGEKLSALPLSLYSDPAA
                     LGLEYAPFVIAGASSESVSVFDNGMDAGRVDWIRDGTVGALAYPRSAAKEFGAEATVP
                     GDNLILDAGGSVSLDQMVAETERGLLLTTLWYIREVDPATLLLTGLTRDGVYLVENGK
                     VTGAVNNFRFNESPLDLLRRVTQAGATERTLPREWKDWFTRTAMPSVRVPDFHMSSVS
                     KAL"
     CDS             302454..302660
                     /codon_start=1
                     /locus_tag="ROP_02820"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH48529.1"
                     /transl_table=11
                     /translation="MHSDTRIRETLHGHTKVTGRFALADVALTTFVCLVCATGIGIIT
                     GSVLAAATGGLIVVLATALMVAAV"
     CDS             302657..303004
                     /codon_start=1
                     /locus_tag="ROP_02830"
                     /product="hypothetical protein"
                     /protein_id="BAH48530.1"
                     /transl_table=11
                     /translation="MTAPSTQRSTTIQEITVSNDVLEAAPPAHSIPHRHPDGREVLAT
                     AKGILIATRGYGDAEAFDELLDVSRHHHVSVLRAAKSLVELATRRQTCPSVTTPAPSY
                     ALEFTEWTTLLAR"
     CDS             complement(302973..304160)
                     /codon_start=1
                     /locus_tag="ROP_02840"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH48531.1"
                     /transl_table=11
                     /translation="MTSQLSSSHRYAALDVMRGAAILGTLATNIWIFTNVEGLVGYVN
                     GTGKATGGWAPVQVVLQQFAQGKFLGLLTVMFGIGLVIQQRSAERRGQRWPGGYPWRA
                     ALLMLDGALHFLLFTEFDVLTGYALTGLIVAFILTAGIRAQRTWIVCAVAVHAAMLAL
                     LVAALYSAPAREPQPLSPNPYADGSFWDLIVFRADNVLLFRLEVLFILPLSIALFLVG
                     ARLYGARVLDPDRGVLRRRLMVAGLAIALPLDLALGLFGGDAGLILGRYGTAPIVALG
                     LLAAIAHRYADGRAPGAPGRALSGVGRAALSCYVLQNILCSIVCYGWGFGLAARLDGT
                     TVVPATIALFGAVSATLIVVSRLWLRRFDRGPLEWLTHRAYQRLTRADRDGVTAPAAS
                     SIP"
     CDS             304240..304824
                     /codon_start=1
                     /locus_tag="ROP_02850"
                     /product="putative TetR family transcriptional regulator"
                     /protein_id="BAH48532.1"
                     /transl_table=11
                     /translation="MPKLIDHDRRQQEIAEAVWRVIQREGIGAVSVRDVAAEAGISSG
                     SLRHVFASKAELLAYSMRLVATRVRERAQAHASITDPWQRALAVLDEVLPLDDRRRCE
                     MEVNLALVAESPAHPLLKDIALDAQRQLRGACAAILTGLAKRGLLAPDIDVDTEAMRL
                     HALVDGAAMHVLLGDTDTPETAQRMIAEHLRALA"
     CDS             complement(304882..305535)
                     /codon_start=1
                     /locus_tag="ROP_02860"
                     /product="hypothetical protein"
                     /protein_id="BAH48533.1"
                     /transl_table=11
                     /translation="MPSETRHSEGRPYVVAHVAVALDGATTGFEPDVGRFYELAATWR
                     EDVTLVGADTIVAQEQALAAAPRPGPVGDGPLLAVVDSRGRVGDWVWDALRDAGHWSE
                     VLALHAEATPPRGDGRSVHELVTGTERVDLAAALKILGRRAGVEVVRVDSGGALLGAL
                     LGAGLLDEVSLLVHPCLPGVRNNRLWHGTAPAAIRFDLIASRAFDDGVVWLRYQPVR"
     CDS             complement(305572..305796)
                     /codon_start=1
                     /locus_tag="ROP_02870"
                     /product="hypothetical protein"
                     /protein_id="BAH48534.1"
                     /transl_table=11
                     /translation="MSPEQAHLIDVDRAFFIGDAADRAALEADPMFTSLPIYRDGRVT
                     FFADSEDPPVGAALSQSTILSLPYAIDQVL"
     CDS             complement(305803..306606)
                     /codon_start=1
                     /locus_tag="ROP_02880"
                     /product="putative iron-siderophore binding protein"
                     /protein_id="BAH48535.1"
                     /transl_table=11
                     /translation="MPTEHDLSAVRGFIRIRRERSAAVTFVALLLGVWLLAACGSATG
                     ERDSGAAPGDTYTVEHVYGTTEVPRDYERVVSVGYTDDQTMLAVGVKPVGMVDQYPAG
                     GSPDRNISWPWVEDLWAGTVPEVVMTNGESLNFEKVAALQPDLIVGVYSDITEGDYQR
                     LSAIAPTVAWAPDVADPFVAPWQDTARQIAKALGKEDEAEAAITEITDGMAQAVADHP
                     EFGGRRAVAFSWYDASLAPFASTDVRGKLLTDLGYRPVAEIDQAAGDKF"
     CDS             complement(306683..308050)
                     /codon_start=1
                     /locus_tag="ROP_02890"
                     /product="hypothetical protein"
                     /protein_id="BAH48536.1"
                     /transl_table=11
                     /translation="MNVPRRDAHAVVIGGSIAGLLASRVLADYFDTVTIFEKDHLVDS
                     AEPRMGVPQGRHVHSIWKRGLSLMEESFPGLTSELIEGGSAEVEMTKDFAWYHRGVWK
                     LRVPSGIFITCQTRPFLEWQIRRRVCQISNIDLVDHCHVKRFVTDATAQRITGVAVQS
                     RRAGATEETVSADLVVDASGRGSRTPRWLEELGYGRPDMSVIDVDVGYATRFYARPPQ
                     EDCPWKALIVAPTPPDGTRLGVIFPVEGQRWIVMLGGWNGDHPPRDEDGLLEFARNLE
                     APDIYTFMREAEPLTPIAGYKFRANVRRHYERMRRFPGGLIVLGDSLCSFNPIYGQGM
                     TTSALDAMTLRECLDRAVHRGESLDAMAHHFLKRVPRRLDAPWRLAAGEDMNWPGTQG
                     DAPFGTPFMNWYFGRVHALAARDPQVLVRFVRVANMIDSPVRIFHPRVLAPVLTRSTR
                     VAPSP"
     CDS             complement(308247..308642)
                     /codon_start=1
                     /locus_tag="ROP_02900"
                     /product="hypothetical protein"
                     /protein_id="BAH48537.1"
                     /transl_table=11
                     /translation="MGRVTTEFDRVSSAKYVLLTTFRKDGTPVATPLWAAADGDRLLM
                     WTVTDSYKVKRIRRNPEVTVAACDARGKPKGPEVPARAVILDVADTDHTRDVIARKYG
                     ILGWLTMKGSLLRRGKTGTIGLAVTADDR"
     CDS             complement(308660..312262)
                     /codon_start=1
                     /EC_number="6.6.1.2"
                     /gene="cobN"
                     /locus_tag="ROP_02910"
                     /note="protein synonym:cobalamin biosynthesis protein"
                     /note="protein synonym:hydrogenobyrinic acid a,c-diamide
                     cobaltochelatase"
                     /product="cobaltochelatase CobN subunit"
                     /protein_id="BAH48538.1"
                     /transl_table=11
                     /translation="MILLLSTSDTDLLSARASGADYRWANPARLLVEEDLPGLLDGAD
                     LVVVRILGGKRAWEEGLDAVLASGLPVVVLGGEHAPDAELMECSTVAAGVSAEAHNYL
                     AEGGADNLAQLHHFLSDTVLLTGHGFEAPVHLPSWGVAPFAPDADAGRPTIAVLYYRA
                     QHLAGNTRYIEALCDAVEAAGGTPLPIFCASLRTAEPELLTTLRRADAMVVTVLAAGG
                     TKPAGVSAGGDDEAWDVAALAALDVPILQGLCLTSSRESWEANDDGLSPLDVATQVAV
                     PEFDGRLITVPFSFKEIDADGLSTYVPDAERASRVAGIAVRHARLRHIPAAERRIALM
                     LSAYPTKHARIGNAVGLDTPASAIRLLTEMRAAGYDLGPADGPDSVPGLAARDGDALI
                     HALIAAGGQDPDWLTAEQLEGNPIRISAARYREWFSALPAELREGVEEHWGPAPGELY
                     VDRSQDPAGEIVIAAMQFGNLVLMVQPPRGFGEKPVAIYHDPDLPPSHHYLAAYRWIA
                     ADAAAGGFGADAVVHLGKHGNLEWLPGKTLGMSASCGTDAALGDLPLIYPFLVNDPGE
                     GTQAKRRAHATLVDHLIPPMARAESYGDISRLEQLLDEHSNISALDPSKLPAIRQQIW
                     TLMRAAKMDHDLGLEERPEEDVFDDMLLHVDGWLCEIKDVQIRDGLHVLGEAPRDDAE
                     VELVLAMLRARQMWGGEQNVPGLREALGLSEDGDESRTRVDEIEQQAHALVQGMHDAD
                     WNPDAADTLTADATVAKILRFAATEVVPRLRETDNEIAQVLHALDGGFIAAGPSGSPL
                     RGLINVLPTGRNFYSVDPKAVPSRLAWETGQAMAESLLDRYKSDHGEWPRSVGLSVWG
                     TSAMRTSGDDIAEVFALLGVRPVWDEASRRVVNLEVIDLEELGRPRIDVTVRISGFFR
                     DAFPHVLALLDDAVRLVAAVDEPAESNFVRAHAQADLAEHGDERRATTRIFGSKPGTY
                     GAGLLQLIDSKSWRGDADLADVYTTWGGFAYGRGLDGAPAADDMRTAYRRITVAAKNT
                     DTREHDIADADDYFQYHGGMVATVRALTGKSPEAYIGDSTRPESVRTRTLSEETSRVF
                     RARVVNPRWLEAMRRHGYKGAFEMAATVDYLFGYDATTNVVADWMYEKLAESYVLDEQ
                     NRKFMEQSNPWALHGIAERLLEAAERDMWEHPEQQTLDGLRQVYLETEGELEGD"
     CDS             312468..313601
                     /codon_start=1
                     /EC_number="1.14.13.83"
                     /gene="cobG"
                     /locus_tag="ROP_02920"
                     /product="putative precorrin-3B synthase"
                     /protein_id="BAH48539.1"
                     /transl_table=11
                     /translation="MVDSRSRPDACPGALQVHQAADGALARVRLPGGVLTSTQLQTLA
                     ESARDLGNGEIELTSRGNAQLRAVRDPLEFARRLAGAGLLPSETHERVRNILVSPLTG
                     RIGGLTDLRDLVGVLDRSLCGDAALADLPGRTLFTLDDGRGDVSALGGDFGVHAVSES
                     EVALILAGRDSGVRIPTSDSAHVLVGAARAFLELRDRHWRLSEIADGVERTLSALTLA
                     PTADPVRGFDEHRPPIGWLDQPDGNVTLGGGLAFGVLDARLAEFLAAVEKPVIVTPWK
                     SVLLCDLDEWSAEQVVRVLAPMGLIFDENSPWLNVSACTGQPGCEKALADVRTDARDA
                     VASGELPVEGRQHWSGCERCCGRPKGEVTDVVATETGYRVEER"
     CDS             313626..314252
                     /codon_start=1
                     /EC_number="5.4.1.2"
                     /gene="cobH"
                     /locus_tag="ROP_02930"
                     /note="protein synonym:precorrin isomerase"
                     /product="precorrin-8X methylmutase"
                     /protein_id="BAH48540.1"
                     /transl_table=11
                     /translation="MIEYIRDGAEIYRQSFATIRAEADLSAFPEDVSQAVVRMIHASG
                     QVDLVDDVAFTPGVVKAARAALADGAPILCDAQMVAAGVTRKRLPADNEVICTLRDPR
                     VPVLAEQIGNTRSAAALELWGGKLEGAVVAIGNAPTALFYLLDMIESGAPRPAAIVGG
                     PVGFIGAAESKEALIEHPSGLDYLVVRGRRGGSAITAAALNAIASEVE"
     CDS             314249..315751
                     /codon_start=1
                     /EC_number="2.1.1.130"
                     /EC_number="2.1.1.131"
                     /gene="cobIJ"
                     /locus_tag="ROP_02940"
                     /note="bifunctional protein"
                     /note="protein synonym:cobalamin biosynthesis protein
                     CobIJ"
                     /product="precorrin-2
                     C(20)-methyltransferase/precorrin-3B
                     C(17)-methyltransferase"
                     /protein_id="BAH48541.1"
                     /transl_table=11
                     /translation="MSSEERSTGKLWGVGIGPGDPELVTVKAARIITEADVVAFHSAR
                     HGKSISRAVAAPYLRDGQIEEHLVYPVTTETVDHPGGYQGAMDEFYEEASQRLAAHLE
                     AGRSVALLAAGDPLFYSSYMHMHKRLAQRFEAEVIPGVTSISAASAALAMPLVEGEEI
                     LTVLPGTLPRGELTRRLRETDAAAILKLGRTYPAVRQALKDSGRIDETWYVERASTTR
                     QKIDHADDVSDSDVPYFSIAIVPSPSNARREDAPPQGELVVVGLGPGDQSWTTPEVQH
                     ELSLATDLVGYGPYIDRVPERPGQRRHSSDNRVEAERAAMALDLAKNGARVAVVSSGD
                     PGVFAMAAAVLEVAAEEQWRGVPVRVLPGMTAANAVASRVGAPLGHDYAVLSLSDRLK
                     PWDVVAQRISAVASADMAFAVYNPASKSRTWQVAAMRDLVLEHRSPDTPVIIGRDVAG
                     PQESVRVVRLADLDPAEIDMRCLLIVGSSMTTVVENEHGTRVFTPRRYPG"
     CDS             complement(315768..316664)
                     /codon_start=1
                     /locus_tag="ROP_02950"
                     /product="hypothetical protein"
                     /protein_id="BAH48542.1"
                     /transl_table=11
                     /translation="MTSAEKRIRDVFADAGCTGWLHARRVGTPAGEVGVGADDLVVLA
                     SVYKLPLLVALCRAFESGELSPTATVRVNPADCTPGPTGVSTFRDPVVLSWRDLALSM
                     MTVSDNAAADLVLGQVGLESVERALSDLGLTNTRIIGGTADAHHRLVIDAHAHTTAEA
                     FAALADNDEAWTVSAYDPSYASATTPREMTSLLDAIWAGRAVPGAQGGFVRQVMSAQI
                     WQHRIRSGFPHSGVDVAGKTGTIGAIRNEVAVVTFPGEIPVAVAVFTRAARTDPVLPV
                     VDAAIGHAARIAVTELRSGSVD"
     CDS             complement(316661..317554)
                     /codon_start=1
                     /locus_tag="ROP_02960"
                     /product="putative LysR family transcriptional regulator"
                     /protein_id="BAH48543.1"
                     /transl_table=11
                     /translation="MVGMDLLRHLSFFVAVAEEGHFGNAASRLGMTQPPLSQGVRRLE
                     QRLGTELIQRSARGVGLTDAGRQLLPRARLLVADAARFEDEAQRIAGGRDAVVRWGVP
                     HSVADGVVVRCVRALRDADEAHETRVVTTTASTTELVDAVRAGSLDVAVVEHPALLTG
                     LGSGPVIKLRRWVVVPDDHPVSAAKKAQVRMLRGLTLATGPRSDNPPAHDLFVDLWRV
                     RGLDPDIVIASGQRELLTRVSAGGHFGVTATPPTVMPGVAWVDLLREDLSLRVRIVWR
                     SGADVASSAAALDRVLIRADR"
     CDS             317703..318656
                     /codon_start=1
                     /EC_number="3.5.2.6"
                     /locus_tag="ROP_02970"
                     /product="class A beta-lactamase"
                     /protein_id="BAH48544.1"
                     /transl_table=11
                     /translation="MLTHRNHPKPRRTGRRGVVALALALPLLAGACTATAEQTLPATS
                     ESTAPDHESLDAKIEALEAQYATRIGVTAVDPQTGAVYSHRGDERFAMCSTFKAYASA
                     AVLRKIEDGSTSLDKTVMIEPADLVENSPVTAAAVGTPMTLGQIAEAALTQSDNTAGN
                     YLLREIGGPQAITALARDVGDASTRLDRWETELNTAFRGDPRDTTTPTGLAHGFRALL
                     LGDALDAASRGQLLDWMRASKTSDKRMRAGLPPGWTAADKTGGGGFGTANDAGVAWSP
                     DGSPIVLAVLTDSLTNQEDAQGNSQAIADTTTAVIAGLTAP"
     CDS             complement(318631..319458)
                     /codon_start=1
                     /locus_tag="ROP_02980"
                     /product="putative hydrolase"
                     /protein_id="BAH48545.1"
                     /transl_table=11
                     /translation="MELSRTFEWRGRSVAWDRFGNGPAVVMCHGTPWSSQLWWPFAHA
                     LAAEFSVYLWDMPGYGQSSKDGAHDVDLGVQGELLADLLRHWNLDAPHVVAHDYGGAV
                     SLRAHLVHDARYASLALVDVVALRPWGSDYFRLVAGNADVFAAQPTSVHRGALEAYIA
                     GASHRGLTPAQMAVLTAPWLSEQGQVAFYRQIAQADERYTDEIQDRYTSIDLPVAVVW
                     GRDDAWIPVDRGEELARLIPGATLEVIDGAGHLIQFDAPVVLAVSLHRWLTAQSNPR"
     CDS             complement(319529..319882)
                     /codon_start=1
                     /locus_tag="ROP_02990"
                     /product="hypothetical protein"
                     /protein_id="BAH48546.1"
                     /transl_table=11
                     /translation="MNAATDRQWAVRDAVLRWLLAKVTEGYRSPILDADAIGETVGWA
                     PSPLTRDEVADASNYLYREGHVTGVPVMGIGIPRPMLTVAGRRVAKAGRSLRPANCRH
                     EVDGGHSVLETGLLQ"
     CDS             complement(320326..320688)
                     /codon_start=1
                     /locus_tag="ROP_03000"
                     /product="putative transposase orfB for insertion
                     sequence element"
                     /protein_id="BAH48547.1"
                     /transl_table=11
                     /translation="MTGANTHDSTMLQPLVAAIPGVKSRRGPRRRKPRKLRADKGYDY
                     DIHRRWLRERGIVPRIARRGIERNDRLGRYRWKIERTIAWLTGYRRMTIRYERHGEHF
                     AGFLHLAAALTCFKKLPT"
     CDS             complement(320775..321134)
                     /codon_start=1
                     /locus_tag="ROP_03010"
                     /product="putative transposase orfA for insertion
                     sequence element"
                     /protein_id="BAH48548.1"
                     /transl_table=11
                     /translation="MVDELSLRLVPDALWEIVEPLIPPFVARPQGGGSAPADDRAVFT
                     AIVYVLTSGCAWRHLPPSFGVTVPTAHRRFSAWVRDGVFEKLHREVLDRLGSAGELDW
                     TAAILDAASVRAKRGAH"
     CDS             complement(321359..322498)
                     /codon_start=1
                     /locus_tag="ROP_03020"
                     /product="putative transposase for insertion sequence
                     element"
                     /protein_id="BAH48549.1"
                     /transl_table=11
                     /translation="MAGKVVKRAFKYRFYPTEVRADQLARTFGCTRYVYNRALAERSR
                     AWSKEGRRVSYADNSTMLTRRKREAETAWLAEPSKGPLQESLRQLQGAFDKFWRIQAR
                     YPQFKRKGRSKDSATYFSNCLTFRGGQIRLAKQSEPLDIRWSRPLPEGATPSQVTVSR
                     NARGEYHISILVEDTIPELDRTDRVVGLDAGITSLYTLSTGEKIPNPRHERRDRERLA
                     KAQRVLARKQKGSRNRAKARLKVAKIHGRIADRRRDYLHTLSTRLVRENQVIAIEDLS
                     VRNMVKNRSLSRAISDAGWSEFRSMLEYKADWYGRVVAIDRFHPSSKTCSVCGEVVSA
                     MPLKVREWTCRCGVVHDRDVNAARNILAVGLAVAACGDGVRPPRT"
     CDS             complement(322793..323206)
                     /codon_start=1
                     /locus_tag="ROP_03030"
                     /product="putative MerR family transcriptional regulator"
                     /protein_id="BAH48550.1"
                     /transl_table=11
                     /translation="MREETAHGHRRDHRRHNEDGRAPRVQRFATEFADGVGQQSVSAL
                     HYYEQLGLISSTRRSGNQRRYECHMLRRISLIVVAKRLGIPLADVGIVFETLPADRMP
                     SIRDWQRVSKLWRVQLEDQRKRIDRLEHELTGCIG"
     CDS             323261..325357
                     /codon_start=1
                     /locus_tag="ROP_03040"
                     /note="fragment"
                     /product="putative drug resistance efflux protein"
                     /protein_id="BAH48551.1"
                     /transl_table=11
                     /translation="MICAIGPSMEVLLVGRAVQGLGGGLLAGLNYAVLREALPEHLWA
                     RATALVSAMWGVGTLAGPAIGGLFAQLGQWRLAFVALAVVAAAIAVIAPRALPRTGRV
                     RGGRTRPGHVTRSAHPGDDRDQCGGDPRQPHPHADPDRSGSRLRRSVPGLGAAITAPG
                     AAAVDVPPGVVPEVDLPHHRGPRVRNRVRGLHTAVRSTARRIGAVRRGVPRRHDVGRL
                     VGDHDLQFRHLPTAGKDGGHAHRTARPRRRLAPHGGALARRRRTRRGDSVGRRAGRRR
                     CGHRTRLPAPDGRRHAEHRRRAGGRQGGGRAQHGRVDRDGCRVRGRRCAGQSRRTLDP
                     RLRETALPRSRRHRNGRRVHRVSRDPGARRSALGPRREVVRATENVVGTGELRRMPAV
                     RDAATVRPQSLDRRLGPGDVVRVGCQRGVDHGYLLVRQGQLPGHPHLAGKPSVVPHAL
                     GAVRQRRPVDRGRDPGRPAGIDEPGPGVCQRHRGSSGAGVAAIVADPEREPRDGSGAS
                     DVVHGHDGLGRFDESNHRDTWDVGGRVPHLLGRFGFREHQPAQPGQAADRVEVALPVR
                     GGCVVDPHPARIPFEPPRGATATVVLRGERQAVLEVDDQRIGAGGRRRGENLVPDRGD
                     QKPASRHRDDDLAALRCHDAHAVLSSAIPRSLRVTAGRRTRRSGVRRTCPGTASSGAA
                     PPRAVRLRSRSPRRPG"
     CDS             323562..324362
                     /codon_start=1
                     /locus_tag="ROP_03050"
                     /note="fragment"
                     /product="putative drug resistance efflux protein"
                     /protein_id="BAH48552.1"
                     /transl_table=11
                     /translation="MCAGGEPVPATSLALLTLATIAISVAGILGNRTHMLILIAVGVV
                     FVVLFLAWERRSPRRVLPRSTYRRGSSLKWIYLTIAVLASGTVSEAFTPLFGQRLAGL
                     APFAAGFLGAMMSVGWSVTMIFSSDISRPRAKTAAMLTGPLVLAAGLLLTAALWRDDA
                     GLAVVILWAGVLAAAGAGIGLAFPHLMVAAMQSTDDAQEGAKAAAGLNTVELIAMAVG
                     SAVAGVLVNLGAPSTLASARLLFLGLGVIATVGVFTAYRATREPAGRR"
     CDS             complement(324359..325195)
                     /codon_start=1
                     /locus_tag="ROP_03060"
                     /product="putative citrate lyase beta chain"
                     /protein_id="BAH48553.1"
                     /transl_table=11
                     /translation="MSIVTAQRSEIVVAMARSWLLVPAVGNEVLAAAAASGADALVID
                     LEDGLPFAAKDDGRGCAAGWLERNPGWVRINDATTPHWQRDLDAIRGLPGLRGLMLSK
                     TEAPEQVRDSAADIPGVPVVALIESAEAVVAVDDIARTAPVARLAFGIGDYCRDTGAG
                     RTPMALAYARSRLVNASRAARIAAPIDGPTLAHGAESVRDDARLAREMGMTGKLTLAN
                     EQVPVINTALAPDSDDISWAESTIERLGSDGSRVTHGGHPPQLARAHDILRRADHFAS
                     RA"
     CDS             complement(325326..325613)
                     /codon_start=1
                     /locus_tag="ROP_03070"
                     /product="hypothetical protein"
                     /protein_id="BAH48554.1"
                     /transl_table=11
                     /translation="MQKKSARRAAALAGILSAPLVLGATVGAGTASADPWHVGPVYRA
                     ETSGEGAEYFCGKAAALEQTSGVVIVPCTFDSATAVWYRVVFNPASWGFDF"
     CDS             complement(325681..326391)
                     /codon_start=1
                     /locus_tag="ROP_03080"
                     /product="putative resuscitation-promoting factor"
                     /protein_id="BAH48555.1"
                     /transl_table=11
                     /translation="MPRPQARRGLSQMTTRNMEKRTFGWIALIGAAATVLLGLGAGTA
                     LGAPHDWDEVAECESGGDWTTDTGNGFYGGLQFTPETWKANGGKGDPSEASEAEQIRV
                     AENVLKTQGPGAWPVCGQYLKKGGTAPVEVPPVTPAPAPDVVETPEVVETPDAVETPE
                     VVETPDAVETPDVVETPDLAEAPDAVETPAPVETPTTAEDPATVKAAAQEALDSARAL
                     AAQNGSSEVFEERAAAPR"
     CDS             326989..328005
                     /codon_start=1
                     /locus_tag="ROP_03090"
                     /product="putative ABC transporter substrate-binding
                     protein"
                     /protein_id="BAH48556.1"
                     /transl_table=11
                     /translation="MTPLSRLVSAAALGTVAVLALAACSEPAAADSEQAGAGTLTVYT
                     SEPQAKIDALVAAFTAETGIDVEVFRAGTGDLTARIEAERTTGTIGADVLLAADAPTF
                     EGYKTAGMLQQYTPADVNALNPDVVDPDGYYVGTRIIPTVIAYNTAAVDAPPTAWKDL
                     ADPKYRGKITLPNPDVSGAAAFNTAVWLSTPELGEGWLEALAANDPVVAESNGPVGQA
                     VAAGTQPVGIVVDYLVRELAAKGSPIALTYPTDGIPYISQPAGIFTDSDDAEAARKFV
                     DFLVSKQGQELAVEQQYLPVRGDVGTPDGAPALSDLALLTPDLQEITKIQDDAVRKFN
                     GLVG"
     CDS             327989..329656
                     /codon_start=1
                     /locus_tag="ROP_03100"
                     /product="putative ABC transporter permease protein"
                     /protein_id="BAH48557.1"
                     /transl_table=11
                     /translation="MVSSVRTVSSNAARALPGQRFDPVGAVRVALWLFAAAVIVAPLA
                     TVVSLGFGGNHIAQLIDGGIAGAATHSAVSAGLSAVFAVALATVMALLLDRTDLPGRG
                     ILRLILLSPLLIPPFVGAIAWTGLLGPSGLVNRFWAERFGGPLWNIYGGDGVVFLLTV
                     HSYPLAYLIIAAALRKVPGDLEQIARIGGASPWRAMRTVTLPLLRPALLAAFTLTAVS
                     NLADFGIPALIGLPERYVTLSTMVYRYIQSGTVDRPLEVVSTIGVVLLLLAVLAVFVD
                     RRLSRRSRQLDGPVTAPQPLPLGGGRIPVGTLAWTVGLALTGLPIFALASQALLPAPG
                     VPLAWDNLTLESIAAAVTAPGTVVGVQNSLLLAVGAGIVCAVAGLVLGVLTTRTRSRD
                     NASLDLLAMLPQAVPGLVIAVGWLIVGRYTGLFDTRWVILCAYVTAFLAIVVQAVRAP
                     LSTTPASLEEAARASGASRLRTLRDVPVAMTVPAAATGGVLVALTAVRELTMSVLLVA
                     PGTQTLGVSIFNLQQAGDYNAASALSLLVTIVGIAGLGLFAGTRAGR"
     CDS             329684..330787
                     /codon_start=1
                     /locus_tag="ROP_03110"
                     /product="putative ABC transporter ATP-binding protein"
                     /protein_id="BAH48558.1"
                     /transl_table=11
                     /translation="MSAITLTGVDLHYPDGTTGLSGVDLDVRDGEFVALVGPSGSGKT
                     TLLRTVAGFLAPTAGLVRLGDEVVADGTRAVPPDKRGLGMVFQQHAIWPHRSVGRNVA
                     YPLEVAKVPRARRAERVADVLDLVGLPGLAKRDPATLSGGQRQRVALARALVAQPRAL
                     LLDEALSALDEPLRDRLRLELRTLTRAQNLTVVHVTHDRAEALALADRVVVLDSGRIQ
                     QVGTPEELVQRPRSAFVAKFLSDASLLPGTVSEHGFSSTDGGVHVSRDRLADRSSGTG
                     ILAVLPSDIEVTSTESAGTARGIVMSSLFGRDASDVVVSCRGAKFRCAVRGTRPAVGD
                     RVGLTIRRALFYPAPSKTAPPAHGAATLAGAPR"
     CDS             complement(330811..331437)
                     /codon_start=1
                     /locus_tag="ROP_03120"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH48559.1"
                     /transl_table=11
                     /translation="MGGIGQQAAAVTSLAFVVAGLAVVAGRRRDAPTVTYGLLVVAVG
                     VGSLIQHGPDPPWQGYAHDIPIATVLAYIAVDAASDRFGRRMSPGWWLVVPLLMIPVV
                     AAGPTASTIVQALLAAVAVGLCLERARVRPELRRTTIVAAVLVASGALLGAVGDRTSI
                     CRPDCLLPGHALWHVLAAAGLWRLAPTIGRPRARQRDGGTRSPGETGR"
     CDS             331533..332267
                     /codon_start=1
                     /locus_tag="ROP_03130"
                     /product="hypothetical protein"
                     /protein_id="BAH48560.1"
                     /transl_table=11
                     /translation="MGDTAVDAVAIYHATAANRRGTPWVALDYDVEPGSRHTLLQNLA
                     GRGWRNPSPAFDGVDDLPSAVLSLHSADGRTLLIEDGTDVLFEGVVVPPHGWLEHVRM
                     LGAVGVIAGAGITAAPDWQRQLPRLARESELLGSTATVTFSSAFGREDFHAFAYEVVS
                     ALRPALPAEALHDAGFALEDDRPHRAVLEVLDSAVQHRVAVPARIVDMLERRAVDRTS
                     FGWRDARTLKRLLRKVHTDGRAPAGR"
     CDS             332390..333790
                     /codon_start=1
                     /locus_tag="ROP_03140"
                     /product="hypothetical protein"
                     /protein_id="BAH48561.1"
                     /transl_table=11
                     /translation="MSRSVPGDGSDDPGHMAYARVRAGQVNAVQAALGDHTGRLEWPR
                     EQIEHYRTARLRALLSHARERSPFHARRLRGLDPSTATVADLASLPMMTKQDAQDEWD
                     AIVTTGDLDRARAERILAEQQWFSYTPNDEQIFSSGGSSGVRGVYVWDWQFYVSAACL
                     AWRVQAREERMVPMRPSSRLAVLAAGVPPHASTPLFDVPTAPGMETVVIPAGAPFDEI
                     LAAVAAAHPTHLVGYASVIGRLARAALSGDLQVRPVRVSTNSEPLLDEDRQAIDEAWS
                     VPIHNLWGSTEIGVQAVGCGQGEGLHVCEDEVVLERVDAGGAPVAADAPAVRTLATGL
                     ANRTFPFIRYDLGDQVTLLPGTCPCGSAFVRVADIGGRRDDDFRYGTKTVPASTFRYV
                     LGADPRVSEYQVRQTVDGAEIFAVGDPDVARLTSAVAAALRRQGLSDPQVRIEVVDHL
                     QRHQASGKLQRFIALR"
     CDS             333927..334244
                     /codon_start=1
                     /EC_number="5.4.99.5"
                     /locus_tag="ROP_03150"
                     /product="putative chorismate mutase"
                     /protein_id="BAH48562.1"
                     /transl_table=11
                     /translation="MTDSDSGAVTEDATGAVSDGTDLIRVHAEIARLDAEILDAVNRR
                     LVLAQLAARTRVESGAPMVALGGETDVIRRYQDELGPRGSLLALELLRLARPPFSSTY
                     RTR"
     CDS             complement(334379..334873)
                     /codon_start=1
                     /locus_tag="ROP_03160"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH48563.1"
                     /transl_table=11
                     /translation="MTNKRISRLRGASVDYAIAAFRVVIGFLFFCHGTSTLFAWPTAP
                     HSGHTAAVGAWPSWWGAVIQLVCGAALFLGLGTRIAAFLASGSMAYAYFWSHQPDGAL
                     PIQNNGELSAIFCWALFLMIFLGGGALSLDRLIAHGVRTARVDDEAAAGEPGSTDELR
                     EVNA"
     CDS             335041..335976
                     /codon_start=1
                     /locus_tag="ROP_03170"
                     /product="hypothetical protein"
                     /protein_id="BAH48564.1"
                     /transl_table=11
                     /translation="MLSMRDFRFSFNIFGFDSRDALLDRCRLGESAGYDTVFAADHLG
                     APAPFPLLVAVAGATGLRVGTLVLNAPFWNAALLAREIATTDVLTDGRLEVGLGAGHM
                     KWEFDAAGVEWKAFGGRVEQLSELVDGLRTCFTTDFAELPEDRTVPRPLQRRGFGGSG
                     PPLIIGGTGDRVLRIAAAHADIVGVAGTFQIPGRPPGTFRLATADEAAERIRFVRTHA
                     GARAERIEWHLLVQLVVETDDRRAAANEIAERLGGTMSVDDVLGTPYVLVGTVEEMAG
                     QLRSHRERYGFSYITVHEPYLEVFAPVIRRLREQN"
     CDS             complement(335988..336374)
                     /codon_start=1
                     /locus_tag="ROP_03180"
                     /product="hypothetical protein"
                     /protein_id="BAH48565.1"
                     /transl_table=11
                     /translation="MNLIKKSAASVLVAATVTLGAGTAHADPVVPNPGMPALAIPGRH
                     EVDKQKALENMLNELGVGWANGGAAGTAIGALMGLGVGCVSMFPGSLAGCIIGTPIGA
                     ITGAIVGMGQGNPRAAQAIQEYINTP"
     CDS             complement(336502..337290)
                     /codon_start=1
                     /locus_tag="ROP_03190"
                     /product="putative ABC transporter permease protein"
                     /protein_id="BAH48566.1"
                     /transl_table=11
                     /translation="MTTMGYALSDSATMLRRNLRHMIRYPSVTVLLVGMPIVLLLLFV
                     YVFGGTLGAGLGDPAGGRGAYIDYVAPGILLMTVASAAQGTAISVATDMTEGIIARFR
                     TMAIARVSVLTGHVIGSMIQTLISLVLVVGVAVLIGFRPTAGIGEWVAATAVLAMFAF
                     ALTWLSVAFGLVSKSVETASNLPMVLILLPFLGSGFVPTDSMPAGLRWFAEYQPFSPV
                     IETVRALLLGGPVGSSAVLAVGWSAGIALFGYLWAKRLFNRRVN"
     CDS             complement(337287..338252)
                     /codon_start=1
                     /locus_tag="ROP_03200"
                     /product="putative ABC transporter ATP-binding protein"
                     /protein_id="BAH48567.1"
                     /transl_table=11
                     /translation="MMTASITTRSAITTTGLRKSYGDKLVLDGIDLDIGEGTIFSLLG
                     PNGAGKTTMVQILSTLVAPDGGDVRIAGHDLTREPDAVRSTIGVTGQFSAVDNLLTGR
                     ENLMLMADLHHLRRDAGRARATELLARFDLVEAGAKPAGSYSGGMRRRLDLAMTLVGD
                     PRIIFLDEPTTGLDPRSRRAMWQIIRELVADGVTIFLTTQYLEEADRLADRIALLDGG
                     RLVAEGTPEQLKRLVPGGHITLQLPGVRELDAASRLLGDAPRDEESLTLQVPGDGSVH
                     SLRALLDRLDHASIEVENLTVHTPDLDDVFLALTERATTRKESVR"
     CDS             complement(338249..339127)
                     /codon_start=1
                     /locus_tag="ROP_03210"
                     /product="hypothetical protein"
                     /protein_id="BAH48568.1"
                     /transl_table=11
                     /translation="MPTFSTPAPISATVELVVGDARITATDRDDTVVDVHPSDGSRES
                     DVRAAEQTRVEYSAGRLLVKAPKQRGLGLFGKAGSVDVTIALPTGSEFEGEASVATFH
                     GAGRLGACRVKTSAGDVHLGDTGPLDVHTGAGAVTVDHVAGDADLSTGSGKLRAGAID
                     GSAVIKNSNGDNWIGTIAGGLRVKTANGDISVDDARADLAAATANGDIRIGQVTRGAA
                     SVETGHGRIEIGIRSGTAARLDAHTSFGKVHNHMDSVDRPESTDDKVDVRARTGFGDI
                     VIRRVDTQESTSRKAQ"
     CDS             complement(339177..339695)
                     /codon_start=1
                     /locus_tag="ROP_03220"
                     /product="hypothetical protein"
                     /protein_id="BAH48569.1"
                     /transl_table=11
                     /translation="MDLTPYVASLRHELAVAAAAGGEDARALAERLTAPLESGVRLAL
                     LDALSAAAGEITRDLAPGSVDLRLRGREPTFVVTPAPVEQSFEEPAASGPGTSSPRIP
                     EVEDGAMTRINLRLSQDLKDRVEEAAREAGLSVNAWLVRSAAAGLESDGGSGRSERRA
                     PRSNDRFTGWVR"
     CDS             complement(339798..340847)
                     /codon_start=1
                     /locus_tag="ROP_03230"
                     /product="RNA polymerase ECF-type sigma factor"
                     /protein_id="BAH48570.1"
                     /transl_table=11
                     /translation="MSDNSVRTPHASADAEDDDLARARDGDDAAFTRLVGPLRRELHA
                     HCYRMLGSSHDADDALQDALLRAWRGVAKFEGRSTLRSWLYTVATRTCLDAVESRGRR
                     ALPVDLGPSSDRAVVGDVPLTEVAWLGPYADAGLVAGVAGPAARYEQREAVELAFVAA
                     LQHLPGNQRAALLLFEVLGFSAAEIAAVMETTTASVNSALQRARAIVANKIPSVTQSR
                     TLREIDDAHLRALVAGYSTALERGDADALVALLTEDVTWSMPPMGHWYRGLAAVTDFA
                     VRVPLTGCGSWRHLPVGANGQPAVAFYLWDEDAGTHLRWSITVLTLRGTKIAELTSFI
                     GPEHFEPFDLPQSMP"
     CDS             complement(340889..342160)
                     /codon_start=1
                     /locus_tag="ROP_03240"
                     /note="fragment"
                     /product="putative S12 family peptidase"
                     /protein_id="BAH48571.1"
                     /transl_table=11
                     /translation="MRRPRDRGVLTHVRADNLGERFTARRDIGDGDRGFGFGAQFHRS
                     GRVPGGGRCCRRGVDDARRGGTAPHPSGKRRRGGRHTTELGADTPPDAQTRFRIASNT
                     KTLTAALTVLLAQDGKLRFSDPVSTYVADVPGGENITIAQLLTMRSGLYNYTSAPELA
                     AGLDSDPAKAWTPQEVLTIAFSRPPEFPPGTSYEYSNTNYALLGLIAEKAGGRPLAEQ
                     FRERLLGPLGLNQTSLPAADDTAVPDPYSHGYMYGESAYALVDEPYPADMQAAARAGT
                     LQPLDYTNQNPSYATAAGGAISTADNLATWIRALVSGEVLNPEYQQQWRDSLQPEDPD
                     APDGQQYGYGISYQRFGPDASMYYHGGELPGFNSFIGYDPDNDVTLVIWANLTLSPEG
                     ETTANALLPTVLDEIYAGMSLAPTPAPSPTR"
     CDS             complement(341845..342351)
                     /codon_start=1
                     /locus_tag="ROP_03250"
                     /note="fragment"
                     /product="putative S12 family peptidase"
                     /protein_id="BAH48572.1"
                     /transl_table=11
                     /translation="MGSRARIRKRSASWCRPSARCSNHGAEAVMATMRDSPAEYVRDR
                     RTGVDRFRTLRATRIAVLAACGALVIAGCSPTSEPTTSENGSLPAATSATGTAASGSA
                     LNSIDPAAFQAAVDAAAEELMMPGAVVQLRTPQGNVDAVVGTPRNWERTHRRMRRPVS
                     GSRRTPKP"
     CDS             342408..343517
                     /codon_start=1
                     /locus_tag="ROP_03260"
                     /product="putative decarboxylase"
                     /protein_id="BAH48573.1"
                     /transl_table=11
                     /translation="MRELLPTAEAVPRQPSDTEGTSMSTRRSIHNTSLTDGEIVEQSD
                     LGSITRVTADTFPILQGLSIKRVLINPGAMRTPHWHANANELTYCLSGTSLVSVLDTG
                     SAFSTFTVGAGEMFHIDSGSLHHIENIGDEVAEFVIAFRSERPEDFGLGAAFGAMTDA
                     VLGNTYDLDASDFAALRRNTADRALAARIGDPVVPPAAKFSDAHKFAVEEQNPVLSLA
                     VGSAHLARVQFWPALKDLSMYSLRIREDGMREPHWHPITAEMGYVRRGSARMTVMDPD
                     GTLDTWYLEQGDVYFIPRAYPHHIEVVGSDDIHFLIFFDQPTPGDIGYRASVSAYSRE
                     VLAATFDTHIGDLPNFPFTPADPLIVTRNNPLDDR"
     CDS             343947..344276
                     /codon_start=1
                     /locus_tag="ROP_03270"
                     /product="hypothetical protein"
                     /protein_id="BAH48574.1"
                     /transl_table=11
                     /translation="MDALRDRGEMEAQNLRQKFKEWLAALVHEVVHSNAGVGAGLEGI
                     RAALTGKNPVWAAIKALVSGLSGKAKFGLILLLVVALLLGPVLLVILLLVLLVAVIVA
                     AVRAATQ"
     CDS             344567..345274
                     /codon_start=1
                     /locus_tag="ROP_03280"
                     /product="hypothetical protein"
                     /protein_id="BAH48575.1"
                     /transl_table=11
                     /translation="MKTKGQVALAVGAGYMLGRTHRMKMALMLAAAGATGRFPGGPRD
                     LLERGTKVLANSPEFAKISDSVREELVSAAKAAAVTAASQRINKLNNRLLSGGGEAVS
                     DVGDTVDDTVGGVGNSVGKLSSLGKLGRKRRGRSKDEEYDESEVDEEPDEQYAEEDED
                     YEEPEEEEPSDDEDEPPRRKRPAARRRASSNGSSRPTSRSRSAKSDEDDEEAPARGRR
                     TRAKATTDSAPVRRGGR"
     CDS             345271..346437
                     /codon_start=1
                     /locus_tag="ROP_03290"
                     /product="hypothetical protein"
                     /protein_id="BAH48576.1"
                     /transl_table=11
                     /translation="MSTMTNAAKKLREAAPGDGNGSSGVLQDALQKLVGTVTEKALSS
                     VTDKVQNASGRLTDYAEGGGGGLLAAVTGSEKLAEGESPIKSAVSGGWESAKQMAKDT
                     ASDVKEAVTGGGGSKGKKLKLTNIVETLDVGVPVQLAYNQWTQFADFPSFMKKVERVE
                     QESDEKLEWKAQVFLSHRTWEASIIEQVPDERIVWHSKGAKGYVDGAVTFHEVTPDLT
                     RIVLILEYHPKGLFEKTGNIWRAPGRRARLELKHFGRHVMTQSVLHPDEVVGWRGEIR
                     DGEVVEPDEDETQQDEDETQPDESGELEETDDNEDEESEEEEEEPEQEESEETDEDES
                     EDTDEDEETPPPARRGRPRKTAASSEERAAPKRRGRPRKTAAKKAAGSRQGARQ"
     CDS             346434..346844
                     /codon_start=1
                     /gene="gvpA"
                     /locus_tag="ROP_03300"
                     /product="putative gas vesicle structural protein GvpA"
                     /protein_id="BAH48577.1"
                     /transl_table=11
                     /translation="MTAIQPAGGGGGVSGGPSSSSLADVIDTILDKGLVIDAYVRVSL
                     VGIELLTIDARVVVASVDTYLRFAEAVNRLEIGSGEPKGLTDLVGSVTEGGAKSKTKG
                     ALEAAGDKLGDILGGGQEEPERERVSRKSSRGDK"
     CDS             346841..347632
                     /codon_start=1
                     /gene="gvpF"
                     /locus_tag="ROP_03310"
                     /product="putative gas vesicle synthesis protein GvpF"
                     /protein_id="BAH48578.1"
                     /transl_table=11
                     /translation="MMSTSEKSNDAPDEPRTSGVYVYGIVPADVEAEEDAVGVCDGPV
                     AIVTHGDIAALVSEISVDRPLGKPEDLQAHAHLLDGTSGVAPVLPLRFGAVMTDEDAV
                     EKELLEAHADEFAAALKELEGRAQYVVKGRYVEEAILREIIEENQQAGELVDAIRDQP
                     EETTRDARMALGEIISNGIEAKRDEDTRTVVEALESLSDSVNVREPTHEEEAAQVAVL
                     VEVARQEDLEKAVGELAERWDGRVEMRLLGPLAAYDFVVTQKPEG"
     CDS             347636..347887
                     /codon_start=1
                     /locus_tag="ROP_03320"
                     /product="hypothetical protein"
                     /protein_id="BAH48579.1"
                     /transl_table=11
                     /translation="MGLMSFIVTLPLAPVRGVISLAELIQRQVEEELHNPASARRALE
                     ELEDARASGEISAEEEEQAQQAILDRMTGTARPNSPEKE"
     CDS             347894..348184
                     /codon_start=1
                     /gene="gvpO"
                     /locus_tag="ROP_03330"
                     /product="putative gas vesicle synthesis protein GvpO"
                     /protein_id="BAH48580.1"
                     /transl_table=11
                     /translation="MAEEEPPPLPAPEIAEIATRDVAKLTGKKPLGATSVMPTDDGWT
                     VEVEVVEDRRIPSSTDMLALYEVVLDLDGELLSYRRTRRYIRGVGDSGSAQS"
     CDS             348181..348588
                     /codon_start=1
                     /gene="gvpJ"
                     /locus_tag="ROP_03340"
                     /product="putative gas vesicle synthesis protein GvpJ"
                     /protein_id="BAH48581.1"
                     /transl_table=11
                     /translation="MTVVGGGASNLPQSSGGGFGGGHQSTNLGEILERVLDKGLVIAG
                     DIQVNLLDIELLTIKVRLVIASLETAKEVGIDWWEHDPWLTGKNSDVELENRKLRERI
                     AELESDRSVRPAVEDADTVEVEASRQERDDDRR"
     CDS             348575..349354
                     /codon_start=1
                     /gene="gvpL"
                     /locus_tag="ROP_03350"
                     /product="putative gas vesicle synthesis protein GvpL"
                     /protein_id="BAH48582.1"
                     /transl_table=11
                     /translation="MTADDGVWLYSITTDSVDDAQLAEVTGVAGEPVRAVASAGLVAV
                     VGTVSLSEFGQEPLQRKLEDLDWLAATARAHDAVVAAVTRRGPTVPLRLATLYLDDDR
                     VRVLLTERREEFGATLRRVTGRSEWGVKGYGDAKILSQDVKEEPSPTGAAGKGTAYLL
                     RRRAELSAQQDVERKAADHAGEIHAALLEQAVDGLRRQVTDPVLTGKRAWMIFNGTYL
                     VDNDRIEGFAALVTALDTERPGITLELTGPWPPYSFAGIDG"
     CDS             349358..349567
                     /codon_start=1
                     /gene="gvpS"
                     /locus_tag="ROP_03360"
                     /product="putative gas vesicle synthesis protein GvpS"
                     /protein_id="BAH48583.1"
                     /transl_table=11
                     /translation="MSEMVPTEDTRRIALVDLLDRVLGGGVVITGEITLSLADVDMVR
                     ISLRTLIASVSALVPDPAEQDSADG"
     CDS             349560..349892
                     /codon_start=1
                     /gene="gvpK"
                     /locus_tag="ROP_03370"
                     /product="putative gas vesicle synthesis protein GvpK"
                     /protein_id="BAH48584.1"
                     /transl_table=11
                     /translation="MAESEPADSDAPSEIGRRVLPQRIDADPESVEKGLVTLVLTIVE
                     LLRQLMERQALRRVEHGDLTDDQIERIGTTLMLLEERMAELRDHFDLTPEDLNIDLGP
                     LGPLLSNE"
     CDS             complement(349919..350113)
                     /codon_start=1
                     /locus_tag="ROP_03380"
                     /product="hypothetical protein"
                     /protein_id="BAH48585.1"
                     /transl_table=11
                     /translation="MNMGKKIRHRVETAEGAAKKAVGRATGNAHLEAEGSKEQARGNA
                     KQMGDKVKDAGKKIKNALKH"
     CDS             complement(350205..351263)
                     /codon_start=1
                     /locus_tag="ROP_03390"
                     /product="putative S-adenosylmethionine--tRNA
                     ribosyltransferase-isomerase"
                     /protein_id="BAH48586.1"
                     /transl_table=11
                     /translation="MTRAGSDSVTEFRFVLPQRLEASGPPEERGLLRDSVKLLVSDRG
                     NLVHSTFHDLPHFLRSGDVVVVNASATLAAAVDGTVDTVGPVVVHFSTELEGGEWALE
                     VRAPGLVSGALDSVGAGVRIRLSRGAVATLHEPWPRGSTRLWRASIDGVADVAAELLA
                     TAGRPITYAYIHDRWPLGYYQTIFGRTGGSAEMASAARPFTHPIVTELATSGVVTAPI
                     LLHTGVSSPERGEPPIPERYDVPEHTARLINDRRAEGGRVIAVGTTVTRALETRATPD
                     GLAVAGGGWTNLVLSARRPARVVDGLITGWHAPGASHLMLLESVVGAAAVRRAYDEAL
                     ARGYLWHEFGDSALLLRR"
     CDS             complement(351260..351967)
                     /codon_start=1
                     /locus_tag="ROP_03400"
                     /product="putative oxidoreductase"
                     /protein_id="BAH48587.1"
                     /transl_table=11
                     /translation="MNGTRTALITGGSTGLGRASALALAERGWEVIVTGRRVEPLDRV
                     AARGSAITAVLGDVTDPWHRERITEAIAERRRLDLLLNNASALGPSPMPALTRYPEDA
                     LAQVFATNVLAPIALIAALIGPVRAAEGTVINISSDAAVEAYAGWGGYGAAKAALDHA
                     TAVLAVEEPDLAIYAFDPGDMRTAMHQAAFPGEDISDRPEPETVVPALLRLLDTRPPS
                     GRYRASDFAVANTGVSS"
     CDS             352224..352529
                     /codon_start=1
                     /locus_tag="ROP_03410"
                     /product="hypothetical protein"
                     /protein_id="BAH48588.1"
                     /transl_table=11
                     /translation="MRSAIAAAAALAAFSAPGIAAAAPNLHGDPNTPGTQVQVESEPG
                     DSNSYTCGAVGVAGAGVGSNSSGGAGSVNGAYFGPGPVQGGCVGSDGSVYFPTGNAE"
     CDS             complement(352820..353278)
                     /codon_start=1
                     /locus_tag="ROP_03420"
                     /product="hypothetical protein"
                     /protein_id="BAH48589.1"
                     /transl_table=11
                     /translation="MTTSDRQPEGTSPAGNVETPAEAPASAVEGTESPAGTTESAPGA
                     ATPPAAEAPPSAQDADTSVGQTLFAEDELSVLRLRWDEVQSGFVDDPRECVQKADGLV
                     SDVVDRITTGFSEARSRLEEQWARGEEGSTEDLRLALKRYREFFQRLLEL"
     CDS             complement(353275..353862)
                     /codon_start=1
                     /locus_tag="ROP_03430"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH48590.1"
                     /transl_table=11
                     /translation="MPVWGWILIAVLVVIAVLAIIASRSISSRKRTERLKGRFGPEYE
                     RTVGEVGDQGAAEKELAARERKREKLDIVPLPPEARAKYADSWRTVQIEFVDNPSSAV
                     AAADRLVIHVMRERGYPIDDFDQRAADISVDHPKVVENYRTAHGIYLAQEQGDIGTED
                     QREAFVHYRELFEKLLETDENNDEPNKDEPKETRA"
     CDS             353991..355025
                     /codon_start=1
                     /locus_tag="ROP_03440"
                     /product="putative oxidoreductase"
                     /protein_id="BAH48591.1"
                     /transl_table=11
                     /translation="MTVRIGIVGYGLGGRYFHAPFIEAAEGITLGGIVTRSADRAAQA
                     AADFPGVPVFASLGELIDSGVDAVTITTPPQTRRELVLEAVGRGVHVVADKPFAPDVA
                     MARELVAAGDEAGVLLSVFHNRRYDADIRTLKSVLPRLGDIWRVESHFDLDGADTLEA
                     GPTGGLLRDIGAHVVDQVLWLLGPAERVDAHLDYVDRPEGRTDAGFVVNITHRSGVYS
                     TVSSTKVNHFEGRRLRAFGSAGSYVADGTDVQAQALFAGTRPVDDPTGWGLERPERWG
                     VLHTAEGPETIPSQRGAYQDYYREFAAAVAGAAPQPVPARTALGTIAVLAAAREAAET
                     GRTVVVAPAD"
     CDS             complement(355041..355844)
                     /codon_start=1
                     /locus_tag="ROP_03450"
                     /product="putative hydrolase"
                     /protein_id="BAH48592.1"
                     /transl_table=11
                     /translation="MPFIESGGDRIDYTVHGDGRSSNVILLAGFKAPATSWRYQIPSL
                     IGAGHRVVAVDLPGHGTAPAMPHGTTMQTRADQVHALLEELDLQDAAMIGGSMGGNTI
                     WSYVDTYGTGRLRAAVVVDQTPRMLNTPDWEYGFYGYGGDEADTFFADGIPSTGHGTP
                     IWRRGMRLVRFIAAMGRVDWKLSQPELALLNDHAQRDWRPAIRSSGLPVLFVAGSESE
                     LWPPAHAEVAAALAAKGASTVIPRAGHATNMERPESFNTAVAEFLDSAR"
     CDS             356425..356874
                     /codon_start=1
                     /locus_tag="ROP_03460"
                     /product="hypothetical protein"
                     /protein_id="BAH48593.1"
                     /transl_table=11
                     /translation="MAQLAASAEPEVRAQLDAKIAVLDEHRTAVGLKRGKINRELAFH
                     FARQTADYAAAAGATVIAVLDLTTLEARGHGRVNNNRAAQSARRKAVTALAHTAAGVG
                     IAVVSVGPADPPRGVRVATHPSHAPAAITPRGVQVAGSAATATTSPE"
     CDS             357283..357660
                     /codon_start=1
                     /locus_tag="ROP_03470"
                     /product="hypothetical protein"
                     /protein_id="BAH48594.1"
                     /transl_table=11
                     /translation="MDVGSTHSDRTLEMHTSLHHEASHASNRSGAVNTLRRVPLRNRF
                     VTVVAAAALAVVPVGSATAVAAAPELPATTVSAPTIPGDRGDNGDGPRHDRQRDQRQE
                     RRDQGMTLDELLVGWNSSQIHQF"
     CDS             complement(357651..358133)
                     /codon_start=1
                     /locus_tag="ROP_03480"
                     /product="hypothetical protein"
                     /protein_id="BAH48595.1"
                     /transl_table=11
                     /translation="MTIDDIIDFVEGLDDVLTLRPVPGDGSPEISWGDTFFYYSPDGV
                     VPTTTQPFATIVTKNYPGDEDSRLDRAGAFRVNIHAGKEAFLATLGRAPREPGPAHTD
                     AGASDTVIAHPVYGSAAWLAIVNPGPRTGRLTRELLCTAHALARSRYERRADAVRRQN
                     "
     CDS             358211..358960
                     /codon_start=1
                     /locus_tag="ROP_03490"
                     /product="putative MerR family transcriptional regulator"
                     /protein_id="BAH48596.1"
                     /transl_table=11
                     /translation="MPKFRTVDVARRAGYSVQQIRNLERAGVLPPATRTATGFRVYTE
                     VQLQSALAYRELAVAVGPVEAKRIVRSVHTCPAAATVALLDAAHARLHTERAELALAK
                     DAAAVISAEQIEDVRASDWMSVAELAAALGVRTSTLRHWDTEELVIPDRKAPTRERRY
                     SPSQVRDARIVHQLRKAGYRIAPLRAVMAQLRRPAGSGDIGVALAVRDETLTGRSRAL
                     VDATAALAGLLPPSGVSPRATAPQPENRSRR"
     CDS             complement(358911..359582)
                     /codon_start=1
                     /EC_number="2.1.1.-"
                     /locus_tag="ROP_03500"
                     /product="putative methyltransferase"
                     /protein_id="BAH48597.1"
                     /transl_table=11
                     /translation="MALARAGLIEEESTMSERTPSGRTPSRWEEITAADPGHSAWYVE
                     RFRAMEAKGQDIVGEARLVDAMLGRGGRVLDAGCGLGRLGGYLHDAGHVVVGVDVDPV
                     LIGVAEEDHPGPTWLVGDLAELDLPSRGVAADFDVIVCAGNVMTFLAPSTRESVLAGF
                     AAHLAPTGRLIVGFGADRGYEFPQFMADAGANGLTVDLLLSTWDLRPFTDDSDFLVAV
                     LSRAD"
     CDS             359666..360085
                     /codon_start=1
                     /locus_tag="ROP_03510"
                     /product="hypothetical protein"
                     /protein_id="BAH48598.1"
                     /transl_table=11
                     /translation="MPESPPDRVQITDRLHVVANLLDTRDWPGFAATLTEDVVAYGRT
                     GPAAVVARVRSHLDVCGTTQHLLGNIRIDLDGDTARTTSYFRAFHLGLGDRAGASYEC
                     LGEYRDQWRRGPSGWLLSGRVIDVRAEIGDRSVIAPR"
     CDS             complement(360099..361187)
                     /codon_start=1
                     /locus_tag="ROP_03520"
                     /product="putative ABC transporter substrate-binding
                     protein"
                     /protein_id="BAH48599.1"
                     /transl_table=11
                     /translation="MNARMRAFGVAVTVAATVLGACAAPPPGDDAAKKVYFFLPNTTT
                     TRFVERDEPLFTDFLELFAPKATVTVRNAEGDPARQQSQVESAIADGAAVLVLISADA
                     RFSGGALTAAADANVPVVLYDHDAVGGPAEVQVIFDPLEVGRRQGSRAADLIAAMPGD
                     GLKIARVEGNLGEYGTRQFQLGQNEYLQPLIGSRKIRVVCETAIDDWDPAEGQAFAEE
                     CLTRENNDVDLFVTMNDDLAGGIVAALAGRGLAGRIPVTGGQDANLAALQLIAQGTLD
                     NTIFKNLSDQAKVAAQLTTSILHGADLPENMINGTIDNQYMAVPTVFLPVQNITQDNL
                     HVVVNSGFYTWQQICAPDPDSAVCREHD"
     CDS             361226..362704
                     /codon_start=1
                     /locus_tag="ROP_03530"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH48600.1"
                     /transl_table=11
                     /translation="MPGVGIPTGVDGYACSSMLSVFSGTDRRTLSAGMEEERVFDQDR
                     GTVSSGERDTSPADEHLLKESLLVEPEIRRRPWREFLESTPGRLSVLAVVLVAVALTA
                     GVVTSAVIGARQQRMETLRAHTEPLADAAQNLFSSLSIADAAATSSFIAGAIEPLAVR
                     DRYNQAIGDASNALVTASYGVTSGDVGSLRLLTEMSRHLAVYTDLVATARSNDSAGNP
                     VGVAYLGTASALMQDTILPLAERLYSDQAGAVADTQSHTARLPVTAIVVASAGVVVLA
                     VAHAYVAHRSRRRVNPGLACATVLLAALVVWIVVAGLLSTSASERARLDGAEPLAAVT
                     KARILAQQARADETLGLLRPGFDPTGSDYTRHTDALAAILNSDASPDAVDVPAIDDAS
                     AAFEGWRSAHRELQRRLADGDFQGAADIAVGPGSTASTAQFRTLDESLEDAIIALRAD
                     ELDAMRESYRTMAALAVGAVVLAVSAALAVIAGIEPRVSEYH"
     CDS             362704..363693
                     /codon_start=1
                     /locus_tag="ROP_03540"
                     /product="putative ABC transporter substrate-binding
                     protein"
                     /protein_id="BAH48601.1"
                     /transl_table=11
                     /translation="MVRPFRARRPGITRLLGGLAFGTVLIAGCGSPDAPTPMFSGDFT
                     EFPASVGARIIEPSESPPPDGQPSSCAPTVSLRPGIAGAGGALGEIRARGSLVVAVDQ
                     NTNLFSFRDPTTGTLTGFGVDLAREVARDLLGDPAKVEFRPLGSGDGAEMLAHRDADM
                     IVRPVALPCESPQDVAFSTVYLETPRRLVVRVGSGISEPADLARRRVCTHDDPASVSA
                     LSRIAPKATIVAVPDWDDCLMAIQQRQVDAVVGAALLAGLVAQDPNLDIVGPDSDSAR
                     YAIALAPGRDDLVRFVNGTLERLRTDGTWTALYDRWLSPLGPAPAPPSPDYRD"
     CDS             complement(363713..364126)
                     /codon_start=1
                     /locus_tag="ROP_03550"
                     /product="hypothetical protein"
                     /protein_id="BAH48602.1"
                     /transl_table=11
                     /translation="MELVERAVSADIDAAARAVITAAAAEASRHADEIIGTGPLPGTA
                     EWDAEQGTDIPNQRTLAWHLLSLRIQLAAGLDGIETVLGLRFQGATWATIGKAAGMTR
                     QSAHERWGARTTALLDPMGTGLPQTVADDDPEVAR"
     CDS             complement(364203..364961)
                     /codon_start=1
                     /EC_number="3.3.2.-"
                     /locus_tag="ROP_03560"
                     /product="putative epoxide hydrolase"
                     /protein_id="BAH48603.1"
                     /transl_table=11
                     /translation="MGGVRFRSPSTGRSIRAVLFDTFGTVVDWRTGIASAVAGYAERH
                     SLTLDAAAFADRWRDRYQPSMEPIRSGAREFVTLDILHRENLDVALRELGVDPTEHDS
                     GELDELSRAWHELTPWPDSVPGLTALRSDYIIGPLSNGNTSLLLDMAKNAGIPWDVII
                     GSDINRIYKPHPRAYLHTARLLGLDPGEVMLAAAHNDDLDAARAAGLATAFILRPLEH
                     GSHQTSDLAPTGSWDISATDIPDLAAQLRAASRG"
     CDS             complement(365051..365494)
                     /codon_start=1
                     /locus_tag="ROP_03570"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH48604.1"
                     /transl_table=11
                     /translation="MTSTPPATGAFDATPAPTDGTTKKARVAGLVVSALAVLFLLFDS
                     LIHIANTQMVREAMAELGFAENLNRVIGVVLLVCLILYIVPATSILGAVLLTGYLGGA
                     VATNLLTEQPIVSTTLFPIYVGVFVWGGLYLRDPMVRSIMPVRRT"
     CDS             365700..366161
                     /codon_start=1
                     /locus_tag="ROP_03580"
                     /product="hypothetical protein"
                     /protein_id="BAH48605.1"
                     /transl_table=11
                     /translation="MDGLVKLVIEATDLPGSSCPPGANFPGYDNIHVAVQRRGTPGDL
                     LDLHPGDATTARWVLECGTTPTPTGLDITGPYIQGRPGARFVYLSWGTVDGDGGFDMF
                     RRAKLMWDAVDPATANAAASAGRITARLGLTDARGNPLCAAVRPPLVEWSA"
     CDS             complement(366234..367667)
                     /codon_start=1
                     /EC_number="2.7.13.-"
                     /locus_tag="ROP_03590"
                     /product="putative two-component histidine kinase"
                     /protein_id="BAH48606.1"
                     /transl_table=11
                     /translation="MTGRTANARRMSLRTLLWLAIGILVALFAVSAAFSVYGRLVVRA
                     SEDVLSERLLPAQRAVSDLTTAYVDQETGQRGYVLTGDPRFLEPYDAGRSAAAASLSD
                     LTALLGGDAEASATLDAVVEAANTWTSQASEPEITARRNDAIAQDQVVAMTATGKELF
                     DGLRSELQELNSLTDERVTEQVDRVRSAQILANVATAVAFVLAVGTAIISGYLTRRLL
                     TQPIERLVADISAVAEGDYERKIGTDGPREVSMIGGAVDTMRNSLLTQNRLLVQAEHE
                     RTRHDEQTRMAADLHDLTIQRVFGLGLALTSVARRHPRLTADLDPLIDETDSIVRGLR
                     AVIFDLQMGSASLTNGTASLSAAVGEIVESSTAALGFTPDVCLDGPVDLFSGHDAGPE
                     LQAVLREALSNVARHAHATSCRVMVAADDDRLTLSVTDDGTGIGEDAVRGHGLANICN
                     RAAQLGGRAVIRDGAPGTVVEWEVPAS"
     CDS             complement(367798..368220)
                     /codon_start=1
                     /locus_tag="ROP_03600"
                     /product="hypothetical protein"
                     /protein_id="BAH48607.1"
                     /transl_table=11
                     /translation="MGTGGRAARVEDVHESALGMPHVTVTYGPADNPVYQVGGKSFVF
                     FRTPRPDATDPDTGERYDDVIVFWVPSDADKQALVRDHTTPFFTTSHFDGHLSVLLRG
                     SRVGELSRHELVELVQDAWLSRASARRAATWLSAHPPA"
     CDS             complement(368345..368800)
                     /codon_start=1
                     /locus_tag="ROP_03610"
                     /product="hypothetical protein"
                     /protein_id="BAH48608.1"
                     /transl_table=11
                     /translation="MNSIMTLSDLTALTGLDVFDYLDQEVLVPVVDGMQAQGDLIVIP
                     YSIVAELVTPNHWTRSENVPLSGVELLRSAAGGNPHSLVADEGMCTWSTPVDDPRRLA
                     LGILDTRVTAYLIHPEHGATGIAPGRYVVGRQRERSVGRSFERTQFVVD"
     CDS             complement(368834..370066)
                     /codon_start=1
                     /locus_tag="ROP_03620"
                     /product="hypothetical protein"
                     /protein_id="BAH48609.1"
                     /transl_table=11
                     /translation="MSATPRRSKARHRATFIDNTDHSAEYMFGVGAVRDAWLGHGLCA
                     RPSDRAAAESAVETLYRRAGFRDPEFVWVPSPPAGSDLIAAEGLATTLSFAGDGADCV
                     SARMATMLSESRKRMDALIARGRSDWPNERRAIEIARAQPPDHSARVGISPNAIIRAA
                     VWDSLRTTLFDGVAAAIRTLMPAAVGGVSWYGQQEAHRVAYYDTYRRFGLARFHSVDA
                     ELLDVHTALTGATGWWWAFDSTCVMAERPIALHAEPIPGRVHNEHRLHHLDAPALEFG
                     DGRSLFVQNGTIVPDWVVLEPTVERIAGERNVEVRRCAIERIGWDTYIDSAGLALIGR
                     VDDPGNIGHTLQLYATSDGRGRIEHILLAVNGSPERDGRRRRYGIYVPTRISSALDAA
                     AWTYGLDGADYARLVRRT"
     CDS             370305..371009
                     /codon_start=1
                     /locus_tag="ROP_03630"
                     /product="hypothetical protein"
                     /protein_id="BAH48610.1"
                     /transl_table=11
                     /translation="MTSSNYSAPPNDGSRHRTGPADALKGELPVTDSVLSYTDHGRTD
                     EMTLIPDRSPIVIGRSAYADLSLPTDPDISRLHATIERIGIHWTITDDGLSRNGTFVN
                     GTRLQGRQTLHPGDVIQVGESLLTYHGEPGTDCGITHIGDTVDPDIVLTPAQHTVLTE
                     LCRPFHDGTDHPIPASNRQIADALHLSTETVKTHLRALFSTFHIEDLPQNQKRSRLVT
                     LALTNGVLDAAAPSDF"
     CDS             371130..371561
                     /codon_start=1
                     /locus_tag="ROP_03640"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH48611.1"
                     /transl_table=11
                     /translation="MDPTFVIVGGATGALTAYVLPLWLIRSGRGPRLAAKREVSTAID
                     TGALPPDADIWSWRPRLVESRQTVARGRWVMLAAGLLMSFVTLAHAVGEGGTLLTWVF
                     VGSAALSLVGAFGMHRQVRRADSLLAAISAGPTARPNFGAR"
     CDS             371680..372369
                     /codon_start=1
                     /locus_tag="ROP_03650"
                     /product="hypothetical protein"
                     /protein_id="BAH48612.1"
                     /transl_table=11
                     /translation="MRRVVRAFWGPRPEPVEALAGRWRLTLERVSQLLPVGGEWRQVH
                     ASEPDTACAPDELTAVLLVAQDTEAWSDRTGTGLRLVCTGEAGWAVELSGVAGGTPQF
                     LLQSLVMTVEAPEDAVVPESELLAMLAAVWEPDFGDVTDDDILDALEDDAGFVVGDPV
                     VGRFGYLCSARAVLIPDGLEASGPAVPDGGVLLHIAASGEIDTVVRVYERLRDAGALA
                     PLARPLDRPTL"
     CDS             complement(372400..374430)
                     /codon_start=1
                     /locus_tag="ROP_03660"
                     /product="hypothetical protein"
                     /protein_id="BAH48613.1"
                     /transl_table=11
                     /translation="MEFPMLSKGQNLSLPADVEQIDVVLGWTESDVEVDASALLLNVD
                     GKVRSDADFVFYNQPESTDGSVRFLGASGTEEGAQARIAIDLSTVPEDVHTVALGGSV
                     AAGGFGDLGKLALRVVDGAGHTLAEYVTADATTESAFVFGEVYRRNGDWKVRAVGQGW
                     ESGLAGLATDFGVDIADDPDPELTESADAPSDRENSDGAVPTGSTGDAPQLVPELPTT
                     PAAPRKTATRGVRTTKRVVKKSKPLVFGLAEQDTWQPARLFSVIGVGAGEEQERRATS
                     ALIATMQAVRPFARAVCARVGAPAGTFEGYVEVAYARGETKVIPDAVLKVARGSRVWT
                     GLLEVKTGSGKLKKEQLENYLDVARKKKYDVVVSLSNDVPASAGELPVEVDRRKLAKV
                     ALRHLSWAEVAHEARMLLSHGGIDDDLQSWVLAEFLRYLDHPRSGAVEFVDMGRHWVT
                     VRDAVTAGTLRAGDEKALTVADTWVSLSRHLALRLTAELGVTVKHVLPRRHSTDPAAR
                     NAAVAERLAGDGVFEAVLRIPETAGDLVVIADVRTNKIRCRTTVEAPNEGTSGRRVSW
                     LLKQLRDVPGDVQVEAVFSERGNEACEHIEAVRVDPKVLTVGRSGDIVSFCLEQSFPM
                     GGRRSGTAASFISSVTSSADGFYGTVVQQLREWVPAAPKQTEQPRAAAPEGE"
     CDS             374905..377454
                     /codon_start=1
                     /locus_tag="ROP_03670"
                     /product="putative LuxR family transcriptional regulator"
                     /protein_id="BAH48614.1"
                     /transl_table=11
                     /translation="MDSVWPLIGRDQELRRIWATIEGSGDDSGVLVAGGVGVGKTRLA
                     SAAVAILAKRHAVRWVTATASTRTLPLGAFAQWAPISQADPMKVLHTVIEALTAGDKP
                     VVVAVDDVHLLDDLSVVVIQQLVQRGLARVVLTLRSTEPAPDTITTLWKDGFLNRLDL
                     DPLRENDTERLLSTVLAGPVAPATAAELWNLTRGNVLFLRHLVCQERDAGRLVSDVGT
                     WRWSGEPVVSPTLAKLITGQLGSLTDDTAEVLDYLAIGEPVDGTVLEMLTSPHAVKEV
                     HSRGLIDMTSDNGDIAVRLSHPLYGEVRRSTGNLLQLRRLRGRLATALSTRADPTPAA
                     LLRRASLTLESELPSDLELYLVATATALRLHDAPLALRFADAGHISDSGFQAAMLHYW
                     VLTNVGRAQDAFALLEALDQNTLTIEERQRLSVMRVGTLCWSLGDPEQARRELAIAKQ
                     APESHESPELAAFEVLLESVQGRPEHAIAAGNVLYQAAPSDMAFVLTSCALVIAHGYS
                     GNAANVFPLTERASALVATSSDASALEYGIVYFHIEAMFIAGYLQAAEQVMTQFVEYA
                     ANTPGTIGLFVSLLHSYVDLSRGRLSAALEVLNRADREFRTTTYDRSAVVSCRIYLIL
                     ALSHRGDGKRAAELVRDLDTLNPYGFLRSACTLAKAWAAAAQDMIADAIRLARKAAAI
                     AADRGHFGQELMCLQAGSQFGDRTTAHRLNELTALVDGPRVHAAALHANGLNSVNGET
                     LAEASRRYEEIGDLVAATDASAQAGTLFREQQHHGSALTAIERARTLAGTHRGLDTPA
                     LRRATETKPLTRRQREVVALVSQGFTNKEIAERLGVSIRTVEGHRYHARLR"
     CDS             377542..381390
                     /codon_start=1
                     /locus_tag="ROP_03680"
                     /product="hypothetical protein"
                     /protein_id="BAH48615.1"
                     /transl_table=11
                     /translation="MQLEKRFEAMGRPSPRMVRPDCSSKRPHGGVTMNSDKHLKHLGE
                     LAVAVGIGLAVAPAGTAVAAPSVGDSSTSSSSDSSDQTSSDGRAADRSTDGASSDRTS
                     SGTSRTDSDSSSDGSRSSTTGDSTTDSQSTSGTDSQSTSGTDTQSTTDTESTSATSSD
                     DVNGSGATTPDISSTVNDGSMPDSGTTAGESEQAGSSSDATAPTAIDASGAAIAPADR
                     PQERADTELSDSPASPAPVQGHDSAPQGSDPAPTPPTTPVTGSSGAALDPIMAEDPAA
                     RGPVPNAPAAIQDAVPATASAPEITTIDGATALTGIASDTKADASQVVTQALAPSLPT
                     AAVDVASSVVSKVLGALGLRPFLSNDPQVPIESPTFWALAAAWCRRQEKVFTADANPT
                     LAAAPVTTSEPIESVAVTSTASTLTSTASTGTSSTSTAGPTVGAPDRSTGVVLGSINT
                     SGDQLGYTVTGQPSRGTVTVDETGGFRYTPTQAARQVAALDPSADYTSFDSFTVTPTS
                     GQTSTPVTVQVPVSAARMQVAQSTTVGSNPSGAVFTGTRTYVANQGSKSVSVLDTNDT
                     VVGTVTVGTSPTGVAANPAGTRVYVTNSGSGNVSVIDTATNTVVATVKTGTTPSAVAV
                     NPAGTRAYVTNSGSGTVSVINTATNTVVGSPIKVGITPNAVAVSPDGTRVYVTNRSSN
                     TVSVINTATNTVVATIRTGTTPNAVAVNPTGTRAYVTNRANNTVSVIDTATNSVVTTV
                     AVGSQPTAVRVSPDGSAAYVVSNPDRLTVIDARTNTVVSTLSIDSPTESGDHSIALSA
                     DGSRMLVTDATDGRVRAVTLTHVNSEPTMSWTADAPRPSDGAVVVTLVDPRDPDGDPL
                     TFTNTAPGSGSVVSDGMTFTYTPTAAARDLALQTPGEDADHFTIALADGQAVTNIVVT
                     VAISPTEVPDILEVESTTIAVGSGPTGVVTAEDRIYVVSDEGFVRVIDPETNTVVGAP
                     IEVDWASSNIAATSTSVYVNSPYTGAISVIDTSTGTVVDTIWVDPAPDYQGYSLAQEL
                     AVSPDGTRLYASGEDGTVSVIDTATNTVIASQLLGSYSSLEVSADGRYLYGTSGATVS
                     VIDTASLTRTAEITVGPEWDLTRTSSEFADVSHSVTVVNGNRLYVTHHVSTVERATGS
                     FSNGQFITDSQGRLWRVTGGYGLVSVIDIDPASATYGSTLDTVRLTGDAQDLALSPDG
                     GRAFVTAGDGRTIAVIDTATNTVVGTFVTDGEGAVTGPYGPLRTVSISSDTLYVTDYN
                     DGAMYAVTGALDGAPAAVLT"
     CDS             complement(381477..382016)
                     /codon_start=1
                     /locus_tag="ROP_03690"
                     /product="hypothetical protein"
                     /protein_id="BAH48616.1"
                     /transl_table=11
                     /translation="MADASLRITRLRTLIEHPRTGDTERAAAQRMLDRILSKSRSRYD
                     TSDRTYGARHDRVGRHAGLSRIADEIRDDIALARVVFSTPTLPGQLAAPDPIGDAPPG
                     ITYTVETPHDAGIVITINDVPADWGWISAGGVEAVSPALRALAGELAKLMDGYNHYGA
                     HIGRRFFGRIRVGGETLIW"
     CDS             complement(382108..383130)
                     /codon_start=1
                     /locus_tag="ROP_03700"
                     /product="putative ABC transporter substrate-binding
                     protein"
                     /protein_id="BAH48617.1"
                     /transl_table=11
                     /translation="MTQVRKSRQGARPWIRYLVGIVAVVVLAGCAAPDPLTPTVSGTY
                     TTRPMTNGAQIIPPTNNPPPEGPSPESCGALASLRPGPQPPPGQMPPGGALAEIASRG
                     RLIVGVDQNTNPFSFRDPTTGTLQGFDIDVAKEITKDIFGDPAKVEFRLLTSAGRFSA
                     LEQNDVDVVVHATAITCERARRVGFSTEYFRAFQRILVPRGSDITGPADLAGKRVCTF
                     VDTTSLPTVQRVAPEATIVAVPDWDDCLVTMQKRQADATSTSDALLAGLVSQDPHFQI
                     VGPPMEGEEHWGLAVNKYKDDLIRFVNGTLDRMRSDGTWMRLYDRWIAGSLGPIAGPP
                     PATYRD"
     CDS             complement(383130..384485)
                     /codon_start=1
                     /locus_tag="ROP_03710"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH48618.1"
                     /transl_table=11
                     /translation="MQEGRMFHRGDHVAIETPTLDEGLLVEPEGRRPWVEFLTSTPGR
                     LTVLGVALIAVVIAAGVITSAAVGARQQRVEVLRTHTEPLANAAQALYSSLSIADAAA
                     TTSFISGGGASTGAEQFTQAVGDASNALVTATNGVSSQDAESLALLSDVVRNLAEYFN
                     LVATAQANDRAGNPVGVAYLSDASALMQDTILPLAEQLYVRQAEAVAETQTHTAQLPA
                     AAFTVTAAALVALVLAQLYLVRKSKRRFNPGLAVASLLMAGLLIWLIAGSLVSTSASE
                     HARTEGTQPINTVARARILAQQARADETLALLQRGADTQSEVDYTRHSQALSDELTRQ
                     LDSAHGDVAADDLRDAETAREGWLAAHRDIEIALERGDYPTAAAIAAGSGSGTSAAKF
                     AVMDAALRDAIDRLRDDEAAAVTDAYRSMSSLAIGSMIIGVSCGFAVGGGIWPRLNEY
                     H"
     CDS             complement(384585..384842)
                     /codon_start=1
                     /locus_tag="ROP_03720"
                     /product="hypothetical protein"
                     /protein_id="BAH48619.1"
                     /transl_table=11
                     /translation="MVWAALLVAVLLIEGPPARVVVAGATAVGVLVVQLAGVRPRLTR
                     RSDRVLAGEDVPRSHAHYVYIGLEVAKVVALLVTGVLLLGV"
     CDS             385015..385887
                     /codon_start=1
                     /locus_tag="ROP_03730"
                     /product="hypothetical protein"
                     /protein_id="BAH48620.1"
                     /transl_table=11
                     /translation="MSSRGSAAEWASGQVHAVRDDPDARLELSARTYHGPVGNAPRHL
                     PFRRAALSFMRWQVGRGVLAALDASPPGSPWWRAVNERLLRDGCEAVARSGGMGGTPS
                     SQAVDLWMLFVADPTARTWYRAHNASIVSAYLDHRGLAESESRPERFFLNVVLLRVLF
                     AHALVAAPRLALGRLAPAGPLLGDPRLSMTGIFLSLSRVLPDRYPLGDDVAAYVAAEH
                     NLGELLDYGLIGPRLQQLYEWSAAELDEPRLLGCIRDGSPTYAWSYTDREVWHPARPA
                     ATIRAVRRFVPARR"
     CDS             386029..386925
                     /codon_start=1
                     /locus_tag="ROP_03740"
                     /product="putative oxidoreductase"
                     /protein_id="BAH48621.1"
                     /transl_table=11
                     /translation="MADQYACQDPTTQYPDPDREHQPEIPHPGLTADMVTTPDHGEKT
                     YRGSGRLDGRRALITGADSGIGRAVAVAFAREGADVVVSCLDAEEPDARETVRLVNGA
                     GRRAVVATGDITSEDHCQTLVDLTVREFGGLDILVNNAAFQMVQTGGIADITTEQFDR
                     VLRTNLYALFWLCKKSVAVMEPGSTIVNTSSIQGMNPSPGLLDYATTKAAIINFTKGL
                     AADVAKRGIRVNAVAPGPIWTPLIPATMPADGYRKFGEDVPLGRPGQPAELAPAYVFL
                     ASNESSYVTGEVLGVTGGIPFT"
     CDS             complement(386963..387706)
                     /codon_start=1
                     /locus_tag="ROP_03750"
                     /product="hypothetical protein"
                     /protein_id="BAH48622.1"
                     /transl_table=11
                     /translation="MENSTPVTPPIRLDDLIEAIKKGHAEAPLEQLTDAVLAAEHLGD
                     LADHLIGHFVDQARRSGASWTEIGKSMGVTKQAAQKRFVPKDPGQASDLDPNQGFSRF
                     TPRARQVVVVAQNEARAASNSEILPQHLVLGLLTDPDGLGARAIAAQGVDLDTVRHAA
                     TATLPPAVEEIPALIPFDAQSRKALELTFREALRLGHNYIGTEHILLALLEVEDGVGV
                     LAGLGVDKAAVEENIAANLAAIVAARTEE"
     CDS             387818..388210
                     /codon_start=1
                     /locus_tag="ROP_03760"
                     /product="putative PadR family transcriptional regulator"
                     /protein_id="BAH48623.1"
                     /transl_table=11
                     /translation="MASRSRDRCSMHIEKDLVAASATPLVLGILAEGESYGYAILKRV
                     NDLSGGRIQWTDGMLYPLLHRLERLGLVSASWGASDSGRRRKHYTITAKGREMLAERR
                     AQWDVVADALSQVWRSVQLPPAPAEGWS"
     CDS             388201..389556
                     /codon_start=1
                     /locus_tag="ROP_03770"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH48624.1"
                     /transl_table=11
                     /translation="MVVMDTDKELESQIGQWRGYVERRHAISAADTDEMEDHLRDQIS
                     DLSAAGLETDEAFLVAVKRMGNVDDISREFAREHSDRLWKQLVLIPAAPDGDRTRPTR
                     ELFVVLGFAVGAALALEAGLATLDEQDLARNLSLFILPFLAGYFAWKRKVTLRLAAAL
                     VVPFVLAAVLLNVFPFVSNGSTEVIAAIHAPIALWFAVGVAYIGGQWRSDRRRMDFIR
                     FTGEWVVYLTLLALGGGVLIGLTVNAFDALGLSVEWVVEDWVLPFGAAGAVIVAAWLV
                     EAKQNVVENIAPVLTRVFTPLTTLMLLVLLIAFATTGSVVDVDRNLLILMDLILVVVL
                     GLLLYAISARDPYLPPDLFDRLQFVLVVSALAVDLLMLFAMLTRIAEFGFTPNKVAAL
                     GMNLVLLVNLTWSAVLILGFLRGRREFGSTENWQTRYLPVFGVWAALMVGVLPPIFDF
                     T"
     CDS             389673..390662
                     /codon_start=1
                     /gene="mreB"
                     /locus_tag="ROP_03780"
                     /product="putative rod shape-determining protein MreB"
                     /protein_id="BAH48625.1"
                     /transl_table=11
                     /translation="MGGLGIDLGTANTVVGTPDDGIVLNEPSFMLVRTKEPHRALAIG
                     SEARSLVGRTPIGITPVRPLRDGVIVDLESARAFVTAIVKRVSPARRYGVRPKAVISV
                     PAGATPLERRALLEVGHEAGLRKVGLVPEPVAGALGCGINPLEPRAHLVVDIGGGTSE
                     ITAICFGGILSHRSCRLAGDELTNALYQYLRAEHNIVVGELTAERAKLGAPDTDEGQS
                     LVVEGRDAVTGRARFVTLETEEIVDALRPTTTGIVHTLTECLEDLPPQAIGDVMSEGL
                     LVIGGGALLRGLSQLLEEAFGFPVKTAERPLTCVAEGATACLVHPEVVAAYSS"
     CDS             complement(390663..393500)
                     /codon_start=1
                     /locus_tag="ROP_03790"
                     /note="bifunctional protein"
                     /product="rod shape-determining
                     protein/penicillin-binding protein"
                     /protein_id="BAH48626.1"
                     /transl_table=11
                     /translation="MQDGKHESDPWIVGAAIVLVVLGLLNLTATGMTGHAVRHLLFAA
                     AGLAIMWVVSRLRVSDLRTFGWAVFGVATLLLAAVPLAGVATKGAQRWLNFGVFTVQP
                     SELAKLALILVPASMLAGGFTLARFLATLGIAAVPVTLVAVQPDLSTAVVLVATAGFM
                     LILARVPLLPLVPLFVVGIASLPLAVLFLRPYQLERVHVFLSSNADPAGAGWAELQAN
                     IAIGSGGLWGLARDPLYDVRAQFLPESEHDLAFASLVYGWGLIAGLAVVVATSVIVWR
                     AALAARTARTREAALVAAGIGGLFGIHALVSIGQSLSLLPHTGMPIPLFSYGGTAAIV
                     GFAAIGLVLAVRRDGVARPLWAPDPGRRRRPRGMSAGTMTMIAALVAMSVFAWQVQHD
                     RGAEYRAMSDAQMMRCIRLPAERGLIVDRNGVPLVVNVAEYAVAVVARMFEDSDDDAR
                     NRLAALLVKSPNELSDLIDAGGEGETQVAVGRVAPDQARRIVDARIPGVLVVPSGRRQ
                     YPYGAVLASILGHVGVADADDMERWPHLALGSRVGKAGLEKQYDALLRGSDGKQCMYV
                     DPSGNPVATGERVDPVRGHDLRLHLDIGVQTLATDALTEAMRTSKGDLGAAVVMDART
                     GAVLALASVPGADNNVYGPPADLVALTAQSQTPGPSPLVNHATQTAVPPGSTFKIVVA
                     SADMQYPVLSPDAVIETGAAYTYGGHTFRNWQPMGPNNLLGAIQWSDNVYFYKLGELL
                     GPEKMADVASQLGAGRRSGIDLPGESEGFLGTPENVGSIGATWYPGSTLLMGIGQGTV
                     SATPIQVARWTSGIATGAMVTPQLAAAYGPELISIPTAAPQRLAFADRLDPVRAGMRA
                     SAAAGTAGQLANLPVPAGAKTGTAEDPSAPGEGLNAWFSAVAPFDAPEIVVSVLVRGG
                     GFGSATSGPVVKKILEHYFPRPPAPAPAPGR"
     CDS             complement(393517..394515)
                     /codon_start=1
                     /locus_tag="ROP_03800"
                     /product="hypothetical protein"
                     /protein_id="BAH48627.1"
                     /transl_table=11
                     /translation="MSDSGHLMIEYGRGAVSGQDVNEAVAGLFRSIASNCRGSALPDR
                     LHESLVETTDLDALLQSVRLAIAPDLDPAEEERKRCQLARLVAATKGRPRPDGPTVEE
                     RAAGEKPPPVAAGSTLASPGWFPPVRNPWHRRRRRPSRRQGALGVVAILILFAAVVAA
                     PRAWSELRRGWDAVLNPVNAEEQNQIRPVSPPPPEPPVGLPTPAMSDAGRVPPPVDVG
                     APGSAGPITLVTATRANGECGPGQACAIRVDVHLDPAATVDAVTWRVNVYDRCSGEVR
                     AGGDVSERVQPGSQQVYGVVRTDLPAGAALAVAAITSAPATAASEPLLMPAENARC"
     CDS             complement(394940..396454)
                     /codon_start=1
                     /locus_tag="ROP_03810"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH48628.1"
                     /transl_table=11
                     /translation="MSRWWPLAAAAVLVVVLALGRVVPVWPGLLHLVALPPLDQFADL
                     RLLLVRTDSWPQFLVLLAVVSAVRILLMAWMLGGLDSRRIRFATAFYATAFGPVLLAS
                     CADATAYAMLYSRAFWPAVALVAVVVWILGPVPWQGGAGLRAAMGRAWRRGLRIEVMV
                     PYCAAILALGALADRVPALTVLLVPVSAAATGLTVWAMDRAPLRRPVAALAAVLVAST
                     VVSVAFVPTRAYDYPEPGPRQAGSLLVMSGIDSRSGEGTMYRADVQRLGYECEQVYYF
                     SYAGTGGGQPRRNAGCPIRTGAPYEPADTQRPVGEQVALFAEQAANLQRPLTVAAHSH
                     AGWIAWEAVAAGRARVDVLILVGVFPETPLGFPPPDVERPGRVFGDLLRWAVPAIEVA
                     FFPFDPDTPAARQLLGEAGSAQAVLGETLPEEVRVLSVASVADLPLMPHGWRLDVERN
                     GCPVRAAHSSLPVSAAFDDEVIRFLNHRDPLPCPAWRDWGAVVMRALGVPPSGR"
     CDS             396589..397110
                     /codon_start=1
                     /locus_tag="ROP_03820"
                     /product="hypothetical protein"
                     /protein_id="BAH48629.1"
                     /transl_table=11
                     /translation="MTFPGGIGEDDHLMDGSEVGSHRSLMTFDQFEDIFRVAASIGVV
                     RDDFHRFDDVVTGKLYDLLLVAQSDAAAQHRNVIELTDLPITRGLQENIGLFRELGPH
                     LRAGPILERLTDYPPLGGALATDTRSGLPDITGGLSVALARTFRIVYPELRTLRARTT
                     HWALVSTLVDLYL"
     CDS             397297..397695
                     /codon_start=1
                     /locus_tag="ROP_03830"
                     /product="hypothetical protein"
                     /protein_id="BAH48630.1"
                     /transl_table=11
                     /translation="MNSTKTRIAAAAATGAAIGLGMFMAQSATAVAAPAQATSPQVVS
                     PDSGLSPYKVEVRDRIGCANAWPMVACDAPDEDVPPQVTLVEPGTTLVEPGGTSLFGP
                     ASATIHQVNYPLEPDDGVISHSLDPDMPWM"
     CDS             397978..399447
                     /codon_start=1
                     /locus_tag="ROP_03840"
                     /product="putative amino acid transporter"
                     /protein_id="BAH48631.1"
                     /transl_table=11
                     /translation="MTTERVMGSKAADQECQDCGYEPELKRTLGSFQVFAVSFAFISV
                     AVGIFGTYDDVLRDAGPVGIWLWVVVALGQILVALVIAQFAARIPLSGSSYQWASRLA
                     NPKVGWLFGWLTFCYLALGVVTVDNAMASSALMPLFGMQPDEGTARVITLVVVLVQAV
                     LVVFSTRLVGLITSGAVGLELVIVVVLAIGLFVAVPITGEGSVGNLTSRGVAEGAPNY
                     FAVGGGLMAATIMGLATLVGFDSAANMAEEAKDPFRSVPRAIVGSVVAAAVLGLVFLI
                     ALTIAIEDVPRISDSDTPVAAILRDQLGPVMERTLLVAIAFAFFGAGMVTLATCSRMV
                     FAMSRDARFPAHRLMRRVNPRTQTPIPATILIVVVGVVLMAALPGGALLELLTVGTVI
                     SAVLYGGIVVLYLAVRTRLDRKEGAFDLGRFELPVAICALVWSAFVVFVIVSPSTALT
                     SILIAVGLLLAGGVYFTYLLIFKRDVLDTEPGDADVFAH"
     CDS             399431..400870
                     /codon_start=1
                     /locus_tag="ROP_03850"
                     /product="putative oxidoreductase"
                     /protein_id="BAH48632.1"
                     /transl_table=11
                     /translation="MSSRTDRAAQHLTTTANVLTGDVVRPGDSGYEEARVGWNRLYSR
                     YPEAIVFCCDTQDVVNAVRWAREEGIALRARSGRHSLDGWSSLDGGLVIDVSRMKDIV
                     IDESARTATVGTGLTQMETVAALGQHGFAVPTGSEGGVGLGGVILGGGFGLLTRSMGM
                     ACDNLLAAEVVVADGARSAKVVEATEHRNSDLLWACRGGGGGNFGIATSYTLRLHELS
                     NVTFLVARWSGHGDLADLLRAWQREAPVADNRLTSALEADSTAVELSALLYGGSRREL
                     EDQLRSLLAIGSPEVTVTEDAWPTVYGDVDRGPNDVPFWKFYSQFVTRPLPDEAIDLI
                     VRFMDNTPSPPSNFFCSSFGGAVRHAPPGGSAFPHRDALFYCEPGAAWNDPALNSAAL
                     GWAADFWRALRPYGDGAYVNVPNAAASDWEREYYGSHRERLREVKATYDPENVFNFEQ
                     SVPLSPADPSRALRWGDGGQPKSQGQGSP"
     CDS             400884..401225
                     /codon_start=1
                     /locus_tag="ROP_03860"
                     /product="hypothetical protein"
                     /protein_id="BAH48633.1"
                     /transl_table=11
                     /translation="MDSVEHDLTDEQWSALTEAWGGCAYCGATDKPLQRDCVQALSRG
                     GRYTLDNIAPACGSCNASKCNDEVTGWLRRKRLDERAFLLRHIEIKSALARRFPAEPD
                     PAIEMPDTAAP"
     CDS             complement(401256..401885)
                     /codon_start=1
                     /EC_number="2.4.2.9"
                     /gene="upp"
                     /locus_tag="ROP_03870"
                     /note="protein synonym:UMP pyrophosphorylase"
                     /product="uracil phosphoribosyltransferase"
                     /protein_id="BAH48634.1"
                     /transl_table=11
                     /translation="MGTVHLIDHPLVQHKLTMMRRKDASTNSFRRLANEISALMTYEV
                     LRDIPMQEIEIETPLEVTTGRVIDGKKLVFVSILRAGTGILDGMLTIVPGARVGHIGL
                     YRDPRTLVAVEYYFKMPGDLHERDVVVVDPLLATGNSAVAAVERLKECGPKSIKFVCL
                     LTCPEGVAALDKAHPDVPIYTAAVDRQLDEHGYILPGIGDAGDRIFGTK"
     CDS             complement(401903..403168)
                     /codon_start=1
                     /locus_tag="ROP_03880"
                     /product="hypothetical protein"
                     /protein_id="BAH48635.1"
                     /transl_table=11
                     /translation="MSVTGVGPVLDVGRADGAAAALRTTTAVRERAQLLVRRAREGGS
                     RWFDVDDGALQTAAGEVVDVTHARYPDLKIPFHSRWRHFEAGGVDRKAELDARLAALD
                     APGRARAMIDLAVVSVLLDAGAGPDWQYREEASGQRFARSEGLGVASWHAFLGGLFSS
                     DGAQPLRVDAAGLRGLDADRLAQAFQVGPSNPLVGLEGRVLLLRRLGEALAVQPDVFG
                     LHGRPGGLFDLLVAPQVPGAATVAAHDILSQLLTSLSGIWPAGNAIGTEPLGDCWPHD
                     SVDGPGLTRGWVPFHKLSQWLTYSLLEPFQWAGVQVVGLDALTGLPEYRNGGLLLDTG
                     VLRLRDPGWAARSWAAGDELIVEWRALTVALLDELAPLVRARLDVDAREMPLACVLEG
                     GTWAAGRALAQRTRGGLPPLSVVSDGTVF"
     CDS             complement(403165..404436)
                     /codon_start=1
                     /EC_number="3.5.4.25"
                     /locus_tag="ROP_03890"
                     /product="putative GTP cyclohydrolase II"
                     /protein_id="BAH48636.1"
                     /transl_table=11
                     /translation="MSAEPVAATPDNPAGHIRLTSHSGGVGAIPVHWGAPTASERGPV
                     VGTTTNRAHRNVIGTHSGSYSIYRALAVASGALSRHHKADLTNTAPTNAVGPYPQWSE
                     PGKIVSLDPWGATVAEVFAAELAAGHDIRPSIAVTKAHVILPEIMDAIQKGRLHPDGR
                     FLLPSGAALVTKAAIEPVWHLPGVAERFHCSETDLRRVLFEETGGMYPELVTRSDLEV
                     FLPPIGGQTVYIFGDARDLADPAVELTARVHDECNGSDVFGSDICTCRPYLTHAIEEC
                     IQGAQRGGVGLVAYSRKEGRALGEVTKFLVYNARKRQVGGDTADQYFARTECVAGVQD
                     MRFQEMMPDVLHWLGVRKIHRLVSMSNMKYDAITGSGIEVGERVDLPADLIPADARVE
                     IDAKMAAGYFTPGAVPDAEELAKVKGRELDE"
     CDS             404636..405997
                     /codon_start=1
                     /locus_tag="ROP_03900"
                     /product="hypothetical protein"
                     /protein_id="BAH48637.1"
                     /transl_table=11
                     /translation="MDLRTQDEADDVFTRGDALQASVPSRAHDHAATGAGRPDVLNFV
                     EADNEGRLTHLVPLRIGRMIASPFAFFRGAAGLMAADLAASPVTGLTAQLCGDAHAAN
                     FGLYGTPDGQIVMDINDFDETLPGPWEWDLKRLAASLVLAGREGGVSESGCVEAAEDA
                     VKSYRRTMRDLAELPFLQSWNALPDKSVLARAKADALLDDFDKAAQKARRNTSEKVAA
                     KWTAHFENHETGIRRRRFVDDPPILTHVDRATADAVTDGLERYVDSLRESRRNLITRF
                     VVSDVAFRIVGTGSVGLRSYIALLHGNRDEVLVLQLKQARPSALAAYLPVDEPKHEGK
                     RIVHGARLVQAESDILLGWTTIDGLPYIVRQFRNLKGDIDPTGLEQDHLDDYGRLAGA
                     LLARAHTRSLDPRALAGYFAGDTELDEAIGRYAVRYADQTEADHAELVAAVKSGRMAA
                     EPA"
     CDS             complement(406017..406367)
                     /codon_start=1
                     /locus_tag="ROP_03910"
                     /product="hypothetical protein"
                     /protein_id="BAH48638.1"
                     /transl_table=11
                     /translation="MESLALASAVVEQLAPVATKSRRTRTGRTVQDVVPAPSIHLRVA
                     VTWVSIFPLVTLGMTVMTLSGPITATWPTWLRALSLTGVVVPTAVYFVVPRILAVALR
                     WLSWRRRRSAATPG"
     CDS             406476..407075
                     /codon_start=1
                     /locus_tag="ROP_03920"
                     /product="putative TetR family transcriptional regulator"
                     /protein_id="BAH48639.1"
                     /transl_table=11
                     /translation="MAWDTERTKRLLLEAGAEEFSAFGLAGGRVDRIAAKAGVNKERI
                     YQYFGKKEAFFSAVVESELTASLDAVELSGEGVSAVADYAGRRFDYQRSHPAFTRLLF
                     WEGLELEKPVAEETRRKHAQTLVAGAQQATGLSEADAQELLITVITLVDGWGTLQTAD
                     RLFSPPPSRRDDRDSRRREFIVMTVEAATDAAIARTDRT"
     CDS             407121..408218
                     /codon_start=1
                     /gene="chaA"
                     /locus_tag="ROP_03930"
                     /product="putative Ca(2+)/H(+) antiporter"
                     /protein_id="BAH48640.1"
                     /transl_table=11
                     /translation="MAFGWRSVAAEWPLVIPPVAVAVLGVTWGRHIGTVVVLAVAVVL
                     VGAVLAAVHHAEVVAHKVGEPFGSLILAVAVTVIEVGLIVTLMISGGPATASLARDTV
                     FAAVMITVNGIAGLSLFVGSRRYGVALFNAEGTGAALATVASLATLSLVLPTFTTSRP
                     GPEFSSAQLIFAAVASLVLYGMFVLTQTGPHRHFFLPVIADEPETGDRSSAPPTGRMA
                     GVSLALLVVALCAVVGLAKVESPAIEDAVEDAGLPQSIVGVVIALLVLLPETLAAVRA
                     AQRNRIQISLNLAFGSAMASIGLTIPAIAVASIWLDGPLLLGLGPTQVVLLAITVVVG
                     MLTVVPGRATRLQGGVHLVLLAAYVFLSVNP"
     CDS             408297..408824
                     /codon_start=1
                     /locus_tag="ROP_03940"
                     /product="hypothetical protein"
                     /protein_id="BAH48641.1"
                     /transl_table=11
                     /translation="MRTASWVSAATAVLLGATAAAAWRKANLADQARHEAEAALEAAL
                     GQLEAMTRIAEAAQQALPRPLEVEFDVQRIRGPVDRFRLHNVGTGIATDVRFVVDPAE
                     EQNRRVPTPQWLHEGAVTLLPKEWADFSASALSPVAGSWRIVFPAFVTVIHDGAGTPQ
                     RVDLPTTVTEDGVIG"
     CDS             complement(408864..409382)
                     /codon_start=1
                     /locus_tag="ROP_03950"
                     /product="putative PadR family transcriptional regulator"
                     /protein_id="BAH48642.1"
                     /transl_table=11
                     /translation="MDERPLNATAASLLGFLHEGSKTGWDLVVTAQERIGKFWSITTS
                     QVYRELAAMERAGLIEAGERGARERKPYTLTDEGRRAFAEWIQREPGPENIRYPLLLT
                     VAFGAHLPPDRLADMVDSHRAAHERQLAEYERDAAVHESNRFALATLDFGIVYERAVL
                     DWFDLVADRLRQ"
     CDS             409487..409969
                     /codon_start=1
                     /locus_tag="ROP_03960"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH48643.1"
                     /transl_table=11
                     /translation="MQYADNIRISDSERDQVVAELGRHLTAGRLTIGEFDQRAAEVYR
                     STTRQQAHQVLRDLPSAAPTVAAASVTTPPTRPARRRIPGHQKIEWLAWAVAGGINIA
                     IWGIVSLATGAMIYAWPVWVIGPWGLVLLGRTVLGRESGCSKFTDALRDDRMRAVASR
                     "
     CDS             410014..410415
                     /codon_start=1
                     /locus_tag="ROP_03970"
                     /product="hypothetical protein"
                     /protein_id="BAH48644.1"
                     /transl_table=11
                     /translation="MKRVVQSRIVSSVAPRSLSHPCTPPGRASQRARTPSMASGTRPR
                     RSRSLGCARPGSGAKQHRSGRGGRHLQDVHEPVPRIEPVAYGYAAQNRPGTPESAEAR
                     KGDQRRRDQARHSLQPTAWGPARTRNRYTPR"
     CDS             410516..410857
                     /codon_start=1
                     /locus_tag="ROP_03980"
                     /product="hypothetical protein"
                     /protein_id="BAH48645.1"
                     /transl_table=11
                     /translation="MPAPMNAQPMTCGDYVTATFARDFVAEGFDHDTVERIHRGLFDE
                     WTHALAQSGLFSNGTVAAALDSWQDDPHSLLTALLANADEITLKRYDLVWEALERSAH
                     AGSADAVVEYA"
     CDS             410875..411147
                     /codon_start=1
                     /locus_tag="ROP_03990"
                     /product="hypothetical protein"
                     /protein_id="BAH48646.1"
                     /transl_table=11
                     /translation="MSPRSPPRPGPTSAAPTTPTTPTNETMSTNTYPTIETIRIGQYG
                     HECRYCGHAVAKDGPGYRHTTTGQFRCDPTSRALQEARLSDSLVRS"
     CDS             411153..411407
                     /codon_start=1
                     /locus_tag="ROP_04000"
                     /product="hypothetical protein"
                     /protein_id="BAH48647.1"
                     /transl_table=11
                     /translation="MNAPAMQLLPPRDGLADYRDAVDALRALETHGSLRADPRTALLF
                     DSLTDDLIEAAQTNEAGDTMSQREVFAMIDFAISRPRPSL"
     CDS             411582..412307
                     /codon_start=1
                     /locus_tag="ROP_04010"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH48648.1"
                     /transl_table=11
                     /translation="MTNDRSESPQSRPKPGGTRRRLPWLLAAAAVAVVGAVAIGAYVL
                     TAGSDDARKAHDFAPSADNPDPSLGIEGIVTVDYPPADHVQAPQRVAYEESPPFGGAH
                     DQYWATCTGIVYPEAIRAENAVHSLEHGAVWVTYDPDHLSADDVTALAAHVDGVPYTL
                     MSPYPGLDSAVSLQSWGHQLRLDDVHDQRIADFLTALRQNPNTYPEPGATCSTVRGGF
                     DPADPPPFDPSAPGPDAVPVDGN"
     CDS             complement(412526..413383)
                     /codon_start=1
                     /EC_number="3.2.2.-"
                     /locus_tag="ROP_04020"
                     /product="putative nucleoside hydrolase"
                     /protein_id="BAH48649.1"
                     /transl_table=11
                     /translation="MFGNCTERQAASNALTVLSVAGLRDVPVCIGRPRPGPPPATPSA
                     HGLDGLGDRGHRPPPDARPAPGSAVEQLFRAAEERPGAVDLLCLGPLANIAAAVTRDP
                     RILTRFRAVTIMGGMGPASRRGAEAAVQPHFLAKGDTNTDHDPAAAAVVAAAPGPITW
                     VGMNVTGRLRLAWADVVARSAPGKVATFVRDITEDYHRHCTTTYRAEHPVYTSHDSVA
                     AAVMLDPAAVLSAIDAHPQVLREDGRSSVWGVARARGTVHRFVIDVDYRSIRDRIAAT
                     LDADISRSD"
     CDS             complement(413485..413850)
                     /codon_start=1
                     /locus_tag="ROP_04030"
                     /product="hypothetical protein"
                     /protein_id="BAH48650.1"
                     /transl_table=11
                     /translation="MTNKAVVSLTTGLEDAEKVTVAFLVAVGAAEQQRQTLMFLTKEA
                     VRLALDGTIQGVACEGCPPLPDLAARFENAGGTYMVCPICFEAKHLDKDALVSNAELA
                     GTVPMWKWIGDEGAVTFSY"
     CDS             413977..414891
                     /codon_start=1
                     /locus_tag="ROP_04040"
                     /product="hypothetical protein"
                     /protein_id="BAH48651.1"
                     /transl_table=11
                     /translation="MFEERPSQQISIVRLEVRRSRSTSANVAEHVGIHPRLLAGIGAE
                     PRQQVRVSREGTTALFTLVPGNGAGGIDTVQVTDGGCRRIGAESGHAVVLDLRCIDPT
                     MSEAEAEVEGEFIERLEDDGRHHRLAVLAPHGGAIESHTDRQAEQVYASLGSRDSTLW
                     TCKGWRPVGNAYRAWHISSGDLSVRSFPLLRSLAARRFRWAVSFHGYRGDDVLIGGRA
                     PARLKSEVLDAVATALDGTGIRVRVADPGERYSGESASNLVNRLTVGAAGGIQIEQPR
                     SARTLYGQAIAAAVGEVCESWIAADSGR"
     CDS             complement(414935..416215)
                     /codon_start=1
                     /EC_number="2.7.11.1"
                     /locus_tag="ROP_04050"
                     /product="putative serine/threonine protein kinase"
                     /protein_id="BAH48652.1"
                     /transl_table=11
                     /translation="MQSGALFGRYRLDRSLSVDENGEVWAAFDTVTARHVTVRALPRD
                     ASEDDEYCDRFVREAGLAAHIRNPHVVPIHDFGQIGNRLYLATPLTGGTNLRTILQAS
                     GPMEATRAAGVVEQLASALEAVHATGLVEQGVTSGNVVVTDGGLVQLTDVGLPAAAGA
                     AAGVPSLSTVLYECLTGGQFASNGRELPSSKFSTLPVGMQAVIARGTAADPGRRYRSP
                     SDLATAAARAAATGPQASADPAPETPPNGRNRRLLLAGLALAAIIAVAIVGGVIIGSQ
                     SSSPDVVVPVPASSAAGPTSATSSTAAANPTAAEQVPPAAEAPVQDEVPPAETPAPQS
                     PVLPVPAPAPAPAPAPAPAPAPAPPAASAPQVLPCYPGYEHTPPPDGPCLPPGSPPVP
                     APAPAPAPAPQVLPCYPGYEHTPPPDGPCWAPGP"
     CDS             complement(416349..416843)
                     /codon_start=1
                     /locus_tag="ROP_04060"
                     /product="hypothetical protein"
                     /protein_id="BAH48653.1"
                     /transl_table=11
                     /translation="MRRAGKILAGIGMATVITATGQGIAVAAPEGTTESVTTLQVPPI
                     GMSPVLAAYFTVDAVTGRVPGVVRFRTVSECYVLNPISADTCIPGPGNAMRANAVRVH
                     WLNMNTGATGAVTIPIGTAGSTDSPRPEIDVATGSGRIVVGTMAPAEYPQALLPGFGT
                     FDVP"
     CDS             417021..417203
                     /codon_start=1
                     /locus_tag="ROP_04070"
                     /product="hypothetical protein"
                     /protein_id="BAH48654.1"
                     /transl_table=11
                     /translation="MRTALCNALFAAFDHRICCGRIPEWTAHVGQTWDTYDIAPWNLY
                     NVIWRIQNWIRCGIRD"
     CDS             complement(417234..417623)
                     /codon_start=1
                     /locus_tag="ROP_04080"
                     /product="hypothetical protein"
                     /protein_id="BAH48655.1"
                     /transl_table=11
                     /translation="MKVTATATRRGGSWVVKVPGVEGAVTEARRLDQISAMVAEAVHL
                     VEGVRAEDVEVELDYDIGDPAALMEARAAHWQVESAAHAQECAARASRAAVAHLRRSG
                     LSVRDIGVILDLSPQRVSQLDRAGLHA"
     CDS             complement(417765..420794)
                     /codon_start=1
                     /EC_number="2.7.11.1"
                     /locus_tag="ROP_04090"
                     /product="putative serine/threonine protein kinase"
                     /protein_id="BAH48656.1"
                     /transl_table=11
                     /translation="MADFDPDATQAASVRAVGHGIVAELDAAGFAGAEEVGRGGFGVV
                     YRCLQRSLGRIVAIKVLTSDLDSENRERFLREGYAMGGLSGHPNIVNILQVGVTETGR
                     PYIVMHYHPRDSLAVQIRREGPLPWPEAISIGVKLAGALETAHRTGTLHRDIKPANIL
                     LTDYGEPQLTDFGIAHIAGGYETATGGFTGSLAFTAPEVLNGESPTARSDVYGLGATI
                     FSLIAGRAAFERKTGEELVAQFVRISTQTVPDLRAQGIPDGVCAVIERAMAPNPFARP
                     ASAEEFGHELQAAQRHIGLRSDAMALAPLEPAQPGQAHPAADAGGYRQIRFEDSDGQR
                     RFFASTEQIQPDSHPSAPFWPPTGPSPWPPPEARGRSGPARGRRRGILIVLALVVTLV
                     LAGGGYLVFREATGPGTAGPIAQDGGEPPAVDPTAAWRPVGDARVARQQTATTVADGT
                     IWVFGGLDDNGVSARQEGYDPAIDTWKAGPDLPVPLNHAMAVTYNDEPVLIGGWQAKG
                     QNLTAVASARVMAMRDGRWVDLPPLNVPRAAGAAAVVGDRIVVAGGQADGELVSPTEV
                     FDGTKWTTVAHIPTSREHLAGVSDGKYFYAIGGRDLASDQNTAAVERFDPVAGTWATL
                     PGMPTPRGGLGATFIDGRIVAVGGEEPTRVLSTVEAYDVVAGSWSQLPALRTPRHGMA
                     VGAVGNTVYAVGGGIKPTHAESTAVSEALQIAPRKTQWAPAWRPLRDAPIARQQTATA
                     VADGTIWVFGGLDNVGSTAKVEGNDPAIDTWKAGPDLPVPLNHAMAVEYGGELVVLGG
                     WVPEGPNLTGKTSDRVLALRDGNWVDLPPLNVPRAAGAAAVVGDRIVVAGGQADGELV
                     ASTEVFDGTKWTTVEDIPTSREHLAGVTDGKYFYAIGGRDLASDQNTAAVERFDPVAE
                     TWATLPGMPTPRGGLGAAFIDGRIVAVGGEQPTRVLSTVEAYDITSGTWSALPPMPTG
                     AHGMSVAAVGHTVYAIGGALRPTHAESTATAQALDFW"
     CDS             complement(421047..422453)
                     /codon_start=1
                     /locus_tag="ROP_04100"
                     /product="hypothetical protein"
                     /protein_id="BAH48657.1"
                     /transl_table=11
                     /translation="MESLPDSGMLLAVLEHSPALVFVSEFVSGRIVYVNPAGVGVLGF
                     GDAVHAYSRTTAELFTDVGLVQAREVESALADRGEWTGLTEFRHFVTGEPIPMLISTF
                     VLEYAETGPSVIGSIAQDRRGAEDDEQRLQRALGESAYRAREQQAIADLSQLAVGGDL
                     DELLSAAAGAAAALMGVHCSSIARVSDDGELTVLAYRGPEPCPKTFAPGPGSQPGYAA
                     ADGSVIVCTDRVHETRFSTAGMSGRGLQSGVCVPFGSDAVWGVLTAHSRRPREYTDRD
                     LTFLRSVTAVLSAAIRRIEAEAALVHQSLHDPLTGLPNRTLARRRLDEALDAVPRGGP
                     RVALLLVDLDDFKTVNDSLGHAVGDDALIVLARHLRSAVRPGDTVARLGGDEFVVVCE
                     HVAGAAEAVAIAARIAGSFADLNRARSLEWPISASIGVALSDPEGTREELVRRADAAM
                     YRAKAAGAGGYALYDDTF"
     CDS             422636..423124
                     /codon_start=1
                     /locus_tag="ROP_04110"
                     /product="hypothetical protein"
                     /protein_id="BAH48658.1"
                     /transl_table=11
                     /translation="MGMRRARWPAFAPPTASGTAVHGPTILASGTHLTLDLLGIVAFS
                     SGIHVRLALTATGRTAERAHHETRLLSDPADPDTQWSYLSVLLQLGSVVGVADPYLPR
                     SGSPRKWGGVPAYRTEPNYWLGTCTRPHDIMISAGWPEIGLGPTCLTALLEPSPSTVT
                     SD"
     CDS             complement(423159..424436)
                     /codon_start=1
                     /EC_number="2.7.13.-"
                     /locus_tag="ROP_04120"
                     /product="putative two-component histidine kinase"
                     /protein_id="BAH48659.1"
                     /transl_table=11
                     /translation="MAESSVLPADLGGSPDLERIVLEHAYRGAHLQLALRGVLVLFIA
                     LTLVFVPPTNDANVCVAVLIGYALWTVGLAMWTRRGGPGPVNAIWLALFVDLAVIGSL
                     TLLTGIAAQQSWTADILTNGLFVIPLLACTQLRPGVCASVVVPTVLVFLAASWATMAS
                     NEEPWSSILLSTMALAILSAGAVVLSRIQRSRVLTIGHLVHDRTALLAELMGLEQRER
                     RALSEQLHDGALQFVLAAKMDLDDLTGGADPEAVDRITHALTESATLLRATVSELHPT
                     VLDRVGLARALGDIVRSAQARGGFDVDLQTVEWDDDLRTSADDVLFSAARELLSNVVK
                     HARARTVRVELSRTGGHAVLDVTDDGCGISREAIDRSLSRGHIGLTSHELRVVAAGGS
                     FSVRPGPRSGTVARIEMPFEVVTASDSLTISAH"
     CDS             424683..425597
                     /codon_start=1
                     /locus_tag="ROP_04130"
                     /product="hypothetical protein"
                     /protein_id="BAH48660.1"
                     /transl_table=11
                     /translation="MTRIRRRSAVALASIAGASVLLLAACTQDASSIDGTESAAPGAT
                     SESPAAEPAVDGVDAKQYASSDPATETYGFVTPSGKWLCAIIPAKQLAGCASHPTAGP
                     LGVPGTPQIASPNGGPPAEADLIAIEAGKEPNFQNWNQALFPGNANVLPYDTTLAVDG
                     FSCNVQFSGVSCREDATNKGFTVSTNGYKFEFTPLPMSVPSASPPPIAPTAAPLPQQA
                     RGSNQCGPITYPETGKPATVVIVKGTLRCDEAHTMLTKYFTGRDKSEPVYSFDGWECR
                     LAGDPESAEIGYTINCTDDNGNSVVAQP"
     CDS             425694..426011
                     /codon_start=1
                     /locus_tag="ROP_04140"
                     /product="hypothetical protein"
                     /protein_id="BAH48661.1"
                     /transl_table=11
                     /translation="MQPPNDQAGTWEGSWLAAMTVIKSAQRVFTPDNRPPSELIPLVE
                     PLSRLGDALRATPPDPEESRRRAADLVADRDLITWACRPDQPRDIRELGATLAFLSMK
                     LTT"
     CDS             complement(426036..426950)
                     /codon_start=1
                     /EC_number="3.1.11.2"
                     /locus_tag="ROP_04150"
                     /product="putative exodeoxyribonuclease"
                     /protein_id="BAH48662.1"
                     /transl_table=11
                     /translation="MRIATFNINGIRAAQRRGFEEWLGDRAPDVVSLQEVRARAAAIP
                     SGVFGRYHLAYDEGEFAGRNGVAILTRHAPLAVRTWSGTALVQAPGETHLERVELDPQ
                     PLARGLGEFANHGRYIEVDLADAPITVVSMYLPKGGLPAHLQKPGRMRDAPDGGARYD
                     RKMRFLSAFARQLTRSRRTARARGRELLLMGDLNIAHTRHDVRNWRRSNQAEGYLPEE
                     REWFDSIVSPRTLVDVVRRHHPGVDGPYSWWSWLGQSFVNDVGWRIDYHLATPHLARA
                     AVTAGTDRDPAADRRMSDHAPVVVDYDF"
     CDS             427108..428667
                     /codon_start=1
                     /locus_tag="ROP_04160"
                     /product="hypothetical protein"
                     /protein_id="BAH48663.1"
                     /transl_table=11
                     /translation="MRIARIRRGVASSALAVSVVLGVATSPAPAIASAETYVFDDVGS
                     TAVPRADCGPGSLPETGMQGDVPAEDRNNGRSTQGYRCNMSLIGGLQDRGGGLLSVTY
                     DHCSYTSTFFPGNLLDPDTPGVQVLDVSDPAQPVLSTTLNEPAMLGGTWESLKVNKAR
                     KLLAATAVPAAAGTGYFSVYDISDCAHPRLLNRGAGTDVTMPLPFLSHEGGFSPDGNT
                     YWVSGPAPGFLTAIDIRNPAEPRITWQGLHGLGGHGFGITPDGNRMYLSNLGGITVLD
                     ISAVQRGDPYPTVPQLATYLWTDGFFNQHSIPVTYGGKPHIFTVDETGGGGIKVFDVA
                     DPAHADIVQKVKLEIQLPANTAANLRSSQGGSVFSYDPHYCVVDRPSDPTALACSWES
                     SGIRVFDIRDLDDIREIAYYNPPAQTGKNLQLTNSPHALSSLIGVSLFDFVPLARAVF
                     EGKADPRVAFGPRAGMVAFGDLSADWCFSPPEFHGNQIWTSCSDNGFMALQLDESVYQ
                     APANQDSTYGQ"
     CDS             428657..429310
                     /codon_start=1
                     /locus_tag="ROP_04170"
                     /product="hypothetical protein"
                     /protein_id="BAH48664.1"
                     /transl_table=11
                     /translation="MASDTRRSRFRRPVVLLLCAVLLGAGGVAAGMWLQSAREQLVGR
                     VQLSPADVGFAQDMSVHHEQAVLIAQTLPRDVDPQIRVIADQIVVAQTSEIATMRGWL
                     NLFDEAFTTAHPMQWMHGSDHVMSEQGGAPMPGTASTSEISRLAGLRGADAEALFLQL
                     MIRHHQGGVEMAEAAIHAVASEPIRRVARGMIRDQSNEIAVMTALLGTRDAKPLPHP"
     CDS             complement(429421..429750)
                     /codon_start=1
                     /locus_tag="ROP_04180"
                     /product="hypothetical protein"
                     /protein_id="BAH48665.1"
                     /transl_table=11
                     /translation="MSATIRSLVIPVSDLDAAKAVYTALLGEPHTDQPYYVGYNVDGF
                     EVALNPGEEGGGPVAFADVEDLDAARATLLEAGATERSAPRQVAAEARVCVLADADGN
                     PIGLRGK"
     CDS             complement(429868..430602)
                     /codon_start=1
                     /EC_number="3.1.2.-"
                     /locus_tag="ROP_04190"
                     /product="type II thioesterase"
                     /protein_id="BAH48666.1"
                     /transl_table=11
                     /translation="MKWIRCFQASPNASGVLLCFPHGGGTASAYRTLAEALFPRIELL
                     AVQYPGRQDRIGDEMMSDIGAIAEQVVCESTPPAGSRLAVFGHSMGATVAFEAARRFE
                     QQDHALAALFVSGRTAPSVVQPTTLHLERDQALLDDMRRLGGADSNVVQMLVENPDLA
                     EMVLPSVRNDYRAVETYRYRPGPDVSCPIVAIRGDSDPSVSGTDMRLWSKFTTGSFDT
                     REFSGGHFYLDDHVDEIASLVGSRFD"
     CDS             complement(430705..431088)
                     /codon_start=1
                     /locus_tag="ROP_04200"
                     /product="hypothetical protein"
                     /protein_id="BAH48667.1"
                     /transl_table=11
                     /translation="MMTPPDEYVSVRYLVDDVAAAIDFYTSHLGFTLHTNPAPAFADV
                     TRGSLTLLLSGPASSGARATPADNAGAGRNRIHLIVGDLDDEVTRLRDAGVTFRSDVV
                     VGPGGRQILLADPSGNLVELFQPAT"
     CDS             complement(431396..431770)
                     /codon_start=1
                     /locus_tag="ROP_04210"
                     /product="hypothetical protein"
                     /protein_id="BAH48668.1"
                     /transl_table=11
                     /translation="MEWSVARVAGDDRDTAGPSAAADRGSSGSGYRPSLESAPNPTPR
                     RAVRQLRCLRLRSHRRSTFCDRRSRYRGARTLYCPPNEEHWHGAGTDSFMEHLAMLDN
                     ADDPATTTTWLEHVTDDEYLAE"
     CDS             432016..432723
                     /codon_start=1
                     /gene="mspA"
                     /locus_tag="ROP_04220"
                     /product="putative porin MspA"
                     /protein_id="BAH48669.1"
                     /transl_table=11
                     /translation="MTDISTSRFGYKRFTRTVAVAGIAALAMVMGNGSASAGVDNSSS
                     VIDARGNRIEVVQGDTQYQTVPPLDGVPTSVEFFHNGYAGVAITGPNSEEFEGTQLTV
                     GYQIGYPVALAGATIVLNTPGLGFAIGSSNGIDIGFGPMGFESLGLSAGTNAELAGDI
                     IPSQELDIDLEPGGITTVPILEGQEFDGSAAVVRMQGVHGSISGAIGPVTIRPYAMAV
                     TSNGDTVMTYGVPQKLN"
     CDS             complement(433001..433489)
                     /codon_start=1
                     /locus_tag="ROP_04230"
                     /product="carboxymuconolactone decarboxylase family
                     protein"
                     /protein_id="BAH48670.1"
                     /transl_table=11
                     /translation="MGDRIPPPLDNLLEGNIMTSVNLSKQHPSVYKSLMKLDADVKAA
                     LETAGVDPLLVELVKIRVSQLNGCAFCLRMHTRDALAKGETTDRLAVVAAWWEAQYFS
                     EKERAALALAEQVTALSVPERRAWDDGSLTDEQVSAISWLATVMNAWNRVAVTSHYPV
                     TP"
     CDS             433889..434269
                     /codon_start=1
                     /locus_tag="ROP_04240"
                     /product="hypothetical protein"
                     /protein_id="BAH48671.1"
                     /transl_table=11
                     /translation="MTSIKTRTAVAAAAGVAVGLGVLMAQGATAGAAPAAEVAPDAVS
                     PYTVQVRDRIGCADAWPMVACDAPDEDRPPQVTLVEPGTALTQPGGTDLFGSSSAPFH
                     AANYPLEPDDGVISHSLDPDMPWM"
     CDS             complement(434764..435630)
                     /codon_start=1
                     /locus_tag="ROP_04250"
                     /note="fragment"
                     /product="putative aminopeptidase"
                     /protein_id="BAH48672.1"
                     /transl_table=11
                     /translation="MLGVSYGTLIADRYARRYGDHVNRFVLDSVVGPGPDGRDDWHAF
                     GLRQAEALLSQRETMIGWWAQHAERFGLGSDPVAVRRNYDVARHLPPSGRIGADEFDR
                     AVYRALGRTERWQPLGDALARALHTGDLQTLEAVVPGIDDERRNSEAANRTVVCADST
                     ETLPPTAILAGRSALRELDPQPIVTGLEAEVCAFWPMDRPTEPMPAAQPEVGAHLLLV
                     AGTHDPVTPVTDAERRHRQWPGSGLITSAQTWSHGVFASQRIDCVDEAVADFLLGASA
                     SVRQCTGPGLPR"
     CDS             complement(435688..436338)
                     /codon_start=1
                     /locus_tag="ROP_04260"
                     /note="fragment"
                     /product="putative aminopeptidase"
                     /protein_id="BAH48673.1"
                     /transl_table=11
                     /translation="MVFPYGDLRPFAICLSARTSAAVALAFALLIGGSAPLSAALPTL
                     ENTSGGDGGRATLHFGPCSAITGTDDLGMQGLECGTLLVPLSSDDPGAGTVHLAVSRL
                     RATDPAARRGMLLVNPGGPGGAGLEYAATKGAKLPQRVLAAYDIIGFDPRGIGHSVVS
                     RPNTGQPPSSLNCGPMGGNFDRPVPPTKDLTALPALAATAGDCAAAIGPHAADFGT"
     CDS             436411..437697
                     /codon_start=1
                     /locus_tag="ROP_04270"
                     /product="hypothetical protein"
                     /protein_id="BAH48674.1"
                     /transl_table=11
                     /translation="MAHLLLVESWVGAMGTLLPRAVAELGAEFTFLTRRPEHYPQSAP
                     DGLPHPLRLGRGVVTAETNDPATALAAARTLHADTPIDGVLTSCDYYLPLAARIAAEL
                     GLPGPTPAAVVAACNKALTRAALDRCDVPGPRHVTVPADDQQRLRTGAEMVGFPLVLK
                     PTDLCAGMFVRRVEDWAALDTAARDLLRFEVNARGQRREPVVLLEEFLEGPEFSVESW
                     IRDGEVHTVGVTDKSLGGASGFVETGHMFPADVGDQDHARLVAAAEAAIRAVGLDHGV
                     VHTELRLTAAGPRIIEINPRPAGNQITELIRHVTGIDLPRIAVELALGREPALPTVPN
                     GQRGGSRALSAAVSMLVPARAGILTGIEGTEAVAADPAVIAATFKAPGHRTTVGVDNN
                     SYLGSVIALSHEQSGARRLAEGLLSAVSARYEEPAP"
     CDS             437694..438536
                     /codon_start=1
                     /locus_tag="ROP_04280"
                     /product="hypothetical protein"
                     /protein_id="BAH48675.1"
                     /transl_table=11
                     /translation="MTPGAKTNAHTGPAAALLDRYRTDPALIPPAAVMVSTAFTTFQG
                     VRHSGRSAGYRNQVISLRVGGATGSCAVEPGSVDPDVIHACAGVPVAELLRHDELAVR
                     VAALDSYLAHQRPHAFDSRADTVHVAPGDSLQRSLARARAVTGLLDAPRQGRVLVIGV
                     VNSLLACLRERDLRYVPCDLKGGKTEWGEPIVTEFADGLDDCDAVLASGMMLGNGTLD
                     RLLELVAASGRAVPVALFAQSGAAVARELLGHGVDALSAEPYPFFWLTGDTSTIHLYR
                     AQPR"
     CDS             438533..439606
                     /codon_start=1
                     /EC_number="2.5.1.47"
                     /locus_tag="ROP_04290"
                     /note="protein synonym:O-acetylserine (thiol)-lyase"
                     /note="protein synonym:O-acetylserine sulfhydrylase"
                     /product="putative cysteine synthase"
                     /protein_id="BAH48676.1"
                     /transl_table=11
                     /translation="MTVIEPRWRVGHSPLVRITTPVPRRHPGYFAKIESLGLGGLKAR
                     SALSMLVGARRRGELRPGARVVESTSGTLGVGLAYVAQSLGHPVTLVVDGELEPAMRN
                     LLRALGATLEIVERPHPEGGWQQARLDRLSRILATDAGAYWPNQYDNPDNAAGYHGLA
                     DEIVAGLAAVGIDRADVLVCSVGTGGHSSGVGLRLRQVWPGLRIIGVDALGSKIFGQP
                     AGRRLMRGLGSSVHPGNVRYEMFDEVHWVGPREAVHACRALARGGFHTGGWSTGAAAT
                     VAGWAAAQGSGSVVTIFPDGPDRYLRTIFDDDWCRGRGLLDPPRTQPHEIDDCRDHTE
                     CWTRCQSVLAPHSLAGDGTKAAG"
     CDS             439603..440634
                     /codon_start=1
                     /locus_tag="ROP_04300"
                     /product="putative dipeptide epimerase"
                     /protein_id="BAH48677.1"
                     /transl_table=11
                     /translation="MRLTWSVSTLELTQPFRISRGVMASRAAVTITLVGADPTIVGRG
                     EVVTSPYADLSLDRIEAQLAVIHGHCGDDGADLDPVLAEVHPAVAAAVWSAVAEHRAR
                     AGGRSLAAHLGVPLPDTVPISRTVGIGTPRSMAVEAARLAADGVRLLKVKTDADRTES
                     ARRLAAVAAAAPAAELIVDPNEAWTAASALGVLADTQGLPVTALEQPLPAGDRDGTRE
                     LRSRTDIPLIADEAVHTLTDLDRLDGLADVVNIKLPKCGGIYRAQEIAIAAGERGLEV
                     MLGCLVCSSLGIAPAVHLASLARWCDLDGHLLLARDPWTGLGGEDGVLRPSGVAGLGV
                     RRREEDDPR"
     CDS             440631..441887
                     /codon_start=1
                     /locus_tag="ROP_04310"
                     /product="putative MFS transporter"
                     /protein_id="BAH48678.1"
                     /transl_table=11
                     /translation="MTETHSGAGTLALLRSFPRSVQLLVLNQYGVNTGFYMLVPYLSM
                     HLTGNLGLSLTITGLVLGIRTLSQQGLFLVGGTAADRLGPHRVIIAGCALRSVGFAVF
                     AFGTSVPLLLLASILSGLAGALFNPAVRSYIAVAEPRRRAEAFAVFNVFAQAGALSGP
                     LIGTALLAVDFRTVALAAAVIFAALTAAQLRLLPAHPVKPAESTVLRGWGVVLADRRF
                     VLFTLAMFGMFVLQTQMYLVYPVLAGRITEWAGAVAVLFLSTTVFSLLFQVRITRWFA
                     GRTSRGTAIAVGLALMSGAFVVLLPVLWADPGRVVWQVVLALGALVLSALILESGIMI
                     AQPFVMELIPAYGDSRISGTLFGMFYLVSGVVAAGGNALIGYGIELGNGWPGALVCIT
                     LGAASAAGIWLLQCRRLLAEPAGVKA"
     CDS             441884..442720
                     /codon_start=1
                     /EC_number="2.1.1.-"
                     /locus_tag="ROP_04320"
                     /product="putative methyltransferase"
                     /protein_id="BAH48679.1"
                     /transl_table=11
                     /translation="MTATEARNLLTDNPELYEARFPDPDHAAGRFVDDVLGAHLPPAM
                     SGHPERPVTVLDLGCGTGRDLGFLADRGYRCLGIDQSSAMVEFAQRRYPGVSASVGDL
                     RNFQLGETVDAVICLDSSLLYCHTDDELESCLRCCRSHLRTGGLLVAEMRNGAFFLGS
                     TDLLDGPRRSSFEWQGRTWRAETTLWIDHAAQLLRRRRQWQIPDSAAELVQTSAWRLL
                     FPLELTGHLRRAGFTVRAMFDTPGPRAEAGWPTGSERDPLTRVGEGTMSGDRLHVIAE
                     AI"
     CDS             442783..444360
                     /codon_start=1
                     /locus_tag="ROP_04330"
                     /product="putative ABC transporter substrate-binding
                     protein"
                     /protein_id="BAH48680.1"
                     /transl_table=11
                     /translation="MNPVPRSPLSPLPYLSRRSFLGLGAAATGAVLIGACSTGDTGTQ
                     VTSTPRDGGRLRAVFAGGGAQEVLDPHKTNLYADVARSNALYDKLVEYGDDLGPVPRL
                     ATAWRPNADATTWTVQLRPAVFHDGRPVRAADVLYSYQRILDPKNALRPRASLEVIDI
                     ARSRQVDDRSIEFVCTRPCGDLANVLAAFGAYIIPEGTTDFTAPIGSGPFTFVSFAPG
                     RSFVAARFGDYWDGPPHVEQLEILTAPDETARINALLGGQVEYADDLGVTSARTYETD
                     ARVQILRSPRSAMSGFAMKVDRPPFDNLDLRRAMFALTDRDELVSTVLGSTGVVGNDL
                     FGKDTKYYATDLPQRSLDLDDAKTLIRKAGAQNTTIELQTTGATNGFVEAANILAEQA
                     ARAGLTIDVKVGEGSTYWTRTLDEGVLSSFRSGAMPIETHLAQRMLSTSSKNYTQWRR
                     PDFDALFATASETTDEAVRARAYRDMQSQLYTEGGLLVWGFSDGLHGLAPNLAGMARS
                     APSNTLGYARFDKAWLS"
     CDS             444357..445307
                     /codon_start=1
                     /locus_tag="ROP_04340"
                     /product="putative ABC transporter permease protein"
                     /protein_id="BAH48681.1"
                     /transl_table=11
                     /translation="MILTRYAGMRVALGLAQVLGVLVVVFLVASVLPGDAAVVIAADD
                     ADPARIAQLRETLGLDRPLLVQLGDWLAGLPRADLGTSAVSGRPVAEILSAALVPTLT
                     LAALALAVLIPLAVGLGVAAAVGRGRRVDRTISGVVVALYAVPEFALAIVLVAVFAVG
                     LGLFAPTAVGAGGPLLWQPELWVLPVAVLVIRPVCSLSRLVRASMITTLESDYIRHTL
                     RLGVPGRRVVWRHALPGSLTPAAAHLARVADWLLGGVVVVEAVFALGGLGQVLVSAVS
                     SRDIPLLMGLAALFAVITVAVNTIADIVAFRLTPTAGGTS"
     CDS             445304..446140
                     /codon_start=1
                     /locus_tag="ROP_04350"
                     /product="putative ABC transporter permease protein"
                     /protein_id="BAH48682.1"
                     /transl_table=11
                     /translation="MTAPGRVLSRLPRQRYLVGLLLTAIPLLIAVLGPLIAEPAGRGP
                     AFTLGENWLLGTDSEGRDVLNQLLLGGRSLVSVATAAVLVTYLLAVPWGVAAATTRRR
                     IVDEALMRPLDLLLSLPSMLLLLLVVALTGADTLVLAVTVAVLLFPDAARMVRASALH
                     AAHTPAMEALGLQRETWWRRNIGYLGRSLLPVLAADAGLRFVGAIYLVASASFLGLTA
                     DSTGTDWAVMIDRNRSGIALVPWGVVVPAVMIIALAMGVNLLFDAGARAATDHSSPKD
                     PE"
     CDS             446137..447576
                     /codon_start=1
                     /locus_tag="ROP_04360"
                     /product="putative ABC transporter ATP-binding protein"
                     /protein_id="BAH48683.1"
                     /transl_table=11
                     /translation="MTDTVQELHTRPSVIRVRGLTATTRDRTLIAGIDLDIPGGLVTA
                     IIGSSGSGKTTTALALMGEHRPGVTLSMDCRDTAGARFGYVPQQPSSVLSPFLRIGAV
                     LRDIERAARRAGHKVSVPDALQRAGFPSDPVMLRRYPHQLSGGQQQRLVIAHALLTNP
                     TCLIMDEPTTGQDPANRAAVLDEITRLSRQGLTVVLLTHDLDAVRAVAQKVIVMAHGH
                     IVEAGDAGVLDGSVHEQTRALVDAQSRLRRHRPSRHPSGRRGTRLTVDAVTADFRKSS
                     ILHDFSLSLDPGECVALVGPSGCGKTTAARVIAGLHQPAAGRVVLDGCALAGATRRRT
                     RQQVAAIAYVFQDAKAAFDPYRSVWEQIVRGPLQLRGATHAEATAAAGTALDQVGLDK
                     RIARQRPYALSGGEAQRAAIARALAVAPSVLMCDEVTTGLDTVSQRRVLDILSELTRA
                     RNVSLLMISHDAAVVHAVADQVVDMAGAH"
     CDS             complement(447612..449822)
                     /codon_start=1
                     /EC_number="3.6.3.-"
                     /locus_tag="ROP_04370"
                     /product="putative cation-transporting ATPase"
                     /protein_id="BAH48684.1"
                     /transl_table=11
                     /translation="MSADPVASDTPTGLAVISDAAGRMRVHLPWLRASAGRAVAIEDA
                     VAKISGVRAVHAYPRTGCVVVWYSPRRLDRDELLDTIAAGEQTPWSLVPDRSPRSAEV
                     GNADIVRMAIGGAALILLGIRRYGLRRAPLLGPSSRLFATGATIFTGYPFLEGALRTL
                     AGNRSAGTDALVSAATIASLVLRENVVALTVLWLLNIGEYLQELTLRRTRRAISDLLK
                     GTQDTAWIRLADASEISVDIDSLQVGDEIVVHDHIAIPVDGVVVDGDAIVDQSAITGE
                     TLPIATSVDHLVHAGSVVLRGRLVVRATAVGNETTIGRIISQVEQAQDHRAPIQTVGE
                     NFSRRFVPASFGLSALTLVLTRDVRRAMTMLLIACPCAVGLSTPTAISAAIGNGARRG
                     ILIKGGSHLEQAGRVDAMVFDKTGTLTIGRPIVTNVVAFEPEWTPERVLAYAASSEIH
                     SRHPLAEAVIRSTEERHILIPPHEQCEVLVGLGMRTWADGRTLLLGSESLLREENVQV
                     SAEAAEWVRSLQQLAETPLLLAVDNILVGLISLRDEVRPESLDVLSRLRADGIRRIVM
                     LTGDHPMTAATVAAELGIDEWRAEVMPDDKLLVVRTLQAEGHIVAMVGDGTNDAPALA
                     AADIGIAMGLAGTDVAVETADVALASDDLRRLLDVRDLGAHAVALIQQNYAMAIAVNA
                     IGLLVGAGGVLSPVLAAILHNASSVAVVANSSRLITYQVQQPMPSRRRAGPASN"
     CDS             complement(449824..450108)
                     /codon_start=1
                     /locus_tag="ROP_04380"
                     /product="hypothetical protein"
                     /protein_id="BAH48685.1"
                     /transl_table=11
                     /translation="MALHILLVKAASTVVTGAVGVAAYNAARKVVAKAPLHEAAVTAT
                     AWGLRGARKAEEGAESARLKVSDVVAEARGRIGEEVPPPPDPEIGHGHNH"
     CDS             450281..450436
                     /codon_start=1
                     /locus_tag="ROP_04390"
                     /product="hypothetical protein"
                     /protein_id="BAH48686.1"
                     /transl_table=11
                     /translation="MHRLDLSGARLDPSDSRQFAAAAAIELEAGRRDPYRQLSRIFHL
                     VGRKGPN"
     CDS             450482..451993
                     /codon_start=1
                     /locus_tag="ROP_04400"
                     /product="drug resistance efflux protein"
                     /protein_id="BAH48687.1"
                     /transl_table=11
                     /translation="MRSERSASLGVFMKTASPRTHYQLTFTVLTIGVGAFALLQSLLM
                     PVLPTLESALGTTQADVTWVLTAYLLSASIFTPVMGRLGDMHGKKRVFVLALAALAVG
                     SLLAALATSLPVMIAARAIQGIGGGVLPLAFGIIRDEFPEEKVAGAVGVIAALTAVGA
                     GLGIVLAGPIVTVLSYHWLFWIPLIMVVLAGAAAQMLIPESPVRTAGKINWLTALLLS
                     GWLVTLLLGVSQAPAWGWGSPIVVGLLVAAAVIVVTWVAAEARSSNPLIDMQMMRVRS
                     VWAANLLALLMGVGMYAAFGFLPQFLQTPTAAGYGFGASVTESGLMLLPLSVGMFLLG
                     LASGRLAARLGSKCLLIAGSVVSAIGYFVVAFAHQTETEIYLATSLIGIGFGLAFSAM
                     SNVVVAAVPSEQTGVASGMNANIRTIGGSLGAALMASIVTAGASAEGVPPESGYTHGF
                     VVLGTAVGLGAVAAMFIPAMKRGDITRLEESTALRHPELAMVAGGTLVGDEPE"
     CDS             451990..452634
                     /codon_start=1
                     /locus_tag="ROP_04410"
                     /product="putative TetR family transcriptional regulator"
                     /protein_id="BAH48688.1"
                     /transl_table=11
                     /translation="MKSDVKVQGNEKALRRDAAENRQRLLDAAATVFSERGLDVGVDE
                     IARVAGVGIGTLYRRFPTKDALVSELVRQVFDDFLAVANEALSAPNGEGLEQVLYGTG
                     AILASNRGCLSRMWNDDETRILRDEYRRILFELLARAKQHGRIREDATDADLDLIFWS
                     VRGVVATTRGVTDTGWRRTMAIMIAGLSPGADTLDASPMSAQHVAQIIDNMSAR"
     CDS             complement(452661..453962)
                     /codon_start=1
                     /locus_tag="ROP_04420"
                     /product="hypothetical protein"
                     /protein_id="BAH48689.1"
                     /transl_table=11
                     /translation="MAEIRVSASEVRLALSRFERFAGLHGNVAVPMPLIRGAEVIADP
                     FANIRGVRAPGLGIPRRLCIGTWRGRGVRSFVAARAGVPAIRVRTLGRGAGAEFDELI
                     VTVSDPGHVVAQIRDVLDPGRVRAVEREVRFRSGDGTLLAGTATVPAGAEGGPAAVIL
                     TGSGRLDRDGDHAKLPIGVSRALADALARAGVASLRYDKRGVARSGGDYLSTGLSDNI
                     ADAAAAVDWLRTTGGFGRSSIAVIGHSEGACLAVALGADRGVDPAAVVLLACPAVTGR
                     QVLQWQSGEAVDGLPSAVRVVLRALRIDVKERQRVALEKLSRTTTDAARMGGRRVNAR
                     WFREFLDFDPKPLLRENLAPVLVITGAKDVQVDPEDLAVIAELVPGGADTVQVPDLTH
                     LIRRDADPPSLRAYRRLVRDAVDPEVLSLVADWTAGHLRRV"
     CDS             complement(454130..454615)
                     /codon_start=1
                     /locus_tag="ROP_04430"
                     /product="hypothetical protein"
                     /protein_id="BAH48690.1"
                     /transl_table=11
                     /translation="MPVTNVSQDTDALTLTITAEFAAPRARIWQIYADPRQLEKVWGP
                     PTYPATVVDHEFAAGGRVTYFMTGPEGEKYAGYWNIISVDEPTGFTFTDGFADADFTP
                     IESMPVSTNEFSFAEKDGSTVATYVSTYATAEGLQKVLDMGVVEGSSQAIGQIDDLIK
                     G"
     CDS             complement(454619..454960)
                     /codon_start=1
                     /locus_tag="ROP_04440"
                     /product="putative ArsR family transcriptional regulator"
                     /protein_id="BAH48691.1"
                     /transl_table=11
                     /translation="MSETDEDRADALFHALSDRTRRDIMRRVLAGEHSVSALAAKYDM
                     SFAAVQKHVAVLHKAGLLVKRRSGREQLATGDVEAVRAVSSMLAELEQVWRGRISRID
                     ELIATEPLRKE"
     CDS             complement(455356..455670)
                     /codon_start=1
                     /locus_tag="ROP_04450"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH48692.1"
                     /transl_table=11
                     /translation="MRRASSGVEGNGMFGTGLGAMVGLLVVALLVVPVSFGVAARADA
                     KARRLSESPASDANEGLSVAVAEMTGRCDQWRQLATQAWLICGGASLVAVVVVGVLIC
                     VG"
     CDS             complement(455804..456010)
                     /codon_start=1
                     /locus_tag="ROP_04460"
                     /product="hypothetical protein"
                     /protein_id="BAH48693.1"
                     /transl_table=11
                     /translation="MYGVHRHRRGSQEPLHVKERVVMARISKKSGADLLDALRVSVIG
                     TVVCAGLVMGVIVVTMWNFPVPGV"
     CDS             complement(456609..457211)
                     /codon_start=1
                     /locus_tag="ROP_04470"
                     /product="hypothetical protein"
                     /protein_id="BAH48694.1"
                     /transl_table=11
                     /translation="MMTRLQVAIAVIVGYWLGRTHHTKPGMMLAAAGAGRLAGSPQEM
                     VDHAAKLLQASPEFAALDESVRGQLLDAVRVAAVTAGTARADVDTDIDRLLPSGSDDA
                     LRTAEDLAEDTAALVDDIPAAAPVEDVPDDIDADIDIDTDNDAQADDAPTADDGNAAA
                     PAPSTAEVRTWAREHGFPVSDRGRLRAEVWEAFAAAHPER"
     CDS             457418..458605
                     /codon_start=1
                     /locus_tag="ROP_04480"
                     /product="putative drug resistance efflux protein"
                     /protein_id="BAH48695.1"
                     /transl_table=11
                     /translation="MTEGRSGRAAAAHRRMRPLYAAGFTTAFGAHAVAANLAFDLEDP
                     AGSLLYLGLLLALYDGAEVLLKPVFGTLADRIGARPVLLGGLIGFAAASVFFVVVGDS
                     SWLWLARLGQGVAASAFSPAASALVARMTPKAAHGSAFGTYGFYKGLGYTIGPLLGGA
                     LVWLGDLTLLFAVMTALAVTVAAWAARVVPALPPLPRNRQTVLDLARRLSDRTFLRPT
                     LALAFATSALSVGVGFLPVAGAAAGLGSVATGAAVSVLAACAALVQPRAGRALDAGRI
                     SAGPGTALGLLITATGLGCAMLPGLLGVLLAALAIGTGTGLITPLAFASLAGSTPDER
                     MGQTMGAAELGRELGDAGGPLLVGGIAAVATLTVGFGALAALTLVAGAVTAAAGSARA
                     GQP"
     CDS             complement(458644..458910)
                     /codon_start=1
                     /locus_tag="ROP_04490"
                     /product="putative Xre family DNA-binding protein"
                     /protein_id="BAH48696.1"
                     /transl_table=11
                     /translation="MVRSPLTPQQRAAGKRLGAYLRQARGDRKPAEVAHAASISPETL
                     RKIETGRLATPAFTTVAALAAVLAVPLEDLAQICLPELNLQQTG"
     CDS             458994..459779
                     /codon_start=1
                     /EC_number="3.4.11.18"
                     /gene="map"
                     /locus_tag="ROP_04500"
                     /note="protein synonym:peptidase M"
                     /product="methionine aminopeptidase"
                     /protein_id="BAH48697.1"
                     /transl_table=11
                     /translation="MEDERVLELKTPREIEAMRTTGAFIAELLDDLQSRAAVGVNLLD
                     LEHRARHLIKDRGAVSCYWDYAPSFGRGPFHNVICLSVNDAVLHGLPHDYTLRDGDLL
                     SMDIAVSIDGWVADSARSLIVGTPHAGDQRLIEATERALDAGIDAARPGRRLGDISAA
                     IGAVATDYGFPVNTEFGGHGLGRTMHEDPHVSNQGRAGRGLVLRPGLTLALEPWFARG
                     TDKIVYDPDGWTIRSADGSRTAHSEHTIAITDGDPLVLTRRSA"
     CDS             complement(460014..461186)
                     /codon_start=1
                     /EC_number="3.3.2.-"
                     /locus_tag="ROP_04510"
                     /product="putative epoxide hydrolase"
                     /protein_id="BAH48698.1"
                     /transl_table=11
                     /translation="MPRPASDVQAFEAHATDAELDDLRARLAAVRLPETETVFRDAPD
                     PRRWEQGVPLADLVEVVNYWRTGYNWRSFEARLDRIGQFRTTIDGLGIHFLHRRSARA
                     DATPLIVTHGWPGSIAEFVDVVDELADPTDADAPAFHVVVPSLPGFGYSDKPATTGWG
                     IEKIATAWVELMGRLGYSRFAAHGGDWGGVITTVLGGRFPAHVLGIHTTTAQAPPGLT
                     TDGLTAAERKWTEDTRDFWRHHAAYAKQQATRPQTIGYSLVDSPVGLLAWILDKFAEW
                     TDTEDSPFETISRDRILDDVTLYWLTRTGASSARIYYESHNSLDPELRVDVPSAISVY
                     PRDIEKCPRVWAQERYRQIVRWRSPETGGHFPSLEVPEYFVRDLQEGLAAVLAADR"
     CDS             461290..461877
                     /codon_start=1
                     /locus_tag="ROP_04520"
                     /product="hypothetical protein"
                     /protein_id="BAH48699.1"
                     /transl_table=11
                     /translation="MRAGFPDFRLGNVLATSFTGTLSERHGNAVERIPTPHRLVDWLA
                     ANGLVVDFCTTTQLELARELRESIHAASTAVASQDDLPASAVRVINDCSIRGRAAAIL
                     TPEGNRRWRLSSPSCVEDALGVIAADAISIIAGERDGKFALCASPTCRAAFFDTSQSR
                     TRKWCDMNTCGNRQKKARFNANHRKNPDAPRAPRI"
     CDS             complement(461915..463267)
                     /codon_start=1
                     /EC_number="1.4.3.-"
                     /locus_tag="ROP_04530"
                     /product="flavin-containing amine oxidase"
                     /protein_id="BAH48700.1"
                     /transl_table=11
                     /translation="MMDCDVVVIGAGLAGLTAARALTAAGRRVRVLEARDRVAGRNLG
                     GRLANGVAVEMGGQWIGRTQTEVLALAGELGLETFPTYDEGAAVTLYKGKVTRYSDET
                     FGLSEEAAVEVGRLQHELEELAETVSLSAPWTSPDAIELDRKTLDEWLRANTDDPEVR
                     AFWDAVVPALFSAAPAEMSLLHFLFYIKSGGMIDALVATTGGAQELRVVGGTHQISER
                     LAAELGDVVRLNSPVHTITHDDSEVRVDFDGGTVTAAHAIVAIPPTLAGRLRYRPALP
                     GSRDGLTQQIPMGSVIKIQIAYPRPFWRESGFNGFAFNLDDELSVTLDNSPTDGSCGV
                     LVGFFEGPHARSAARRTPAERRAAVVATLVKLFGPDAGEPIDYLEQDWMAEEYTRGCY
                     GGRLGAGVWTQYGAALAEPIGRLHWAGAETSDIWNGYMDGAVRSGRRAAAEVLAQLNS
                     "
     CDS             463379..464017
                     /codon_start=1
                     /locus_tag="ROP_04540"
                     /product="putative TetR family transcriptional regulator"
                     /protein_id="BAH48701.1"
                     /transl_table=11
                     /translation="MAYVKASEREEQIVAAAIREFSETGVPGTTLRAVAGRAGIPLGT
                     LHYVFPSKERLLRAVIATVINEIAETLRAELEADKGVEHALRHGVGNFWKKLVTSRVG
                     LQIMQYELMTYSLRSDSDGDLAQLQYERYSALVTDFCEQAAQAAGERCAVGFDSLGRI
                     ALAQVDGLILQYIAKPDPDRARRDLDHALNMLVLYADPQPVTRTKAPKAETA"
     CDS             464175..465545
                     /codon_start=1
                     /EC_number="1.4.3.-"
                     /locus_tag="ROP_04550"
                     /product="putative flavin-containing amine oxidase"
                     /protein_id="BAH48702.1"
                     /transl_table=11
                     /translation="MTQHPTGSSNDEQAPSRKTTVAVVGAGMSGLIAARALQRQGLDV
                     LVLESADRTGGRMMADTSALGSRFDLGGQWIGHGHHRFSALAAELGTTVFPMHTPKRP
                     TVVRHGRTLSAVSPSTLLASAALVVWQIRAKRGAPKRWNSTTVQEWLNSLPSAGARRL
                     LEVLVEVSTTADLERFSMDAFAKMIGYQGGLSTMLSTNGGAQESLIVEGAGTLTDRIA
                     AELGPRVLTGSRVTSISRDGHGVVLRSPTALVRASKAIVSVPPPAAAAIAFDPPHPAG
                     RHRLEQNTYMGSVYKAVAVYRQPFWRSTTDAEFMFLDHPGFAVFDTSPPGGPGHLCVL
                     VGGREARELDGLDEAGRRRAILGPVAAAIGSPEILRPASWHEKSWHLDEHAIGGYSAL
                     PTAGNPEGAFPFPSDPIGDIHWAGTETASEHAGYIEGAIESGERAAREVIQALRHTTA
                     AVIRSQ"
     CDS             complement(465612..466115)
                     /codon_start=1
                     /locus_tag="ROP_04560"
                     /product="hypothetical protein"
                     /protein_id="BAH48703.1"
                     /transl_table=11
                     /translation="MANQTRWSWPAVGVALIAVAAVTWLAAVVIADVRRAPDAECLAV
                     DSTVTDLIASRPVADPIEPVDAVAVRDPWTRSSGSVPFDNYYAIAMEFRSSDGSISHG
                     VWGLGTDAAPAEGRALTAHADNALGAPFVSVDQLARQSTLWPDTAMFFPEDANAVREA
                     RRCLTFQ"
     CDS             466296..466913
                     /codon_start=1
                     /locus_tag="ROP_04570"
                     /product="hypothetical protein"
                     /protein_id="BAH48704.1"
                     /transl_table=11
                     /translation="MDGPVARAFDSAARRFLEVSAAATGHYDAPGLGEWSVRDLVGHT
                     SRSLSTVETYLDAAGEDPGAVELTDAVAYYLAIADALSDTAAVAQRGREAGAALGEDP
                     MGALSALVARVPERVRASPSTALVRTPFGTMTLQGYLPTRTLELTVHTCDLAAALGVD
                     ADVPREAVAETFAVIGGLAAVQGTAPAALLALTGRSPLPAGYSVL"
     CDS             complement(466983..467465)
                     /codon_start=1
                     /locus_tag="ROP_04580"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH48705.1"
                     /transl_table=11
                     /translation="MEIVVRAAVLFLFLWVITRVVGRSTVGELSTFQLVLYVVMGDLV
                     QQGVTQQDYSVTSAVLAVGVFALLTLALAWANARFPRVRGVTHGVPVIIVRDGIPDLD
                     RLRTERMSLDDLMADARQKGIRRFDEIELAVLETNGRVSFFTRTGHTDAGAPEQPGIA
                     "
     CDS             complement(467465..467995)
                     /codon_start=1
                     /locus_tag="ROP_04590"
                     /product="hypothetical protein"
                     /protein_id="BAH48706.1"
                     /transl_table=11
                     /translation="MRPSDRIPASVFDDVREYARTPAVAWLRRAAVALLALIVAFGAV
                     GLLGVRSGTAYAEGGGYALTLTYPRVARAGLDVPWDLTVRKPGGFSEPVVIVVDSDYF
                     DMFETQGWTPEPSAETSDALRTYMTVDPPPGDTLTLGFDAYIQPSSQLGHSGSVSVSE
                     KGVDVATLEFTTWLVP"
     CDS             complement(468621..468992)
                     /codon_start=1
                     /locus_tag="ROP_04600"
                     /product="hypothetical protein"
                     /protein_id="BAH48707.1"
                     /transl_table=11
                     /translation="MWRNAHVPSYLLGMPPRYHVTSVLNRASIFRYGLDFSRMGAARG
                     IAGSSGPEQKGCFLAADEWERDWFVRMNNTGGAVDVWEVHGINDDDLIESPEGHYFFP
                     GVIAAAKLRLVQRDLPPSRNY"
     CDS             469176..469505
                     /codon_start=1
                     /locus_tag="ROP_04610"
                     /product="hypothetical protein"
                     /protein_id="BAH48708.1"
                     /transl_table=11
                     /translation="MHRSTAGGRFGPVRLIERDSDFAVVFAADTTRWVVLVQAGGDSP
                     KASVILGVPNPGVGFGRSLRASYLQRLTVHRSGDPSVARKPPEFGWMALAGIAAEGVS
                     QFEVRSS"
     CDS             469686..469955
                     /codon_start=1
                     /locus_tag="ROP_04620"
                     /product="hypothetical protein"
                     /protein_id="BAH48709.1"
                     /transl_table=11
                     /translation="MATKDSQPQLKDQEMYEELREMGDSKEKAARISNAAAARGRKNV
                     GKSGGKSQSYDDWTVDELEKRAKELGLKGYSKLNKKELIDELRNH"
     CDS             470033..470398
                     /codon_start=1
                     /locus_tag="ROP_04630"
                     /product="hypothetical protein"
                     /protein_id="BAH48710.1"
                     /transl_table=11
                     /translation="MQKVLTFAAGAAVGFVLGTRSGRQTYEKMRHQSLELWHNPTVQE
                     KVSEATDTVKDKAPQVQHKVGELAKKATHRHTDTHSTTAPTNGASLGDAPTPPPAAPT
                     PTDAETTTGVPPTRGESAG"
     CDS             complement(470435..470932)
                     /codon_start=1
                     /locus_tag="ROP_04640"
                     /product="hypothetical protein"
                     /protein_id="BAH48711.1"
                     /transl_table=11
                     /translation="MGTRTPWHPVPHHPGVLPSAPLCARRCGAGSDSAYAKYPQSIDA
                     VAAEYRLTGTRGADFWGNSVTSTADTVTFLEAKTTDPSSPILGWMATAAPVAVDGTRQ
                     NGGTGALPSVTGTKWGWSDDGSSVVASASFGPDFSVAANTYGTAEQHTSDVLGAFGLE
                     PTPPA"
     CDS             complement(470944..472236)
                     /codon_start=1
                     /locus_tag="ROP_04650"
                     /product="hypothetical protein"
                     /protein_id="BAH48712.1"
                     /transl_table=11
                     /translation="MTRKDRDRLSADDAHILGLESAVISGHTLKLVVLAPAPGPLDIE
                     ALRTAVAERLSSQPRATERIDTSGAQPRWTAATAFDICDHVRRREEAGCTSRADLWRA
                     VSTLMSEHLDHERPLWTFDLIGPLGDGREAIAVRIHHAMADGIGAVRFLDDVLWDRHA
                     DPAPRESRPGVRAESTKHSRIDEVLRMPAAMRRELGHRGSRSPFDRPISAARELAFTV
                     APLSELKAIGASRPTRATVNDVLLGIVAGGLRSWLSTGDAALPRLRAQVPVSLHHRNE
                     EARVGNRDSFLNIDLPLAEADPLIRLDRISAETSKRKHLDDADELFDLFHALGRVKGV
                     GAAAQRLAGSAREFSLAISNVPGPPLPVSVSGRRVERLFSSSEPAVHHALRISAISCA
                     GIVGIGLCTDPEALPDVARLAMAMEDSYTELRDATSTP"
     CDS             complement(472333..472947)
                     /codon_start=1
                     /locus_tag="ROP_04660"
                     /product="putative TetR family transcriptional regulator"
                     /protein_id="BAH48713.1"
                     /transl_table=11
                     /translation="MAGRRGWGGSPPGTDEEASRRIVIAAVDLISRKGTAISIADVAE
                     SLGVIRQTVYRYFPSTDSLLRAAAIAAVDGFLDRLTQHVAGIEDPAEAVVEAVIYTLN
                     EAPRVPQLGIMLSGSHSHTEGITSEEALAFGMTMIRRFDVDWERHGYGEHTLRELVEY
                     QLRTMQSFFISPGNPPRGQDELRAYLRRWVGSAVAVTGSPASAG"
     CDS             473194..474144
                     /codon_start=1
                     /locus_tag="ROP_04670"
                     /product="hypothetical protein"
                     /protein_id="BAH48714.1"
                     /transl_table=11
                     /translation="MSDLHPRKMDFAFDEQDVPFLWNPDNPAWSSMSNAISFLAIGFE
                     KMIVKAIMQAKPLMTDPEVAEEAVAFMRQEGHHSTAHRQHVKALIRRYPGLQNTLDAV
                     IGEYDLLTEATSLNYRLAYTADLEATFTPVFKLMLDNDATLFRPGDDRVASLFIWHFV
                     EEVEHRSSALVIFDSLVGEELYRMRMAPSIFTHVMKVVRIACAGFNQHVPLRERKVDA
                     MSMFATHRTKQKLLTAFAPYLSKGIMPRAFDHLPRGEQLTALAGVVRSQMPKHNPTHE
                     KLPALADEWFTRYDAGFDCTRWYTAESSEQRTEPAPAVVN"
     CDS             474144..475301
                     /codon_start=1
                     /locus_tag="ROP_04680"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH48715.1"
                     /transl_table=11
                     /translation="MADLCSPTFDQLSTALGFSCAEAGGLVEVRSPLALENWTLPVLE
                     LTIVLGSVLALVFAVLRWRRNGDPTTLALWFGATAYLFVIEPPLYFPAAFGIEEHVDT
                     MFAHNVFTVDFLWGRLPLYIIAIYPLMATLAFELVRMLGVFRKYGVLVGAVCVGFVHH
                     AFYEIFDQLGPQLRWWEWSTTNPVNQPMFDAVPLPSVVVFAALWPMSLAMCVQFFVGR
                     HADRGRKFTGLELAWRTIVIGLLASAGTFILPLPATVLGMESTTVRGVFYAAELAVVA
                     LVAIPVLVRQWSRLRGGTSDVPSYSNDFVRAYSVVYLGVMGMLWLTALPDYFAAVDGV
                     TSNGDPIGNIWYTIVCFAIAVLCVAATFTVPRNSVNGHGAVSGERTPDAVR"
     CDS             complement(475911..479861)
                     /codon_start=1
                     /locus_tag="ROP_04690"
                     /product="putative non-ribosomal peptide synthetase"
                     /protein_id="BAH48716.1"
                     /transl_table=11
                     /translation="MEHAARATYREHRSDPFPLSAAQHGLWFAQQLAPDVPICIAQYV
                     DIRGPLDVELFREVALVAGHEYESVFLRLIDVDGEPHQVIDPPADAAMGVVDFRGASD
                     PMAAAETWMHDNYTARVDFEHDHLCESSLLCVGDERHLWYSRIHHVALDGYAAMTLVN
                     RVAALYTAAVEDRALEPNRAADLHTLHRLEEDYRASHRFTSDRDYWAERLHRRTNGAS
                     LTDVEAPPAAHSLTVRAALSPDTVARLEDTGGRPGATAAAALIAAFACHLSRRTGQEE
                     VLVDIPLSARTTAVLRRSSGMLANVAPLLVQVRSGDTVGDLVARVQHELMGAMRHQRG
                     NVEDILRDLGVSAESRRISGPMVNVMLFDQDLTFGSLTGDFRILTTGPVPDLSVNVYR
                     SGTPASTIVEFEANPYRYREDELRSHHAAVVGLIDDVLAADPDTPLAAIGVADVGRLT
                     PVVGGLSVSEVSLPELLAAAVAVDPDAVAVVCEGRGLSYRELDEASNRLARVLLGSGV
                     GCESVVAVAVGRSVESVLSVWAVAKTGAAFVPVDPGYPVGRIEHMVADSGVVVGVTLS
                     GSVAVLPGGVRWVVLDDVETVEWLSSVSAGPVTDGDRGAPVRVGQAAYVIYTSGSTGL
                     PKGVVVSHRGLANVVASQRAGFGGGVGARVLQCASPSFDASVFELVWAVGLGGRLVVV
                     PPTVYGGEELARILVSEGVTHAVLTPTALSSLDPSGLEALGALVVAGEVCPPELVARW
                     APGRSMFNAYGPTESTIMSNASDGLVVGESVTIGGPVRGFGELVLDARLRPVPVGAVG
                     ELYLSGPGLARGYRNRVGLTSARFVADPFGVPGQRMYRTGDVVRWREGAGGGLVLEYV
                     GRADFQVKIRGFRVELGEIESALLGYPGIDHAVVHTSGDRLAGYVVPVAGSDLDTSAV
                     LAHARTRLAPHMVPATVTVLDAVPVTANGKLDRAALPEPDFTAGRAEYRAPRNATEEM
                     VAAAFAGGLGLDRVGLDDNYFALGGTSLTATSVIARIAEDAARAVPVQWIFTHPTPEA
                     LAHMIATAPEDARAGDTADRSLDVLLPLRTTGTGSPVFCIHPAIGLAWCFTGLVQYLG
                     DRPVYGLQSPALTDPDLRIDSLQELAGRYVDRIRSVQPHGPYHLVGYSVGGQIAHEMA
                     VQLTGAGDEVATLTMLDTHLAGGLDRTAEKPTMAALLAEFGAVVPRDGDDATTTERAV
                     EVLRRTGGPFAAVTADDLDAVHRVFTQTVDLALAHRPSTPSGVDLLYFGAADSVDAPT
                     GVSAWRQHITGEILVHHVPAAHQQMTSPEALAGIGPVLAHHVLLADKPMRVVSS"
     CDS             480170..480505
                     /codon_start=1
                     /locus_tag="ROP_04700"
                     /product="hypothetical protein"
                     /protein_id="BAH48717.1"
                     /transl_table=11
                     /translation="MRSVTFAPAAARHVGRRMPVSGQAMGSGTENRMRRREIPVPRAD
                     SMTESGTERRPTIALPMARAVPKQQDSSHADRIFASSRFEFFSGVSRSAVLRDDPRPK
                     GVVERCRHR"
     CDS             480511..480765
                     /codon_start=1
                     /locus_tag="ROP_04710"
                     /product="putative WhiB family regulatory protein"
                     /protein_id="BAH48718.1"
                     /transl_table=11
                     /translation="MQRHDTELWQWRLSARCHEEDVEIFFPADAERRNARFEREDLAK
                     EFCRGCAVVEECLAYALDTGQQHGVWGATTPGERLARLDR"
     CDS             complement(481075..481248)
                     /codon_start=1
                     /gene="rpmF"
                     /locus_tag="ROP_04720"
                     /product="50S ribosomal protein L32"
                     /protein_id="BAH48719.1"
                     /transl_table=11
                     /translation="MAVPKRRMSRANTRSRRAQWKAPVPALVTVTVGGITHRVPRRLV
                     KAVQSGLIDSRDL"
     CDS             complement(481378..481500)
                     /codon_start=1
                     /gene="rpmJ"
                     /locus_tag="ROP_04730"
                     /product="putative 50S ribosomal protein L36"
                     /protein_id="BAH48720.1"
                     /transl_table=11
                     /translation="MKVRASLKSLKNQPGSQVVRRRGRVYVINKQNPRFKARQG"
     CDS             complement(481836..481997)
                     /codon_start=1
                     /locus_tag="ROP_04740"
                     /product="hypothetical protein"
                     /protein_id="BAH48721.1"
                     /transl_table=11
                     /translation="MVNNRHPAKNRTGTWNAVVVPPGSGGRFAVAVADEQSGIAMAAT
                     DAAAQATIE"
     CDS             482495..482872
                     /codon_start=1
                     /locus_tag="ROP_04750"
                     /product="hypothetical protein"
                     /protein_id="BAH48722.1"
                     /transl_table=11
                     /translation="MLNSEISNPVRSTRSFLDRRRGPSDRELVTTAKAVLITRRGYSD
                     AQAFDELLDVARRHHLSVQGAARCLIDLTSNTGHLTSRRPVTFPEWEGLRGQPSGHHR
                     RPSQRMDSLQGRHHPHLATQIRP"
     CDS             482978..483736
                     /codon_start=1
                     /locus_tag="ROP_04760"
                     /product="putative oxidoreductase"
                     /protein_id="BAH48723.1"
                     /transl_table=11
                     /translation="MTRGTTPVSIQREPELAGQTVVLIGGSAGIGLETARRARTEGAE
                     VILTGRNPDKLESAAADVGARHTAAFDANDPAALRTFFEGLPTPIDHVLVTAGGPRYA
                     PLLEMDADQVRRELSDHMVLGLEVARSAANKTRPGGTLLFMGGTGGRRIGHGLGIASA
                     ATAALPPFTAALALELAPVRVNLIAAGFVDTPLSASLLGDRLDERRNELRTKLPIGRV
                     VGAADVAALAVHIMCNTALTGATYDIDGGQQFVF"
     CDS             complement(484082..484750)
                     /codon_start=1
                     /locus_tag="ROP_04770"
                     /product="hypothetical protein"
                     /protein_id="BAH48724.1"
                     /transl_table=11
                     /translation="MAVGATRRRPRRRMPIVYARSSTFDAHPSFIDEGIKHVRDTVMP
                     ALADIAGSAGMSLLVDRGSGRCIATSSWTDDEALRASEAPVRQLRDRMAEVFHATATV
                     ARWDIAALHRDHRSHHGAWVRVAWLDVEPGHLDRVIDVYKMSSLPAMHELAGFCSASL
                     LVDPAAGRVVSSMTFDSAPAEAGARDAVESIGTSEIRESGARLLEVGEFELAIAHLHV
                     PEMA"
     CDS             complement(484823..485035)
                     /codon_start=1
                     /locus_tag="ROP_04780"
                     /product="hypothetical protein"
                     /protein_id="BAH48725.1"
                     /transl_table=11
                     /translation="MTQQGAVGGIQADPDDIAGTEPVGLRETASSLTADAIVWPDPSP
                     LDSWWKRVVIDHATALAEGEPSARPE"
     CDS             complement(485032..485361)
                     /codon_start=1
                     /locus_tag="ROP_04790"
                     /product="hypothetical protein"
                     /protein_id="BAH48726.1"
                     /transl_table=11
                     /translation="MIEDSTEPSLTPVPSPTRLIPRRRPDGRELLGTAKGILIAGRGC
                     TDAQAFDELLDVARRHHLTVLGAARSLVELAAGPSPRPRRADTARFDEWEQLVAQLPP
                     RRHAQAS"
     CDS             complement(485723..488263)
                     /codon_start=1
                     /locus_tag="ROP_04800"
                     /product="UvrA-like protein"
                     /protein_id="BAH48727.1"
                     /transl_table=11
                     /translation="MPTPDPGPPAEPSPAREFAGIEVFDASEHNLAHVDVFIPRDCIV
                     AFTGVSGSGKSSLAFGTIYAEAQRRFLESVTPYARRLMDQVGAPRVGDITGLPPAVAL
                     QQARGHTSARSSVGTLTHISNVLRMLFSRAGTYPPDAAELDSNAFSPNTPEGGCPTCH
                     GLGRTHDVDVDALVPDPSRSIRDGAVAAWPGAWLGKNYRDILDTLGIDVDRPWSELPA
                     HQREWILTTDEQPTVTVSPIRDPGKMVRDYQGTFSSARTYVLHTFATTKSATQRAKVS
                     RYLLSRPCSACDGKRLRPEALAVRFAGLDIADATALPMSELATALDAAVGSRDAAADD
                     ATDRASEALVDNLLGRLRGLSELGLGYLSLGRSTTTLSPGELQRLRLATQLQSGLFGV
                     LYVLDEPSAGLHPADTEALVAAVRRLRAAGNSVFVIEHNLDIVRAADWIVDVGPDAGE
                     HGGRVLYSGTVDGLAETPESVTRRYLFEPREHRPEPAQPSRWIELSGITMHNLRDLTV
                     RIPLGVLTAVTGVSGSGKSTLVSRVLTDVVAQHLGVDDEPGPDTVGDDADSTAVLADG
                     RDTTASTVVSSHGLGHIDRLVRVDQTPIGRTPRSNLATYTGLFDVIRKLFAAHPTARE
                     RGYSPGRFSFNVTGGRCDECEGAGAITIGMLFLPEASAPCPVCAGARYNTETLEILVD
                     GRSIADVLAMTADEAGDFLNHVPAAKKSLDMLVEVGLGYLRLGQSATTLSGGEAQRVK
                     LASELQRIRSGHTLYVLDEPTTGLHPADVDRLMVVLRRLVAAKNTVVLVEHDMSVIAA
                     ADWMIDLGPGGGDNGGRVIASGQPVTVAATADSATAAHLGRHLAPANG"
     CDS             complement(488352..489518)
                     /codon_start=1
                     /locus_tag="ROP_04810"
                     /product="putative oxidoreductase"
                     /protein_id="BAH48728.1"
                     /transl_table=11
                     /translation="MSKELPGQASVVVIGGGVIGASIAFHLAESGVSDVVLLEKDELA
                     CGSTCKAAGGVRASFSNEANIAIGLRGLEVYSRFAQEYHQEIDFSRDGYLYLLSDQEN
                     VDIFTESVALQNRHGVPSRMITPEEAQKISPLINTDGLLAASWSPQDGKATPESVVMG
                     YAAAARRHGARIVRHCAVTDIESTGGTIAAVVTERGRIATGTVVCAAGAWSAEIGAMV
                     GVNIPVVPVRRQIAFTEPLSELPESSPSLTIDFPSNFYFHPEGKGLLLGWSDPNEPAG
                     FNLEFELEDWLMGLGAIAETRVPAVLDYGISTGWAGLYEVTPDRNQIIDRSTEVDGLL
                     IATGYSGHGFLMGPATGEIVRDLYHGREPGYDISSFALGRFAQSSIGAGETNIV"
     CDS             complement(489567..490715)
                     /codon_start=1
                     /EC_number="1.4.1.-"
                     /locus_tag="ROP_04820"
                     /product="putative glutamate dehydrogenase"
                     /protein_id="BAH48729.1"
                     /transl_table=11
                     /translation="MFELIDEWGPEKVVCVSDSRTGMRGVLVIDNTARGMGKGGTRMS
                     TTVSVGEVARLARNMTWKWAGVDLFYGGAKAGIWADPTASSKEAVLRAFVRALRNEVP
                     EEYVFGLDVGLTEKDAAIMLDEVGGRGGAVGTPHALGGLPYDQLGVTGHGVAESADAA
                     AQTLGLSTGSLSVSIQGFGAVGAASAKRLAELGATAVAVSTSRGGIHNPDGLDVAELL
                     TLREQFGDALVDHYSDAKPLAAGEELSVTADILIPAALQDVIDTDLARTLPARIVVEG
                     ANLPSTPEAQAVLFDRGVTVVPDFIANAGGVVAAAVAMDARFSGIRPEPAAVFDNISN
                     TLRASTIDTLEASKAQGRTTHEVARTTAQERVREAMVLRGRAPRNAAF"
     CDS             complement(490749..492305)
                     /codon_start=1
                     /gene="pcd"
                     /locus_tag="ROP_04830"
                     /product="piperideine-6-carboxylate dehydrogenase"
                     /protein_id="BAH48730.1"
                     /transl_table=11
                     /translation="MSTAVADTIALPTTDELRTLARTSLQRCGVDPAVLDTTGATNTV
                     TARTPVTGEALFDYPAAGAADVEAAIDAAHDAFLRWRTVPGPVRGFLIKCLGELLTEH
                     KDDVANLISIEVGKIRSEALGEVQEMIDICDFAVGLSRQLDGRTMPSERPGHRLMETW
                     HPLGVVGVVSAFNFPAAVWSWNLALAIVCGDAVIWKPAQLTTLTAAACSALFDRAARE
                     SGAPANLNVLVSASAADTQALIDSPKVPLISATGSERMGEQIAPRVAARFGRAILELG
                     GNNAAIVTPSADLDLATRGIVFAAAGTAGQRCTSMRRIIVHRDIADELVGRICEVYRR
                     LPIGDPFADGTLVGPLIDGKSHANMTEALDKAVAQGGQILAGGARRPSSDNSYYVEPA
                     IVRMPAQSDIVRDETFAPILYVLTYDTFEEAIALHNDVPQGLSSSIFTTDQREAERFI
                     AADGSDCGIVNVNIGTSGAEIGGAFGGEKTTGGGRESGSDAWRAYMRRATNTINYSRE
                     LPLAQGVNFG"
     CDS             complement(492306..493754)
                     /codon_start=1
                     /locus_tag="ROP_04840"
                     /product="hypothetical protein"
                     /protein_id="BAH48731.1"
                     /transl_table=11
                     /translation="MPITQQWELRAEFARRLSHLYGKEVPAYTALLEVSRAVNDTVLS
                     NLGAGAQRLGSTARITAERHGAIRVGTPQEMAQVARVFAAMGMYPVGFYDLREAAASS
                     VPVVSTAFRPTDPDELARNPFRVFTSMLVPSDRRFFSAELQQRLESFLAQRRLFTAEL
                     LVLADRATEYRGLNSGDAEMFLTLATAAFKLSTEAVDRAWYRELEQVSSVAADIGGVT
                     STHINHLTPRVLDIDDLYARMERRRIDMIDTIQGPPRWAGPDLLLRQTSFRALAEPRV
                     FREADGSVEKGSLRVRFGEVEARGIAATVRGREVYDRLTGEIEQAVREAAATAPVSAE
                     VRNEIAAALWNQQVPATEQGLALHDLAYFTYRVDTDKQRNGTVPGRSLQDLIDQGWVR
                     PEPIVYEDFLPKSAAGIFQSNLTSDGHKDTTQSMTDIDAAWMEGVLGRTLHDPYALYD
                     GIRRVSLDHVASQLGIRGPIDVPAPIATRGVK"
     CDS             493924..494841
                     /codon_start=1
                     /locus_tag="ROP_04850"
                     /product="putative LysR family transcriptional regulator"
                     /protein_id="BAH48732.1"
                     /transl_table=11
                     /translation="MNMSLGHLVTLRELARRGTMVAVAEELGYTAGAVSQQIAALEKA
                     VGSQLVTKVGRNVVLTDSGVVLAEHAVKILSAEQTALDALRAVHDDVAAPLLLGTFGS
                     TAAALLPPVVAAAQREYPHLALSSRELDVDEAATAVQRGQVDVAFGLDYPNSPMPRTP
                     DIEMITLRSERFGLAVSPGSYGIRTECTIDLCEAAEWNWILPPAETQFGRAIRIACRQ
                     EGFEPIARHEIVDTAVSLALAAKGLGAAPVTDMMIRLNSSVPIVRVDLEQEIGRRIVL
                     LRLARSETRPTVRAVTEIVRAVVNTAETR"
     CDS             complement(495130..497994)
                     /codon_start=1
                     /locus_tag="ROP_04860"
                     /product="putative FAD-linked oxidase"
                     /protein_id="BAH48733.1"
                     /transl_table=11
                     /translation="MLGTCSMLRMISAESLAAELRRSGVGDVLSDGTTRAAYSSDASL
                     YRVRPLVVARPRRAEEVAAALAVCRREGVPLTSRGGGTSVAGNAVGTGLILDFSRHMN
                     RVLSIDPDAQTATVEPGTIQTVLQQAVAPHGLRFGPDPSTFTRCTIGGMIGNNACGSR
                     TLGYGRTSDNVTGLHVLTGTGESLQLGSAGEVTASPALRALQQVTRGGLATIRTELGQ
                     FGRQVSGYALEHLLPENRFDVTRMLVGTEGTLAVATQATVRLVTEPAHRVLVVLGYPN
                     IAAAGDATTLVLKFDPTACEGIDSRIVDVVRERRGPDAVPPLPAGAAWLFVEVVGDDL
                     DDTIAAARQVGRDCGAVDSLVVTEAGRAAQLWRIRADGAGLAGRSPAGLPAHAGWEDA
                     AVPPAMLGNYLRDFDALMDEYGVTGLPYGHFGDGCLHVRIDWPLDRPGGSGIFREFLV
                     AASRLVAGYGGSLSGEHGDGRARSELLPLMYSPEAMKLFAAVKHVFDPDNVLNPGVVV
                     DPRPVDADLRIPAAPLLRRNLALAYHHDDGDFTQAVHRCTGVGKCRADNTATGGVMCP
                     SYQATREEKDSTRGRARVLQEMINGTAVEGGWRSPEVHDALDLCLSCKGCSSDCPTGV
                     DMAAFKSEVLHQSYKGRLRPASHYSLGWLPRWAKIAGHAPGVVNAAMRIPGIGPLALS
                     AAGVDRRRSIPPFAKQTFRSWFQATEHDRATTGDPVLLFVDSFTNYFTPEVGHATVRV
                     LEAAGYRPQLTDRQQCCGLTWISTGQLTAAKKILGRTVDALSESAAAGMPIVGMEPSC
                     TGVLRSDAAELLGRAAAEPVADATRTLAELLTDRGWEPPSLDGTSVVAQPHCHHHSVM
                     GWSPDAQLLEKAGAQVQRLGGCCGLAGNFGVEKGHYEVSVAVAEQQLLPAVAAADADT
                     TILADGYSCRTQLSDLTDRRGDHLAQLLAARLDADRTRRD"
     CDS             498029..498754
                     /codon_start=1
                     /locus_tag="ROP_04870"
                     /product="putative GntR family transcriptional regulator"
                     /protein_id="BAH48734.1"
                     /transl_table=11
                     /translation="MADEALELEPLAPFPGRRMEQAIAAVRAAIDDGRMKPGVKYSVY
                     QLAEGLGISRTPVRDALLRLEEVGLIKFEARQGFRILLPEPREIAEIFAVRLALELPA
                     VRRAATADDPALPDALLQQQRLMRDAAAVGNEHQFAHHDLGLHDLILDAADNSRARAI
                     VKTLRETTRLLGANTADKTRTLTDIDDEHTPVIDAIIAGNPDKAEAAMRRHLENTGRL
                     LVAQALRTEASDKSVDEIWSAVV"
     CDS             complement(498816..499004)
                     /codon_start=1
                     /locus_tag="ROP_04880"
                     /product="hypothetical protein"
                     /protein_id="BAH48735.1"
                     /transl_table=11
                     /translation="MNRTDLPQTLRRSSKEVQAAFATAHETAVRRYGEGEEAQRAAYG
                     ELKQSYELVTDHWVPKQD"
     CDS             499221..499475
                     /codon_start=1
                     /locus_tag="ROP_04890"
                     /product="hypothetical protein"
                     /protein_id="BAH48736.1"
                     /transl_table=11
                     /translation="MPVSPHTLLQHVQDRTTDLRRWLDTGENTATLTAYLRDEPVDHR
                     WLSTYRRLTHDLLRAVDHACPPREPHDAPTPSVGRQSDLQ"
     CDS             499472..499678
                     /codon_start=1
                     /locus_tag="ROP_04900"
                     /product="hypothetical protein"
                     /protein_id="BAH48737.1"
                     /transl_table=11
                     /translation="MNDDQRRALEHVRDTCAMLHCFLTTHSSDRPPERVRTATFEQLT
                     DDLLDAVTSAQNVGVPEQRIFDSM"
     CDS             499675..501162
                     /codon_start=1
                     /locus_tag="ROP_04910"
                     /product="hypothetical protein"
                     /protein_id="BAH48738.1"
                     /transl_table=11
                     /translation="MTDDLHRPGRKSECGAGPAYGRLCLVILTISTTARPATDLGYLL
                     HKHPDRVQEFTQSCGVARVFYPEANENRCTVALLLDVDATRLARSSGRSADYALGQYV
                     NDRPYAVSSLLSVALADVFRTARAGRCTLQPELAATPIPLEISLPALPCSGGPELAEQ
                     LFTPMGWTVEARPVRLDDAFPEWGDSRYVRLTLRGDIRLADALNHLYVLLPVLDDAKH
                     YWVASDEVDKLIRAGGSWLAEHPERTLITRRYLRHQTALTRSAFERLAELGDDVAEQL
                     EPPVDEEPGNDTVAAAPPLNVIRREAVLGALGELDARTVIDLGCGSGQLVSALLDDAR
                     FTEIAAADVSTRALSIAARRLQLDRMPERRRERLQLFQAALTYTDSRFAGYDAAVLME
                     VIEHIDPPRLTALEQVIFVTARPGHVIVTTPNSEYNVRYPDLVGMRHRDHRFEWSRAE
                     FRSWAGNVCQVHGYTADFRPVGDDDPEVGPPTQMAVFTRAGGAHD"
     CDS             501155..503692
                     /codon_start=1
                     /EC_number="3.1.3.16"
                     /gene="prpA"
                     /locus_tag="ROP_04920"
                     /note="protein synonym:phosphoprotein phosphatase"
                     /product="serine/threonine protein phosphatase PrpA"
                     /protein_id="BAH48739.1"
                     /transl_table=11
                     /translation="MTDISVPALSLVVLVGVSGSGKSSFAAQHFAPTQVLSSDFCRGL
                     VADDENDQSATSDAFDVLLYIAGTRLRRGLLTVVDATNVQREARKALVDLAKSHDVLV
                     DAIVIDVPDDVAIARNATRPDRDFGPHVIRRQHKDLRRSLPKLGREGFRRVHVLTGVE
                     AIDSATVSIEKAWTDKRDLTGPFDIIGDVHGCRSELETLLRELGWQLQPDGAGAHHPE
                     GRTAVFVGDLVDRGPDTPGVLRLVMGMVAAGTALCVSGNHEQKLSRALHGRNVTTSHG
                     LQASLDQLAAESDDFRKSAHAFIDGLISHYELDGGNLVVAHAGLKEAYHGRASARVRS
                     FALYGDTTGETDEYGLPVRYPWAHDYRGRAFVVYGHTPVPETEWINNTICLDTGVVFG
                     GRLTALRYPGKDIVSVPAEQVWFEPARPLDTASARPGHRTQRDPTLLSIDDVRGTRHI
                     DVRYNKGRIKVREENAAAALEIMSRFAVDPRWLVYLPPTMAPPATSNLDGYLEHPVQA
                     FAEFAAAGVGEVVCEEKHMGSRAIAVVARDAATAAERFGVTDGSSGIVYTRTGRPFFD
                     DPATMSELVARLRTACTPLMDDLGSSWLALDCELLPWSAKAGELIRTQYASVGAAAGA
                     ALPDAITALERAAARGLDVADLLTHNRTREANARLFREAYARYCWPVTGLDGVRLAPF
                     QILACEGRATAVTEPHSWHLAKLATLDDPLVAGTRHQFVDLTSDESRHAATTWWSQLT
                     DAGGEGMVVKPLGPTPAELAHRRIQPGIKVRGREYLRIIYGPDYTENLDVLRDRSLGR
                     KRSMALREHALGLEALTRLTEGDPLWRVHETVFAVLALESEPVDPRL"
     CDS             complement(503696..504322)
                     /codon_start=1
                     /EC_number="2.1.1.-"
                     /locus_tag="ROP_04930"
                     /product="putative methyltransferase"
                     /protein_id="BAH48740.1"
                     /transl_table=11
                     /translation="MANARTQPGETVRESYSARSQEYADLFGSMTSTHPSDRALVRSW
                     AAALTGPVLDAGCGPGQWTDFLAACGVAASGIDLVPEFVERARVRYPRLSFDVGDFEA
                     VDAAAESLGGVLSWYSLVHHSPQDIQIPLAEFARVIRPGGGLLVGFFEGATVDTFDHA
                     VTTAHRWPVAELSEQLVTAGFEVTETHTRTGSGYRPHGAITARRQITR"
     CDS             504330..504488
                     /codon_start=1
                     /locus_tag="ROP_04940"
                     /product="hypothetical protein"
                     /protein_id="BAH48741.1"
                     /transl_table=11
                     /translation="MIVDRALDMPNPLGVSPHLASTIAVGSLGLRATTRLRPLLGHSL
                     WRSRSQKN"
     CDS             504522..505031
                     /codon_start=1
                     /locus_tag="ROP_04950"
                     /product="hypothetical protein"
                     /protein_id="BAH48742.1"
                     /transl_table=11
                     /translation="MLIYSMSVEEDGFIADREGGFGWTVPTRSTRQRPSQCPARRGAA
                     NDPSMTSRFSSNLVRGIIVATSVLTAACSSGGAERSAPLVGVETSTAPATPDTPGTLP
                     TANELTALYNTALDYDVPLSDRVNLIQGVDEADPRLAQKFVQEEMTVAFHAVLDRGDG
                     SLLAFGNPS"
     CDS             complement(505465..506919)
                     /codon_start=1
                     /EC_number="1.2.1.4"
                     /locus_tag="ROP_04960"
                     /product="putative aldehyde dehydrogenase"
                     /protein_id="BAH48743.1"
                     /transl_table=11
                     /translation="MDLDNVLEQAAVAKGEFARQTPQQRYAQLTGIADRLDATADELV
                     PVAMTETHLPEPRLRGELRRTTMQLRMFAEEARTGEFLDARIDDPDPDFGSGPRPNIR
                     RMKMPIGVVLNFAASNFPFAFSVAGGDTASALATGCPVIVKAHEGHPKLSELTGRLVT
                     SALDDAGAPAGAFHLIEGRDAGVDALRDDRVDAATFTGSVRGGLFLAGIASERPRPIP
                     FYGELGSINPVFVSQAAIDARGQAIAEGFVESFTLGSGQFCTKPGIVFLPAGHGLEDI
                     LTTRVGEKRTGELLTDAITSGFADRLREIGDQIGGRMLVEPTAIDGCHQPALLSIDYP
                     TFVEHADNVLTEAFGPFSIIVEYTDVKQLTDAATRLHGSLTISLHVQEADADILDDLR
                     RVVERRTGRILLNEWPTGVSVTPAQHHGGPFPSTTSPLHTAVGTAAVERFLRPVSFQN
                     YFDSWLPEPLQDSNPWNIPQKRSAAGQSQIWGRG"
     CDS             complement(506937..507695)
                     /codon_start=1
                     /EC_number="5.3.1.6"
                     /gene="rpiA"
                     /locus_tag="ROP_04970"
                     /note="protein synonym:phosphoriboisomerase A"
                     /product="ribose-5-phosphate isomerase A"
                     /protein_id="BAH48744.1"
                     /transl_table=11
                     /translation="MYTTETPQDAAKYAVGRAAVERYAHDGAQLGLGSGTTSAWFVRA
                     LGEKVAEGLDIVGVPTSTATRDLALSVGITLIDLNDLDRPLDVTLDGPDEVDHDGDMI
                     KGGGACLLWERMVAEASLKMVCIADDTKLVERLGSFPLPIEVIPFGWKATRRSISALF
                     RDLGYTDIDIVQRQRDGQPVVTDSGNFILDAHMVAITDKALLDTNLNWIAGVVENGLF
                     TGIAHEILIASPDGAAKLIELPHRRAARIPQWRK"
     CDS             complement(507719..508372)
                     /codon_start=1
                     /EC_number="3.1.3.18"
                     /gene="gph"
                     /locus_tag="ROP_04980"
                     /product="putative phosphoglycolate phosphatase"
                     /protein_id="BAH48745.1"
                     /transl_table=11
                     /translation="MSTTQTKFTAVVFDLDGTLVDSSEDIAAAMNEALSGHGDRRVTV
                     RQVADALGGGPRALVEQCLRAAGLPVTAPTVDDVLRTYSERYRANPAQKTRLVDTAAV
                     VLAELDARGIQLGVCTNKRTPIAHAVLDALGLGAIIGAVIGSDATDGPKPDPRHLTDT
                     IAALGASGSTVLYVGDTDIDRDTATAAGIRYAHVSWGHPDVDADFRLDSFDDLLTLI"
     CDS             complement(508369..509901)
                     /codon_start=1
                     /EC_number="2.7.1.17"
                     /gene="xylB"
                     /locus_tag="ROP_04990"
                     /note="protein synonym:xylulose kinase"
                     /product="putative xylulokinase"
                     /protein_id="BAH48746.1"
                     /transl_table=11
                     /translation="MTTAARVHLGVDIGTSSCKVVAVDHTGAVMTTAVREYPLFSDRH
                     GWSEQDPHDWWAATDACIREVTAQLPRRGDEIVAIGLSGQMHGLVALDDTGTVIRRAI
                     LWNDQRCEAECVAITDTVGGPHSVLDATANRLITGFTAGKVAWLRDHEPEVFARIHRI
                     VNPKDYLRLRMNGRFVTDVSEASGTGLFDVANRKWSPAMLDAVGVSESMLPEVVESPE
                     RTGVLLPEIADAWNLRPDVEVYGGGGDAVVQTASMGITQRGDIGVTLGTAGIVAAVSR
                     TCPDNVTGSVQVSCYNQPGFWHVMGVSLSAAGGLQWLADVVHQLPGAQDVSFTELIDL
                     AKEVPVGADGLLFLPYLAGERSPHYAPSASGAMVGLTRMHGLGHLVRAVIEGALLNMR
                     QILESFADLGIPCDRIIASGGATRDAFWLQAMADVFGTEVVTMTGSSEGGAYGAAIVS
                     GVGAGTWESFDDAYGHLQVSSRHVPRTAEAARYTRIFEGYRNLFGHFTDVFGDIDIAR
                     KT"
     CDS             complement(509898..511379)
                     /codon_start=1
                     /EC_number="1.2.1.-"
                     /locus_tag="ROP_05000"
                     /product="aldehyde dehydrogenase"
                     /protein_id="BAH48747.1"
                     /transl_table=11
                     /translation="MPAELTTPERKAHAMTITTLNNYIDGGWVPSETTFKALNPADEK
                     VIAEVPASTATDVDAAVTAARRAFADWRHVNPTVRARYLHTIGDIVKSRERELAEAIT
                     TEMGKTIGEATGEVDKLAKAFHFYAEEATRIHGEVIPNDVDGFTSTVVHEPIGVIGAI
                     TPWNYPLELVGWKLCAALAAGCTIVIKPSQYASLSPALLFGCIDAAGLPPGVANLVLG
                     GGETGPAVAGHPGFDKLAFTGSTATGAKIARGVPAAKPLTMELGGSCPMIVTDRADID
                     AAVAGAARRGFRNAGQICIAINRIYVHETVYSEFVDRLTATVSELTVGNGMDPTVDVG
                     PMATRPGLDVVDQHVRDAVARGATVTTGGTRIETLAPGNFYQPTVIAGCNPDMLVMHE
                     ETFGPVVGVMPFSDLKNAVDLANGTEAGLAAYVYTGDLAQAHDLGRLLDFGNVAVNNV
                     DAGIMNAPYGGRKGSGFGVEHGKAGLEGYLQYKHLRIRYGTGQ"
     CDS             complement(511364..512323)
                     /codon_start=1
                     /locus_tag="ROP_05010"
                     /product="putative dehydrogenase"
                     /protein_id="BAH48748.1"
                     /transl_table=11
                     /translation="MPDMRMVITDHNFSGEDFERAAAKDLDADFALFHATTEAEAIDA
                     VSGADVALVNFAPMTAEVLAAMNPNGVVVRYGIGFDNVDLDAATRLGVRVCNVPDYGA
                     DTVADHAVTLTLMLLRKVAQFDRALAAGGWPSATELAPIRSTGETTVGLLGTGRIALA
                     VAKRLQPFGFDLIAHDPYANPDVAADHGITLVDLDELFRRSHALSLHAPATADTRGIV
                     NADNLAKMPFGSFLVNTSRGALVEQDAVLDALDSGALAGVGLDVFHPEPLAPDHRLRT
                     HPNAVLTPHAAFYSEQSLRDLQRLAAEEAARAIRGEPLRCPLN"
     CDS             complement(512316..513503)
                     /codon_start=1
                     /locus_tag="ROP_05020"
                     /product="hypothetical protein"
                     /protein_id="BAH48749.1"
                     /transl_table=11
                     /translation="MNLIDQHAAVLPTDAANATLVGRVHDDAIGGPCIVTLRSGAVVD
                     ITDAFPTMTDLLESPDPVKAVRSAVGTRSWPIADVLASSLTARTTAPYLLAPVDLSVL
                     KAAGVTFATSLLERLIEERAGGDPEQADAIRGDFERLIGSTLSSIEPGSEDAARLKED
                     LKSRGQWSQYLEVGLGPDPEVFTKAPVLSAVGCGSEIGVAQVSSWNNPEPEVALAVTS
                     TGRIVGAMLGNDVNLRDVEGRSALLLPKAKDNNASASLGPFIRLLDESFTLDDVRAAE
                     VRLQVLGEDDGFVLDDVSYMREISRDISTLAEYTVGDAHQYPDGIVLYTGTLFSPTHD
                     RGGEGMGFTHHIGDVVRISSPKLGTLVNRVNHSEKAQRWEFGLRSFIANLHGRGLVGK
                     VGA"
     CDS             complement(513558..514274)
                     /codon_start=1
                     /EC_number="1.1.1.-"
                     /locus_tag="ROP_05030"
                     /product="putative alcohol dehydrogenase"
                     /protein_id="BAH48750.1"
                     /transl_table=11
                     /translation="MRGLNGMVVAVTGSAGGIGEAVCARLIDEGATVYALDRSTSPLG
                     ESTIVDITDPEAMGQVVADIVDREGGVDGLVAAAGVVEDDIAAEEMTLDQWDRTLGVN
                     LRGLFITNQAFGRRMLGQGAGTIVNISSMSGNHVVNVPQKQCAYNASKAAVTALTKSL
                     ASEWADRGVRVNAVSPGYVATPLLARKAHQFQQWLDATPQHRMAEPSEIAAAVAFLLS
                     NESGYFCGSELVADGGYSLR"
     CDS             complement(514297..515343)
                     /codon_start=1
                     /locus_tag="ROP_05040"
                     /product="putative ABC transporter permease protein"
                     /protein_id="BAH48751.1"
                     /transl_table=11
                     /translation="MTVQRAPGRPAGAFKRIFTDYGIVIALIAIIGFFSVMRPDTFPT
                     VANFGSILQANASIMFIAFGLMLPLIVGHFDLSVAAMAGFGGVLATGLMSNGTVSQWP
                     LAVLIVVVVAVVVGLINGFLVAYLNLNALVVTLGTQSVLFGAILWYSKGAVIYSGIPQ
                     SFKDLGQDRPLGIPLPFIFAVAVGIVLWYVLYYRPVGRRLYAIGGSRDAARLTGIKVD
                     QLTVGAFVGGAVLAAVGGVLQVAQVGSAAPTSGSEFLLPAIAACFLGETSIRRGYYNV
                     WGTMTAVVLVAAGTTGLFMLGAQTWVQPVFNGVVLVGAILAAKVGVLKTRARKARPPA
                     TTAPPTPTVVAAAH"
     CDS             complement(515372..516958)
                     /codon_start=1
                     /locus_tag="ROP_05050"
                     /product="putative ABC transporter ATP-binding protein"
                     /protein_id="BAH48752.1"
                     /transl_table=11
                     /translation="MVPDQETRTAMTSNDSSPTPSIEIIALSKEFGVNRVLDNVNLEF
                     RPGSINALLGANGSGKSTLIKLLAGYHTPTSGTIRVHGDELALPADPTVLHDAGVRFV
                     HQDLGLIESMSIADNLALALGYEKRAATINWRRQRATAVADLAAVGLDDLDPRALVGA
                     LGPVQQTLVAMARALRGLQPGRGVLVLDEPTARLPNAQVDELLTRCRLLRDQGIALIY
                     VSHRLDEVFAMADRVSVLRDGRLVFDDVIAATDDQHLTQIITGGATTDETADHPAPAR
                     RVVDPGTPPKLALRGVCGTFVQDVDLDLRPGEVLAVTGLVGSGRSELGRLIFGSQAIT
                     AGEVRLRGQQLRRISPKLSIERGIGYVPQDRKQSAIPSFTLADNLCLASLDKHMSAGL
                     LSAESERTVTASAIERLDVRPADPERLLGELSGGNQQKIVLGKWLELDLDVLILDEPT
                     YGVDVGARKTILEAVLEQVGRRQLSVLLLDSDIDLVARYADRVLVMRRGRIATELVGA
                     EITTERIAAASYAVQDLSTA"
     CDS             complement(516962..518074)
                     /codon_start=1
                     /locus_tag="ROP_05060"
                     /product="hypothetical protein"
                     /protein_id="BAH48753.1"
                     /transl_table=11
                     /translation="MTGCSAAPSDRSAVDPAARNAAVDKAQRGAAELLDAGLHDNHWT
                     GPETSPPPRQGLEITIIPEQMASTGSSRPAKAIESEVKKLGWVPKISDGQGKPEVQLN
                     ALNTAVDEKVDAVILIFVDTTRVQSALQRALAAGVKVVTLGSLKNTPDTVPDVSFDWV
                     RAGESIAQYAVWKSGGDLGMLQMRNADLYIVVNGQYKGSQSYLDAPGNCPGCDVVTQD
                     WSLATFEDPTIGPAAQAVATRLANPQLNWVSCFDSCLFRVSNGLNRAGFSGKVSGAGF
                     DCNPENLDIIRAGGVQKVCFADPREWLAYAAIDNINRMTNGLPAFNFTESIPVALFDK
                     DSLSQLAPDRSAELETKGWQGNYDFRAKFEQLWGIG"
     CDS             complement(518345..519046)
                     /codon_start=1
                     /locus_tag="ROP_05070"
                     /product="putative GntR family transcriptional regulator"
                     /protein_id="BAH48754.1"
                     /transl_table=11
                     /translation="MSETTRSRQRLSDAVAQTLQDEILSLTAGDRLPTEAELAERFEV
                     SRTVVREATRLLVQRGLVTVSPGRGMTVATVDGSVIAEQYGLLLRLSEGTFEQLMELR
                     LVLEVEMAALAAARHNDGHLAELTRLNERLRSADPSSPEFLDADLAFHEQIAQASGNP
                     FFPLVMRPVNDYLSDSYSAGAGYPSEAGHTVQEHLEIAEAIAVGDPARARFAAENHLR
                     RIVRNRASLTSRKRK"
     CDS             520024..521454
                     /codon_start=1
                     /EC_number="1.2.1.-"
                     /locus_tag="ROP_05080"
                     /product="putative aldehyde dehydrogenase"
                     /protein_id="BAH48755.1"
                     /transl_table=11
                     /translation="MDMLLAGEWRGAADGRTETVQSPFDGHAVDTVPVATAADAAAAL
                     DRAEIGARVLRSMPAHERVAVLMRAADLADQRAEDIAQTISAETGKPISEARGEAGRS
                     GSIIRLAAFEGSQLYGSTLPLDANPGTGLEKVGFTLRQPCGIVVAITPFNYPALLVLH
                     KIAPALAAGNAVVLKPARTTPLTALKLAECFVDAGLAPESLSVLTGPGAALGDILVTD
                     PRVRKVSFTGSTATGTRLASIAGIKKLSLELGASCPVIVLPDADIELAASAVAAGGYI
                     NAGQVCISVQRVIVDSRVEADFLDALVPKVEDIVMGDPANADTKLGSLISETEAIRVH
                     SAIAEAALAGAKVLTGGDREGAVVSPTVVAGVDPTSPFSRDELFGPAVAVSSAPDIES
                     AIALANDNDYGLGAGIFTSDISATTRAMRQIDAGNIHINWTPLWRADLMPYGGLKGSG
                     IGKEGVRSAVEEMTEEKTVILHGRPW"
     CDS             521502..523454
                     /codon_start=1
                     /EC_number="3.7.1.-"
                     /locus_tag="ROP_05090"
                     /product="putative 3D-(3,5/4)-trihydroxycyclohexane-1,2-
                     dione hydrolase"
                     /protein_id="BAH48756.1"
                     /transl_table=11
                     /translation="MTPLSTHKTIRLTTAQAVVKYLAAQYSVADGERRRLIPAALGIF
                     GHGNVAGLGQALDELSDDLPFIQGRHEQYLAHIATAYAKASRRRATLAVTASIGPGAL
                     NLVTAAGLATINRLPLLLLPGDTYATRHQGPVLQQLEHASEADLTVNDTFRPVAKFFD
                     RITRPEQLLTALPQAMRVLTSPTDTGAVVLSLPQDVQSHAFDFPIEFFEPRDWRIRRP
                     LPDPAEVEAVAAQIREASRPVIIAGGGVHYSDATAALEALAEQAGIPVVESFGGKGAV
                     SRDEWWQVGGIGLEGNFASNKLVKQADLVLSVGTRLTDFVTGSQSIFENENVRFAALN
                     VVDADTRKQGATGILADARLGLEALTTALAGHTTSDTWQQTVRSAKADWAPIRAAALD
                     PDTAFEPAQHPHAPVTGAVLTQPQLIGLMQEHARSGDTIIAAAGGPPGDLQKVWDATG
                     NRNVHLEFGFSCMGYEIPAAMGVRLAEGNRGQRIVTFIGDGTYLMAPTELVTAAQEGL
                     DVTIVVSENHGYQVIHRLQMNRNGREFGNEFRYRTDGDIIADGGDKARLEGEYLKVDL
                     RQIAEGLGATAIRATTAADVRAALIETREVSGPVVIVVPTVPHVDLPGGDVWWDVAPA
                     EVSNQEWVQTLRADYDNAVGRQRWFG"
     CDS             523484..524272
                     /codon_start=1
                     /EC_number="4.1.2.-"
                     /locus_tag="ROP_05100"
                     /product="putative 2,4-dihydroxyhept-2-ene-1,7-dioic acid
                     aldolase"
                     /protein_id="BAH48757.1"
                     /transl_table=11
                     /translation="MNNTTPLDGGTLRRRLADGETTVGTFVGMASSTAAEVCAAAGAD
                     WILLDLEHGSGSEDALRDGILAAGAYGVPTVVRVESGERIRIGRVLDQGAAGVMVPRL
                     DKPDQVADAITHLAYPPHGDRGVATYNRSCRWGMDRSVLLAEEQAALGVIQIETLAAL
                     DAVDEIAAQAGVDVLFVGPLDLSFALGVPLQFDSPVFTAALGRVLEAAHQHGKTAGIL
                     AANAALAAGYVELGFRFVAVGSDSTLLAAALTDAFATARPEQTT"
     CDS             524354..525565
                     /codon_start=1
                     /locus_tag="ROP_05110"
                     /product="putative oxidoreductase"
                     /protein_id="BAH48758.1"
                     /transl_table=11
                     /translation="MSTPRTVGVGLISVGWMGQLHARAYRDVPIVYPELGVTPKLVIA
                     ADTADSRVEFAKNVLGFAEGTTDYREVLAHPDVDVVSICAPNFLHAEIGIAAAKAGKH
                     FWIEKPVGRSYAETSAIETAATEAGVITSIGYNYRHAPAVEHARTLIAEGSLGRITNV
                     RATFFSGYANEPNGALSWRFDRELAGSGVLADLFSHATDLCQYVVGPIAEINALTSTV
                     YTERPKLEMGSGTHFAVIENGEMGPVENEDYAAALVRFGAQGPGSGAVGTIEASRVIV
                     GPECGYQIEVYGTEGSVKWDFERMNELKVCLGRTNPEQGYLTVNASPKHGDYSRFQPG
                     PGNALGFDDLKTIEAKKFLLAVTGGPQKNSNVHDAASAAAIVTAAETSAATGQWQKLD
                     DIAGTTASRTV"
     CDS             525609..526541
                     /codon_start=1
                     /locus_tag="ROP_05120"
                     /product="oxidoreductase"
                     /protein_id="BAH48759.1"
                     /transl_table=11
                     /translation="MSTSISTQLFVGLGPLNRELVDPYLAGHQQLALDPTEEQLAVAE
                     AAIVRAAFTVDAALLDRMPALKVLARTGVGTDLVDVAEAHRRGIPVVITPGSNTVSVA
                     EGVFAHLLSLVKRLPTLTTLVRSGRWGERGGVTVGDLEGATLGIVGFGRIGRKVAQIA
                     EAFDLNVRAYDPYAEIPDRYRCASVDEVLTSSDFVTLHAPLTAENHHLINEVRLAAMR
                     PGAILVNCSRGALIDLDAAHAALRAGQLAGLGLDVFDPEPPQYHPVFDHANTVLSPHL
                     MGFTDRAMALTIRAAVEGAVAVLDGRAPAAVAAP"
     CDS             526538..527530
                     /codon_start=1
                     /EC_number="1.1.1.18"
                     /gene="idh"
                     /locus_tag="ROP_05130"
                     /product="myo-inositol 2-dehydrogenase"
                     /protein_id="BAH48760.1"
                     /transl_table=11
                     /translation="MTVRVGVIGVGVMGADHARTLHRSVSGAQVTVVTDFDAARADTL
                     AHELSARTVATATELIAAPDVDAVVIASHDSAHAEQVAACLDQRKPVLCEKPLAPSVD
                     ECRDLVTKEDALGLADPLVSVGFMRRFHHPYVALADEVRSGSIGTPLLVRNSHRNVSA
                     YPGGDSASTITNSAIHEIDITSWLLGSPIVEVGWHAPRSTSYDSSRQDPQVLMLRTAD
                     GALTVVDVFVNARYGYDVRCEVVGETGAVSLAAPHTLSIDSSLRSASMYPKDWRPLFA
                     DAYRRQLQAWIDALIAEVASPLATARDGLRATQVAAALIDSMNNDGATTKVDYH"
     CDS             527588..530992
                     /codon_start=1
                     /EC_number="6.4.1.1"
                     /gene="pyc"
                     /locus_tag="ROP_05140"
                     /product="pyruvate carboxylase"
                     /protein_id="BAH48761.1"
                     /transl_table=11
                     /translation="MTFSKVLVANRGEIAIRAFRAAYELGAGTVAVFPYEDRNSIHRL
                     KADESYQIGEEGHPVRAYLSVDEIVSAAKQAGADAIYPGYGFLSENPDLAAACAEAGI
                     TFVGPSAEVLELTGNKARAIAAAKAAGLPVLASSEPSADVDELLAAAETMQFPLFVKA
                     VAGGGGRGMRRVAERAQLKESIEAAAREAESAFGDPTVFLEQAVVDPRHIEVQILADG
                     QGNVIHLFERDCSLQRRHQKVIELAPAPNLPEELRAKICADAVAFAKEINYACAGTVE
                     FLLDTRGNHVFIEMNPRIQVEHTVTEEVTDVDLVQSQLRIASGETLADLGLSQDKITL
                     RGAALQCRITTEDPANGFRPDTGRITAYRTPGGAGIRLDGGATLGAEVGAYFDSMLVK
                     LTCRGRDFETAVARARRAVTEFRIRGVSTNIPFLQAVLDDPDFKAGRATTSFIEERPE
                     LLTLRSSADRGTKILSYLADVTVNKPHGERPSAVYPRDKLPQIDLSTPPPDGSRQKLL
                     ALGPEGFAKALREQKALAVTETTFRDAHQSLLATRVRTSGLLDVAGHVARLTPELLSI
                     EAWGGATYDVALRFLHEDPWYRLSALREAVPNICLQMLLRGRNTVGYTPYPEKVTRAF
                     VEEATNSGIDIFRIFDALNNVDQMRPAIDAVRETGTSVAEVALSYTGDLSNPHEKLYT
                     LDYYLRLAEEIVEAGAHIIAIKDMAGLLRAPAATTLVTALRKNFDLPVHVHTHDTPGG
                     QLATYLAAWQAGADAVDGASAAMAGTTSQPALSAIVAAAAHSEHDTGLDLQAVCDLEP
                     YWEALRKVYAPFESGLPAPTGRVYTHEIPGGQLSNLRTQAVALGLGDKFEEVEAKYAA
                     ADRMLGRLVKVTPSSKVVGDLALHLVGSGASTEEFKDNPAKFDLPDSVVGFLRGELGT
                     PPGGWPEPFRTRALEGRGEAKPEVPLSAEDEKALAGTSAERRATLNRLLFPGPTKEFL
                     EHRDKYGDTSQLSANQFFYGLRRGDEHRVRLAQGVELLIGLEAISEPDERGYRTVMAI
                     LNGQLRPVSVRDRSISSEIPAAEKADKNNPGHVPAPFAGVVTLAVTEGQHVAAGDTIA
                     TIEAMKMEAAITAPRGGTVTRLAIGSVQQVEGGDLLAVVATTDAAE"
     CDS             531041..531937
                     /codon_start=1
                     /locus_tag="ROP_05150"
                     /product="hypothetical protein"
                     /protein_id="BAH48762.1"
                     /transl_table=11
                     /translation="MTTTQTPALLAACWTSAGDVMPARGSDLSPVPIRERIEAVARTG
                     YTGFGLTRPDLVAARETVGLGEVAKMLADNGITQVQLEWITNWWTTGDARAASDEVRR
                     DLFEAAPVLGVDNIKVGADDDGVPVSRDLLVEQFDALASDGAGVGVKIAFENTPFSHH
                     IKTTEQAAQFVKDVDNPNGGLILDIWHAFRGGTDYDTLPQLVPARFVFGVELDDGWST
                     VRGTDLEDTFDNRVPCGEGEFDVPKFINAVRRIGFDGPWGIEHMSEEFRQLPVADALA
                     RARTGALQCFARADEQAAGKRS"
     CDS             532336..533148
                     /codon_start=1
                     /locus_tag="ROP_05160"
                     /product="putative oxidoreductase"
                     /protein_id="BAH48763.1"
                     /transl_table=11
                     /translation="MPEGRKIERNTVATLLNEKVVLVSGGTQGVGAGVVRAAVREGAR
                     VAFTGRRAEAGKALAAELEATGAQVRFFQADLADPGEARDSVTRTIEEFGRIDALCNA
                     AGLTTRGTLLDTTPELFDQHIAVNLRAPFFTMQGAVADMVERKAPGTIVNIISIAEHG
                     GQSYLAPYVAAKAGLAGLTRNAAYAHRFDRIRINGLDIGWTETEGETATQQRFHGADD
                     NWAAEAAAKVPMGKLGQVDEIADMVVFLLSDRSGVVTGSVINWDQTIIGGHD"
     CDS             533148..534155
                     /codon_start=1
                     /EC_number="1.1.1.18"
                     /gene="idh"
                     /locus_tag="ROP_05170"
                     /product="myo-inositol 2-dehydrogenase"
                     /protein_id="BAH48764.1"
                     /transl_table=11
                     /translation="MGSTIGVIGLGRIGAFHADTLAQLPGVDGLVVTDERPDVTASVA
                     AKFGARAVENAAAVFAAGVDGVVIAAATPAHAPLILAAVDAGIPVFCEKPVAFTADES
                     YQVVERLKTSTVPVQIGYNRRFDPAFAAARAAVASGELGWLHTVRSTTLDPAPPPADY
                     VAASGGIFRDCSVHDFDIVRWVVGHEVTEVYAAGSNQGDSIFADCGDVDTATTTLTFE
                     NGTLGVVSNTRYNPRGYDCRLEVHGSQDSVVAGWDASAPVRNLEAGITFPDGPPHRFF
                     MDRFTAAYRAELGAFLDVIAGTAPSRCTAQDALEVAWIAEAAALSLSQHRPVQMSEVR
                     R"
     CDS             534152..535015
                     /codon_start=1
                     /locus_tag="ROP_05180"
                     /product="putative inositol catabolism protein"
                     /protein_id="BAH48765.1"
                     /transl_table=11
                     /translation="MIRIAGAPISWGVCEVPGWGHQLGSERVLTEMRDAGLEAAEIGP
                     EGFLPADPQELAATLASYDLEAVGGFTPVLLHDPDHDPVPDITGALAAFTAAGAEVLV
                     LAAITGTDGYDSRPDLDDAGWKTLLSNLDRLHDVAADQGIRAVLHPHVGTMIEKNIEV
                     ERVLDGSSIPLCLDTGHLLIGGTDPLELARAAADRITHTHLKDVDAEFAARVQAGELT
                     YTDAVAQGMYTPLGTGDVDVAGVVRHLVASGFDGWFTLEQDTILTGEPEGEGPVADVK
                     TSAAFLRSLQL"
     CDS             535012..535992
                     /codon_start=1
                     /locus_tag="ROP_05190"
                     /product="oxidoreductase"
                     /protein_id="BAH48766.1"
                     /transl_table=11
                     /translation="MTPLRIGVLGASRIAELAIVKPAQILGHRLVAVAARDRGRAETF
                     AQTYGVERVLDSYEALIADPEVDVVYNPLANAFHAPWNRKAIEAGKAVLTEKPFARNA
                     AEAELVRRLARERDVPIMEGFHYLFHPIIRRIFELLADGTLGDLQRVEVVMRMPEPKP
                     DDPRWSLDLAGGAVMDIGCYGLHVHRQLGRFAGGEPAVVTARAVERSPGVDEACDIDL
                     VFPSGATGSSINSMTSDRFEMTLRLVGDRGEAFAYDYPLQSGDDRITITTDTGTVVEH
                     LGTRSTYTYQLDAFAQHLADGTAFPIDVDDAVTTMELVDSVYRAAGLPLR"
     CDS             536146..537174
                     /codon_start=1
                     /locus_tag="ROP_05200"
                     /product="putative ABC transporter substrate-binding
                     protein"
                     /protein_id="BAH48767.1"
                     /transl_table=11
                     /translation="MDTHNGPNASVPRKLPSRATALALSVAAAVLLAGCSSTGGKPES
                     TGGGMASGTADTPRATIAMITHEVPGDTFWDLIRKGAETAAAKDNIELRYSADPEAPN
                     QANLVQSAIDSRVDGIAVTLAKPDAMAPAVRAAVDAGTPVVAFNGGMDQYKSLGVPQY
                     FGQDEKLAGISAGQRLTADGAKKALCIIQEQGQVALETRCAGVIEGFKGQTEILNVNS
                     KDMPSVEATITAKLQQDPSIDHVVALGAPIALTAVQSKANANSSATIVTFDTNAALVD
                     AIKAGDVQWAIDQQPFLQGYLAVDSLWLYLNNRNTIGGGMPTLTGPAFIDQSNIDSIA
                     EYAQAGTR"
     CDS             537229..538287
                     /codon_start=1
                     /locus_tag="ROP_05210"
                     /product="putative ABC transporter permease protein"
                     /protein_id="BAH48768.1"
                     /transl_table=11
                     /translation="MSTQQDLDLSSHKVVHDERVKEQKRLQRLLLRPEIGSLFGAIAI
                     FVFFMIVAPPFRSPEALATVLYASSTIGIMACAVALLMIGGEFDLSAGVAVTTSSLAA
                     SMIAYNLHLNLWAGAALALVVSLAVGFFNGYLVMKTKIPSFLITLSSFLMLTGINLAV
                     TKLITGQVATPSVSDMQGFDSAKKVFASSFTIAGVSVRITVLWWLLFTAVATWVLFKT
                     RIGNWIFAVGGNQDSARAIGVPVTKVKIGLFMTVGFAAWFVGMHLLFSFNTVQSGQGI
                     GNEFLYIIAAVIGGCLLTGGYGTAIGAAIGAFIFGMTNQGIVYAGWNPDWFKFFLGAM
                     LLFAVIANNAFRNYAAKR"
     CDS             538293..539108
                     /codon_start=1
                     /locus_tag="ROP_05220"
                     /product="putative ABC transporter ATP-binding protein"
                     /protein_id="BAH48769.1"
                     /transl_table=11
                     /translation="MSTIEQMPVDTEPGGGGKIPLIELKHVGKQYGNIIALEDINLRV
                     RAGEVTGVLGDNGAGKSTLIKIIAGLHQQSSGELLVDGEALTFDSPKEALSKGIATVY
                     QDLAVVSLMPVWRNFFLGQELRSGPMRSLDSNGMRATTQEELHKMGIDLPDVDAPIGS
                     LSGGQRQCVAIARAIFFGARVLILDEPTAALGVKQSGMVLRYISAAKEQGFGVVFITH
                     NPHHAYMVGDHFVLLNRGRQKLDCTYDEISLEELTQQMAGGDELEALTHELRR"
     CDS             complement(539191..540225)
                     /codon_start=1
                     /locus_tag="ROP_05230"
                     /product="putative LacI family transcriptional regulator"
                     /protein_id="BAH48770.1"
                     /transl_table=11
                     /translation="MAHSRYKVREIAQQAGLSEATVDRVLHNRAGVREGTRAEVAQAI
                     IDLDKQRSQLRLAGRKYLFDVVMQAPTRFSGAFQEAVEAELPALAPAVVRTRFHFRET
                     GSVPAMVEVLDKLAKRPSHGVIVKAPDTTEVADAIDRLTEEGIPVVTYATDVPSSNRV
                     GYVGIENRAAGETAAYLLEQWLRDNPASVLVTLSSNAFRGEEEREMGFRGALRRSGSV
                     GGMGSQRTLIDISESEGLDSTVEQLVLDALERNPGIEAVYSIGGGNMATVRAFEKLGR
                     SYRVFIAHDLDSDNRQLLREKKISAVLEHDLRFDANLACRMLIQSRGGLSGVTTVMSP
                     IRIITPYNMP"
     CDS             540651..542087
                     /codon_start=1
                     /EC_number="1.6.99.3"
                     /gene="ndh"
                     /locus_tag="ROP_05240"
                     /product="NADH dehydrogenase"
                     /protein_id="BAH48771.1"
                     /transl_table=11
                     /translation="MTTPAQQNPERHKVVVIGSGFGGLFATQGLHRADVDVTIIDRTT
                     THLFQPLLYQVATGILSEGEIAPSTRTVLKDQANARVLLGSVTDIDLAAQTVTSQCDD
                     TTTVTRYDSLIVSAGAQQSYFGNDHFAEHAPGLKTIDDALEARGRILHAFEKAELIDD
                     PVERARQLTFVVVGAGPTGVELAGQIAELAHRTLDGTFRSISPTAARVVLLDAAPQVL
                     PPFGAKLGTAATRTLQSKGVEVELGAIVTDVDEHGLTVKDADGHTRRIEAACKVWSAG
                     VSASPLAKQLAEQTGAPLDRAGRISVGADLTLPGQPNVFVIGDMMSRDQLPGVAQTAI
                     QGGRYAARHIAREADGTSLPQDRAPFRYRDKGSMATVCRFSAVAQVGRFEFSGFIAWL
                     LWLAVHLVYIVGFRSRIATLLSWTSSFLGSGRGQLTTSEQQIRARSAVTSRQGQSERP
                     SPALMPDELGSPSHDPVAHEAASAIRVS"
     CDS             542120..542404
                     /codon_start=1
                     /locus_tag="ROP_05250"
                     /product="hypothetical protein"
                     /protein_id="BAH48772.1"
                     /transl_table=11
                     /translation="MSERIGAELIDFGLRWAPFGGPCDDDLLVEFGMTSGTYYNRLAR
                     ALRMRPAVQGGEAAHRSLLDMCYRQEPRSGGFEASTSDPPTPTTSTSPSK"
     CDS             542428..543921
                     /codon_start=1
                     /EC_number="1.2.1.27"
                     /gene="mmsA"
                     /locus_tag="ROP_05260"
                     /product="methylmalonate-semialdehyde dehydrogenase"
                     /protein_id="BAH48773.1"
                     /transl_table=11
                     /translation="MSNVITHWLDGKSFTGTSGNTAPVTNPATGEVTGQVALASVEDS
                     RAVIDAAAAAFPAWRDTSLAKRTQIIFKFRELLNERKGELAEIITAEHGKVVSDALGE
                     VSRGQEVVEFACGIAHLLKGGMTENASTNVDVHSIRQPVGPVGIISPFNFPAMVPMWF
                     FPVAIAAGNTVVLKPSEKDPTAAIWMAELWAEAGLPAGVFNVLQGDKTAVDELLTNPA
                     IKAISFVGSTPIAQYVYATGTAHGKRVQALGGAKNHAIVLPDADLDLAADAMVNAGFG
                     SAGERCMAISALVAVGDIADELVAKIKERTDTLKIGDGTKDSDMGPLVTKVHRDKVAS
                     YIDAGEHDGASIVVDGRTVQANGGKDGFWLGPTLIDHVTTDMSVYTDEIFGPVLSVIR
                     VDSYDEALELVNSSQFGNGTAIFTNDGGAARRFQNEVEVGMVGINVPIPVPMAYYSFG
                     GWKNSLFGDTHAHGAEGVHFFTRGKVVTTRWLDPSHGGLNLGFPQNN"
     CDS             544103..545518
                     /codon_start=1
                     /locus_tag="ROP_05270"
                     /product="putative myo-inositol transporter"
                     /protein_id="BAH48774.1"
                     /transl_table=11
                     /translation="MLTDSGRATAATSSSTRSNRPSKRLGLIAFIATFGGLLFGYDTG
                     VINGALEPLKEDLGLTALTEGFVVSILIFGAAFGALIGGRLSDRYGRRHNILLLSVVF
                     MTGTLGCVLAPTWEVLAAFRFVLGLAVGGASATVPVYLAEMSPAERRGSIVSRNEFMI
                     VSGQFAAFVINAVIFNIWGEHDSVWRYMLLVAVAPAIVLLLGMLRMPESPRWLISQGR
                     HDDALMVLQQVRTPEAAQAEMAEVEALAEEEKLTQVGGPIDLSVKWIRRLMLIGIGLG
                     VFQQFTGINSVMYYGTQLLADAGFSSSAAIVANTLNGLVSVLGITIALKVMNKVNRRT
                     MLFVGFALITIFHLLIGLSAVLLPDGTVKAYCILVFVVLFVFSMQGTIGPLAWLMLAE
                     IFPLKIRSFAIGVCIFVLWIANALVALFFPPVVAAIGIAMTFFIFAGLGLLALIFTTQ
                     VPETRGRSLEELEDDFREKYS"
     CDS             545546..545902
                     /codon_start=1
                     /locus_tag="ROP_05280"
                     /product="hypothetical protein"
                     /protein_id="BAH48775.1"
                     /transl_table=11
                     /translation="MTVLVAVTDTPEGAQALIAGKEEAERLGTTLLVLNLSLSEFPPT
                     ELAIADEADILDRSGRQARDPAVTVLDLIQERPDIERLVIGVKRRSRVGKALLGSISQ
                     RLILHSPVPVLAVKNE"
     CDS             complement(546153..546680)
                     /codon_start=1
                     /locus_tag="ROP_05290"
                     /product="hypothetical protein"
                     /protein_id="BAH48776.1"
                     /transl_table=11
                     /translation="MRKSLLIVALIASWSVAGAVPAGAAPMQPSWSGEYSLKRFAATK
                     TGTSLAARQWEPDFADTYRFETSCTDDSCVATVTDGPTPANPTLPLPPRYIWDGTSWV
                     HTYDWEWDCYQGEGVPKVWAPAHSVAYYTPQPDGTLTGSWRTDIDGGPCEGSVIMDVA
                     AYPVEPPPGPFGSSW"
     CDS             546965..547594
                     /codon_start=1
                     /locus_tag="ROP_05300"
                     /product="hypothetical protein"
                     /protein_id="BAH48777.1"
                     /transl_table=11
                     /translation="MSTSETWTADFANRAARRAAEPDPDWSRGCRRHPAVARLGCLRR
                     CYAPPVSRPWVGTGPTPYLCICVCREALRLELMVVTVAEVVALRYYRALADGGGDALP
                     AEVSNRILDDERHHVPFQSRRLSTGFAHTPAPARAAIGRIWRALAFAVAMVVAWNHGP
                     ALRVLGVTRRTFVSDTKRLFDNAAAEAMHTQRNRPPHACQSAVLRGSGP"
     CDS             548077..549159
                     /codon_start=1
                     /locus_tag="ROP_05310"
                     /product="hypothetical protein"
                     /protein_id="BAH48778.1"
                     /transl_table=11
                     /translation="MLDDAATGRFAVVPVVARSVGAGFGVAWIEREVSVVGVRVETVG
                     EGEPIGLDDVDTRVRWLLDLISGAEAQMLSRLWQPATFDVLAAGVDRQGRKLATQGHV
                     AAARLGWTPHYPDGVYVPSRVTRVVTAQVMASLRTLAFRDTAIASLSERFDPATGRIA
                     PPTAAADWMPPGFARGVRRQLIARARRDGDAVPSGRLRITDMQAPPQTSAMARLSAAD
                     RQLAQLTVAERELVLTVKLPTTPAPTGRAQWRSVRLTAAIPAHLHGRAITDWHLPTLV
                     LDKKGLLLRCAATELVPSGDLGSATVAVGWIGPRPRSVPPPSPPTARRGWSRTFGVSR
                     TTTAASGPNSPACRPKASCCTARPPG"
     CDS             549132..549869
                     /codon_start=1
                     /locus_tag="ROP_05320"
                     /product="hypothetical protein"
                     /protein_id="BAH48779.1"
                     /transl_table=11
                     /translation="MLHRKAARLTQLATNAEPEARTQLEAKIAVLNEHRTAAGAKRVK
                     INRELGFHFARQTADYATAAGATVIAVEDLTTLETRGHGRVNNNRAAQSARRKAITAL
                     AHTAASVGITVVSVPARGSSAQCPGCDAPLARPDGYHTAWCSGCRVGGNRDHIAGVNL
                     AKRALLGKGKVTRRRGQMPAVRVAEHAPVRRSRDKTGPTPRRPRHRRVRRSLPTVTPR
                     AGVTPKQICSCTSSVGVGHGPTRTTSR"
     CDS             550113..550691
                     /codon_start=1
                     /locus_tag="ROP_05330"
                     /product="hypothetical protein"
                     /protein_id="BAH48780.1"
                     /transl_table=11
                     /translation="MTATYTFDVFSSLDGYGGVSGGDWGGYWGKQGPELLDHRLALYD
                     SEQRMIFGANTYRAFAQMLASSTEESEVRDPWVTRMRSLPATVVSTTLEGPLDWPDAT
                     IVSGDAVDIVARLKQESDVPLRSHGSLSMNRALMAAGLVDRLQVTLFPVITGKTGDDP
                     IFQGAADFDLELLENRTLDGDIQELIYRPTLH"
     CDS             551055..551804
                     /codon_start=1
                     /locus_tag="ROP_05340"
                     /product="putative transposase"
                     /protein_id="BAH48781.1"
                     /transl_table=11
                     /translation="MASDIFGVSGRAMTDALIAGERDPKVLAQMARARMRAKIGLLEE
                     AFNGHFDEHHRFLLARMLGRIDAIDVDIAAVDDQIEAHLAPFTAAAERLDEIPGIGPV
                     AAADIIAEVGLDMSRFPTAGHLCSWAKFSPGINSSAGKSKGNGSTGHGNRYLARALGE
                     AAVVVGRTDTFLAARYRRIARRRGKKRAIVAVGRSILVIVWHLLQNSDARFRDLGPEH
                     FTRHINPDTKKRNHIRQLEALGYTVTLAPAA"
     CDS             552196..552636
                     /codon_start=1
                     /locus_tag="ROP_05350"
                     /product="hypothetical protein"
                     /protein_id="BAH48782.1"
                     /transl_table=11
                     /translation="MTFKRMDHVSVIVDDLESAIAFFVELGMEQEGGAQIEGPWVDRV
                     NGLDDVRVDIPMMRTPDGHGRLELTKFHNPTAISAEPENAMGNTLGLRSVMFAVDDID
                     ATVAGLRARGAELVGEVAQYQDSYRLCYLRGPAGIIVALAEELG"
     CDS             552720..553472
                     /codon_start=1
                     /locus_tag="ROP_05360"
                     /product="hypothetical protein"
                     /protein_id="BAH48783.1"
                     /transl_table=11
                     /translation="MADPMHFEAHAEIYGEARPPYPPALWDYLHGLGVLERGRRALDI
                     GAGTGQATGPLLAAGLDVTAVEPGPRLAARLRRAHPDAVVINERAEDVELPDSGFDIA
                     IAATSIHWIDLDIVLPKIHRALTPDGKFLVWRNVFGDPETRTPFRERVARIVQDRGAS
                     PRVGPDPDDVAALSEELTRSSLFSVDVVRTFRWNIELNDRQVFRLFSTFSDWTSEEAD
                     RAAAAVRELGGTVVEHYTTWLVALTPTPATTR"
     CDS             complement(553572..554459)
                     /codon_start=1
                     /EC_number="1.2.1.-"
                     /locus_tag="ROP_05370"
                     /product="putative aldehyde dehydrogenase"
                     /protein_id="BAH48784.1"
                     /transl_table=11
                     /translation="MAAWKLAPILTAGNTVVIKPSEQTPLTTLEFAELVGDLLPAGVL
                     NVVTGLGATVGAGLTEHPDLDMIALTGSVGSGKAVARGAAESLERVHLELGGKAPVVI
                     FADADLDDAAVSLRAASYWNSGQECGAACRILVHESVADAFVDKLVAQVATLVVGDVE
                     IGPLVSKAHYDRVAGYLERAAQQGITAAIGGSGLDGPGYFVAPTVLVGVPDGAECARE
                     EIFGPVVTVETFTDEDDAIRRANDVPFGLSASVWTENAPSQPRCRRPHRRRNRVGELP
                     SRPRERGPLGRLQRIRLRA"
     CDS             complement(554509..554940)
                     /codon_start=1
                     /locus_tag="ROP_05380"
                     /product="hypothetical protein"
                     /protein_id="BAH48785.1"
                     /transl_table=11
                     /translation="MIVSDDLPPSQHYIGGEFVAGEAGSFTDIVDPATETVIARIPEG
                     TTADVDRAVAAAVAAKPDWARLVPRQRSEILHRIADRLEQNSEILARIESANTGKPFE
                     VSNDDVAGTVDTFRFMAGAFTCHHLPLRGRLRREPPLAHPP"
     CDS             complement(555099..556592)
                     /codon_start=1
                     /locus_tag="ROP_05390"
                     /product="sodium/alanine symporter"
                     /protein_id="BAH48786.1"
                     /transl_table=11
                     /translation="MPEIDWAELLTTLADGIWGPMAYVVLGLGLAYTIAMKGIQFRRI
                     PDMIRQLREHSEGEGGLSSFQALVLALGSRVGVGSIAGVATAVGGGGPGALLWMAVTG
                     LVGCTVGYAEATLAQVFKRQVEDEDRQKAGEDIGGMPYYIKYGLKLPKVAALIAFLGL
                     VGYGFMFPGFQVSTIASSAQLAFGLPSWVPAVFVTALIALVIFGGTTRIVKVTQTLVP
                     TLAIGYLVLALAVIIANLESVPDAIKLIVNSAFGIDPVLGGIAGAAVAWGVRRAVFAS
                     ANGIGEATFAAAAARTSHPGKQGLVQTFSIYIDVLLICMATGLMMVVSGQYNVSDGSG
                     GHLVENLPGVEAGPNWVQKSIDTLAPGWGAGFIAVAVFLFGFTCLLLYYYVANSNLLF
                     LLNGRKGPVPRLILKLGTLAIVFVGSVVNAGIVWAIGDIGLGMIAWINLACLVLLFPL
                     VYKVYRDFEQQKKRGLDPTFVPKSLGIEGADFWEESSAATVTADRKD"
     CDS             complement(556596..557489)
                     /codon_start=1
                     /EC_number="4.2.1.52"
                     /locus_tag="ROP_05400"
                     /product="putative dihydrodipicolinate synthase"
                     /protein_id="BAH48787.1"
                     /transl_table=11
                     /translation="MSKQLSGVLTALTTPFDADEQIDVKKLQVVVDRSIKAGVDGVVA
                     AGSTGEVGALSSDERLRLVDTVIEHADGRVPVIAQTGATTTAEAIRLSRAAEKSGADV
                     LMLITPFYEPLSTEETVTYIKDVASSVELPIMLYNIPAVTGVNLNPGTVRSLAEEVDN
                     IRYIKDSSANWEQALQLIHHHSDVIGTFIGWDSYIYSALVEGAAGVMAGAANVVPDEI
                     VAVNRLIADGDLHGALGKWRDLYPVIDSMISVPFISAVKAGLALQGEPVGAPRRPTAE
                     LPAEQVERIGRALKKLADRSG"
     CDS             complement(557535..558929)
                     /codon_start=1
                     /locus_tag="ROP_05410"
                     /product="putative oxidoreductase"
                     /protein_id="BAH48788.1"
                     /transl_table=11
                     /translation="MRDVVVVGAGLAGLSAGWRLRHWDTLVLESDERVGGRIRSERRG
                     SYWLNWGGHVFAGPGSSTEALLNEAGVMSVDIPGSLQALSMNGKFLRKGHIATYPFRI
                     PMSLSARVATMRAGMKVVAGVGKYTGVVRKRAGESGAMRQQRIYDFANDESFLDFVGD
                     LPEDAAALFKTTVTRSAGNMDQISAGAGIGYFSLVLGFGQGLSRGIVGGPSTLTEALA
                     ASLGDRVQLGAAVHEVVHKKDSVIVRYRQDGRDHEVEARTVVLATTADVSHRVGVDLP
                     DDLRDALSQVKYGPHVSSAFLTDEKTKQPWDDIYAIAAPKRSFAIALNQASIVRGSES
                     VRQPGGSFMTFSPAALGQALLDKSDEEVVQTHLADLEQILGPGFSDTVVEAKAARWKN
                     ASPYSFPGRAKLQPTLTRGAGRVFLAGDYLGTLYTETSITSGFSAAQEVTSVLATHRQ
                     TRHSSPVVAQAASA"
     CDS             complement(559359..559751)
                     /codon_start=1
                     /locus_tag="ROP_05420"
                     /product="hypothetical protein"
                     /protein_id="BAH48789.1"
                     /transl_table=11
                     /translation="MRFVAAVSDGFGKARIASLGTADAPAKRGASRRVGGSAGLAAMV
                     EPGALQIQERRALGICSLLPAGDVVPNGSRTSVKFRRSAVGVLVVEKMGGRAIAPNQQ
                     LFIGETRRRSFVELRDRDVLHELQRDTQ"
     CDS             complement(559726..560559)
                     /codon_start=1
                     /locus_tag="ROP_05430"
                     /product="hypothetical protein"
                     /protein_id="BAH48790.1"
                     /transl_table=11
                     /translation="MGTSRLGDVELTYQLRERGERVVLVHASAFASWYDPLIEQLTAY
                     STLRYRRRLRKSDSGVYRALTVAEDAGTCVSVMDHVGWDAAHIVGHSYGALVALQLAT
                     ENPGRVGSVALLEPAIRGVASSEQIIVALQPVIAAYRSGDKAAAVDGFLRHVCGDGYR
                     GVLDRMVPHAFDDALEEADLFFQSELPAVQQWSFGAAESERITQPVLNVLGAESAPRF
                     VEGSELLQSWFPRAERLSVPKAGHLLMVQNPTAVARGLKDFFSRHPIDQVGSALRRRS
                     L"
     CDS             complement(560631..561458)
                     /codon_start=1
                     /locus_tag="ROP_05440"
                     /product="putative NADPH-dependent FMN reductase"
                     /protein_id="BAH48791.1"
                     /transl_table=11
                     /translation="MTIADFALRTALQQRYWDPALTEPAQWNPVLEALHSHRSVRRYL
                     PDPLTDETLDVLVSAAQSAATSSNLQAWSVVAVRDPDRKARLAALAGDQAHIVEAPVL
                     LVWLADFARVRQLAGDRGAPIEGADFLESSYLGFIDAALAAQNAVTAAESLGLGTVFI
                     GAIRNKPEEVAAELGLPPHVFAVFGLVVGQPHPDADAQIKPRLPRQAVLHHETYDLPA
                     QRDHIDAYEGRIAAFYGAQELEHSWTARVLDRLASAARLNGRDRLKESLIRLGFPLR"
     CDS             561638..562378
                     /codon_start=1
                     /locus_tag="ROP_05450"
                     /product="putative oxidoreductase"
                     /protein_id="BAH48792.1"
                     /transl_table=11
                     /translation="MTERVIVVTGAGSGIGRSIATGLLDAGHRVVLTGRTREALDQTA
                     HGNDHALVVPADVTSPQSVHNLFAVVAERFGRLDVLVNNAGTFGPSGAVDEIEPQDWD
                     QTVATNLTGVFLCSREAVRMMKSQTPRGGRIINNGSLSAHTPRPASVAYTATKHAVSG
                     LTKSIALDGRDHDICCSQIDIGNAETAMTAGIGQSARQADGSMRAEPTFDPRYVADAV
                     TRLVELPLDVTVPTMTIMAARMPFVGRG"
     CDS             complement(562381..563634)
                     /codon_start=1
                     /EC_number="2.7.7.49"
                     /locus_tag="ROP_05460"
                     /note="protein synonym:reverse transcriptase"
                     /product="RNA-directed DNA polymerase"
                     /protein_id="BAH48793.1"
                     /transl_table=11
                     /translation="MTARPALSPEIARRLAAVATDGAWTRAGLVLRFEETGVPDAGRI
                     AIRLHDLMPTPPIGGIDSVHRLLSELPLIAPPEPIVDEVSGNDWKFDVPQWSRTAAVA
                     EAVGLTPTELDWFADSGGWLRTKAPPLQHYRYRIRSDNRLLEAPKERLREVQRRVLRT
                     VLDRVPPHVAAHGFVRGRSVHTFAAPHAGHEVVLRVDLRAFFPSVSRTRVQAVFDALG
                     YPARVSRVLAGLCTTSTPPGVLAQLPFDTASRLRGAHLPQGAPTSPALANLVAHRLDR
                     RLTGLARTHRVAYTRYADDLAFSGSDLAVDRLIHAVGLIVADEGFSVHPGKTRVMRAH
                     RRQHLAGLVVNTRPQAARAEYDAVKALLFNCVRHGPDSQNRDGRPHFREYVYGRIAWV
                     GESNEGRKRSLHALAARVDWTEQRL"
     CDS             564241..565353
                     /codon_start=1
                     /locus_tag="ROP_05470"
                     /product="hypothetical protein"
                     /protein_id="BAH48794.1"
                     /transl_table=11
                     /translation="MRGVARGSKRKGNPDADLPGDDAPADLAAVRRDDALIDAIAGDG
                     PVATDSPEQYELALLLTNWRADIVSTPMPTGPLLDDVIAAIDASDNARSARSAARGKL
                     RLLRPIAGAAAAIAVVMGGATIFSYNAEPGDPLWSVKSVVFSQQADSTVAQIDTTTQL
                     QEAERLIAAGDAESAKNLLDGAADRAGGVRDADKRNELDVWRAKLAAELEKIAPTTPP
                     ATTTPGTTTTDTPTQTTSSPATVPGTEPLPGTQLPPDLQLPGLPPNSMPPLPTTTLPP
                     ETLPYISPEPTITMVPPPQAPLPEPSDNPITQPPPPEPSDNPITQPPPSEPSDNPITQ
                     PPPPEPSDNPATQPPVEQPPPQEPSSEPLAPPVPTS"
     CDS             565468..565740
                     /codon_start=1
                     /locus_tag="ROP_05480"
                     /product="hypothetical protein"
                     /protein_id="BAH48795.1"
                     /transl_table=11
                     /translation="MSTPADLDEQVTKVRDALHALRRTLLDLERTYADLDANKLDVDA
                     PGDPTTAPETLESAVDALRAAQDTLGIADADLEVAKRHTSRLTPRG"
     CDS             complement(565979..567364)
                     /codon_start=1
                     /locus_tag="ROP_05490"
                     /product="hypothetical protein"
                     /protein_id="BAH48796.1"
                     /transl_table=11
                     /translation="MHRMRRMDRSVAVRHPRRGERHMTDIIDYADKVWKGEANQNAYH
                     HGDLRTEGMHCIAEGTYMWPAFGNVYVFPTKAGLFVYDTGDRRTAEDLFAATRRISEQ
                     PVHTAVYSHGHVDHVFGMEPFDTEARERGWTRPTVLAHENVTRRFDRYKETRGYNGII
                     NQRQFQAPNLVWPDEYRYPDVTFADQTTLAVDDLQVQLHHARGETDDAAIAWIPDRKI
                     LCCGDFFIWASPNAGNPQKVQRFAHEWARTLRWMADLGAEILLPGHGLPVLGADRIRT
                     TLTDAAELLEILHGRTLEMMNAGATLDEVVHSVAAPGELLRKPYLAPSYDEPEFVIRN
                     VWRLYGGWYDGNPAHLKSAPRADLAREIADLGGGAAQLAERARALLARGEHRLAGHFA
                     QMATDADPQNRDSHQVRVDVFGQLEQGATSTMAKGVYGWAVAESRAFLDGSDHATELK
                     AKTAGRARWAF"
     CDS             complement(567432..568661)
                     /codon_start=1
                     /locus_tag="ROP_05500"
                     /product="putative CdaR family transcriptional regulator"
                     /protein_id="BAH48797.1"
                     /transl_table=11
                     /translation="MRTAPEGTRDDLQGTIARIRRSVQRMARTTIDRYIAASPLYTQT
                     AVPEHLHRESAHTVRSMFEVCLQSITDESIDVADAMRENIERGTERVAEGLPLREYMR
                     CWQIGFDVLSEELERELGTDHGLFWFAFRRAHVTFDGMLREVISAYEIHAHDLIAAQD
                     RNHAPTIDALLRGDGWVFDAPDSVPAEPSIMLLHIGDTLAEGSGDRNTRSLAATRKVR
                     AIRAHLARAVPGLWLIDVRPRHARILMHPPIGALDPLAVDLARVSGAPVTIAIEDATS
                     IEDLPRAGTTAAEVLDIAVRSGRTGTVSRMSDVALEHHFAHTSASLPVLLERCAPLRS
                     RPDLVHTLRVYFTSNLDRRATADTLVVHPNTVDNRLIRVRELTGLDVHVTTELLTLAV
                     AVSAATVHPDAGADHPQ"
     CDS             568812..569990
                     /codon_start=1
                     /locus_tag="ROP_05510"
                     /product="CaiB/BaiF family protein"
                     /protein_id="BAH48798.1"
                     /transl_table=11
                     /translation="MPDSANAPDDLPLAGIMVVDFGQYIAAPGAAQALADLGADVLKI
                     EGPGGDQARGIGVYGEAIMRAYNRRKRSIVLDLKTEVDLRHARVLIARADVVIHNLRP
                     GVMEKLGLSADEIHELNPTVILAAVSGFGTDGPSRRRPGLDIAAQAETGMMSVTGEAD
                     GDPQRVGFPLVDHATSYVVTQAVLSALFRRERTGLGDDIDVSLLDVAIDLQCVNWGEY
                     SITGVAPHRRGNGQPTAAPAADVFPTADGSIVISAYTEQRFAQLCGLAGQPDLPSDPR
                     FVDNPSRVAHRGELLAALAPFFAGLDTEAALAALTSVGIVAGAVRTYDLVPSAPDVIA
                     SGIFATGSTGDGHTYSIPGLPYRSRSTPRTADAGRVPELGEHSNEIVAHYRLGEYSLT
                     "
     CDS             570046..570840
                     /codon_start=1
                     /locus_tag="ROP_05520"
                     /note="fragment"
                     /product="putative MFS transporter"
                     /protein_id="BAH48799.1"
                     /transl_table=11
                     /translation="MSLQNPQTRAEGGDLVADPELDSPRVRRRGWIITLMLMAFMLIN
                     FADKVVVSLAGVEIKTDLGLSNQQFGTAQSAFFWLFAVGAVALGSLGGRISARWLLAG
                     LVGLWVLSLAPMTTTVGFGVFLACRMVLGFAEGPAGALSQQIAHTWFSPKRRSLPASV
                     VIMGASLGPLIAAPVLTWIIQSYSWHAAFLVLMVAGVMWLVAWLFIGGEGPAGNAGAG
                     TGNQAVTLPDTVPVRLLWTRPTVIGVAIFSFCSYWATALKVSWLPL"
     CDS             570841..571383
                     /codon_start=1
                     /locus_tag="ROP_05530"
                     /note="fragment"
                     /product="putative MFS transporter"
                     /protein_id="BAH48800.1"
                     /transl_table=11
                     /translation="MREGLHYSANATGLLITLPFAAAVILTFLAGLISTRLSLAGRSS
                     RTARALFAAGLLAAGGVCMIGFTALPVGAIQMVLIALAFSLNTAAWGLAFSLLSDVVP
                     AKQRGSVMSITVAIYSLGGVAAPLLIGSLVSGAADTAAGYGRGFVIVGVIMLVGALTA
                     AVLVNPERDATTIAAHHPNT"
     CDS             complement(571759..573165)
                     /codon_start=1
                     /locus_tag="ROP_05540"
                     /product="hypothetical protein"
                     /protein_id="BAH48801.1"
                     /transl_table=11
                     /translation="MDAHIVLPTIDGQSFASLRRRATPRAERYALGKRLRQETPRSAL
                     GEWRAPDDRPDVVDQIGVSHQGRVESLIPVRVGRMAASPYGFLRGTAIVMAQDLAGLP
                     ATGIQPVICGDSHLGNFGFYASPERDLVLDLNDFDEAHPGGWEWDLRRLTASIWVAGR
                     QNSATESQCESAVQSCVATYREHVRWLAEQPLLARSFERLDLDRLHTTASDESLRHEI
                     TRAAERARRRVSDRALPRFTEQDETGRRIVEEPPLITRVSKAEAERIAAGLDEYLTTL
                     PSHWARLLSGYTVVDVAHKVVGVGSVGLRAYVVLCEGSSADDVVFLQLKQARRSVVAR
                     FVHGESAWHDHQGRRVVEYQQALQTVSDPLLGWTTVEGRQYYVRQFRNMKGAVPIDNL
                     SAAALTDYAGICGRLLAKGHARTSGASMISGYVGKSDTLDVALSRFAHAYADQTERDH
                     ATLVDAVKRGKLPCEPLT"
     CDS             complement(573571..574827)
                     /codon_start=1
                     /locus_tag="ROP_05550"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH48802.1"
                     /transl_table=11
                     /translation="MNAISSAGERLTFGAPSSPWLRVGQVGAALAAGMGIGRFVYTPV
                     LPLMEAQAGLTPSAGAALATANYSGYLVGALAGIAIPGVMRSAATMRISLLALTVTLA
                     LMPVASNETSWGVLRFIAGVASALVFVLAVGAMHSHLGGQAAHLSGWAFGGIGAGIAL
                     SGFVVLVLRTMSTWESVWWAAALLTAICTFAAWTLTPQPRATAAAGERRKSPEQGVRS
                     FGALFVSYLLEGVGYIIAGTFLVAAIDRTAGSIAGSGAWVLVGLAALPSGPLWASLGR
                     RWSRPILLVIALTVQAVGIALPAAADGVWPALVSAFLFGGTFLGISQMSLAIGADLQI
                     PRAVAILTSGYSLGQIVGPLVVTPLLSDGYHLALLVAAGIVLAAALAAAALPVLTWGL
                     PKRAGATATGAWSDCRSRYRTPPRGG"
     CDS             complement(574873..575772)
                     /codon_start=1
                     /locus_tag="ROP_05560"
                     /product="putative LysR family transcriptional regulator"
                     /protein_id="BAH48803.1"
                     /transl_table=11
                     /translation="MDIGDLSFFLAVARAGGISRASKELLTVQSNISSRIRALEDELG
                     VELFRRHARGVTLTNPGERLVPYAEHITRLVREVTQVVGDDRDPSGRLAIGSMETTAG
                     LRLPGVLAAFSEDCPRVDFTLTTDTTDALTTQVLEHRLDGAFVCGPVRHPDLISEQVF
                     IEQLVLVSGVRIAGLDSVPADGRRHKVLVLRAGCAYRARLERLFEQHGLPGPDILEFG
                     SLEGILGCAAAGMGVTLLPLGVVTASPLASALKVHHLAPADSRAETLFVRRKDSTTTP
                     ALSRFLFHIHESSRPASLTSVAR"
     CDS             complement(575754..576806)
                     /codon_start=1
                     /EC_number="1.13.11.32"
                     /locus_tag="ROP_05570"
                     /product="putative 2-nitropropane dioxygenase"
                     /protein_id="BAH48804.1"
                     /transl_table=11
                     /translation="MFDLEEDLRIAIVGAPMAGGPSTPELAAAVSSTGGLGFLAAGYK
                     SVDAVRREVDAIRALTDAPLGLNLFVPGRPLADRAAVEAYRERLRPLAERRNVVLPEV
                     VDHDDDAFDAKVGLAVELAVPVVSFTFGLPPRDVVDRLHAAGTAVVATVSDVDEARSA
                     AERGVDAICMQGVDAGGHRATLDPDAEPDPRSTRDLVEAARSAVDTPLIAAGGIATGG
                     DVAAALAAGAVAVQIGTALLGADEAGTKPAHRAALHDDRFTDTVVTRAFSGRPARGLV
                     NDFISDFDTYAVTAYPQVHLLTSGLRSAAAAAGDPHGLALWAGVGYRTARSAPAGEIV
                     RDLWSEARGFSWTSAT"
     CDS             576935..577804
                     /codon_start=1
                     /locus_tag="ROP_05580"
                     /product="putative LysR family transcriptional regulator"
                     /protein_id="BAH48805.1"
                     /transl_table=11
                     /translation="MTIELRHLRAVVAVAEAGSFTAAATALHITQPALTRTVQQLETS
                     LGVRLFDRTSRALALTEDGAGFVEKVRVILGDLDSAVALYTTRSLALGFSWLLPDPWA
                     QQVIDDVEKNSRATVVPRRCDDPIAALNNATVDAAVVRRDVPGDEFVQHPLFEEQRIA
                     AVSAASPLASRETIDWAEFGTLPLVINTLSGTTSEDLWPNHDGPVVTCSNFDEWLELI
                     AADRGVGTVPEVARRRVTHRNVRFIPLVGAPPAVVRFVYRRNRVTPLLRVLRDAAIRN
                     SPPPHGATVRQPR"
     CDS             complement(577792..578478)
                     /codon_start=1
                     /locus_tag="ROP_05590"
                     /product="hypothetical protein"
                     /protein_id="BAH48806.1"
                     /transl_table=11
                     /translation="MTGPSRYGAIAFTAPVAERQKATGSIHWYGRRRAQGENVGRPDE
                     LDTRVTALIRSTDSFFIATVTPSGWPYIQHRGGPPGFVHVPNSSTITLADYPGNQQFV
                     TIGNLDENDRVALFFIDYPTRTRVKVYGRADIVERADDPELIERILATPDGVGRAGCD
                     RALVVHVEALDRNCTKNIPPKYGEARMRESLALARKGLQDEVDALKSRNAALEREIAQ
                     LRGGSDGQRG"
     CDS             complement(578475..579914)
                     /codon_start=1
                     /locus_tag="ROP_05600"
                     /product="putative MFS transporter"
                     /protein_id="BAH48807.1"
                     /transl_table=11
                     /translation="MASQSVSPPVPVSGVPKSSLRKIIAASSVGTLIEWYDFYIYGSL
                     AVVFSGMFFPEGNGTAALLVTIAAFGTGFVVRPIGAIVFGRMGDRVGRKKTFMTTLLI
                     MGGATTLLGLMPTYDHIGILAPILLVTLRLLQGLAIGGEYGGAVVYIAENSPTEKRGA
                     LTSVLQTTATGGLLLSIGVIVLCRVGLGEAAFTSWGWRIPFLLSAVLVLFSLKIRMKM
                     HESPVFEEMRKSGNLSRSPIRDAVAHKPAFALLLVVLFGVTAGLGVAWYTSQFYTLYF
                     LQTILKIDFLTANVSVGIALVIATPFFVVFGKLSDKHGRMRIILCGLVFSAAGYLPLF
                     AWIRHAAVHGDQFQMVLALTVQVIFVTMIYGPTAAFLSELFPPQIRYTGLSLAYHLGT
                     GVFGGFTPLVALSLNTATGNVLAGLIYPIAVTAITALVFVLTLRRGVDSPIVRRAWKQ
                     IDSEYTAESISATAEQPRGSVPAPEAATS"
     CDS             complement(579972..580961)
                     /codon_start=1
                     /locus_tag="ROP_05610"
                     /product="putative oxidoreductase"
                     /protein_id="BAH48808.1"
                     /transl_table=11
                     /translation="MSLQNRFTEKFGIEHPIVLAPMDYVSDWRLASAVAEAGGLGLIG
                     GGYGDESWLHDQFDQVTTAAVGCGFITWSMAQQPRLLETTIDYRPAAIFLSFADPAPH
                     APAIRAAGIPLICQVHDLDQARRAVEVGASVLAAQGGEAGGHGTGARSTFTLVPEIAD
                     FLRRQAPEVMLLAAGGIGDGRGLAAALALGADGALVGTRFWAAEEAAIPRAAQRRALR
                     ASGDDTIRQSAFDIVREKPWPTRYTGRVLHNGFIRRWHGDEPGLRDALREKQEQFLVA
                     VKAENYDVANLIVGEVIGQIDRVDSVASIMDDMVGTAAAILGRSSRDLAAIGS"
     CDS             complement(581181..581921)
                     /codon_start=1
                     /locus_tag="ROP_05620"
                     /product="hypothetical protein"
                     /protein_id="BAH48809.1"
                     /transl_table=11
                     /translation="MTIERLLTTHFPDDPVMDAAFASALLRRTGRDPNAPGLVRIYSP
                     ARTLSFGRLDAIRPQFPAAAAAARRHGFTPVVRGAGGRAAAYHEQTLVVEIFSRDTEG
                     IIGARPRFERITPRIAAVLRSLGVDARIGPVPGEYCPGDWTVNGEGRVKLAGTAQRIV
                     AGAWLFGFELVVSDSNPVRAVLTDVNAALELDFDPGTAASLTDMNPGVTLEQVRAAIL
                     AETGGLHERAADPGLLDEAANLRDAHVA"
     CDS             582148..582585
                     /codon_start=1
                     /locus_tag="ROP_05630"
                     /product="hypothetical protein"
                     /protein_id="BAH48810.1"
                     /transl_table=11
                     /translation="MLLRSSVVALPCAVAAVLSASPAQATPSSGVTAQILFETTVPAV
                     AGSSAGTDLTLRRIEIASGGTTGWHYHDGPVYAFVESGVLSRTLQDCTKAVTTAGQAI
                     TEDHGSDHVHEGSNLGTEPLVLLAFYTQPEGKPLSEDAPAPAC"
     CDS             complement(582605..583345)
                     /codon_start=1
                     /EC_number="1.3.1.54"
                     /gene="cobK"
                     /locus_tag="ROP_05640"
                     /note="protein synonym:precorrin-6A reductase"
                     /product="precorrin-6X reductase"
                     /protein_id="BAH48811.1"
                     /transl_table=11
                     /translation="MSRILILGGTGEARALAAALADVPGVEAVSSLAGRVRDPRLPAG
                     EVRIGGFGGAAGLAEWLCAHPVDAIVDATHPFAAQITRNAADAAHRRGIPLVVLRRPE
                     WAPRPGEHWHTAPDLARAADLLPGLGTRIFLTIGRQGVDVFAGLHALWFLIRAIDPPD
                     VAMPPQSTLLLARGPFAVAGETALMREHRIDVLVTKNSGGGQTDAKLDAARALGIPVL
                     MIRRPPLPSATATVDDVAGAVAWIGALA"
     CDS             complement(583348..584097)
                     /codon_start=1
                     /EC_number="2.1.1.133"
                     /gene="cobM"
                     /locus_tag="ROP_05650"
                     /product="precorrin-4 C11-methyltransferase"
                     /protein_id="BAH48812.1"
                     /transl_table=11
                     /translation="MTVYFIGAGPGAADLITVRAQRIIATSPVCLYAGSLVPQELLAE
                     CPEGARVIDTARLSLDEIVALLIEADAAGQDVARLHSGDPSIFSAVAEQVRRLESAGV
                     AHTVVPGVPAFTAAAASLGRELTVPGVSQSIVLTRVSTLSTAMPEGEDLRSLGRSGAT
                     MVVHLGAHRIDQIAEELIENYGRDCPAAVVAFASRPDEIVLRGTLATIADQVKAAGVT
                     KTAVVIVGKVLAAEGFPDSYLYSATRERTTH"
     CDS             complement(584094..585329)
                     /codon_start=1
                     /EC_number="2.1.1.132"
                     /gene="cobL"
                     /locus_tag="ROP_05660"
                     /note="protein synonym:precorrin-6Y methylase"
                     /product="precorrin-6Y C5,15-methyltransferase"
                     /protein_id="BAH48813.1"
                     /transl_table=11
                     /translation="MTDPIVVVGIGADGWDGLSPSARREIEVADVVMGSGRQLALIPE
                     TPALRVAWPSPLVPALPGLFEQHHGRRVCVLASGDPMFHGIGVTLVNLLGAERVRVIP
                     HPSSATLACARLGWAAHETPVISLVNRPVDALLPELADATRLLVLSRDEHTPAAVADL
                     LTGRGFGPSRLTVLGELGGPDESRLDGTASVWSHGPGPRLNVIAIDCRAESGAVRLTR
                     LPGLPDAAFTGDGQMTKHEIRALTLCALAPAAGELLWDVGGGSGTVAIEWMRTHPRCR
                     AVTFERSAARVDQIEANASALGVPSLTVFGDAPAAFEDVPPASSVPDAIFVGGGVTQD
                     GLLGECWSRLRVGGRMVANAVTAESEALLLQWFSKCGGQLRKFQVYRGEPLGGFTAWR
                     PQLPVAQWSVTKQSKGDAA"
     CDS             complement(585326..586099)
                     /codon_start=1
                     /locus_tag="ROP_05670"
                     /product="putative oxidoreductase"
                     /protein_id="BAH48814.1"
                     /transl_table=11
                     /translation="MSLGSKKNSGQPDEGVVLLLGGRSEIGLEIASRLAPGRTIVLAA
                     RRSTELAAERQSLLDAGASAVDCVEFDADDLDSHEKLLRSVVDTHGPLSVAVLAFGIL
                     GDQARAERDARHAVAVVHTDYVAQVSVLTHLATLLREQKSGRIVVFSSVAGVRVRRAN
                     YVYGSAKAGLDGFASGLGDALHGSGVSLLLIRSGFVIGRMTEGMSPAPMSSTPGQVAD
                     AVVRGLYRGASRVWVPGRLRPVFFVMRLLPQAIWRRMPR"
     CDS             586130..586543
                     /codon_start=1
                     /locus_tag="ROP_05680"
                     /product="hypothetical protein"
                     /protein_id="BAH48815.1"
                     /transl_table=11
                     /translation="MDRTPSTPIRLPDAALAFLGEYHLGTLTTLRKNGTPHVVAVGFT
                     WDQEHGLARVITNGSSQKALNAERGGYGAVSQVDGPRWMTLEGPARVLTDPESVADAV
                     ARYAARYRQPRVNPTRVVVEIAVSRVLGSAALRHD"
     CDS             complement(586503..587261)
                     /codon_start=1
                     /EC_number="2.4.-.-"
                     /locus_tag="ROP_05690"
                     /product="glycosyltransferase"
                     /protein_id="BAH48816.1"
                     /transl_table=11
                     /translation="MESVAPKVTVVVPTYNERDNLPKIVELLAALDIPNLHVLVVDDN
                     SPDGTGEVADTLAQSGPIPVGVLHRTVKDGLGRAYVAGMTRALSEGADIVIQMDADLS
                     HPTEAIPRMVETLTTTDAAVVLGSRYVAGGAVASDWPWHRKALSAWANFYVNAILRLR
                     VKDATAGFKAWHADTLRAIDVEGVQSNGYAFQVEMNYRTVQRGMTIAEVPIRFEERTD
                     GVSKMSLAVQLESARVPWKLRFSRDAAQPSRVRG"
     CDS             complement(587390..588529)
                     /codon_start=1
                     /EC_number="3.4.13.9"
                     /gene="pepQ"
                     /locus_tag="ROP_05700"
                     /note="protein synonym:prolidase"
                     /product="putative Xaa-Pro dipeptidase"
                     /protein_id="BAH48817.1"
                     /transl_table=11
                     /translation="MSSLGASTSRFPTTIYADRIARAGALARDAGLDGLLITPGPDLR
                     YLLGSRAESFERLTCLVIPANGDTASVVVPRLELAALTESATSDLGLTVRDWVDGVDP
                     YALVSGLLPSPARTAVTDAMPALHLIPLSEALGALPILATEVLRELRMVKDDAEIDAL
                     RRAGQAIDRVHARMGEFLKVGRTEAEVAADITAAILEEGHTEAAFVIVGSGPHGADPH
                     HEVSERVVESGDVVVIDIGGPVEPGYNSDSTRTYSMGEPDPGVAEKFAVLEEAQAAAV
                     ALVRPGVTAEAVDAAARDLLAAQGLAEVFVHRTGHGIGLSVHEEPYIVSGNSIELTEG
                     MAFSVEPGIYFRGEWGARIEDIVVVTADGCEPVNTRPHGLTVLPG"
     CDS             588557..589522
                     /codon_start=1
                     /EC_number="3.1.11.-"
                     /locus_tag="ROP_05710"
                     /product="putative 5'-3' exonuclease"
                     /protein_id="BAH48818.1"
                     /transl_table=11
                     /translation="MRVMTGPLLLLDGASLWFRAYYALPDSITSPDGRSVNAVRGFTD
                     MVAALITKHQPSRLAVCLDLDWRPAFRVEAVPTYKAHRVAEDTGGAEEEVPDTLSPQV
                     PMILDVLAATGIATAGAEGLEADDVLGTLAATETRDAVIVVTGDRDLLQVVTDDPVPV
                     RVLYVVRGLAKAELLGPEEVAAKYGVPADRAGEAYAELALLRGDSSDGLPGVKGIGEK
                     TASSLIMQYGSLAALRAAAVDPESDMAKGARAKFAAAADYLDAALPVVRVVRDAEVEL
                     SREDTLPAKPVDADRLGRLADELGIENSVGRLTAAMKKVAAARVP"
     CDS             complement(589550..590245)
                     /codon_start=1
                     /locus_tag="ROP_05720"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH48819.1"
                     /transl_table=11
                     /translation="MSGPYGPNDPNGQWAQGQQPGQGNPDQSGGQYGAPQYGQQPPAQ
                     PWGQQPGQPQQPGQPQWGQQPQQPGQPQWGQQPQPGQLGQPGPGQWGQQPQQPGQPQW
                     GQQPGQPQQWGPAPGQQQWGQPPSSGKSKLPLIIGGVVALLVIVGIALVLAFTVFGTD
                     TLDQKAAEDGVERIVTDSYGAENVSGVTCPSGQEVKKGNSFTCSLTVDGEKKQVTLTF
                     TDDKGTYEVSRPS"
     CDS             complement(590348..593083)
                     /codon_start=1
                     /EC_number="3.6.1.-"
                     /locus_tag="ROP_05730"
                     /product="putative helicase"
                     /protein_id="BAH48820.1"
                     /transl_table=11
                     /translation="MTTGDTTGGTELDVFSAQLGFVLDPFQINACRALEGGHGVLVCA
                     PTGAGKTVVGEFAVHLALAAGRKCFYTTPIKALSNQKYAELVRRYGKDTVGLLTGDSS
                     INSDAPVVVMTTEVLRNMLYADSAALRGLSHVVMDEVHFLADRFRGAVWEEVILHLSE
                     DVRLVSLSATVSNAEEFGAWMETVRGDTTVVVDENRPIPLWQHIMVGRRLFDLFDTRA
                     RSGDARNDLVVDQDLVRHVKQRQALERADSWEPRGRGRRGGGRGYSSDFRPLPRPEVI
                     SRLDDEGLLPAITFIFSRAGCDAALAQCLRSRLDLTTPEQVAEIRTIVDAHTGELPKA
                     DLEVLGYWEWRKALERGLAAHHAGMLPAFRQTVEELFVKGLVRAVFATETLALGINMP
                     ARTVVLERLVKYNGEAHAELTPGEYTQLTGRAGRRGIDIEGHAVVLWQPGVEPVDVAG
                     LASTRTFPLRSSFRPGYNMTINLVDRMGAAESRALLERSFAQFQADRSVVGLTRGIER
                     NEAALTTLRERLGGEDGEYFEYARLREELSSRERSLERAGRTERRDAAVASLVALRRG
                     DVIAIPVGRHSGLAVVLEPDRDPTDPKPLILTEAKWAGRVSAGDFPEPARSLGSMRLP
                     RRFDHHTARVRRDLASALRSTGIVAPGRRKRKKSGAAADDAEIARLRRAIRQHPCHSW
                     PDREQLSRIGERYNRLARETETMRQKVAATTNSLARTFDRILSLLAERDYVSAGEHPD
                     ATEHGTRLSRIYCESDLLVAECLRQGVWKGLGPAELAAVASAVIFESRREGDTVESGG
                     PGALRHALDETVRVWRELRADEIRHKLPPTREPDFGFAAAIYHWASDNSLVEALIAAG
                     DQGRALSAGDFVRWCRQVIDLLEQVRSTSPDPEVGKAAGRAVAAIRRGVVAVDAA"
     CDS             complement(593102..594142)
                     /codon_start=1
                     /gene="tatC"
                     /locus_tag="ROP_05740"
                     /product="Sec-independent protein translocase protein
                     TatC"
                     /protein_id="BAH48821.1"
                     /transl_table=11
                     /translation="MRIPFDPRHSKRRTNPDGTMSLVDHLYELRTRLLLSVLAIVVTT
                     AVGFFWYSHQIFGIESLGELLRGPYCSLPESSRADLSNDGSCRLLATGPFEQFMLRFK
                     VALTAGVVLACPIWLYQLWAFITPGLYAKERRYAIGFVVSGAALFIAGAVLAYVVVAK
                     ALHFLLTIGDNVQITALGGAEYFGFIINLLIIFGVSFEIPLLIVALNFVGILPYAKLK
                     AWRRGLIFALFVFAAIATPGQDPFSMLALAFALTLLFEIAVQIARINDRRKARRTEQE
                     WGALDDDEASTIAAPADLNESFDVAAATVPESAGRFRRSRKSGKSGAANKNDAASTTG
                     SNTPGQDFSDTL"
     CDS             complement(594214..594495)
                     /codon_start=1
                     /gene="tatA"
                     /locus_tag="ROP_05750"
                     /product="Sec-independent protein translocase protein
                     TatA"
                     /protein_id="BAH48822.1"
                     /transl_table=11
                     /translation="MGAMSPWHWAIVALVVVILFGSKKLPDAARGLGRSLRIFKSEVK
                     EMQNDNSTPAPTAQQSAPAELPVADTTTAPVTPPAPVQPQPQHTEPKSA"
     CDS             complement(594568..594834)
                     /codon_start=1
                     /locus_tag="ROP_05760"
                     /product="hypothetical protein"
                     /protein_id="BAH48823.1"
                     /transl_table=11
                     /translation="MGRERVGAEIRDHGLRLTDLHGSDIEVGASDIAFDTGPGTAAPV
                     NARLVALIREAEAGGNRQWSGEALLADLRSQRGPRKPAGKRQRS"
     CDS             complement(594841..595821)
                     /codon_start=1
                     /gene="pafC"
                     /locus_tag="ROP_05770"
                     /product="proteasome accessory factor C"
                     /protein_id="BAH48824.1"
                     /transl_table=11
                     /translation="MSNRLSSRLSRLLNLVPYFIANPGMSAAEAAAELGVTTTQLMSD
                     LNQLWVCGLPGYGPGDLIDLSFSEESIEVTFSAGIDRPLRLTSTEATALLIALRSLVE
                     MPGMVDPSAAHSAIAKIEDAAGTAAARAAVTPASERAAVEDVAEDPVAAAVRSALHRR
                     RALHLTYYSASRDRVTERTVDPVRIVLVDNHSYLQAWCRQAEGVRLFRLDRIDAATEL
                     DEASTPPAQALVRDSNLELFSGDASLPQARLHIGADCVWVLDYYPMDVATVAADGSVE
                     ATMSYGALEWMARLVLGFGSGITVLGPPELVHEVRRRAVEALSAYEAVEA"
     CDS             complement(595818..596810)
                     /codon_start=1
                     /gene="pafB"
                     /locus_tag="ROP_05780"
                     /product="proteasome accessory factor B"
                     /protein_id="BAH48825.1"
                     /transl_table=11
                     /translation="MPTSKIERLMNLVICLLSTRQFLTAEKIRESVAGYADSASDEAF
                     SRMFERDKNELRDLGVPLETGQASRFSTVEGYRINRNAYELPDIDLDQEESAAVAVAV
                     QLWESPELTSAAQGALLKLRAAGVQVDPDSAATPITAVPARTRGSEPALGKLLAAVDA
                     GRAVHFPHRGALNEPYTERTVEPWGVVTAHGRWYLVGHDVDRGAVRTFRLSRIGDDVT
                     EFGPSGVVHKPADVDLRDIVDRVTGSGEVTGTATVWVAEGRAQELRRLATTAEEKRVN
                     ERSGTVLRIPIHSRDWIARLVAGHGADALVLDPPELRHDVLTKLKDAAGEGVTS"
     CDS             complement(596858..598216)
                     /codon_start=1
                     /gene="pafA"
                     /locus_tag="ROP_05790"
                     /product="proteasome accessory factor A"
                     /protein_id="BAH48826.1"
                     /transl_table=11
                     /translation="MQRRIMGIETEFGVTCTFHGHRRLSPDEVARYLFRRVVSWGRSS
                     NVFLRNGARLYLDVGSHPEYATAECDNLIQLVNHDRAGERVLEELLIDAEQRLAEEGI
                     GGDIYLFKNNTDSAGNSYGCHENFLVARAGEFSRISDVLLPFLVTRQLICGAGKVLQT
                     PKAATFCLSQRAEHIWEGVSSATTRSRPIINTRDEPHADAEKYRRLHVIVGDSNMSES
                     TTMLKVGTAALVLEMIEAGVSFRDFALDNPIRAIREVSHDVTGRRPVRLAGGRQASAL
                     DIQREYHARAVEHLQNRDPDPQVTQVVDLWGRMLDAVETQDFAKVDTEIDWVIKRKLF
                     QRYQDRHGFELADPKIAQLDLAYHDIKRGRGVFDVLQRKGLVKRITEDETIEAAVDTP
                     PQTTRAKLRGEFITAAQEAGRDFTVDWVHLKLNDQAQRTVLCKDPFRSVDERVERLIA
                     SM"
     CDS             598293..599756
                     /codon_start=1
                     /locus_tag="ROP_05800"
                     /product="hypothetical protein"
                     /protein_id="BAH48827.1"
                     /transl_table=11
                     /translation="MNRHLHRIHRVDEIVFGRSADLRPSGVDRAMRFLSHAADKGVLW
                     WCVAALLGLVGGRARRGAVRGLLSLAMASGLANGILKPVFPRRRPPARAWTNVLRGVP
                     IPRSSSFPSGHSASAAAFTTGVALESPAAGAALAPLAAAVAYSRVHNGVHWPSDVLVG
                     LMLGGAVASGTRRWWAVRTEDPAELGPAVDAPALPGGEGLLVLVNQESGPDTVDPSEE
                     IATALPKAHVRALDTDRDFAEQLDAWVAETNPRALGVCGGDGTVVAVASAAARHTLPL
                     AVFPGGTLNHFARDAGVPEISDTATAVETGHAVLVDQAVVHTDVAEPAPFLNTASLGG
                     YPDAVRLREKWQPRYGKWPAACAAMIRILAAATPLAVTLDGRPVNVWMLFVGNGRYSP
                     GDQVPMSRPAITGGLLDVRYVRADRRASRPRLLFAAVTGTLGSSRVYVRSLVPRLTVR
                     VNGAPVALATDGEVVTDARRFEFRTVPGAIAVYRPQS"
     CDS             complement(599747..600526)
                     /codon_start=1
                     /EC_number="3.4.25.1"
                     /gene="prcA"
                     /locus_tag="ROP_05810"
                     /product="20S proteasome alpha-type subunit"
                     /protein_id="BAH48828.1"
                     /transl_table=11
                     /translation="MTMPYYASAEQIMRDRSELARKGIARGRSVVVLTFRDGVLFVAE
                     NPSTALHKVSELYDRLGFAAVGKYNEFENLRRAGIVHADMRGYSYDRRDVTGRSLANA
                     YAQTLGTIFTEQPKPYEVEICVAEVGRVGSPKAPQLYRITYDGSIVDEQHFVVMGGTT
                     EPIATAMRESYRADLDLEAAVGIAVNALRQGGAGEGEKRNVDVASLEVAVLDQSRPRR
                     AFRRIAGAALEQLVPAAPAAASESAPEPKPDTETKPADPQD"
     CDS             complement(600523..601407)
                     /codon_start=1
                     /EC_number="3.4.25.1"
                     /gene="prcB"
                     /locus_tag="ROP_05820"
                     /product="20S proteasome beta-type subunit"
                     /protein_id="BAH48829.1"
                     /transl_table=11
                     /translation="MTADRPALRTGDGDTRLSFGSNLSSFTEYLRGHAPELLPENRIG
                     HRSHSTRGGDGMESGDLAPHGTTIVALTYKGGVLLAGDRRATQGNLIASRDVEKVYVT
                     DEYSAAGIAGTAGIAIELVRLFAVELEHYEKIEGVPLTFDGKANRLASMVRGNLGAAM
                     QGLAVVPLLVGYDLDADEEARAGRIVSYDVVGGRYEERAGYHAVGSGSLFAKSALKKI
                     YSPDSDEETALRAAIESLYDAADDDSATGGPDLTRGIYPTAVTITQAGAVHVSEETTS
                     ELARRIVAERTEEGGSAR"
     CDS             complement(601404..601598)
                     /codon_start=1
                     /locus_tag="ROP_05830"
                     /product="putative proteasome accessory factor"
                     /protein_id="BAH48830.1"
                     /transl_table=11
                     /translation="MAQEQTKRTGGGDEDDTPGGDGAAGQERREKLAEDTDDLLDEID
                     DVLEENAEDFVRAYVQKGGQ"
     CDS             complement(601768..603267)
                     /codon_start=1
                     /locus_tag="ROP_05840"
                     /product="putative proteasome accessory factor"
                     /protein_id="BAH48831.1"
                     /transl_table=11
                     /translation="MQRIIGVEVEYGISSPSEPSANPILTSTQAVLAYAAAAGVPRAK
                     RTRWDYEVESPLRDARGFDLGRLSGPAPVIDADEVGAANMILTNGARLYVDHAHPEYS
                     APEVTDPLDAVIWDKAGERVMEAAARHASSVPGAPRLQLYKNNVDGKGASYGTHENYL
                     MSRATPFSAVINGLTPFFASRQVICGSGRVGIGQSGDEAGFQLSQRADYIEVEVGLET
                     TLKRGIINTRDEPHADADKYRRLHVIIGDANLAEMSTYLKVGTTALVLDLIEAGVDLT
                     DLQLARPVTAVHHISHDPTLRATVALADGRELTGLALQRIYLDRVDKFMSAEGNDDPR
                     VADLLEKWAMVLDLLERDPMECAHLLDWPAKLRLLEGFRNREGLNWSAPRLHLVDLQY
                     SDVRLDKGLYNRLVARGSMERLVSEQAVLDAVDTPPTDTRAYFRGECLRKFGADIAAA
                     SWDSVIFDLGGDSLVRIPTLEPLRGSKAHVGELLESVETAKELVDELTN"
     CDS             complement(603342..603719)
                     /codon_start=1
                     /locus_tag="ROP_05850"
                     /product="hypothetical protein"
                     /protein_id="BAH48832.1"
                     /transl_table=11
                     /translation="MALPRSIARFNRVVTNRVSRHVASILPGFAMVEHRGRKSGKSYH
                     TPVNVFVVDGRYRFALTYGARSDWVRNVVAAGGCTIVTRRRTVHLTDPRIGTDGTHSW
                     APPGVRTVLEAISADQYLECSPG"
     CDS             603803..604351
                     /codon_start=1
                     /locus_tag="ROP_05860"
                     /product="putative hydrolase"
                     /protein_id="BAH48833.1"
                     /transl_table=11
                     /translation="MDSAPNTPPGTDEVVAVFDSAGRPVGSAERSRVYAEGLWHASAG
                     VLVRSGDGKRLYVHRRADTKTVFAGHNDCLAGGVVDPGETPEEAASRELAEELGITGV
                     GLTPIARVAWDGRWQGLRLRCHLYAYEAHWDGPVVHQASEIASGWWWTPHELVTHLHD
                     PEWPFVPDTRALLEDYLVARDR"
     CDS             complement(604420..606195)
                     /codon_start=1
                     /EC_number="3.6.-.-"
                     /gene="arc"
                     /locus_tag="ROP_05870"
                     /note="protein synonym:AAA family ATPase"
                     /product="ATPase ARC"
                     /protein_id="BAH48834.1"
                     /transl_table=11
                     /translation="MSSTENPDSVAAARELEALRAEASALRRQLAESPEQLREMESRV
                     DSLSIRNTKLMDTLKEARQQLIALREEVDRLGQPPSGYGVLLGVHDDQTVDVFTSGRK
                     MRLTCSPNVDAETLKLGQTVRLNEALTIVEAGNFERVGEISTLREVLDDGQRALVVGH
                     ADEERIVWLAEPLATVFEESERESVAYDAESPTRKLRPGDSLLVDTKAGYAFERIPKA
                     EVEDLVLEEVPDVHYDDIGGLGRQIEQIRDAVELPFLHKDLFHEYELRPPKGVLLYGP
                     PGCGKTLIAKAVANSLAKKIAEARGQDSKEAKSYFLNIKGPELLNKFVGETERHIRLI
                     FQRAREKASEGTPVIVFFDEMDSIFRTRGSGVSSDVETTVVPQLLSEIDGVEGLENVI
                     VIGASNREDMIDPAILRPGRLDVKIKIERPDAESAQDIFSKYLVETLPVHSDDLAEFG
                     GDRTACIRVMIERVVDRMYAESEENRFLEVTYANGDKEVLYFKDFNSGAMIQNIVDRA
                     KKYAIKSVLDTGAPGLRVQHLFDSIVDEFSENEDLPNTTNPDDWARISGKKGERIVYI
                     RTLVTGKNASASRAIDTESNTGQYL"
     CDS             606379..606882
                     /codon_start=1
                     /locus_tag="ROP_05880"
                     /product="hypothetical protein"
                     /protein_id="BAH48835.1"
                     /transl_table=11
                     /translation="MIIRKPLNGRSFTGRSAVAVGAVVFALGMSACSSDDASDTAAAT
                     SAATSSAAEAAVAAPTSEELLGTLQLLVDPARPVDEKTVVVVDGDERRPNLEAMTAAM
                     ANYPVSFTVTDVQVEGDTATANVAIVSPHGTAAPTAWTWENVDGVWKVSDESTCTLLG
                     MARAGCS"
     CDS             complement(606931..607785)
                     /codon_start=1
                     /EC_number="2.1.1.-"
                     /locus_tag="ROP_05890"
                     /product="putative tRNA methyltransferase"
                     /protein_id="BAH48836.1"
                     /transl_table=11
                     /translation="MVGRETRPSGPFRVGDRVQLTDGKGRHYTVNLEAGKEFHTHRGG
                     ILHDDLIGTDEGSVVKSTNGTPYLALRPLLTDYVLSMPRGAQVIYPKDAAQIVHEGDV
                     FPGARVLEAGAGSGALTCSLLRAVGPEGRVISYEVRDDHAEHAVRNVETFFGERPENW
                     DLTIADVAEFDAEAAGGPVDRVVLDMLAPWDALPAVSKALVPGGVLVVYVATVTQLSK
                     VVEAMREQECWTEPRSWESIVRGWHVVGLAVRPEHRMQGHTAFLVSARRLAEGTVTPK
                     PQRRSGKG"
     CDS             607881..608786
                     /codon_start=1
                     /locus_tag="ROP_05900"
                     /product="hypothetical protein"
                     /protein_id="BAH48837.1"
                     /transl_table=11
                     /translation="MSISESPAPVTKGSPSQPGDTSATRRRPALSPSRAGDFKQCPLL
                     YRFRAVDRLPEAPSRAQVKGTVVHAALETLFGLPAAERVPARAVDLVRPSWERLLDEA
                     PDLIDLVPVDQRESFLDEARSLVTAYYQLEDPTRFEAESCEQRVETELADGVLLRGFV
                     DRIDVAPTGEVRVVDYKTGRAPREMSESKALFQMKFYALVLLRTRGIVPAQLRLLYLA
                     SGTVLTYAPDEDELLRFERTLSAIWKAILAAGVTGDFRPKPSRLCDWCDHKSLCPSFG
                     GTPPPYPGWPEGPAEDAPGFEEIVE"
     CDS             608783..609619
                     /codon_start=1
                     /locus_tag="ROP_05910"
                     /product="hypothetical protein"
                     /protein_id="BAH48838.1"
                     /transl_table=11
                     /translation="MSSESYYVPVGSEALGAPTPGSDQKVVVERFASTDLTISVWADT
                     MQHGAPPSALLVRALERCAAREDARLTRVVVEILGPIPIAELEVRSWVQRPGRRVELV
                     VAELWTVGDRPRAVARGSAWRMETVDTSDAVHVVDPPLEPRSTGRDGAFGGIWNSGYL
                     TTLDWRWIAEMGCEGPGKLWAKPRPALVLGETMTPLERLFAIADIANGVGSKLDPAQW
                     TFLNTDLTVHIFRVPEGDWVGVSSETSIGPDGVGMCAGVLYDETGAVGRIAQTVQVRA
                     RP"
     CDS             complement(609668..610519)
                     /codon_start=1
                     /EC_number="2.4.2.17"
                     /gene="hisG"
                     /locus_tag="ROP_05920"
                     /product="ATP phosphoribosyltransferase"
                     /protein_id="BAH48839.1"
                     /transl_table=11
                     /translation="MLRVAVPNKGSLSESAAEILSEAGYRRRTDSRDLTVLDPSNQVE
                     FFFLRPKDIAIYVGSGELDLGITGRDLARDSGAPVAERLSLGFGRSTFRYAAPAGKDW
                     KVEDLAGLRIATSYPNLVRDDLSARGIEASVIRLDGAVEISIQLGVADAIADVVGSGR
                     TLRQHNLVAFGDTLCDSEGVLIERAGSPADDSARNQLVERVRGIVFAQQNLMLDYDCP
                     KTILDDALKITPGLESPTLSPLADENWVAVRAMVPIKGHNGVMDELADLGAKAILASN
                     IRSCRAL"
     CDS             complement(610567..610848)
                     /codon_start=1
                     /EC_number="3.6.1.31"
                     /gene="hisE"
                     /locus_tag="ROP_05930"
                     /product="phosphoribosyl-ATP pyrophosphatase"
                     /protein_id="BAH48840.1"
                     /transl_table=11
                     /translation="MKEWVLVKTFESLFAELTERAATRPEGSGTVAALDAGVHSQGKK
                     ILEEAGEVWIAAEHESDEALAEEISQLLYWTQVLMVGKGLKLEDVYRHL"
     CDS             complement(610874..611767)
                     /codon_start=1
                     /locus_tag="ROP_05940"
                     /product="putative pseudouridine synthase"
                     /protein_id="BAH48841.1"
                     /transl_table=11
                     /translation="MAGAPLPVRGGLGPDRIRMPAGLGARTVAEFLVDTYPDERAHWL
                     SLIDAGDVVDEHGRVVDRGTRYAPTRFVYFYRDPAPEIPVPFEIDVLHRDDHLVVIDK
                     PHFLATIPRGAHITETAVVRLRRALDLPDLTPAHRLDRMTAGVLVFLIRPEDRRAYQE
                     LFVSQQVTKEYEAVAGHDPALEFPRTIRSRIVKEHGIMTATEEPGEPNSETVVDLIES
                     RDGRARYRLLPKTGRTHQLRLHMSSLGLPIEGDNYYPDFRRSEPGDFSTPLRLLARAI
                     EFTDPRSGRVRRFESRRTLGW"
     CDS             complement(611769..612626)
                     /codon_start=1
                     /locus_tag="ROP_05950"
                     /product="hypothetical protein"
                     /protein_id="BAH48842.1"
                     /transl_table=11
                     /translation="MAVPKIVLFYVFTPLADPEAIRLWQYTLAEAHDLTGRILVSEHG
                     INATVGGDIRDVKRYVKGTRSYAPFKDADIKWSDGLGNDFPRLSVKVRPEIVTFGAPG
                     ELKVDADGVVGGGTHLAPEEVHRLVEGRGDDVVFFDGRNGFEAEIGRFRDAVVPDVST
                     TRDFVHELDSGKYDHLKDKAVVTYCTGGVRCEVLSSLMRSRGFGEVYQLDGGIVRYGE
                     AFGDTGLWEGSLYVFDKRMTIEFSDQAKTLGRCTRCGGPTSRYENLPDDRGRELVLVC
                     AGCTENRAG"
     CDS             complement(612642..613334)
                     /codon_start=1
                     /locus_tag="ROP_05960"
                     /product="putative hydrolase"
                     /protein_id="BAH48843.1"
                     /transl_table=11
                     /translation="MSEAFDGLAGVLWDMDGTLLDSERMWDVAVRELSLHLGGPMTEE
                     TRLKTIGASSANALGVIFDALGLDRDPAALADAKEWMFTRVEELFGDGIPWRPGAHDA
                     LRTARAHGLRSALVTNTERRLTERALETLGRHHFDHSVCGDEVPAGKPHPDPYLRGAE
                     LLGLHPSQCLAVEDSPTGAASAQAAGCVVLVVPCEIPVADGPGRVFRDSLEGLTGSDL
                     AEAWAQPSGVRL"
     CDS             complement(613327..616896)
                     /codon_start=1
                     /EC_number="2.1.1.13"
                     /gene="metH"
                     /locus_tag="ROP_05970"
                     /note="protein synonym:5-methyltetrahydrofolate--
                     homocysteine methyltransferase"
                     /product="methionine synthase"
                     /protein_id="BAH48844.1"
                     /transl_table=11
                     /translation="MSAPFHSALLDALNQRVVIGDGAMGTMLQAADLTLDDFLGLEGC
                     NEILNDTRPDVLKEIHRAYFEAGADAVETNTFGCNLPNLADYDISDRIRELAEKGTRL
                     AREVADEMGPGRDGMGRFVLGSMGPGTKLPTLGHAPFAILRDAYAEAAMGMIDGGADA
                     ILVETCQDLLQVKAAILGSQRAMETLGSRLPIITHVTVETTGTMLLGSEIGAALTALE
                     PLGIDMIGLNCATGPAEMSEHLRHLSKYSSLPVSVMPNAGLPQLGPNGAEYPLTAEEL
                     AEALSGFVTEFGLGLVGGCCGTTPEHIRQVADAVRLVEKAARNPVHESGTSSLYTAVP
                     FEQDASILMIGERTNSNGSKAFREAMIAEDYQKCLDIAKDQTRDGAHMLDLNVDYVGR
                     DGAADMAALASRFATSSTLPIMLDSTEPAVLQAGLEHLGGRCAVNSVNYEDGDGPDSR
                     FQKIMRLVKEHGAAVVALTIDEEGQARTAEHKVRIAERLLEDITVNWGLDESDIIIDA
                     LTFPISTGQEEVRRDGIETIEAIRELKKRHPRVHFTLGVSNISFGLNPAARQVLNSVF
                     LHECTEAGLDTAIVHASKILPMARIPDEQRETALDLVYDRRREGYDPLQKLMELFEGV
                     SAASARESRAQELAALPLFERLERRIVDGERNGLDDDLTAAMEEKPPLAIINETLLSG
                     MKTVGELFGSGQMQLPFVLQSAEVMKAAVAYLEPHMEATDEDGKGRIVIATVKGDVHD
                     IGKNLVDIILSNNGYDVVNLGIKQPIATILDAAIEQKADVIGMSGLLVKSTVVMKDNL
                     QELNAKGVAEKFPVLLGGAALTRSYVENDLAEVYEGDVSYARDAFEGLHKMDEIMAVK
                     RGGAPDPDSPEAIAAREKAAERKARHERSKRIAEKRKAAEVPVELPERSDVATDIAVP
                     SPPFWGNRIVKGVSLSDYSGLLDERALFLGQWGLRGQRSGDGPTYEELVETEGRPRLR
                     YWLDRLSTEGILAHAAVVYGYFPAVSEGDDVVVLTDPTPDAEERFRFTFPRQHRDRFL
                     CVADFVRSRTEAKETGQVDVFPMQLVTMGQPIADFANELFAANAYRDYLEVHGIGVQL
                     TESLAEYWHQRVREELVLPGGHNVGEQDPSEVSGFFDLAYRGARYSFGYGACPNLEDR
                     AKMVALLEPERIGVKLSEELQLHPEQSTDAFVLHHPEAKYFNV"
     CDS             616948..617889
                     /codon_start=1
                     /locus_tag="ROP_05980"
                     /product="hypothetical protein"
                     /protein_id="BAH48845.1"
                     /transl_table=11
                     /translation="MSSSEFPVTPAGPDDDTPDTADDGATDSGVPVLRDPVLVAAFEG
                     WNDAGDAASGAVEHLELTWDAQPLAELDSEEYYDYQVNRPTVRQVDGVTREIVWPATR
                     LSVCSPPGSDRDVVLLRGIEPNMRWRSFCEDLLELIDQLQINTVVILGALLADTPHTR
                     PVPVTGSAYSSEAAERFKIEQTRYEGPTGITGVLQDACVRAGVPAVSFWAAVPHYVSQ
                     PPNPKATVALLQRVEDVLDIEVPLGELPSQADDWQEAVTEMTADDEEIGDYVRSLEER
                     GDAETDISEAISKIDGDALAAEFERYLRRRGPGSFGL"
     CDS             617886..619037
                     /codon_start=1
                     /locus_tag="ROP_05990"
                     /product="putative drug resistance efflux protein"
                     /protein_id="BAH48846.1"
                     /transl_table=11
                     /translation="MTRNSSESLRSSLQRTALYAGGFLGPFGGGVVASILPEIGDDLG
                     VSASAAAGSLTAYLLPFALLMLVSGTLGARWGQMRTVRIAYGVYLLSSLACFAAPTLP
                     LFLGARVLQGCSNSFTTPLLLAALAASTPKKHLGRALGIFGAFQAAGQSSAPLVGGLA
                     AEVDWRLAFLVIALVAAVLGLVGVPDSPPAEPGAARPRLRDALTPSVLRIGVVALLGW
                     GALGGLSFLVAFRAEDVFGLSPTQRGLLLTGFGVAGILTARLVGGVIDKFGARAAVLI
                     GAFGGAALVAAAGTVSLLPVVAVAWFAAGTAGQFILVGVNAAVLGSPGPNRGGAVSVV
                     QALRFTGNALAPITLTPVYAVSPAAGFLLPALLLAVLAPLLMPRDRPPA"
     CDS             619449..621614
                     /codon_start=1
                     /EC_number="1.7.1.4"
                     /gene="nasD"
                     /locus_tag="ROP_06000"
                     /product="nitrite reductase large subunit"
                     /protein_id="BAH48847.1"
                     /transl_table=11
                     /translation="MLIVATGSNTFFPNMDGLREHDGRLARGVFGFRNIADTNGMLQM
                     AQAHDDVSAVVIGGGLLGLEAAYGLRTQGLTVDVVHSPGHLMNQQLDERGGSVLRAEI
                     EKLGVGVHTSMRTTAVLRDDAGLVTGVSFVDGSTLDADMVVVTAGIRPNTELARAAGL
                     VVERGIVVDDQMRCEDEGSVYAVGECAQHRGETYGLVAPVWEQAVILADVLTGSDPEA
                     AYVGSRTTTQLKVAGVDVAAMGVKGPETADDEFVQYYEPRSGTYKSLVVRDGKLIGAT
                     LMGDISKAGFLTQAFDGKVPLPEERISMLFDVGTPAAATSVADLPDDLQVCNCNGVSK
                     GDLVACVHSGAKTLTDVCATTRAGKGCGSCKGLVADIVACAAGGELEADPSADWYVPC
                     IPMSKPELTAAIRERDLRAVSQVFAELATDANEDASAKMPLASLLRTIWGPDWVDERG
                     ALFINDRVHANIQRDGTFSVVPQMKGGVTTPDQLRRIADVADKYRVPLVKVTGGQRID
                     LLGIKKEDLPKVWGDLDMPSGFAYGKSMRTVKTCVGTDFCRYGLGDSTSLGIALEERF
                     QGLETPAKLKLAVAGCPRNCSEALCKDFGVVAVGDGRWEIYVGGAAGAHIRKGDLLAT
                     VESPDAVVELGGRFIQYYRENAKWLERTYDFVPRVGLEHLQALLVRDEEDIVTGLDER
                     IQTAVDGYRDPWKERSAPKSPAQFAPSLPLLPLPQVPVR"
     CDS             621611..621937
                     /codon_start=1
                     /EC_number="1.7.1.4"
                     /gene="nasE"
                     /locus_tag="ROP_06010"
                     /product="nitrite reductase small subunit"
                     /protein_id="BAH48848.1"
                     /transl_table=11
                     /translation="MTALIEGPTEFAVGPVSDLTPGEGRTYVVQDRQVAVFLLSDGTV
                     RAMDAVCPHRGGPLADGQIDASGVMCPLHQYAFAFDTGACGSEGVGSVRTYPASVREG
                     SVVVHV"
     CDS             622061..624247
                     /codon_start=1
                     /EC_number="2.3.1.-"
                     /locus_tag="ROP_06020"
                     /product="putative acyltransferase"
                     /protein_id="BAH48849.1"
                     /transl_table=11
                     /translation="MSTVASPEGRRRSGNHSQAGDRAAGTVFRTDIEGLRAVAVLAVV
                     LFHAGVPGIDGGFAGVDVFFVVSGFLITGLLWRDVAADGRVGLAEFYGARARRLLPAG
                     CVVLVATAIGAALLLPPLQARAVLGDGIASALYVGNYRLALHGTDYLAADTPPSPFQH
                     YWSLGAEEQFYLLWPALIIGVAWLVRRRTRRLDPDRAPSTTPYLVVLTVVAAVSFAVS
                     LDWTRTLPPWAFFSLPSRAWELAAGGLVALSVRHWRRLPPVLAAVAGWVGLALIVLAC
                     LRLGEKTPYPGTAALLPVLGTVLVIGAGCAAPRRGVGRGLSLPPMRAVGRVSYSWYLW
                     HWPVLLLAPIVLGRSLDLTDRLAMVMVAVGLAGLTLTLVENPVRFSAPLRRSAPRSLV
                     LGGAVTAVAVCAALVLLVARPVPVGHGAAAASLTVSAPAESTTPAIDPRDAAVTDMTA
                     QVQAAVEEAAGLQAVPSNLSPPLADAPADKPAVFVNGCVRSWLEVGQDECASGDVTSA
                     TTVALVGDSHAAMWAPAFEAAAEQHHWRLETMGKVTCPLLDLPLTSPYLGREYSECEQ
                     WRGEILERLRAERPRLVVLSMSRRYGADFGFSVYGRPWLDSLTGLVTQLRATGAAVLV
                     LGPVPDPQSTVPTCLSAHLDDARACSPPRPVAVNDAGVAAEASATAAGGGRYADLTAL
                     FCTAERCPVVVGNDLVYRDDNHLTLEHAQALSPVIAALADRALAQG"
     CDS             624340..624927
                     /codon_start=1
                     /locus_tag="ROP_06030"
                     /product="hypothetical protein"
                     /protein_id="BAH48850.1"
                     /transl_table=11
                     /translation="MTRIPQAELTGIYGAVVKRMSRKMLGDVPDGVGVVWHNRKVTNF
                     SFSLGRKIQKWDRCDENLKSFAHMAVASMVGCGFCLDYGYFQAHNKGLDETKAREVPR
                     WRESDVFTPLERDVLEYAEAMTLTPPTVTDDLSARLLGALGPAALVELTAFIALTNFM
                     TRSNTAFGIESQGLAASCGLKPLSARPTTRTQPTS"
     CDS             complement(624912..625352)
                     /codon_start=1
                     /locus_tag="ROP_06040"
                     /product="hypothetical protein"
                     /protein_id="BAH48851.1"
                     /transl_table=11
                     /translation="MGYLHTARSKFTIASWSESVITDIDGEGTTAGDTYYPARGATRA
                     DVEYSYSGDIEGTSTVAYLIAYKADAAPVLGLERFEGSIGGHDGTCVFQHLGSQDQGS
                     VSARIEVVPGMGTGGLTDLRGSADLSIAGPGDGGFEFVLSYDVG"
     CDS             625418..626218
                     /codon_start=1
                     /locus_tag="ROP_06050"
                     /product="putative AraC family transcriptional regulator"
                     /protein_id="BAH48852.1"
                     /transl_table=11
                     /translation="MPNVPGHPEAIVRPTADASGFEVERIAPRPDLAEFVDYHWLVRW
                     SVSKPHRQQVVPQPRVHIGAEDGQLLVHGISRSPFYRTLTGHGHVLGAAFHAGGFRPL
                     LKGSLGAISGTVQPGRDLLDGDDRPVAERILAGTDSAEMIDAFERYLLRTDPVPDPTG
                     RQVTALVGDAQRRRDIVRADQLAAHAGCSLRTLQRLFTEYVGIGPKWVIQRFRILDAA
                     AAAHSGERIAWSALAYELGFSDQAHLTRVFTQVVGTPPATYQRANGLP"
     CDS             complement(626237..626449)
                     /codon_start=1
                     /locus_tag="ROP_06060"
                     /product="hypothetical protein"
                     /protein_id="BAH48853.1"
                     /transl_table=11
                     /translation="MSSSDTAGETEFPASMGKVSRRELASHGYTRFDQLTMVTAKELL
                     KIHGVGPKAIRILEEELAKRGLGFAG"
     CDS             complement(626524..627114)
                     /codon_start=1
                     /locus_tag="ROP_06070"
                     /product="putative Xre family DNA-binding protein"
                     /protein_id="BAH48854.1"
                     /transl_table=11
                     /translation="MTQELGLDGVIRQRIRGLRVARGWSLDALAARCFLSPSTLSRIE
                     TGHRRIALDQLVPIARALGTTLDQLVESVDDEDVVIRPMPEQTRGLTTWLLSRERALH
                     GATVAKMRITPERPAGPEHVCVHPGHEWFTVLSGTARLQLGERTILIEAGAAAEFSTM
                     VPHSIGAHDGPVEILTIFDHDGERAHLHTADDAPPA"
     CDS             627163..628014
                     /codon_start=1
                     /locus_tag="ROP_06080"
                     /product="hypothetical protein"
                     /protein_id="BAH48855.1"
                     /transl_table=11
                     /translation="MTQHSHHHAHHHDEHTPAHETALADLLELDAEIFGSYLDQVAEW
                     AGRRVGEAPRRVVDVGAGTGVGSLALARRFPAAEVIAIDRSEVMLERVRAAALGQGMA
                     DRVSGVHADLNAGWPAVEAADVVWAASSLHEVSDPDRVLRDMYAALNPDGVLVLVEMD
                     ALPRLLPDDLGLGRPGLESRCHEALARMDWNAHPNWRAHVERAGFGDVEQRSFTSEAR
                     PAPQSTGRYAHTFLRRVRSALDGQLAADDRDTLDRLLSDDGPDSVLHRGDLTVRGSRT
                     AWTARRP"
     CDS             628372..629529
                     /codon_start=1
                     /locus_tag="ROP_06090"
                     /product="hypothetical protein"
                     /protein_id="BAH48856.1"
                     /transl_table=11
                     /translation="MSMGVGLRIGSVVSTAVVASNDPGSPDPVVIVRDTVLHMCPDGT
                     AILGGSAPHTIGDTHTVSGFLPRVGDPAGVAVGDGSRYRAEDLVAGAMRCLLRECEPL
                     PDHGGRTGGAPDIMATYPTRWDSAAVAALRDALDYADMSYLSLVSDAEAAAAWFESEI
                     AERPGQLVGIYHVDDTGSTVALIRSGVEAGKAFRFSSGGSPTAQIATALGAFGWLPGN
                     LDAVVVTGDGLIARDSAAVHGFAATIGEKFDVRCVVGPGPEQTSALGAAIRAAGFNPT
                     THKVTPIGLPPSYDVTEVIDAVVGEPVPSTSPTPTRPATRTQNPATAAAVGASPARAS
                     GGTAVATPPEPRAVAQSGEDSDSASRASWLVAAAVGLALVLVAIVFVLFVL"
     CDS             629626..631167
                     /codon_start=1
                     /locus_tag="ROP_06100"
                     /product="hypothetical protein"
                     /protein_id="BAH48857.1"
                     /transl_table=11
                     /translation="MSESGSDPGRSPSGLRAARPAVAPPLRDDRLKLFSFATAEKRAE
                     YLWVLRAFDHARANYIVLLHAGDVARILDGLAGDDPAGQLGAGDVTPLLEQLHVWEVL
                     ERSYDGTRAATLAEYLNRHFVYQFSQAGYQVFRAVEDALAARLDDASLSRLALPDLLA
                     DMNDLAAANRAADNDLVYRKLNRLDATLSDMAGRAAQFYLTLGDLVRTTEITPETFMS
                     HKDALLTHMREFSSDLSRYAPKLAAAIALVEDSGVEAMVARAAASDERVFLDVEEREA
                     DWRSRWAGVTHWFVGSEAGPSESERLREGTMSAIAAVLSLLRRVTETRKGGVSRESQL
                     RHLAGWFAATPNEDAAHALFRAVFDLGRPRHLSMVHPDADIIPDTRSWWEAQPVEISR
                     TLAETGRPPSPGLPARVQRNEGSVRRLREEQLTAQRLRAAAAQSLARGGVYERELDEA
                     ETDVLLSLLNAALTARVPVSGRVKSSTGSENGVKLTLSPHGESTVVRTARGRLHLDGL
                     QVSVR"
     CDS             631164..632552
                     /codon_start=1
                     /locus_tag="ROP_06110"
                     /product="hypothetical protein"
                     /protein_id="BAH48858.1"
                     /transl_table=11
                     /translation="MKAREISPLALDSYQRAARVILSNHLVTQTYPDRIALPLLRRWA
                     TELREDLMTLFGYRLEVTETTARLFTVSDRLDAGTPAKTATDRTFDRYRYAYLALALA
                     ALGRAGNQITLSELADHVAADAAQVEGVDLSTERASDRDAFVDAVGWLAARGAIALAD
                     GDAGGWAANPDAGEALYDIDRSVVIALFRPPRALQHLRSIRGLLAGADSVTDEDTAET
                     SRTVDVKETTRRVRRALVERPVVYAADLDDHELVQLALPRTAADVELLTGLVAERREE
                     GVAMIDSSGRLSDVRFPGTGTVAQVALLLAGEIADRVLDPDAAETARMPLPRGRSEDL
                     VEQVDGAIPQSGIFDSLAGHDGVEPAEPAPADRLFPVVEDQWITDTVRTLTERFGRTF
                     AAGWQADPDGLGRAALALLERLRLTASVPGGVLALPALARYRGVVVTIRDRTPEIDLF
                     QSSANDSEDITA"
     CDS             632549..636706
                     /codon_start=1
                     /locus_tag="ROP_06120"
                     /product="hypothetical protein"
                     /protein_id="BAH48859.1"
                     /transl_table=11
                     /translation="MTSARFRPTRAGIINLWDYRDQEFSFADGRLVLRGPNGSGKTKA
                     LEVLFPFVFDGRIEPRRLNPFAGEERTMKSNLLYRGQESAYSYVWMEFCRGAKDDPEA
                     VTVGIGMRASRTNDKVTRWYFVADGRVGVDFSLLGTDDRPLTKKQLGEQIGTDSITDR
                     PLDYRAAIDARMFGLGVQRYDQLINLILTLRRPQLAKNLDPKGLSQALTDGLRPLDEQ
                     LVLEAARSFSDMEEVGRALEGLAAADQAAQSFVGVYAKYLRQQARTDVDQLATRLDAV
                     RSGITALHGAAADRARSQESREAAEERFTVAERALDQANATLDALKRSTAYEGRTQLD
                     DLAQAVSTLEKSTALQAEKARKAKATLEQRSEEHEKAGDAVTRAVEALAHAEDELHVA
                     AEDAGITWTALPDTARADQLTAALRGHAEERDGDLRAVRAALATVERAATERTRADDA
                     ARRGQEQLDTAKVAVLEAETAVESARSRCATELRSWWTEQSSLYAEIEAPAALFDALD
                     TALRGIGDEDAATLSETLTEQTRDAVDALRMRRQQYDRDAAAAAEAIAEYESVRAAIE
                     SEHDDAPPLPAGRHDTRSGLTGAPLWRLVRFADGVDAAVAAGIEAALEAANLLDGWVP
                     VDDALPDVESEQFLVALPAGDRPTGRTLADVLEVEQDTGVPDDRVRGILESIALESLD
                     PAEGPVGVAQDGGYRQGIQRGRHTKSDAEYIGTTARARRRAARLVELDRTLAETRATL
                     DDTRASAEAVAELLTRTTAAARALPRTGSILTALKKVTESAGALRSRTDTATAVGREL
                     DQAIADLSAKEKQLRATASTHRTPHVAREIDSLAAAVRHFEKQGEMVQRCRREHGKEV
                     EHTRQSEDRLHEARGNAEEYAEEAAVAEEVLAQQIQRLGTLRDTLGAGAEELDRQLEE
                     AHARIEACKKEQRDARKADKDAGEAIGKAEGAYNTAVQTLRLALTETHADAAHLAPYA
                     RRDLLELLGVDGGHTWPASAAAWMSAEQLVYRIQNAGQDIPILPPEVDALFRALDSAT
                     DSVRVSDSARKSTRTALTTALQDFDAQLAAAGQDYRLQWDAPDGLTVVQVQDDEGYSS
                     IGEFAARIASARSDQELLLTESERRILEDALLTGLAQQIHERTVDARELIARMGTEMR
                     ERRMSSGNTIGVHWVLADNLDDSAKAISKLLERDTSALGPDELATMRAHFAHQIRTAR
                     AAHPERSYPEILASALDYRRWRVFSFTLISGNGTEDRLTVARHSALSGGEQSVSLHLP
                     LFAAAHVMLDSADPHAPRLLALDEAFAGVDDNGRAELLGLSVQFDLDLFMTGFDLWIT
                     YGGVPGCAHYDLAHSTAEQSVSATLLVWSDGELLAEHDGTDLAQALGSPLRRRVPTPA
                     EGALEFA"
     CDS             complement(636746..637993)
                     /codon_start=1
                     /gene="mshC"
                     /locus_tag="ROP_06130"
                     /product="cysteine--1D-myo-inosityl
                     2-amino-2-deoxy-alpha-D-glucopyranoside ligase MshC"
                     /protein_id="BAH48860.1"
                     /transl_table=11
                     /translation="MQSWSETAVPSVPGQGPPLRLFDTADRQVRPVTPGRTATMYVCG
                     ITPYDATHLGHAATYLTFDLVNRIWRDAGHDVHYVQNVTDVDDPLFERANRDGEDWVV
                     LGMRETALFREDMEALRVLPPRDYIGAVESIGEVIEMVEKFVASGAAYVVDDPEFPDV
                     YFRADATEQFGYESGYDRATMDTFFAERGGDPDRPGKQNPLDALVWRAARPGEPSWPS
                     PFGPGRPGWHIECSAIALNRIGSGFDVQGGGSDLIFPHHEYSAAHAESATGDRRFARH
                     YVHTGMIGLDGEKMSKSRGNLVFVSKLRGEGVDPAAIRLGLLSGHYRQDRPWTEQVLA
                     DAHTRLQLWKDAAALESAQSATDTIARLRQHLADDLDTPKALDALDGWARRALDNGGS
                     DTNAPTEFAAAVDALLGVRLRRP"
     CDS             complement(638066..638869)
                     /codon_start=1
                     /locus_tag="ROP_06140"
                     /product="hypothetical protein"
                     /protein_id="BAH48861.1"
                     /transl_table=11
                     /translation="MPAEESDPLESGELTLIGQITHASNATLVCDAAAGENTVRCVYK
                     PVRGERPLWDFPDGTLAGREYASYLVSEQLGWGVIPRTLLRDGPFGPGMVQRWVDTPD
                     RHADDTGGLDLVDICAPDAIPEGWFEILRATDMDGEPVALIHADDPRLQRMAVLDVLI
                     NNADRKGGHALEGLDGSVYGVDHGICLHTENKLRTVLWGWAGTDVPGALVVDIAELIS
                     SLEGDFGARLGEHITSDEVAALYERAVDLLAAPVMPRPNGHRPIPWPAF"
     CDS             complement(638873..639466)
                     /codon_start=1
                     /locus_tag="ROP_06150"
                     /product="hypothetical protein"
                     /protein_id="BAH48862.1"
                     /transl_table=11
                     /translation="MSRAIHVFRTPDRFIAGTVGEPGDRSFYLQAVHEARVISVLLEK
                     QQVQVLADRMGLLLEEVHRRFGTDVPPEGAELDDSSPLVTPIDAEFRVGTMGLGWDAD
                     AGAVVVELLAVSETEFDESVVLDDSEDGPDAVRVFLTPLQARDFSLRSERVIAAGRAP
                     CPLCGEPLAPEGHICIRTNGYRRGQSFGLTPEMDEED"
     CDS             complement(639592..640290)
                     /codon_start=1
                     /locus_tag="ROP_06160"
                     /product="phosphoglycerate mutase family protein"
                     /protein_id="BAH48863.1"
                     /transl_table=11
                     /translation="MTVVLLRHGRSTSNTAHTLAGRSPGVELDDRGREQAQAIVARLA
                     DVAIEEIVRSPLVRCEQTVEPLARARGLTPVVEHRLVEVDYGEWTGRELKVLLEEPLW
                     KIVQQHASAAVFPGGEGLAQVQARAVAAVREHDARLAELHGRDVVWVACSHGDVIKSV
                     LADALGAHLDGFQRIVAEPASISVVRYTSTRPYVLKMNDTGADLSGVNTPPVSGDGAR
                     AEVSGSVPGGEVRL"
     CDS             complement(640331..641179)
                     /codon_start=1
                     /EC_number="3.6.1.27"
                     /gene="uppP"
                     /locus_tag="ROP_06170"
                     /note="protein synonym:undecaprenyl pyrophosphate
                     phosphatase"
                     /product="undecaprenyl-diphosphatase"
                     /protein_id="BAH48864.1"
                     /transl_table=11
                     /translation="MMGEAMTWLQAIVLGAVQGLTEFLPISSSGHLRIVSEIFFGDDA
                     GASFTAVTQLGTEAAVLIYFARDIGRIIAGWFRGLFHAEHRSDLDYRMGWYVIIGTIP
                     VGVLGFLFKDQIRTGARNLWLIATMLIVFALVIAAAEYYGRKVRPVEDLRAKDGIIMG
                     SAQALALIPGVSRSGGTISAGLFLGLTREAAARYSFLLAIPAVVASGLFSLPDAFEPA
                     GEGLNASGPQLLVATVIAFAIGYASIAWLLRFVVDHSMYWFVGYRIILGVVVLSLLAT
                     GVVSAT"
     CDS             641413..642342
                     /codon_start=1
                     /locus_tag="ROP_06180"
                     /product="putative oxidoreductase"
                     /protein_id="BAH48865.1"
                     /transl_table=11
                     /translation="MEQRSVGASGLRVSRLGLGTLTWGRDTDGDEAAAQIAAFVDAGG
                     TLVDTSPAYGDGAAQRILAELLDDVVPRTELVLSSSSGINPAGPSRIDCSRRGLVAQL
                     DATLRELGTDYLDMWQVATWDPFTPVDEVAATLDFAVSSGRVRYVGARGYLGWQLATA
                     AGASRSTTLVATQVEYSLLARGVEEELVPAAAHHGVGVFAAVPLARGVLTGKYRNGIP
                     VDSRGADEAHAQDVQSYLTDSSVRVVDAVVTAADGLGTSPLAVALAWARDRPGVASAV
                     VGARDIAQLTGVLVAEELELPAAIAAALDDVSA"
     CDS             642439..643125
                     /codon_start=1
                     /EC_number="1.14.99.3"
                     /gene="hmuO"
                     /locus_tag="ROP_06190"
                     /product="putative heme oxygenase"
                     /protein_id="BAH48866.1"
                     /transl_table=11
                     /translation="MTTLNEADAADRGTVGFAERIKAGTDAAHRETEQSRFVGALLAG
                     ELTSDGYAELLAQTYLVYRELEDAGRAHAGSPVVSPFLHDELLRVPSLEADLAFLRGP
                     SWRDTVSALPATTRYVERLREVAYEWPAGFVAHHYIRYMGDLSGGQIIRRMLERAYGY
                     STDGLQFYIFDEIPKPKVFKDGYRAKLDAAPLSPEDQRRVIDEVNLAYRLNGALFADL
                     EAGIDRYLAR"
     CDS             643122..644162
                     /codon_start=1
                     /gene="hmuT"
                     /locus_tag="ROP_06200"
                     /product="putative hemin ABC transporter hemin-binding
                     protein"
                     /protein_id="BAH48867.1"
                     /transl_table=11
                     /translation="MKSMFRAFTNRSLFAVLVLLLVSVVAVSACSSGAGDNAGGTGGA
                     RTAVLDDLNPEPLASAATPALPVTVRSFDGVDVTITDASRIVTADRYGTLTETVFALG
                     LGDNVVGRDIASEFPAAQHVPVVTPGGQSLNAEAILDLAPTVILTDTSIGPQAVQDQL
                     RAAGVPVVYFDPTRTLDGVPGQITAVANALGVPEQGRELADRTENEIAAARSRAPEGE
                     NPLKIAFLYLRGTAITMIGGPGSGADSLIDALGAVDAGTASGITQQFAPITSEALIAA
                     APDVLLLMTGGLESIGGIEGLEKIPGVAQTPAGRNQRVVDMQDGVLLSFGPNTGRVLG
                     ALADAVYPAATR"
     CDS             644159..645229
                     /codon_start=1
                     /gene="hmuU"
                     /locus_tag="ROP_06210"
                     /product="putative hemin ABC transporter permease protein"
                     /protein_id="BAH48868.1"
                     /transl_table=11
                     /translation="MTVEDLDAPGKSSPRTRTGAVLGGLLIALAVAAVFSACIGQVPT
                     GPGEVVGSILHRIGLDLGPMPAHPSGEVTLWEVRFPRVVLAILVGAALGCAGALLQGV
                     FANPLAEPGVIGVSAGAAVGASAAIVVGAFAAGWTVAGAAFVAGLVTTVAVYLLARHE
                     GRTEVVTLVLTGVAVNAFAGGLIAFFTFVASPAARDQIVFWQLGSLNGATWSAVAVVA
                     PMTVAGIAATMMIAGKLDLLSLGENAARHLGLDVERLRQIAVLIVALLVSSSVAFTGI
                     ILFVGLVVPHLMRIAVGPGHRALIPASALCGSLVLLLADLGARSLVANADLPLGMLTA
                     LVGGPFFFWLLRRTRASQGGWA"
     CDS             645226..646104
                     /codon_start=1
                     /EC_number="3.6.3.34"
                     /gene="hmuV"
                     /locus_tag="ROP_06220"
                     /product="putative hemin ABC transporter ATP-binding
                     protein"
                     /protein_id="BAH48869.1"
                     /transl_table=11
                     /translation="MSPSFHPLRTRVGEALDQNLFRRTDPVPPPRPSGAVTLRAEGIA
                     VTRGGRPVLDDVSVDVRIGEVLVLVGPNGAGKSTLLAALSGDQDVHAGSVELDDRDLG
                     EWTALEMAQRRAVLPQQNTVGFSFTARQVITMGRSPWARTPRSDDDAAAIAEAVRICD
                     VVAFADRPFTALSGGERARVALARVLAQRTETILLDEPTAALDLGHQETVMRLARSRA
                     EQGTAVVVVLHDLALAAAYADRIVVLEQGRVAADGPPRDVLSEGLLTRVYGHPVEVIA
                     HPVTGATLVLPRRDHR"
     CDS             complement(646115..646510)
                     /codon_start=1
                     /locus_tag="ROP_06230"
                     /product="hypothetical protein"
                     /protein_id="BAH48870.1"
                     /transl_table=11
                     /translation="MVSRPPAQVIEEQTVEAPETPTFTVEDISVGPHAHGFGRTAEGN
                     SYAFRVRKSTMHVEVYRADVETEVPDPDDVVASARRSVREIDLTDERSIVAVVRDAVS
                     DPDSLSARPEDGITVRAVLSRLGAVIDGL"
     CDS             646653..647663
                     /codon_start=1
                     /locus_tag="ROP_06240"
                     /product="hypothetical protein"
                     /protein_id="BAH48871.1"
                     /transl_table=11
                     /translation="MGRPGARVVASCIGAAFLLVTGCSSNSDEDQAITIAPASAAQSP
                     AQSTAPAGVVHPVGLPIDSTTFDPETRTTVVLGGEGNQILLFPVGDFTAAPRTIPLDG
                     AVAQVSLAPGGVALLAMNTQVGRLDLRTGEVTFVPADGDVRSVAQLPDGRLAMGLGNG
                     EIHIVNTETNESQVIDGLTSVDGLAVVGDSLTALDRGQTSVTAVDVPGSALGVALRAG
                     EGATQLTTDHYGRILVTDTTGDELLAYTTDTLMLRQRFPAGLAPYAVAYDDTADRAWV
                     TLTGTNEVVGFDLSSGVGVETARYPTVRQPNSVTVDTVNGDLLIGSATGDGLQQIPTR
                     SS"
     CDS             647664..647903
                     /codon_start=1
                     /locus_tag="ROP_06250"
                     /product="hypothetical protein"
                     /protein_id="BAH48872.1"
                     /transl_table=11
                     /translation="MASHSRRLPSGWEIESEDYEYVPLRLPPDVTRVSASMRLALQAE
                     FGGWELSRVRLYSDGSRRVLLKRKKTAHHVPDPAI"
     CDS             647914..648984
                     /codon_start=1
                     /EC_number="1.3.3.1"
                     /gene="pyrD"
                     /locus_tag="ROP_06260"
                     /note="protein synonym:dihydroorotate oxidase"
                     /product="dihydroorotate dehydrogenase"
                     /protein_id="BAH48873.1"
                     /transl_table=11
                     /translation="MYHLLLRVMFRLPPERIHHLAFAAMRLVTRFSPLRQLVGRVLVV
                     DDPVLRNTVFGLDFPAPLGLAAGFDKDATGVDAWGPLGFGFAEVGTVTAQAQPGNPAP
                     RLFRLPADRALINRMGFNNHGAGNAANHLRQRRAGVPIGANIGKTKIVDAADAPADYT
                     ASAHLLGPLADFMVVNVSSPNTPGLRDLQAVESLRPLLRAVLDSVTVPVLVKIAPDLS
                     DDDVDAVADLALELGLAGIVATNTTIRRDGLNTPDDEVTAIGAGGLSGPPVAERSLEV
                     LRRLHARVGDRLVLISVGGIETVDQAWERILAGASLVQGYTGFIYGGPFWARRIHKGL
                     ARKVREAGYSSVADAVGAGAVR"
     CDS             complement(649055..649585)
                     /codon_start=1
                     /locus_tag="ROP_06270"
                     /product="hypothetical protein"
                     /protein_id="BAH48874.1"
                     /transl_table=11
                     /translation="MSHDPYEALPDLPSFELTSTDVTDGQPLNKEQVSGIFGAGGHDN
                     SPQLSWSGFPAETKSFAVTVYDPDAPTASGFWHWAVANIPADTTTLVSGAGDDDGTGL
                     PSGAITLKNDAGLSRFLGAAPPAGHGPHRYIIVVHAVDVEILDGVTADSTPAFLGFNL
                     FSHAIARAKIQGTYEQ"
     CDS             complement(649620..650972)
                     /codon_start=1
                     /locus_tag="ROP_06280"
                     /product="peptidase M20 family protein"
                     /protein_id="BAH48875.1"
                     /transl_table=11
                     /translation="MPTTQETPGQGRAEAEVVDLVSSLIRFDTSNTGELATTKGEREC
                     AEWVASQLQEVGYETEYVESGAPGRGNVFARLKGSDPDRGALLLHGHLDVVPAEPADW
                     RVHPFSGAVEDGYVWGRGAVDMKDMVGMILAVARQFKAEGVVPPRDLVFAFVADEEAG
                     GKYGCQWLVENRPDLFEGVTEAVGEVGGFSLTVARPDGTDRRLYLVETAEKGLGWMRL
                     TAKGRAGHGSFLHGENAVTILAQAVARLGAHTFPLVMSDSVAEFLAAAGEETGLDFDP
                     ESPDLDGTLAKLGTIANILGATLRDTANPTMLSAGYKANVIPQTAEAVVDCRILPGRQ
                     AEFEATVDELIGPDVTREWITKLDSYETTFDGHLVDAMNDAILAHDPGARTVPYMLSG
                     GTDAKAFAKLGIRCFGFAPLQLPADLDFSALFHGVDERVPVDALLFGTRVLEHFLLHS
                     "
     tRNA            651084..651169
                     /locus_tag="ROP_t0010"
                     /product="tRNA-Leu"
     CDS             651243..652697
                     /codon_start=1
                     /locus_tag="ROP_06290"
                     /product="hypothetical protein"
                     /protein_id="BAH48876.1"
                     /transl_table=11
                     /translation="MGETTTTIDPADLEICLKVLDLAAELDDADPDSVTVQRAVGHLF
                     KKLKKRRRIAARDAVSEADRKVVAATATGSPDRIDDETAGIPLTSNADGASAGTLIRP
                     RPCYICKQRYTRVDAFYHQLCPECATKSRAKRDARADLTGRRALLTGGRAKIGMYIAL
                     RLLRDGAHTTITTRFPNDAIRRFKAMEDSSEWIHRLRVVGIDLRDPAQVVALADSVAA
                     QGPLDILINNAAQTVRRSPGAYSALADAESGALPSGDLPDVLTFGKTSDAHPAALAGS
                     LSDVSVMAGAALSPDAVSSLALVAKSASPDRIDQGLAIDAGGLLPDLAHTNSWVQTVE
                     EVDPIELLEVQLCNSVAPFILVSRLRPAMAAAGARRKYVVNVSAMEGQFSRAYKGPGH
                     PHTNMAKAALNMLTRTSAKEMLEDGILMTAVDTGWITDERPHYTKMRLADEGFHAPLD
                     LVDGAARVYDPIVQGEQGVDLHGCFLKDYEPSPW"
     CDS             652875..653219
                     /codon_start=1
                     /locus_tag="ROP_06300"
                     /product="putative Usp family protein"
                     /protein_id="BAH48877.1"
                     /transl_table=11
                     /translation="MQRREQLLVLHVLDDDPGQDAESDRSALRAEIQATLEGGGVGES
                     SWELRTGEHDGDQVSALRALVDNSGADLLVVGTRRMSPVGKFLLERWLQRLLLEVDIP
                     ILVVKEEARGSA"
     CDS             653307..653717
                     /codon_start=1
                     /locus_tag="ROP_06310"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH48878.1"
                     /transl_table=11
                     /translation="MGSVVFYEVVADATVVAHLTFILYVVCGGFLAWRWPRTIVVHLA
                     AVAWGFTGLIVGIDCPLTHLESWARVRAGQDPLPSSGFISHYLTGVVYPESAAGAIQT
                     LVALCVVTSWAGYVVLRTRTRTPLAPTRPGGAEL"
     CDS             653753..654997
                     /codon_start=1
                     /locus_tag="ROP_06320"
                     /product="hypothetical protein"
                     /protein_id="BAH48879.1"
                     /transl_table=11
                     /translation="MTDSARELDLVVYGATGFVGKLLADYLAQHAPDGVRIALAGRSA
                     AKLEAVRSALGPRAADWPVLVANSDDAASLATLAGRTRVVATTVGPYAKYGHALAAAC
                     AAAGTDYVDLTGEVLFARESIDANHERARETGARIVHSCGFDSIPSDLGVHVLHAKVR
                     EDGAGELTDTTLVVTSLRGGVSGGTIDSLRTQVDVSKKDAASRRLAASPYSLSPDRSK
                     EPDLGKQSDMGVVDGKTIAPGVKGWKAPFFMGPYNTRVVRRSNALRDWAYGREFKYRE
                     VMNVGSSPITPVIAGAVTAGLGAMIAGMALPPTRYVLDRVLPSPGDGPSEEAQRNGHF
                     TVDLYTTTTTGAHYTSRVKAKGDPGYRATAVMLGESALSLVLGGDALPDAAGVLTPAT
                     ALGDVLVARLRDAGMEISARKL"
     CDS             655260..656225
                     /codon_start=1
                     /locus_tag="ROP_06330"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH48880.1"
                     /transl_table=11
                     /translation="MFKLLIFTLVGVGAQLVDGALGMAFGVTATTLLVFSGVGPAHAS
                     AAVHFAEVGTTLASGASHWRFRNIDWPLVLRLGVPGAIGAFLGATVLSQLSTAAAVPV
                     TSTILLAIGVYVLLRFSIRPPAVNDARTSPHTAKFLSPLGLFGGFIDASGGGGWGPIT
                     TSTLLSRGKTAPRTVIGSVSASEFLVSAAASIGFIFGLGSDFFDNIPIIAGLALGGII
                     AAPVAAWLVSRVPATLLGTGVGGIIIITNAQKLFKTFEVTGVVATLGYIALVAVWAGL
                     LVVAWRRSRLSAAEAAGDLHRIDTEIDTPSEPETQSLEPSTGEKA"
     CDS             656358..658538
                     /codon_start=1
                     /EC_number="2.3.3.9"
                     /gene="glcB"
                     /gene_synonym="aceB"
                     /locus_tag="ROP_06340"
                     /product="malate synthase"
                     /protein_id="BAH48881.1"
                     /transl_table=11
                     /translation="MTERVEVGGLQVAKVLYDFVNEEALPGTGIDVDGFWSGAVKVIE
                     DLAPRNRSLLAVRDDLQARIDTWHRDHTGTPDPAEYRQFLTSIGYLVPEPGPFAVSTA
                     NVDAEITSTAGPQLVVPVLNARFALNAANARWGSLYDALYGTNAIGVDGGAEPGDSYN
                     RVRGDRVIAWARNFLDTAAPLRSGSHADAARYTVDGGALAVALADGTSTGLADPGKFV
                     GYLGDPAAPSSVLLRNHGLHAEIQIDPTSPIGQTDAAGVQDVVLESAVTTIMDFEDSV
                     AAVDADDKVIGYRNWLGLNRGDLTEELTKGGQAFTRRLNPDRTYTAPDGGELTLHGRS
                     LLFVRNVGHLMSTPAILHPDGTEIPEGILDALLTSLCAIHGLSRSEQTGPLDNSRTGS
                     IYIVKPKQHGPDEVAFTTDLFGRVEQVLNLPANTIKVGIMDEERRTTVNLAACIHEAR
                     ERVVFINTGFLDRTGDEIHTSMEAGPMIRKAEMKQQTWISAYEDWNVDIGLACGLQGR
                     AQIGKGMWAMTELMAEMLEQKIGHPKAGANTAWVPSPTGATLHATHYHQVDVFAVQDE
                     LKGTRRAGLDQILTIPLAPDTDWTEEQKQEELDNNCQSILGYVVRWIDAGVGCSKVPD
                     IHDVALMEDRATLRISSQLLANWIRHGVVTAEQVVASLQRMAPVVDRQNQGDPTYRPL
                     APDFDTNIAFQAAKELILDGTTQPSGYTEPILHRRRREYKAANA"
     CDS             658665..660452
                     /codon_start=1
                     /locus_tag="ROP_06350"
                     /product="hypothetical protein"
                     /protein_id="BAH48882.1"
                     /transl_table=11
                     /translation="MGQHRGESRARGISKGPLIVLGLVVVLVLGVLGWFQLRDRINDQ
                     GAAAAGACVEGESVLAVAADPDIAPQLQTLADHYAETAPVIRDQCVSVTVTAVASDTV
                     RDALAAGPDGPWDAAAFGPRPALWIPSSSHSVKQLSATGVISGEARPLASSPVVLAVR
                     TAFANAPGTAALDWKDLPSLQSGRDALATLGLPGWGGLGLALPVGPGAESTEMAVEAV
                     AAAVTGSSTGPVTEEQARSVPVTSALTDLALGYEASTGAKPATTREALTALAEQGDPA
                     TSAIHAVATTEQQVYQALRDAPGADITTSMPKGPTPVADHPAAVLAGPAVDETQSRAA
                     AQFAEFVRRPEQAQVLADAGFRVEGLARPDDTTLAFPGVESALVPADAAAAAELMQVI
                     RNPISPRTSTILLDVSSSMGEREGTSTRLANTTMALAAHVDQSPDSSNLGLWEYSTTL
                     DGSRPYTTVVATGPLSAGGFTEGTRRQALDARLARATSATGSSTYTSLEAAYKSAVDG
                     YTPGRTNSVLLVTDGANDDSVSRAELLSAIAASSSMSKPVRIDVVTIGENPDLNTLQA
                     LADRTGGSLEKVTTSDGAALPTAISKLLS"
     CDS             660449..661603
                     /codon_start=1
                     /locus_tag="ROP_06360"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH48883.1"
                     /transl_table=11
                     /translation="MTRLLVFAVFLALVTWWLHRRLVRATGLGRPWSVIVDLALVALW
                     VLAVIGVGSGEAFDPGWARPPGWAGWVWLGAMFYLVLGLLLVAVVSLLTRLFARVRGG
                     GHDEQVDLSRRRGLRIATAVVVVGAVGAAGYGVREAARPRIVRVRVPLQRLPAEFEGV
                     RVALVSDLHVGPARGVDFTRRVVDLVNAERPDLVAIAGDLVDGTVAKVAPDLQPLGDL
                     EAPLGVFGVSGNHEFYADDGGRWLDVWDRLGIRTLRNEHATLTRGGAAIDIAGIHDYS
                     SPAPYEPDLPAALAGRDPSTFVVLLAHEPRQALEASDLGVDLQLSGHTHGGQMWPLGY
                     LVPLQQPSVTGLDRIGNTVLYTTRGVGAWGPPVRVGAPPEITILELVRAD"
     CDS             complement(661646..664498)
                     /codon_start=1
                     /EC_number="1.4.4.2"
                     /gene="gcvP"
                     /locus_tag="ROP_06370"
                     /note="protein synonym:glycine cleavage system P-protein"
                     /note="protein synonym:glycine decarboxylase"
                     /product="glycine dehydrogenase"
                     /protein_id="BAH48884.1"
                     /transl_table=11
                     /translation="MIDAGSRTFADRHVGPNAAELAHILELVGADSLDDLASKAVPAV
                     ILDGVTGGIADGLDALPAPVSEHEALAELSALAAQNTVATSMIGLGYYDTLTPPVLIR
                     NIIENPAWYTAYTPYQPEISQGRLEALLNFQTMVADLTGMEVANSSMLDEATAAAEAM
                     TLLRRASKSKSPRFVVDADLFPQTLAVVETRAEPLGIEIVVADLSAGLPDGDFFGVLG
                     QMPGASGRIADYTDVIAAAHERGALVAVGADLLALTLLTPPGEIGADACFGTTQRFGV
                     PMGFGGPHAGYLAVHTKHARQLPGRLVGVSVDADGDKAYRLALQTREQHIRREKATSN
                     ICTAQVLLAILAAMYASYHGAEGLKAIALRVAATAHSLAAALRGTGATVVHEHFFDTI
                     LVRVDGRAADVVAKAKDAGINLRLVDADHVAVACDEATTDDDVARVLAAFGGDGPVAR
                     EAGTSVPESQLRGSDYLQHEAFTRYRTETAMLRYLRALSDKDIALDRSMIPLGSCTMK
                     LNATAEMEAITWPAFAGLHPFAPTGDTPGILRIIKDLENWLVAVTGYDAVSLQPNAGS
                     QGEYAGLLAIRNYHLSRGDDHRDTCLIPSSAHGTNAASAVMAGMRVEVVACRPNGDVD
                     LDDLRAKIADHAERLAAIMITYPSTHGVYEHEIADICAAVHDAGGQVYVDGANLNALV
                     GLARPGRFGGDVSHLNLHKTFCIPHGGGGPGVGPIGVRSHLTPFLPGHPLAPELGTAG
                     PISAAPYGSASILPITWAYIRMMGAVGLRRASLTAIASANYIARRLDEYFPVLYTGEG
                     GMVAHECILDLRPITKDTGVTVDDVAKRLADYGFHAPTMSFPVAGTLMVEPTESENLE
                     EIDAFCEAMIAIRAEIDRVGSGEWTVDDNPLRGAPHTAGCLAAEWNHPYTRETAVFPR
                     GKARPKVWPAVRRIDGAHGDRNLVCSCPPISAFEGA"
     CDS             complement(664861..665481)
                     /codon_start=1
                     /locus_tag="ROP_06380"
                     /product="putative MerR family transcriptional regulator"
                     /protein_id="BAH48885.1"
                     /transl_table=11
                     /translation="MGDRPQENALNLAPGDNVAEPEFSSEEIQPGLFPDDSVPDDLVG
                     YRVPIACQIAGITYRQLDYWARTSLVVPSIRGAAGSGSQRLYSFKDILVLKIVKRLLD
                     TGISLQNIRVAVDHLRKRGVRDLAKITLFSDGTTVYECTSAEEVVDLLQGGQGVFGIA
                     VSGAMRELTGTIADFPAERADGGESEQSPEDELASRRKNRASRKTG"
     CDS             complement(665762..666235)
                     /codon_start=1
                     /locus_tag="ROP_06390"
                     /product="hypothetical protein"
                     /protein_id="BAH48886.1"
                     /transl_table=11
                     /translation="MSEMHVIGVRVEQPQNQPVLLLRETDGERYLPIWIGQTEATAIA
                     LEQQGVEPARPLTHDLIKNLIEAFGRTLKEVRIVDLREGTFYADLVFDQNTRVSARPS
                     DSIAIALRVGVPIFAEEAVLTEAGLVMPDEREDEVEKFKEFLESVSPDDFKATDG"
     CDS             complement(666379..667119)
                     /codon_start=1
                     /locus_tag="ROP_06400"
                     /product="putative MerR family transcriptional regulator"
                     /protein_id="BAH48887.1"
                     /transl_table=11
                     /translation="MTAVRQQQAHSGMSIGSVLDRLRPDFPDVTISKIRFLEAEGLIS
                     PQRTPSGYRRFSIADTERLRYVLTAQRDQYLPLKVIKEQLEAIDRGVATVGAGDSSPR
                     RPRALTVAPGEVSPEEFRTDREVRISRDDLISRAGIDEKFLVELTRGGLVVPGPAGFF
                     DEDAVTLARTARAMSEFGLEVRHLRAFKLAADREAGLVAQIAGPVAKGRDAGARDRAE
                     EMVRELAALSLTLHTCLVKSAVRGALDR"
     CDS             complement(667116..667616)
                     /codon_start=1
                     /gene="garA"
                     /locus_tag="ROP_06410"
                     /product="putative signal transduction protein GarA"
                     /protein_id="BAH48888.1"
                     /transl_table=11
                     /translation="MSENGNDAVYGETPAETTSVFRADFLNELDNSSATQAPEAPVSG
                     VEGLPAGSALLVVKRGPNAGSRFLLDQPTTSAGRHPDSDIFLDDVTVSRRHAEFRQED
                     DEFQVVDVGSLNGTYVNREPVDSAVLANGDEVQIGKFRLVFLTGPRTTAGGSQIGETS
                     AGAGSQ"
     CDS             complement(667938..668342)
                     /codon_start=1
                     /gene="gcvH"
                     /locus_tag="ROP_06420"
                     /product="glycine cleavage system H-protein"
                     /protein_id="BAH48889.1"
                     /transl_table=11
                     /translation="MSELEIPADRRYTAEHEWVERTGPTTVRVGITDFAQSQLGDVVF
                     VQLPAVDEDVTAGESFGEVESTKSVSDIFAPLTAKVVAANADLDGNPELVNSAPYGQG
                     WLVELGVDDEAALDAALAEMLDAAGYADLTAG"
     CDS             complement(668385..669131)
                     /codon_start=1
                     /locus_tag="ROP_06430"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH48890.1"
                     /transl_table=11
                     /translation="MSGHEGRHELHGTEPTTSRRSHVVFALLAALLLGGLGIAIVTQV
                     KNTGSGDTLDSASPADLLVVLDTLNQREAALRQEIASLEQTLATLQQSGSSGAALDEA
                     QARLTALSIQVGSAPATGPGVTMRITDPNRGVGSEVLLDLVQELRAAGAEAIQVQGAD
                     GPPIRIGVDSWVSGSAGGVSVDGRKVNAPYGVVAIGDPPTLAAALNIPGGVVDTVARS
                     GGQLTIEQSQQVTISALREAKPRQYAQPGN"
     CDS             complement(669139..669501)
                     /codon_start=1
                     /locus_tag="ROP_06440"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH48891.1"
                     /transl_table=11
                     /translation="MKAALKGGSAIYGVLALIVGIVLGVVFSPQVPDAVQPYLPIAVV
                     AALDAVFGGLRAYLDEIFDSKVFVVSFVFNVLVAALIVWLGDQLGVGTQLSTAIVVVL
                     GIRIFGNAAALRRRLFGA"
     CDS             complement(669534..670397)
                     /codon_start=1
                     /locus_tag="ROP_06450"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH48892.1"
                     /transl_table=11
                     /translation="MKRTESGVRRNPVPSLLQSLMNDHLDPGYEGAAEDREHGHSRQT
                     RVGRQVWIAIGALLVGLVLSVAYRQATERIPGTEQVRSELLSKVQDAEDRAGALAATR
                     DTLSAQADDARATALAGDARGAALLDELRGLEGDAGVEAVHGPGLTVTLTDPAAKPNL
                     SDSSQRSVGGKAVVLDRDLQSVVNSLWAGGAEAIAVGDVRIGPSVTIRQAGGAMLVDN
                     QPVFSPYVVSAIGPQGPMQTGFVVSDAYLRMSSVAQLYGIGFAVAEADDLHLPAAPAR
                     EVRAAREAGTR"
     CDS             complement(670397..671020)
                     /codon_start=1
                     /EC_number="2.7.8.5"
                     /locus_tag="ROP_06460"
                     /note="protein synonym:CDP-diacylglycerol--glycerol-3-
                     phosphate 3-phosphatidyltransferase"
                     /product="putative phosphatidylglycerophosphate synthase"
                     /protein_id="BAH48893.1"
                     /transl_table=11
                     /translation="MNSVDRDTARSDRIVTVPNLLSVVRLLGVPLFVYLLLVTHSDGW
                     ALAILMISGFTDWLDGKLARILDQSSKLGALLDPFVDRLYVVTTLVTFVVRGFIPWWV
                     AAILIGRDAVLALTLLIYRRRGLPPPDVMYLGKGATFLLMFALPMTLAAQGDWSIATV
                     AQPLAAALLVWGTVLYVWTGLLYTVNAVTVARTVPARGSGGDEREAR"
     CDS             complement(671153..672211)
                     /codon_start=1
                     /locus_tag="ROP_06470"
                     /product="hypothetical protein"
                     /protein_id="BAH48894.1"
                     /transl_table=11
                     /translation="MTFFESLARKLDRTGVDPVVWHAPPPPPLTGVLAPNGVLDGVHR
                     WALPAGEGPEDVAVDHDGRVVTGGNDGRIWRFDSRGDATELANTGGRPLGVEVLDDGR
                     YLICDAERGVLRVDEKGRIDVLADTAVGRPLVACNNSAVGRDGTVYFTDSSAHFTIAD
                     HRYDLLEHRGTGRLLRLDPRTGETDLLAEGLQFANGVGLASDESFVLVAETGSYQISR
                     VDLAGPSQGSTSVWAENLPGIPDNMTSQTHDGLFWVALYSPRMRLLDLLAPYPALRIV
                     AANLPEAVQPNPVHAGWVVALDQRGRIVHSLRGGKGSYAPVTGVREHDGWLYLGSLTA
                     DAVARVPAPPRPHIAAGE"
     CDS             complement(672253..672873)
                     /codon_start=1
                     /locus_tag="ROP_06480"
                     /product="hypothetical protein"
                     /protein_id="BAH48895.1"
                     /transl_table=11
                     /translation="MMVDGHVLSRERLADALARFEPRIVDPTNRRSAAVVIAVMNDGA
                     DGQAVPLTRRPSKMRAHPGQFALPGGGVDPGETGADAARRELHEELGLDVGPSAVLGR
                     LDDYVTRSGYVITPFVVWSEQSIASLVPNHEEVAEVFSVGVAEIDAEPRFVEIPESSK
                     PVIQWPFRRHLVHAPTGAVVYQFREVALHDRHTRIDGFDQPVFAWR"
     CDS             complement(672952..674472)
                     /codon_start=1
                     /EC_number="6.2.1.-"
                     /locus_tag="ROP_06490"
                     /note="protein synonym:acyl-CoA synthetase"
                     /product="putative fatty-acid--CoA ligase"
                     /protein_id="BAH48896.1"
                     /transl_table=11
                     /translation="MRLTDYLDKGASLGPSSPCLTMGERTLSYADVQDLSRRVAAALA
                     RSGIAAGDKVAVLSGNDPTAFSCVFGISRAGAVWCPINPRNEAAENRDLLDLFDCRCL
                     IFQKAFAPLVDRIREQLPLLTTLVCLDGDETYAESFDTWLGAARLDAEPVDDLALIVG
                     TGGTTGRPKGVMLTGRNIETMSALTLMSYPFDGRPVYLALAPLTHAAGVLCFPILTLG
                     GQVVIMPAPDLGQFLAHIDRDRVTHTFLPPTLIYMLLDHADLETTDLGSLQCFWYGAA
                     PISPTRLSEALTRIGPVMAQLFGQSEAPMMIATMAPKDHFHEDGSVATARLSSAGRPS
                     PLVTVAIMDGQGILLPAGERGEVVVRSSLVMAGYYKNPVATQEASAHGWHHTGDIGYL
                     DEDNFLYIVDRAKDMIITGGFNVYSVEVEQALMAYPGIQDCGVIGLPDEKWGERVVAV
                     VQARAGTPIEADALTAFVKARIGSVKTPKEILVWPDLPRSKLGKVLKNEIRQQLLG"
     CDS             complement(674504..675625)
                     /codon_start=1
                     /locus_tag="ROP_06500"
                     /product="hypothetical protein"
                     /protein_id="BAH48897.1"
                     /transl_table=11
                     /translation="MTDKKPVIVYGVSGYTGRLVCEYLREFNIPFVAAGRDKKRIQEV
                     LDRVPGLDTVDHDVVEVEHTVPALTELFSGARVVSNMVGPFIKYGAVVVEAALAAGCH
                     YTDTTGEQDWVLDVQAKFGDQFAEKGLLLSPGVAQMYTTGEIAANIALETPGLDTLDI
                     LVLWKGFPTYASTQTIFTILKADWYYLEQNRYAKWDPGTTFDVVVPGQHQMALALPWG
                     GTCHPVWFKDDPRVANVKAAGGVFDRSVMEGVVATQKMVEEQIKTLPADEQDAALAEI
                     AGSVQAGMPPRENPRVNTSLDSVYASGPLGRAHCVIHGNCNYKQTGLLQAYAAHSLLQ
                     QPPKKTGLASACQAFGHRELLGILRSFGLVMEPVVTVQN"
     CDS             complement(675667..676488)
                     /codon_start=1
                     /locus_tag="ROP_06510"
                     /product="putative oxidoreductase"
                     /protein_id="BAH48898.1"
                     /transl_table=11
                     /translation="MRRQVGMSVRDLAGRKALVTGGAKGLGAGMAAALADAGAAVVIG
                     DVLEEEGRATADSLGKSGVDTGFVTLDVTDDGNWERAVAATVEQLGGLDLLINNAGIE
                     ISSLVVDIDPADVRRMCDVNILGVALGLKHGLRAMRPGGAAGAGGSIVNVSSVAATIP
                     FPGIAGYSATKSAVDRLTRVAAQEAGKLGYGVRVNCVYPGLVATEMGLGLAADMERLG
                     LWPSADAAVADVIGLTPLGRLGEVADIADTVVFLASDAARFVTGIGLPVDGGMGM"
     CDS             676681..677316
                     /codon_start=1
                     /locus_tag="ROP_06520"
                     /product="putative TetR family transcriptional regulator"
                     /protein_id="BAH48899.1"
                     /transl_table=11
                     /translation="MTPVAEKNADRVSRRQVDKFAERRDQLAEAALQTLSELGYARTS
                     LREIAQNSEFSHGVLHYYFSDKVDLITHCVRHYKARCVTRYDGVVATAQTSDELKAGF
                     GRVLVDSLRGEASMHRLWYDLRSQSLFEESFRADVAAIDKSLENMIWRIVSRYAELAG
                     RTITIAPPTMYAVFDGLFQQSLAGYLSGDDSAADALADNVDQVLALVIPAR"
     CDS             complement(677323..677763)
                     /codon_start=1
                     /locus_tag="ROP_06530"
                     /product="hypothetical protein"
                     /protein_id="BAH48900.1"
                     /transl_table=11
                     /translation="MAGRFEGTVVIDRPIEEVFEYLAAGVNDREFSPRVQEIVKKTDG
                     PPGVGTVFVSTVKDAGMTTKREFEITEFEAPRRIRWAERSTNTVTAKEGGYDLEPSGA
                     GTKVTIFNVLEGHGIGRLIAPLALRAARKDAPAFAQRIKVAAEK"
     CDS             677762..678091
                     /codon_start=1
                     /locus_tag="ROP_06540"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH48901.1"
                     /transl_table=11
                     /translation="MPASRFRDLPGSDSTRAEAGARSHRRRAVGHRSDAAARTIGETV
                     GAFVLIAAVATSRSRYVMATNSPVAEALTSGFQRVLLASSIFLVAAALIALRTGNTRG
                     DCTARTK"
     CDS             complement(678106..678579)
                     /codon_start=1
                     /locus_tag="ROP_06550"
                     /product="hypothetical protein"
                     /protein_id="BAH48902.1"
                     /transl_table=11
                     /translation="MRCRNPGCDRSPVAGRPLAGRARRRLQGAPAPDDTDPVRQSAVV
                     DAFLAAARGGDFDALLSLLDPDVVLRADTGEIPAGASPVVRGAETVAGRVLGFARLAR
                     FANPALVNGTAGVVAISDGQLLSVLGVTVRQGMIVEIDILADRDRLAGLVVENLD"
     CDS             678720..679481
                     /codon_start=1
                     /locus_tag="ROP_06560"
                     /product="hypothetical protein"
                     /protein_id="BAH48903.1"
                     /transl_table=11
                     /translation="MSKAQHVGRLFLVSVLAALAVCGVSVAASAAPPAVTGKILAPAL
                     TPASGQVVGIAHPVVVRFTSPVPDRALAERGVRITPSTPVPGQFSWIDDRTLQWNPDR
                     FWPANTAVTVEAAGARSQFQVGDALVAVANTTTHQFTVSINDQIVQTMPASMGKPGYE
                     TPLGTFPVIEQFRDMIMDSSTYGVPIDDEEGYRLYVEYATRITWGGIFVHAAPWSVGS
                     QGFENVSHGCINLSTENARWFYDNAKIGDPVIVTS"
     tRNA            complement(679570..679646)
                     /locus_tag="ROP_t0020"
                     /product="tRNA-Pro"
     CDS             complement(679733..681160)
                     /codon_start=1
                     /gene="engA"
                     /locus_tag="ROP_06570"
                     /product="GTP-binding protein EngA"
                     /protein_id="BAH48904.1"
                     /transl_table=11
                     /translation="MTEQFTTEFAGDGTWSEESDWEVLDLEDGGDGEAHVPVPTLAVV
                     GRPNVGKSTLVNRIIGRREAVVEDIPGVTRDRVSYEANWSGRRFMVQDTGGWEPDAKG
                     LQQSVARQAELAMQTADAILLVVDAVVGATATDEAVAKVLRRSKTPVLLVANKVDDGR
                     TESEVAALWSLGLGQPHSVSATHGRGTGDLLDEVLAALPETPREGIPGGGPRRVALVG
                     KPNVGKSSLLNKLSGDERSVVHNVAGTTVDPVDSIVELGGRPWRFVDTAGLRKRVSHA
                     SGAEFYASLRTKSAIEAAEVAILLIDASEPISEQDLRVLSMVADAGRALVIAFNKWDL
                     VDEDRRLQLDREVDRDLVRVPWAQRVNISAQTGRAVQKLVPALDTALESWDKRIPTGR
                     LNTWLKEVVAATPPPMRGGRLPRVMFATQAGTRPPTFVLFTTGFLEAGYRRFLERRLR
                     EEFNFDGSPVRISVRVREKRERRSR"
     CDS             complement(681157..681846)
                     /codon_start=1
                     /EC_number="2.7.4.14"
                     /gene="cmk"
                     /locus_tag="ROP_06580"
                     /note="protein synonym:CMP kinase"
                     /product="cytidylate kinase"
                     /protein_id="BAH48905.1"
                     /transl_table=11
                     /translation="MSTSSLIVAMDGPSGTGKSSVSRMLARRLGARYLDTGAMYRIAT
                     LHVLRKGVDLADPDAIADATVGLPWSIGTDPAGEQVLLDGEDVGEEIRGDAVTKAVSA
                     VSAVPAVRELLVAAQRRLACEAGRIVVEGRDIGTVVLPDADVKIYLTASAEARAQRRN
                     AQNLAEGRGDDFAAVLADVQRRDHLDSTRAVSPLRPADDSVLVDTSELGIDDVIGRLL
                     LVVSERSGVGQ"
     CDS             complement(681843..682895)
                     /codon_start=1
                     /locus_tag="ROP_06590"
                     /product="pseudouridine synthase"
                     /protein_id="BAH48906.1"
                     /transl_table=11
                     /translation="MKKPARRDGTPDRNNKKQRPTRSETGGRTRSETGGRPDRAEAAH
                     RSGRPDATKGKPGRPDPAAKNKRGKPKSAKPQRAQAQAPKISNAKPARHQYADADRPA
                     GPPQGDGMRLQKVLAQAGVASRRAAEELISQGRVEVDGRIVIEQGLRIDPENAVVRVD
                     GVRVVVQKDLVHLALNKPRGWQSTMSDDLGRPCVGDIVSERVAAGQRLFHVGRLDADT
                     EGLLLLTNDGDLAHRLMHPSFEVSKTYLATVSGALERGVGKKLKEGVELDDGPAKVDT
                     FTLLDINEGKSLVRVTLHEGRKHIVRRLFDAVGHPVIRLVRTDIGAVALGDQRPGTLR
                     VLGRGEVGGLYGAVGL"
     CDS             complement(682912..683604)
                     /codon_start=1
                     /gene="scpB"
                     /locus_tag="ROP_06600"
                     /product="chromosome segregation and condensation protein
                     ScpB"
                     /protein_id="BAH48907.1"
                     /transl_table=11
                     /translation="MSSAPFDEPDDQGAVDTEPELSDTELAAVLESLLLIVDSPAGAE
                     QLASATGASVNRITETLNRMSAELTARGSGMDLRYAGDGWRLYTRTAYAPYVERLLLD
                     GARSKLTRAALETLAVVAYRQPLTRARISAVRGVNVDGVVRTLLARGLIAEAGVDPDT
                     NATQYSTTELFLERLGLASLADLPALAPLLPDVDLIDDISDSLESDPRFARMNKATAS
                     TEELDTGLDTED"
     CDS             complement(683601..684461)
                     /codon_start=1
                     /gene="scpA"
                     /locus_tag="ROP_06610"
                     /product="chromosome segregation and condensation protein
                     ScpA"
                     /protein_id="BAH48908.1"
                     /transl_table=11
                     /translation="MVDTQDIPAPPQTEGSHGEDPQAPAGKPGFRVTLRNFEGPFDLL
                     LTLINQRQLDVTEVALHQVTDDFIAYMRTLGAEMGLDQTTEFLVVAATLLDLKAARLL
                     PAGQVEDAEDLALLEARDLLFARLLQYRAYKQVAQLFGELEAAALRRYPRSAALEDQF
                     TRLLPEVLLGVDPQRFAEIAATVFTPRPKPTVGLDHLHDMHAVSVPEQAARMLELLRE
                     RGAGEWASFGDLVSECEITVEIVARFLALLELYREQSVLFEQPEPLGELLVSWTGEDT
                     HAPVTEEDYG"
     CDS             complement(684462..685466)
                     /codon_start=1
                     /locus_tag="ROP_06620"
                     /product="putative chromosome partitioning protein"
                     /protein_id="BAH48909.1"
                     /transl_table=11
                     /translation="MGSTAIIERTGDHRTVVTPQPPAAESEHSQPEGDMFDVRQTETA
                     ALLDDAAVVVEEELGPTGRPTREVPEPAPLPSHGPAKIVAMCNQKGGVGKTTSTINLG
                     ASLAEYGRRVLLVDLDPQGALSAGLGVAHNDLELTVHNLLVEPRVSIDDVLMRTRVEG
                     LDLLPSNIDLSAAEIQLVTEVGREQTLGRVLHPVLDRYDYVLIDCQPSLGLLTVNALA
                     CADSVIIPMECEYFSLRGLALLNDTVEKVHDRLNPRLELAGIVVTMFDARTLHAREVM
                     ARVVEVFGDLVYDTVINRTVRFPETSVAGEPITTWAPKSTGAEAYRALAREVIHRSGR
                     "
     CDS             complement(685626..686294)
                     /codon_start=1
                     /EC_number="3.6.1.13"
                     /gene="nudF"
                     /locus_tag="ROP_06630"
                     /product="putative ADP-ribose pyrophosphatase"
                     /protein_id="BAH48910.1"
                     /transl_table=11
                     /translation="MPDIGRHEFETLDSRAVYSGAILALRVDHVAMPDGRTAEREVVE
                     HHGAVAVVVLDDEDRIVLIHQYRHPVGRRLWEIPAGLLDEPGEDPADAARRELAEETG
                     LAARRWSVLVDVVLSPGFTDESVRVFLAEDLYEVDRPDPEDEEADLEIERIPFDEVVS
                     MVLNGTIVNATAASGVMALAAARSRPGGLGELRDVSAPWVDRPERFSERKRARAAGDE
                     AARA"
     CDS             complement(686308..688077)
                     /codon_start=1
                     /EC_number="6.3.4.2"
                     /gene="pyrG"
                     /locus_tag="ROP_06640"
                     /note="protein synonym:UTP--ammonia ligase"
                     /product="CTP synthase"
                     /protein_id="BAH48911.1"
                     /transl_table=11
                     /translation="MPQSRTHSRTATKHIFVSGGVASSLGKGLTASSLGQLLTARGMR
                     VTMQKLDPYLNVDPGTMNPFQHGEVFVTEDGAETDLDVGHYERFLDRDLSGQANVTTG
                     QVYSTVIAKERRGEYLGDTVQVIPHITDEIKSRILAMSGPDLQGHRPDVVITEIGGTV
                     GDIESQPFLEAARQVRHDVGRDNVFFLHVSLVPYLAPSGELKTKPTQHSVAALRNIGI
                     QPDALILRCDREVPPALKNKIALMCDVDVDGCISTPDAPSIYDIPKVLHSEGLDAYVV
                     RQLGLPFRDVDWTVWGNLLERVHQPRETVRIALVGKYVDLPDAYLSVTEALRAGGFAN
                     RSKVEISWVPSDACETEAGAQAALGDVDGVLIPGGFGIRGIEGKLGAIRYARHRKTPL
                     LGLCLGLQCVVIEAARSVGLDDANSAEFEPETTHPVISTMADQEDVIAGEADLGGTMR
                     LGAYPAVLAKGSVVARAYGSEEVSERHRHRYEVNNAYRDRIAKSGLRFSGTSPDGHLV
                     EFVEYPADQHPFFVATQAHPELKSRPTRPHPLFAAFVDAALRHKLEERLPVDVHGEER
                     AAADDEIAESADRDEVASVDSAG"
     CDS             complement(688219..689169)
                     /codon_start=1
                     /locus_tag="ROP_06650"
                     /product="putative channel protein"
                     /protein_id="BAH48912.1"
                     /transl_table=11
                     /translation="MISLRQHAISIAAIFLALAIGVVMGSGLLSSGLVSGLRDDKADL
                     QTDLENASERNNQLTEQLNSADGFDSAVGGRVVADSLAQRTVMVVTTPDADPADLDGV
                     NRMIAQAGGSVTGRVSLTDSFVDATGGDRLRTVVNNVIPAGVTLKTGAVDQGSLAGDL
                     LGSVLMLGKETGQPQSSAQEMALALETLRGAGFVSYDDGAVQPAQVAVVLTGDRDVED
                     GVSGNRGAVVARFAGALDSRGAGAVLAGRPASAQGNGAVAVARADAALSAALTTIDNI
                     DREAGKITVPLALQEQLNGGAGRYGTGPGTTGVTVGATPA"
     CDS             complement(689166..690350)
                     /codon_start=1
                     /locus_tag="ROP_06660"
                     /product="hypothetical membrane protein"
                     /protein_id="BAH48913.1"
                     /transl_table=11
                     /translation="MKMPALLSRNTETLPGVSGIARVDRNTAKLLRRVGPGDIVVLDE
                     LDLDRGTADALVKAGVLAVINASPSISGRYPNLGPEVIVANGILLVDSAGAEIFKSIK
                     DGSKVRVNGGGVYSGERRIAKGDEQTEAEISDRMIEAKTGLVDHLEAFSGNTIEFIRT
                     ESPLLIDGVGVPDVDVDMKERHVVIVSDGPDHASDLKNLKPFIKEYSPILIGVGAGAD
                     VLKSAGYRPDLIVGDPEDITSATLKSGAEVVLPADQDGHAPGLSRIQDLGIGAMTFPA
                     SGSPSDLALLLADHHGASLIVTVGSTVSLDEFFDRGRRDSNPSAFMTRLKVGPKLVDA
                     KAVATLYRSRVSGSAIALLVLAALVAVIVALVVSNVGGEALDWAVATWNSFALWVQGF
                     FK"
     CDS             complement(690459..692231)
                     /codon_start=1
                     /gene="recN"
                     /locus_tag="ROP_06670"
                     /note="protein synonym:recombination protein N"
                     /product="DNA repair protein RecN"
                     /protein_id="BAH48914.1"
                     /transl_table=11
                     /translation="MLAEIRIDNLGVISEASAQFHEGLTVLTGETGAGKTMVVTSLHL
                     LSGARADAGRVRLGAPRAVVEGRFMTDEGSEHVERAVSRLLESTGAERDEDGTIIAVR
                     TVGSDGRSRAHLGGRSVPAGVLSEFTDPLLTVHGQNDQLRLLRPDQQCAALDRFADKT
                     VGPLVARYRKHRNEWMTARSELIERTGRTRELAQEADQLTFALNEIDGVAPTPGEDEA
                     IVSEVRRLSELDSLRSAAEEAHAALAGGDVMDGDGGAAPALDLLSEARARIESATDPE
                     LDGLGPRLADAIAVVTDVSADLTTYLAGLPADPGALDSLLSRQAELKNLIRKYAADVD
                     GVLEWADNARARLEKIDVSSDALAALTKQVEESAASTAEAASKLTAARVKAATKLAKA
                     VSSELAGLAMGRAALEVTVRPRIAGPQDTAPLTVDGTELHAGSSGVDEVEFRLSAHSG
                     AQSLPISKSASGGELSRVMLALEVVLAGSDSGATMVFDEVDAGVGGRAAVEIGRRLAR
                     LARTHQVIVVTHLPQVAAFADTHLVVDKVDDQDGVVSSGVHTLTDDERVVELARMLAG
                     LDDTETGRAHAEELLATASAERSA"
     CDS             complement(692234..693196)
                     /codon_start=1
                     /EC_number="2.7.1.23"
                     /gene="ppnK"
                     /locus_tag="ROP_06680"
                     /note="bifunctional protein"
                     /note="protein synonym:poly(P)/ATP NAD kinase"
                     /product="inorganic polyphosphate/ATP-NAD kinase"
                     /protein_id="BAH48915.1"
                     /transl_table=11
                     /translation="MSGGSSGGQQREREILLVAHPGRAEITETARRVGKIFERAGIGM
                     RVLVDEVDSTRIEPMDGMAADEFLVPGLEVTIVQAGPDAALGCEMVLVLGGDGTFLRA
                     AELAQAASIPVLGINLGRIGFLAETEAEHLDEALGQVVRREYRIEHRMTLDVLVRVDD
                     EIIERGWALNEASIENRSRLGVLEVVLEVDGRPVSAFGCDGVLISTPTGSTAYAFSAG
                     GPVVWPELEALLVVPSNAHALFARPLVTSPESLIAVETVAGSHDGLVFCDGRRTLELP
                     AGARVEVVRGKEPVRWVRLDSAPFADRMVRKFELPVTGWRGRKP"
     CDS             complement(693193..694023)
                     /codon_start=1
                     /gene="tlyA"
                     /locus_tag="ROP_06690"
                     /product="putative hemolysin"
                     /protein_id="BAH48916.1"
                     /transl_table=11
                     /translation="MARRARVDAELVRRGLARSREHAQELIASGRVLISGAAATKPAT
                     AIEAGTPLRVVEVDNEVSWASRGAHKLLGALEAFGPRGLAVDGKRCLDAGASTGGFTD
                     VLLHHGAREVVAVDVGYGQLVWRLQSDDRVHVVDRTNVRSIDAEQIGGPVELVVADLS
                     FISLKLVLPAFVACVTDGADLIPMVKPQFEVGKDHVGSGGVVRDPELRVASVLDVAKT
                     AASLGLRTVGAVASPLPGPSGNVEYFLWLRADVTPGTDDVPVESVEELIRTAVQEGPQ
                     "
     CDS             complement(694025..694312)
                     /codon_start=1
                     /locus_tag="ROP_06700"
                     /product="hypothetical protein"
                     /protein_id="BAH48917.1"
                     /transl_table=11
                     /translation="MFVTRFAVCVSDRDGLALCPMSTPIPRPGAHLPGPPQSVDPEKI
                     HTEVDGLLSRLGAVEPDPDDEHGAGVIPRKAHLLEKAHDVLVEALATVDKI"
     CDS             complement(694331..695326)
                     /codon_start=1
                     /locus_tag="ROP_06710"
                     /product="putative hydrolase"
                     /protein_id="BAH48918.1"
                     /transl_table=11
                     /translation="MTALRENYDALLLDLDGTLYQGPQEIPGAREALAAGMQSCYYVT
                     NNASRSPGDVAEHLTDLGFEAGESTVVTSSQSAARLLAENVAPGSPVLVVGTEALADE
                     VRNVGLRPVRSFEDAPVAVVQGHSPTTDWAILAEATLSIRAGAVWVAANLDSTLPTER
                     GLVLGNGSMVAALRTATSREPLVAGKPAAPLMEDAMRRSGCVRPLVVGDRLDTDIEGA
                     NNVGLDSLLVLTGVSTAIDVLRAAPEQRPTYVASELDALNRPADESLVGEDSRWSVEF
                     DGTDLVIEPTADSAEPMDSAALLRAVAVGAWKFPDFARITSTTRAVSAVVSGWGA"
     CDS             complement(695323..696330)
                     /codon_start=1
                     /locus_tag="ROP_06720"
                     /product="hypothetical protein"
                     /protein_id="BAH48919.1"
                     /transl_table=11
                     /translation="MVCVKGMTVSESDDGRRSFRGGGASQSGRGGASQSGRGGASHND
                     RGASGGNRGGAGGSGRGGSSGGPRRDSRDNRGGAGGDRRGGGPRRGGEGGFAPRGREG
                     DRPQRQQARPDEPDLPENVEAGELDPAVRRDLLSLDKTNANTVARHLVMAGKLVDDDP
                     RLALAHARAARQRAGRIAIVREAAGITAYHAGEWAEALSELRAARRMAGGPGLLAVMA
                     DCERGLGRPERAIELGRSEEAAALSGDEAAELRMVVAGARMDLGQFDQAVVTLQTPDL
                     DAARTGPGAARLFYAYADALVAAGRIEDGLKWFLNSAAADLEGDTDAEERVAELTGDD
                     Q"
     rRNA            complement(696372..696491)
                     /locus_tag="ROP_r0010"
                     /product="5S rRNA"
     rRNA            complement(696641..699775)
                     /locus_tag="ROP_r0020"
                     /product="23S rRNA"
     rRNA            complement(700117..701637)
                     /locus_tag="ROP_r0030"
                     /product="16S rRNA"
     CDS             complement(702246..703523)
                     /codon_start=1
                     /EC_number="6.1.1.1"
                     /gene="tyrS"
                     /locus_tag="ROP_06730"
                     /note="protein synonym:TyrRS"
                     /note="protein synonym:tyrosine--tRNA ligase"
                     /product="tyrosyl-tRNA synthetase"
                     /protein_id="BAH48920.1"
                     /transl_table=11
                     /translation="MTENIIDELTWRGLIAQSTDLDALRRDLDAGPVTLYAGFDPTGP
                     SLHAGHLVPLLALKRFQRAGNRPIVLAGGATGLIGDPRDVGERTMNSADTVAEWADRI
                     RGQLERFVDFDDSPSGAVIENNMNWTGKLSAIDFLRDVGKHFSVNVMLARDTVKRRLE
                     TDGMSYTEFSYMLLQANDYLHLRRSHGCSLQVGGSDQWGNIIAGVELNRRVDAASVHG
                     LTVPLVTSADGKKFGKSTGGGSLWLDPEMTSPYAWYQYFVNTGDADVIKYLRWFTFLS
                     AEELAELETATAERPHAREAQRRLAAEMTTLVHGEANTRAVELASQALFGRAELQDLD
                     EPTLGAALREASVAELAPGEPSSIVDLLVLSGLCESKGAARRAVKEGGASVNNQKISS
                     EDWTPESGDLLHGTWLVVRRGKRNFAGVKVLSN"
     CDS             complement(703532..704149)
                     /codon_start=1
                     /EC_number="3.2.2.-"
                     /locus_tag="ROP_06740"
                     /product="putative 3-methyladenine DNA glycosylase"
                     /protein_id="BAH48921.1"
                     /transl_table=11
                     /translation="MTIDRLDRAEPVDAARIVLGSTLIVGDVRIRIVEVEAYGGEKDG
                     PWPDPASHSYRGRTPRNEVMFGPAGHLYVYRSYGMHFCMNVSYGPVGTAGGVLLRAGE
                     VLDGSATVQARRPRVTRPADWARGPGNLGSATGVTLAENGAGLFEGDSPVRLEVADSD
                     DWLSGPRVGVSTAADRPWRFWIPESPAVSAYRRSPRAMPADERMG"
     CDS             704186..704974
                     /codon_start=1
                     /locus_tag="ROP_06750"
                     /product="putative ABC transporter ATP-binding protein"
                     /protein_id="BAH48922.1"
                     /transl_table=11
                     /translation="MGRIIHHTMNSPSDELRSAMTDAAAIDIRDLHVRRGRNEVLHGI
                     DVQVASGSITGLLGPSGCGKTTLMRCVVGTQIVESGTVTVLGSPAGSVSLRSRVGYVT
                     QSPSVYADLTVRKNVAYFAALYGQPSSAVTEAVDAVGLTRFATQKAADLSGGQLGRVS
                     LACALVARPEILVLDEPTVGLDPLLRVELWERFEELAAAGTTLLVSSHVMDEAEHCAS
                     LLLMRDGYVLAQVSPGGLREQTGETSLEDAFLNLIRASHVGSEN"
     CDS             704974..705729
                     /codon_start=1
                     /locus_tag="ROP_06760"
                     /product="putative ABC transporter permease protein"
                     /protein_id="BAH48923.1"
                     /transl_table=11
                     /translation="MNVTIFAATAGRILAQLRTDHRTVAMILVVPSLLMVLLYFLYQN
                     VPAPPGQQSLFERVAITMLGILPFVVMFLVTSIAMQRERTSGTLERLLTTPMGKLDLL
                     GGYAAAFSTAAAAQAGLACAVAFGFLGLTTEGSVTWVLLIAVLNAILGVALGLLCSAF
                     ARTEFQAVQFMPVVVVPQLFLCGLLVPRDQLPTWLEWISNVLPLSYAVEALQQVATHP
                     GATGLMWRDLAVVAAFALLALSLGAATLRRRTP"
     CDS             705726..706352
                     /codon_start=1
                     /locus_tag="ROP_06770"
                     /product="putative TetR family transcriptional regulator"
                     /protein_id="BAH48924.1"
                     /transl_table=11
                     /translation="MTDPATRSDATTGLRTGRRRGNPDTRSRILTTARKLFAQNGFDK
                     TSVRSVAAGAGVDSALVHHYFGTKRQLFLASVDIPVDPTKVIAPVLDTPRDEIGSRLA
                     LAVFSVWESPHKPAVVAAFRSAMAGNEPTLIRTFLLEVVLRDLGPRVDEPPGTGMLRM
                     QLVASQMAGVLVTRYVLEFEPLASLPVDDLVAIVAPTLQRYLTGDLPV"
     CDS             complement(706353..706565)
                     /codon_start=1
                     /locus_tag="ROP_06780"
                     /product="hypothetical protein"
                     /protein_id="BAH48925.1"
                     /transl_table=11
                     /translation="MVIDPTLLGILACPQDKGPLLLVGDELLYNPRLRRAYPIENGIP
                     VLLIDEARDVDADEHETLLARASGAA"
     CDS             complement(706604..709645)
                     /codon_start=1
                     /EC_number="6.2.1.-"
                     /locus_tag="ROP_06790"
                     /note="protein synonym:acyl-CoA synthetase"
                     /product="putative fatty-acid--CoA ligase"
                     /protein_id="BAH48926.1"
                     /transl_table=11
                     /translation="MRAGGSEACVTVRESGRVFVGLNTETVMGPIRRVVATAQNGLEV
                     VRLGGLETDLTTSPFEVVERAPMYRLRRYFPDTDPAEAGPPIVLVPPMMMSADVYDVT
                     RDQGAVGILRSMGIDPWVVDFGSPDSEEGGWDRNLADHIVAISEIIDQVRSHTGRDVY
                     LSGYSQGGMFAYQAAAYRRSRNIAGLVTFGSPVDTLAGLPFGIPAGFATDAAGFLADH
                     VFNRLAVSGWMARTGFQLLDPVKTLKSRLDFLRQLHDREALLPREQQRRFLATEGWVA
                     WSGPAVAELLKQFIVHNRMMTGGFVIKDQVVSLAELTCPVLAFVGEVDDIGQPLAVRG
                     IRRAAPRANVYESTLRAGHFGLVVGSAAATHTWPTTGKWVLWNEGLGPRPTNIELMRY
                     DEHFGSESGVSISDRIIHTVASVAEVGVGVGKGISDFASGALRGTMELSGEATRALPR
                     LARLGQIQPHTQISLSRLLAEQRRKAPGGECFLFDNRVHTYEAVNQRIDNVVRGLIQA
                     SVRPAAHVGVVMQTRPSALAAIVALSRLGAVAVLLPPGREVHSAIRIDGVERIVTDPE
                     NLDAAIATGMQVLVLGGGAQRDLDVDPSANVVDLEKIDPGAVTLPGWYRPDPGLAREL
                     AFIICSESNGHWETKQITNYRWALSAFGTASAADLDRGDTVYCLAPLHHSSSLLAAIG
                     GAVAGGSRIALSRGLDAERFAEEVHRYGVTVVSYTWTMMREILDAENLALDGSHPVRL
                     FIGSGMPQGLWRRTTERFAPAKVLEFYASTEGDVVLANVAGAKVGAKGRPLPGSAEVR
                     LAAYDPISGRLLEDEQGFIRECEDDEVGLLLGRAGVHAEMSGGAMRGIFAAGDAWIPT
                     ENLFCRDADGDYWLVDHRKTVIATPRGAVFTQPIVDALGSVDRVDLAVAYGVEAGGRT
                     LAVAAFTLRDGRPPRLAEISDALDALAPALRPDIIQVVGDIPLGSSYRPNADALSAAG
                     LPKPGTRVWYVDPESQQYRRLTKAVAAEFQDGSAGVPAGAR"
     CDS             complement(709699..711117)
                     /codon_start=1
                     /EC_number="4.3.2.1"
                     /gene="argH"
                     /locus_tag="ROP_06800"
                     /note="protein synonym:arginosuccinase"
                     /product="argininosuccinate lyase"
                     /protein_id="BAH48927.1"
                     /transl_table=11
                     /translation="MSAHGTNEGALWGGRFESGPAAAMAALSKSTHFDWVLAPYDVRA
                     SQAHARVLHKAGLLGDEDLATMLDGLGRLAADVASGDFIPSESDEDVHGALERGLIDR
                     VGPDVGGRLRAGRSRNDQVATLFRMWLRDAVRRVAEGVLDIVDALATQAAAHPSAVMP
                     GKTHLQAAQPVLLAHHLLAHTHPLLRDVQRLRDFDVRAAVSPYGSGALAGSSLGLDPE
                     AIAAELAFDSSAENSIDATSSRDFAAEAAFVLAMIGVDLSRMAEEVILWSTPEFGYIT
                     LADAWSTGSSIMPQKKNPDVSELTRGKSGRLIGNLTGLLATLKAQPLAYNRDLQEDKE
                     PVFDSVAQLELLLPAITGLVATLEFHTDRMAELAPAGFTLATDIAEWLVRQGVPFRVA
                     HEAAGACVRVAEARGAGLEDLTDEELAGVDPALTPDVREVLTVEGSIASRNARGGTAG
                     IRVAEQLGGVRQLSESLREWCR"
     CDS             complement(711120..712319)
                     /codon_start=1
                     /EC_number="6.3.4.5"
                     /gene="argG"
                     /locus_tag="ROP_06810"
                     /note="protein synonym:citrulline--aspartate ligase"
                     /product="argininosuccinate synthase"
                     /protein_id="BAH48928.1"
                     /transl_table=11
                     /translation="MADRVVLAYSGGLDTSVAISWIGKETGKEVVAVAIDLGQGGEDM
                     EVVRQRALDCGAVESVVVDARDEFADEYCLPTIQANALYMDRYPLVSAISRPLIVKHL
                     VEAARAHGGTTVAHGCTGKGNDQVRFEVGFGSLAPDLDVIAPVRDYAWTREKAIAFAE
                     ENEIPINVSKKSPFSIDQNVWGRAVETGFLEDLWNAPTKDVYDYTQDPTVNWQAPDEL
                     IISFEAGRPVAIDGKPVSVLEAIQELNRRAGAQGVGRLDVVEDRLVGIKSREIYEAPG
                     AMVLINAHQELEHVTQERELGRYKRQTEQRWSELVYDGLWFSPLKVALDTFIEKTQER
                     VSGDIRLVLHGGAIIVNGRRSNESLYDFNLATYDEGDTFDQSYAKGFVQIHGLSSKVA
                     AKRDLGL"
     CDS             complement(712367..712903)
                     /codon_start=1
                     /gene="argR"
                     /locus_tag="ROP_06820"
                     /product="arginine repressor ArgR"
                     /protein_id="BAH48929.1"
                     /transl_table=11
                     /translation="MNAAPPQRTGAAPPQRTANAATAPTRAGRQARIVAILSNNPVRS
                     QTELAALLAAEGIDATQATLSRDLEELGAVKLRAADGGAGVYVVPEDGNPVRGVSGGT
                     DRLSRLLGELLVSTDASGNMAVLRTPPGAAHYLASALDRASLPDVVGTIAGDDTILVV
                     AREPLSGAELAAKIESLA"
     CDS             complement(712900..713847)
                     /codon_start=1
                     /EC_number="2.1.3.3"
                     /gene="argF"
                     /locus_tag="ROP_06830"
                     /product="ornithine carbamoyltransferase"
                     /protein_id="BAH48930.1"
                     /transl_table=11
                     /translation="MTTVVKHFLRDDDLTPEQQAEVLELAARLKKAPFAERPLEGPRG
                     VGVIFEKNSTRTRFSFEMGIAQLGGHAIVVDGRSTQLGREETLQDTGRVLSRYVDAVV
                     WRTFGQKRLEAMASGADVPIVNALSDEFHPCQVLADLQTLAERKGSLKGLKLTYLGDG
                     ANNMAHSLMLGGVTAGVDVTIASPEGFAPLPWVVEAARARAADTGATITLTEDPQAAV
                     VGADALVTDTWTSMGQENDGLDRVGPFRPFQINEALLAKAAADAVVLHCLPAHRGEEI
                     TDEVLDGPQSVVWDEAENRLHAQKALLVWLLAQRTGNRP"
     CDS             complement(713844..715043)
                     /codon_start=1
                     /EC_number="2.6.1.11"
                     /gene="argD"
                     /locus_tag="ROP_06840"
                     /product="acetylornithine aminotransferase"
                     /protein_id="BAH48931.1"
                     /transl_table=11
                     /translation="MTGTPELQQRWSGALMNTYGVPRVALTRGQGAVLTDADGKEYVD
                     FLAGIAVNILGHAHPALIEAVTAQLSTLGHVSNLYASEPAIELAEKLLSHLGAPGRVF
                     FCNSGTEANEAAFKLARATGRSKIIAAENSFHGRTMGALALTGQAAKRAPFEPMPPGV
                     VHVPYGDLDALDRAVDADTAAVFLEPMMGEGGVVVPPEGYLAGARQITADRGALLVLD
                     EVQTGIGRTGWFYAHQAVGIVPDVMTLAKGLGGGMPIGACVATGAAADLFGPGKHGTT
                     FGGNPVCASAALAVLRTIAEDDLISRADTLGKALSAGIEGLGHPLIDHVRGAGLLLGI
                     VLTQDVAPAVENSAREAGYLINAAQPGVVRLAPPLVLTDEQAEGFVAALPAILDNAQS
                     AAQPGKQ"
     CDS             complement(715040..715966)
                     /codon_start=1
                     /EC_number="2.7.2.8"
                     /gene="argB"
                     /locus_tag="ROP_06850"
                     /note="protein synonym:N-acetyl-L-glutamate
                     5-phosphotransferase"
                     /product="acetylglutamate kinase"
                     /protein_id="BAH48932.1"
                     /transl_table=11
                     /translation="MTAASEALTGITDHQKAHVLAEALPWLQQFRDKVVVVKYGGNAM
                     VDDALKTAFAADMAFLRTVGIQPVVVHGGGPQINAMLGKLGMTGEFKGGFRVTTPEVM
                     DVVRMVLFGQVGRELVGLINAHGPYAVGISGEDAHLFTATKRTVMVEGTPTDIGLVGD
                     VTTVNPEAVLDLIRAGRIPVVSTIAPDSDGVVHNINADTAAAALAEAIGAEKLVVLTD
                     VEGLYTNWPDRDSLATEIDVDALAQLLPSLDAGMVPKMEACLRAVRGGVPTAHVIDGR
                     LAHSVLLELFTGEGIGTMVTPAPTSPTEGVAP"
     CDS             complement(715963..717207)
                     /codon_start=1
                     /EC_number="2.3.1.1"
                     /EC_number="2.3.1.35"
                     /gene="argJ"
                     /locus_tag="ROP_06860"
                     /note="bifunctional protein"
                     /note="protein synonym:arginine biosynthesis bifunctional
                     protein ArgJ"
                     /product="glutamate N-acetyltransferase/amino-acid
                     acetyltransferase"
                     /protein_id="BAH48933.1"
                     /transl_table=11
                     /translation="MSSDSTIDPHPAREVAGGTLVRSQGVSGPAGFRASGIKAGIKAS
                     GNADLALVVNEGPELAAAGVFTANKVKAAPVLWSQQVLTTGRLRAVVLNSGGANACTG
                     AGGFQDAHKTAEEVASALSNWGTETGAVEVAVCSTGLIGDRLPMDKVLTGVTEAVHEL
                     AGGISGGTDAAYAIMTTDTVPKQAALHHAGKWNVGGMAKGAGMLAPALATMLCVVTTD
                     AVATASQLDAALRAATRVTFDRLDVDGATSTNDTVLLLASGASNVTPTQEELNAAVTA
                     VCDDLADQMMADAEGVTKRVRVTVSGAVSEHDALIGARTVARDSLVKTALFGSDPNWG
                     RVLAAIGIAPIELDPDKISVSFNGAPVCIDGVGAPGARDVDLSEVDIALDIDLGLGEH
                     AVTIRTTDLSHAYVEENSAYSS"
     CDS             complement(717204..718259)
                     /codon_start=1
                     /EC_number="1.2.1.38"
                     /gene="argC"
                     /locus_tag="ROP_06870"
                     /note="protein synonym:N-acetyl-glutamate semialdehyde
                     dehydrogenase"
                     /product="N-acetyl-gamma-glutamyl-phosphate reductase"
                     /protein_id="BAH48934.1"
                     /transl_table=11
                     /translation="MTEHAGKPIRIAVAGASGYAGGEVLRLLLGHPSYADGSLVIGAL
                     TAGGNAGSTLGSHHPHLLPLADRVLEDTTVDTLSGHDVVFLGLPHGNSAQYAKDLPES
                     TVIIDCGADFRLTNAEDWERYYKSPHAGSWPYGLPELPGAREKLAGATRIAVPGCFPT
                     VSSLAMAPAVAAGVVEPRVTIVAVTGASGAGRAPKADLLGSEVMGSVRAYGVGGVHRH
                     TPEIIQNLSELAGERVTVSFTPVLAPMPRGILATCTAVTTATEDEVRAIYEKAYADEP
                     FVHVLPRGVLPQTGAVVGSNAVQIAVAVDADAGQIVVVAVIDNLAKGTAGGAVQSMNL
                     ALGLPETAGLSTVGVAP"
     CDS             complement(718328..718726)
                     /codon_start=1
                     /locus_tag="ROP_06880"
                     /product="hypothetical protein"
                     /protein_id="BAH48935.1"
                     /transl_table=11
                     /translation="MTEVRDVVAAASQLTDAEFLQVVRAVAAGRPGLGALLAAVDVGA
                     AIPTEDPVTAEVVPHVVPGAPAPDYTPGGVPTFDRVRERIEGRFGTATGSSELAHDSP
                     SGQSLEEAWEKREKAGKAKLDEIRRSLGKQ"
     CDS             complement(718769..721255)
                     /codon_start=1
                     /EC_number="6.1.1.20"
                     /gene="pheT"
                     /locus_tag="ROP_06890"
                     /note="protein synonym:pheRS"
                     /note="protein synonym:phenylalanine--tRNA ligase"
                     /product="phenylalanyl-tRNA synthetase beta chain"
                     /protein_id="BAH48936.1"
                     /transl_table=11
                     /translation="MRVAQSWLTEILQRATPDWDVTAEELDAGFVRVGLEVEEVDRLE
                     PVDGPLVVGKVLEITELTEFKKPIRFCKVDVGAAEPQGIVCGARNFAEGDLVVVALPG
                     AVLPGGFAIASRKTYGQVSDGMICSVAELGIGKDHSGILVLEPGTALPGADANELMGL
                     HDTVIELNITPDRGYCFSVRGLTRELACGFDLDFADPAAVAPSPADGEAWPIRVEPES
                     KATRFAARRVTGIDPNAVSPWWLQRRLLLSGVRPISPAVDVTNYVLLELGQPLHAFDA
                     AKIRGELVVRRAVAGEKLTTLDETERVLDPEDVVIADDSGVLSLAGIMGGASTEVGPG
                     TTDILLEAATWDPLAVFKTARRHKLSSEAGKRFERVVDPEIPVAALDRAAALLVDIAG
                     GRVESALTDIGEVTPHRPIHMDIDLPDRVAGVDYPTGTSARRLTQ