LOCUS       AP010968             8783278 bp    DNA     linear   BCT 07-OCT-2016
DEFINITION  Kitasatospora setae KM-6054 DNA, complete genome.
ACCESSION   AP010968
VERSION     AP010968.1
DBLINK      BioProject:PRJDA19951
            BioSample:SAMD00060928
KEYWORDS    .
SOURCE      Kitasatospora setae KM-6054
  ORGANISM  Kitasatospora setae KM-6054
            Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae;
            Kitasatospora.
REFERENCE   1  (bases 1 to 8783278)
  AUTHORS   Ichikawa,N., Watanabe,Y., Nakamura,S., Katano,Y., Oguchi,A.,
            Ankai,A., Yashiro,I., Fukui,S., Hashimoto,Y., Kamata,S.,
            Otoguro,M., Tanikawa,S., Ikeda,H., Ishikawa,J., Horinouchi,S.,
            Ohnishi,Y., Hayakawa,M., Nihira,T., Kitani,S., Kuzuyama,T.,
            Arisawa,A., Nomoto,F., Miura,H., Takahashi,Y. and Fujita,N.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-JAN-2009) to the DDBJ/EMBL/GenBank databases.
            Contact:Director-General Department of Biotechnology
            National Institute of Technology and Evaluation, NITE Genome
            Analysis Center (NGAC), Department of Biotechnology; 2-49-10
            Nishihara, Shibuya-ku, Tokyo 151-0066, Japan
            URL    :http://www.bio.nite.go.jp/
REFERENCE   2
  AUTHORS   Ichikawa,N., Oguchi,A., Ikeda,H., Ishikawa,J., Kitani,S.,
            Watanabe,Y., Nakamura,S., Katano,Y., Kishi,E., Sasagawa,M.,
            Ankai,A., Fukui,S., Hashimoto,Y., Kamata,S., Otoguro,M.,
            Tanikawa,S., Nihira,T., Horinouchi,S., Ohnishi,Y., Hayakawa,M.,
            Kuzuyama,T., Arisawa,A., Nomoto,F., Miura,H., Takahashi,Y. and
            Fujita,N.
  TITLE     Genome Sequence of Kitasatospora setae NBRC 14216T: An
            Evolutionary Snapshot of the Family Streptomycetaceae
  JOURNAL   DNA Res. 17, 393-406 (2010)
  REMARK    DOI:10.1093/dnares/dsq026
COMMENT     "Otoguro, M. is at NITE Biological Resource Center (NBRC). Ikeda,
            H., Miura, H. and Takahashi Y. are at Kitasato Institute for Life
            Science. Ishikawa, J. is at National Institute of Infectious
            Diseases. Horinouchi, S., Ohnishi, Y. and Kuzuyama, T. are at The
            University of Tokyo. Hayakawa, M. is at University of Yamanashi.
            Nihira, T. and Kitani, S. are at Osaka University. Arisawa A. is
            at Mercian Corp. Nomoto F. is at Nagase & Co. Ltd. The other
            authors are at NITE Genome Analysis Center (NGAC).
            
            Please visit our web site. URL:http://www.bio.nite.go.jp/
            
            DOGAN ; Database of Genomes Analyzed at NITE. The database
            contains genome sequence data, physical maps and the genomic and
            proteomic data of the microorganisms analyzed.
            URL:http://www.bio.nite.go.jp/dogan/Top
            
            The microbial strain and microbial genomic DNA clones used for the
            sequencing project are available through the NBRC.
            URL:http://www.nbrc.nite.go.jp/e/index.html
FEATURES             Location/Qualifiers
     source          1..8783278
                     /db_xref="NBRC:14216"
                     /db_xref="taxon:452652"
                     /mol_type="genomic DNA"
                     /note="strain coidentity: NBRC 14216"
                     /note="type strain of Kitasatospora setae"
                     /organism="Kitasatospora setae KM-6054"
                     /strain="KM-6054"
     repeat_region   1..127148
                     /note="left terminal inverted repeat"
                     /rpt_type=long_terminal_repeat
     CDS             complement(382..2745)
                     /codon_start=1
                     /gene="ttrA1"
                     /locus_tag="KSE_00010t"
                     /product="putative helicase"
                     /protein_id="BAJ25855.1"
                     /transl_table=11
                     /translation="MVSACGTGKTLIGIRVAEEVGSRRVMVVLPTKDLAVQTALAWRA
                     DRRREPMVLISSMDATASASLQAANVGSTGDFTRLASLMKSVEQLTVFVLYDSLRKIT
                     EAQQALHAPAFDLAIMDEAHRISGHHDKQWATVLDNQHIKADRRLFLTATPRIWDSPD
                     LAEDPDNPHRPRPRRRRTTVQRAPIDPRLINSLDNTHLYGPTVHHYPLHQAVEDGVIA
                     DYRILVPTITDTHLHQRLHTDTTTAASTRAGSAPTTGTRPGNAQTDDMRTGNAKPGGS
                     PAGSALRTTALHLAVHKAMTEHQLHHVLVYFNEVATARDFTREYPHTLRRLPPELRPA
                     TMPSVLHINGDDLPDERQATLNAFTAAPAAILTNAKVLTEGIDSGAIDAVVIADTTRS
                     VVRCVQALGRALRKPAGADKLAHLIIPAYIPEGADPTDILGTPYEPVWAIATALRSHD
                     HRIAERLPNRANRLPGEVRELVRRRWRFDYDTHPEVIARAMDLVSFDPARISTRPRLK
                     GLASAQAYRDEHGHLAVPHEYVDPYGFTLGEFVSGQRSAHQRGELPPEWIAELDALGM
                     IWSVPDAQWQANLTTVTAYHQQTGHLAIPTTDPGGRFLAEQRAQAARGQLAPERTADL
                     ENIDPHWRLLHGPDWHRKYATLRTHLRAGHDPAELHPDSVLVGIRIGPWLQRQTTGWA
                     KLHPDQQRLLTEIGLTPASSPLPRLARTRRTFRQNTDLLEAFLVREEGRLPEARESII
                     VDGEKIAIGAWLAKARSRARSGALRAEDRATITGLLGEEWAAAPDTA"
     CDS             complement(2892..4472)
                     /codon_start=1
                     /locus_tag="KSE_00020t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25856.1"
                     /transl_table=11
                     /translation="MTSGTVLRGPLGDVAQRAARQEGVHVEDAYAAALCWWAAAVAPS
                     ATLPTRSKDWPCLVWGAFLTGDAQPSLTTTLTEAGLDTHRFRRLTRHHDITTLDKLRI
                     AWTKASRTMAPGTDFSMLLTGSPVARRGSGTSCDDFLTYKLRTAWDGREYRDPGHRLR
                     SRRGAPARKAAKVGVLWEMPATDWPYRARTDEASSTRFLIFLRKTPGERRSTPVPVPR
                     PSAACRAVEELVRIYEDLTRRQVPMVITDEAAAKFWPIQLSADQFDDLGPAANQFARL
                     DAHTHRIAAALALAEDTDVVTGGHIEAAWSVVARSALDRSRLLCPDALEPVSVALDKI
                     GGEVRAAAGSPRVLTLDELSWRGGHRTVHTPTAVPEHAVRDRKGRITRDGAVAQDVKD
                     WHRNQCQMCGDILRIPGPQEAISEGAHIRPLSHGGPDYTGNVLCLCPSCHTRFDHGAL
                     YLTDDLHIVETLTGTVRGLLRTEPRHQVGLDCVRWHRARWEQHIPPGKRPAVPDGPAE
                     PPALRAAEPLAHSARLEH"
     CDS             complement(4964..5719)
                     /codon_start=1
                     /locus_tag="KSE_00030t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25857.1"
                     /transl_table=11
                     /translation="MGAWAWTALFAAAAVLAALVWWTNRYPGGWRFAFHRQHADDRAR
                     LRTKRGNLRRLEHEAADRLAALRAAVDTERSAYRSRIARAERRLAMLRDPGRGTLHST
                     MGPVQLYEHRLVVSTGGATHEYPLEEIAVRCERADDIGHLHLVLPDGRQQALDFPEEE
                     YDPTELTQFAARTHDAIAAAKRATPLRLANIPQAEAELAEAVADTTRHEQALERLEQG
                     KAEQAADTKIPTARRALDEELDRWHKITGARPR"
     CDS             6255..8075
                     /codon_start=1
                     /locus_tag="KSE_00040t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25858.1"
                     /transl_table=11
                     /translation="MARQFSYEKLVLTSVNGVREVDLDHPVIGVFGPIDTGKTTLVDA
                     LAYPLGYSVDWRQVPKDRLISVTVVLRVEGMRIALRRGLGSRANLVELIDPRSGEVDE
                     TLVVKYDPSGKQRRVGDVLLELLGLAELFAPPEAVAVSSAGAGRLSFEHLYPLCYLSQ
                     DMVDGGELVRGGANSASSYKAVVELLLHLTDARTRILTARLKVLLDAVRPLQARVEHV
                     KEFLAAARDEHALRQDLEESRRRVQETLVALEEFKGRQRAMTAEQDPLRCKVAEREAA
                     AARCRSVAAEARAEVERMVGRVRGLQHRAQAGPRLVSPCPGCARDLTGRTVGDGFCGV
                     CTERWDASRLQDLLRLAETELLAAEQAATAATKEQGRKEADLAAAQAELDAHLASRIG
                     PAAGHLEQLAAAHASAKAQSAALEQELEPYARLRELQQELERAVGERDEVKQQLADHR
                     ASLSGRQVAVQEIEDFFRHIIDALQLPGDPGAAIDRSSYLPRVRRGPLSNVGHGVRTV
                     LNVAYRMAFTSHALVTGATDLPTLLVIDSPRKNVGYGTDDQQLISRLYTHFLEHITAV
                     REGTTVVRPSQVIIVDNDLPVGFRDRLHVIELSRENPLVP"
     CDS             8506..10917
                     /codon_start=1
                     /locus_tag="KSE_00060t"
                     /product="putative helicase"
                     /protein_id="BAJ25859.1"
                     /transl_table=11
                     /translation="MPTAEQQAAREMFAAGGDLALVAGAGTGKTSTLVLMGQSTPRRG
                     LYVAFNKSIADDAKSRFGSNVECRTAHSLAFQSVGRNYRERISRSARVPAWQTARRLG
                     IDRDLPVNSTRITVKHQARLVMGMVRRFCYTTDRQLMARHLEWVNGLDTGGQDFVARE
                     LLPYAARAWEDLQDPGGELRFEHDHYMKMWALTSPVLGADFVLLDEAQDTNPVLEEVF
                     LNQKAQRVCVGDPAQQIYAWRAAKDVMTAFPAEHLELTQSFRFGPGIAAVANRWLCHA
                     ESPMRLAGCGPESRIGPVVGADAVLCRTNADALREVIGFLDDGVPVALAGGGAAMERI
                     AQAALELKAGKRTSHPELFLFSSWGEVQEYVEQDSAGSDLKAIVQLVDTHGPEAILAA
                     AQRLTPEEQAKVTVSTAHKAKGREWDTVRIAGGFEAPPLDEDGLQAPLSLPEARLAYV
                     AVTRACRHLDMESMAWLDAYEKTLASGPGAGGRPLLDLSLTGQLKHLASPMSRFMEQH
                     LPDARHVAGDYLKRLPPLPRPVQPLDVAHPKFDALGHAIDYRLRLSLGRDMGGAVAAG
                     VDAMHPRWELPGAPAPKVRSALHTAGVELLDLTRRHLDSEGTYLDEDTLSRLCFVAAS
                     YEDIYRIGRVHRFSFLTRADEHTTLRRLTDAVDSYVPDDLAVQMRLAQEPFAALRALP
                     EAQRVCGPVFAGSGDIGGADADFVLGGLLIDCKATTRPRQLGVAEIYQLAGYLLLDYD
                     DEFGIDRVGLYLSRQGHLITWTVPDFLLRLGTTTPLPTLRHRLRDFLHTEAAALASPI
                     GNRVR"
     CDS             complement(11456..12301)
                     /codon_start=1
                     /locus_tag="KSE_00070t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25860.1"
                     /transl_table=11
                     /translation="MKRERATAVLVEMLDRLEQGAWPLNLVEEIHLFGSYARGALEVG
                     DVDVVVEHATDARWTRESLDAFCDGRDSYVTMRQALRGRRRGVSFQFQERKALESEGI
                     DLSLLWRRGEPVVTARQRLAALTPDPAAGRAPRDHVLPSYEAIADLLPRPVRIDLHRL
                     CTEGAVTVAAFSLPDAWPTSARAAAHVQGRWALNSPLRRAAAAALARLESTGQALERV
                     EVHGQHLVYGTADEAVDCFVDLGWRYWRSAERYLDDGQAWFEVLPATARQPLHALHVT
                     PVALA"
     CDS             complement(12518..13216)
                     /codon_start=1
                     /locus_tag="KSE_00080t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25861.1"
                     /transl_table=11
                     /translation="MTAKTHRTRLAKALAKTRPVSYQKALAHVVACGDAGLLPARLDQ
                     DGMSQALAVLERHLDTPAVVESGPAARSAVGPAAVPSARKPPMSKDPRCVALSDALLP
                     VLESTSPEGAGGYGGSLQANLSPAEAEALGGLPLIRAALRRAARRLGWRVQTVGHESE
                     HVVVVFIHDTREAPAEFAEALERDRHRQGREAAERMDRFYDGRDVRELGPGPVDRQSA
                     LFRTAARAVLSRQA"
     CDS             complement(13584..17138)
                     /codon_start=1
                     /locus_tag="KSE_00090t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25862.1"
                     /transl_table=11
                     /translation="MSREPRSLREHQQQAIEAATATLGLLPRATVIAACGTGKTLIAI
                     RVAEHFAGQGNVLVLMPTLDLVAQTIRRWREDSSIHRMTAVCSSGRTDYPDITRHVVF
                     TTDPEVLASRLSERPGPAVVFATYASLEVLELAHRRHFLPEWAIVVADEAHHTSGDRG
                     KDWGAVHDDERLPAARRLYMTATPRLWTANSGTRRRKRKPGAPVELASMNDATIYGPV
                     VYRLTLAQAIDRKLLADYRIVVPIIRDEDLREVLHTAEATPEYDGLRLAALQVGLLQA
                     VADYGLRRVVTFHSRIVASQNFADSLPLTAAAISEQDTPPRIWSRAVHSNQTPRQRAR
                     CLRQFDTMPLLGSTTRGPLGYQFAILANVKTLGEGVDVPDADGVLFADPKRSAVDIVQ
                     SLGRALRQPPGSGKIATLVIPVYLAPGQSTREAMWSSHFSVLWDVLTGLRDHDDRVFH
                     RLTGIRRRRLQDPVLPGPERADEIAPVLDLRTHQIDSGEWADGWNAAVRFVDRHDHFD
                     VPSDYTDSSGFPLGCWVGRHRTHYKAGTLPIERAVALNALGISWPHPPDSFEHHLERA
                     AATASRTGSLAFDPTIPGSDPTLGAWLARMRRRASTSNLESERVDALNAVDPWWNPPW
                     SLRWQHTYTHLRHRLATTTWTIPYHRQADTDTGWNSWLDRQINRRDDLHPGQRHLLHH
                     LARTHPDAHPHTILLSRPATALAAAFTRGLRAARQYHQREGHLDVPAGHCETVDSEQV
                     HLGRWIRQRQRDAAQLTSRQLTALRALGIDPAPHFLQAPADPALTQPAGPIEPPGPPL
                     AAPRIPQPFPHRARSEPADTTAGSSTAPPGTDTAPHHQATAPPAAAVIAQAAPRPTAF
                     EEPWASMLTKAATFAAQHGHLNPAEGALASWLSRQRHLHATGRLATRRRNDLDALGMI
                     WNKHEDAWERGYAHARAFAVRTGHLAVPADEQVEDYNLGTWVRRQRKADLTADQEARL
                     TALDPLWRMAPDWQRSYRRLVAYLAAGGRLTGPVNRTGTPGDERFRPGAWLRMQNRHA
                     DTGNLDAHQTALLDALGAWRTHPAQGEPAPYRRAQGSAGCGQPPYARSMAAPPSVPPL
                     RPGPRTDRPAHRPPRSALTPIHQLPAEFRRYIKAARAFRDREGHLDVPPGFVERVEHA
                     KVRLGTWIARQRDKVFRGQLPPLLISELEALDMVWVRR"
     CDS             17330..18346
                     /codon_start=1
                     /locus_tag="KSE_00100t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25863.1"
                     /transl_table=11
                     /translation="MNVQEHGRCSDLRELPLHVRFLPNESTGSYVTRLAERNGLSVGY
                     LLEIVGEGKSRVVAPHLTELYLNRPAAERLARLAGRPLPVLQRALASLGEEYLLTGSG
                     EHPVWKWPWAVTDGYLVRACALCAARRGVTEPAWLMVPDTWSVCGEHARWTDNSRDTA
                     WPWTDLRPWPQVLDAHRRLACLGRRMGKVGRALMADAFSMMADRQVRSLYGRAPRWFA
                     EAADRLGERRAAPFLAYPEAVRVARVLARSERHRLAGALTWEEYRRWHAQAVAELGPA
                     FSPVLTVWMARHQPQTSVAARKAGVRPPLAAPHKVVGALASVAQLSCLPGELGAGTFD
                     RPYL"
     CDS             18556..19215
                     /codon_start=1
                     /locus_tag="KSE_00110t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25864.1"
                     /transl_table=11
                     /translation="MRAVPLERCEPLREPHAYHGRQSILTRYWAATTKGMVVCGSERL
                     MYAAALLDFDASVQWFSATATQICWQDGSAHGTVEPAFFARTVRGERLVIVHPARDGD
                     EQARSREAEVVAHVADAAGWTVAPLDVPTGIRLQWLRVVSAHRFPDLYDEKIRDVLLP
                     AFSVARPITAGVAAAGLPRTALAHAWHLLWTGDLSFERDRALIPVSLAWAGNAANRVV
                     V"
     CDS             19212..21722
                     /codon_start=1
                     /locus_tag="KSE_00120t"
                     /product="putative transposase"
                     /protein_id="BAJ25865.1"
                     /transl_table=11
                     /translation="MRAQRSGCTCRTGSAPGTDDDDGRCAGLEPGDTVRWHGASYLVA
                     ALQGGRVHLSAADEDGEDAVALLSAVVGAPDFAVLDDAGTERPGARIPDVSILSLLTP
                     AELVDVRAWERHLREAEEGLPPGCAPDARPRPEYDPATVSRSQRLASKERELKALGWR
                     KVSVATLDRRLKEYSAQGVAALVKVVAGKLYGNTDERIVALLLQELKDGVEESSGWGT
                     RLHERLQAGLRAAYPEENLRISRTGFYRLLNSLGTRTGSLRGPVRRRREAAGSPEPPW
                     TPTRARMLGEMVQIDSTGLDVLAIGDDGYPVQVELTAAVDVASRSIIGALIVPRAPGR
                     GYKGKRLGGRATTSFDATLMLAQALAPMPARPGWSPLSRAELSDLPYADQVACDPRMA
                     GAAARPVIRPKMVVVDQGKIYQGEHFEDVCTSLGISIRSARDNTGPDKAIVEATFSAL
                     KKLFSQYVAAYTARDLARRGKYVAEGPMWRLNELQDLLNEWIALHWQQHRHEGLRSPN
                     LPGVVLTPNQMYAALVACEGYAPLPLSPSQSRKLLLCEWRQVGDKGVRVGNRTYNSAA
                     LQAYNKQPSGVRGQGKRWPIRFDPYAPHYVWLFDQRQEQLGKDPWVEAEFIHQDLIDG
                     EWSQYLWQTAEQAFLNAGGPEEHEQRERDIALAVSELRERARRGPLDEAPAARAWRRA
                     GAARRLWRRPGRPFTGPQPAVRPPDPDRYASISVPDPATIVPARSLENPAQFLFPDQD
                     AGPRLSGDAGVLVTAGEPVAVPDTDERPPQNAEPPADPGVDMTTGTGKEPRLVAQRRG
                     STGGIADLFLSGLPAPADASDPAPPPRAAAGSTDEEDS"
     CDS             21719..22801
                     /codon_start=1
                     /locus_tag="KSE_00130t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25866.1"
                     /transl_table=11
                     /translation="MNDTTRQGTAPAPAGTSPLPGGPFDPGPLTTKEGFRAQARRTYG
                     PPDLQDCAPLGTKVTLSDPRLVYHGRLLPVVTDDVGAALKQARRLLVKNLTTGNGRGP
                     NFVVDGPRLSGKSLLAALIALGFHALVDELYGPDPDRHPVVYINVPHDRSDDLHWSLP
                     FADFLGIEHSRSPETMNHRPVDMTEPIVRVMQRAGTRLVVVDGVEYIRSSERQTAFDY
                     LLRLQDRLPRVTFLFCGIGAREIIRAGYGDHRSQAPAAGTHAPRPHIAFPTLWVRPVP
                     YTDAEPEQWHRVLGKVEENLRLYKHKPGTLRDLAAYLHGRTDGSMHVLDQLICQAAQA
                     SILEGTEEIDKDLLDSVLTGYDDPAH"
     CDS             22971..26153
                     /codon_start=1
                     /locus_tag="KSE_00140t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25867.1"
                     /transl_table=11
                     /translation="MYTSTEVWADPAKYEKNHVRQLLVPASELDVTESGGAKRVHSVF
                     GSWPAVDAAHDVPQEAEALTAVLPAGASSGVVGWRGSLARTGPDSVRRSLRGSIGYRP
                     HDEPGSLRRPQLGALHAVMAHWVSGLPDPGVVVMPTGTGKTETMLAVLVAGRVERLLV
                     LVPSAALRDQLAGKFETLGVLQRERIVSAGALRPCVGRLEHSFKDPDEAARFAQACNV
                     VVATPQVLNACSPAVRAKLLGAFSHLIVDEAHHAPAATWARVIDTFADRPVLLFTATP
                     FREDGRRLPGRVIFRFPLREAQRDGIFGRINYRAVLGLRDTDRELAEAAVERLRSDLD
                     AGFDHLMMVRAESIPKAEEIVEIYRELAPGFAPTVVHQNVGARRRTAAVRALRDRSCR
                     IIVCVDMLGEGFDEPALKIAAMHAARRSLSPMLQFIGRFARARKDLGEATVFVAQEPG
                     AGVSPLRQLLREDADWNLLLDRLTDGAASSAEETSAFDATFADAPDDVAVSVLEPKMS
                     AVAYRAASGQWNPEAALGLFRKNARVLDETVATGGQDNPVAWFVVEHRTAVRWGAPQA
                     LEQVVYELYILYFDVARRLLYIHGSEKSGAYKELAEAVLGPDCELINGARTYRVLAGV
                     DRLIPSNVGLKDARNHFTRFSLHVGSDVSQGFDTSQEHKSQTHIAASGFENGEGVSIS
                     AAYAGRFWTPTTAPDLKAWTDWCDHQGSKLLDDSINVERVFDGFIIPEDIDERPEYVL
                     LAVQWPWQIHTDAGRRLTVHHDGRSCSMTDIDFEVDDHSPTGPFRFSLVSTAWRIPYQ
                     ADYENRRLVYRPLGSDAKVRSSTRGTQALPLQAWLNIHRPELFLEGDRLIDDEGRLLN
                     PRYARLPFDTSGFVPLAWQGVDLTKESQGPERRPDSIQFHMSAHLRASSAFDVLIDDD
                     GPGEAADLVGLRVVDNKYLDITLVHCKYTKAAAGRRVKDLYEVCGQAVRSAKWRRGRT
                     LSLLDHLRDRAQKYTARTGISPYEIGGPRELLAIHDIARTLIPRFHTVVVQPGLQAEH
                     ATHDQLLLLAGAEQYVRHATAGDFAVYCSP"
     CDS             26324..28477
                     /codon_start=1
                     /locus_tag="KSE_00150t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25868.1"
                     /transl_table=11
                     /translation="MANTFFNDDPVDGSPDAPDLLGHQRYAHHAVGLLQEVRGQSESG
                     VLALIGPWGSGKSSVLQMVLRNLRQGPADGVSWSVAELNPWLYPDLDTLTMALFSEIR
                     GALPKDDQWSETRKKIGNFGQAISPLGKVGGLLGLDPSEAIKALSERISGDTSPSAAK
                     ATASEALRKAGRPVLVVMDDLDRLTPQELLLVFKLVRLVGNLPNVYYLISFDEQTLLD
                     VLRRSDLVGDSQHRASEFLEKIIQVRLDLPAFRERDASALVDQSLSTLLESHQLALTE
                     PEERRLATAYFQYLQDRLRTPRAIKRYFGQAAASLHALAGDVDLVDFLLVTFLRTSEP
                     GVYRLLNRHRAELTGTSFDPAARRERQSGEHTQRWRERLEKAGVAPDHMEGVLGLLAM
                     LFPPLGQALGGGGDASGTARRRGIGSNDYFDRYVAFGIPDDDLSEAALTTGLDQLTAG
                     APGPEAAELLLRLDNDTQRIGRRIRQRMDAGTPVPSTALLLELAARYGSLTAQTEGLL
                     GADVSARFLAQDLFRSLPSDGRAEVLQRMAATPQGAMLASRVLYDATEPSNSKPAFAQ
                     EDDAWVQEARTGLVARLRQHLATPGSRPAAHLSDSDVDLIWNWRHIDHATARAWIRQR
                     LDDGTWQLLPLLTKIVRPPRTPWGAVDADTLANLDALIDRAEVYTVLDQAQTSPDPDQ
                     SRLLEGLRHARDRDRAEATQQPDSGSAEVTNTQDT"
     CDS             28985..29272
                     /codon_start=1
                     /locus_tag="KSE_00160t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25869.1"
                     /transl_table=11
                     /translation="MDRVEVRVVVPGEAGRRLAALAAGLGWSAERVLAVLAEHAQVDD
                     DGLVHVPPVAVTAAPPGLEPPPERAPVVYRERPRFGRDEGGEGYGGPALDW"
     CDS             complement(29443..29934)
                     /codon_start=1
                     /locus_tag="KSE_00170t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25870.1"
                     /transl_table=11
                     /translation="MKTVSDFLPLLGAPVRQDEGHLIKEIAASWSITLPEDFIAIAGA
                     YGDALISDYLYFCGARKLRSYADRMGRMLEATRTVPHAVLPTPGGALVWGNTVEGDQL
                     FLVPRGDGSWTVSAFRRGWADWHDTDLGFSDWFHLALTGQTATDWLPEWEPLPHPLEP
                     SDE"
     CDS             30483..30809
                     /codon_start=1
                     /locus_tag="KSE_00180t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25871.1"
                     /transl_table=11
                     /translation="MARVRYCASCGGRLPRGASSRRRYCDDACRAQAYRDRKAEQRRL
                     DFLTLLGQAHYASHRRLIRALTCPVCGRATMARASRRRDAVYCSGRCRSRAWRQRASR
                     RARSAA"
     CDS             30921..31289
                     /codon_start=1
                     /locus_tag="KSE_00190t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25872.1"
                     /transl_table=11
                     /translation="MPTWRSLGLICGNANQPQITVGLGEEPVPEGSAGARDGPGRPGV
                     RPRPRFRVGMRLRVGVRGALDRQEAGAAGGGLAAVVVGRGAGKVEWSTVGHGPSLPRR
                     WAPGPERRPEDGRAAAGPGE"
     CDS             complement(31737..32753)
                     /codon_start=1
                     /EC_number="4.2.3.-"
                     /locus_tag="KSE_00200t"
                     /product="putative sesquiterpene cyclase"
                     /protein_id="BAJ25873.1"
                     /transl_table=11
                     /translation="MAEFEIPDFYVPFPLECNPHLEEASRAMWEWIDANGLAPTERAR
                     DRMRRTGADLSGAYVWPRADLDTLTIGLKWIALTFRIDDQIDEDDTAERLPARMTAID
                     ELRGTLHGLPVSGRSPTARALGALWQETALGRPATWCDAFIGHFEAFLQTYTTEAGLN
                     AHGAGLRLDDYLDRRMYSVGMPWLWDLDELRLPIFLPGSVRTCGPMNKLRRAGALHIA
                     LVNDVFSVERETLVGYQHNAVTIIREAQGCSLQEAVDQVAVLVEAQLHTVLQARQELL
                     EELDRQALPSRAREAAVDYAANVAANLSGQLVWHSSVERYAVDDLQSAADPRATPTTS
                     SLGI"
     CDS             complement(33650..34930)
                     /codon_start=1
                     /locus_tag="KSE_00210t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25874.1"
                     /transl_table=11
                     /translation="MGTDKDPDYEAEDPAFVAAVLALADDMDRWARQVWERIEAKGWN
                     QDRIAVRTPEVSISPTKASHWKHGSGILHTDRALPTALETRVVAARLELTGREAADLI
                     ELGRAIDRACTGLRKQYRWRQRARKVLGRRAAATDQAAAVPVPVPELQPVLVPEPVPV
                     LGPVVEPEPVSEPVVLPRGLRRRGPVKGRRSRVRIGAGAAAVAVVVGLIGWYGRSPDV
                     GSAEAAESAGASAPAASGPAAPLPSGPVASSPAPSTAPPSSRAPSGSAPGSPPSSPSA
                     SPTPSPVPSPPASAPASAGVAAAVPADTGEHCRGPVEAYTDHQASVDVCYRRSGDDLY
                     MIGYIQSAARPLSVDLYLWLKDGSGTAVYPTDHAVAWTKVTATVPQARREAKIAVKLN
                     PGTTYSVCFLDFPTGSPTPKFNTPGTGRQVTFVY"
     CDS             35132..35917
                     /codon_start=1
                     /locus_tag="KSE_00220t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25875.1"
                     /transl_table=11
                     /translation="MPSGEAMNTSSQQHTTAPAMPVQPAPAGWPVPPQPAYAPTVPPA
                     VAQPLPPRQGAGAPPRSVARTRIVLIAAAIANLVLALAVLLQAQAELDSYAAYRGAWF
                     AGALSGQEQAAQAAVGFAQLALVWTALHAAGALALAVRLGRGRGGLHRAVVVFGAWQC
                     LMGALTLAVGSEAGAAAVLQALATLAGGALTAWYATRPDTTAAVVVFGAWQCLMGALT
                     LAVGSEAGAAAVLQALATLAGGALTAWYATRPDTTAWARRPRP"
     CDS             35980..36783
                     /codon_start=1
                     /locus_tag="KSE_00230t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25876.1"
                     /transl_table=11
                     /translation="MTMNATSALAAAGRNRYVRILLALLAAVLVLTGLAAAVPAPTAT
                     AAAKPSSKARADREEVKEIQRRLVAHGYPVTVDGSYGARTLYAVQDFQRDHGLAPTGL
                     VHDFAPTGFDTNTTFFALLAPPAKKSSGAPAKLTNSQAISRLRAAGVDWHSSKDCTDQ
                     GKYGCTSFTKMLAPTLDLAIELKKRSGCDVTVTGGTEVGHSTVGARIHGTGYKIDVRP
                     NPCLDKFITNNLFRGEDRSSDPRWLTHDAEYVLEHPQKGAVHWDIKYTL"
     CDS             36948..37289
                     /codon_start=1
                     /locus_tag="KSE_00240t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25877.1"
                     /transl_table=11
                     /translation="MSWWDAALWGLAGGGAVGVLSLMTAIREAGARWPWRKGEMWPEL
                     THMAGGLVLGALVSAAASSQISGPWPAFIFGVGAPATIRGLLSGVQVTARRLEVLDSP
                     VDDPNTEGESP"
     CDS             37526..38140
                     /codon_start=1
                     /locus_tag="KSE_00250t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25878.1"
                     /transl_table=11
                     /translation="MDLTGADLTGVYLSGANLRGAYLTGANLRGAYLTGANLRGTNLR
                     DTYLASADLRDADLRNADLRDADLRDANLTRADLSGANLRDADLTAADLSGADLTAAD
                     LTRANLRAAYLNGANLTRADLSGTDLSGANLTGESRIGQVGGMGPGRPTLLVNVTWSD
                     ETQWPDDVGSDMRRRSEPLGDGRYRVLGSGNSDAELGVSPVPVR"
     CDS             38229..38423
                     /codon_start=1
                     /locus_tag="KSE_00260t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25879.1"
                     /transl_table=11
                     /translation="MLEVLAKHVQVNGDGLVHVPAVAVTAAPPGLEPHPERAPVLYRE
                     RPRFGRDEGGEGYGGPALDW"
     CDS             38614..38925
                     /codon_start=1
                     /locus_tag="KSE_00270t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25880.1"
                     /transl_table=11
                     /translation="MSEDSGPVGGRWCRCCGGRLRPESPPGAVYCSAACRARQWRVDC
                     RLRKRVAAELSGVGRVECPECGERWVAGVDRRSNAVYCSRRCVMRAWRRRNEAFGERS
                     Q"
     CDS             39091..40212
                     /codon_start=1
                     /locus_tag="KSE_00280t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25881.1"
                     /transl_table=11
                     /translation="MAQEIETTADKVGSVSASRYEEIVALLREVVENQTRGQFTIGDA
                     ALEIEPMREPGGSAPADEMFSVKQSLARLAEDIGLTFSSVSGTRWVASRWPKERRQPK
                     VSYTVHRTLAGIADEGERFAAILTPPGKKGRWTADEANRRVGRQVEIPVTPQEKVSAI
                     HALAKDEEVAATVTGDFLRRPEVVAQVQPQDRVRVVEELTRDDQVAAAVAPSFLRRPE
                     VVARVAPAEKVRVVQELTRDETVAAEVTTGLLRRPDVAARAMADDTARHQVNHAQVER
                     GRQAREHFEQTNPVAPAVKNIDRTVEFLDLVTACHAFVAAAGRVVPGLRDRQLSEDEQ
                     AVIRENCARVRATLDWVETAVDTGKVDMDGELARLLQGE"
     CDS             40216..40644
                     /codon_start=1
                     /locus_tag="KSE_00290t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25882.1"
                     /transl_table=11
                     /translation="MPRAARRRSAAAERHADTVRFVLFEARPAGLVFAQLSRASGLST
                     SQTRSGLACLRDTIAERGWPPLIWSRTDGYKFCSDPVELQAYEVAVIREKLTEIRRFI
                     TGVVAPHAVLQPKGRWVRHLNTQLSSVESTLDVIADYIDA"
     CDS             40719..41573
                     /codon_start=1
                     /locus_tag="KSE_00300t"
                     /product="putative transposase"
                     /protein_id="BAJ25883.1"
                     /transl_table=11
                     /translation="MARRRCYPSDTWDEEWKLLEPLLPVPACETKAGGRPEKHPRREI
                     VDAIRYVVDTGCKWRALPKDFPPWRTAYGFMARWAAAGVVGRIRDQLRRRIRRDMGRG
                     PEAVATIIDSQSVKAAETVGKDSRGYDAAKKINGRKRHLVVDTKGLPLFVMVTPADVT
                     DRDAAKEVLFRLRLMHPEITIVWADSAYAGQLVSWAKKYLNLTVKTVNRPKEAKGFVV
                     LPRRWVVERTHAWVMHARRHARDYERLVQHSESLITWATITVMTRRITRRNSTRTGQT
                     ASRETQRD"
     CDS             41698..42156
                     /codon_start=1
                     /locus_tag="KSE_00310t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25884.1"
                     /transl_table=11
                     /translation="MMLTARQRGERSGREKCTSMELISGAGLHSRPWPELMPDGRPAL
                     ILPAAPDRPVIAQDGWADRTTAFDPAAGPQPGWSAVLDDYRLTLHRPGGTAWFDGEIG
                     ADRHWRRRLRDHRTLLLITGPFTGVFDFRPAAEAGRLSLLTTPARLASDL"
     repeat_region   42800..42802
                     /rpt_type=flanking
     repeat_region   42803..43902
                     /note="IS candidate"
     repeat_region   42803..42814
                     /rpt_type=inverted
     CDS             43035..43874
                     /codon_start=1
                     /locus_tag="KSE_00330t"
                     /product="putative transposase"
                     /protein_id="BAJ25885.1"
                     /transl_table=11
                     /translation="MTDRRRYPSDLSDARWALVEPTLTAWRRARTERALAFGRPPEHE
                     LRDLLDAILYVDRTGIPWRYLPHDYPPWETVYAYFARWQKEGVFEQLNGLLRRLVRTA
                     EGRGPEPTACIVDSQSVKTSTNVPTSSQGVDVGKKIVGRKRSIVTDTIGLLLMILVTA
                     ASVQDGAAGKQLLTAVATEHPAIRKAWTDMGYKNAVVEHGATLGIDVEIVRRDPATRG
                     FVVQPRRWVVERTFGWLMNHRRLARDYEALPARSEAMVHVAMISLMTRRLTGESTPTW
                     RGT"
     repeat_region   43891..43902
                     /rpt_type=inverted
     repeat_region   43903..43905
                     /rpt_type=flanking
     repeat_region   43906..45005
                     /note="IS candidate"
     repeat_region   43906..43917
                     /rpt_type=inverted
     CDS             44138..44977
                     /codon_start=1
                     /locus_tag="KSE_00340t"
                     /product="putative transposase"
                     /protein_id="BAJ25886.1"
                     /transl_table=11
                     /translation="MTDRRRYPSDLSDARWALVEPTLTAWRRARTERALAFGRPPEHE
                     LRDLLDAILYVDRTGIPWRYLPHDYPPWETVYAYFARWQKEGVFEQLNGLLRRLVRTA
                     EGRGPEPTACIVDSQSVKTSTNVPTSSQGVDVGKKIVGRKRSIVTDTIGLLLMILVTA
                     ASVQDGAAGKQLLTAVATEHPAIRKAWTDMGYKNAVVEHGATLGIDVEIVRRDPATRG
                     FVVQPRRWVVERTFGWLMNHRRLARDYEALPARSEAMVHVAMISLMTRRLTGESTPTW
                     RGT"
     repeat_region   44994..45005
                     /rpt_type=inverted
     repeat_region   45006..45008
                     /rpt_type=flanking
     CDS             complement(45296..46324)
                     /codon_start=1
                     /locus_tag="KSE_00350t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25887.1"
                     /transl_table=11
                     /translation="MEPGFHGNTGKPEGDQRYMSSVTYALYNSARKEMILFDLLQGGR
                     LRIPVQNDSAGLFIAPDQTDRVTRVAIDNTTGYLFSWDLIDARLSRQYVGKSQRPHSD
                     YLFEAAEPNGPTGPMTTDLDLDRTRGLVAAYYDEDGDGRGHDAVLMVYGTTDGKQRAV
                     VTLPADSTGEIAVVPGTDRIYVTAPAGPDTLLHAYGTDGTRHEDLRLPGVTDAGSFVT
                     DPGTGDLYFYGAKDGTGRLLTRSAADGTVRAVTGLTGHPNDVVIDDQARLAYVLTTET
                     TSPPGDPSPSLRNRVAVVDLATRAVLADTPIEQHGLGLDFDPQTHLVYAGGRRGDLYG
                     ITTLQYTP"
     CDS             46907..47464
                     /codon_start=1
                     /locus_tag="KSE_00360t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25888.1"
                     /transl_table=11
                     /translation="MRTRPLSLALPLLLGASLLLPAASPAAAGDDDGASCHGASGHQT
                     YDPPLSAEPKTTTVTTTVLYEMCEHFPAETAKSVTTRTVRASCEEPDDLDALTEVTVV
                     FDSTPATSTTLKGTPERRSQDTAVLKGTVTAGEHQGWRGEYTFTLPRIRTEECERDTL
                     ARAELGWLDAFIGLFPDRRTTDRQS"
     CDS             complement(47500..49014)
                     /codon_start=1
                     /locus_tag="KSE_00370t"
                     /note="Similar to Formimidoyl fortimicin A synthetase
                     Fms14 in Micromonospora olivasterospora (Q50259)."
                     /product="putative oxidoreductase"
                     /protein_id="BAJ25889.1"
                     /transl_table=11
                     /translation="MGSREPDTTETPGAGGRGGQAFDVVVVGNGVLGMSLAVVLLRRG
                     ARVAVVGDGNRPLAASTASGAMNGCFGEVTATTTATAHGRARLEMDVLAARLWDDWLA
                     GLEEDGGATVRCARGTLVIHNTIGMAEIDDTAMTAIRAALELHGEPFESVDPTEAVPW
                     LDPQPTARPLAGLFLPREHGVDSGALLKVLHRAVVRLGGVLVPEHAVRVVHGAGRAGG
                     IALADGTVLAGDRVVLAAGVGTQALMDSLPPEVSAPVPRLISGFGVSVVLSNGPAAAP
                     PDCVVRTPNRSFGCGLHTVPRGPDRVYVGATNTTRPRPGSDPSVRDLAFLLDCAARQL
                     RRDLWFSDITATRVGNRPMTLDGHPLLGETLLPGLWLMTGTFRDGLHTSPLLASRLAD
                     RILDGTPPTPEMDLFRPTRPPIQTMDRRDTVRHATVHRLAVGHEWNWSLPVEWPVHLE
                     EMYEAKYRAVAERTHDTITPPPEVLAYIPAFPELADMLDAYYTASRPRLGASGD"
     CDS             complement(49097..49678)
                     /codon_start=1
                     /locus_tag="KSE_00380t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25890.1"
                     /transl_table=11
                     /translation="MDPRSPVPPRLRGRRPRRPPNALPLLLALLLAAAALVLPAPPAR
                     AAGSLLDCPGTATSTYAPPLTAAGAPTTITLSEVLTPCAAPGTAVTSGTASLVVPVPT
                     PYPCGQLAGSGTLTRTITWNTGQTSTLTGTYTATFVGATIVGNGSGTVVSGLFAGQPF
                     TDVRVTPSEQVLRCEAALATVSGTVAVTDLLIG"
     CDS             50078..50167
                     /codon_start=1
                     /locus_tag="KSE_00390t"
                     /note="Similar to Putative small membrane protein in
                     Streptomyces coelicolor (Q9X901)."
                     /product="hypothetical protein"
                     /protein_id="BAJ25891.1"
                     /transl_table=11
                     /translation="MGVRTIVGLIVAVLLVVYLILSIKYPDRF"
     CDS             50380..51093
                     /codon_start=1
                     /locus_tag="KSE_00400t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25892.1"
                     /transl_table=11
                     /translation="MDIRLLNTFDTPTLAVLVVGVIVALSVLAVLLVRRRYPGLAEGE
                     HNDMIGTVLGMFGAIYGIILAFVIVTLWTQLDTTNTIVASESTAAATLVRDAGAFPPA
                     ERDRIREATGANLQALYDALQSYEPGTETEKAYYGQATGQLDEMVLQRRARIAMATKE
                     LPLLLQVLVYGGALVIIPLTFLCGVRSRRMQVLFVGTVAMLIGFSPLLTLVLDRPFSG
                     DLSASSGPFKEGALTQFWK"
     CDS             51283..52248
                     /codon_start=1
                     /locus_tag="KSE_00410t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25893.1"
                     /transl_table=11
                     /translation="MAYGPEAAAVVLAAAGAGAMGAMLPPNLAVALLLGTLVLSYRQV
                     IAVHPGGGGSYAVAKQEFGRTTALLAAAGLVVDYVLTAAVSLATGAASLASAFPVLND
                     HLPLVALTGLAVLTAVNLRGLADSARLLAPLTLLFVLAVLAVVVLGAARPHPVGAVGG
                     PPTVAVTQGLGVLLVLKAFAAGCTAVSGVEAIANGVPAFRPPRVRTARRTQVLLGVLL
                     AVMLVGLGHLMARDHVVPRADVTVLAQLTAHSLGTGWPYYATNLTVALLLAAAANTSF
                     GSLPILLALLARDDRLPTSSRSARPGRSTAPACWAWPSSPRSCSW"
     CDS             52206..53024
                     /codon_start=1
                     /locus_tag="KSE_00420t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25894.1"
                     /transl_table=11
                     /translation="MLGLAVLTALLLVVTGAVTERLIPLFALGIFIGFSVSQLGMVRY
                     WYLARPARWRRLAVLNGTGAALTLVATAVLLVLKFTRGAWAVVLVVPLLMLLFARVER
                     YYGAAAGAVGAGRVPPRPVPGRGLVVVPVGELSAVTAHVLARALTLGGDVVAVTVDVP
                     GTAAPALARQWREWDPGVPLETLPGTHHALLEPIVRYVQRATAEGRDVTVLVPRKLTR
                     RHRERLLQGGRPAVLAALLRRRTDAVVSTVPYHLDTAARPRAARPEPPVGTTTP"
     CDS             53335..53688
                     /codon_start=1
                     /gene="groS3"
                     /gene_synonym="groES"
                     /locus_tag="KSE_00440t"
                     /note="protein synonym:Cpn10 protein"
                     /note="protein synonym:GroES protein"
                     /product="putative 10 kDa chaperonin"
                     /protein_id="BAJ25895.1"
                     /transl_table=11
                     /translation="MTPRSLARLCLTALLVGGLTWTAGPAASAAPAAVLRPVAPAAVA
                     APAGYVMVSTHEIAATEVLGVDLLAGRVSAVGIGLDIAPGETVIFAKYSGTEIRLDGE
                     DYLQLSGNEILAVVG"
     CDS             53727..54566
                     /codon_start=1
                     /locus_tag="KSE_00430t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25896.1"
                     /transl_table=11
                     /translation="MTGGTPLPLISVITPVHPDKHAFLSETWASVRRQALPPGWEWEW
                     LVQQDGPDRPDGSVWDVLPRDPRIRTGSARAGGAGVARTMALARARGTLVRALDADDL
                     LLPGALHRDVTALHRTGAAWCVSACLDLLPDGTLRPGPWDPPDGPLELAALRQRFEAG
                     AFPLVGTHLTARTDLVRALGGWPAYPALEALAMVLFCAALAPGVMIAQPGGIYRKHPG
                     MTTSEPSYHHETDFDALRRSILTRLDSPARAGFSWLPRQPGAPNPTPPEDRADPGPRR
                     PGR"
     CDS             54634..55179
                     /codon_start=1
                     /locus_tag="KSE_00450t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25897.1"
                     /transl_table=11
                     /translation="MRRNPVPGLLAALALAAATITVTANAPARAAVGDVLCTTPSSDS
                     SAYWPALSLTPAATVVTITRDLSTCTSLSVPAIDSAPVTVHQVTLPSYSCLTLLSSAP
                     TVINFTWNNGATTVVTGTRTVNLAAAALTTTVTGTVTSGLFTGDTVVYQLVAPSTDVL
                     ACTLGLGTVSRIDSTATLTIG"
     CDS             55948..58026
                     /codon_start=1
                     /locus_tag="KSE_00460t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25898.1"
                     /transl_table=11
                     /translation="MLLCPLLSGTGPAAAAAGAQQRGPAPAQARTAGTGTLLFSESFQ
                     DGAVPDPKLVPLGDACLTGARGAPPAGSSALGPCSSSNGAPGRGGSPGYLQLTDNRTY
                     RSGGIVYNRPLPAASGVVAEFTSYQYGGSGADGISFFLTDGAQQLTRTGAVGAALGYA
                     ALKGVDGVPGGYVGIGFDAFGNFHTAGDGLGSGCPARSDTSRVGNAVGLRGPGDGSSG
                     YCYLAGSLNAAGSAGALPGQLRAGSLASAARKTRITVGPGALPTITVEIDFNDGKGYR
                     QVLSHTMTTPAPATYKFGFASSTGLLSDVHLIRSMTVGTVVPLAQLNLVKQIDRGTAQ
                     PDSYKTGQSVPYQFVVTNSGTEPVHGLRVDDPGAGPVDCPETDLSAAGSPGATVTCTG
                     THTVTAADLGGGGTFTNTATATALDASEKPVASNPSSVTVKVEGVAQLRLTKTSDARE
                     PVKPGDRITWTVTAANPAGTSAYTGAKFTDDLSGVLGNADYGNDAAASSGVAAVSGTT
                     LTWTGNVAVGQTVTVTYSTTVKPYGSGNGTMANTVVGPADSKPTGSTGCSPRSAAGDD
                     GRGGPSSGPPRPVRYRRAPDRRRHRTNAPPDRTSTAAAAPSPASRPPAEPVAASSGPC
                     PDPPVPTDGSGRPGDEEDGDAGEADGVGDPVGLALGLGLALGLALTLGLGLGLGLDAT
                     ALPVTWADTW"
     CDS             58777..59241
                     /codon_start=1
                     /locus_tag="KSE_00480t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25899.1"
                     /transl_table=11
                     /translation="MYDRIRPAYPAAALRWALDGGSPDAVRGAAGVDVAAESLADAVP
                     AHGVLLGGPPEPGHDALPGADTARWILPDGRYLRLLAPDGGEGPVARHLRRRGRGLYA
                     VAFEVDDLEGACRRLARADVGTRPLTVEEVLVEPPGPLAARITLRSAATPTG"
     CDS             complement(59265..60311)
                     /codon_start=1
                     /locus_tag="KSE_00490t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25900.1"
                     /transl_table=11
                     /translation="MHRTRLTEFFPLHHQVGPEPTVPRGFVHPERGRVACPAAPLVEA
                     HLRAEGLLTGAGGPAPELLPVPAQRVRDGGVLACTTYIDLDGSVTGIAVTAPRALETA
                     ARDAVQRWAAVLRTRRIVIALGEPCRQAARSAPGHAGCPKAAATRELVRQYRERGDTV
                     LVLGAAGECDSASAHALPDVAAALRFEPDDDTRLSFVLAPCSPVEAAMPVLRVLRARF
                     PALRGQHPDQWCYAASDARLGARMVTETSDLVLDLGASAAPTDGADAPSRRTVRRVRT
                     LADLRPEELAAAATVGVLPQLSGRERPDDSPTVTDVIEVLSGLGPLSVVHHRASTDVS
                     TNVYERSALAHSAR"
     CDS             60649..61206
                     /codon_start=1
                     /locus_tag="KSE_00500t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25901.1"
                     /transl_table=11
                     /translation="MARAAALAAAAAALLVPLPTRAKATSAVPGAQASARLIRLNSSA
                     VPAIGLAAFSGTYGTASGPGHGADDQGDFSDPDGVLAHVAVGSGTARTSVSASRDSAQ
                     AQLTGLEVRFNSRSLVRVEAGAVGSLDAYASSASPHRSDRGRSPTTARTPRGSPSWAG
                     GSPPGPPGSPSPARTSASPASAPAP"
     CDS             61209..61994
                     /codon_start=1
                     /locus_tag="KSE_00505t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25902.1"
                     /transl_table=11
                     /translation="MTVSPHQEPATQSRQYTASAWLDIEVSGTLDDTDGNRVHQGPII
                     ALRLGEVQVDCRAASPSPSPSPTPSPTPTPMPERSSTPSPSTAASTVPTPTPSAAPSA
                     SPTPTSGPEPSGSASAVPTVGASAAPSPSPSPGASAPPTVPAPSPTPTPTSVALSPPP
                     PSASPGPSGARPSRAASPPPASDDPLPPSATGGSSTAPAVTVAPVTTPVPGRSGAPGG
                     DRLAETGAGGGHGLRARAAVAFVLVAAGAAGIGLSRRRGARHR"
     CDS             complement(62027..62410)
                     /codon_start=1
                     /locus_tag="KSE_00510t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25903.1"
                     /transl_table=11
                     /translation="MCAGPGCREPLIRAATGRPAVYCGQACRQAALRRRRLREAAPAL
                     RAEARDLLGALGAASGVPESTYEEHLGRLGAEDLDDLIRHARAARAGLDGVRGILGRG
                     RPPARPAPAASWSGLFKEPPATRNA"
     CDS             62909..63382
                     /codon_start=1
                     /locus_tag="KSE_00520t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25904.1"
                     /transl_table=11
                     /translation="MKCTRPLSRAATGRPSLYCSQACRQAALRERRSTEQAPALRAEA
                     AALLALLALLAPRAPVHHLDGLTGEQLAHLVRHVRAVLDLLTLTPHPGPAARHEPVQL
                     PPDRHGRAPWAVLDLGTGLWSTTDRKVDLFVTKDSALVFIRRRLKHPGQTRAFDD"
     CDS             63604..65091
                     /codon_start=1
                     /locus_tag="KSE_00530t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25905.1"
                     /transl_table=11
                     /translation="MTKRLLTAACAAVALAVTAQAAPSSAAAHRPPARAAAGNLGAEQ
                     LALWENLGEDVWQEALEEHCMLAGGPSCEMSGKDVDSVLPGIERLTKELGDNVTSKPD
                     LVRGVHRAGSGIRNTPRDLSRIAADIALSSSDPNVRRLAETTLPSPSGTKAGGRKVID
                     AIGDFAEKVGELNTGHDVLSQQGAAAVMSAVAGALPVLGDAWSIANAVNDRDVESGVT
                     ALISVAGAMVATVCAPAGVVIAVGLVVYTVAKKMWGWLCAKDRDWRLDPPGDPRDLVE
                     KGADFTWETHLGRRRTGPDAGKDVAYALQMTNFKDSGADYFWAHPKLMLNSRWTKGAE
                     RNTDPVTYVLTGIDLLGLTQVYTSTSEDLQGTLRIAQDGKIVHKRCYVEPTPNITGDT
                     LHCDLAASEQVTISADKPALVTLDIPYNIFNGNIKDPAPGSENPKDKWFCDLADGPCV
                     PEDSGKYRSVLKLEDRKARSTYLAKIPFGYGLVPDLPGAELRDIG"
     CDS             65273..65824
                     /codon_start=1
                     /locus_tag="KSE_00540t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25906.1"
                     /transl_table=11
                     /translation="MANQRLRALLREASWSGAEFALALNEAGARAGLALYYQRGSVSQ
                     WLAGTMPRPQVAGLVCAVLSLRLGRLVTLAQAGLAAPDGPAPPGGREEYARAAVAELA
                     ALTSGPLRTARSPSAGQAWFDVSADPLSVPRFGFREDGGRPVGQVRRRVEHAEALLSA
                     LSALDLSSGGGQVRHALGGGTCR"
     CDS             65878..66069
                     /codon_start=1
                     /locus_tag="KSE_00550t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25907.1"
                     /transl_table=11
                     /translation="MAVAARLTYLYAFINFDDDQHRAAQRFSLISLSLARGAGDATAS
                     ALALRSLSSAFILVGFDVP"
     CDS             complement(66041..67006)
                     /codon_start=1
                     /locus_tag="KSE_00560t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25908.1"
                     /transl_table=11
                     /translation="MTAPAGPGRAGALRCRAHAAPTREETATPSRPPPRTPPRTSRPR
                     TRPPKPPRASSSRPRPSRRSSRCGSTPAPGPDRRGPKGGRPRRHGGVLTFARPDTWHT
                     PDTATATDTARYGTAQATAWDRTHPRLTHRGPWLDHAEEEPPIPHGTLIRLEVECLPG
                     DRDLKPVRLWCSATTATGTDVDLWWQSFLRRFDLEHTFRLMKQTLGWTAPKIRHADTA
                     DLWTWLIIAAHTQIRLARPLAEDVRRPWERPATEPRRLTPARVRRGFRNIRATAARPA
                     AAPKPSRPGPGRPPGSKNKQRAPRHNVGKTAKRADSIKEHQSRRG"
     CDS             complement(67003..68334)
                     /codon_start=1
                     /locus_tag="KSE_00570t"
                     /product="putative cytochrome P450"
                     /protein_id="BAJ25909.1"
                     /transl_table=11
                     /translation="MPAPAPCPPAPGQVPLLGHAPALLRRPLSFFEATRTAEPLVRVG
                     FGPIRLYLANDPALVHRIQVDTDSFERGRFFERLASNFGNPLIASDGAEHQHQRRALK
                     PAFSRRSVRDHTSAITEETERRIGAWRPGTVVAADEEMSDLVAAVVLRSLFSTRLSPT
                     TVRDIRETLFLIARRLLVRTVFPDIVSSLPTPGNRRFAASVGRFHTTVDELIRERRAN
                     PRPHHDILQTLLTTRHPATGAPLSDTEIRSEFLMLLFAALETTSTSLSWAVFEVARRP
                     DVQHRLQNEADTVTAGGPLGYDRLKNLTYTRQVIDETLRLHAPMLFTRRARHDVTLAG
                     ITVPAGSEVGYSPRAVHRDPGLYPHPAAFDPDRTAPDSATDRPQGAYFPFGTGPHRCI
                     GEHLALTTMTTALATLATKWNLRIAPGTRIRETNSSLPHLSSLPLLPTPRG"
     CDS             complement(68427..69281)
                     /codon_start=1
                     /EC_number="2.1.1.-"
                     /locus_tag="KSE_00580t"
                     /product="putative methyltransferase"
                     /protein_id="BAJ25910.1"
                     /transl_table=11
                     /translation="MLTEDHRAWGHTASTGLGFTHHAIVDTHFRACRDPYLDLLRQAG
                     LQPGWHVLDAGCGPGDFLPAIAGHIGPRGRITALDLAPENAALAAERVSAAPPGCPVD
                     VRQGSVTDLPHPDDTFDAVWCSNTVQYLDDTQLDRFLAEAIRVTRPGGLLAIKDLDAH
                     LITLRPGDPYLFQDFFRTAGRTPGYARQLLRSRELYRRMRRAGLTDVRQRTVLIEHHA
                     PLSPDALDFYTQACDRLARQAEQLGLSQEWQRLRHDKDSPQHPLNHPDGYISEGNVLA
                     LATVPPAP"
     CDS             complement(69275..70048)
                     /codon_start=1
                     /locus_tag="KSE_00590t"
                     /product="putative S33 family peptidase"
                     /protein_id="BAJ25911.1"
                     /transl_table=11
                     /translation="MTAPTRTPVVLLHALSLHASMWDHHTQALRARGHQVIAFDQRGF
                     GTTPLGTAQPSLDVVADDLARLLDDRGIDRAVLAGSSMGGYAAMAFLARHPGRTAALA
                     LLSARATADTPEARAQRLRFADLVEDAPTRATVIDQTTPLLVGATTRARHPEILARLL
                     ADARAADPKALAWAQRAIAARPDATATLRATDVPAVVIAGDQDALVGYEESRQTAEAL
                     PQGHLVSIPDAGHLQPLEAPAAVADALHGLLDRIGDTPC"
     CDS             complement(70045..70734)
                     /codon_start=1
                     /locus_tag="KSE_00600t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25912.1"
                     /transl_table=11
                     /translation="MPAMSAPATAATAALPEPAAATAAEPAAGTIRLGYHGSPEVAHR
                     VTALAGLPEATVTLHPYDITDPFRGLREGDLDLIIVKFSLREPDLAVSRVLTHDARAV
                     VVGARHPLAARTSVSVEELADHDAFHRPGDLPAYVWDEVVPPRTPAGRPIRRRHRVTD
                     IPRMMALVAEGAAVHLSLISLADVAPPTVRIVPVHDLPPAPVALAWHRATGLPPHAAR
                     YVTAAEQAASR"
     CDS             complement(70722..71510)
                     /codon_start=1
                     /locus_tag="KSE_00610t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25913.1"
                     /transl_table=11
                     /translation="MSPSPSPVLDPAQDRLRHAAAGRVRRARPDLAARYDLDTTEGLL
                     EAQQAVATRAGDGAGEEGTLAAVVVRHVDLAAWVRSTCEFALALDPALARPWRRSFTR
                     TVFLAGNPDNLRERFPFAHTGAGAAWTPPGPDKDTAALRRLLKTFDGPAGPPARPATD
                     ILIPAGPGPHGPGGRAARHRDLYLATAGCTLSEALVHLNHILVEAVLDGLIAPGERLT
                     LRQIPRLTGIEAPFAALRVVAEPHRRGRLKAAAALTEEIPPCPQ"
     CDS             complement(71507..72679)
                     /codon_start=1
                     /locus_tag="KSE_00620t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25914.1"
                     /transl_table=11
                     /translation="MSARPSVSARPPAPAHQDAAAPRTRRVLLAPITVTPSKPLTPSH
                     LKGLLWTDVMYRATQPLAHVTYRYSHTTYHPTEQTLGFWEYLDRTQGDTDYADLSEEQ
                     IGAHYVAFRAEPDRPPAHHLQPYQDAVEQGWVHPASARILSLWAGHYRGLGLHDPGLQ
                     AHQPPGLTLDEAFTTLRAHGMCLDQRPFGGPVHLDLTRHGLPLRQIVTRDGRPNYLAC
                     ALRELIPLAGDFDEIVLLYDPELDPDYQLLERVLTALGPTVRRIPVGRVPIDGRIRSA
                     RHGGDPGHHAAALLTAAHADHDADAVRLGMRLYFIAVLGPGQQQSFRPDLLRQCLGRA
                     QRLLAAAAPADPAHLAGLLGGHRRDHTYVDPYRLTSALLGKRRAAPARDLLTEVFV"
     CDS             complement(72676..74121)
                     /codon_start=1
                     /locus_tag="KSE_00630t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25915.1"
                     /transl_table=11
                     /translation="MPVAVIAGGSIAGLAAALALHGIGYRVHVLERGDEPPPRRAGEA
                     APDRPRPTAPQALHSHTLTSLGLRVLRERAPQVLAAARDAGAHLLDLTLAMPAGATDA
                     AREPGDDELAALGCRRPTLERALHDTVRTLPGVTLHHRATLAALELDPARRAVRAVRT
                     TAGERLPADIVVDATGRTAAHRAWLRDAGTPPPEDRAEPSGLRGHTRVYRLRSATAPG
                     PLNRGNAAGDIWDHYAGVLHPGDGDTFSIALATLPGDRGLSALRTAAGFTAAARATPG
                     LGPWLADGVSEPLSPVRAITAPPNTLRGAALAPRPPVTGLYPLGDAACTTNPLFGRGM
                     SLALEHAFRLADLLAAHPRPGEEAAHDAARLTTTLLLPWYEHSAAADRARIARWQAAV
                     DGAAPPPPPPADPADPPGPAALAAAAATDAVVWRALTRTLMTLATPAQALGDDKILAR
                     IRQAPPPPARPQAPPHAELVRLVTQAAGARP"
     CDS             complement(74123..74980)
                     /codon_start=1
                     /locus_tag="KSE_00640t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25916.1"
                     /transl_table=11
                     /translation="MTASLDAVERTALLTAALRAAETRRPDRLYEDPYADALAGDIGP
                     ELLAQVRAATFPADGERTLPSTPDYNAIRTRFFDDYLKEAAADPATTQIVLAPAGMDS
                     RAYRTDWPARVRWFEVDRPAVLAYKQQRLGAVQARTDHRKVAVDLTSPDWEQDLQNAG
                     YDPSAPSTWLLEGLLYYIPEADTHRILQRVAAISAPGSRIAADIVNADALTLAHMRGL
                     LDVFESWGCPWLFGTNEPEALFDQYGYTTRALQPGEDGADFGRWPDPVPPRSVQGVRR
                     VFFVHGRRR"
     CDS             complement(75148..76830)
                     /codon_start=1
                     /locus_tag="KSE_00650t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25917.1"
                     /transl_table=11
                     /translation="MNSAEAWTDPDRLRRYRERVFHERARLRAALADAPGRRRHVLAD
                     LLEFNAGTHYGREHGFAAIRTLDDFRKAVPVQDYTALGPWIERAAAGEHNVLTADQPA
                     VYFTSSGTTGAHKKIPVTPRFMHTTFFPFYYAAWAPLIEHFPDVLDRPDAVLNLKHDP
                     LTAPPTTASGRPHVGASQVDFGTRFGEPLSAEPGTGAPWAVLPAHVDAGAHLEKMYLR
                     LRLAVESDVRCVIGINPAMIAALPHQLNLWWPRILKDIADGTLGGLPHGAPNPRRAAE
                     LERIAARHHTVRPAHIWPRMRALFCWTTGLASLYLPRLREEFGPDVALLPAPVAASEG
                     PVGVALDRHPSAGSLVVTAAVHEFADAEDDLTPDTETLLPEELETGRDYHVVFSHVGG
                     LYRYAVGDVVRVVDRAGGAPRLEYTGRSTRSDAAGERLRDAQVTRALAVALGRTGLEL
                     RNVACRVRPSAPGAAPGYEFALSPRAPWNEDGSRRFLHLLDAQLGTESAGYRTARAGG
                     RLAPPTLLRLAPEAFAEDWQAAVASGIRPTQVKDRLFRQDDAQWARLTDGHH"
     CDS             complement(76817..77452)
                     /codon_start=1
                     /locus_tag="KSE_00660t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25918.1"
                     /transl_table=11
                     /translation="MPEHHPAFCVLLGPDYAGKSSALSLLRDTVPWRTLSVDDTHLAP
                     EHTLLTSLRRDLVREVAGRPGAWSPDFLATMLQTAAVHLRDRLCADPHTPAVVDSYYY
                     KLLAKGRLAGADDHAGFAWWRTFPQPRRVVYLDVRPATAWRRSHDGRDLNRLEYYGPQ
                     PTADGFTRYQGDLAKTMHDEIAHLPVTVIDGHGDPAQTAQAIRKVLAHELG"
     CDS             complement(77837..78754)
                     /codon_start=1
                     /locus_tag="KSE_00670t"
                     /product="putative DNA-binding protein"
                     /protein_id="BAJ25919.1"
                     /transl_table=11
                     /translation="MDTPSVLGDFLRSRRARLQPEDVGLRAYGARRRVPGLRREELAQ
                     LAGVSVTHYTRLEQGQSTNASDAVLDAIARALRLNTDETAHLRDLARPAAPARPAPLR
                     PDYARPAAAQLIAAMTDVPAVILDRRNDVLAWNPLGHALLAGHIDYTAPQSPSERPNL
                     TRMLFLDEHTRELHTAWEDEAKTSVAALRLTAGRHPDDRRLAELIGQLAMKSDEFAGM
                     WSRHPVRSCTFGTKLLHHPFVGALELSFESMQLADDSGQRMLAYSAPAGSPSQAGLQL
                     LAGTLLSHPPHGARPAARGHLAGEKPRDR"
     CDS             78929..80377
                     /codon_start=1
                     /locus_tag="KSE_00680t"
                     /product="putative drug resistance protein"
                     /protein_id="BAJ25920.1"
                     /transl_table=11
                     /translation="MSVVDEASVSGGVRGAGSPPARMTGRLRLLLVVLLVAQFMLAVD
                     FSILNVALPVIGKGLGFSLSNLQWIATSFALCAAGFTLFFGRVADLFGRRRLFLAGLA
                     LLGLSSLVGGLATSPGILIAARIAQGLATAAVTPAGLSLLTTSFPEGPLRDKALGLNG
                     ALMSAGFTTGAILGGVLTDLLSWRWSFFINVPVALAVLLIAPGVIKESRPDQRPRLDI
                     PGALTVTLGLLALVFGLTRAGENGWSDPTALISLAAGLLLLIAFYLVESKAPAPLVPV
                     TILKRPTVIWGNIAGLIAFLTETSLVFLMTLYLQEVLDFSPLAAGLSFGVLGIGTVIG
                     GSLAAKVIARIGTKATLITGGLLQAAATAALLTLGDTRTSMAVLLTATFLGGIGNMLV
                     IVGFMVTATSGLPDHEQGMATGLATMTQQIGITMGTPIMSAIATTQITTHATHTTVLD
                     GVTLAVLVNTALVLAGTLTTALFLHTRKTPTP"
     CDS             80623..81468
                     /codon_start=1
                     /locus_tag="KSE_00690t"
                     /product="putative esterase"
                     /protein_id="BAJ25921.1"
                     /transl_table=11
                     /translation="MTGSATGTPGQIVWKSALVPGGEHPVPVRILRPAAGHRGWLVWA
                     HGGSWRSGSAEGWHRACADLAVQAACTVVSVDYRLSPEHRHPAALQDVLAVLDWAQER
                     AEEEGLPPVAVGGDSAGGTLAALAALVRRDRGQPLSAQVLAYPPLDPECRAPSYTRYL
                     DNFPTRESLVSAWEDFRGSDGGRGYPSTPFEVEDLGALAPAILSVGALDPVADDVRDF
                     ARRLRAAGNEVVFQEFPQMLHAAFLLPQGQLRQWLGAALRLRLLASGPSRSGSGSSSS
                     SSSAS"
     CDS             81477..82076
                     /codon_start=1
                     /locus_tag="KSE_00700t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25922.1"
                     /transl_table=11
                     /translation="MPPYRRPSQKEKPVNSVPESATGTVPASAGTAALPHVTALLRHF
                     GDLRDGSHGEATSRRGKEDLFLSAVALLAPYALEALEEVNAHLLNGTGKVEGTGVRRT
                     ADGGVAALWTLSWPEQRSEGIEPITLAAHYGRNFHHPHLRGATVGEWPLNVFTPAQAK
                     AELPTLRAIITADLHNLVFQRDFRIVPATMAAVGSDHTN"
     CDS             82087..83061
                     /codon_start=1
                     /locus_tag="KSE_00710t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25923.1"
                     /transl_table=11
                     /translation="MSIRLSVLDQTPVGEDFSPAEALRASVDLAEAADRLGFTRYWVA
                     EHHNSPGFAGTAPEILAGALLARTRHLRVGTGGVLLPRYEPLKVAEVFTVLASVYPGR
                     VDLGIGRAGGPAHRFPQQLDELRRLLGMSAPGSGAEDARRAGPQMWLLGAGGSSAALA
                     GRLGTSFAFAHFLAPAPGRAALEDYRREYAASGARPPAEGVLAVRVVTADTDAKAQEL
                     AQGLLLWRSRKDLGQDLPLPSPATARRHRWTGAEAERAAVNRRALVAGTPERVREVLT
                     GLAAEHGVGEIVVNTLTHDPEDRLRSLQLLAQAFGLTERGGALATAVV"
     CDS             complement(83156..83941)
                     /codon_start=1
                     /locus_tag="KSE_00720t"
                     /product="putative hydrolase"
                     /protein_id="BAJ25924.1"
                     /transl_table=11
                     /translation="MPTVHAAGTDVHYRTEGTGPGLLLVHGSTADSETNFADLRPRFT
                     ARHTVITPDYAGSGLTALPEGPLTLDHLVAQVTAAARAAGADRSAPVDVVGLSLGAVV
                     AAALAARHPHLVRRLVLVGGWARNDDPRQEALLGLWRRLADLDTEAYQQFITLLAVSP
                     AGLAGLDRAALAKAASTAVPSEGARRQIDLDLTVDIRDLLPAIHTPTLVVGATQDQVI
                     PVGHSRELHRAIRGSRYAEIDSGHNIPYERPAELTALITDFLR"
     CDS             complement(84034..85293)
                     /codon_start=1
                     /EC_number="2.3.1.-"
                     /locus_tag="KSE_00730t"
                     /product="putative acyltransferase"
                     /protein_id="BAJ25925.1"
                     /transl_table=11
                     /translation="MSSTPPATPRAAAGAKPAALAKLPSLTGLRFFAALAVFFFHSTL
                     SNSPIPPNAPINPFADKGLAGFLETAFSKSGYLGVSFFFVLSGFVLAWASRPGERVTA
                     FWRRRMLKIFPNHLVVFAASIVLFAGAAVTGTAQWLPNMLLVHTFFPQPDINLSVNPP
                     SWSLGSELLFYVLFPLLIIPIRKIAGKALWAWSAVMVAGTVAVQLVSTYLVPATPKSA
                     ITPVSDLQFWFGYLFPPGRVFEFALGILLARIVMSGKWPRQIGIGVSFALTAVGYGVA
                     LLVPFQYSFVVAMIIPVSALICSVAAADVDGRRTRLRGPVMQLLGEISFGFYLVQGVT
                     IFYLRSLLGAHTYSAPVALLVVIGFLAASLLGGWLLFRFVEMPAMRRWSRSRRPATAT
                     LPAALPAQDTDQDTDRSARPVTAASRT"
     CDS             complement(85399..86652)
                     /codon_start=1
                     /locus_tag="KSE_00740t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25926.1"
                     /transl_table=11
                     /translation="MTANDASHLRAPRFAAEIVADQLRDGYWLEAPDIDNDNKPDLFG
                     YGLRLGEIYWYQNGEKWTRRLVADKIKMPVGADFADISGNGHPDIIVCYDLYGPIGTI
                     QDANTAGGKIDWLENPGSPDKDESRWKRHYVGRATGMHRLRVGHFTQTERLEIIGLPI
                     VAKEDVHAVLPVVLFTQPDDVQSAEEWPMTVIDDSHFRMIHGAEKKPGLIPGSDRDSL
                     LLASDEGVTWLYWDDSAKEWVRKLIGTGELTQFEQTGFRGSGDLNAGRIGDDPMAYVA
                     AIEPFHGNTVAVYTKTTDGPAGEAEWKRTLLDVYGDPNENGEGPGHQIVCADFDGDGE
                     DEFLVALRGPWPWQGVMYYKAIDLENGVWAKWRVSDESVARIATADFNGDGRLDFATI
                     AYSVQHYYVAKDAKLMLYRNEIEQQ"
     CDS             complement(86663..87415)
                     /codon_start=1
                     /locus_tag="KSE_00750t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25927.1"
                     /transl_table=11
                     /translation="MPRNAETPLNFSGPRVQALLVQDVKDYHVSGPAVVVNTGTSDVH
                     LARTPRKAIPPLSSTILTGVRIEEAASLLILRVKDDTDIAGIAREPGWDLLGDLLGDS
                     TTPTEDATLPFPRDTPLWKSPQDHAGLIELDPAHLLAERAEPRRLQPFEIRANLWFAP
                     AGTDCFIHNQHDFIEVHTQLHGLGRMQKFTEQDHSTLYEDLPMSPGYTTSQPFCSTGP
                     DGTYLYPWHQYRADTDCVWLAVEYHPMPHRHP"
     CDS             complement(87415..88611)
                     /codon_start=1
                     /EC_number="5.1.3.14"
                     /gene="mnaA1"
                     /locus_tag="KSE_00760t"
                     /product="putative UDP-N-acetylglucosamine 2-epimerase"
                     /protein_id="BAJ25928.1"
                     /transl_table=11
                     /translation="MRSVAVVLGTRPEAIKFAPVIRALQADPRFDPVVISTGQHRQML
                     DDTLEAFGLKPDIDLEIMAPKQTLSQVTYRCLRGLGEQFGKLSTEAVLVHGDTATTLA
                     AALSGFHHQIPVIHVEAGLRSGFLGSPFPEEGNRRLVAQIAALHLAPTPGNHANLLRE
                     GIAEETIVVTGNTVIDALQWASGRSDSYGDPALADLDTDPRRVILASAHRREAWPHLP
                     QIAQALVDIADEPDVRVIVPLHRNPVVREAMLPRIGGHPNITVVDPLPYLSFSKLMRR
                     ADIIVSDSSGSQEEGPALGKPTLVLGSVTERSEAVVAGTARLVGTTTEGIVAATTELL
                     RNPAEYLRMATAANPYGDGCATERTVGAIAHFFGDGPAVDPFVPGVEVDEFAVELARR
                     APFARA"
     CDS             complement(89514..90887)
                     /codon_start=1
                     /locus_tag="KSE_00780t"
                     /product="putative phosphohexose mutase family protein"
                     /protein_id="BAJ25929.1"
                     /transl_table=11
                     /translation="MPLSRPHSLDLSPLVNTHDLRGTVPDQWDERIAELFGAAFARVT
                     KAQALVVGHDTRSCAPDLALAFAQGAALYGTAVTDIGPCTSDQLYFASGELALPGAMF
                     TAPHGPAGYHGLTLCRAGAAPLGQDAALAEIRALVERWAVHGAPPSFVPVGTIRRRDV
                     LGDYGARLRALAGLRGIRPLTVVVDAGDGPGRHSAPAVLAALPLRVVPLPAGPDTAPA
                     HARADPLAPAATAALRARVVAEGADLGLALDGGRCAVVDERGESVPAPALAALLTARE
                     MDRHPGATVVHDLATSRSVPEAAAEYGGKAVRTRVGHTFVREEMAATGAVLGTGRAGH
                     YYFRDFWNADSGLLAALHLLAALDDRSGPLSALVAPWDRYRSCDETDIATDDPQGRTA
                     ALRAAYARHEDVMLDDLDGLTVTAHDWWFNLRPSTTRPLLRLNVEARDAATLGSVREE
                     VLRRLRA"
     CDS             complement(91029..92651)
                     /codon_start=1
                     /locus_tag="KSE_00790t"
                     /product="putative oxidoreductase"
                     /protein_id="BAJ25930.1"
                     /transl_table=11
                     /translation="MAGAAVAAAALGGSAAAAPAGAAPGAATGPTIRPDDPRYPLLTS
                     GNNQRFVARPDYVKMIRSSADAERALESAFRAGKRVSVRSGGHCFADFTANPGVEVIL
                     DFSEMTEVGYDPGHRAFVVEPGARLINVYEALYKGWGVTIPGGICYSVGAGGHIAGGG
                     YGLLSRAHGLVSDHLYGVEVVVVDGRGKARTVLATREENDPNRELWWAHTGGGGGNFG
                     LVTRYLFRSPGATGSNPADQLVSPPSTVLVSAIELPWDQLTEAKFTRLLKNFGAWHEA
                     NSAPDSEYRHLSSLFNVSSRAHGSLGMFTQVDATVPGARRLLDDYLTAVLAGTGVTPR
                     ALARANGELPAMPELLAPRELPWLQATRQVGTNNPTITNPTSRGAHKSGYMRRNFTDH
                     QVAAVYRHMTRPDFNNPDTMLVLFSFGGQVNAVAPDATANAQRSSIFKMCFQTFWADA
                     SEDDFYLGWARGIYEDFFAKTGGVPLIDDATDGCYINYPDRDVSDPRHNTSGVPWQTL
                     YYKGNYPRLQQVKKRWDPTNFFRHSLSVELPR"
     CDS             complement(92775..94001)
                     /codon_start=1
                     /locus_tag="KSE_00800t"
                     /note="Similar to Protein AraJ in Escherichia coli
                     (strain K12) (P23910)."
                     /product="putative major facilitator superfamily
                     transporter"
                     /protein_id="BAJ25931.1"
                     /transl_table=11
                     /translation="MPLALIALALGAFGIGTTEFVIVGLLPQIAGDFSVSIPSAGMLV
                     TGYALGVVVGAPLMTAAGSRLPRKTMLAVLMALFIAGNLLCAFAGSYTQLMTGRLVAA
                     LTHGAFFGIGSVVAAGLVAPARRASAIALMFTGLTVANVLGVPLGTFLGQHFGWRSTF
                     WAVTAFGVVGLCGITALVPRQERERGAGLRGELAVFRRPQVWLALLTTTLGFAGVFAS
                     FTYVAPMMTEVAGFPPGAVTWLLVLFGAGLCVGNVLGGRAADRSLMPSLYVILAALAG
                     VLLLFVATARTPVSAAITLAALGAVGFATVPPLQMRVMQKAEGAPALASAANIAAFNL
                     GNAVGAWLGGLTISHGLGYTAPNWVGALLAVAGLAVAALAGLLDRRTAADGPPPPHDP
                     PPHDLPASEQTSPAAA"
     CDS             complement(94001..94678)
                     /codon_start=1
                     /locus_tag="KSE_00810t"
                     /product="putative RNA polymerase ECF subfamily sigma
                     factor"
                     /protein_id="BAJ25932.1"
                     /transl_table=11
                     /translation="MGRRRRSTAPDLTRAARAAALAGTVEGRLMTDTITAAPQTRAQR
                     SERFERDALGHRDRLHAQALRLTRNPADAEDLVQETYTRAYRGYHGFRPGTNAGAWLS
                     RILLNTYLDAYRKKQAAPQLSGAPYTEDRGPARPGPVPSAESQVLDRLPGPAVTRAML
                     GIPGIFRTVVYLADMEGLSHEEIAALVGVPYATVNTRLHRGRRRLRALLEDHRDAGAR
                     AHREEVR"
     CDS             complement(94642..95439)
                     /codon_start=1
                     /locus_tag="KSE_00820t"
                     /product="putative oxidoreductase"
                     /protein_id="BAJ25933.1"
                     /transl_table=11
                     /translation="MDLQLADKVFLVTGASAGIGRATVRVLAAEGATVVGVSRKPAAG
                     PADPAGPGARVSTVAADVTAPNAARRVVDTVLERHGRLDGLVNNVGALHSRTGFLDVS
                     DEQWQATFDTNFHSAVRMTRAALPALLERGAGSLVHLASEAARFPDHPLVDYAASKTA
                     LLSLSKSLTAEFARRGVRSNVVSPGPTRTALFDAPGGFADQLAERFALPADEAVEHFV
                     REVRALPTGRIGTPDDVARVIAYLLSPLAAQVTGAEWAVDGGALRQI"
     CDS             complement(95532..96980)
                     /codon_start=1
                     /locus_tag="KSE_00830t"
                     /product="putative drug resistance protein"
                     /protein_id="BAJ25934.1"
                     /transl_table=11
                     /translation="MSVVDEASVSGGVRGAGSPPARMTGRLRLLLVVLLVAQFMLAVD
                     FSILNVALPVIGKGLGFSLSNLQWIATSFALCAAGFTLFFGRVADLFGRRRLFLAGLA
                     LLGLSSLVGGLATSPGILIAARIAQGLATAAVTPAGLSLLTTSFPEGPLRDKALGLNG
                     ALMSAGFTTGAILGGVLTDLLSWRWSFFINVPVALAVLLIAPGVIKESRPDQRPRLDI
                     PGALTVTLGLLALVFGLTRAGENGWSDPTALISLAAGLLLLIAFYLVESKAPAPLVPV
                     TILKRPTVIWGNIAGLIAFLTETSLVFLMTLYLQEVLDFSPLAAGLSFGVLGIGTVIG
                     GSLAAKVIARIGTKATLITGGLLQAAATAALLTLGDTRTSMAVLLTATFLGGIGNMLV
                     IVGFMVTATSGLPDHEQGMATGLATMTQQIGITMGTPIMSAIATTQITTHATHTTVLD
                     GVTLAVLVNTALVLAGTLTTALFLHTRKTPTP"
     CDS             complement(97070..98086)
                     /codon_start=1
                     /locus_tag="KSE_00840t"
                     /product="putative regulatory protein"
                     /protein_id="BAJ25935.1"
                     /transl_table=11
                     /translation="MDTVQADTLPASGGDAGRPPEAEDQGVQRVPIGMLLPADSPRMS
                     GENLDHARALGALDGNLPPILVHRATMRVIDGMHRLRAAILQERALVEVLFFDGTPED
                     AFVVAVRSNCRHGLPLTLAERAAAAARIMISHPQWSDRAIASVAGLSSKTVAALRRRA
                     GAGNLAPRARVGQDGRVRPLDSTAGRLAASRLIAATPQASLREIARQAGISPGTVRDV
                     RARLERGEDPLPRARGRRGAGARASRARPREDAGKAPGPAAGPPADLGRVLTSLRNDP
                     SLRQTETGRLLLRMLETHLPHQWDRLAESVPAHRTETVALAALECAKAWQEFAARMRR
                     APSP"
     CDS             complement(98282..99196)
                     /codon_start=1
                     /EC_number="2.7.7.9"
                     /gene="galU2"
                     /gene_synonym="gtaB"
                     /locus_tag="KSE_00850t"
                     /note="protein synonym:UDP-glucose pyrophosphorylase"
                     /product="putative UTP--glucose-1-phosphate
                     uridylyltransferase"
                     /protein_id="BAJ25936.1"
                     /transl_table=11
                     /translation="MTSTSARIVKAVVPVAGLGTRFLPATKATPKEMLPVVDKPAIQY
                     VVEEAVASGISDVLMVTGRNKRPLEDHFDRNYELEAELLRKGDTDRLARVCAPTELAD
                     IHYVRQGDPRGLGHAVLCAAPHVGSEPFAVLLGDDLIDPRDPLLSRMIEVREQHGGSV
                     VALMEVDPSQIHLYGCAVVRHDRDGDTVQVTDLVEKPAPGTAPSNYAVIGRYVLDPAV
                     FEVLRRTEPGRGGEIQLTDALRELAHTNEGGPVHGVVFSGRRYDTGDRSDYLKATVRI
                     AWEREDLGPEFRTWLREFMAADVLAPAH"
     CDS             99365..99847
                     /codon_start=1
                     /locus_tag="KSE_00860t"
                     /product="putative MarR family transcriptional regulator"
                     /protein_id="BAJ25937.1"
                     /transl_table=11
                     /translation="MASGAVDRSGYAVAPGAAAELAALAARLCAVMDATTSERIAEHG
                     LTRADFDVLAALRGAGPGHRLRPMDLSALCRLSSGGTSNVLRRMTESGYVVREADLRD
                     GRSSWAQLTVEGLRVVGAVQEGVDAVHARVLRRLPPGVVDALSALLAQAVDALESPQW
                     "
     CDS             complement(99914..100537)
                     /codon_start=1
                     /locus_tag="KSE_00870t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25938.1"
                     /transl_table=11
                     /translation="MELTATKPIIDIWFDYICPFSVMTRKVIDDVTARTPADVRWHPY
                     ELHENGVPPTGKTDYPEHVWENSVLPMAERLGIRFGPVPAIALPRTALAMHGHRYARE
                     HGLQEAWDTRVFDAHFHHGRDISDPAELTATAAGLGLDPEEFRARILSPQAALDHHDS
                     QQHTRRALRVHTVPTIAIGPWRTEGVPQAGRLLDVIAALSTRRPTRA"
     CDS             complement(100528..101961)
                     /codon_start=1
                     /locus_tag="KSE_00880t"
                     /product="putative maltokinase"
                     /protein_id="BAJ25939.1"
                     /transl_table=11
                     /translation="MSGQPLPFERAATERALTAWLPSQRWYAGRTRPLDHVSVIAAHP
                     FGGPPGPRRGPARGLLLVARAHFADAGAPEHYQVPIGIRPALPGPRPQDPPPIAVIGD
                     TVVHDALADHALVRDLLAPPAPDGAPTPLALRAENTTPGHRPPAGPPATSRLLTAEQS
                     NTSVVIDDRYLLKCFRRLHTGPNPEVELRRALAGHPGPPLTPPLHAVLHGHLGEAPVT
                     YAVLQSYLPDAVDGWTAALHHLRTRPGQSFARDAHAMGTATGAVHTRLAAAFGTRRPT
                     PGEAARLTARLLTALEDALRAVPELARHETALRHAYAQAADPTPATTLQRVHGDLHLG
                     QLVRCGRTWQLIDFEGEPSAPMAERTAPRPPLADIAGMLRSFDYAAHHAAWQPGPADP
                     RDLRRWARDSQHAFCDGYALATGHDPRDTPAPLRAHILAKAVYESAYEARNRPHWLHI
                     PLEDVERLLDPAAWPPHRPPGDDTPWN"
     CDS             complement(101958..103745)
                     /codon_start=1
                     /EC_number="5.4.99.-"
                     /gene="treS1"
                     /locus_tag="KSE_00890t"
                     /note="protein synonym:maltose
                     alpha-D-glucosyltransferase"
                     /product="putative trehalose synthase"
                     /protein_id="BAJ25940.1"
                     /transl_table=11
                     /translation="MSTDRTPSAAPVRRPAPVRRPAPVRRPADARRAAPPGGLGAAPD
                     WFKTAVFYEVLVRSFQDSDGDGVGDLRGLTARLDYLQWLGVDCLWLPPFFASPLRDGG
                     YDVSDYKSVLPESGTLEDFTALVTAAHQRGMRVITDMVMNHTSDQHPWFQASRQDPDG
                     PYGDFYTWADDDSRYPDARIIFVDTETSNWTYDPVRKQYFWHRFFSHQPDLNYDNPAV
                     REAMLDVLRFWLDLGIDGFRLDAVPYLYTREGTNCENLPETHDLLKEVRALVDREYPG
                     RVLLAEANQWPEDVADYFGDHERGGDECHMAFHFPLMPRIFMAVRKESRYPVSEILAA
                     TPKIPAGCQWAIFLRNHDELTLEMVTDEERDYMYAQYAQEPRMRANVGIRRRLAPLLG
                     NDHRQIELLTALLLSLPGSPVLYYGDEIGMGDNIWLGDRDAVRTPMQWTPDRNAGFSR
                     ADPGRLGLPPVMDPVYGYQAINVESQRDNNASLLHRTRRLLAARRRHPAFGLGEFEEI
                     PSSNPAVLAYLRRHTRDDATTSTVLCVNNLSSRPQPVELELRAHRGIVPVEVTGGAAF
                     PAIGGRPYQLSLPGHGFYWFCVCPQEEPR"
     CDS             complement(103851..105023)
                     /codon_start=1
                     /EC_number="2.3.1.-"
                     /locus_tag="KSE_00900t"
                     /note="Similar to Acyltransferase MdmB in Streptomyces
                     mycarofaciens (Q00718)."
                     /note="Similar to Macrolide antibiotics
                     3-O-acyltransferase in Streptomyces thermotolerans
                     (Q56074)."
                     /product="putative acyltransferase"
                     /protein_id="BAJ25941.1"
                     /transl_table=11
                     /translation="MAPAAAPPERLPSLTGTRFLAALLVLAFHASSEGLFADRGTAGV
                     LAALLGKAGWAGVSFFFVLSGFVLAWSAGPHGARPGFRRRRIARIHPAHLVTTLTAMA
                     LLVAGGTGLTWAEVVPNLLLAQAWFPQPEIFVSGNPVSWSLSCELLFYLSFPPMWRAL
                     CRIRAGRLWWWAGALAAAVVCVPPLAGHLLPGGPVLTMPDGTVTLHQYWFVYVLPPVR
                     ALEFVLGAVMARVVREGKWIGLRPLPATALAAAGYAAATRVPYLYGLAAATVVPIALL
                     VAALAHADRTGRRGWLAARPVVRLGELSFALYLVHRLVLGYGHRALGADRGWSTPVAA
                     LLVLAALAVSLALAWLLHTLVEIPALRRWARPRPRPAPPRPHPAAPPGPAGHASPN"
     CDS             105299..106126
                     /codon_start=1
                     /locus_tag="KSE_00910t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25942.1"
                     /transl_table=11
                     /translation="MSKRVLVVLSEFGYWGEELVGPLDVFDARGYRTAFITPTGKRPQ
                     ALPPSLDSEYIDPPLGRAVTTRDMARRARAMDDSSRLDNPLSLAEMLPERPYYSALNH
                     LRDLEEYNRRLGAATGELLASFDAMVVVGGSGPIVDLANNERLHELILAFVAAGKPIL
                     AECYGVAALAFARDAESRASLLRGKHVTGHPKEYDYKDGTGFVGVEFNMGPPPYPLEY
                     ILRDATGPDGAFHGNVGKETSVVVDFPFVTARSTPDSVLAGELLAEVLENGLRRFGW"
     CDS             106174..107871
                     /codon_start=1
                     /locus_tag="KSE_00920t"
                     /product="putative decarboxylase"
                     /protein_id="BAJ25943.1"
                     /transl_table=11
                     /translation="MPARPGKAALFEQFAADGITHMFGNPGTVEQGFLDLAGAGATRY
                     VLALHESVAVAMADGYARAAQRPSVVQLHSGVGLGNAAGMLYQAKRGGSPLVALVGEA
                     GVRYDAMDAQMAADLVAMAAPVTKYATRVLDPSSVLRVLRRAVKIAMTPPRGPVLVVL
                     PADVLDQDTAESAVATLVPSLRAVPEPAAVAEAARLLTSGTAPLVLMGDGIAASGAQR
                     QLTAVAERLGAPVWGVNSSEVNFDTTHPLFAGNLGHMSGADSARVVGGADTVLIAGTY
                     VFPEVFPSLANPFAPGARIVHIDADAYEIAKNFPVDLGLAGDPALALGALGAELASRG
                     GAAPARPAAPRRPHGPHGPHGPHGRDGQQGRDGRDGQHGQHGRDGRQGREGLMEAFAR
                     ELAARAPANLAVFDEALTASPALTRHLPPRVPGTYFQTRGGSLGVGIPGAIGVKLARP
                     DLQVVGFTGDGASMYTVQALWTAARYGVSAGFVVCNNRRYRLLDLNIERYWQEQGIAP
                     HAYPDAFDLSRPEIRFADLARSLGVAGQRVDAPEQVGPAVHAMLTHDGPYLVDLVTG"
     CDS             107976..108425
                     /codon_start=1
                     /locus_tag="KSE_00930t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25944.1"
                     /transl_table=11
                     /translation="MPTPQIQQQLSEAAVRRLVEDWYRALDRHDPVEDVLPHLAADGL
                     VMRFPEGTAHGHEGFRSWYDAVTHRFFDEAHTVLTVDVEEIRAASAEVRVLVNWQTRT
                     WKAPDATSTWLGFDAHQSWSVVLEDGTPRIRAYTVDSLTPMPGSAGL"
     CDS             108553..109164
                     /codon_start=1
                     /locus_tag="KSE_00940t"
                     /product="putative peptidase C56 family protein"
                     /protein_id="BAJ25945.1"
                     /transl_table=11
                     /translation="MRTVKPLPTGRLAGKRIGVLMESDFVEDEIAYYRRRFAEEGAEV
                     RLLTRLWGQPSLTFTGHEHHAPLDVDGDLEGADYHELLQYSALIVPAGSVADRLRFSE
                     DVEQTPPALELLRRAFRIPSLVKAFSCHGLQLLAAAPELIRDRPVTCHNNLAADVRNM
                     GGVYLNQDLVVDRDLVTSRTADHCHLLARTVIERLSVPARSTE"
     CDS             109161..110984
                     /codon_start=1
                     /locus_tag="KSE_00950t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25946.1"
                     /transl_table=11
                     /translation="MNTALPFSFSDLTAGYVTGHQGSRFTLRTLDGRDVTLHLTETTT
                     AQRLRNLGEPYHDVSARIGEHLSPGALVFAHGPVYPDGADLYFQADRLVFAGDAATAH
                     PYQEPGWWTRQLDQLAKFYRRSQFGDGPADFAHYRTQVRGCGHRTAHHVQESDTISRL
                     VYGMATAYMLTGNEEYLEVAERGSQYLHDHLRFHDEAEDTVYWYHGVDVEGGGERKLF
                     ASEFGDDYRAIPAYEQIYALVGLAQTYRVTGSPVIKADIEGTVRLFDKYFHDPRLGGY
                     YSHIDPVTLSPHHDGLGPNRSRKNWNSVGDHAPAYLINLYLATGEDRYRRMLEHTCDM
                     IAVHLPDRGPDPSPFVNERFHGDWTPDHTWGWQQNRAVVGHNLKIAWNLTRTGAALPK
                     REYRRLAEQLAHTMPAVGRDGQRGGWYDLLQREADNGRHAFVWHNRKTWWQQEQAILA
                     YLVLAGHTREDHYLHHAHEAAAFYNAFFLDHDEGGVHFTVLADGMPFLMGDERLKGNH
                     AMAMYHKAELCYLAEVYTRLLVRGESLDLWFRPRGDADYPGALLRVAPDLLPPGRVEL
                     QHVLIDGAPWSDFDAEAMTVRLPAHDRAMTVRVRLRPTERP"
     CDS             110981..113104
                     /codon_start=1
                     /locus_tag="KSE_00960t"
                     /product="putative glycogen debranching enzyme"
                     /protein_id="BAJ25947.1"
                     /transl_table=11
                     /translation="MNAPPTRTTPPPRPAPPAPPAPAVLPGDPLRPGASPTAAGVTFT
                     VNSPTAHAMWLVLLDAAHGGILREIRFPEEYRTGDVFTMTVPGLDPRAVHYAFRAQHS
                     PGTPPGPLLLDPYAKALAGGEHWGQRPAYRSKIVHDDFDWQDVPHPRIAPQDLVVYEL
                     HVRGFTRHPSAAVRHPGTFAGLREKIPYLRALGVNCVELMPVLEFDETDNPFTDPATG
                     APLPDYWGYNPVAFFAPKAAYAADPWGPGPVRELKELVRELHRAGIEVILDVVLNHTA
                     EGDHRGPTLSLRALHDTAYYLHDHDGSYLNLTRTGNTVNANHPVTRALLLDCLRHWAS
                     EFRVDGFRFDMAPILTRGQDGRPLDNPPLLEAISHDPVLAHCKLIAEPFDASGLDLVG
                     RFPSHGRWMEWNSRFQYAVRRFLTGTGDGGEELAHRMAGSPDLYGRRGHRASVNLLTS
                     HDGFTLADWTSYDHPHNEANGERGEDGPRDNASWNAGCEGPSEDPAVLRLRSQQIRNA
                     LLLLLTAPGVPMLTAGDEFGRTQHGNNNAYSQDNATGWLDWTLADTNAHQLAFVRACL
                     ALRAAHPVLRRPARAPGDTPPGWPYPALSRHGELPWRGEDPAAEGLLALLAHHQDDDA
                     TTTADTVFLAANTRGHTRAVHPPPPPAGTRWHLFADTSAPPGQDINPPGAPPGPALAG
                     PLTLAGHSVTVLVAHPAETGDERDL"
     CDS             113094..113435
                     /codon_start=1
                     /locus_tag="KSE_00970t"
                     /product="putative antagonist protein"
                     /protein_id="BAJ25948.1"
                     /transl_table=11
                     /translation="MTFEAYYGITGSTATIHLTGELPERRVPALRGLVEQALQRPLNR
                     LVLRVHGLRSICAGGVRCLAHTQQLLPRGAQITVDGAGTAVRRALTAAGLDTAMTLTD
                     DPTHTTGPAGA"
     CDS             113585..116080
                     /codon_start=1
                     /EC_number="2.7.7.13"
                     /locus_tag="KSE_00980t"
                     /product="putative mannose-1-phosphate guanyltransferase"
                     /protein_id="BAJ25949.1"
                     /transl_table=11
                     /translation="MKAVVMAGGEGTRLRPMTSDLPKPLLPVADRPIMEHVLRLLRRH
                     GLRETVVTVQFLAPLVQEQFGDGSALGMSLTYAREDSPLGTAGSVKNAQEQLGGAPFV
                     VISGDALTDIDLGDLIRFHREKGALVTVCLTRVPDPLEFGITITDDQGRVERFLEKPT
                     WGQVFSDTVNTGIYVMEPQVLDHVAAGESVDWAGDVFPRLLAQGHPVYGYVAEGYWED
                     VGTHGSYLKAQADVLEGRVRVDLPGFEVAPGVRVAATAQVDPAAVLEGPLYIGAHAQV
                     GAGARLGQHTVVGSHAVIEQGAVLQRAVVHPHAYVGPRAALRGAVVGRGAVLHSGTRV
                     EEGAVLGSGCVLEEDSCVTGGVLVYPGKSVEAGTVVSDCLIWDSRRAKSVFGSRGVRG
                     TLNTEITTELAVRLAGAYATTLSLGAHVAIARDHGTPAQVLAPAMICALRAAGVGVRD
                     LGHVPLPVARRESAAGCDGAIVVTTTPGTPESVDIVFLGADGTDLPQGAQRALDRVFG
                     RREYRRVLAGELGCLNTSPASVEDYARELAERVDVSAIAERRLKVVVDAACGSAALVL
                     PSVLGRIGVEALTVNSGLMPSACTQTASERAAAMRTLGHLVAASRAAFGVRFDSAGER
                     LWIVDELGREVGDDAALLLMVRLVTAELGGGTVALPVTASRVAESAAAAHGGRIRWTA
                     TAPGELARRAAQDAAVLAADGEGAFILPEFSPHADGIAAFVRLAGLLARDGAPLSELL
                     SSLPRAHVRSRDLPTAWQDKGQVMRTVVEAASGRAIDTTDGVRVLEDDGRWALVLPDS
                     VSAVTRLWAEGPDPASADALLDEWCEAVGQPIA"
     CDS             complement(116396..116998)
                     /codon_start=1
                     /locus_tag="KSE_00990t"
                     /product="hypothetical protein"
                     /protein_id="BAJ25950.1"
                     /transl_table=11
                     /translation="MTVDIDVWFDYICPYSLITRQLLARAVTGAGTDTRTTLHPFEVN
                     PHCVEEAGEYPRGVWENSVRPLARRHGVPLPGPPGTPLRRARMAFTGYQYALEQGAEP
                     AYSDLVFHAYFHDWQDISDPVVLTALARRAGLDPLAYRSAILSARYARLHRQAEAAAR
                     ASAGVTMVPVVVIGSWRIDGVPSRAQLDDAIGRAAEAGTG"
     CDS             complement(116995..118305)
                     /codon_start=1
                     /EC_number="2.3.1.-"
                     /locus_tag="KSE_01000t"
                     /note="Similar to Acyltransferase MdmB in Streptomyces
                     mycarofaciens (Q00718)."
                     /note="Similar to Macrolide antibiotics
                     3-O-acyltransferase in Streptomyces thermotolerans
                     (Q56074)."
                     /product="putative acyltransferase"
                     /protein_id="BAJ25951.1"
                     /transl_table=11
                     /translation="MTPARADLAGPGAPGRLPSLTALRFVAALLVFCFHATYENAFRD
                     PDAGARFSQLFSKAGWVGVSFFFVLSGFLLTWSARPHDSARRFWRRRFFKIYPSHLLT
                     ALAALALMARAGQPRPGVLRNLLLVQTWTPDVDVILGVNPVSWSLACEALFYLAFPAL
                     LPAVRRIRPARLWPCAGALTAAVLCVPPLAGALLPATPHMTWLPVSEQHYWFVFAFPP
                     VRALEFVLGMVMARIVATGRWKGPGTPTATLALAGAYALALRAPFDYGLAAVTLVPVT
                     WLITAAAAADTRTPATPATPTTPTTPLAGRRRAGPRARPLRAPLMLRLGELSFAFYLT
                     HRLVQVYGHRALGEGRAWSTPAAAALLAASAALTLLLAWILHTAFERPLMRRFATPRH
                     TPPDTPVPPPAPAVPVPPPPVAAPPVAARAPVPASGDPTHGDTR"
     CDS             complement(118302..119978)
                     /codon_start=1
                     /locus_tag="KSE_01010t"
                     /product="putative drug resistance protein"
                     /protein_id="BAJ25952.1"
                     /transl_table=11
                     /translation="MADTPAATRAVKEPPPARPPARTPTTGPHPAPAPAAPGAPGAPA
                     VRHPAEGGAPAVPAEDGAGAARGRVLLPVLLGGAFMTVMDSFILNVAAPTIRTSLHTG
                     LTQSELVISGYVLAYGLLLITTGRLGDLHGHRGAFLAGLALFTTASLACGLATSATAL
                     IGLRLLQALGAAVLYPQVLALLQTSYTGRRRDRAFAAFGATIGAASVTGQLLGGVLLA
                     ADPFGLSWRTAFLVNVPAGALLFTAAAFTLPRTPRRRPARLDLTGVLLLTCALLLLTL
                     PLLHATGPARPAWTWTLPLLSLPALAAFHRHERALHARGGTPLLPPALLRDPAVRRGG
                     ATALAFFAGNAGLFFTLTLLLQDGLRYPPLQAALTFTPLACAFVAASLLAPRLKPPYQ
                     AHVLAIGYTVNAAGTLLLLAATLLPATAGDRWTLMTALTVIGFGEGLGVSPLFAAVLR
                     DTPARDSAAVSGAMETAAQIGMSLGITVTALVFSRALGGRTGAGAHQDAFAAALAAVT
                     LLALLALALAPRPTPTPTRTGTGPGTGPGPGTGPGPGTGSGTAPRTGRPR"
     CDS             complement(120128..120724)
                     /codon_start=1
                     /locus_tag="KSE_01020t"
                     /product="putative TetR family transcriptional regulator"
                     /protein_id="BAJ25953.1"
                     /transl_table=11
                     /translation="MVKQERAARTRHALVKAAAVEFDRAGYEGTSLARISETAGISMG
                     ALTFHFRTKGELAVAVQRLGRSATQDVVTRVAAHPAPALQSVIALTLELARLLEKEAS
                     VRAAARLTREMPATTAATAWYPAWTHTVDELLEQARDGELRPGTDLRTVAALVAHLVA
                     GAETHIRCRVPHTEHQSADAQLAQLWRLVLRGVSANPT"
     CDS             121231..122430
                     /codon_start=1
                     /locus_tag="KSE_01030t"
                     /product="putative transposase"
                     /protein_id="BAJ25954.1"
                     /transl_table=11
                     /translation="MAEDMSRAAAALAQSRLSAFTEELFGHLPRADQRRWAQAYLRGL
                     LVTPGKKSVRRLASAVSDSPTASQSLQQFINASPWDWRPARRELTRVVEQHAPTEAWS
                     VAAAVLPKRGDHSCGVHRRFVPSAGRTVNCQVGVGVFLSSGGQDVPVDWRLLLPDQWD
                     DDAVLRERTRIPPAVRHRPLWAHTLDLVDTLASRTSQAPAPVVADMSEYPDAGRLVEG
                     LSRRGRDFVIAVPGTLRVVPGGLRAAAPDLHAPLSARQLLYPSGTRHPHTATLPAPDR
                     RLRSVRILSGLARLHLPRQDAPAARHTYRLFTQWRPGGGQQPARMWITNLVDRRIDRL
                     IALSQLHRGTTTAMRSLEQEYGMLDFEGRSYPGWHHHMTLVSAAYTYNRLVHPAQQPG
                     EPVHQSA"
     CDS             complement(123256..124230)
                     /codon_start=1
                     /gene="ksbS1L"
                     /locus_tag="KSE_01040t"
                     /product="putative autoregulator biosynthesis enzyme"
                     /protein_id="BAJ25955.1"
                     /transl_table=11
                     /translation="MGGRRIVLSGATGFVGSVVLEGLVRGWAGAAGGGGVELRVVSRR
                     PPVGGGGVVEWVWGDLAEPASLRGVCEGADVLVHLASYIGADEGMCEAVNVAGSAALV
                     GEAVRAGVGRIVGLSTAAVYGVGPHSGIGVDEVEPVPVSVVSRTRLAGEGPVLAAGGI
                     VLRPGLVLGEGDRWVVPALAELVERVPARWEGGRGLLSAVAVGDLGRLIVRLACASRA
                     VGGGLYHASHPVPVRVGDLLAVLAAHGVLPSVAQREELSWEACLERLRARPGRVSARQ
                     LELLTRDHWYRSERVWRAAGCPAGPGVLARTAQAARWYRSHLDPRPTA"
     CDS             complement(125292..125933)
                     /codon_start=1
                     /gene="ksbBL"
                     /locus_tag="KSE_01050t"
                     /product="putative gamma-butyrolactone receptor protein"
                     /protein_id="BAJ25956.1"
                     /transl_table=11
                     /translation="MAEPKQERAVRTREVILYAAAEVFDECGYSGASISKIMQRSGAT
                     QGGMYFHFKSKEGLAHAVMASQQEFIRLPPGRDGLQRLIDITFHIAGELQRNVLFRAS
                     VRLAVEQGELGLEDDTAYQEWVQRFHAQLVAARECGELLEGVDEWEFATVLVGAYTGT
                     QIFSNVATGRADLPERIASLWRYLLPAVATPQAAVLLRVEPSVGPPSGRVSAG"
     CDS             126119..127066
                     /codon_start=1
                     /gene="ksbS2L"
                     /locus_tag="KSE_01060t"
                     /product="putative gamma-butyrolactone biosynthesis
                     enzyme"
                     /protein_id="BAJ25957.1"
                     /transl_table=11
                     /translation="MLVTTQPHTGPRPALTTTVAKEYVHRASLSEVFLTGWHQTAPDT
                     FTVTAQWPRSHSFYTTDHHTHDPLLLSETIRQTFPLLTHAAYHLPFGHQLSWSHFQIR
                     LDPRAMRIEPTPAEIELHVTATNIRYHRGLPASMTMHYTARRDGQPLATATTHFHCHT
                     PTVYQRLRAGRATTAHPFHTAPPPPHPLTPTTAGRTHHHDIVLSPTPHPHHWQLRVDT
                     HHPVLFDHPVDHVPGMLLLEATRQATNTLTTPRKPHIITHLDITFNRYVELDTPCYIH
                     AHTTHHNPTNHHNPTHHITATQADTTAFTAHTHTTPLPT"
     CDS             complement(127439..127681)
                     /codon_start=1
                     /locus_tag="KSE_01070"
                     /product="hypothetical protein"
                     /protein_id="BAJ25958.1"
                     /transl_table=11
                     /translation="MSDLCLGLKDGSGAAVCPTDHAVAWSEVTATVPQARGGAEIAVK
                     LIPGATYSVCFPDFPTGSPTPKFNAPGTGRQVTFVH"
     CDS             127904..129214
                     /codon_start=1
                     /locus_tag="KSE_01080"
                     /product="hypothetical protein"
                     /protein_id="BAJ25959.1"
                     /transl_table=11
                     /translation="MKTPAGLALAPQHQRGHHAPHGTPNRGRPNTDPPRTEPAGLPLP
                     RAADGRPVLAVDVSPWPRPDAGTCPDHSSRHTYRHGDAKHQAIPDRPYPFVVALETGR
                     TSWTTAPDTVRPNPDPDAAATTAAPLRDMAAPSITAGQRTTGDPEAPAVMDTDYDTPR
                     IAHPPGNHPPGDQPTQAPGRLRPNRVTHRPAPTRAKWHAAHPAGGRPPKHGGESAFGD
                     PATRGDKQEATTTETRHHATTTVRTRDRHHPRPTRRAARPDHDSELPLLQSTVIQPAI
                     EKLPSGEVNRPTRPYRSPTDTDPADIDHCRHPPPPTVVPAQVRPGTHLPPARTDTGPN
                     PTPPARLRGNRPPDPDHDRHPHPAPPRPAHPLITDLHHPQENPAEPNKPTPTHTRRGS
                     RSVRAAAARPCRTTPPVREPRTGGARPLPAALEAHPIFHTSTNE"
     CDS             129305..129691
                     /codon_start=1
                     /locus_tag="KSE_01090"
                     /product="hypothetical protein"
                     /protein_id="BAJ25960.1"
                     /transl_table=11
                     /translation="MSAGFAPKEIPVFPRTKRTTFSAALAFAAATALTVAVPSGNAYA
                     IDHIECKGGEDYLKIWSHLDGRQSVDCYANAGRTDFGGWWIDRISTGNNDLIYYDVNG
                     DSVKIERWHDITFPNHPPRVKSIQIL"
     CDS             complement(130087..130416)
                     /codon_start=1
                     /locus_tag="KSE_01100"
                     /product="hypothetical protein"
                     /protein_id="BAJ25961.1"
                     /transl_table=11
                     /translation="MGGGWWVPGLVGTVLLPVWFLGFLVLNALATFVKFGDAGCDDGS
                     SGCMGAGPGARAAVVVLLGVVVLAVVVTWLLPCVRRLRVARWVLVAVSVLLGVVVLAV
                     GVSRPSH"
     CDS             130726..131187
                     /codon_start=1
                     /locus_tag="KSE_01110"
                     /product="hypothetical protein"
                     /protein_id="BAJ25962.1"
                     /transl_table=11
                     /translation="MSDDVLSIIPSDPRWQPNREAVDRVVALVEDLVPGRADDMEVDV
                     RWHDTVTVVDCGENLERIGCPLCQAAIDTEWWSDLLEAHCDDGFTTLAVEVPCCGGST
                     TLDVLDYDWPCGFARFEIAIWNPERSWFREDELTALADRLGHPVRQIRAHI"
     CDS             complement(131425..131667)
                     /codon_start=1
                     /locus_tag="KSE_01120"
                     /product="hypothetical protein"
                     /protein_id="BAJ25963.1"
                     /transl_table=11
                     /translation="MSGRVLALRGDAPVGERRSRRSSEGVMAGERSEDLPGPSRPVGR
                     AAAERIESALLSALRHSPFLEPGTGLPAPVPAAAGS"
     CDS             complement(131671..133047)
                     /codon_start=1
                     /locus_tag="KSE_01130"
                     /product="hypothetical protein"
                     /protein_id="BAJ25964.1"
                     /transl_table=11
                     /translation="MPPPASAELTGTAWGELPHSCTGLHNVPDTPDILMGLLDGDHTR
                     RARAVWDLYRLLLSQERVFPATAPAALVVSALLDDPRTLAGGQWERRAGTRPLRAELL
                     NWLASFADVARLDPQDGAGAPRDLAAARAARPTLHARVAVFCGDDDPQVREAAVAATA
                     LLLADPALAASIPRHAPVVRDVLARSADSYYRWIARERLATWGEDIADLITAEEEHRT
                     AADRAHKLANNPFDEGQGQAVRWLAEQPEDTAALEPPGRWHPDRAAPEQTVPHEPAPE
                     APTAVRGSTPEHRGPWRIARSEERDEWTFTPHIGVGPLHFGMPLEEITAALGEEGTVS
                     GYYAPGTCERRLSHVDFRTAGVRALFRVNRLECVAVDALTGPQVRLDGVPLTGCVPSR
                     LEDWLVHRPLRGPLMYSVAAEPVFPDLGLAIRSQSAGDINLTRPLFLLHNWLDLWHSL
                     PSEERNHR"
     CDS             complement(133092..133358)
                     /codon_start=1
                     /locus_tag="KSE_01140"
                     /product="hypothetical protein"
                     /protein_id="BAJ25965.1"
                     /transl_table=11
                     /translation="MGVAHPRPLRFVSIPYPPRSSRRTIRAAAFPLPPLPPPPRPRSL
                     RLPVPPTGPEGVVLGVLAVRVRGSDPPGGFGVPWVSEPAGRLRP"
     CDS             133483..134433
                     /codon_start=1
                     /locus_tag="KSE_01150"
                     /product="putative peptidase S11 family protein"
                     /protein_id="BAJ25966.1"
                     /transl_table=11
                     /translation="MAAAVGVVAVLVGGGGCAAPGADAGAGAGVGGIDLPWPGEGQSS
                     VVVEGFGSLGGRGGSTPVPIASVTKVMTAYVILRGHPLEDGGQGPRIGVDAAAARESF
                     APGESTAQLREGQDLTERQLLELMLLPSGNNVARLLARWDSGSQEAFVVKMNRAALEL
                     GMTRTTYTGASGLEESTRSTAEDQIRLARAAMGLPVLREVVGMRETTVAGVPGTVVNT
                     NTLLGRDGVIGLKTGSTTAAGGNLMWAAEVRAGGGVRLVLGVVLAQRANTTPQQGLAA
                     ALERSGRLIEAVREQLPGVLAAGDGNGEGAAAAGGRGGRP"
     CDS             134493..135431
                     /codon_start=1
                     /locus_tag="KSE_01160"
                     /note="Contains an Endonuclease/exonuclease/phosphatase
                     domain (IPR005135)."
                     /product="hypothetical protein"
                     /protein_id="BAJ25967.1"
                     /transl_table=11
                     /translation="MWARMWRAGGRRGRVVAAGAVGSALLMAGHALVPNTPGRLGSLL
                     ETFLPWLGLAVPVGLVLAAVRRSRAAAVAVLLPAAVWAAVFGGTLPDRSGSGGDLRVV
                     SHNVDEANRDPRGTARALAASGADVVALQELPARGAQSYGEVLDGVFPYHRVLGGVGM
                     WSRYPLRDVLPVEIMPWVRAMRATVDTPRGPLALYAAHLASVRVSALSGFGTGQRDEA
                     ARRLAAAVRAEPSERVVVVGDFNGSTRDRTLAGALEGLRSAQDAAGDGFGLSWPAAFP
                     LVRIDQILVRGVTPVWARTLPRTGSDHLPVEASVRW"
     CDS             135595..136344
                     /codon_start=1
                     /gene="cseB"
                     /locus_tag="KSE_01170"
                     /product="putative two-component system response
                     regulator"
                     /protein_id="BAJ25968.1"
                     /transl_table=11
                     /translation="MPQYEPVPTPRAGRPAGGDAVRVLLVEDDETIRRSIALALERYG
                     YRVATAPDGLSGLEAFREGGHDLLILDVMLPHLDGIGLCRRIRESSQAPILMMSARGH
                     SLDVVSGLEAGADDYVVKPVDTTVLVARIRSLLRRAAPAADRDRDREEGPAREAVWVF
                     RDLEVDTLALQVRRQGEPVALTPTELRLLLEFTAQPGVALSRQRLLREVWDYGWEGDS
                     RVVDLTVQRLRKKIGADHVETVRGHGYRFRR"
     CDS             136436..137794
                     /codon_start=1
                     /gene="cseC"
                     /locus_tag="KSE_01180"
                     /product="putative two-component system sensor kinase"
                     /protein_id="BAJ25969.1"
                     /transl_table=11
                     /translation="MDPRSLRWRVAALVTLATVAMALGMGVLVHRTTEERSMALARSG
                     AVRELQTAVERFQRAAGNGTGNGAEGSRGDGSGPGDRGYYVGGEVPDALTARLGAGPD
                     PVTWYDERTPVRPRMWAASVVDGQPVAVSTELTLDDLSRKALDRHMRYAALATLAVVV
                     PATLLAAEPALRRLRRAAGTAGRVRRGDLGARSGGRPGRDEIGELSAAVDHMADALAE
                     RLRAEQRFTADVAHELRTPLAGLVTAASLLPEGEATELVRGRVRVLHRLVEDLLEISR
                     LDAGVEEAEAYPVPLGEVVADSVRRTGLRARVEVLGEPVVRTDPRRLDRIVANLVANA
                     HRHGTAPVRVDVEGTRVVVRDDGPGYPTLLLAHGPQRFRTGTAERGHGHGLGLTIAIG
                     QARVIGARLVLANAAEGGAVATLLLPETTGDEPEDEPEDGPGDGPQNGPEHRPEDRPE
                     EG"
     CDS             137939..139495
                     /codon_start=1
                     /locus_tag="KSE_01190"
                     /product="putative peptidase S08 family protein"
                     /protein_id="BAJ25970.1"
                     /transl_table=11
                     /translation="MGVRRRQVFRGVAAGALALLVGAGGAVPAVAAVPEGVVRGAGAP
                     GAVAGSYLVVLAPQQGAAVAAVGASLAARYGGVLGRSFESALRGFSVRLPERQARRLA
                     ADPAVALVAQNRRVSVDGSQAGPPSWGLDRVDQRRPPLTDRFDYPAGGGQGVTVYVVD
                     TGVRISHEDFGGRASYGFDAVDGDAVADDGNGHGTHVAATAVGATYGVAKRASLVAVR
                     VLDDDGSGTIEQVVAGVDWVTAHAVKPAVVNMSLGGDPDEVLDAAVRNSIASGLTYTV
                     AAGNQGVDASQHSPARVPTAITVGATDVEDDVTWYSNYGPLVDLHAPGEEITSAGIAY
                     DDDYDVMSGTSMASPHVAGAAALYLADHRTATPAQVSTALTSASTTGSIGALEPGTAD
                     RLLYTGSIPNRAPGRRFTNDADTPIGVAPLVSSITVTGVPGSGPANLDVAVDIVHDWP
                     YDLVIDLVSPAGKVFRLKEENFSGPFNDVHKLYGVDASTGAANGVWQLRVTGGSEYFD
                     GYLDRWALQF"
     CDS             139639..140403
                     /codon_start=1
                     /locus_tag="KSE_01200"
                     /note="Similar to Sporulation-control protein Spo0M in
                     Bacillus subtilis (O87735)."
                     /product="hypothetical protein"
                     /protein_id="BAJ25971.1"
                     /transl_table=11
                     /translation="MVFKRLLGALGVGGPTVDTVLSTPTVYPGGTVHGQVNLVGGDRD
                     AEINGITLCLVARVEVEYEDGEAHRTQEFAPLRVSGPLRLAAGERRAVPFALPVPWEA
                     PLTVVDGHHLSGMALGVRTDVDIAGQLDRGDTDPLAVQPLPVQQRVLEALSALGFHFH
                     RADLEAGHIRGTGQTLPFYQEIEYKAAPQFAHRCNEVELSFVTDPYRVEVVLEFDKRG
                     MFHSGDSVRTFVLDHGAGQHDLSGTVDGWVRGVLGH"
     CDS             140522..141295
                     /codon_start=1
                     /locus_tag="KSE_01210"
                     /product="hypothetical protein"
                     /protein_id="BAJ25972.1"
                     /transl_table=11
                     /translation="MGFGAVAAAYERFRPGYPDELFELVAAYAGRPLRTALEIGAGTG
                     KATRLFAGRGVAVTATDPDPAMLAELARNVPGAVTAPGSVRTVRAAFEELRPGPTYGL
                     CYAAAALHWTRPEGRWARVAALLEPGGVFASFGGPVRLADPGLEERVRVARAAFLASD
                     EVPSPDGTAPAAEMQWPGTELLRSPLFEDVRQVVLGRRLTLDAADYVGYLSTVSAYLE
                     LAPERRRAALGAVLRVLPARVGIDAGLIGHLARRVSAPA"
     CDS             141441..142910
                     /codon_start=1
                     /locus_tag="KSE_01220"
                     /product="hypothetical protein"
                     /protein_id="BAJ25973.1"
                     /transl_table=11
                     /translation="MTVQRPTPAPAPPPADRPHGPTPATTRARVAALLRGPGVIAWGL
                     AAGFAALYLCVAVNRNRRGLGKAYDLGIFEQAVRAYAHGRAPIVPLKGPGYHLLGDHF
                     HPLLAVLAPFYRVFPGPLTLVTAQALLMALAVVPLARWAHEVGGARLAVLVGGATGAS
                     WGIVRAVADDFHEIAFAVPLLAFAATALGRRRPLAAALWALPLLLVKEDLGLTVAAFG
                     LLIAWRARRERRTPVPGLVLAGVGVAAAALIVLVVLPSFNPHGGFDYWQQLDGSGSGP
                     LWALPLRLGWPPVKWLLLFLLAATTGFLALRSPLALLCVPTLGWRLLADNPHYWGVSY
                     HYSAVLMPLLFAALVDAVRRSGTGSRAVRRGLAATVLVAVVTLPLYPLHEVVMPEAWG
                     TSARVVETRAMLARVPDGAAVAASNRLAAQLTARADVTLVCREPVGAGPRWVAVDLRD
                     PSVKAPCATADTARMLARYRDAGYLTRFDRDGLLLLERP"
     CDS             143044..143424
                     /codon_start=1
                     /locus_tag="KSE_01230"
                     /product="putative GntR family transcriptional regulator"
                     /protein_id="BAJ25974.1"
                     /transl_table=11
                     /translation="MIEYRIDRRSGVSTYQQIVQQTKQALRLGLLEPGDKLPTAREVV
                     ELTAINPNTVLKAYRELEREGLVEPRPGLGTFVRRSLARPEAAADGPLRGELVGWVDR
                     ARAAGLEREDIAALMASVLEQRTG"
     CDS             143499..144506
                     /codon_start=1
                     /locus_tag="KSE_01240"
                     /product="putative ABC transporter ATP-binding protein"
                     /protein_id="BAJ25975.1"
                     /transl_table=11
                     /translation="MDDDPTPTSAALAAVGLGMRFRDGWALRGCDFTVPAGRISGVVG
                     PNGAGKSTLLALAAGQLAPSEGGLLVFGEPADAPGPRARVAYVAQDKPLYAGLTVAET
                     LRMGRELNPVWDQEAAQRVVEQGELRPRARIGSLSGGQRTRVSLALALGKRADLLLLD
                     EPMADLDPLARHQLMGTLMSAVAEHGTTVVVSSHVLAELDGVIDHLLLVQRGGIRLAG
                     DLEDVLDGHRLLTGPAGADGPPAELVVERRVTGRLATALVRTGRAGAQPGGAQPGGEG
                     AGWRAEGWESERPGLEELLLGYLRGPVTPAATAGTAATGTAAAGSTEAGRTATNDEKA
                     A"
     CDS             144503..145507
                     /codon_start=1
                     /locus_tag="KSE_01250"
                     /product="hypothetical protein"
                     /protein_id="BAJ25976.1"
                     /transl_table=11
                     /translation="MSTDVLTERAASPADRRERPAKPRLRGLLWLSLRQNRLLLRVLA
                     VFLVLAVADLVWVHVAVQHVVGVLRRTGCYEPESWGSDTCWVLFSPISRPHFWFVSVL
                     QPLVTAFPLLVGVFVGAPLLAQEYERGTIRLVRAQSVGPARWLTARLLVPAAAVLLVS
                     GVLAALMSWVWWTDLVHGPGAFDPPFQAFTYPALGVAPVAWTLFAFTAGVLAGQATRR
                     VLPAMALTAGAVVVAHGLVRWVRPYFHSAVEVLVSAGTAQPPNAWLLGRTTVLPDGTR
                     VRAEYCLGSPECAQAPETWLRYHPARHLVPIQLVEAGVLVALTAVVLVVVFRRVGRLR
                     "
     CDS             145620..147212
                     /codon_start=1
                     /locus_tag="KSE_01260"
                     /product="putative peptidase S33 family protein"
                     /protein_id="BAJ25977.1"
                     /transl_table=11
                     /translation="MIMRTTRPFRRALPAAVLAVLLASCSSTPGPSPAPPSAPGSPSA
                     SASPSPTAKPTGADDPALRAFYTQQIAWAPCPDDPKTEKIDESALQCGRLRVPLDYAN
                     PAGEGIEVALARKPAAAADQRLGSLVLNPGGPGGSGVQQVQYSGDSFKDLNARYDLVG
                     FDPRGVGASTAVHCLDDATHDTWALSDGRADDQGKAYADACAANSGKLLPHLGTRDAA
                     RDLDVLRGALGDPKLNYFGFSYGTYLGSSYAEQFPDRTGRLVLDGAVDPTADQLDQLV
                     QQFAGFEKSLTAFAADCVKQEQCPLGKDAGKAPQKLATFLDGLRAHPLAAGKGRELTS
                     AAGWTGTLNMLYGSEKSWEYLRNALSWAMLRDKGDYLLAMADDYNGRDEDGHYTNMFD
                     AYTAIHCADPGADTPTADRLQAALAAAHQQAPLVTAHFTDRDLFDPDCRSWPYHSAEK
                     PHVVKAAGSAPILVVGSTGDPATPYAWAEKLASGFANATLLTREGDGHTGYGKSTCIR
                     TAVNGFLLDGTMPAAGTRCPTP"
     CDS             147357..151010
                     /codon_start=1
                     /locus_tag="KSE_01270"
                     /note="Similar to Putative molybdate metabolism regulator
                     in Escherichia coli (P33345)."
                     /product="hypothetical protein"
                     /protein_id="BAJ25978.1"
                     /transl_table=11
                     /translation="MRRWEFTEDGSDKFWEAGTEGTALTVRYGRRGTAGRARVREFAS
                     AADAAAHLAKAAAEKERKGYREVGGQAPAETPSGGTDTVDASNASDAVDEDVFVLPDG
                     WRRLLVPRRGGASRPPAAPVKGAVERLRAGVGERRAWIDEALADPRSDGPSVAAARAY
                     LAGAADPLGAAAVAALAGLGGERATADAWVAGHGLVFAAVAAVELMEVEVSWRSSGST
                     RRQGPVLSAGQSSYRSDRLAVAGRVRALLAACPEPLYREAVGALGAVRTAPSREVVAA
                     YLVPTEREWVDACCRRPGAGRRGGTRQAMLLCALSAPEQVAALAEPARVEWSAALVAT
                     VADGLGAAAAPLLLQGVEGAYDGVERRRLFDALALLPSDEGFRGLLAHRADPAARQAL
                     PAAMANRPRRALRLLAEAVAEARASQAPARTGRTRPDDPVPALLALLAAHAAAHRAAA
                     LELLPSLPPAPAAVLAPLTEPGDRLPDASAAELPAVLADPPWARERVAAGARVVPGVA
                     APAGCEVRWLPGEERAWAAAPADAYRVWEYRDDWAVAADWFRQGRLHAYQEFTLLLRA
                     PHEVARPLLADWSGAEYLGDGAAALRLLVVRHGADALAPVLRAVREDPAGLGGVLLPL
                     LGVEVARCAADWLVRLKSAGATARSWFARHGVAAARLLVPDAVGRAGAARRGAEQALR
                     LVAAAHGAAAVRAAASGYGAGAAEAVDALLSADPLVNALPARLPVLEGWADPAGLPQL
                     PLAGGGAALPVAAAGHLVMMLALSRPGEPYPGLAGVVPRCDPAGLAEFAWALFERWRL
                     AGLPASGAWALHALGPLGDDGTVRRLSPVLRAWPGEGAHHRAVDGLEVLAAIGTETAL
                     RHLHLIAQRVPFKALKARAGERIAEVAAGLGLTGEQLADRLVPDFGLDAAGTAVVDYG
                     PRAFTVGFDEQLRPFVRDGSGRRRAELPAPGAADDAGLAAAGRARYAELRKEVRATAA
                     DQVRRLEAAMVARRSWPAAEFTGLLVAHPLLRHLVRRLVWLAETAAAGGGGSAGGGGA
                     VTAFRVAEDATFADVADRAYALPADAVVRVAHPVLLGAAELAAWAELFADYEVLQPFR
                     QLGRPVHALTDQERAGHRLARFEGGPAVPTGRFRALARRGWEIGDPGDNGVSRWVSRP
                     VGDAGHLVVVPEHGIPVAGSDAYPEQSVREVRLVARPGDHRRDGEPGPVLAALDPLLA
                     SELLADLVELTVP"
     CDS             complement(151111..151914)
                     /codon_start=1
                     /locus_tag="KSE_01280"
                     /product="putative serine/threonine protein phosphatase"
                     /protein_id="BAJ25979.1"
                     /transl_table=11
                     /translation="MSPHRTPLYVAADIHGHRTEFRAVLRAAGLADENGHWSGGRARL
                     WLLGDHVDRGPDGIGVIEDVRRLAAQARDEGGQVGALLGNHEVQLLAAHRFGTAPVPG
                     WDQPGGFHGGWARFGGQEADLRGLTPSHLEWLAALPAAALVDGHLLVHSDTTRYLELG
                     TSVAAVNAAATAVLADEHPEAWLEFSRLMSSRGSFRGARAGRPDEPVARILDALGGSV
                     LVHGHSTLTEYFGIPPERVRAALRYAGGRVLAIDGGAYLGGRILLTRLR"
     CDS             152205..152690
                     /codon_start=1
                     /locus_tag="KSE_01290"
                     /product="hypothetical protein"
                     /protein_id="BAJ25980.1"
                     /transl_table=11
                     /translation="MSSYGISVNIDFSLEPLFSWYVVLLMVSGLITICLALVPASGLG
                     IGMRVISGLIGAAFFGYGLYLGFFFEGGRYVIYFKVLFIPVAMIFYLVRSLVNRAKGT
                     PAPPQYPAAYPPAQGQYPGQAPFQGEAPQQQPGQVPPQAPFQAPGQAPVQQPPVGGPT
                     A"
     CDS             152883..153656
                     /codon_start=1
                     /locus_tag="KSE_01300"
                     /product="hypothetical protein"
                     /protein_id="BAJ25981.1"
                     /transl_table=11
                     /translation="MGVHGVAAAGAREARFDPLLADRVVDALLLVGLPVAHGGHGPGV
                     HLFASGSAEDTGSTYGLDPERWPLTLRWLCSPRLEDAAAAGGTDSPWPRTRRLVADSI
                     ETALAELLPALGLSATRDAPDGPTRIGPADSPTTPAAPAAPELAVEPAVELPAVELPA
                     AAVAAVRRAAALAGLPLAAHPRAVGVALTACLPAPDTAPVADVAWRPSPRLPDGPPVS
                     TAVRESMHHAVGSVLAGCGLRTTWHRPPDSAPHLHAAAR"
     CDS             complement(153723..154313)
                     /codon_start=1
                     /locus_tag="KSE_01310"
                     /product="hypothetical protein"
                     /protein_id="BAJ25982.1"
                     /transl_table=11
                     /translation="MAARPRPAYNGRMPPKDLPSRHRAARATAPSYPEVGATRDAALP
                     AGYSWLRRRIHLGSGPAVLERAGAYVLHWGAQLGSGFALYPPPEKAAPGATVLLRIAL
                     PGLRLPRLAIPCRVVWTVEEPDRIGFAYGTLPGHPERGEESFVVSADADGEVWFEVAA
                     FSRLDSWYARLGRPVALTLQHLAIERYLRVVARAAR"
     CDS             complement(154411..154623)
                     /codon_start=1
                     /gene="cabB"
                     /locus_tag="KSE_01320"
                     /product="putative calcium binding protein CabB"
                     /protein_id="BAJ25983.1"
                     /transl_table=11
                     /translation="MADIEAARTAFARLDVDGDGRVTAHEYKTVMAQLGDYHVTETVA
                     QAIINAKDANGDGKLSFEEFWASVQS"
     CDS             complement(154754..155185)
                     /codon_start=1
                     /locus_tag="KSE_01330"
                     /product="hypothetical protein"
                     /protein_id="BAJ25984.1"
                     /transl_table=11
                     /translation="MTSVMAGTVQPATYQGLLTDPRVTAMTNTGNSKDDDRTDIRISL
                     IGGTRLEGEEIHTRTLTASLVGGADIDLTDVDIPDGAELRITKLSLIGGVSLRVRPDV
                     KVVVTGVRLGGVSDDGPTREGGPTVHVAAWGLIGGVSVRRD"
     CDS             155406..155969
                     /codon_start=1
                     /locus_tag="KSE_01340"
                     /product="hypothetical protein"
                     /protein_id="BAJ25985.1"
                     /transl_table=11
                     /translation="MASGFQRYKLTSMFHAFDADGNGYLDEEDFRALADRWGRLPRVA
                     ADPELAARVERVMLGWWDALYEAADTNGDGLVDLDEILAMVDRLPEMREAVTATADTV
                     FDAVDENGDGRISREEHRRLVDVWNGRATDTAGVFELVDLDGDGFLSQAEFTELWAQF
                     WISADPADPGNHLCGVLSPAADPAAGA"
     CDS             complement(156009..156686)
                     /codon_start=1
                     /EC_number="5.2.1.8"
                     /locus_tag="KSE_01350"
                     /note="protein synonym:PPIase"
                     /note="protein synonym:rotamase"
                     /product="putative peptidyl-prolyl cis-trans isomerase
                     cyclophilin type"
                     /protein_id="BAJ25986.1"
                     /transl_table=11
                     /translation="MKRTSWGAGLTVLAMVSLALSTTGGTASAATPAAGAASAATCTY
                     TPAVPADNFKGIPVFDAQKAAKPYSATLRTSQGQITFQALTDKAPCTTFSFRFLAEKD
                     YYDRTHCHRLTTQRLYVLQCGDPTGTGSGGPGYSFPDENLNGATYPAGTVAMANAGPN
                     TNGSQFFIVWKDTKLSPAYTPFGRVTAGLDVLQKIAAGGEDDQNGPGDGFPTLPVNIR
                     NVGISKR"
     CDS             156986..160168
                     /codon_start=1
                     /locus_tag="KSE_01360"
                     /product="hypothetical protein"
                     /protein_id="BAJ25987.1"
                     /transl_table=11
                     /translation="MVGFVVRRLHGRLPLAAAALLTVLITTSVLTALVAFDRGAAEAG
                     LRRALQGAGAARATVLVGGDRAVGDRARDDAAVAAYGRELFGALPVSAESVARSRSYG
                     LPGAADRPDLTVLAALDRGRTALLAGAWPTAGPPAGAGAVQAAVPQNALAGLGVDAAA
                     LPARLELTDRFTGRPLTVEVTGVYRAADPSDPYWRTDPAAGRGVQVLAYTTYGPLLVD
                     DAVFTSGAVAQASRSWLLRADFAGLAPEDAAALRGRVAAAGAGLQRDAGLTASTELDG
                     QLGELASDAQVARATLLVGALQLVVLAGAALLLVVHLLADRQAAENRLLVARGAARGR
                     VGAFAAGEAVLLAAPAALLAPLLTPWLVRLLAETGPLAGAGLDAAVPWTVWPVAAACA
                     LGCVLLTALATAARSAGAAVLRRVGRQRARASAVLRSGADVALLALAAVAYRQLARYS
                     GVSHGVDPLLVVAPTLALCAGTVLVLRLLPPVSRLGERWAARSAGLGPALAGWQLARR
                     PGRAAGPVLLLVLAVSVGMLAIGQRASWADSQRDQAAFATAGGLRITASALPAAGQGG
                     VYAALPGGERIVPVARRDVPLPRGATATVLLLDAGRAAEHLRIRADLLDGHDARTVFT
                     PLASQPEGGLPLPSPRIELDVTTDGGASPGAGPGRATDASLSPSVPALSLLVRDRFGL
                     VQSVPAPVLAGGAQHLAVDLAAGGAGGAGGPGGPGGAGGPGGRLAGPFALVGLALEVP
                     GTAGSLRVDGLSAAASADWSVTGPGATVVPGAGRLPVVSWPAAPGPVRRLVLAPAGRP
                     AAPELSAVATASYLAAVGAKVGESVPVPFGTATLRARVTAAVTALPATEGPAVALDLA
                     AVDRHLDARGEVAVAASEWWLPAAGPGDDAPRRAAAELRAAPFAQRTLEQGALAGRLR
                     GDPLGAAPQSALAALAVAAVALAAIGCAASAAGAAAERSREFAVLAALGAPRRRLLRT
                     VAAEQGVLALLGVGTGLLLGALLVRLVVPLVVLTPAAARPLPEVLVRLPLGQVAALAA
                     VAGAALLLPALLAGRRGRDLGTRLRGSEEP"
     CDS             160296..163013
                     /codon_start=1
                     /locus_tag="KSE_01370"
                     /product="hypothetical protein"
                     /protein_id="BAJ25988.1"
                     /transl_table=11
                     /translation="MAPWVRTRLRAVRVSTWLTAALVLVAVFLAAGLPRALDRAADGA
                     LRERLASGGRDGAVVTATSLRLGAQGGGSPALQLDVLAQELERRVTDPLRPTGLGAVY
                     GSTTRADRSLPGPGLPRPNGMAPVLGLAYLHGVGGRAALAAGRWPAAVADGADFEVAL
                     SEPVARTFGVSVGAVLDAGTDASMSPPRHFRATVVGVFAAADPASPFWAGTDCLVEAC
                     LSSTVALGERIRYWRAAALVGPGELADLGFWSGKSPQDFVRVPVDVSAARADRLPRWR
                     AAVGSLTGGPERTALQVAAGRPDVQVRSRLSELLETAAERQSAVAPLTVLGPAGAAGV
                     GLTVLLLAAALAAERRAGELRLLRARGASRGGVLRRLLGESAATALPAAVLGTALALL
                     VLPSPRWGAAVLAAGVTAAVALLVFPLRAALFPERGTEPGTEPGAAAGRRRVVAELSA
                     LALAAGAVVAVRRRGVAPAGAGVDPLLVGAPLLIALVGALLLARLLPPLVGAASRRAA
                     RRRGAVGFLALARASRPAVLPLLALLLAVSTAGFGATVLESVDAGRLRAVRAETGADA
                     RVTARTVLPDGFGRAAGELPDVRAGVSAWTDRAASVAKPDGTVLAEVTLLVVDPQQYA
                     ALARRNGQPAIDPRPLAGGGPDGVPALVTPGLAGRLGAGPHPLHTGQSVLPFRLAGVL
                     PAGGGPALGAGEAVVLPVGQASERVAALGRSNLWLGTGTPRADRLRELLRRLDPASAP
                     ESGAYAVRTGAEESERLAADPLQRSAARVFGWSVLAAGAFAALAVLLTLARSGPERAA
                     LLARLRTMGLRPRQGLAVVLLESLPTALAAAVAGALLAVGTTVLLGPALDLSALVGAP
                     ATGGVSPSAAAVLTWSLALAALFAATVAAEALVAGRRQIGTELRAGDAR"
     CDS             complement(163082..163459)
                     /codon_start=1
                     /locus_tag="KSE_01380"
                     /product="hypothetical protein"
                     /protein_id="BAJ25989.1"
                     /transl_table=11
                     /translation="MARRPPKQPGLAAFVAALPAAERTGADSAGWPWPGGTREFTDDH
                     GYRWHRRAKAALDPRRAARLVRDADVMITGPWELRHLAPGERAAAWAEATARTEPGDL
                     TEYVAHEFTSEGGLTLLYLERHC"
     CDS             complement(163490..164053)
                     /codon_start=1
                     /locus_tag="KSE_01390"
                     /product="hypothetical protein"
                     /protein_id="BAJ25990.1"
                     /transl_table=11
                     /translation="MSYLRTFLPWIVFAVIPSTQWQWAALAGLVIAAAVIAQQRAAGT
                     GWDALIIETGSGLYFAVLAVIAFTDPHSGVRDYSAALSSAVLALIAGVSLLIGKPFTL
                     GIAKRTTPREYWNLKPFIRVNAVITSVWTAAFAITAAVLGVLAHGGHGHSATALVVQI
                     AGFVVPMVFTIRYVAIVQARAPRAPQT"
     CDS             complement(164250..164540)
                     /codon_start=1
                     /locus_tag="KSE_01400"
                     /product="hypothetical protein"
                     /protein_id="BAJ25991.1"
                     /transl_table=11
                     /translation="MPRPARRHLRLAATAAATAVVAVGTTAAALADPTPPARAGAVAP
                     RWEYRWAVAQPGGRTVGDLEQLGKDGWEVVGPVNEYTADRWNFLLKRELPDG"
     CDS             complement(164595..165086)
                     /codon_start=1
                     /locus_tag="KSE_01410"
                     /product="hypothetical protein"
                     /protein_id="BAJ25992.1"
                     /transl_table=11
                     /translation="MNPLHRRAAAAAAALAVGVVLTATGTQAHSTPAERTAVTAPADY
                     GAVTALAAATVTDPGARVERLWVVDGDEQLVPAGQQVPVRLKLRALDHDHHPVAGATV
                     LFSTPGPGLKFPDGDDDATAVTDADGYALAPALTALGTPGPDLVIASVSDRAQVAFEI
                     TVV"
     CDS             complement(165110..165544)
                     /codon_start=1
                     /locus_tag="KSE_01420"
                     /product="hypothetical protein"
                     /protein_id="BAJ25993.1"
                     /transl_table=11
                     /translation="MPIPVRPGFLRPLTLAAAALALGAAPAVAVPVSNPPGVHVLNGD
                     SRVARHVDCPAGWVCLYDGFTFDYAAVALLPGTELTDTERLQLPDGSRFTGKEGISAW
                     VNNSPVPYCWYPGKDYQGTAMAMAPATQGNAHNDALKSLRPC"
     CDS             complement(165556..165762)
                     /codon_start=1
                     /locus_tag="KSE_01430"
                     /product="hypothetical protein"
                     /protein_id="BAJ25994.1"
                     /transl_table=11
                     /translation="MNPLHRRAAAAAAPAQEPTIEWEGQWRFEPEGDPVFNHGIADQR
                     IGPVTEEAPTRGKAVWTEALPNSK"
     CDS             complement(165786..166220)
                     /codon_start=1
                     /locus_tag="KSE_01440"
                     /product="hypothetical protein"
                     /protein_id="BAJ25995.1"
                     /transl_table=11
                     /translation="MPIPVRPGFLRPLTLAAAALALGAAPALAAPVSNPPGVHVLNGD
                     SRVARHVDCPAGWVCLYDGAHFDYAAVALLPGTELTDTERLQLPDGSRFVNEEGISAW
                     VNNSPVPYCSYPTKDYQGTASAMAPATQGAAHNNLLKSLRPC"
     CDS             complement(166232..166834)
                     /codon_start=1
                     /locus_tag="KSE_01450"
                     /product="hypothetical protein"
                     /protein_id="BAJ25996.1"
                     /transl_table=11
                     /translation="MELLRTALRKGAAPAAALLLAATPLAAAPVATAQEPTVECDGKW
                     HFESEGDPVLKREIADKFTLDNRNGPEPLDQTVRTKESLTKTFSNQVDLGFEVGAEAS
                     AGFGAFSASVQTKFSASYGFSLTDTNTVEKETEVRLVAGPGVGYTRYVGIESVQVTGY
                     YERILDCDKKTQRYQRIGPVTEEAPTRGKAVWTEALPNSK"
     CDS             complement(166822..167310)
                     /codon_start=1
                     /locus_tag="KSE_01460"
                     /product="hypothetical protein"
                     /protein_id="BAJ25997.1"
                     /transl_table=11
                     /translation="MPRTPWRHRLPAALAVPASVLALTAAVPAPGPAAAMPPAARDLD
                     PGCTGPTGPAVPVAGGTVSWCPTQQGGRLVFTNTGRAYADLSLVVYDCDGGKAPNVDA
                     AKCAGSLKGTSDIIWRQIKSKQSVHADFAIPRGANAQVWWTADGTDQATDLKLLGTPW
                     NS"
     CDS             complement(167494..167949)
                     /codon_start=1
                     /locus_tag="KSE_01470"
                     /product="putative hydrolase"
                     /protein_id="BAJ25998.1"
                     /transl_table=11
                     /translation="MRSDEGETVTERRQLIRRARAEGVGEFMGGVAVLDGSGRVLTVR
                     RRPEDTYGGQWELPGGSLDPGEDPERGAARELAEETGLTGLALAYLHAVDFTGLGGVR
                     ARQFVFTAAVPDGTPVTLSEHDAHRWSPLDDLPAVSAHHLVALALLRDR"
     CDS             168131..169027
                     /codon_start=1
                     /EC_number="6.3.2.1"
                     /gene="panC2"
                     /locus_tag="KSE_01480"
                     /product="putative pantoate--beta-alanine ligase"
                     /protein_id="BAJ25999.1"
                     /transl_table=11
                     /translation="MRILRTIEDVRSTLGRGAGTVGFVPTMGAFHEGHASLMRAARAE
                     CDTLVVSVFVNPAQFPDREVYLRYPRDPEGDAALAEREGADLLFLPEPAEVYPPGFAT
                     AVSVTGGPAAGLCGAGLGTDGQLTGMCTVIVKLLNIVGPDTVYFGEKDLPHWIAVRRM
                     AADLNLPARIRVLPTVREADGVAMSSRNVHLGAHRPLAACLPRALDAALGAVAAGLRD
                     TAAIRARAAAELSGPLVAPDYVEVLDAASLRPLAVLDRPAVIAVGATVAGVPLLDLAR
                     CAVPAGPPPRPAPAERVDGAAR"
     CDS             complement(169043..174970)
                     /codon_start=1
                     /locus_tag="KSE_01490"
                     /product="hypothetical protein"
                     /protein_id="BAJ26000.1"
                     /transl_table=11
                     /translation="MGALDATPGGPGPIDFFISYSPADERWAAWIAWTLEEAGYRAFL
                     QAWDFVPGTNFVDFMDRGITESAAVIALLSRNYERSRYGRMEWQAALRADPDAPERRL
                     VTVRIEDIPVDGLLATLTYIDLVGVARPAEARQLLLTRVAAAMDGRSRPELRPGYPGG
                     VPGPADVPGAPGTLSPAGRTPAGAPTATTAATAAARGGRRRRPSTQPAYPLAAGRAGG
                     REAVTVLHLAGPGFGRGADPAELQAAVWGDLVELADSGAPAPELVVVTGDLTASGSPR
                     ECEQALSFLTGMRTLLGLEPHRVAIVPGGQDVSQAASRAYFATCEADEVRPAPPYWPK
                     WRHYSRLFQEFYQGLDLVFDSAQPWTLFPVPELGTVVAGLNSTMAWSHRPDDRHGWLG
                     PEQTAWFAQALRPYENDGWLRIGALRHPAAAARPARGGPADEPLRDADRFTRLTAPRL
                     HLLLHGPTAARTALGALTTSAGELTTLAAPAAGGHQLLQLTREGLTRWSAPGAEPLRT
                     AAPWPRAGRVFPAPEPAAQPPTAEPPELDGARPATAPEREVRRPASPLETLLARVAEV
                     CRTRHQGAQIREVAGPPPQLFVTWAESGLIRQQRVAVSVRTPTEEDVDRFVDEVHADG
                     AAPDAELVHDGPPPSLALRERARRRGVRLRSFPEFQGLLDLRDYVSAQSERLAADSQY
                     QPGLYLPQRYRDAERPGAEERDGLVDELLRLLDSDHGRFVLLLGDFGRGKTFALRETA
                     RRIPAELPYLTPLFIDLSALDKAHSLDGLVAAHLTGHGIDSLDLRTFRYMLRQGRIVL
                     LFDGFDELVNRVSYERAADHLQVLLDAAVDNAKIVVTSRTQHFRSHEQVLTALGERVG
                     LLPRRRLVAVQDFTPHQIRSYLANRYGDPDAAARRMRLLEAVPDLLALCRNPRLLSFV
                     ADLDHDRLRAVAGAGRALSAAGLYQELFTSWLRFEERRGDGGPGAAPGLRLEQLWQAV
                     TLLAVRLWESGRSSIALDEIVDIAGVLTGLADSPMPTPQVAHAVGSGSLLVRSDEGVF
                     HFIHGSVVEWLVARAAAAALERGETDLLARAPLSRLAVEFLCDLADRQAVQNWAHSVL
                     DGPRDGGPDGTRDGARDGGEAARLNAVKVLDRLRVPAHTVLRGAPLAGEDLSHRDLSG
                     VDLSGADLTDARLLGTDLSGADLRGATLAGARLDGADLSGADLRSADLRGARLLGTDL
                     RGARLQGSRWQRAALISATADPDALAAPELRAAAIAPGLPVEAGFSPSEVGVPYGFDV
                     RSTRLPEPVAFSPDGRLLAVGSEDGSVLVCDALTGTALRTLKDHIGRVYAVKFAGEVL
                     ATGSADGTVRLWDQVSGECRHRLDVHPGGVWPVSLGPGGRLVATGDPNGTVTLWDTAT
                     GRPLHRLRGHDAPVYTAVFSPDGTLIVTGDSGGGARLWSTATGRRRAVLPGHLGTVYR
                     TAFSPDGTLVATADGGDDHGTGGTVRIWDTTGRRPLHTLTGHAGRIYTLAFHPDGDLL
                     ASGDTEGQVRLWNPLDGTALERPDDSTGKIYQVAFDEAGTRLAASDSDGGVRIWRVTR
                     HSPDQRGGRHRVVPLRRQPPEHRGSVWACRFRPGAGRGGAETDALLVTGGNDGLVRLW
                     DPASGRSRQLLRGHGRRIGSLSFSGDGTLLAAGGNDGVVRLWEPATGRRVRELTGRSS
                     RLVSAEFSPEDAVLATATNDGDLCLWNARTGEYLREMDVETEHVWAEGFSADGALVAT
                     ANDDDTVRIWYRRTGAHLTTLREHRGRVRSIAFTPDGRRLLTGCDDHKVRISDLDTGR
                     VEAELVGHTDRVYAVTAVTGTPDGDWLASASWDGTALVWRDGAVRHRLTGHVGRLWTA
                     AAHPARPLLATAGDDRVVRLWDTRTGAPLAGLRGHTGRILAVTFNPDGTLLASGGEDG
                     TVRLWRIGPEGRPAPLATLLGAPAGWAALLPSGAYKYEGDVAGEFWHAVGMCRFEPGE
                     LDAHLPGVHRLPPEAEL"
     CDS             175372..176580
                     /codon_start=1
                     /locus_tag="KSE_01500"
                     /product="putative arsenical pump membrane protein"
                     /protein_id="BAJ26001.1"
                     /transl_table=11
                     /translation="MLAYWPAVRRLHPLDLLAGGLLALGLVFLATGLLPAESAGAAGR
                     RIAPLLAFLGSVVVLAELTGAAEVFDVLAARVARAGRGSYPVLFLLCVGFAALTTAVL
                     NLDTTAVLLTPVMLALASRVGIAPLPLAMTTVWLANTASLLLPVSNLTNLLAADRVAL
                     SSAGLAWAMWAPQLAALLATMACLWGFYWRRGRRGADGYLPPAVQRPKDRVLFRVCAL
                     ACAGFLACTLVAAIPLWVASGAAAAVAVAAYAVRRPESLRVALVPWRLLVMVPGMFLV
                     VQTVDAHGLHRLLAAAIGTDSGPLGLFRASGVGAGLSNLLNNLPVYLAGEGAVPPDNH
                     QQLLALLIGTNIGPLIAPWASLATLLWYERCRSAGLRIPLRQVAGTSAVLAVTGVTLA
                     TAALALTGTA"
     CDS             complement(176605..177540)
                     /codon_start=1
                     /EC_number="3.1.3.25"
                     /locus_tag="KSE_01510"
                     /product="putative inositol monophosphatase"
                     /protein_id="BAJ26002.1"
                     /transl_table=11
                     /translation="MDDTAPGERGEGTGGAGGAEAAGLGGSAGLGGSAGLGGFADECR
                     TAVRAAEEAGALLRARFLDAFRVDSKGEDGDVVTELDLLAEELVTRRIAERYPADRIL
                     AEEGGTTADRPGSRRTWLVDPLDGSNNVVIGLPAYVVGIALCQDGAPVVGVVHDPVAG
                     RTWRAVHGCGAYGPSGRLRAPARPAGPGRPVLGWTQGHGVARDDPVARALKDGLEDGA
                     RRVLQLWAPLLTWSLLACGLIDGFVGYRAEEIDLHAGSLLATEAGLVVRAFDGSRFDP
                     RIGRPDTARSYVAGRAEIVPHLLDLVARAAAPGRA"
     CDS             complement(177518..178177)
                     /codon_start=1
                     /locus_tag="KSE_01520"
                     /product="hypothetical protein"
                     /protein_id="BAJ26003.1"
                     /transl_table=11
                     /translation="MRNLYTALERATGHTAATPGLAGLVGGLLTEVATGARPLRAVAH
                     PLGFYCLPVLRDGAHGVCVHVFDPGPARADREIHCHSWELKSSVLYGRIGNLRVRVHD
                     EPARPTHRAYEVHSADGIDEIRPGPRLVRWEPLAEQTSSRGETYTLGAGEFHATLLPD
                     AAPAATVVLGRTVPGPLDVVLGPVDGTARRVVRRLCDAARTARIADEAARRISGRHGT
                     R"
     CDS             complement(178214..179218)
                     /codon_start=1
                     /locus_tag="KSE_01530"
                     /product="hypothetical protein"
                     /protein_id="BAJ26004.1"
                     /transl_table=11
                     /translation="MAHAGTGGGGRLESAIAWVLRNSDGVVALAGALAVGLLDLFGGG
                     LGDNVVSGATLLVLAAVVYGSLAERRRRVVDIREATEGARQALENLASVRELAGVDLE
                     RALERARQDTDRWVFKGGTGTYLRAVTLPECVQEARRRRRALTVKIDIVHPGNEAVCA
                     AYARFRGTFGTADRRTGGGSGSGLGGGGGGHDAGWSVERTRKESYATVLAAAWYRQRL
                     DTLEIDVHLSEVAPSLRFDVSASCLIITQDDPRRVSIYVERGRPLYDYYVTELHHYRE
                     QAVKLDLRDTEPLGDDPTVDEARRLFEHLRLPLPTAFSDRDVNDIIDRALHAENPYRR
                     "
     CDS             complement(179423..180511)
                     /codon_start=1
                     /EC_number="1.1.1.-"
                     /locus_tag="KSE_01540"
                     /product="putative zinc-containing alcohol dehydrogenase"
                     /protein_id="BAJ26005.1"
                     /transl_table=11
                     /translation="MKASVTEGLGQGFVVEEVDLADPVGHEVRVRVRASGLCHSDLSV
                     ATFIGGEFPVVLGHEVAGVVTETGPQVTQVKVGDHVVGSLIQYCGSCVNCLSGRTHIC
                     LRPEATLRTPDQAPRLSWNGAPVAQGMGLGGFAQEALIHENQLAVVPEGMPWAPAALI
                     GCGVLTGAGAVLNSADVRQGDTVVVIGAGGVGMNAVSGARIAGAGTIIVADIEDAKLE
                     RAKAFGATHVVNSRSTDPVDAVRDITGHGADHVFDFVGARPVTAQGLRMLGKGGGLYL
                     IGVGGTDAGVEVSALAVLSGSQKVQGVYMGSSNLKRDIPFYASMYLQGRMNLDDLVSR
                     EIGLADIEAGYEALKDGSTARVVITDFS"
     CDS             180693..181373
                     /codon_start=1
                     /locus_tag="KSE_01550"
                     /product="putative TetR family transcriptional regulator"
                     /protein_id="BAJ26006.1"
                     /transl_table=11
                     /translation="MSATPPDPAPVGAPAGATPDAPADDTPDALDVRVRRTRDRLREA
                     VLRLASERPVEEIAVADLVREARVNRTTFYKHAASPAAVLEQVLYEELDRLRAAWIAD
                     VLAGGLPVPVIWERASHALLDHLERHDALYTIGLAEHRSAALHRLLVDHFAASVATLL
                     ARDPEAVPGRDGPLAWRVEASSRFLAHGEVGIVEAWLSLPAPRDRRLFASAATALLPP
                     WLAAHPQP"
     CDS             181517..183283
                     /codon_start=1
                     /locus_tag="KSE_01560"
                     /note="Belongs to Streptococcal 67 kDa
                     myosin-cross-reactive antigen like family (IPR010354)."
                     /note="Similar to 67 kDa myosin-crossreactive
                     streptococcal antigen in Streptococcus pyogenes (Q54525)."
                     /product="hypothetical protein"
                     /protein_id="BAJ26007.1"
                     /transl_table=11
                     /translation="MYYSSGNYEAFARPRKPAGVDGKSAWFVGAGLASMAGAAFLVRD
                     GQLPGERITVLERLKLPGGALDGIKEPKRGFVVRGGREMENHFECLWDLFRSIPSIEV
                     EGASVLDEFYWLNKDDPNFSLQRVTHQQGRDAGTDGLFALGNRAQRDLLKVFLATRAE
                     MEGKRIDEVFGEEFLASNFWLYWRTMFAFEQWHSALEMKLYLHRFVHHIGGLPDFSAL
                     KFTKYNQYESLVLPLYRWLLEQGVVFRFDTEVTDVDFSFADGRKRATRLHWLAAGEPG
                     GVDLTADDLLFATIGSLTENSDNGDQHTPAKLDEGPAPAWDLWRRIAAKHPDFGRPDV
                     FGAHIAQTKWESATVTTLDRRIPAYIQKVCKRDPFSGRVVTGGIVTVRDSSWLLSWTV
                     NRQPHFKQQPADQVVVWLYSLFVDRPGDYVKKPMQECTGEEITREWLYHLGVPVELID
                     PLAAEAARCVPVMMPYVTSFFMPRRAGDRPDVVPPGAVNFAFIGQFAEAGDRDCIFTT
                     EYSVRTGMEAAYRLLGVERGVPEVFGSTYDVRALLNAASRLCDGAPVGLPGPHVLRKR
                     LDARLGTSEIGELLKEYNLLPE"
     CDS             complement(183335..184906)
                     /codon_start=1
                     /locus_tag="KSE_01570"
                     /product="putative multicopper oxidase"
                     /protein_id="BAJ26008.1"
                     /transl_table=11
                     /translation="MSGRLTRRGLLGAGGAAALGLGAAIGIPPLMNRLLPGGEPGRLL
                     RSALPLPARYTAELPVPAVLRPVRSDADADYYEITARRATVRLLPGHDTEVWGYQGTF
                     PGPTVESRSGRRTVVTHRSELPRPTAVHLHGGHTPQDSDGHPLDLVGGSAAHHDMPGM
                     AGTDGMAGAEGATVLAQRAYTYPMAQRAATLWYHDHTMGFTGPQVYRGLAGFHLVRDE
                     EEAALGLPHGPRELPLMIADRSFAADGSLAYPELPGGAPGVRDAYMNGVLGDVMLVNG
                     APWPLARVDRAWYRLRLLNAANARRLRLALDPQPAGGGALVQIGSDGGLLERPLRHDG
                     VDLAPAERCDVLVDFSRYPAGTRVRLLNRLGDGPAGEVMAFEVGSAAADDGFRLPDRL
                     ATVERLDPAKAVATRTFVFRKGEQHWTVNGEEYRPGRSIAAPRLGQVEVWRFVTDFHH
                     PVHLHLDPFQVLGRTSGRPGRNDTGWKDTVDVLPAQGVEVAVRFTDYAGRFLLHCHNL
                     EHEDMAMMAEFTTTE"
     CDS             complement(184903..185388)
                     /codon_start=1
                     /locus_tag="KSE_01580"
                     /product="hypothetical protein"
                     /protein_id="BAJ26009.1"
                     /transl_table=11
                     /translation="MSEYREPPRWPLTVLRAGAALTALLALLMPFLAGGFLQGYYPLL
                     DAHKQTAMALSTVSLLTAAAGLLLWRLSRGPSGPAVQYGVLTLLCVVQYAFGDERILL
                     LHVPLGVGVFVMAEKSVVEAFKVKLGAGAGAGAGAGDKAGAKPADAPDDEPAAAAAGA
                     E"
     CDS             complement(185529..186992)
                     /codon_start=1
                     /locus_tag="KSE_01590"
                     /product="hypothetical protein"
                     /protein_id="BAJ26010.1"
                     /transl_table=11
                     /translation="MSARPRTTSRRARLAAAAAIAAAGLAATALTVVPASAADAFSVQ
                     YRTSASGATADQSEPWLQVTNTGSGTVALNRITLRYYFKSDGPSTTYRFACSWAVKGC
                     ANITGTFGTLANPTATADRYLEIGFTAGAGSLAPGQSTGDMQLRFYRSDWQTLTQSDD
                     YSFGGAQTGYADWQKVTLQEDGALVWGTAPAGNNPSPSPSSSPSPSPSGSTSTPPVDP
                     NAPVLFDDFSYGTSADAAVQQHGWTVKSGQGGPGVSGATWSPADVTFPTVGGSKVLNL
                     RLTTDGTAAGTRETEIQTTARKFKNGTYAARVKFADAPNSGPDGDHVNQTFFAFTPLN
                     APMDPNYSEQDFEYLPNGGWGEPGDIMYETSWETYNPDPWNAVNTHGEQRQSYDGWHL
                     LQFTIDNSAITYWIDGQVVATHGEPYLPETPQFIDFNHWLIDLAGQYSTTPRSYDQQV
                     DYVYFVKDQVLSPAQVASNVAALRSAGTAFKDTVPGS"
     CDS             complement(187166..188698)
                     /codon_start=1
                     /EC_number="3.2.1.52"
                     /locus_tag="KSE_01600"
                     /product="putative beta-N-acetylhexosaminidase"
                     /protein_id="BAJ26011.1"
                     /transl_table=11
                     /translation="MILPTPVDLVPAAGRFTLTERTTVRADGGAAAVAELLRTLLRPA
                     TGLPLAPGAEGTVVLTLDPGDRELGEEGYRLTVDPFQVVLHAARPAGLRHAVQTLRQL
                     LPPEALAAGPVSGVEWSLPAVRITDHPRHAWRGFMIDTARHFQPVERLLAAVDRIALH
                     KLNVLHLHLTDDQGWRLPVDAYPRLTEVGARRARSMAGHAGSAAYDALPHQGAYTKAE
                     LRRLVGYAAERGVTVVPEIDMPGHTRAALAAYPRLGNQPGRQLDVWTEWGVCETVLGV
                     HEEALEFCRAVLDETLELFPSRYVHLGGDECPTVEWERSPAARRRAAELGLAAPAQLR
                     GWFLGEVGRHLLAAGRVPVCWAETDGATLPVEFTVMPWRDAEHGREAARRGHDVVMAP
                     HRATYLDYPQSARPDEPLGQAGYVVDLAATHAHQAAPAHWDEAERARVLGTQAQLWSE
                     FVTTAEHFDYLAYPRLCAIADRAWNPASDYVRDFLPALAAHRPRLAALGVHHAERALS
                     LT"
     CDS             complement(188809..189720)
                     /codon_start=1
                     /locus_tag="KSE_01610"
                     /product="putative sugar ABC transporter permease protein"
                     /protein_id="BAJ26012.1"
                     /transl_table=11
                     /translation="MNPLAPRPRQARRPPQAPRPRQARRPSRARRLRRLPLNLAALAV
                     LATAAFPVYWMVATAFKPTAEIQSATPTFLPLHPTLDHFATAVRAPGFGGYWRNSLLV
                     TLGAVLLSLVVALLAAYAVGRLRWRGRRAFLLLVFTAQMAPWEALLIPMYVIARDTDM
                     LDSLSMLTLVYFMTTLPFTIVTLRGFLAAVPAELEEAAQVDGCTRAAAFRRVTLPLLA
                     PGLLATSLFGFITAWNEFAFANTLIIKNQDARTLPVWLSSFANVFGTDWGATMAAATL
                     FMLPVLLVFLFLQNKVTTGMTAGAVKG"
     CDS             complement(189717..190631)
                     /codon_start=1
                     /locus_tag="KSE_01620"
                     /product="putative sugar ABC transporter permease protein"
                     /protein_id="BAJ26013.1"
                     /transl_table=11
                     /translation="MPTDAPPPLRTRIRPYLLIAPTLVGAAYLLLYPVARNLVISFQH
                     FRMAELIRGGATFTGFDNYTELLTDPKFWTVTARTLGWTALNTLLITGLGTLVALMLV
                     RLGRRMRLAVMSALVLVWATPVIAATTVFQWLFQSRFGVVNWALDQLGLHGYHDYAWF
                     AHSGATFTVLVLLVVWQSVPFAALTLYGGLTTIPTELYESARIDGAGAWQTFRLVTVP
                     VLRPLFALVTSLEVIWTFKCFAQIWVVSQGGPDGATTTLPVYAFQIAQNLHKYDLGSA
                     ASTLTVLILLAALVTTLRRMHRQEGAEA"
     CDS             complement(190686..191960)
                     /codon_start=1
                     /locus_tag="KSE_01630"
                     /product="putative sugar ABC transporter solute-binding
                     protein"
                     /protein_id="BAJ26014.1"
                     /transl_table=11
                     /translation="MRSPALPTTLRSAIALLLGAATLTACSSGPAAQDAAGPAELTVW
                     IMKDTVTDGFLKDFEADFEATHPGTTLHVQVQEWEGIGQKVTSALASKDAPDVIEVGN
                     TQVAQYAASGGVHDLGDKAAELGGKDWIPGLADPGKIDGKQYGIPWYAANRVVIYRKD
                     LFQQAGITTPPKTRDEWIADTQKLNTGGNEGIYLTGQTWYVFAGFLWDEGGDLAAKGA
                     DGKWAGTLDTPQAKAAIGFYQQLQALGRGPKDADEAKPPQAEVFAQGRTAQLISTPGG
                     AAAILKADPGLKDKLGFFPIPGKSAGKPGAVFTGGSDLIVPESSRHQQAAYEVVKALA
                     GDKWQTAIAKEMSYVPNRTTLASALSGNEGAAAMAVGAANGHATPNSPDWAAVEADNP
                     IKQYMTQVLTGTDPGAAGKTAGAAITKALSGN"
     CDS             192285..193133
                     /codon_start=1
                     /locus_tag="KSE_01640"
                     /product="putative GntR family transcriptional regulator"
                     /protein_id="BAJ26015.1"
                     /transl_table=11
                     /translation="MTTDSSGGAGLKRDQVREYLRELVESLTPGDPVPSERTLCVQLG
                     VSRPTLRAGVDELVAAGLLVREHGRGTFVAPAKIVQELTPSGGGDPSFSVPRASGSWT
                     SQVLEFTPLPAGAAIGRRLRLSPAAPILHIVLLRLVDGEPMAIEHLHVPADLLPGLTP
                     DDLEHGDLYQLMAGRGVHVHQAVQAIEPTVVSEREARVLAVPPLSPALRFDRLTTDET
                     GRPVEYVHSLYRGDRYRIVSRISLADPSPTAPGDSRHHPGIPPGDLTTLGTGPTVTTG
                     DIQPLL"
     CDS             complement(193184..193453)
                     /codon_start=1
                     /locus_tag="KSE_01650"
                     /product="putative transcriptional regulator"
                     /protein_id="BAJ26016.1"
                     /transl_table=11
                     /translation="MPIAVDIDVMLARRKMSVGELADRVGITPANLAVLKNGRAKAVR
                     FSTLAALCEVLDCQPGDLLRWELGEPGEGHGQARGQGEDDGAVGG"
     CDS             complement(193453..193944)
                     /codon_start=1
                     /locus_tag="KSE_01660"
                     /product="hypothetical protein"
                     /protein_id="BAJ26017.1"
                     /transl_table=11
                     /translation="MGKPAVRVLRVVLAVLLVGTVLVQALMLWMLIGGGDPEDGRLPL
                     TAFRIATVLGIGAVQTVLVCVWRLLAMVRRGTVFSPAAFRYVDGIIGAITAAALVWFA
                     VTALNAPGQREDPGVTLIMAGIGLAVLGVALVVYVLRTLLAQAVARDTEATLLRAELD
                     EVI"
     CDS             complement(194050..194673)
                     /codon_start=1
                     /locus_tag="KSE_01670"
                     /product="hypothetical protein"
                     /protein_id="BAJ26018.1"
                     /transl_table=11
                     /translation="MTADDLTEGLRLVVELLKGPEAAAADWDRPAGTLEWSCWETAEH
                     LADDLFSYAAQLGPQSPPAEGFVPLVWRREAPGKPANVVFAQRETGAPGMAQVLEACG
                     ALLVAMVGAARPEHRAFHGFGTADAEGSAAMGLVELFAHAQDLALGLGLAWTAPAGIS
                     ARVLHRLFPDAPTGTDPWPTLLWATGRGDLPGRERLTEWRWYSAPRG"
     CDS             complement(194761..195792)
                     /codon_start=1
                     /locus_tag="KSE_01680"
                     /product="putative LysR family transcriptional regulator"
                     /protein_id="BAJ26019.1"
                     /transl_table=11
                     /translation="MIDRPSRTVRSAQPNAYPGRRGWDGGTAGRRARKAARKAERPVE
                     LRQLRTFEAVVEHRTVTEAAGALGLAPSSVSEQIRALETSLGTALFDRRPRGMALTPA
                     GQRLLPWAARLREQAEQARHETATEHPTVRLGALESLAATHLPPLLAQLADRRPELRV
                     TLQIGSDRGALLADLAGGTLDATLLLDTAGALGGLGFPLPPADLEHLDLRDVPLVLVA
                     APDHPRRHHTGLRPADLLGTRLLVGSPQCSFALAGHRHFGDRLERLHTGGVTVTRACA
                     ERGLGMALLPEFTVREQLAAGTLAPLHLADPPPPLRLRLVWRRDEERARPGLRDVLYG
                     ISGTAGAAG"
     CDS             195857..197260
                     /codon_start=1
                     /locus_tag="KSE_01690"
                     /product="putative drug resistance protein"
                     /protein_id="BAJ26020.1"
                     /transl_table=11
                     /translation="MSTTSLPTTTAVPSGSPPGRSRALLGLSLSYFAVLLDTTVLAVA
                     EPDLAASLGSSTAGLQWVVSAYSVAFGAVLLSAGTVADRFGAHRLFRVGAAAFGAASL
                     LCALAPGVWVLVAARALLGVAAAVSVPAGMALLGVLYPVPAERARAVSVWAAVSGAAM
                     VCGPVLGGALVGWFGWRSVFWLNVPLTVLVLVLTASSAVRAPGRPGRVDWWSQAGLVV
                     ALALLTDALIAAGSDGGWHVGVSGAGAVLAGGWFARRERAGELRRGLLAAAGVRAALV
                     AGAAVNFAVLGVLFVLPLVFGRSWGWSAALAGAAFLPMTVSPACVPLLLTGRLVARVG
                     PWRPVAAGLVLLAAGCAGAGAALGRGAPYGVLAVALGAVGLGVALSLPALVAGVVGAA
                     PAGTAGSASGLLNAARQVGASLGVAVAGALVGGAAGGAAPGRAGSAGALLVAAAVCAV
                     AVLPVLRLVGRVPRTPS"
     CDS             197378..198625
                     /codon_start=1
                     /locus_tag="KSE_01700"
                     /product="putative major facilitator superfamily
                     transporter"
                     /protein_id="BAJ26021.1"
                     /transl_table=11
                     /translation="MRERAKTEGLAAQLRHPPGGRDGRTMLLTLFVDRTGTGVWAAAC
                     VLYFTELSRLTATQIGLLLGLSSVAGIAGTPLAGRLAASYGVRPVLIGCHLLRVAALG
                     AVLCCSAFWPLLALVALATLGDRAARAMEMLYATEVAGERRSAYRALSRTAMNAGYAA
                     GAGLAALGLAVGTPAAYRALVVADVASFLVAAALVASLREPFPTRAADGAAADPAPRP
                     SPWRDAGYLRFVALDAVLTIDDAILNVGLPLWLIHSTRAPHALVPAFLVVNTVVVVLA
                     QLRVSALVHSARQAVRVVPVYGFAILGCCAAAALAHRTGAPAASALLLAAAVLVTLAE
                     LVRSVVSWELSVALAPERARPEYLGVAGMAHSTEKAAGPLLLTGAVLATGPLGWLTLG
                     AATTAAAYAQRRYGALRLAALTR"
     CDS             complement(198816..199436)
                     /codon_start=1
                     /locus_tag="KSE_01710"
                     /product="putative isochorismatase family protein"
                     /protein_id="BAJ26022.1"
                     /transl_table=11
                     /translation="MSMMEASATLREVIGLDGTPPELGEATLVLIDYQNTYREGVMRL
                     EGAEEALAAGARLLAAARAAGAPVVHVVNDGGPGTPYDIRAEIGAISGPVAPAAGERV
                     VVKAFPDAFHETELAEVLDALDGDGPRRDLVLAGFMTHMCVAFTAQGAFRGGRRPTVV
                     AEACATRALPGPDGTVVPAAQLHAAALATVGDLYGTVVAEVAALTG"
     CDS             complement(199515..200471)
                     /codon_start=1
                     /locus_tag="KSE_01720"
                     /product="putative AraC family transcriptional regulator"
                     /protein_id="BAJ26023.1"
                     /transl_table=11
                     /translation="MIAVFPDVDLLDVTGPAEVFALANRESGGRAGYRVELAGPAEGL
                     VRTSAGVRLAVDLTFDQVAGPLDTLLVPGAVDPGADGPRARIDPDVVAWVRRHAPTAR
                     RTASVCVGAHLLAAAGLLDGRRATTHWSTAAQLAADHPEVTVDPDPIFVRSGPIWTGA
                     GISACMDLALALVAEDHGEELAMSVARQLVMYLKRQGGQSQFSVPLSSPPASRRDIDE
                     LRLHIAEHPDGDLSASALAARMCLSERHFARVFRQETGSTPGAYVEAARVEAARRLLE
                     GTDQPLEQIAAASGLGSVDTLHRAMRRRLGTTPAAYRKRFRL"
     CDS             complement(200666..201472)
                     /codon_start=1
                     /locus_tag="KSE_01730"
                     /product="hypothetical protein"
                     /protein_id="BAJ26024.1"
                     /transl_table=11
                     /translation="MNHGTMAHLDGFQYGWVNPVVAYLIACVGAAIGLRCTARAMTLQ
                     PKKRFGWLALAAGAFGCGIWSMHFIAMLGFMVDSSSLVYDIPLTLVSLLVAIAVVGLG
                     IGYVGYRGKSTGALLVSGVVTGCGVAVMHYVGMAAMQVEGKVSYDTLLVVASVAIAIA
                     AATAALWMTLHVKGLPAALGAALIAGVAVVAMHYTAMAAVSVSLDGRPLGGGTPASQF
                     ILPLAVGIMVVLAVAGIAIALSPQDPEDGEGGGGPAVEPIRVDLFGQERY"
     CDS             201697..202104
                     /codon_start=1
                     /locus_tag="KSE_01740"
                     /product="hypothetical protein"
                     /protein_id="BAJ26025.1"
                     /transl_table=11
                     /translation="MEHLPEPPAPLLVVDGANVVGSVPDGWWRDRRGAAERLRDALVP
                     VATAGLPGLPGPLAVVLVVEGAARGVEPVPGVRVVSAPGSGDDRIVDLVAAEAAAASG
                     RRLLVVTADRELRGRITALGAEPLGPRTVRHRT"
     CDS             complement(202261..206583)
                     /codon_start=1
                     /locus_tag="KSE_01750"
                     /product="hypothetical protein"
                     /protein_id="BAJ26026.1"
                     /transl_table=11
                     /translation="MKYLIPAQPAPRPPRTRLRAGALAAALAVTSGLVAAAPFTAGAT
                     TVDPNAAVRAADAQRDQDAPPSTAGLKQDTEVGRALAEAARTGADVPVPGLTTEFSES
                     VATPAGHLRETQHPKQQRVKKAGTWTPLDATLVAAADGSIHPKTAASDVVLSGGGAGD
                     LATMTAAGGRKLAVGAPFALPVPELSGSTALYRNVAPDVDLRVSVTDLGGFSTVLVVK
                     TPQAAANPLVNDLKFTTKADGVTVSADKGGNLTAADDAGKPVFRAPTPLMWDSAATTA
                     APAARTPRQAPAAQGAAADSAAPTGPADGAKVAALSVAATPGQVSLGADRSLLTDAAT
                     VYPVYIDPAWVPVTIGQPSWTWTQQGFPNTSNYNKSSSDVADHPGVGYQGFSAPTGIQ
                     RAYYQFNVSGYKGVVVNRATLNVEEYYSSDFSCSNTYGVSAYLSAQFNSGTTWNNAPA
                     RYDSLGTAQVGGARQNGCNGNVPVQYDATAVIRNGTGSGWDVAAFTLQGDEANRNGFK
                     RFDYNASLSIEYDRAPNAPTDPKVGPAEPRTVSPATTTETCNNNGIGDWGWVNGDTAT
                     LSAVVSSPSQSQLAAWFHIWDYAQSGAPQVAEGTTGMVNSGGRATLQLPAGLLQDGHH
                     YGWGGFATDTLPGVGWTQFSPDCHFRVDRTAPTVSFPDKVADPTTQFPPSGNGQTTGL
                     YAGQTGSVPFTATDPNPSGLQTSGLACLRWSWDPQLNGAAWQCGSAMPTGSIQVTPGH
                     WGTNILYVQAQDNAGNVSVSGAYTFYVPWSAKGPAPVFGDVTGDGTPDILAPDSAGNL
                     RAHSVPGNDQATKAAVYLASPANQSPGKDGWAGYDLTHRGTFAGGGNVDDLLVHKPGS
                     PDLYLYNNPGNTAMAGRFDTKTPLVKPECQSGTDCAGYNGTWNGTLSIAAVGDPSTTG
                     LDTAKQFLNKSGLLTVETGTDGRDSLWFYPGVNSSQLGAPIRLAATGWKDLQLLPAGD
                     WAGQGHPGVWTRHKTTGELRGYTFKVDKATIDGDFDPIEYPVLTSVATDTHLSGVDPK
                     GWPLIGSDGDLTGSGQAALWGVDTAGTIQIWTGRSTGTQTAPAYTFTNGPDTVGSTGT
                     GPDQWQLGSSSTNNGNAVDTLGGNPLTAPAGATWTADHKGTANNAAAFTGNGATYATK
                     TNGIWGTADLTAVNSLLPGQRLTAVNTKLTMQNDGNLVLSPLNAPTVLWESRTGGHPG
                     AKAVMQADGNFVVYDTSGAALWATGTNGRNGSYLRLQSDHNLVVYTSGNQAVWASNTF
                     DGTYNTAIAVAANGTGVDTGKSYTLSAWVKVDRDTGGDQSFVCQNGDTLPPVNLQYIN
                     GSKAWGAYTPTQDDWNAGWPVAKSADNSAAYGQWTHLAVTYDTATHAVSLYVNGVHSG
                     STTQETPWGSGNAASAARALTVGSCYMNNNKDVINKLDGAVSDVRTYPYALTPAQVAA
                     LAAT"
     CDS             206846..212956
                     /codon_start=1
                     /locus_tag="KSE_01760"
                     /product="hypothetical protein"
                     /protein_id="BAJ26027.1"
                     /transl_table=11
                     /translation="MALSPGGAGRARPWSPFRTRIAVLSALAIAASVLAPTAATAAGS
                     SDRIWSPPGTALPKTKAVGGKAAGKPTQVTPKYQVPSDWAPADGTPADSGASASPSAA
                     ARGLAAPMAQPAAAPAGSPGGDGTYTATSLAPSSAWAAGNASGSFTYNYPVEVPAPLA
                     GAAPQVVLGYDSASVDGRTSSTNAQASWIGDGWDYSPGFIERSYQVCDKHGIDNSFDR
                     CWAGDNATLQLGGHSGELVRDDANGSWHLKDDDGTRVEFLTGAANGDDNGEYVKVTDN
                     DGTAYYFGLNHLPGGDRTDPATNSAWTVPVYAPAAGNPCYDSAKGAGSWCNQAWRWNL
                     DYTVDTHGNLTTYNYAAETNYYNRGGAQNGGTGTLTGYTRGGTLTSIAYGQRLADQVA
                     AKGTAKAAATVRFDTAPEGRCSTAGGFTCSGASISTAGAAHWPDVPYDQNCAATGTCT
                     TYSPTFWSNARLASITTRVLSGGSYRNVDTYALSHSFPDPGDGTKPAMWLSGIQRTGK
                     DGTAITLPATTFTPVMLPNRVDGTSLVPAPAPFNRPRVQMVTTETGGQTNIDYNLPSC
                     SRLQGVMPSAADNNTTSCYNVKWYPRGSSADSQPVDDWFNRYTVRSITENDPVTGAPQ
                     KVAAYAYGPAAWHRDDSALTDSKTRTWDSFRGFASVTTTTGDGNDGPKTQTRTTYLQG
                     MNGDLRADGSTRGVTVTDSLGESVTDDDWLQGRVLESAVHTQAGGSVTAYTVTRLTDP
                     VITATRARGSGLPALVARYGATRSAITTKSLKADGTWRTTAEVATTDPANGNRPVRQD
                     KTADGQAELCVRTSYATGSDPMVRNLVSEKLTVRGDCSTAPSSGNTLAGSRTLYDGKP
                     YGQAGGAGDATGEQVLDRFDAAGTAQYVTMSVTGYDGYGRVTSTTDPNSTDAQHPAGA
                     TTTTAYSAANAGELPDSVAVTSPAPASATGWTSTTTLSPARGLPLATTDQNGRTTTSA
                     YDALGRITAVWLPGQPTTSPANQTFAYAVNGTGAPSSVTTSTLNDNSQYTRVQVEIYD
                     GLGRVRQVQSTPTVSAYQGRLITDTYFDSHGWAAKTNAAWYNDAAAPGTALYTAADAV
                     IPAQTRTVFDGQGRPTASAFYSLNQEQWRTTTSYPGADRTDVTPPQGGTPTSTVTDAK
                     GRTVQTWQYRTPTATGRESDADVTTVGYDDAGNTVSHTDAGGKNTWSYGYDLRGRQTS
                     VNDPDAGKSTYTYTAGNQVRTVTDARGITTSRDYDLIGRQTGLYEGADTTDPSKQLAA
                     WTFDTVAGGKGRPSSATRYVGGAAGDAYSTQVYGYDNAYRPTGTTWSVPGREVGQTAP
                     FTYTSRSAYNTVTGSLKSTLTPAVADRAAETISYTYDVNGAMLKFGTSSTVYDMGTNY
                     DAYGRPVRTTVNPWGTQIVSTVNYDEATGRVVSHFVDKQTSATGAVQQSTLTYDASGK
                     VTSVKDVADNAPAGTDLQCFGYDYLGRLTTAWSDTGTTTTKPQPAVPGQGACTNASPT
                     SGAVAPAGTTVGGPAAYWQSYTYDTTGNRTALVKHDTGGNGAADVTVTQSFPAAGSTN
                     TPTGTPVPGSGSGGPHALLGSTATGAGNPGPTSYRYDAAGNTTSITTAAGTSDLAWNA
                     EGKLSTLTGAAGSTGYVYDANGNLLVRHSPGRTTLFLGSDELGYDTAGKTLSDVRSYP
                     LPNGLTAVRSGTAMVFQVADRHGTNGLAIDATTLAETRRATDPFGNPRGTQPTGWTGT
                     RGFVGGTADAATGLTTLGAREYQPATGRFVSTDPVLDPDDPQQWNGYAYGDNNPVNLS
                     DPTGLRPDGQYGGFSSLMPDGLTETWAPDNNGGWNWSRKYALGAPGKGVTQWVTQTVN
                     FNNKKPSADRTTFVNQKFRPNATWSSVLHVGAELSGVNDLRDCSKGSVSSCGWAAMSI
                     VPFGKVGKAVKIAEEGAEAARAAHAAEDANHVVPKKGKEVVKGAENVARDMLDPESMR
                     GATWDEALELAKGDGWILEDAPRATGGGFILRKGNPFILIEKGDKGARSLDHQGPYIK
                     YQFGSKAVRIPLQGNPALKQ"
     CDS             213018..213365
                     /codon_start=1
                     /locus_tag="KSE_01770"
                     /product="hypothetical protein"
                     /protein_id="BAJ26028.1"
                     /transl_table=11
                     /translation="MCDWSDLEECLLVNAVELSPLWALAPDCSRSDDEADWPPYVERL
                     KPLIAAWVRAGRIALWRGPEWPAFEGGHRVSIEDVDAVLSDDEFWTYRESATVVVHLE
                     LLVETDRIRPPLG"
     CDS             complement(213385..213705)
                     /codon_start=1
                     /locus_tag="KSE_01780"
                     /product="hypothetical protein"
                     /protein_id="BAJ26029.1"
                     /transl_table=11
                     /translation="MRLLFVCQDCGCHYLVPTSLDYPDGGRASAVWCSSCQRAAAERG
                     AAEPAELAAVAVLLALRALKAAVAVRPAPSDTPPARPDRRPTRPAISSRGRTHPTAAR
                     TRLA"
     CDS             complement(213702..213971)
                     /codon_start=1
                     /locus_tag="KSE_01790"
                     /product="hypothetical protein"
                     /protein_id="BAJ26030.1"
                     /transl_table=11
                     /translation="MRAPHGCAEGIGGWSGGEPLSRTGVGTLRSVVWRWPMTDQQTCP
                     GCGGARGTEKTEHSVETDAEGRQQPVRRSYWSPCSVCGGSGVVQR"
     CDS             214046..214744
                     /codon_start=1
                     /EC_number="2.3.1.-"
                     /locus_tag="KSE_01800"
                     /product="putative acyltransferase"
                     /protein_id="BAJ26031.1"
                     /transl_table=11
                     /translation="MIPRMIPHTNPRTSTDQSAGPGSLPQGVLIEHRGAAPQVHPTAY
                     VAPTATLVGDVRIGPNARVMYGAVLDAEGSRIEVGESSVVCENAVLRASAVAADQPVL
                     VGDHVFVGPHATLLGCTVERACYLATSVSVLQEAVVGTGSVVAVAALVHTRTVLPADF
                     FVPPYLTALGEPVRLLAPGDPEVPQAIGRLGFAGTAFGVDASWTDRIARHERIAEVRS
                     AEFGAHLADRPARS"
     CDS             complement(214866..215186)
                     /codon_start=1
                     /locus_tag="KSE_01810"
                     /product="hypothetical protein"
                     /protein_id="BAJ26032.1"
                     /transl_table=11
                     /translation="MYRGPALLLADGLEIPVQAELTGNVPEVGLPGWTGMLESGDTRF
                     SAGAVRFGRLRLPDGWEGGFAVMRRLLGVSTVWVRGNDVEASPADWPDATRQQQAETG
                     DAGR"
     CDS             215396..215833
                     /codon_start=1
                     /locus_tag="KSE_01820"
                     /product="hypothetical protein"
                     /protein_id="BAJ26033.1"
                     /transl_table=11
                     /translation="MIKPLAVLAGAAALSATLTVPAVATTTDTPQTTTACGGWALQGG
                     LATQICAERTGDQVRLYGTLGLAGPPSPGTPLPYRKDVIITLTGTTPSGSVNQYITFT
                     GSNQQVGNIIGSVPCDAAIQGTYSVSSFDLGPHPVTINTVIPC"
     CDS             215935..216495
                     /codon_start=1
                     /locus_tag="KSE_01830"
                     /product="hypothetical protein"
                     /protein_id="BAJ26034.1"
                     /transl_table=11
                     /translation="MPTTSHPRVEVVLGDLTEQDTAAIVTAANESLLGGGGVDGAVHR
                     AAGPRLAQAGGALAPCEPGDAVATPAFDLCPPVRHVIHTVGPLWEGGGYGETEVLASC
                     YRRCLAEADRLGAESLAFPAIATGAYGFPAELAARIAVETLTGTPTAVTLIRLVAFDA
                     PTRALLAALLGDLPGDLLGDLLGGSR"
     CDS             complement(216512..216850)
                     /codon_start=1
                     /locus_tag="KSE_01840"
                     /product="hypothetical protein"
                     /protein_id="BAJ26035.1"
                     /transl_table=11
                     /translation="MGIGIELHSARPRRLDPAHTRATLLRASHEHGEGLARVLHELPL
                     DRGWRLWRIDPYDHTFFDQREAAAALGEIDRLLALCVDEEQRAAAVDLERMLGACAAT
                     SGGWLWFVGD"
     CDS             complement(217014..217526)
                     /codon_start=1
                     /locus_tag="KSE_01860"
                     /product="putative sporulation and cell division protein"
                     /protein_id="BAJ26036.1"
                     /transl_table=11
                     /translation="MTHDPYHDPYRDPAPRRVPPQRGSTTRIAVHLVVEVVVAPALHV
                     PVAARLRYGADEPYTVHLDNHVDLPEPVTWSLSREVLLTGLTHPAGLGDMTVTPGHGP
                     DHGHLLLTLHGEESSALLRLPAPALRDFLRRTECVVPVGCEQEHVDLDGLVERLLGED
                     GEEDGHRDEE"
     CDS             complement(217717..218004)
                     /codon_start=1
                     /locus_tag="KSE_01870"
                     /product="hypothetical protein"
                     /protein_id="BAJ26037.1"
                     /transl_table=11
                     /translation="MAVDIRVEPLGDREYLVEVEDGSVGAATRIRVTDGVLEHPGLAG
                     GDEGRIVRETVAFLAERQPVIDIPPMIDLDDLADAYGDAYLDELVRRLGQV"
     CDS             complement(218198..219340)
                     /codon_start=1
                     /locus_tag="KSE_01880"
                     /product="hypothetical protein"
                     /protein_id="BAJ26038.1"
                     /transl_table=11
                     /translation="MEKHVSHRRARESSGRRPQGRRAVLLTAAAVLVIGSGAAALAAA
                     GSGGDGHPAAAPTAPDTAAATDGTASEPAAAESGSASPSASASGSASASASASASGSA
                     SAKPSASASASASGSKQAGQGDGQGGAATAPPAAPVAKPGTAPATFTGLAFDTCTAPS
                     LATMNAWYGNSPYGAAAVYIGGKNRGCAQPQLTANWVKSVTSGGWKLVPLYVGAQPPC
                     QTGSSPEKLTADTAVPLGTADGNDAVAKAAALGMRAGSTLYLDVEAYNTADTSCADAV
                     LAYVQSWNRAVHGAGYWAGFYGFASSSAAGIAKAAGENAPDLPDALWYAKYDGAADTT
                     GSFPFGGLWGGHRRAHQYQINQKETYNGATVTVDRNAWDAPVAIVG"
     CDS             219517..219966
                     /codon_start=1
                     /locus_tag="KSE_01890"
                     /product="putative BlaI family transcriptional regulator"
                     /protein_id="BAJ26039.1"
                     /transl_table=11
                     /translation="MELAGVDPEHGEGEGDESGRPRRRGQGELATEVLSVLHRAPGPV
                     TASWVQEQLGGELAYTTVMTILSRLLAKQAVVRSRAGRAYVWAAAADAAGLTARRMRR
                     MLDTEPDRDAVLASFVTALTPEDEQLLRSLLNAAEPSPGAGGRDDGR"
     CDS             219971..220903
                     /codon_start=1
                     /locus_tag="KSE_01900"
                     /product="putative peptidase M56 family protein"
                     /protein_id="BAJ26040.1"
                     /transl_table=11
                     /translation="MGFFVFLPLVLPLTSLPIARLAEHHLHPRNAVRLLSWIGVTMAV
                     CSTLALGLLFVVGTAQIPGNPLPDSWSDPEIRTAVPFHEEVGTAAVVGLVTVLTACSR
                     SLRRHLRIRARAQRALAPLPFDSDLVVLPDPEPYAYAVPGEPGRVVVSTAMMDSLDED
                     EQRALLAHERSHLANRHHRYLLAAQLASCVNPFLRPLQKAVGYATERWADEEAAGSVG
                     DRRLTARAVARAALVTRGGGPAPAFAAFAAPGPVPRRVTALLSPALGEAWPPAASPAG
                     LAAMVAAAGTAVSAVSALNAAVALLLLVKAATPW"
     CDS             complement(220952..222541)
                     /codon_start=1
                     /locus_tag="KSE_01910"
                     /product="putative lytR family regulatory protein"
                     /protein_id="BAJ26041.1"
                     /transl_table=11
                     /translation="MLAGRTLACGLSLAVLGISGFAWYTTKELDGVNRSHALDQARKN
                     APQHLDSSVNILLIGLDSRKNMDGTDLPKQFVEDELHAGSSEIGGYNTNSLIVLHIPP
                     SGKAQAVSVPRDDWVQTYNADGTEGRMHKVKEAYGYAKEAAEQKLRAKGLGGAELEQQ
                     SREAGRSATIQTVQKLLDIPIDHFAEVNLIGFYDIAKALEPIPVCLNKAVDDPIVSRI
                     TDSKGNVIRPGGGTGLQLPAGVSQLNAADALSFVRQRHNLTNGDLDRTHRQQAFIASV
                     EYKLKQQGVFGDLGRMQALLDVVKKDVVIDDRWRLLDFVQQAPNLTGGNVEFNTLPID
                     KFATIGGQEVNQVDPVKLRRIVKQLFGQPVDADPAVPVASPSSSSSPSPGSSSSASPS
                     SGPGAGTGEAPVAEATVDVLNGSPVSGAAAEESKALVALGHRAGRIGTADTRPRTTTV
                     KYGAGAQDAGRQIADHYGVTATASSALAPGHVQVVLGADRATPDAGTGTGTTGEPSPG
                     PSATPQMQGPPVRAGGVPCVD"
     CDS             complement(222573..223253)
                     /codon_start=1
                     /locus_tag="KSE_01920"
                     /product="hypothetical protein"
                     /protein_id="BAJ26042.1"
                     /transl_table=11
                     /translation="MSMTGRRSTGTRGDAPLWRDEPAEAQEQAQAGARAEAEAAAEAA
                     AHPVPAQRGPHRDERRAAPADDGGARPGRAARREAGREAGREVTAPNRMPAVLPALGL
                     PVLGALGDELLAPGLGAVYAAAALLGAALAALVATRAGWWWVVSGAPVVTLAVAGGVD
                     YLARGDKYHGAGIGTEGLKLVSAQFPWMLAALAAALLAVGVRLLRVRLLRARRAGRAG
                     RTGRSRRD"
     CDS             223538..224209
                     /codon_start=1
                     /locus_tag="KSE_01930"
                     /product="hypothetical protein"
                     /protein_id="BAJ26043.1"
                     /transl_table=11
                     /translation="MAERRAKWPWAVLALAVLGIWAYERVGDPPPSAAPAATPAAGAS
                     ASPSPSPSPSPSRPRTDYSPPRFAAEVKRYAAEAGVNPQLVMAILYNEAYKPHGPDVE
                     RSWQKMKPDASFGIANMHRAAYDETRQGRPFADRPWEDLPDDPALAVRAAAWHLHDLG
                     AQLPAKLSGSLDRDELTALGYNTGAGNMLLFARGTKPGTEARSYLDRLHDNWSKSADT
                     LAATP"
     CDS             224328..224906
                     /codon_start=1
                     /locus_tag="KSE_01940"
                     /product="hypothetical protein"
                     /protein_id="BAJ26044.1"
                     /transl_table=11
                     /translation="MSDDLLIAKISHGFDHLDADGDGQLTERDHVLMGQSVARSLGHP
                     SGSAEEARIVDAYVAIWRELHLPHLPTGSVSMRRADFLASTASLADDPKAAEATLGAL
                     ARAFLAVVDPDGDGRVHADEFFLFQRGHFPQLRRSDADTAFAHLDRDDDGTLDPDEFV
                     SAMIEYWTSRDPEAPGNWWTGSPQGDPDPTTL"
     CDS             complement(224914..225330)
                     /codon_start=1
                     /locus_tag="KSE_01950"
                     /product="hypothetical protein"
                     /protein_id="BAJ26045.1"
                     /transl_table=11
                     /translation="MRFAPTAPARHHVCPPCRASYKRPAGGGALCPRCRGPLIDAGRH
                     LRVPRRRDEAAWRALTALLRAGVRFPSYCQGAGWRPRTPREVRERLAASAGTGLPVAE
                     ALVTPELDALAELRRAARRVPERVPGPGAAGGAGRG"
     CDS             complement(225382..225702)
                     /codon_start=1
                     /locus_tag="KSE_01960"
                     /product="hypothetical protein"
                     /protein_id="BAJ26046.1"
                     /transl_table=11
                     /translation="MPRVVTPDQEGCHVLPGRNGRPPPRLPALPGPLIDAGRDLPHVP
                     HRRDTAAWRALTALPRAGVTLHSGCRDGPGRRPRTPREVRERRAARPVPGHAPEPQER
                     PGRR"
     CDS             225767..226510
                     /codon_start=1
                     /locus_tag="KSE_01970"
                     /product="hypothetical protein"
                     /protein_id="BAJ26047.1"
                     /transl_table=11
                     /translation="MTDSRAQGMEPVPPPDHDEAHGGALGGRLNWLRAAVLGANDGVV
                     STAGLVVGVAGANASSGELLTAGLAGLLAGSLSMAAGEYVSVSTQRDAEQAALAQERR
                     ELRLTPEAELAELTGLYQAKGLDPELARQVAVQLTAHDALAAHAETELGIDPDALTNP
                     WHAAWASFAAFTVGALLPLLAIVLPPPTHRVWITVVAVLAALVVTGWASARLGGAAPR
                     RAVLRNVVGGGLAMAVTYAVGVLLGASTG"
     CDS             complement(226626..227723)
                     /codon_start=1
                     /locus_tag="KSE_01980"
                     /product="hypothetical protein"
                     /protein_id="BAJ26048.1"
                     /transl_table=11
                     /translation="MHPVLSPAVLAELRRPRPYPAVSILMPTHRREPDNAQDPVRLRN
                     LLAEAKEKVQADPEVSRADRIDVLEQLDKAAAEVDLVHAEDGLAIFAAPGEHQVWSLG
                     RTAPARVVLSDTYLTRNLVSSQIAERPYWVLAVAADRVALWGGNQEKVIPETGHGFPL
                     ERVHDNPDPERQERIGDTPSTFRDEETKTFLRQADTAIGKVLAADPRPLYVFGDAPAL
                     ALLDAVGPIAKSTTAQIPHGGLAQAGAEAVRQAVEPAVRAHADQEITDALARLDKARG
                     RQAFAAGLDEVWQTAAEGRIALLVVEENFRTTARDDGDHLVPAEEGQPGAREDVVDEV
                     IERALDTGATVSFVPDGTLSDAGRIAADLRY"
     CDS             complement(227878..228495)
                     /codon_start=1
                     /locus_tag="KSE_01990"
                     /product="hypothetical protein"
                     /protein_id="BAJ26049.1"
                     /transl_table=11
                     /translation="MRTTDPRPPHPRPEGHPPRPAAGVTERREGARPPGERQAEGGAG
                     ARVGAGGRARARVGWLAAAAAVLLLGLAAPARVPAAAAAPLGGALYTALLYTLLMAAA
                     PRLGPRTAAGTALAASWAVELFQAGGLPADLGAHSRLSRLVLGTTFDPSDLLGYALGA
                     LAALTARQAARRTARRLRERAAGTGKRREREGEWRQRRGERRAGG"
     CDS             228558..229082
                     /codon_start=1
                     /locus_tag="KSE_02000"
                     /product="hypothetical protein"
                     /protein_id="BAJ26050.1"
                     /transl_table=11
                     /translation="MRTIELTCDPAFDRAVRTVWRTLADGGVDSLADNPHPAHRPHLT
                     LAVCGDLGPERLAEAEELLAGALPLEVRLSGLLSFSARSRRRVLAWGVVPGPALIDLH
                     RELWRLLAAEPDPNPLYLPGRWMPHLGLTRRVEPDGLTLAHRLLGRHPDLTGVFDGAR
                     SFDSNTQSTRDFFI"
     CDS             229170..230675
                     /codon_start=1
                     /locus_tag="KSE_02010"
                     /product="hypothetical protein"
                     /protein_id="BAJ26051.1"
                     /transl_table=11
                     /translation="MPDDLTPAQQLVVIDMDQKIAALLGHLGQPDLQALLPGTPAGGQ
                     VQQDLSGRFGALVGRLPGLGNLVKVNTSLNASMGANTLITSGANPQVFRLDLRPDLVQ
                     AVSASYQNTLTVIHELSHTITENHAFPVKDYAYRSGWAWGYLTPALSVVNADTYAQLA
                     VRLAERADNGPGRYSLFGLVPAQREHLRGAAGQTVLGAALAWADLVLNRAWLRSLDAT
                     AHAKVDVPDANWATQQQTWAADPDAAQRVAFEGRLVGANLLSARYSLLGSTGLTTYGK
                     WTVEWIASAVEEAKNLLSGLEVVPVADNGGFVSCSKDRRTLLVSRGVFGDSPVQLGGR
                     ILNAVLAAVAPSGFTAPAWAPRLRDVVDWLVLHDRPQEHAALAPLLTSLGQLPAVATT
                     PAQWDALIQSLPRAVLTDTTARWQMLDGHVAAIVPLGAAAQARLRHLDAALTEDLGRI
                     GNAARKLTASTADVNALLAQVNAIAARVTPLFPDAAARYEDIRRELNPMRH"
     CDS             230846..232351
                     /codon_start=1
                     /locus_tag="KSE_02020"
                     /product="hypothetical protein"
                     /protein_id="BAJ26052.1"
                     /transl_table=11
                     /translation="MPEKLSPEQSLVVQDIDAKITNLVGRLTPAVVRSVLPGAPPGGE
                     AEVDMTRRFRALAGRLTGLGDQVRTDAGLSTAVGAKVSTTQGENPRLLGMELQPRLVE
                     SVSSGYANTLKVLHELTHSLQEGAVFPVKDYAYRTEWAWGYLTPALSAVNADSYAELA
                     ARIAEDEAQRPGRYGKYGPLPAQREYLRGEAGRSVLGAALAWVDLVLNRAWIRAFGAY
                     AHALVEVEDTELERRKADWKADAEFRALVAFEERLVSAQIVDARFSRFGTNRLGLTDR
                     WVVGEIAERLTEAKQLLSRLVVVPLTTDGRHVSLDASSGTLLVSRGVAADTPVQLGER
                     ILEALLAVVAPSGLVVPKYATRLRDIVDWLRYNDRPQEKAALTPLLDALGRLPAVATA
                     PGQWDALAQGLPRAVLADIAVRWRLVATHAADVAQLPEPQRQPLRRLDLELLKDVGAA
                     TVAAGKLAGTAAELDALLAAVDAVAARALPHFADDAPHYEQLRGRLRPLRR"
     CDS             complement(232332..233453)
                     /codon_start=1
                     /EC_number="3.3.2.-"
                     /gene="eph"
                     /locus_tag="KSE_02030"
                     /product="putative epoxide hydrolase"
                     /protein_id="BAJ26053.1"
                     /transl_table=11
                     /translation="MIQPFHVHVPQADLDDLADRLARTRWPNEIDGAGWDYGFPLARL
                     RELAEHWRTRYDWRAHEAGINAIPQYTTEIDGQRIHFLHLRADDPDALPLILTHGWPG
                     SFLEFLDVLEPLRRDFHLVVPSIPGFGFSGPTRERGWDVPRVARAWAELMRRLGYERY
                     GAQGGDFGAGISTALGAHAPDRVVGVHVNYLPLPPDPAAGPLSAEDEARLDGVRALQA
                     ARPPYQMLQATTPQTLGYALTDSPVGQLAWIAERFAHWTDPATPVDDERLLTDVTLYW
                     LTATAASSARLSRETPRGAIPCPVPLGVAVFARDITRAVRPLAERRFDVRHWSEFDRG
                     GHFAGMEVPDLFARDVREFFTALPGPAATATAAATGAAA"
     CDS             233577..234098
                     /codon_start=1
                     /locus_tag="KSE_02040"
                     /product="putative MarR family transcriptional regulator"
                     /protein_id="BAJ26054.1"
                     /transl_table=11
                     /translation="MSPTPADATPADATPERLRAIPSRLLAGAAAAADRLVNERLATA
                     GARKWHFAVLVALAETGPASQAELSRRTGVYRSDMVAVLNELADAGHLVRDPDPVDRR
                     RNVITLTPAGRAHLHRLDALVTAAQQDLLAPLAPAERAELTRLLGLLTARHRPAHDGH
                     RPENPWPGGGSAA"
     CDS             234110..234661
                     /codon_start=1
                     /EC_number="2.3.1.-"
                     /locus_tag="KSE_02050"
                     /product="putative acetyltransferase"
                     /protein_id="BAJ26055.1"
                     /transl_table=11
                     /translation="MTPARTTPAVTLTPLDTDDAELLHGWLADPVAAHELGWWPRPLS
                     ALRERIERDIADGDDDAFLVLRPDGEPVGLAELTGQSLADGTAGVRILTAPEHRGRGH
                     GRAALDALTDLAFGELPFHRLAARPHTGNAPALALLERAGFTREGVERAACRHRGRHY
                     DLAVLSLLRPEWEALERPRAWEP"
     CDS             complement(234696..235337)
                     /codon_start=1
                     /locus_tag="KSE_02060"
                     /product="hypothetical protein"
                     /protein_id="BAJ26056.1"
                     /transl_table=11
                     /translation="MGVWQTVSLVFMPVLAGWSALRILARQGQRLLDYFSALLWSGAA
                     IGLGLGDGPGWLLAAGCVTLAATLLAHLLVVAARRMNQPLREVDPAAFRARLLEVCTT
                     DPSPPAFLAGVGPDGTITVWGLEEAGIPRDRHRPGATCGSCLLEDVVTELAVNGEDVV
                     ASYRTMLSRRANQLFVLRRGVISGDWEAELRPVQGLKAPYAHAPCQVHRYGRP"
     CDS             complement(235431..236114)
                     /codon_start=1
                     /locus_tag="KSE_02070"
                     /product="hypothetical protein"
                     /protein_id="BAJ26057.1"
                     /transl_table=11
                     /translation="MTAKHAPKPLRVVLTDLNAEVVAAWRTAFAGTPGVEIRTGSILD
                     VDADAWVSPTNSRGRMDGGLDAVVRRHLGAGIQLRVQRAIRDGHGGELEVGSAVCVPS
                     GAAVPRFLISTPTMRASAQDVSQTLNVALACAAAFQAVHRQNAATPGSIASVALVGLG
                     AQTGQVPAQVCANLMWTGHSLFQDHEFTDDDELRRTVTDQLTDLLAAPADRPVRLAVP
                     ARTGRTARR"
     CDS             236216..237871
                     /codon_start=1
                     /EC_number="3.2.2.-"
                     /locus_tag="KSE_02080"
                     /product="putative DNA glycosylase"
                     /protein_id="BAJ26058.1"
                     /transl_table=11
                     /translation="MDHQFAPDRLESAMTDAPSSAVAAADPLALAELFGGGGESWLPV
                     LGPVIAARPDAAAFIGPGRPQDVVPVRELTFQALKPNPPGKWKVVVFGQNPYPRPESA
                     TGIAMFDNTFHDWKDSQFGRVVSIRCLIKAAAMWKYGIPKKTPIADLRALLAQHGTVQ
                     PPEWFQAMLTQGVLLLNAALTASGDGSTSPAAHTAFWKPVAERIVEEVLRAKQDGPEE
                     DRGVVFAWWGAHARSLKSLVQRLEKKYPDVRVRHLDHANPAAQGDVFCDGEHFATVNA
                     ALEGLGADPVDWLPSAGWQAAAAAEGRTDAGTASRMGAFIASTMELHQLYLERLASVK
                     DEGLELPPVTGVFDLERVGFREAVEPVAALLRGLERHVGSAHEFGKRHADAPAGGVLD
                     AEAVAALHLYTCESAFYRELNAALRHPDRARLTPYLPYLRLLFDAVGRLPVRPEPLWR
                     GVALDLRAQYPLGRTVTWWGVSSCTSRPAVARSFLGGRGRRTLFEVRPARAVGIQEFS
                     AFTGEEEYILLPGTRLTVTDVVAERGGLCTVTLTESADGPLVS"
     CDS             238181..238945
                     /codon_start=1
                     /EC_number="2.1.1.-"
                     /locus_tag="KSE_02090"
                     /product="putative methyltransferase"
                     /protein_id="BAJ26059.1"
                     /transl_table=11
                     /translation="MFESVPPDPIAYLDRLAVSELGREYKSVMLAALAVEPGQTVVDL
                     GCGPGTDLPALAAATGPAGSVLGVDHDREAVDAAAERTAHLPGVDVRLGDLHELPLAD
                     GGCDRARTDRVLQHVADPALALREARRVLRPGGLLVLGEPDWGTLTVDHPDGALTAAY
                     TRYVTDQAVRNARIGSQLPRLAAEAGLEVLDVHPLTPVFREVAGADRVLGLQRVTHRA
                     VAAGYFSPADADRWLTHLATGPFLAAVTFHVVTARA"
     CDS             complement(239014..240144)
                     /codon_start=1
                     /locus_tag="KSE_02100"
                     /product="putative beta-lactamase"
                     /protein_id="BAJ26060.1"
                     /transl_table=11
                     /translation="MQHADSADSADNADRADSTDSADSADSAGRPELRRLLDRAVTRG
                     GVPGVVVEVRECGQVWRAAAGVADTATGRERTIADRFRIGSITKPFVATVVLQLAAEG
                     RIGLDDPLAAQLPCPGVESAAGATVRELLNHTSGVPSHTDDPAALNAHATHPPATLLR
                     VAAARPRAFAPGAGWAYSNTNYVLAGLLVEHVTGRTLAAEVDRRISRPLGLTGTRLPS
                     AADHGLPAPHARHYTKLFRTDPDAPVLDATTLDPAPFWASGDMVSTVGDLNRFLAALL
                     AGRLLPPDRQRDLLLTVPTRDWLPGAAYGLGVCALPLPGGTGTRWGMGGATIGSWTYA
                     FATPDGSRLLAVNTNADWTDPASGWADPIGLFTELLETALAD"
     CDS             complement(240171..240701)
                     /codon_start=1
                     /locus_tag="KSE_02110"
                     /product="hypothetical protein"
                     /protein_id="BAJ26061.1"
                     /transl_table=11
                     /translation="MSAFDRYLQALLDRAADEARSDGSATVDAHHLLLALAAAPTTAF
                     DGAPATAFDDLSDDDDAARRVLAAAGLDRDAVRAALDREFAHSLRAVGVSPDTDRLPP
                     PSPGTERPRLGASTRLALERSFGAARKKDQTSAHLLSGILAAEVGTVPRALALSGVDR
                     ERLAGRARAAADRRHA"
     CDS             complement(240698..240934)
                     /codon_start=1
                     /locus_tag="KSE_02120"
                     /product="hypothetical protein"
                     /protein_id="BAJ26062.1"
                     /transl_table=11
                     /translation="MPPADTPLPPDPADSLAAVAALRRLADRLEDAAVEQAMRAGWSW
                     PQVSEALGVTRQAVHKKHAKRLIAGGVTLRRRGE"
     CDS             complement(241105..241473)
                     /codon_start=1
                     /locus_tag="KSE_02130"
                     /product="hypothetical protein"
                     /protein_id="BAJ26063.1"
                     /transl_table=11
                     /translation="MTPAEAAAEAAAEATAPDEHPAKALDDTVHQRVRLGILTVAHQA
                     RRAEFGFLRTTLDLTAGNLGQHLTVLEKAGLVAIEKGYEGRRPRTWVTLTPAGEQALR
                     DEVAQLKRLIRQIEDAVGSP"
     CDS             complement(241470..242195)
                     /codon_start=1
                     /locus_tag="KSE_02140"
                     /product="hypothetical protein"
                     /protein_id="BAJ26064.1"
                     /transl_table=11
                     /translation="MPLPGTPREVLSGLGELTRRVRAAQRDAWIPLLLFGLLTLGAVV
                     VGRLTFRQQDVPCPGAPAAPGETCTAMHQGSPAYWTVGLLAAYAATAWWYLRRSRQRG
                     VGSPVRPYALAGVAAVAALAATAWWGAGQPAPGADLRLWGLQFTANATGTLLLQHFLG
                     GAAAIGVPLLVLARIERNGPLALFALGYLLLELLPVTFGWWGAAAGPWSGLARYGVSG
                     LYLLAGALLFARAAHRTRPQADA"
     CDS             complement(242338..242739)
                     /codon_start=1
                     /locus_tag="KSE_02150"
                     /product="putative oxidoreductase"
                     /protein_id="BAJ26065.1"
                     /transl_table=11
                     /translation="MAHDIHHLDPAYLAFWREYQLCTLTTLRPDGTPHVVPVGATFDP
                     ETGIARVISSRESRKVRNVLAAGEAGQRVALCQVDRARWATLEGRAVIRQDAASVADA
                     ERRYAERYRQPRENPERVVIEITVLRALGRA"
     CDS             complement(242842..243696)
                     /codon_start=1
                     /locus_tag="KSE_02160"
                     /product="putative oxidoreductase"
                     /protein_id="BAJ26066.1"
                     /transl_table=11
                     /translation="MSNAAPTVLITGTSSGIGLAAAVAAASAGLRVVATLRDTAKAGP
                     LLAAAEAAGVAELVKVKQLDVTDPASIAVAVDEVLAEYGRLDAVVHNAGAGAVGTVEQ
                     AGTELFRQALEVNFLGVVELTRVALPHLRASGGRLIAVSSVGGVIGQPFNEAYCASKF
                     ALEGFLESLAPVAAATGVTVAVVEPGAVASEFVANLQLDVPALLAAAGPYEPALKGYL
                     ATTFAAFEDAQSSAGAAETIVHALTAEQVPFRLQTSEAATAFVAAKLADADGAVVQGL
                     TSSWLAAS"
     CDS             244117..245637
                     /codon_start=1
                     /locus_tag="KSE_02170"
                     /product="hypothetical protein"
                     /protein_id="BAJ26067.1"
                     /transl_table=11
                     /translation="MSAVEVWADGPETAGAAELLPLSREFAVDGFAGDAAAAPARPSV
                     ALLELEGLALADSPKRRGKLLRERVPLESHERLVLSASRPEVVAAVEAANAGRLPHLV
                     PLRVGRMAASPFAFLRGSAGLMAHDLATTPVSGVAAQLCGDAHAANFGLYGDARGRLA
                     LDLNDFDETVSGPWEWDLKRLAASLVLAGRQAGADETACRQAAFDAVATYRRTVRQLA
                     KLPALDAWNAWDAIADHQLVEFAGAHELSGLLAAVSAKALRNTGAKFAARSTVRTEDE
                     GWRFVAAPPILSEMTDRQAELVAGSLSSYRHTVPTELHPLLARFRVQDVAFRVVGTGS
                     VGTRSYVVLLTDRKGGPLVLQVKEARPSVLLPHLVRAGFPVPAEGEHEGRRVVLGQKR
                     MQVVSDPLMGWTSVAGLPYQVRQFRNRKGSVDPAALTPAQLDDYGRLTGALLARAHAH
                     TADAALIAGYCGKDERLDDAIARFAVAYADQSEADHAALVTAVRTGRLAAEPAPGA"
     CDS             245761..246867
                     /codon_start=1
                     /locus_tag="KSE_02180"
                     /product="hypothetical protein"
                     /protein_id="BAJ26068.1"
                     /transl_table=11
                     /translation="MVELSSSNGRLTMVSGDGTASAAAVVADALVQQREDGTAGPAAP
                     APVPDAEALARVRHELQRLPRWRQALADAEAAPQDAAVRAALVEAVDEVLTFNSALAQ
                     SLGLDLETAQATTPATATAFEKAPAAPPAPPTAPQDAVPGPPPVPSAPPAPPSAPPAP
                     AFAPPLPPAGPVEPAVALAAKRKRIVLGVGAAVVAGGLVALGSYLFGGGSAPSLPKSV
                     EGDALRNSSAKGDFPDWEDMNSSMTEVGARNLQGATYGVVPKTSSSSSSSKRDPRWNV
                     VIGTSSPDFRRKLAQLAARSDSGSAPHVVKSSLDGTLYCDSYDPDDSPTERARETITC
                     VWADDDYMIVVAGTGVDENLVPRVLERVHGNSEH"
     CDS             247044..247592
                     /codon_start=1
                     /locus_tag="KSE_02190"
                     /product="hypothetical protein"
                     /protein_id="BAJ26069.1"
                     /transl_table=11
                     /translation="MVAGGLALLLGGCLPGGADDGKDPAGQHPPRLPKSVEGAALRAS
                     SDNGSGGPTAWRGALGEAAAKGAQDLHLAAYGALDGTSGPEGFDGDGRAPKWFVQIAG
                     ADDPALRKYVTGDGLDRVSSSLPGTMGCRTEEAAAAGTAPTRTAFCVWAGERYVILVS
                     GRDVPADLPARVIERIHAGTES"
     CDS             247735..248271
                     /codon_start=1
                     /EC_number="2.3.1.-"
                     /locus_tag="KSE_02200"
                     /product="putative acetyltransferase"
                     /protein_id="BAJ26070.1"
                     /transl_table=11
                     /translation="MRIREARIGELPLLQEIERAAGHRFREVGMELIADDEPLSVEEL
                     TPFVTAGLAWVSVDDAADGDAAEHGADRPVAYLIAARIDGALHVEQVSVHPSYARRGV
                     GRALLEHLAGVAAAEGVGALTLTTFTEVPWNAPYYARCGFRPVPEADLGPGLREVRAH
                     EAALGLDRWPRLAMRRAL"
     CDS             248475..249296
                     /codon_start=1
                     /locus_tag="KSE_02210"
                     /product="hypothetical protein"
                     /protein_id="BAJ26071.1"
                     /transl_table=11
                     /translation="MIAGMATDSALSSAILLLAPRVNETGLRLRTAAGRRGLRAHTAV
                     SWRTPRELVGERVHLYGGPLFADAVGRELGVGPVEPGNGWLTALPREVTGRRVELTTL
                     AQARRLRGRAFVKPPADKHFAARVYPDGAALPGPELLDGDTAVLVSEPVRFAVEYRLF
                     VLDGVVRAASRYAVNGELAVAVPESDAPELLAFAADVLSAATGPAALPSAVVVDLGRS
                     DRGWAVVEANAAWASGGYACDSDAVLEVVLRAAGPLAELPPADRPFLRPLPTVTD"
     CDS             249414..249815
                     /codon_start=1
                     /locus_tag="KSE_02220"
                     /product="putative endoribonuclease"
                     /protein_id="BAJ26072.1"
                     /transl_table=11
                     /translation="MSSHLTHITEPPGVAPGTGYTQVVTGAGRLVQVSGQVAFDERGE
                     LVGAGDPEAQARQVFENLRRCLAAGGADFSDVVKFTVFVTDIAFLPAVRKARDAYVDT
                     ARLPASSAVQVAALFRPDVLIEIEALAITAA"
     CDS             249996..251243
                     /codon_start=1
                     /locus_tag="KSE_02230"
                     /product="putative cytochrome P450"
                     /protein_id="BAJ26073.1"
                     /transl_table=11
                     /translation="MTTDATTGTTTDAAAGTTTGAPAAQPLVPLHCLLRAEAGPPRLA
                     ALPTGTPVWVLTRHADVRQALAHPDLGRAALYAPDAPPTVLTPNILDDPSSILNSDGP
                     AHQAIRRTVQRAFTPRAIERWRPWVDGVVRELVGDLVAAGPPVDAVEALTKPLPVRVI
                     SRLMELEGLDTDRLGYWSDHALSTTAYSAEEIGAAIREFGEFGYRLVQRRRKDPGDDL
                     VSSLVRAADQTGGMTEEQITSLTIGLVIAGHETTMTSFGNALVYLLDEQHAGAWRRIG
                     EDLSAATAATEQILRTIPLGDRTTAPGQLRRATADLEIGGVTIPAGAIIAADSTAANA
                     DPEVYPPGPLDLFAPLGTPSLTFGAGPHHCLGAWLARMELELGLHHLARALPELRLAT
                     PADRLEWRTGLLTRSPLRLEVAW"
     CDS             251240..251476
                     /codon_start=1
                     /locus_tag="KSE_02240"
                     /product="putative 3Fe-4S ferredoxin"
                     /protein_id="BAJ26074.1"
                     /transl_table=11
                     /translation="MSDAPRLLVAVDRARCIGSGLCARTAPADLVLGPDGRSAPARPD
                     SEPSEELTEAAEMCPVEAITVRDAATGELVAPVW"
     CDS             251612..252061
                     /codon_start=1
                     /locus_tag="KSE_02250"
                     /product="hypothetical protein"
                     /protein_id="BAJ26075.1"
                     /transl_table=11
                     /translation="MSTHTPTPVPPDDRPGRAPRGSLHHVELWVPDFERALGSLGWLL
                     EALGHTVSQRWEGGRSWRLGPTYLVLEQSPALSADRHDRHRPGLNHLAFHVESAAAVE
                     ELAAEAVRHGWRLLFADRHPHAGGERHYAAYLENGDGFEVELVAAEH"
     CDS             252220..253485
                     /codon_start=1
                     /locus_tag="KSE_02260"
                     /product="hypothetical protein"
                     /protein_id="BAJ26076.1"
                     /transl_table=11
                     /translation="MGGRIGARAGAAAAALALLGTGATGCAHAPEAPPVIEVDAPTAL
                     ADQAVHVRIGGLRPGEEVTVGTRALDDQGRVWSGRAVLRADGGGLVALDTAVPRSGSY
                     QEADGMGLFWSMAPADGDPERLSFTPPLSADHAYRLTLTASAPGRRSADLVLTRQWYG
                     PGVTGRVLLPEADGVSGMLFLPAPGTPRRPAVLLFGGSEGGNGLASTAALLASHGYPA
                     LALGYFGLPGLPDGLKDVPLEYFAGAARLLAAQPGTDPGHLLALGYSRGSEAALLLAE
                     DYPDLVHGAIVYAPSAQVNPGFPYGGAAWTKDGRAVPPGPVPLDRVSGPVLALAGADD
                     QLWRSPDWARQIARELDDAHNPYPHRALVFPGSGHGVGTYPYVPEGTRPVQPVSGQPL
                     QLGGTRAGDAAARAAGWPEVLALLASLDG"
     CDS             complement(253493..254041)
                     /codon_start=1
                     /locus_tag="KSE_02270"
                     /product="hypothetical protein"
                     /protein_id="BAJ26077.1"
                     /transl_table=11
                     /translation="MDVLDVLERAGLPTAGAYDLLAHGDDWETGLALLEEAGGGRPLP
                     AAVWGELTTAAEQLYLPRSAAWCRWRHGEARSDLVVRAELALPPAGEGRRGTAFDGAG
                     VLRPLWDIGDRTPEGGPDLAVAALWVEGRPALGPGELATVRLAPLSPERWRGLRPGQV
                     VTMHEGRPVGGTAVVLEARRHG"
     CDS             complement(254197..254598)
                     /codon_start=1
                     /locus_tag="KSE_02275"
                     /product="hypothetical protein"
                     /protein_id="BAJ26078.1"
                     /transl_table=11
                     /translation="MPSSSEVVDSEPVCTSARVTVPLILASESLSEIRAVSVAENGAV
                     RAAISASSSAAPGAPGAAPLSESVGEAGAGRSPSAAGPPEQPVRAARATPAVQPRNFE
                     IDTGILRATIRAYDRRWRCFRRSSAQGKVVW"
     CDS             254682..254987
                     /codon_start=1
                     /locus_tag="KSE_02280"
                     /product="hypothetical protein"
                     /protein_id="BAJ26079.1"
                     /transl_table=11
                     /translation="MADPVPDHRPLVRALLAAAPASYRGTERLRTRSGGQAHRVSGRL
                     TEHAVADCATDLLVDTAGRLAELEVDCAAFGDGYRFKSTLTLGEYGPATKQEPPSDS"
     CDS             complement(255115..256164)
                     /codon_start=1
                     /locus_tag="KSE_02290"
                     /product="putative LacI family transcriptional regulator"
                     /protein_id="BAJ26080.1"
                     /transl_table=11
                     /translation="MSSEALKRASTLEDVARVAGVSRATVSRVINGVRNVDPAIQEAV
                     RQAISRTGYVPNSAARSLVTRRTGALALVISGSDAPETPDHHVGGEIFADPFFGRVVS
                     GVFTGLRPLDLHPVLMLADSAEARDKALTYLRQGNADGAMVVSTHSRDPLPAQLLAAG
                     IPTVLFGRPPTPLSLSCVDLDNREGGRIAADHLTARGRHRVAAISGPLGVRAARDRLS
                     GFREAMADRGIHQLPHVEGDFTREDGERAMASLLRRYPDLDGVFAANDLMAQGALAVL
                     AEHHRRVPEDVAVIGFDDSSAATAGRPHLTTVRQPVEEMAAEMTRVLLDHLARPGRAA
                     TTVLFEPTLVERRSA"
     CDS             complement(256295..256897)
                     /codon_start=1
                     /locus_tag="KSE_02300"
                     /product="hypothetical protein"
                     /protein_id="BAJ26081.1"
                     /transl_table=11
                     /translation="MRLRRTAAPLLLLLAAVGCGTGTAPVPAAPNAAPPAASSPASPP
                     AASPSAARSSGAPDRPSDATSMICNPYFRQELAGALGTDIVQPLAPTWEKRVYSCEYR
                     YAGGSMTLSVKELPDTATALAQYDGLRGSAGAVTDLNGLGEAAYKRADGTTVVRKDSF
                     VLTVDVARLPETFGTPARSRADVAVMTATTVMICWEEHSS"
     CDS             complement(257031..258416)
                     /codon_start=1
                     /locus_tag="KSE_02310"
                     /product="hypothetical protein"
                     /protein_id="BAJ26082.1"
                     /transl_table=11
                     /translation="MSRGAPHRSALAGTAAAILAAGALTGGVLTQQAAAASDPLISQS
                     KPVTASSVENASFPAAAVADNNLATRWASAWTDSQWIQIDLGGTASISHVELDWEAAY
                     ASGYQLQTSADAANWTTVYTKANGTGGTEQIDLNGSGRYLRLNLTKRATGYGYSLEEF
                     KVYGQVATATTGYVLANPQVTGATPATGNPAHAYFHEFQANCTATHDLPDDPIVYPGK
                     PGASHMHTFMGATNTNANSTLESLQASSTSCLAPGDKSGYWMPTMYDGNTPVDPVGLQ
                     TIYYKSSINDYTAVRPFPAGLRFVVASPTDSATDFTTHPGYVAGWECGNSYRTSDLPT
                     DCPGGGQINIRFQAPSCWNGLYLDTPDHKSHMAYPIEGVCPADHPVALPMIEFKMAFP
                     ANLDHLAQLHLSSGRGFSFHYDFFNAWDAPTLAALVDHCIVGGLQCNARGYDETQPGR
                     GAALNEQYLLP"
     CDS             complement(258738..262187)
                     /codon_start=1
                     /EC_number="3.2.1.-"
                     /locus_tag="KSE_02320"
                     /product="putative glycoside hydrolase"
                     /protein_id="BAJ26083.1"
                     /transl_table=11
                     /translation="MTRTASSAAPRTLAAALAAALVAALVLLLPAGRAEAAPVLLSQG
                     KTATASSTENYGTPASNAVDGDTGTRWSSAAADPQWLQVDLGAPAALSSVTLRWEAAY
                     AKGYQIQLSTDGTSWSTAYTTANGAGGTETVPVTGTARYVRLYGTARATGYGYSLWEF
                     QVYGATGGGDQGCGTANAAQGKTATASSTENYGTPASNAVDGDTGTRWSSAAADPQWL
                     QVDLGSAQNVCGTSVTWESAYAKAYRIQLSTDAATWTDAWSTANGTGGTETAPVTGTA
                     RYVRLYGTARATGYGYSVWEFKVFTSGGAAGSPTPTPSPTPSPSPTGTTPPGNWTTVF
                     SDDFAGGAGSAPSAGNWTVRTGTSEPGGAANWGTGEIQNDTADPANVAIDGNHHLNLT
                     AVRDGAGNWTSGRVESKRGDFAAPAGGQLLISAQVKQPGVADGTGYWPSFRAVGANDR
                     SGGWPGTGESDILEDVNGRSQTSATLHCGTAPGGNCAEYNGMTSGLASCPGCQSDYHT
                     YSQVIDRTVSDEQIRWYLDGRQIWQVNESQVGTADWKNAVDHGFKLVFNLAIGGSYPD
                     SVCGCTTPTAATSSGGALSIGTVTVATTTGPAPAALADPAVPTGKSTVKVTGGQGNWA
                     LSVNGQPYQLKGVTWGPAQSTADAHMRDLKAMGVNTLRTWGTDAASKPLLDAAAAYGL
                     KVVNGFWLNQGADYVNDTAYKTSTLDSIKQWVTTYKDHPGTLMWDVGNEVILTTQDHA
                     YNGATVEQERVAYARFVEQVTQAIHAIDPDHPVTSTDAYTGAWTYYKQYAPSLDLLAV
                     NSYGAVCNVKQDWINGGYTKPYIVTESGDAGEWEVPNDANGVPTQPTDTQKRDGYTSA
                     WNCVAGHTGVSLGATMFNYGTENDFGGTWFNLIPGGWKQPAYYSVATSYGGAARGGNT
                     PPVMPNTTLSRTADVPAGGTFTISSPATDPDGDLVRYQLYYSSKYVDGGTGFAQVRFT
                     QTGDGQFTATAPRTLGVWKVYVYAYDGHGNVGIESKSFRTVAPTPSGTNVAKGKPTTA
                     STYQAAGNGAPYPPSNTTDGNWSTRWASEWADPQWLQVDLGQTTSFKHVQLGWESAYG
                     KAYQIQTSNDGTNWTTVHTQANGTGGIEDIDVNGSGRYVRVAMTQRGTAYGYSMYEFG
                     VYT"
     CDS             262566..263894
                     /codon_start=1
                     /gene="cebE3"
                     /locus_tag="KSE_02330"
                     /product="putative cellobiose ABC transporter
                     substrate-binding protein"
                     /protein_id="BAJ26084.1"
                     /transl_table=11
                     /translation="MPVSLPRTGPTGLRGRLLATSALLVLALTAVASCSSGSSSGGGS
                     SADEDPNARITLTVNLFSDFGYADLYKEYEQAHPNITIKENRADLGAHHQNLHAHLLA
                     GSGTADIEAVEIGQVAGFQPEAGKFLDFLENGVDKNQWVPSKTAPASSPDGKVLFGLG
                     TDMGGMALCYRSDLFKAAGLPTDREQVAALMKDWPSYLAAGKRFLADSPNKDARWFDS
                     GGNLFSAILAQAPQGVYDAQGKVVVEGNPAVKQSFDLVAGAIKDGQSAGIQAFTPAWD
                     TGFQKSQFATVACPAWMSYEFKANPPADGGTWDIARIPGGGGNWGGSYLTVPKSGKHT
                     KAAAELAKWLTAPAQEARLFKEKGYFPSDQALWTQPDIAEHTDPLFNNAPTGRIFSQS
                     ARDLNPQPLGAHGAEIGTALGNALTSVEQGKADPAGAWKQALKDVGNIVD"
     CDS             264002..264988
                     /codon_start=1
                     /gene="cebF3"
                     /locus_tag="KSE_02340"
                     /product="putative cellobiose ABC transporter permease
                     protein"
                     /protein_id="BAJ26085.1"
                     /transl_table=11
                     /translation="MAASTAAARGARAPAPAPAPAPARTAGHRWHRLDRTVSPYLYLS
                     PFFLVFGVFGLFPMLYTGYVSFTAWRADRPGSQGRWVGFENYRRLLDDPFFWNAVKNT
                     LGIGVLATLPQLLLALGLAHLLNYRMRGRTLLRLGVLLPNVTSVAAVTLIFVQLFGRD
                     FGLVNWFLSLFGVDHVDWQAGTLSSWSAIAAIVTWRWTGYNALLYLAAMQSVPFELYE
                     AAALDGASRWRQFRSITVPMLRPTILFTVIVSTIGALQLFGEPMLFSQQQDPTTGGSQ
                     HQFQTLALYSYNQFWGRFKYGYGAAVSWAMFLLIVLVAAVNFLAARRMRGAE"
     CDS             264985..265833
                     /codon_start=1
                     /gene="cebG3"
                     /locus_tag="KSE_02350"
                     /product="putative cellobiose ABC transporter permease
                     protein"
                     /protein_id="BAJ26086.1"
                     /transl_table=11
                     /translation="MSRGRSRTTRQLTAGRGVYAVLGVAVLLSLFPLYWTLVAASRSN
                     TEIHRMPPVLLPGGRLWHNVTQVFAQTDLRLAMVNSLVVAGTVTASVVLTSTLGGFAF
                     AKLRFRGRGPLLASVVATMMVPTQLGIIPLYIMMANWFHWADHLQALIVPAAANAFGL
                     FFMRQYLLGAVPDELLDAGRMDGCTTRGLVWHVVLPAARPAMSVLGMLTFMASWNDFY
                     WPKVVMTQQNPTVQLTLSELASGYIKDYSLVLTGALVASAPVLVAFLLMGRQIIDGIM
                     QGATKG"
     CDS             265830..268298
                     /codon_start=1
                     /EC_number="3.2.1.21"
                     /locus_tag="KSE_02360"
                     /note="protein synonym:beta-D-glucoside glucohydrolase"
                     /note="protein synonym:cellobiase"
                     /product="putative beta-glucosidase"
                     /protein_id="BAJ26087.1"
                     /transl_table=11
                     /translation="MTQLSMPSSLTTPASGTDHRVLDLERKARLVSGGDTFRTSPEPA
                     LGLFPIVCSDGPVGVRGERWDEADTALLLPCATALAASWDEELVARMGGLLAAEARRK
                     GVHVVLAPTLNLHRSPLGGRNFECFSEDPLLTARIGAAYIGGVQALGVAATAKHYVAN
                     DSETERLTVDARVDERTLREVYLAPFEAAVRAGVWAVMSAYNRVNGTSMVEHPLLAEP
                     LKGEWGFDGLVVSDWGSVREADGPGAAACDLSMPGPNPAWGPALAAAVRAGRVPAAAL
                     DDKVERLLRLAGRVGAFDPPPAGRAPVPADPATRGALRAAAVAGTVLLHNPDRLLPLD
                     EPALRRVAVLGPNAATARVQGGGSASVFPAAPVSPLNGLRAALDPSVEVTHAPGVRTE
                     LRPTPLAAADCVLPDGSGPGVLVRYLAADGSPLHTEARATGRVLEPSADVDLTAVRTI
                     EVASRFTAPSAGRWRLGVVGLGALRLEADGAVLLDEYVAPLSDDPTYLHVAPSFRQVE
                     LELAAGQGVDLLARRTVEPEHGRVLVLAADRPAAELEREFAHAVELAAAADVAVVVVG
                     TTDEHESEGFDRAGLRLPGRQDELVEAVAAVNPRTVVVVNTGSPVLLPWRERVGAVLT
                     CWFPGQEGGGALAEVLLGRAEPGGRLPTTWPDAEADCPVYATAPSGGRLAYAEGPHLG
                     HRGWLRAGRTPAYWFGHGLGWGEWCYLALGEPSAPAADGSRTVRVALRNDGPRRSRET
                     VQLYLSRPDSELDRPVRWLAGFGAVEAGPGERVEVELRLPQRALQHWSVEDRAWRTEP
                     GTFVLHVGPHSGELPLAAALPVGA"
     CDS             complement(268357..268857)
                     /codon_start=1
                     /EC_number="5.2.1.8"
                     /locus_tag="KSE_02370"
                     /note="protein synonym:PPIase"
                     /note="protein synonym:rotamase"
                     /product="putative peptidyl-prolyl cis-trans isomerase
                     cyclophilin type"
                     /protein_id="BAJ26088.1"
                     /transl_table=11
                     /translation="MSKVKLSTNHGDIVVRLDAEKAPATVENFLRYVQDGFYSGTVFH
                     RVIDDFMVQGGGMEPGLRRKETRPPIQNEADNGLKNLRYTVAMARTADPHSATAQFFI
                     NVADNAFLDHTAKSGPGWGYAVFGEVVEGREVVDEIKSVATGSKGGHADVPKEDVLLV
                     SAEVVE"
     CDS             complement(269015..269548)
                     /codon_start=1
                     /locus_tag="KSE_02380"
                     /product="hypothetical protein"
                     /protein_id="BAJ26089.1"
                     /transl_table=11
                     /translation="MRTLSRLAVTAVLAAGSLGLGLGSASAAPGTVSCSGQQTQTFTP
                     GLTLTTRQIAFAADATLGTCASTHGDGITSGAFHIEGGGPGSCTAASFYSELTLTWNT
                     GETSRIGLNTPADLKPLGQTVATSYGQVLSGKYTGGTVVEVLELTPDSLALTKCLTPE
                     GLRDSSGTLSLTIQNLT"
     CDS             complement(269712..270284)
                     /codon_start=1
                     /locus_tag="KSE_02390"
                     /product="hypothetical protein"
                     /protein_id="BAJ26090.1"
                     /transl_table=11
                     /translation="MSVVEQSTETHGQPPVHRLKAGSVGLVGVIFMALATAAPITAMT
                     GNLPVIIGGGTRTVTADHTILAVPLPILQQHVDLTPPAPFTDASSAYTRDLADRHLAQ
                     IDTVWPGTRAAWNGRATLSAWHLNPYSYGAYSYWPVGYLTGYAGYEGTAQGNLHFAGE
                     HCSYDYQGYMNGGAVEGARAAAEVLTAIGA"
     CDS             270579..272870
                     /codon_start=1
                     /locus_tag="KSE_02400"
                     /note="Belongs to Oxidoreductase alpha (molybdopterin)
                     subunit family (IPR010046)."
                     /product="putative oxidoreductase"
                     /protein_id="BAJ26091.1"
                     /transl_table=11
                     /translation="MEPSVGAEPSAPPSFEPYRHPAAGWGAAKSVAKVLAATGEWVEG
                     PRAVLRMNHENGGFDCPGCAWPDDYKGLHLDICENGIKHVTWEMTGKRVGREFFAAHT
                     VTELSGWSDFALEDQGRLTEPMVYDPDTDRYLPIDWQRAFDLFGEVVRGLDDPNEAAF
                     YTSGRLGNEATFLYQLLARELGTNNLPDCSNMCHEASGRALTASLGTGKGTADLRDWE
                     AADALFVLGVNAASNAPRMLTALADATRRGARVVHVNPLVEAAATRTIVPHEFANMAL
                     GRATSTSALNLQVRIGGDLALLRGIAKAVLEQSAHDPGALDEEFIERHTTGFAAYRKL
                     VEQTPWEELERQSGLSRPQLLRAARVYREADRSIFSWCLGVTQHEHGVDTVREIVNVL
                     LLRGNLGREGAGPSPVRGHSNVQGNRTCGIDHRPAPEFLDRLSEVCGIDAPRAHGLDT
                     VGVIGAMARGEVKVFVGMGGNFALAVPDTAYTYEALSRCELTVHVSTKLNRSHLVHGR
                     RALILPCLGRTEQDRQRGGVQATSVEDSMSMVHLSVGMRKKPASRQLLSEPAIVAGLA
                     RAALPGSATPWEWYVEDYDRIRDTMAKVLDGFEDFNRRVRLPLGFRIRQPARELVFLT
                     PSGRAEFSAAPLPDVIPAPGTLVLGTMRSHDQWNTTIYSDNDRYRGVRNLRTLVFMNR
                     QDMRERHLDEFSPVDVTATARDGSTRSLYGYLAVPYDLPRGCAAGYMPEMNVLCAIGD
                     YSAQSDQPIMKHLKVTITAAARA"
     CDS             complement(272912..273553)
                     /codon_start=1
                     /EC_number="2.3.1.-"
                     /locus_tag="KSE_02410"
                     /product="putative acetyltransferase"
                     /protein_id="BAJ26092.1"
                     /transl_table=11
                     /translation="MPTPHWPLPDLTARTGRLELRLPTEPELHALADLAAAGVVVPGT
                     RPFRSEWAYAAPAERARAVLRAHWRALAQWSPEDWNLPLAVFADGRPVGVQSVRAKEF
                     ALRREILSGSWLALPHQGRGLGTEARAAMLHLVFAGLGATDATSHSFADNAPSIAVSR
                     RLGYRPDGIERDTRHGEPATTLRFRLTREQWDATARTETRLTGVDACAELFGN"
     CDS             273805..274917
                     /codon_start=1
                     /locus_tag="KSE_02430"
                     /product="hypothetical protein"
                     /protein_id="BAJ26093.1"
                     /transl_table=11
                     /translation="MISVSPRRAHLYRAAGDHPYFSGDGETYLAQHTLRELTKSRPLR
                     VLSEEDFAHWQTYGYVVVREAVPAEHARRLLDFAWQFQGLDPLDPAGWFVDRPFRSEL
                     DRRLHVYGFVEAYHHQLLWDSRQDQRVYDAFVDVWDCEELWVTLDRLNLNPPNRGSRD
                     RALVDPAERGTEVRLHWDIDTSLGVPPQRVQGIIALNETAPETGGFHCSPELFRRFDA
                     WRLAQPADRDPRRPDLDRAELPVVRPELHPGDLLIWNGLLAHGVARNLSEQGVRAVQY
                     LSMMPALEEHERLRESRVDSWRHLRTPHWNRTLVGDPVLHESKRYPTARLTELGRKLL
                     GLDSWYEPVDLSAQAASWLDRPGPGTGPVVDSGGLR"
     CDS             complement(274949..275965)
                     /codon_start=1
                     /locus_tag="KSE_02440"
                     /product="putative oxidoreductase"
                     /protein_id="BAJ26094.1"
                     /transl_table=11
                     /translation="MTQTAQTVQSVQPAQPSVPSGRVGVLLPRDLPVRQLLPYARRAE
                     ELGFDELWVVEDLGWRGGVAQAASVLAATRRITVGIGILPAGARNVCFAAMELATLAQ
                     LHPGRLTAGIGHGMRAWMEEAGGGWPASPLTLLREYATALRALLRGEPAPADGRYVRC
                     AGVRLTETPETAPPVLLGVRGPKSQALAGESADGLLLAEPAPPAYVAASLRRLGRAGA
                     EVVTYDVAAVDEDGDAAVERVRAGLAAIGEPDWAPHLAPLPFAAEFRAHRAASADGAE
                     SARTMPAAWVRELAVAGTPAQARAAIAARWAAGATSVVLTPVGADPLGALESLARALP
                     GGDE"
     CDS             complement(276028..277227)
                     /codon_start=1
                     /locus_tag="KSE_02450"
                     /note="Similar to Protein AraJ in Escherichia coli
                     (strain K12) (P23910)."
                     /product="putative major facilitator superfamily
                     transporter"
                     /protein_id="BAJ26095.1"
                     /transl_table=11
                     /translation="MPLALVALAVTAFAIGTTEFSAMGLLPQIAGDLDRTIPQTGWLI
                     SLYALGVVIGAPLLTAVAAKLPRKTVLIGLAGLFTLGNLLCALAPNFAFLAVARLITG
                     LPHGAFFGAGAVAAAELVAPHLRARAVSVMFSGLTVANILGVPAATLLGQHLGWRAAM
                     LVVVATGLLGAAAIARLVPRLPSHPGAGLRSELATFRSGQLWLALATVVFGCAGLFAC
                     YTYITPALTEVAGFAEGSVTWVLALFGVGMTLGNAIGGYAADRALRPSICAAFLAMTG
                     ALGLFAVTAHERWAAAATVVLIGLAGFATVPTVQTLVISKARTAPTLASATLQGAFNL
                     ANAMGAWLGGLAIDAGYGFTSPSLVGAGLSLIGFVIAALSWTADRRRELPVADHPAAL
                     ERPVAAG"
     CDS             complement(277416..278165)
                     /codon_start=1
                     /locus_tag="KSE_02460"
                     /product="hypothetical protein"
                     /protein_id="BAJ26096.1"
                     /transl_table=11
                     /translation="MDGVRTHHLPSGRDLFAELAAATRWEEVGPGRRAAVLVRPGADG
                     RVPLVRTTARYAQPAQRFRPVHARLADRIRELAGPGEEFDNALAEVYTRAYTRMGAHS
                     DLALDLAEGSSIAVFSCYRNGGAGATRTLVLEPKEGQPGERTAVPLVQHGVVVFSVEA
                     NRRMRHRILLEPPARAADDEWLGVTYRTSRTRLRHRDGRAHLPHGELTAATEEQQREF
                     HRLRRRENAEPDFRYPPLSYTVSASDLLPPV"
     CDS             complement(278170..279414)
                     /codon_start=1
                     /locus_tag="KSE_02470"
                     /product="hypothetical protein"
                     /protein_id="BAJ26097.1"
                     /transl_table=11
                     /translation="MQHVAEAGIADAGHLLIAPARLREDETVRRFLGTVLTPERLAAD
                     PPDLTGRTVYLHGAEAAEAAEAAEKSLRAAERVYAVRESDEPGDPGDPAGPGGPPRAV
                     IGPGRVPLRVGDGAGVYYRRFFDPADDHYGRIRAEHAFQSLTESTKPGSAHRSGIYLT
                     PVTRDGDDLHFRLLRCSTNLSGPTEGFRATDTRIVDALNREAAAVLRGHAPLNHVLAQ
                     VYRNTRATAERKQAKARISAHADKTKDMPANGVLAFCTFYDRTEGLLPLAEDPYDLGV
                     RGVSALTRLRFRPKEEPAAGTAGGGFTVTLHPGSVLLVPLSTNRRHTHEIRPSALPAD
                     LLPTRLGYVVRCSAAEAVHRDGRTYLKTPAGPAELRPPTQDGMDELRRLYAEENRSTA
                     PVDYGGRFPFSMNAGDYTAPRI"
     CDS             complement(279457..280482)
                     /codon_start=1
                     /locus_tag="KSE_02480"
                     /product="putative LacI family transcriptional regulator"
                     /protein_id="BAJ26098.1"
                     /transl_table=11
                     /translation="MQRDAGTGNRRPTLEAVAAHAGVGRGTASRVINGSDKVSGKARE
                     AVLRAVAELGYVPNNLARGLVRRRTDTVALVMAVSEDAVWDEPYFSVLVRGIKRGLAG
                     TGLQLLLAIAQSQPEEEQLLRYLTAQHVDGVLLTSLRGDDPLPRRLEASGIPTVVIGA
                     PTGYDPVHCVDVDNRDGARRAVRHLIGQGRRRIATVTGPQDTRAGVQRLQGFQDALAE
                     AGLTPGPVAHGDFSADSGVLATADLLQLDPELDAVFAASDSMAIGAIRVLKEHGRRIP
                     EDVAVIGFDDSPIAGHTDPPLTSVHQPLERMGREMTRMLIARINGEPVARPVVVFEPQ
                     LVVRDSA"
     CDS             280802..281887
                     /codon_start=1
                     /locus_tag="KSE_02490"
                     /product="putative oxidoreductase"
                     /protein_id="BAJ26099.1"
                     /transl_table=11
                     /translation="MSKAFEPYELGGKRLANRLVMAPMTRARAYGAGQTTTPLMAEYY
                     AQRASAGLIITEAAQPSVIGQGYPDTPGIHTAEQSEAWRQVTDAVHAAGGVVFLQIMH
                     VGRAGHVSIAGLQPVGPSAVTAVGQVYTAAGPQERDVPRELTDDEVHATVADFAAAAR
                     HAIAAGFDGVEIHGANGYLVHQFLAPNSNLRTDAWGGSPEARIRFAVETARAVAEAVG
                     GDKVGFRLSPGNPLNDIDESDAAETEATYTALVEALAPLGLAYLHQMEAAGQRELTDK
                     LRKSWPGTYILNPFTGEAPTGPDELALIEDGTTDLLAYGAMFLANPDLPARLAQGGPY
                     NAPDFATLFGGDGKGLTDYPTLAEAGA"
     CDS             281979..282794
                     /codon_start=1
                     /locus_tag="KSE_02500"
                     /product="hypothetical protein"
                     /protein_id="BAJ26100.1"
                     /transl_table=11
                     /translation="MLNVEINGRPAGVEDVHRMTTWNYGHFTSLQVRAGAVRGLDLHL
                     RRLADASRELFGDLLGTAPDADPDAAGDDGARIRALVRRALAGRADASVRVSVVPSAG
                     SPTRTDLVVSVSDPVPDLPRPALRVRTAVYERELPHLKHAATLGLTHQALPARRAGYD
                     DVLFVGRDGLVREGSTWNAAFWDGERVHWPAAPVLPGVTMQLLRAALTATGVPWSVTP
                     LPVTGLPALRAAAAVNSHCPAQPLAAVDGTALADPELAALLTTAWATVPWQPL"
     CDS             complement(283040..284911)
                     /codon_start=1
                     /locus_tag="KSE_02520"
                     /product="hypothetical protein"
                     /protein_id="BAJ26101.1"
                     /transl_table=11
                     /translation="MPWAATVRGAAGMAVPLGLAVAAGRPAEGVLAGLGAMFAGVNDR
                     PAGRRTGTLQQALPALAGALGLLIGAAGGWWAVPLLGAVGLLGGAISVTGPIASAAAV
                     QLVVLTVLGCGMPVPLPGWAKAGCYLAGAGWLLLLRQLTTHPRPLHVERQAVADVFDA
                     LAEALAATGTDRAETARRRLTAALDRAGEQLRTDHDHTLRTRLAAASALCEASVALLR
                     DARPLPARLAAGPRRLAAAVRADRLPGPLPVPAAESPATAAFDRAVLHAALAFGERSA
                     PLPDGRGHGRGHEVRPLLAAARRRLARWVLGVRGRGPAGRGLRPWGRAGRAYGLRVGV
                     CVAASAALALGLRAGHWYWLPVTAAFLVKPDLGPLFSRVVNRFAGTVAGVLLVGALAP
                     VLPGAWWPVAAVAATGALIPVAQRHFAAQTAVVTVTVLAFVTAGGDPGAAPGRLADTA
                     LACALVLLVGHLPGLADTRARVGQRAAHALRHTQRYLDHVLRSEPAGPAGTAAHRAEL
                     RRTAYRTLAQARAAAETAAAELRPGGPAGPDWLRLTVHAERLADAATAYAVERDHGAP
                     APTTPAARTLTRTLAAAADALDRPGPVPAVSLEGAGLPPELDGVAAEVRRIRVLATG"
     CDS             285162..285770
                     /codon_start=1
                     /EC_number="2.3.1.-"
                     /locus_tag="KSE_02540"
                     /product="putative acetyltransferase"
                     /protein_id="BAJ26102.1"
                     /transl_table=11
                     /translation="MSTSPPPVPSAPPAPVLRPGDVPERLDAEGLVLRRFRAEEAGVR
                     YAAITASFAHLHRWMGWAARLPSEREHAQRFARALAWPDAGGSYSFGVFAADDRALLG
                     MAGLHDNLGGGAVEIGYWCHADHLGRGVATRAARALTGLLTGLPTVRRVEIHCDEANL
                     RSAAVARRLGYRLDRIEPDGVRAPAESGRGMVWVADGPTGPA"
     CDS             285967..286236
                     /codon_start=1
                     /EC_number="3.6.1.7"
                     /gene="acyP2"
                     /locus_tag="KSE_02550"
                     /product="putative acylphosphatase"
                     /protein_id="BAJ26103.1"
                     /transl_table=11
                     /translation="MIRRRVLVSGTVQGVFFRDSCRRAAAEAGVAGWVRNLPDGRVEA
                     VVEGDPDAVEQVVGWLRHGPSRAVVEGVEVIEEQPEGLLVFAVTT"
     CDS             complement(286280..286720)
                     /codon_start=1
                     /EC_number="3.5.4.-"
                     /locus_tag="KSE_02560"
                     /product="putative deaminase"
                     /protein_id="BAJ26104.1"
                     /transl_table=11
                     /translation="MPIDRVLVDAAIDLTRRCFPGQDRGGAAALRLDDGTVLTSAAPR
                     AVNGAVQLCHETGALCEAFKLGRRVTASVCVTAADGDRGFWVLAPCGVCQERLFEHGP
                     DVEVGVPRPEDPRRWRTLRLRDVQPHWFARVFPEDGIWPYEGEE"
     CDS             286798..287439
                     /codon_start=1
                     /locus_tag="KSE_02570"
                     /product="hypothetical protein"
                     /protein_id="BAJ26105.1"
                     /transl_table=11
                     /translation="MTDHHTEAAARDGSATAKRDLKLYLQDARDALVWKLAGLSEYDA
                     RRPLTPTGTNLLGLVKHLTGAEAVYFGAAFGRPFEGGPGLWVAGAAEPNADLWARPEE
                     GREALLADYRRVWAHADATIDALPLSALGEVPWPPHDRLTLGRVLLHVVAETHRHAGH
                     ADLVRELVDGATGLRPDGSVLPEGDAAWWAGHRRRVEEAARAAARAAGERLPD"
     CDS             complement(287496..288665)
                     /codon_start=1
                     /locus_tag="KSE_02580"
                     /product="putative drug resistance protein"
                     /protein_id="BAJ26106.1"
                     /transl_table=11
                     /translation="MRGFRLLVLGQAASEFGNAFQAVALPMLVYSLGGGTGQLSAVVS
                     AFGIGRLAAAPLGGICADRWGARRVMLAADLGRLAATAALAVAALRHLDDLLLIGTLT
                     CLVGLGAGLFLPASWAVVPDLLPADDLQAGNALSSTVNHTAGLLGPPLAGAVLLWLDP
                     GTGLVVDAATFAVSALTLLLIGRTGERTREDPGADRATGFLALLRGSRMLRGLLAVTV
                     VTNLTVGGMTRIGLPALATGDFAAGAVGFGALLAAFTGGCLLGGPIAAALDGVRHRGR
                     TAGLAALLMGLAVALVPFAGLPGALVALLVAGVACTVNNVLLITGVQHRTPPALLARV
                     MAALTFCALCAFPLSALAVGAVVTAFGTPGVFVVTGLTMLAATGITFTVREVREM"
     CDS             complement(288888..289604)
                     /codon_start=1
                     /locus_tag="KSE_02590"
                     /product="hypothetical protein"
                     /protein_id="BAJ26107.1"
                     /transl_table=11
                     /translation="MPPSTERPLLEPLSPIDVELWLDYDPEVQRLPGIALGPRTLDLP
                     APGAAPGAAPAAADAAAEAVTELHRSGVRCLRLADPVPLCHDAPATAVRALMLVREAT
                     ARGLAVRWSAHCADGCVDDGRFHHLHPPIRVTGAAPGHHPAERWRATYFPGKCLYRRG
                     PGFVEVRDRRHGTLELLTIDEPDHLDGIDVLAGGTPADRLPAAVRRDFTDAGLITEQA
                     GLAWWLPMRVRRWPFPAMSV"
     CDS             complement(289588..291483)
                     /codon_start=1
                     /locus_tag="KSE_02600"
                     /product="hypothetical protein"
                     /protein_id="BAJ26108.1"
                     /transl_table=11
                     /translation="MKILLVQMPWGALDTPSLALGILRAVAERAGHRVEVRYANLEYA
                     DWAAEQHGLDHADYTYFSDRSYFQGAGDWAFAGALYGEQDAGDPREHAPYLEHLAAHG
                     ADEQEVRLVLATRATAPAFVERLAASILADPPDLVGFTSTFQQNTAALATARLLKRAD
                     PRITTVLGGANCDGPQGAALHRNFPFLDHVVRGEGEAALPALLDLLAAGADDFSAVPG
                     LCWRGPDGRSRANPTAARPLPPAAIPAPRYDGYYERFDASVAARWVEPRLVLEGSRGC
                     WWGEKHHCTFCGLNGSAMAYRSKRPEDFLEEILALTERHRLLDIQVVDNILDMGYFET
                     VLRPLAALPVDLRLHFEIKANLRREQFQLLGDAGAVQVQPGIESLSSRILKLMDKGVT
                     GCQNVRALRDAQSAGVSVAWNHLYGFPGEHPDDYREILRRLPALHHLDPPVGTGRIAI
                     ERFSPYYDDPRLGFPITRPAPHYRATYRLPESELADLAYLFSTEPRGIDDTLAAELTA
                     AVDTWRAHFPDSRLDRLDTGDRIVLANSRPGYAWRTLELTDPAELALFRLLDQPRSPA
                     TLAARVPGGAEAVTPLLRHWDDLGLLFHDGERWLQVAVESDNQVLMRVEHRHTTHREE
                     DRRAAVH"
     CDS             complement(291993..293384)
                     /codon_start=1
                     /locus_tag="KSE_02620"
                     /product="putative oxidoreductase"
                     /protein_id="BAJ26109.1"
                     /transl_table=11
                     /translation="MDPVHALRDAKPTPFWLEDPGRPDANSALTGDVRCDLLVVGGGY
                     SGLWTALVAKERDPGRDVVLIEAEQTGWAASGRNGGFCAASLTHGLGNGLERWPDEMA
                     ALEQLGARNLRSIEDAVTRHGIDCDWERTGELDVATEPHQVEELAELHELAKQYGDYE
                     LLDTDAIRAQVDSPTYLGALWDKDGVAMLHPAKLAWGLKRACERLGVRVFEHTKALDL
                     AESGSGMAVRTPYGRVFARQVALGTNVFPSLVKRIRPYTVPVYDYAMMTEPLSAEQLA
                     SIGWGNRQGVGDSANQFHYYRLSADNRILWGGYDAIYHYGAKVRAEYDQRPQTYQTLA
                     RHFFQTFPQLEGLRFTHAWGGAIDTCTRFSAFFDTAYRGKVALAAGYTGLGVGATRFG
                     AEVMLDLLAGERTERTALEMVRRKPLPFPPEPVRWAGIGITKWSLDRADRNAGRRNLW
                     LKTMDKLGLGFDS"
     CDS             complement(293471..293845)
                     /codon_start=1
                     /locus_tag="KSE_02630"
                     /product="hypothetical protein"
                     /protein_id="BAJ26110.1"
                     /transl_table=11
                     /translation="MIDSFALHVPDAELEPEPLDPGQIVSGTPEVTGKVVWESADGRQ
                     VRGIWQITPGVVTDTEADEMFVVLSGRATVAFEGGPVLEIGPGDLAVLREGDRTTWTV
                     HETLRKVYTINLGPDAAADEDR"
     CDS             complement(293842..295392)
                     /codon_start=1
                     /locus_tag="KSE_02640"
                     /product="putative amino acid transporter"
                     /protein_id="BAJ26111.1"
                     /transl_table=11
                     /translation="MTAIPAAPPETRWATPKRVSLVPLVALIFFSVSGGAYGIEPLFS
                     TSGPGMGILLILVAPLIYSVPHALVCAELGTAIPVEGGYYHWVKRGLGRFWAFQQGLL
                     QWVCSFVDMALYPVMFTSYLSSLISAVAPGKHVLFELAGIQVDLNWVICVGVIVVFTL
                     LNLMGAGWVGDSSVAFAIICLTPMLILTVIGFYQLVTEGTNPISSMTAEQGQSTWNAF
                     GSGLFIVMWNYSGWDSVSTVAGEMENPKKHLPKALLWSVLLIIAGYLLPSLASLAVGP
                     DGENGWKSWQDGALPDIAGELAGPWLQYVVTIGGLFASVAMFSALLASYSRLPSSLSH
                     DGYLPKWVSKESKRYKMPVASIVGSSVVYALFCFSSFQSLVIYDVFLTNIGILLEVAA
                     LIALRIREPELERPYKIPGGWWSIGLITASLTGVSVWAAIQQYSEEGTKAVVYCLIVV
                     GASLLLYPLLAARKAARASAAADRAAANGRDAEAGERSAYELSGQRPDSAHSDRAADG
                     TAADSVEA"
     CDS             295699..296814
                     /codon_start=1
                     /locus_tag="KSE_02650"
                     /product="putative serine/threonine protein phosphatase"
                     /protein_id="BAJ26112.1"
                     /transl_table=11
                     /translation="MPTITDASDSPRPLLNRVVRLSPFLLIALSAAADAETPAGQRYD
                     RFVVAAPALAAATWGSFGTLVIGAIAVATEVVLAVIRDGRVGAAGASVIAATVTVTLA
                     ASYTSGMRVRRERDLALVRSVARTAQQVVLRPLPDRIGDVGLALYYSAAAEQAQIGGD
                     LYEAVRTPFGVRIILGDVQGKGLPAVELAAALLGSFREAAYDAPDLPALATRLEVGLQ
                     RYAERASSPDAAERFATAVLLEIPNGSAVAYLLNCGHPPPVLLGADGSVRPVEPEAPL
                     PPLNLSALVASDYRPQTVPFGPGDRVLLYTDGVSETRDRRGEFYPLTERLARWSAEPD
                     VRLLESLRRDLRRYAGGPADDDVAALLAARLPAPENP"
     CDS             complement(296873..297025)
                     /codon_start=1
                     /locus_tag="KSE_02660"
                     /product="hypothetical protein"
                     /protein_id="BAJ26113.1"
                     /transl_table=11
                     /translation="MIGDRSRAEDPTAPRADREVPMSVKNVVGLIVDAIVIIYLILAI
                     KYPNRF"
     CDS             complement(297022..298920)
                     /codon_start=1
                     /locus_tag="KSE_02670"
                     /product="hypothetical protein"
                     /protein_id="BAJ26114.1"
                     /transl_table=11
                     /translation="MSPHEPVSPEKSDPEAAPRTTTGRGVLTRVLRSRRSEDRAHLSA
                     LAGLPALSLDALTSVAYGPEAALTVLAAAGARAAGAMLPLTVAVALLLTTLVVSYRRI
                     IATHPEGGGSYAVATSEFGPRTGLLAAAGLIVDYVLTAAVSLSTGAASLASAFPFLND
                     HLLLVSLLALAVLTAVNLRGLADSARLLMPATLLFVALVAAVAAVGVLRPVPAASVGG
                     APGVAVTQGLGLLLVLKAFAAGCTAISGVEAIANGVPAFRRPRVRTAQRAQLLLGALL
                     TAMLVGLGYLMARDLIVPREGVTTLAQLTAHSFGTGWLYLLTNTTVAVMLAAAANTSF
                     GALPVLLSLLAKDDRLPHVFALRSSRLVHQAGVLALAAMTALLLLATGAVTDRLIPLF
                     ALGIFIGFSISQLGMVRHWWRERGPRWRRLTALNGFGALLTLTATAVLLLFKFVQGAW
                     AVVVVVPLLMLLCARVQRYYAAVAAATGTGRIPPRPAGGDALVVVPVGELSAVTAATL
                     SRALSLSGDVVAVTVYSREVPARALQERWREWDPGVPLELLPSPRHSLLGPIVQYVQD
                     AGAAGREVIVLLPEKLPRRRWERLLQGRRSAVLAALLRRRTGALVSTVPFHLGGRPEP
                     GRPRIQPP"
     CDS             299166..299954
                     /codon_start=1
                     /locus_tag="KSE_02680"
                     /product="hypothetical protein"
                     /protein_id="BAJ26115.1"
                     /transl_table=11
                     /translation="MILWLLNNFDTLTLTIVIVGGIMIVAVAGAMLVRRKFPQISEGG
                     HNEMIGNVLGMFGAIYGIILAFVIVALWTQLDTANTIVASESTAAASIVRDADGFAPA
                     EGARVKAAVGAYVHGVVEVQWPLMHDGSPDYEATAPLVREIYAALQSYEPRNSSEQSF
                     YDSAVGSLDDLVQQRRARITMATQQLPLLLQTLVYGGALVLIPMTFLFGVRSKRMQAL
                     FVGSVAALIGFSLLLTLVLDRPFSGDLSVSPKPFKEGALSQFWK"
     CDS             complement(300372..301646)
                     /codon_start=1
                     /locus_tag="KSE_02690"
                     /product="hypothetical protein"
                     /protein_id="BAJ26116.1"
                     /transl_table=11
                     /translation="MAVPPRSNPQLRRLIGETGLSGGQFAGEVNKVAFENGFRLHYQR
                     ASVSQWCSGTVPRRPVREFIAEALSRRLGRPVSASDAGLEAGPATPGQDPVTDVLRLL
                     GDEAPYRPTGPGRPAAGTDGARRPWPRPGGKVGKAELALCVELTAHLSRSDHLSGSRD
                     ALATLTGFTTTVALPWLSCPSSPATRRRLLVACAHLAALGGFLYVDQGRHGQAQRWYA
                     LAMRLAEEGADPPTKAMVLRSLSVQAYRLGHFGHALGLAREAGRVADPAQARLRASVE
                     GQLALALAANGEPLAARLSLREAERALERSSGPVPPLGGYHAASLAFQRAEVRQRLGD
                     TGGALRDLELAVRLRPREELRSQALVLARAGELNLAVGRLDAACASWSRFLDLRRGLG
                     SHRVEEAHRIMRAALAPHRNHGFAHQLLTRDR"
     CDS             302018..303013
                     /codon_start=1
                     /locus_tag="KSE_02700"
                     /product="hypothetical protein"
                     /protein_id="BAJ26117.1"
                     /transl_table=11
                     /translation="MARELVAGLHLVLIRDGEVLLGRRAGTPFAEGHWHLPAGHLEAG
                     ESVLRGMAREAEEELGLRIREQDLDLVHTLHDLDADDGVGRLRLFFTARAHTGPLTNR
                     EPDRCAELAWWPLDALPTPIVGYAAAALADIAAGRPLTVSGWPATSRAAPSRTAVGGA
                     GSRLVLVRGNSASGKSSVAAGLRERFGRGLALVAQDNLRHVVLREHDRPGAANIGLLD
                     ATARYALDAGYHVVVEGILAADHYGPTLRRLVDDHLGVTRCYYLDVPLAETLRRHATK
                     PPTGATEDDLRDWYHERDLLPGGFETVIGADSALPDTVDRILRDTGLAELPALDV"
     repeat_region   303007..303016
                     /rpt_type=flanking
     repeat_region   303017..304494
                     /note="IS candidate"
     repeat_region   303017..303028
                     /rpt_type=inverted
     CDS             complement(303211..304452)
                     /codon_start=1
                     /locus_tag="KSE_02710"
                     /product="putative transposase"
                     /protein_id="BAJ26118.1"
                     /transl_table=11
                     /translation="MPRPGQLKSSVGDRFSDRIALGVLTRAYPPELIDEVVAACGRTE
                     QRSRLLPARVVVYFVLAMCLFFGQGYEEVARLLVQGLERESRWANGWRVPTTAAIGRA
                     RLRLGPEPLRALFARVCRPVAAEHTQGAWYRRWRLVAVDGTTFDLPDTAANAEFFGRP
                     GTSRGQGRSAYPQARVAALAECGTHAIFAAEVASLSVHETALAERLFPALAEDMLVLA
                     DRGFCGLDLWRSARAGGADLLWRVRSVAVLPVIAPLHDGSYLSEIVAARDRNRREDPE
                     RVRVIEYTIGSRGGDGTVYRLITSILDPADAPAGELAALYAQRWEIENTLDELKNHQG
                     APGLVLRSQHPRGVEQEIFAFLLVHHALRDLMHQAAMRGGHDPDRISFARTLRVVRRH
                     VTGQAALSPLPTGPGTHSEPA"
     repeat_region   304483..304494
                     /rpt_type=inverted
     repeat_region   304495..304504
                     /rpt_type=flanking
     CDS             304734..305750
                     /codon_start=1
                     /EC_number="1.1.1.169"
                     /gene="panE"
                     /locus_tag="KSE_02720"
                     /product="putative ketopantoate reductase"
                     /protein_id="BAJ26119.1"
                     /transl_table=11
                     /translation="MSGIPAQLPLRIAVFGAGSIGCRLGGALAAGADVTLIGRAAPMA
                     ELDRAGLTLTGPGDRRLHARPRTAVDASAAAGADYVLVTVKSADTAEAARLLATHLDG
                     RTTVVSFQNGLHNARTLREALPGRTVLAGMVPYNVVRTGPASFHQGTSGELLLERAPA
                     AGRLARAAAAAGLPVGLRADMPRVQAAKLLMNLNNAVNALSGLPLREQLGSRPYRLVL
                     ARCQREALAVFAAAGLVPARLTPVPPAWMPSVLGLPDPVFRRVAAASLRVDARARSSM
                     WEDLQRARPTEVDELQGEVVALADRHRLPAPANRRLRELVHQAERAAVPPAWSGPDLL
                     AALD"
     CDS             complement(306010..306966)
                     /codon_start=1
                     /EC_number="2.3.1.-"
                     /locus_tag="KSE_02730"
                     /product="putative acetyltransferase"
                     /protein_id="BAJ26120.1"
                     /transl_table=11
                     /translation="MAQIRLPAGYTARPLDPDADLPDLLDLLTACERDLHGPAAPAAD
                     PGELAAVLARPGFDPAVDTVLVHGPDGRLAAWAWSERRCECRVHPAHRGRRLGTGLLG
                     WIEGRAVEQGAEKLVQVVADLDATGLAMLRTYGYRPKGASWLLGIALDDLPEPPPPPA
                     GITIRPFRSGDPDDERAAHRVVEEAFADWKARRLPFEEWAQHAVHRETFAPERSPLAI
                     ADGDGETDGGTGGRVVGVALALDQPGSADGYVESLAVDRAHRNRGIARLLLQHTFRAC
                     RDAGLSHCTLWTHSGTGAIDLYLKVGMTVRYTSVVLEKTLPR"
     CDS             complement(307065..307751)
                     /codon_start=1
                     /locus_tag="KSE_02740"
                     /product="putative phosphatase"
                     /protein_id="BAJ26121.1"
                     /transl_table=11
                     /translation="MTTLSSAPEPVGLVIFDCDGVLVDIERIAVRVQVETGAELGWPL
                     DVAEVVERFIGRPPAAIRQQIEERLGTEAAAEWERRFERRHRELVDAELTAVDGIVDA
                     LDGLDARGLPYCVASSGSHDKMRHTLGRTGLYERLAGRIFSASEVARGKPFPDVFLHA
                     AARMGYRPEVCVVVEDSPAGLRAARAAGMRRLGYTAGPTGPALAEREFADQADTVLFS
                     DMRRLPELLD"
     CDS             complement(307900..308325)
                     /codon_start=1
                     /locus_tag="KSE_02750"
                     /product="hypothetical protein"
                     /protein_id="BAJ26122.1"
                     /transl_table=11
                     /translation="MEFFAAPDDTSAAPALPAGPGRAFAPLSYGNFDPEEAALTWQGL
                     LTGRRFEELAEADEPRLVAGEDDGGGPVVLALPPRLSAALADAGPAALDGLAAGWARQ
                     SAADGEAIGAGIAAEIVRGVAALARAARERGEGVYCWVG"
     CDS             308417..309034
                     /codon_start=1
                     /locus_tag="KSE_02760"
                     /product="hypothetical protein"
                     /protein_id="BAJ26123.1"
                     /transl_table=11
                     /translation="MTDMRAFRDAVVERAAGGSAEPTAADARTAGVRTAVLVEGPSDL
                     AAVEVLAGRLGRDLAAEGVCVVPMGGAMSVGRFAALLGPPGLGLRLTGLCDEHEQGFY
                     RRGFDRAGAGRAAFFVCVADLEDELIRTLGLPRIEEVLAAEGDLPAWHTFVRQPAQRD
                     RPPERRLRRFLGTRSGRKIRYGRLLAEALAPDGLPAPLDAFFRHL"
     CDS             309403..309564
                     /codon_start=1
                     /locus_tag="KSE_02770"
                     /product="hypothetical protein"
                     /protein_id="BAJ26124.1"
                     /transl_table=11
                     /translation="MCERVVADPDLSAELPAELPAELPDPDPDWNVDFDDHDELPRLA
                     RLRTEEGNP"
     CDS             309614..310333
                     /codon_start=1
                     /locus_tag="KSE_02780"
                     /product="hypothetical protein"
                     /protein_id="BAJ26125.1"
                     /transl_table=11
                     /translation="MDVLPAGAGPGADRAELTAAARAAFAAERPRPLAAAWWPAVPGE
                     SYLAAFDALGLHDRIPVTVRGGEAAQVDDTRYEGGEAVHRVFVTPEYAGWRLVHAESP
                     IGRCAWWPSTVAEALSAACGRAQLFYQDPFADSVFWLAAERGAVVRSYWRDGEPEWEG
                     EPMPWEEVLTVADFADEAEYEDAYPEPNASEARDVPAAARGLSVDPSLLGPDTPVRGH
                     GWLAVTRAGAGHLGFASLVVL"
     CDS             complement(310316..310867)
                     /codon_start=1
                     /EC_number="2.3.1.-"
                     /locus_tag="KSE_02790"
                     /product="putative acetyltransferase"
                     /protein_id="BAJ26126.1"
                     /transl_table=11
                     /translation="MPELAAARGYRLRGWTEPDAELLRAAAADPYIPLTTTVPSPYSD
                     AAAAAYLARQRRRTAIGTGYPFVIVDPDGRAVGGLGLWTGEVPLRGWATVGYWVAPAF
                     RRRGAAGAALAAAADWALGELALPRLELYVEPWNTGSIRTAERAGFRRTGLRPAHQLV
                     DGRPRDMWHYAREGDPGASEHDE"
     CDS             complement(310926..312416)
                     /codon_start=1
                     /locus_tag="KSE_02800"
                     /product="putative major facilitator superfamily
                     transporter"
                     /protein_id="BAJ26127.1"
                     /transl_table=11
                     /translation="MTERTTTAPTGARRAGPPALDRRLVPPMVLGSVLNPINSTVIAV
                     ALVPIGAALGASPAQTAWLVSALYLATALGQPVVGRLIDLFGPRRLFLASTSLVGVAG
                     VVGTLAPNLGTLIAARVVLGFGTCAGYPAAMALLRAESRRTGQESPAGVLTLLAVANQ
                     TVAVVGPLLGGLLTGLGGWRSTFALNIPLSLLAVTLGALRLPRPEAEPAKPDQAGHPD
                     EADQAGRADQPDEAGQADGGPGPLRRIDLPGMALFAVLLLSLLLFLMHPHADRWYLPP
                     LTLAAAAAFTRRERRTAQPFIDVRVLGGNTPLLLTYARALAAYVVAYAFLYGFAQWTE
                     EGFGLTPLQAGLVQAPTFLVGIGVSVLAGRRGGVRTTLLVGAAGQIAACLLMLALGAH
                     SPLWALVVLAVVFGIPQGANGLALQNSVFRQSDPARTGSSAGLLRTFAYLGSMVAAAA
                     TAAAYGPHAGTAGMHHLAWVMLAAAVLFLLLTAFDRTLRALPAAAG"
     CDS             complement(312459..312911)
                     /codon_start=1
                     /locus_tag="KSE_02810"
                     /product="putative MarR family transcriptional regulator"
                     /protein_id="BAJ26128.1"
                     /transl_table=11
                     /translation="MSEDAEPAPSAVRASQQVRSVIGKLRRRIRAAAGTGDFTLTQAS
                     TVGRLLDNGGQGLTTSDLAVAEGMRHQSMATTIAALAAQGLVERSRDPEDGRRVLIGL
                     TEEGRRRGEEGRRARGEWLAAELQRTCTEEERQTVIAAMAVLERLVQD"
     CDS             313131..313925
                     /codon_start=1
                     /locus_tag="KSE_02820"
                     /product="hypothetical protein"
                     /protein_id="BAJ26129.1"
                     /transl_table=11
                     /translation="MHFTFDPSADLLLDDRDGDSGARTGTHNGTAAVRERGFTLDGVP
                     GVLWTPATADAPAPLILLGHPPLGLRRMHPRLLDRARHAAADGFASAALELPGSGERP
                     GIPELDLARAELRRALGAGEAVAPETVDALVLPLVDRAVPELRAALDALLALPELTGP
                     VGYSGGVIAVGVRLAAVEPRLAAAGLFAGSLIPRRTFAEARGITIPLHVLLQWDDEGN
                     DRQAALDLFDAFASTEKSLSANMGGHTGVPAHAAEAAAGFFRRHLK"
     CDS             complement(313962..314558)
                     /codon_start=1
                     /locus_tag="KSE_02830"
                     /product="hypothetical protein"
                     /protein_id="BAJ26130.1"
                     /transl_table=11
                     /translation="MQHGMGEHSRKDARRGAAADLAEGRYARVERERRFLLARVPAPG
                     AVTVARRITDRYVEGTRLRLRRVERLDTGECTYKLTQKVPAPPGTPAATQGLVTNLYL
                     SEQEYTRLLAALPGPELTKTRLSVPPLGVDVFEGPLHGLVLAEAEFETAEDAETFVPP
                     PGYVAELTDDRHFTGGHLVRTAREELRDDLAGYGVALP"
     CDS             complement(314796..315560)
                     /codon_start=1
                     /locus_tag="KSE_02840"
                     /product="hypothetical protein"
                     /protein_id="BAJ26131.1"
                     /transl_table=11
                     /translation="MSEWLALALAMAGACLVVVAVVLVRHRKADEDEDTSETPDVIEY
                     ITMMIGVVYAIVLGLAIAGVWESRSAAQDDVQTEAQSLYEVSSRAEVFPADYRAVVDK
                     DVDAYVSFVVDTEWHYMRTEGGISPDGTALLGRLRTDVASRAPQNDIEAQAYQAMMDK
                     IAVADEARNSRGGNVGPTMPGVVWFGLGIGAVVTIGMMFALQIRRTRRELVLAGTFSA
                     LIGFLLFLIWDFDDPFGRGMSVTTEPFLNLFPFLGG"
     CDS             complement(315643..316539)
                     /codon_start=1
                     /locus_tag="KSE_02850"
                     /product="hypothetical protein"
                     /protein_id="BAJ26132.1"
                     /transl_table=11
                     /translation="MQRNDRPRADGGTEPAALPAPASGAPAGAARAGQLRRGARAATA
                     LAGVAVVCGVLTGATQAASSAAHDRDDHRLDLCVTVHTSVDAAGVHIGVDAGAGVSVP
                     LRPQDVGDGRGHDSHGNGHGYGHDHHCHPTPTPTPTPTPTPTPTPTPTPTPKPTPTPT
                     PTPKPTPTPTPTPTPTPTPTPTPAPESVPPAPARPAPTPTPTPKPTPPPAPTPTPEPV
                     PEPVPSPAPTTPSPSPSPVPGRPAPPVTVHLPPPPHAQEAKHRGSTTTTRMLVVTVPA
                     VLAAAALRPRGKSGGAGRRSRS"
     CDS             complement(316778..318184)
                     /codon_start=1
                     /gene="eshA1"
                     /locus_tag="KSE_02860"
                     /product="putative nucleotide-binding protein"
                     /protein_id="BAJ26133.1"
                     /transl_table=11
                     /translation="MSVDSSPETQQAQRQQTSLTTAAARNLATTTKSAPQMQEITSRW
                     LLRMLPWTQTSGGTYRVNRRLTYTVGDGRIEFIQTGGDVRVIPQELGELALLRGYEDD
                     EVLTALADRCRQRDFRVGEVLVERGTPSDKIHLVAHGKIDQVSTGKYGDDAVVGVLGD
                     GDRFGENALLDADATWDYTATAKTAGTLLTLSRADFEAVLAQADSLRAHIRDFATLPL
                     QRQNELGEAEIAMSAGHEGEHLLPTAFVDYELKPREYELSIAQTVLRVHSRVADLYNQ
                     PMNQIEQQLKLTVEALRERQEHELINNREFGLLANCSFDQRIQTHSGPATPDDLDELL
                     SRRRDSEFFLAHPKAIAALGREFNSRGLYPDTVDLQGHKVPAWRGVPILPCSKIPITP
                     ENTSSILVLRTGEDNQGVIGLHQTGIPDEYQPSLSVRFMGIDDKAVINYLVTAYYSAA
                     ILVPDALGVLENVEIAHR"
     CDS             complement(318628..319599)
                     /codon_start=1
                     /locus_tag="KSE_02870"
                     /note="Belongs to Patatin family (IPR002641)."
                     /product="hypothetical protein"
                     /protein_id="BAJ26134.1"
                     /transl_table=11
                     /translation="MDGLLGDSGLPGDGGLPGGGARPGGGSPDVGGSWPDGRGKVAFV
                     LGGGGERGGNQVGMVRALLEAGITPDIVVGTSIGSVQGAILAKNPTISVVAELTELWM
                     EFVSMKVMKPSLRAFASNVRHVRAGLTSVDAAHRMLLNHFAPHTRIEDLKLPFVCPAS
                     SIERAEAHYFDHGPLIPALLASCCVPGLFPPVEIDGEHYLDGGLIDSLPIGVAASLGA
                     TTVYALRIRQTGERLAPPRMPWQLAHVAFEVTRRAAVEAEIGRHRPGVTVHVLPSGED
                     ELVKAGRGPVSSGRAELETVRRRIALGYDAASAFLEARQRTRQVAPG"
     CDS             319875..320945
                     /codon_start=1
                     /EC_number="2.3.1.-"
                     /locus_tag="KSE_02880"
                     /product="putative acyltransferase"
                     /protein_id="BAJ26135.1"
                     /transl_table=11
                     /translation="MHRTPPSPGLSRAARLRGGAFAAAGDALALGALTVFLLLLSPLL
                     LLLGLLRPLLPARATAPARLPLVWAAYLTGFSLTALAGSLRLRARRAGPDAWRLLGVR
                     AGRRFRLLTEGWTGLRFQVDPPEPLPDPGRPVVVLARHAGILNTQLAITAVTAVLGRG
                     PRGIAKRCVALEPGLRALLRGVPLVLFRWNRAGRAAALAELTDQARNLGPGEALWLYP
                     EGTNYSAARRAASIARLRARGQDALADRAAAMPHLLPPHLPGALAVLSAVDPSALVLV
                     CGHTGPERLLPWMLGPGYTPGPGDLVRLRWWSFRADQVPTEQQQFADWLYDRWQQLDT
                     WIAGPATAPAAPPHPAGDLDPA"
     CDS             321313..322548
                     /codon_start=1
                     /locus_tag="KSE_02890"
                     /product="hypothetical protein"
                     /protein_id="BAJ26136.1"
                     /transl_table=11
                     /translation="MGGPWDGLPRDLCTDLRAEQQSLAAEIVREIRSAVPEFSRPLSG
                     PFGAGIQQGVETALAEFTDRVAGLPAPGPRQLRVYRSLGRGELAEGRSLDALQAAFRL
                     GARLAWRRYARVARRRGLAAEQLVTLAEAVFAHIDEVAAASVRGYVDARTDRAGALGR
                     ARHRLHELLLAGAEPAELAAAARLADWPLPERVAAVSLDPRPAPSGPPAPAPPSAPAP
                     PFAPPSAPVAPSGALPDQVLASLDVRQPHLLLPEPAVLLGDPRVGAALQGRGAVIGPV
                     VPVGLAAQSLRWARLVRASLPEPPPRPVDCRERYADLLLLTDPALVRLIAERRLAPLA
                     PLTPKQRDRLAATLLAWLQTGRGSAPEVAARLGIHPQTARQRLHRVQQLFGPALTSPD
                     TRLELEVALRATSAGRSAW"
     CDS             322739..323884
                     /codon_start=1
                     /locus_tag="KSE_02900"
                     /product="putative lytR family regulatory protein"
                     /protein_id="BAJ26137.1"
                     /transl_table=11
                     /translation="MVQTDELSTGETSAAAAKDAAAPAKPRRRARRILLITGGTVLAL
                     VLAAGGTGFWMYRHLEGNLDTVDIDKALGEDRPAPLPDGAQDILVLGSDSRSGDNGDL
                     AGGDVGGTARSDTAMVVHIPEGRSNATVVSIPRDTMVARPACTTADGKQVAGTPRVMF
                     NSIYTTAGPACVVKTVESMTGLRMNHYVEIDFAGFKDLVDAMGGVEVTTDTAIDDKYS
                     GLHLPAGTHLLDGTQALAFVRTRHGVGDGSDLGRIGLQQKFLLSVLSQLQRKGTLTSP
                     TKAYGVANAATKALTTDTSLGSLNGLLDFAQSMKGLQPERMKTVMLPVVTDRIDHNRV
                     VADEAKAAALWASLRENRPVPSGSPAASASASPSASARSSASASAHN"
     CDS             323898..327833
                     /codon_start=1
                     /locus_tag="KSE_02910"
                     /note="bifunctional protein"
                     /product="putative glycerophosphotransferase/
                     glycosyltransferase"
                     /protein_id="BAJ26138.1"
                     /transl_table=11
                     /translation="MVAHRPRLSVVVPFQNVEAYLAECLESVARQSFRDFEVILVDDG
                     STDSSTDIARAVCDRDRRFRLIRQEPHGPGHARNTGLRAMHPDGEFLVFADGDDVVPE
                     HAYETLLRTLEESGSDFVSGNVQMMNSTSTWQSPLHKAPMQAERRGTHITKFDKLIYD
                     RTVWNKVFRRSFWDYYFIEFPEGVLYEDSWVNMFAHFRAAKVDVITDVVYYWRRRDGA
                     AAPSITQRHHELDNLRDRVAAVQSVSRFLAGHRSQRFAESKRKYDLACLTSDLMLHLK
                     VLPDAEEEYQHAFLEWTNEFLDEADPDLIGELPAEARVKWLLVRGRKLAELLEVLEFE
                     RRGGPMPVQRRFRRYLKYPHLGDRSLGIDRKAYRLDKELALHGSVGEVRWEDERLVIG
                     GHAYIRFLNVHKRHMSVKGFALRNRKQDRMLLVPARTVYAPQATEHSGQNRYCYDWAG
                     FSTSFDTNRLKLKGKWAEGTWDVAAGVLSRGLFRYRGLDRGSVGSAANPPYRYVDKNT
                     RVLPLFVQNRLKLRVEIVRCRITGHRIDGDHLVLRGVYLGPTVPTGGQLRLVSLGGAG
                     RVQVPVRFTPGGEGWCTFTGRVPLRSVVPAQPAADETRPVSWERGGNGWKTTFHVAGR
                     AMTMYPVMAEDTPDGHHRLPAALQTPEGDRELVVHRNGAGYLVLFERATLPRVIRYEW
                     LADGPLEIVGRYPALDRVPPAERRTAHLVLRSRAQGTERAISLEWRGEYFRARFDPAR
                     LRTLAGTIPLAAGRWDLFLRRQDPSRTPPAELLPDLMLKLEQDAIPGLPLPREADERR
                     YDLQAEAYDRLSLQVHSAMPDHARGPYRQKLLRTKTYPAARQRPVRPAVLFDAFKGTQ
                     YSDSPRAVHEELVRRGARLEHLWVVKDDQVDVPETARAVRMWSPEWYEALATSRYVVA
                     NNHLPDWFRKRPGQTVVQTWHGTPLKKIGHDIEAVHFADKRYLERLAVEVENWDLLVS
                     PNSFSTPILRRAFAFPGELVESGYPRNDVLCRPDTERRAEQVRRRIGIPEGKRVVLYA
                     PTWRDDQYYSPGRYKFDFRIDLADARARLGADHVLLVRRHPNVVDPVPGAGDGFVHDV
                     SDYPDMADLSLITDVMITDYSSLMFDFVNTGRPILFYTYDLEHYRDTLRGFYFDFESS
                     APGPLLFDSAELVDAVRDADGVRRRHAERYRRFQQDFCDLDDGRAAARLVDRMLTVGG
                     DLDPGTAPTPVSAPARGAEAVAGAVPAAVAGAVPAAVPGAVPAPVRTAARTAAPAPDR
                     PRAGVPMPGDTFEGVPWPLPAHLTTPADPDALRLRERVGARRSTEHDHV"
     CDS             327826..329262
                     /codon_start=1
                     /locus_tag="KSE_02920"
                     /product="hypothetical protein"
                     /protein_id="BAJ26139.1"
                     /transl_table=11
                     /translation="MSDQDRPSRPTVEGTDSSGPVPVDFRFSPTRNGTRHLVVVFANF
                     SAPEDYGFSNGVLDQVRANVLWIRDRFDGGNAFYLCQDMDFATERAVAAVIARFVHAL
                     DLTHDQVTVFGGSKGGSAALWFGLRHGYGNVLALIPVFRIGTSLAARRPAAAELMMGG
                     ATPEKVAALDALLPDLVASTPHRNTRVYLVTSPQDELYAEQVEPFLPLFAGYPDFHLL
                     VNDSPLITGHTSVTARTLPAVLGLLNLLVAGITPRLGLARTGGEQPDRDTSALDALLA
                     ATERFPRPQVAFPDPAVPVPGDVVAVGGRAPGAERVSIWLSGKYMGSAQTAEDGSWVR
                     QFTRPWEAGEYTLKLFGVAPDGEQSPRTLHTFTVVEPAPGLPTPLVTEPADLSLVPGP
                     TVRLSGSAPGAERVELVIGEHSLGSTPVTPEGNWSWQPAWEWRGGEHTVDVVAQLPGV
                     RPSAPARVTFTVAGALARDARLQAKYGY"
     CDS             329356..330726
                     /codon_start=1
                     /locus_tag="KSE_02930"
                     /product="putative peptidase S12 family protein"
                     /protein_id="BAJ26140.1"
                     /transl_table=11
                     /translation="MPDAVDGLSGLDEVCERVLAETGCPSVSVAVAAGEELVLARAYG
                     LADVAAGRAATPGTAYGLASTTKAFVALAVCLAADRGLLDLDAPLAAGFGRTAPTPRQ
                     LLCHRGGFPGYYDFSYESAYRPVDIDRYRRQLHEPGGEFEYANLGYQELGRLLEAVTG
                     RATADLLREWIAEPLGLADFAYAHVHPGPGPAATRYTPDGRPYPPVRNGHPAATSGWA
                     TAGDVARFARRSLGLLKPETAAAVHVGPAIFDADGLDSGGLGYGLGRVFQRTADGAVL
                     SSHGGGMGGVASMMLDVPARGLSLAVLANSTDKTARDAVFRYLTAALAPECDPRHLAP
                     SAEPGLPCTLAPGSWSGQVATPDGDTVPLAVTALPDGRVEVRLADHPPVTVPAAASAR
                     WDVRLVAPLQLPTPDALLNSPSFGLELRLRDGDLTGRAIAFRNGDREGLLGPYLPHPC
                     ELRRQG"
     CDS             complement(330754..331986)
                     /codon_start=1
                     /locus_tag="KSE_02940"
                     /product="putative oxidoreductase"
                     /protein_id="BAJ26141.1"
                     /transl_table=11
                     /translation="MADSTHVAIVGGGPGGLTLARLLTMRGDPALRVTVHERDTGRTA
                     RTQGGTLDLHADTGQRALRAAGLTGAFRRYARPEGEDMLLLDHTGTVLHRDDTPADSP
                     ALRPEIDRTDLRDLLLDSLPPGTVAWGRTLRTATPVAGEAAAGAGWRLEFTDGGRADC
                     DVLIGADGAHSRLRPLLTPAEPRHLGVNAVEGTIPDVDRTRPDLAAVVGRGSYWVIGE
                     GRSLAAQRCGDGSVRVGLTFYGRTDGAADWLTSCGIPFTEPDAARAALLPLFADWTPE
                     CRALIAACTGPVTPRPLTGLPVGLRWPHRPGLTLLGDAAHLMPPVGHGANAAMRDALE
                     LATALAAAPADPDAALRAYEEEMFARTAGVAADSARILAMITAPAGARGVAAFFRGEG
                     TGAGPGEGPEPEPEPARR"
     CDS             332145..332954
                     /codon_start=1
                     /locus_tag="KSE_02950"
                     /product="putative TetR family transcriptional regulator"
                     /protein_id="BAJ26142.1"
                     /transl_table=11
                     /translation="MTPRHDSPADSSTAASSGLIWERPEPPARRSPGPLSRALIVTAA
                     LELADADGLEGVSFRRVAAALEVGPMRLYGYVETKAELLELMVDAAYGEIAPRTASGR
                     GSRSTAAGASRAAGRAGEPGWREELRAIAERTRLTALRHEWFTELLGGRPHLGPNALA
                     VMEAVLAAVQRVPGLADDPTGVQRAAGVFHAYLTGTLRVEVGQRQAERSEGRSDHDWQ
                     AAMGPYLVRTLAAGRHPTVARVMAEAEHLAPGEQFAAGLELVLDGIAAQSP"
     CDS             complement(333249..335291)
                     /codon_start=1
                     /EC_number="3.2.1.-"
                     /locus_tag="KSE_02960"
                     /product="putative glucanase"
                     /protein_id="BAJ26143.1"
                     /transl_table=11
                     /translation="MAPHTRRVLALGTTLSTLTLGLVAFVGVPAAQAATPAHPFPSHT
                     AYKVGVMPSASQATRDAAVTKQYDSWKSNYLVHGCASNEYYVSTKGDGDAPNNGTVSE
                     AQGYGMNIVPLMAGYDPDAQTEFNGLWQLVKNHQDQYGLMQWKLDGSTCKYADSGTPD
                     AATDGDLDIGYGLILADKQWGGYKTDALAWLGKIYAHDVTSDGHLKCEDDGVSTDTRP
                     SDHMLDHLRAFAAYDTAHDWNKVISRTEAIDQSLVSNYSNGHGLLPDFVVGANGTPSP
                     APANYQESQPDNIVGYNSVRVPWHMGTDALLNGPSTAAFAYNDAKLWSACAKAISGGN
                     PKNVQPHIKLSCANANVSGDTSAEEAGDSVGPSAMAAGDQAWTDAIWNQLATNPFGDH
                     YYGETIKMLVYLVMAGDYWNPAATTTAPANDFSLALSPASGSVSAGASATVTVSTATT
                     SGTAQSVALSASGLPAGASASFSPASVNSDSGSTLTVTTTASTPAGTYPITVKGTAAS
                     GTHSATYTLTVTTTAPANDFSLTLSPVSGSVSAGASATAAVSTATTSGTAQSVTLTAT
                     GLPAGASASFSPASVNSGSGSTLTVTTTASTPAGTYPITVKGTAASGTHSATYTLTVT
                     TTSTGTCQPAWNPATAYVPNDQVSYNGHNYTALYWSTDVTPGSAIAWNIWQDNGTC"
     CDS             complement(335368..336753)
                     /codon_start=1
                     /locus_tag="KSE_02970"
                     /product="hypothetical protein"
                     /protein_id="BAJ26144.1"
                     /transl_table=11
                     /translation="MAAALPAAALAVVAAGPAHAAGGTFPAHYSAPYLEIDSSTAGDL
                     AADLSASGDKFYTLAFLTPKSGCTPMWERGNDPVGAFKSQIGSLQSAGGNVIISFGGA
                     AGGELAQTCTSVSSLTAAYANIVNTYGVTRLDFDIEGSVLDDTTANARRDQALAALQA
                     QNPNVQIDFTLPVDPGGLPANAMNMLKDAKSKGVKVNLVNIMTMDFGNGQNALNDAES
                     AANGTAPQLASLYGITTAQAFNRLGLTPIAGQNDDNEFFSQANAQTLETFAASKGVQE
                     LAFWEVDGYDKALNYAYSKIFQKITGGTTASDFSVAVSPNSGSVKAGSPATVSVSTAV
                     TSGVAESVALSASGLPAGASASFSPASVNSGSGSTLTVTTTASTPAGTYPITVKGTAA
                     SGTHSATYTLTVTATSTGTCQPAWNPATAYVPNDQVSYNGHNYTALYWSTDVTPGSAI
                     AWNIWQDNGTC"
     CDS             337228..338868
                     /codon_start=1
                     /locus_tag="KSE_02980"
                     /product="hypothetical protein"
                     /protein_id="BAJ26145.1"
                     /transl_table=11
                     /translation="MTTPTAVAAPSGGGTATVSAAVTAPAAFTHPGVLLGKSQLDLIR
                     TRVNGGVEPQKSAWSQLLASPYASSSYTPHPRSTVECGSSSNPDYGCSDEREDAIAAY
                     TDALAWYVTGNSSYAKKAIQIMDAWSGTITTHTNTNAPLQTGWAGTVWSESAEIVKYT
                     YSGGWSNSARFDTMLRNVYLPVVIQGAPDKNGNWELIMMDAAVGIAVHLDDATSYNKA
                     MSIFTGRVPAYVYTTSDGSQPAYPPRSSINTTSELVSYWFGQSTFVNGLAQETCRDFG
                     HTGWGLDAISHVAETARLQGTDLWSQLATRMRSTYEFHAGYDNGASVPSSLCGGSVSL
                     GVGPVTEIAYSALHNRLGLSLANTQKYTLAHRPEGTDDHWIAWETLTHGDTGTPAAAN
                     DFSLALSPASGSVSAGSPATAAVSTATTSGTAQSVTLTATGLPAGASASFSPASVNSG
                     SGSTLTVTTTASTPAGTYPITVKGTAASGTHSATYTLTVTTTSTGTCQPAWNPATAYV
                     PNDQVSYNGHNYTALYWSTDVTPGSAIAWNIWQDNGTC"
     CDS             338992..339126
                     /codon_start=1
                     /locus_tag="KSE_02990"
                     /product="hypothetical protein"
                     /protein_id="BAJ26146.1"
                     /transl_table=11
                     /translation="MLVWADDGCANSLVEYGLTVLALALVTVKRGDDTRGFALAIVPE
                     "
     CDS             339191..340141
                     /codon_start=1
                     /locus_tag="KSE_03000"
                     /product="putative esterase"
                     /protein_id="BAJ26147.1"
                     /transl_table=11
                     /translation="MTARAELIVESGELRLWTERVGASDDPAVLLVMGTASPGIGWPD
                     ELVDVLVAGGRQVIRYDHRDTGRSSCVDFTTRPYALADMAADATAVLDGHGVAAAHIV
                     GVSLGGAIGQWLAVHRPERVLTLTAIMTGPMGHSAGPAWVRAMAGQAPDPSDLPPPAA
                     RFLAHLARRAALPQGTRDEYVTANLETWRVLNGDVLPFDEPAARRFAQASFDRSGNPA
                     AALNHDLAGRHLTEDRLVPLSSIKAPTLVIHGTEDPLRPLPHGRALAEEVPHSRFRPI
                     PGMGHSLFSPGLPRQIGEIIREHIAQGLSRNCRPSLDGGA"
     CDS             complement(340121..340684)
                     /codon_start=1
                     /EC_number="2.3.1.-"
                     /locus_tag="KSE_03010"
                     /product="putative acetyltransferase"
                     /protein_id="BAJ26148.1"
                     /transl_table=11
                     /translation="MVRRGSDVKNRRMHEVRLSDGVVTLSPLSLDDVQAHLAGEDELL
                     VRWLNGGPGTREGVEAYFQHCREQWEAAGPLRAFGIRVGADEVLAGTIDLRFPGEGLL
                     PGQVNIAYGLYPSRRGRGLATRAVLLACRYAASEGGAEAVIQVEPENPASAAVARRAG
                     FTPGRQAQGKDGRRFDWYTGDLRAAIQ"
     CDS             340911..341492
                     /codon_start=1
                     /locus_tag="KSE_03015"
                     /product="hypothetical protein"
                     /protein_id="BAJ26149.1"
                     /transl_table=11
                     /translation="MLTVDGALVPTRDHSIAEQSKNYRYSTNHQVVIDAHPPPGHGDR
                     LTPAGRPERPQGMGGIRHEGRRRQDDDHRRRRLSGHRSRHPAPEIARQGTDRVTDRAQ
                     PCAQAGPRPSRTRIRSNGDLEDPARLPPQGRRSPPRHARHRPAPQPRPGRVAGQSTAR
                     QPLPDPSKKIDYGKVPGACSRSSPRAASDRAAA"
     CDS             341266..341370
                     /codon_start=1
                     /locus_tag="KSE_03020"
                     /product="hypothetical protein"
                     /protein_id="BAJ26150.1"
                     /transl_table=11
                     /translation="METWKILRDCRPKGDGVHHAMLGTARLHNLVQAA"
     CDS             342096..342698
                     /codon_start=1
                     /locus_tag="KSE_03030"
                     /product="hypothetical protein"
                     /protein_id="BAJ26151.1"
                     /transl_table=11
                     /translation="MGRARPKRERLAAGRAERARSALRPSAPPEPGSRGRSFASWAGC
                     LVVSLLILFVGIGLLRDSLALAHGAGVPGEFVVTEEHPCGRCQEPMGDFTPDAPKPPG
                     PGWTVPRPETVSGVMSWGGIPATRVGERARVLYYDGEVYSPDSRLWAYGAAATAFGGA
                     MLLFWSVLAVRRLRRHRADRAARAARTGPADRSGRPQFAD"
     CDS             complement(342738..343184)
                     /codon_start=1
                     /locus_tag="KSE_03040"
                     /product="putative MarR family transcriptional regulator"
                     /protein_id="BAJ26152.1"
                     /transl_table=11
                     /translation="MGQQHEGGLDPAELARLRLVIARLNRHLMRASDRQEFTFAQQSA
                     LARIEQHGPIRLGELAALERVTAPSITRTVASLVDARLISRVPDPNDGRSALVELAPG
                     GVDLLAHIRRRRSELLARRTAELTAPERQALMAALPVLERLVAFED"
     CDS             complement(343219..344979)
                     /codon_start=1
                     /locus_tag="KSE_03050"
                     /product="putative major facilitator superfamily
                     transporter"
                     /protein_id="BAJ26153.1"
                     /transl_table=11
                     /translation="MADVDTQKRWIGAEHPRYKWVALSNTTLGMLIATINSSIVLISL
                     PAIFNGIHLNPLEPGNVSYLLWMLMGYMLVTAVLVVTLGRLGDIWGRVRIYNAGFLIF
                     TVTSVVLSLDPMDGGGGALWLIGWRVVQAVGGAMLMANSAAIITDAFPARQRGMALGV
                     NMVAAIAGSFVGLVLGGVLAEWNWRSIFWVNVPIGVIGTVWAYRSLHETGVRRPGRID
                     WWGNVTFAAGLTALLAGITYGIQPYGGHTMGWTNPWVLAGLIGGSAVLIAFCVIETRV
                     AEPMFPLRLFRDPVFAGGNLATLLGSIARGGLQFMLIVWLQGIWLPLHGYDYERTPLW
                     AGIYLVPLTVGFLAAGPVAGHLSDRFSARMFAAGGLVVMAGSFAGLLLLPTDFEYVWF
                     ALLVFLNGLGGGLFAAPNTALVMSSVPPADRGAASGMRATFQNAGMVLSIGVFFSLMV
                     AGLAGSLPQTLNDGLTGQGVSPADAHAVAQLPPVGTLFAAFLGYNPIHELLGPQVLSG
                     LPAANAQTLTGREFFPHLISGPFHDGLMVVFALAIAMSLVAAAASLLRRRGAGTVGDG
                     PESGTATVPDGDTAASRGPA"
     CDS             345187..345444
                     /codon_start=1
                     /locus_tag="KSE_03060"
                     /product="hypothetical protein"
                     /protein_id="BAJ26154.1"
                     /transl_table=11
                     /translation="MRPARASVLPQFVDRDRGHVTAQMLPLGLVFNLIAVLSDMAWGP
                     VAATARDWFARSPRRLSLVGGVGGLAMIGLGVTVAATGRKD"
     CDS             345579..346022
                     /codon_start=1
                     /locus_tag="KSE_03070"
                     /product="hypothetical protein"
                     /protein_id="BAJ26155.1"
                     /transl_table=11
                     /translation="MREPGYYRDLANDSSDPAVLHELAACPYPFVQHAVAANPCTPPA
                     ALRELAELCGLVPHDRSPWNDNRLLLLLARHPAADRRVLAAAVAAAVAAATVRLAAGT
                     RPYAAVLALADRPELPPEELRALGRLPGASARLRGGLRRVLDGRG"
     CDS             complement(346053..347300)
                     /codon_start=1
                     /locus_tag="KSE_03080"
                     /product="putative cytochrome P450"
                     /protein_id="BAJ26156.1"
                     /transl_table=11
                     /translation="MIDIQRCPHRLDLDGSDLHAESAALRAAGPAARIELPGGVTGWS
                     LTDPALIKRLLTDPRISRDASRHWTADLAGEVPADWPLRMWTDVRNALTAYGPDHARL
                     RRLIGPAFSARRVRALAPEIERITAGLLDRLAAHPEGEVVDLRAEFIWVLPLMVANTL
                     LGVPEEIHDAFRSTIGRTFETGATPEEAVRNAEAVYVQLALLAKAKREEPGDDVTTAL
                     VQARDEETGGGLDERELLDNLLLLVGAGHETTVNLIGSTIAQLAADPQQLDQLKADPA
                     RWPDAVEETLRHQPPVANILARFPVEDVHDEPTGLTFVRGDLLVVNFLAAGRDPALHG
                     EDAARYDHTRPTRRDHLSFGHGVHYCLGAELARLESRIALAALFERFPCLTLAVPADE
                     LRPLPSFISNGPRELPVLLHGRA"
     CDS             347425..347778
                     /codon_start=1
                     /locus_tag="KSE_03090"
                     /product="hypothetical protein"
                     /protein_id="BAJ26157.1"
                     /transl_table=11
                     /translation="MPYVAEGDYSRAGGEAAMRELLARVTELDAVFVASDLMADGALS
                     VLEHAGRGVPADVAVGGFDDSPVAAGTRPPLATIRQPWDRISAEMVRLLLARIAGEDA
                     PTVILPTELVVRRSA"
     CDS             347961..348593
                     /codon_start=1
                     /locus_tag="KSE_03100"
                     /note="Similar to Isonitrile hydratase in Pseudomonas
                     putida (Q8G9F9)."
                     /product="hypothetical protein"
                     /protein_id="BAJ26158.1"
                     /transl_table=11
                     /translation="MKIAILLYPEFTALDAVGPYEVLGRMPGAEVVFAAERRGPVRSD
                     LGSLALTADAALDEVGAAGLLLVPGGPGSARQHGNPAVLEWLRAVDTTSTWTTSVCSG
                     SLLLAAAGLLTGRRATTHWFVDGELAALGALPAAERVVFDGKYATAAGVSAGIDLALH
                     LAGRIHGDAVAQSIQLVTEYDPQPPYRAGSVATAPPAVVAALRANDLIVR"
     CDS             complement(348659..349585)
                     /codon_start=1
                     /locus_tag="KSE_03110"
                     /product="putative RNA polymerase ECF subfamily sigma
                     factor"
                     /protein_id="BAJ26159.1"
                     /transl_table=11
                     /translation="MMAAVEFEAHRAELTAHCYRMTGSFHDAEDLVQETLLRAWNARE
                     RHDPARSAVRTWLYRIATNVCLTALEGRARRPLPAGLGAPGQDTAAPLTPALDVPWLE
                     PFPDARLDAAARTDLRLAWVAAVQLLPARQRAVLVLREVLAFSAAEVAEQLDTTVAAV
                     NSALQRARAALAAAEADRVREPDGPEARAAVDRYLAAFEAADVPALVALLSRDAILEM
                     PPLPLWYRGAAPYGRFMERVHAMRGTDWRTRPVGANGQPAFAAYARTLDGAGYVLHSI
                     QLLEPAGGLIARNTVYTDPGVLAAFGLPQRWG"
     CDS             349710..353024
                     /codon_start=1
                     /locus_tag="KSE_03120"
                     /product="putative membrane protein"
                     /protein_id="BAJ26160.1"
                     /transl_table=11
                     /translation="MLGFVLRRLRGRLPLAAALLFTVLTATTVLTTLVAFDRTVADAG
                     LRRNLDGAPRAAVVLSGDRGADSRAAEDAGAAALGAELFDGLPVAVRSLAHSRAYGLP
                     APASPSGGPSGGPSGGPSGASAREVDLTVLAALEHDRVRLTAGRWPGGESTGSGESSG
                     SSASTGAAGSGDRAVRVAVPGSTLTRLGLAEGALPARVVLSDRYGGRPLTVEVTGVYQ
                     PVDRDAPYWRLDPLGGREIQVRGFTTYGPMLVDDGLFGSGALPQGGRSMMLTADFSGA
                     DRARVERVAARAGRLPELLKRHVPDAQSQTELPVLLGELRSATLVAESTLTIGALQLG
                     VLAAAALLLVVHLVSERQQRENGLLTARGATRRRLAGWTVVEALLLVLPAALLAPPLA
                     GPLLRLLTDRGPLAGLPLAGADTGVRWLVAALCALACAVLCALPALLRRGGERVVTRH
                     QAVVGTVVRSGADLTLLALAVVAYRQLGARTGGLSVDADGVLGVDPVLVAAPTLALCA
                     GTLLVLRLLPFVARFGARLAARGRGLGAALGGWQLARRPGRANGPVLLLVLAVAAGVL
                     AVGQHTAWRDSQRDQADFATAGGLLIRGSALPSLGQGGRYGALPGGDRLLPVARAEQS
                     LPGERRGQVVLTDTARAAAELRVRPDLLGGRPLGELFGPLAGQPAPGMPLPGRPARID
                     LTVAVDTADRPLGDGTALQPPDLWLQLRDGFGATHRLLVPQLPARGETTVPLNLDALT
                     AAPLGSVAAPLTVTGFGLTYPAGWTESASTLTVRRIAVAGTAAGPGVPVPAPAGRWTA
                     PAGGLPFEVSAPADGAGLLTAVYSPAGDHHDGGRAAVFAPGGAPTGPEVPALATRDYL
                     AAVGASVGDLAKVQFGSASVPVRITGTVPALPVHGSTVLLLDLAGTDRWLTERGFDVP
                     DVSEWWLPAAGPDDRVPAEAAAALRAGPTAQQLTLREEDTAARSGDPLSAAPQSALAA
                     LALAAAVLAAIGFTAASAASASERAGESAVLLALGAPRRLLNRAAAAERFVLVGLGTA
                     VGLLLGAALVHLVVPLVVLTPAALPPLPAVRVSLPLGPVLALAAGTAALPLLSAFLFT
                     AHRRNLTTHLRAAEDR"
     CDS             353114..355879
                     /codon_start=1
                     /locus_tag="KSE_03130"
                     /product="putative membrane protein"
                     /protein_id="BAJ26161.1"
                     /transl_table=11
                     /translation="MSTPAPWVRTRLRTAPTAAALTAVLALALVFLAAALPRALDRGA
                     DGALRDFLRGSGPVATSVGVTSGLPVTDDPSGRLDETSEQLTGVVGAVLPLDPSGPVY
                     GRRAKLPRSLPQQGLTEPDGVPPEVALQYQHGARERVRFTEGRWPAGAGAAGEPAEVA
                     LSAAAARTLGIKVGDVFRSDRSVLDRGYPLKPMPLRVAGLYEVTDPADPFWAEIGCAL
                     KACLNISPSSGPADPPHPYWYAVGLVGTGELPRLGAWGSGAEDYWRLPVRVDALRADR
                     LEQTSYALAAVTSGPVAVQVTTGSGRSDVRIASALRTAIDGARQRQASIDAITAVGPA
                     GAAGVAAVVLCLAAALTVERRTPELRLLRARGAGLRGVFGRLLGEGLATVLPAAGLGA
                     LAAFVLLPTPRWQPAAVAAGSVALLALLALPVRAALLLRVAPDRARGGRRRLVAELAV
                     LAVTAAAAVQLARRGVSPLDAGVDPLLVAAPLLLSLSGALLLARAQPVLIGLLARRAA
                     RRSGAVGFLGLARAARGGGGPRSRPSVLPLLALVLAVACGAVGATVLASVAADRTTVA
                     RHNLGGDAVVSASLNSTLPDAFVTRAGQLPGVTGSLPVWIVDDVTMSLGAGASVRVNV
                     VIADPVGYARLADAAGRGRFDPALLTGGPGAGTGAGGGDGRLPALVSGDLPEGEFELR
                     LQAGDAVRIRTAGTVDGTPALTGTAGQTVLLPLGAAADLLPRIGGPTRWLADGSPDDA
                     RLRALAVELLGPPAAGSRPGHLVRTTAEEVALLGHDPLQASAVRLFWLAVGATALFAL
                     LAVLLTLLRAGPERAATLARLRTMGLRPRQGLALILAEVLPQSLVAALGGALTAVGCV
                     LLLGPALDLSPLVGAGVPTGLHLLAAPIARQAVLLALLAALAVVAEAAVTARRQITTE
                     LRAGDTQ"
     CDS             355906..356907
                     /codon_start=1
                     /locus_tag="KSE_03140"
                     /product="putative ABC transporter ATP-binding protein"
                     /protein_id="BAJ26162.1"
                     /transl_table=11
                     /translation="MNTPQPGPHPTPQDSPQPGPQPSLDELRRRALAAAAPRAADGDH
                     AITCERLVRIFSTDGIEVQALQGLDLTVDRGDLIALVGASGSGKSTLLNILAGLDAPT
                     AGTATVDGHDLLTMTAKQRLHYRRDTVGFIWQQTARNLLPFLTAAQNIALPLQLATGH
                     RAARRHRSRVDELLETLGITDLAHRRPAQLSGGQQQRVAIAVALANDPAVLLADEPTG
                     ELDSDTAAAIFDAFRTVNRELATTIVIVTHDPMVAGEVRRTVAIRDGRTSTEVIRRTH
                     TDEHGTETVHEREYVMLDRTGRVQLPAAFLAALGMRHRVAADLAADHIALHPDDHTP"
     CDS             356947..357930
                     /codon_start=1
                     /locus_tag="KSE_03150"
                     /product="putative RNA polymerase ECF subfamily sigma
                     factor"
                     /protein_id="BAJ26163.1"
                     /transl_table=11
                     /translation="MPMIMDRDGVAERLEPFRRELTAYCYRMLGSAFEAEDAVQETLV
                     RAWSKFDGFEGRAALRTWLYRIATNVCLDMAPAPQRRARPMDLTSPCPAGAPDLAQSE
                     ENVWVGPVPDSRVLSGDPAEVAVGRESIRLAFVSALQKLPARQRAVLILREVLAWSAA
                     ETAELLETTVASVNSALQRARATMSAERPAGDVFDPLDETQRSLLARYVQAFEAFDIE
                     ALKRLLHEDAVLNMPPFQMWVRGVVELGEWWQGAGCGCAGSRLVPVEANGTPAFAQYR
                     PAEDGDGWTPWGITQLEIVDGRIATMTNHMDVDRLFPLWGLPARLPAEPRA"
     CDS             complement(357952..358215)
                     /codon_start=1
                     /locus_tag="KSE_03160"
                     /product="hypothetical protein"
                     /protein_id="BAJ26164.1"
                     /transl_table=11
                     /translation="METLELDLSPGAEARLDALLAGRAGHPVRVALLVGEVAGPGPGE
                     LRRVGGLAVLVRRAGHQVVLRGAGERWRLLLELTGLAQALPLE"
     CDS             358479..359273
                     /codon_start=1
                     /EC_number="2.1.1.-"
                     /locus_tag="KSE_03170"
                     /product="putative methyltransferase"
                     /protein_id="BAJ26165.1"
                     /transl_table=11
                     /translation="MASPNTDFGAAGASCARHNASARGRLRHDLVARRLLAELPGAPA
                     RVLDVGCGDGEMTLRLARAGHRVTGVDPSADMLAAAAERLAAGLGVRSDHADRVRLRQ
                     ADLASLPADLGVFDAVCCHGVLMHLDDSAAAVLRLAGLVAPGGVLSVLTRNRGATGVR
                     EALRGDYRRARELIEAGAGESVGNLGLGTRGDDPARLDAWAAAGGLVPLAWQGVRVFH
                     DHRDDWRPDPAEYQAALELEWAASSRDPYRGTARLVHTLARRPAHP"
     CDS             complement(359416..360207)
                     /codon_start=1
                     /EC_number="1.1.1.100"
                     /locus_tag="KSE_03180"
                     /note="protein synonym:beta-ketoacyl-acyl carrier protein
                     reductase"
                     /product="putative 3-oxoacyl-[acyl-carrier-protein]
                     reductase"
                     /protein_id="BAJ26166.1"
                     /transl_table=11
                     /translation="MTQTQELTRTSAATFAPDVLAGRTALVTGGSRGIGAATALALAA
                     AGADVALSHSGSAPRAEEVVRQIEALGRRAAAYKADQGDAAEVEALVAAVAADFGRLD
                     ILVNNAGVLAGGLVDGEADPRALERQYAINVSGVTAAIRAAAPRLPAGGRIITIGSNL
                     AARPGLPGLADYSATKAAVTAYSRGAAAELAGRGITVNVVQPGSTATEMNDESGPHSD
                     AQRAANALGRYGRPEEIAAAVVFLATPAAAFVTGSVFAVDGGYFA"
     CDS             360330..360914
                     /codon_start=1
                     /locus_tag="KSE_03190"
                     /product="putative TetR family transcriptional regulator"
                     /protein_id="BAJ26167.1"
                     /transl_table=11
                     /translation="MTGRPRTFDLDDGLDRAMRVFWRHGYEGTALSDLTAAMGINRPS
                     LYAAYGNKESLFRQCLDRYRTGPARRTHEALAQPTARAVAEHLLRATVEVVTREEGPG
                     CLLVHGALATGAGAEAVRAESAARRADRREALRARFERARLAGEFPPDTDPAALADYL
                     TTLTYGLAVQATEGTPPDRLHRIAAQALRDWPSA"
     CDS             complement(361069..361911)
                     /codon_start=1
                     /locus_tag="KSE_03200"
                     /product="putative ferrous iron uptake protein"
                     /protein_id="BAJ26168.1"
                     /transl_table=11
                     /translation="MFANYLIGLREGLEASLVVCILIAYLVKTGHRDRLGPVWIGVGS
                     AVALAMAFGAVLQFGSSQLSFEAQEALGGSLSIIAVGLVTWMVFWMRRTARHLKSELQ
                     GKLDAALAMGTGALVATAFLAVGREGLETSLFIWTAVQSTGDGWNPLAGATLGLLTSV
                     VLGWLFYRGALKINLAKFFTWTGGMLVVVAAGVLAYGVHDLQEAGWIPGLGVHAFDIS
                     STIPVDSWYGTLLKGVFNFQPDPTKVQVWVWALYLAPTLYFFFRPAKSAGAPPKRVPE
                     AKAV"
     CDS             complement(361956..363251)
                     /codon_start=1
                     /EC_number="1.11.1.-"
                     /locus_tag="KSE_03210"
                     /product="putative peroxidase"
                     /protein_id="BAJ26169.1"
                     /transl_table=11
                     /translation="MDAENEQQAAPAESGGRERQAGLSRRAVIGWAGAGVALGAAAVG
                     TVAAATMSSEDDGAAPQPSPEIPFYGENQSGISTPVQDRLHFAAFDVITDDRDALVRM
                     LKEWTKAAASITGGREVGGGAVGVVPESPPDDTGEALGLPASRLTLTIGFGRTLFDKD
                     GVDRFGLKAKLPEALVDLPKFKGDRLEAGRSGGDLCIQACADDPQVAVHAIRNLARIG
                     MGVVNVRWSQLGFGKTSSTTPDSQTPRNLMGFKDGTHNIAGTDADALAKHVWVAPGDG
                     ADWMTGGSYLVARRIRMTIETWDRASLKDQEDTFGRTKIEGAPYGGQKERDAPDLAAM
                     PADSHVRLAHPDSNGGLMILRRGYSFTDGSDGLGRLDAGLFFLAYQRDTRKAFVPLQT
                     KLAANDKLNEYITHVGSAHFACPPGVRKPGEWWGQSLFG"
     CDS             complement(363459..364616)
                     /codon_start=1
                     /locus_tag="KSE_03220"
                     /product="hypothetical protein"
                     /protein_id="BAJ26170.1"
                     /transl_table=11
                     /translation="MPARRTSAAAFLVLAVAGAALVGCSKKDDGGKGSADGAAGSVQV
                     TATDSKCDLSKTSFPAGHVELAVANKGSKVTELYVYADGDKIVTERENIGPGTKVTIN
                     AEIKAGTYEVACKPGMTGDGIRQKITVTAGSSAPAKADDRLTRAVADYRTYAQEQADA
                     TIPVVEQFAAAVTAGDVEKAKSLFAASRVGWERTEPVAESFGDVDPKTDTREDALGEG
                     QSWTGWHRIEKSLWVDGKIGDEEKALAAQLVTDLKDWQKRIPEAEITPTGMANGAKEL
                     LDEVSKNKITGEEDRYSHTDLSDFAANVEGARQAYELLKPVAAENEPGLSKTLDAEFE
                     KITGLLGKYRAADGTYTSYDKVTEDERKTFSDAVNSLGEPLSKLAAAVVVK"
     CDS             complement(364959..366110)
                     /codon_start=1
                     /EC_number="1.3.99.-"
                     /gene="fadE1"
                     /locus_tag="KSE_03230"
                     /product="putative acyl-CoA dehydrogenase"
                     /protein_id="BAJ26171.1"
                     /transl_table=11
                     /translation="MSQDFDLYRLGEEHEMLRESVRSLAEAKIAPFAAVVDEEGRFPA
                     EALEALLAADLHAVHVPEEYGGAGADALATVLVIEEVARVCASSSLIPAVNKLGSLPV
                     QLAGSEALKAKYLGALARGEGMFSYCLSEPEAGSDAAGMRTRAVRDGDFWVLDGVKRW
                     ITNAGVSEFYTVMAVTDPSARSRGISAFVVEKGDAGVSFGAPERKLGIKGSPTREVYF
                     DGVRIPADRMIGEEGTGFATAMRTLDHTRVTIAAQALGIAQGALDYAKGYVRERRQFG
                     KAIADFQGVQFMLADMAMKLEAARQLTYAAAARSQRGDGDLTFFGAAAKCFASDVAME
                     VTVDAVQLLGGYGYTRDYPVERMMRDAKITQIYEGTNQVQRIVMSRNLP"
     CDS             366209..366937
                     /codon_start=1
                     /locus_tag="KSE_03240"
                     /product="putative TetR family transcriptional regulator"
                     /protein_id="BAJ26172.1"
                     /transl_table=11
                     /translation="MSEVQGQDRTAGSGGARTTMRDALVEAAFELFSERGFEQTTIDD
                     IVTLAGVGRRSFFRYFPSKEAVVFPDHDGCLADMTAFLAAADPAGDPVEQVCDAARLV
                     LRMYAGNPAFSVGRYRLTKQVPTLRIHELSVVWRYERTLAGHLRTRYAARSDGALRAD
                     VIAAAVVAAHNYALRAWLRSGGEGDVGAAVDEALQLVADTWGGGGEGGAGAPSQDDEV
                     VVMVARRGTPMWRVVQGVEAALEG"
     CDS             367159..367656
                     /codon_start=1
                     /locus_tag="KSE_03250"
                     /product="hypothetical protein"
                     /protein_id="BAJ26173.1"
                     /transl_table=11
                     /translation="MTLTLAPSAPHTPQAPHVRQPQQPAQPPQSSHAPDSPFAPFGDR
                     PFPHQQPRTAGPSGEAELDYRRCRWCHSASAAACLLCPVCGSADLVPARASGQGTVQR
                     LLRPTRRGPQPGRPYLIVLDEGHTVQAAVLGGLPGAVPIGARVHLVTSEEGGRVLTFR
                     LAPRT"
     CDS             368021..369400
                     /codon_start=1
                     /locus_tag="KSE_03260"
                     /product="hypothetical protein"
                     /protein_id="BAJ26174.1"
                     /transl_table=11
                     /translation="MSGPPPGRAWRDGLAANPGAPAEVLLRLLDEGAEPGEPGWLARR
                     PALPERVLEAALRHPRWPVRAALAERPGLPAPALAELAADRERRVRRAAASAAHRTAL
                     APEVLAALAADRDPDTRRRVPGCTGLPPELLVLLAQDTSPLVRAAAVRADSWPQLPPT
                     VRTGLRADRDPAVRAAVRRALRVERELPVSLAGYIAESDPARRERTAAGAGLERSLGE
                     WLVLDDDPRIRAAAAGNPRLPTDLALTLAADPHEAVRLAVSLRADLTEAQRATVAYRL
                     PDVPPPLPWVAERAGDPAELLRLARSAHPLVRCAVASLERLPDEAVALLAADPELLVR
                     LALAEHCADAPGGLLRSVYEQLLGPAALVADPRFAAPGLAAWADRPEPALRLAALRDP
                     APAPEVLAALAADGDGVVARAAAGDPRLPLRALLGALEPDAQPAAAAGNPALPVPFMH
                     RLLELSAAG"
     CDS             369552..369938
                     /codon_start=1
                     /locus_tag="KSE_03270"
                     /product="hypothetical protein"
                     /protein_id="BAJ26175.1"
                     /transl_table=11
                     /translation="MTTDLRHNDPRHRGASVVTPGEGTAERWARAQLFFDSKAYADAA
                     LLLAEVVDEVPEQVGPRLLLARAYYHSAQLRRAEEQLRAVIERDPVEHYAHLVLGRVL
                     ERQGRNAEAVPYLRLASAFDGEFPDA"
     CDS             complement(370035..372044)
                     /codon_start=1
                     /locus_tag="KSE_03280"
                     /product="putative protein kinase/phosphatase"
                     /protein_id="BAJ26176.1"
                     /transl_table=11
                     /translation="MTAATDGTGRQRAPEPAVVREGVLLLDAERRLRYANDEARRLLG
                     LPADCEGHPLDALDLPPALTTLLDAPGALTGAPALVRGRTLSVDLHPADRLGGPPCRL
                     ATLRDTAPPVAPDTARLRLELLYRAGASIGTTLDITRTCEELAAALVPAFADFASVDL
                     YEGVLAGGEPRPGRHRPLRRAALAGVTELPPLLAPGVPVPVVPGTPRARALAGPCSVV
                     EPDLSAALAAWDDVSPGTVDAMREEEVHTLVAVPLTVGGTLLGVATFWRARPRPAFDE
                     EDRTLAEELTARAAVLVENARRYTREHTMAVALQHSLLPAGLPEQHALDVASRYLPAQ
                     AGVGGDWFDVIPLSGARVALVVGDVVGHGVHAVATMGRLRTAVHTFSSLDLAADELLG
                     HLDALVNRLDQEHPAPDGADRPITGATCLYAVYDPVTRRCTLARAGHLPPAVAYPDGR
                     IEIVDLPAGPPLGVTGLPYESTEVKLPEGSRLVLYTDGLLASRGQDVDHGLKLLRGAL
                     ARPGRDPGQTCEDLLAALLPSDPADDIALLVARTRALPADHVADWDVPADPAAVARIR
                     AAVTRRLDDWGLSEQAFAAELVLSELITNAIRHAAEPIRVRLLRDRALICEVWDGSAT
                     SPHLRYATDTDEGGRGLFLVAQLAERWGTRYPASGKVIWAELPLD"
     CDS             372470..372628
                     /codon_start=1
                     /locus_tag="KSE_03300"
                     /product="hypothetical protein"
                     /protein_id="BAJ26177.1"
                     /transl_table=11
                     /translation="MDLACGIGPDGQWWGRVVLSVDAAALRRLGLHAEQPSAVLADPP
                     PPGWWGRW"
     CDS             372781..373140
                     /codon_start=1
                     /locus_tag="KSE_03310"
                     /product="hypothetical protein"
                     /protein_id="BAJ26178.1"
                     /transl_table=11
                     /translation="MPHITVDYSPQLADAFDRPGFVRELHPLVREWVASRGVCKTFFR
                     PAAETWVDASDGQLVAFVHIAIGLLPGRPEGLKARLSEEVLRLLDKHLRPVLGREVVR
                     SAEVRDLTASYRLRTGW"
     CDS             complement(373192..374226)
                     /codon_start=1
                     /locus_tag="KSE_03320"
                     /product="putative TetR family transcriptional regulator"
                     /protein_id="BAJ26179.1"
                     /transl_table=11
                     /translation="MTTPGLRERKKQATRAALREAALRLALEHGPDGVRVEDIAEAAG
                     VSPRTYNNYFASREQAIAAAVAADRESRIAAAVTARPAGTPLAEAVTDAVVEKYADTA
                     AQDPRALLLVVSRPALREAFLDTTAGIEPPLADAIAERLDGAEPLTARVLAAATAAAV
                     RVALGEWLRPAAGPAGGTGALVVPAGPLPDRLRAALAPLAPAFAAAERPVHQPVHPPA
                     GQSGAEPVRPVRRVVPNVKLVREAARRESREFYGRLGLEAAMDHGWIMTLAAPGNPTA
                     QLGLATGDATAPVVPDLSVEVDDVDAAYAAMRAAGAEIVHPLCDEELGVRRFFVRDPN
                     GRVVNVLGHR"
     CDS             374377..375402
                     /codon_start=1
                     /locus_tag="KSE_03330"
                     /product="hypothetical protein"
                     /protein_id="BAJ26180.1"
                     /transl_table=11
                     /translation="MRARGIAYDTGFVLHGRTSHPGFDPELVRRELAVIRDDLHCDAV
                     QLIGGDPERLELAARAAAGLGLEVWFSPYPLELEPAEVLALLRDCAERAERVRLLGAE
                     VVFVAGVELSVMNRGFLPGGTPEERVGRLMARPERRAAEIRALGGRMNAFLGEAAAEV
                     RARFGGRLTYAAIQFEQVDWAPFDFTTYELLRSAEIADVFREAVRTLARGPKPLAVTG
                     FGTAAYRGAGDRGGRVLEVVEHDPATGAPLRLDAAHERDEAGQAAYLDELLEVFETEG
                     VDSAFVYLFALPGYPHRPDGDPRDDLDRASLGLVSLLETGHGTAYPGLPWEPKRAFTA
                     VARRYRR"
     CDS             complement(375475..377256)
                     /codon_start=1
                     /locus_tag="KSE_03340"
                     /product="hypothetical protein"
                     /protein_id="BAJ26181.1"
                     /transl_table=11
                     /translation="MSGARTAAGTGTGQPDEEHDAHGPDGPNQADGADEADDPGTPAE
                     WTADDDWTDEALALLRTLRAPHRRNRAKQIAFAAYCTVLLLLVWGGVPSFGLFLQASM
                     GADYTRYGPGLLAAMPGGIAAVGLAVLLLAVRDGLWRGPVVPPRATTDWLLAHPVRPR
                     PVLRPWFWLSCGLAAFPGLIAALGGMVALGLTVRTGLPAALGWSLTGALGLPLLGVCA
                     GLLVQRDPRAAHWARLLTPYATVLVLLFATQSALAAAGHPVPWLERIELWSGPWGWAG
                     VAALAPTPAAVPGGTLAAVLLVLSTALALLFADRAAGTVPLTLLRERARTAAGVMAAL
                     RTVEPRAAKLAVAEATGGTRRLRVRLPAPRRRALVMYWRDTLSLLRTPARPGRAVLLT
                     VPAVLCAAPAHDTRGVLSWAVAALALLFGYLAVAQLLEPARIETDDVRRSSWSPYPFS
                     GLMLRHAVVPALLALVLATAAAATLLLLGAGPVAWLAPLAVPPLAAAALVNACRGPAR
                     RDLLYRSPNPSGGSTGVAFFLAWYAAGPGVALPLLALPFSAALRDATADNLTSTATFG
                     TTLTVLLLAWARHRATLLPARARPTGA"
     CDS             complement(377253..377981)
                     /codon_start=1
                     /locus_tag="KSE_03350"
                     /product="putative ABC transporter ATP-binding protein"
                     /protein_id="BAJ26182.1"
                     /transl_table=11
                     /translation="MAENTPAPRRALLQLTGVSRSYGGREVLHPVDLELAAGECVALL
                     GHNGSGKSTLLRIAAGRDLPTRGTVRFDGLPMDENDPRIRARVAVVGDTVAHYPDLTV
                     REHLMLVAVAHGVAGAAAWVDNVLANRSLTERADALPSALSSGQLQALLLACALVRPR
                     DLLLLDEPEQRLDPEARRRLVELLTVELADGVAVLLVTHHTDLALQVADRAVLLEDGR
                     VIRQGPPAEVLAATAPGAGTVGLR"
     CDS             complement(378043..378927)
                     /codon_start=1
                     /locus_tag="KSE_03360"
                     /product="putative peptidase S33 family protein"
                     /protein_id="BAJ26183.1"
                     /transl_table=11
                     /translation="MGFDRSAFLSAYDALLDRWPVPVDTLDVATPWGTTRVNAAGPPD
                     APPLLLLHGGGATAASWWANVGELARTARVFAVDRIGEAGRSAPAGHPAPAGRSAPAG
                     GTPPRTVDELHDWLDAVLDALGTGPADLCGHSYGGWIALGYALRRPDRVGRLALLDPT
                     GCLTGYRPSYLLHAAPMLARPSERRARAFLAWETGGVPLDPDWARLYGLAATYPAPRP
                     VTGPRPTAPALAALRAPCLLLPAADSRPHDARTLAARAARLLPRARVRTLPGVSHHGL
                     PYLRPAALNAELTAFLAR"
     CDS             379055..379522
                     /codon_start=1
                     /locus_tag="KSE_03370"
                     /product="putative MarR family transcriptional regulator"
                     /protein_id="BAJ26184.1"
                     /transl_table=11
                     /translation="MDDPGPGLRTVHRLRALTVELDLLAAAFARRNGLHPTDLRALIA
                     LLDAAREGTPATPGRLGRELRLNSAGTTAVLDRLERLGLVRRDRDPDDRRRVLLAVTE
                     RAVALGQGFFGPLIGETVALVEGLSPAERATVEGFLASVSGIVARHAEQAADG"
     CDS             complement(379691..380935)
                     /codon_start=1
                     /EC_number="3.2.1.-"
                     /locus_tag="KSE_03380"
                     /product="putative glucanase"
                     /protein_id="BAJ26185.1"
                     /transl_table=11
                     /translation="MRPPRPVRAALSLAVLLAAGLAAAVPVQAAPAASGSASGSASGS
                     AARTLAPDTRFYVDPASKAAQQALTDLKAHDLDGALAMARLASWPVAQWFNGTATPQE
                     TTDAMAALQAKAAKAHQVPVTVAYNVPGRDCSQYSAGGASNSAEYAAWIDALARGIGD
                     RRTVVILEPDGLALSPAFCGGTAAQQQDRLAEISAAVRRLEQQPGAVVYLDSGHSSWQ
                     NVGTQAQLLVDAGVADAQGFFLNVSNYQTDAALARYGTLVSQCVWYLRNTPGATADSC
                     ANQYWPAADADAWYAARVPADAKLPHFVIDSSRNGQGPWTPEPGKYTGDPQTWCNPPA
                     RGLGTRPTADTGRPLLDAFLWIKVPGESDGSCTRGTAGPADPEYGSVDPIAGGWWPAQ
                     AHSLAANAAPKLGFNTGLLPQH"
     CDS             381246..382385
                     /codon_start=1
                     /locus_tag="KSE_03390"
                     /product="hypothetical protein"
                     /protein_id="BAJ26186.1"
                     /transl_table=11
                     /translation="MDTVGDSTGTLDEALQRLHACGPERLGRLTNHAPMAVEALAARG
                     RADAVHGWLDRYADRLEEFPARVEPIAGPEEQRRALGDPRRIADWIDHFGRELAEQPW
                     RAVLARWWPVLLPGLYGGSTHPVIRVGHAVRSLSGGSADGTASGTASGPRLAELAHGL
                     GYWAARHRPLAVPRAAPLGPPVTGSAAAALDAVPPIAERTGGFPQRLERVTALPDWTP
                     AGTGPDEVRQRLAELVRAATHRYATHGHGEPTMLVHAATAPNAVLRVLPALPPPLWGP
                     SLRAAWTASAAVTAMYAPTGPDAPTGPEAPDAPPATRRAASGVRSAEEVLERALAHGD
                     EHVVKLTDTALDVGDPLALAAALRAVELSEPLGRVVRYGRRQGGK"
     CDS             382453..382854
                     /codon_start=1
                     /locus_tag="KSE_03400"
                     /product="hypothetical protein"
                     /protein_id="BAJ26187.1"
                     /transl_table=11
                     /translation="MTVTGGSGADRAAARSVVHSYLAGGRRSAPVLVFAQSAVRDQSE
                     AALRNLLGHPGRPERAVLLGPTRREETTLTVTGLPRPGVRHLWPDRRIGLLTFDWEHT
                     HLSLAAWEHPWTTPCSPHWARCTRAPEPLCP"
     CDS             complement(382921..384204)
                     /codon_start=1
                     /locus_tag="KSE_03410"
                     /product="putative phosphodiesterase"
                     /protein_id="BAJ26188.1"
                     /transl_table=11
                     /translation="MKIAVVVLGALAALGVLGAAHWYIWRRMVRDVSRPGGRYRRIGT
                     ALAIALPVCMLLAAVGGRAFPLAVERWFAWPGYLWMAVSIYLLFALLAGEAVRPLLRR
                     LRRAPATATAAVPAAESVTVPPSLSPSPSPSPSSSPSPLAPAGPAARPDADAARRLFV
                     SRVVAGGAAAVAVGVVGNGMYGVLRGPRLKQVTVPLAKLPRAAHGYRIAVVSDIHLGP
                     ILGTAHTRRIVDTINAAQPDLITVVGDLVDGTVPELGPAARPLADLRAKDGAYFVTGN
                     HEYFSGAAPWVEFVRELGVHPLENDRVELPWFDLAGVNDIAGTAQGQGPDYDRALGDR
                     DRARAAVLMAHQPVTVHDSVRHGVDLQLSGHTHGGQLWPGNYLAELANPTVAGLERYG
                     DTQLYVTRGAGAWGPPVRVGAPSDITIVTLASLQA"
     CDS             384645..385607
                     /codon_start=1
                     /locus_tag="KSE_03420"
                     /product="hypothetical protein"
                     /protein_id="BAJ26189.1"
                     /transl_table=11
                     /translation="MPGAPRAPVGGHRVHPAVRPPARGEVAVQHRRTLTLSEKLRRHR
                     TALVTGIATFAVAGTATLALALPQNTGAAATATTADPTLAGGPRLSADAATAAQSATA
                     SAADRAAAEASAAAASEAAASASAQAEAEASAAAAASASASAQAQAQADAEAEAEASA
                     SASASASASAAAAKAKASAEAKARASASASAASRAQQRPSLSATPSASASPFASASAS
                     ASGSSSSSGTPQQIAAQIVPAGQLSCFSNIVERESSWNVHATNASSGAYGLMQALPGS
                     KMASVGADWRDNPVTQIKWGLQYMNETYGSPCAAWSFWQSHNWY"
     CDS             385841..386836
                     /codon_start=1
                     /locus_tag="KSE_03430"
                     /product="putative glycosyltransferase"
                     /protein_id="BAJ26190.1"
                     /transl_table=11
                     /translation="MAPPLITVVLPAYDEQGQLKECLDSLLGQTFREFEIIVVQTPSE
                     HSPERLVEAYELRDARVRVLRLEAETGIGRARMAGAAHARGEYLLFLDADHLLPEDAF
                     EAMDARLAETGEVDVLLFGHNREHRGKLWPGNAAELLAAVGPDVFSPAERPELFGAPP
                     LAWDRLMRSGTIPTFPDGFYEEVSAVHRSLLAATRVAVLERECVTIRRRHTLHPAGSE
                     GATHFDVFERYESTFELLDAQPTEAEPVTDTVRPHLFTRMIRHYLFVFDLPGCLTRTE
                     RPQFFQRAAEHYKRFLPNGYRRPEGREGIKFSLLASNSYATFEVAKFSRLAGGRR"
     CDS             387025..387846
                     /codon_start=1
                     /locus_tag="KSE_03440"
                     /product="hypothetical protein"
                     /protein_id="BAJ26191.1"
                     /transl_table=11
                     /translation="MHAPPDRKANSPMSSPASPSAAPTPDPAADPSSTDASATAGEPT
                     PGSAAQLPPQQQLSGWTLLLLGALLLAEAFICMAVLISVWTPLTTLTAEHAPTGDPMA
                     WTVLGLGPWHLTSNTAMLLAVLAASGLGSFVHAATSFATYAGNRQLLPSWLPWYLLRT
                     AIGGALALLVYFLLRGGLFANGTDGTATNPYGFAGIAGLCGLFSKQATDKLREVFDTV
                     LTTKDGAGDDERDDKIQPVAPTAPAPAAAPLPRPEPADPAQLVIPQQPSTAPDGT"
     CDS             complement(387879..388112)
                     /codon_start=1
                     /locus_tag="KSE_03450"
                     /product="hypothetical protein"
                     /protein_id="BAJ26192.1"
                     /transl_table=11
                     /translation="MLYRTPDRWRFSIFFAGQVGIACGGLAGVAPTAGPAVAQDACHR
                     LAEETAGRPLTVDWSASERPDRWYGDVTAAPQG"
     CDS             388205..388654
                     /codon_start=1
                     /locus_tag="KSE_03460"
                     /product="hypothetical protein"
                     /protein_id="BAJ26193.1"
                     /transl_table=11
                     /translation="MRGGRAVCQARRMPARNRLLPRNRSWPLTATDVRTALGDPMMDG
                     VILSFHEHPSESRVLLSATWNRTVRSNYAYGETPDWWGKVLVGVGNLPSAERAAAREL
                     LREQALPALREWTAEALRRADEPWALRTRQRHWSVLDGRVVHCDEPA"
     CDS             complement(388824..389525)
                     /codon_start=1
                     /locus_tag="KSE_03470"
                     /product="hypothetical protein"
                     /protein_id="BAJ26194.1"
                     /transl_table=11
                     /translation="MHIGVIGATGTIGSRVVTEALGRGHRVTAFSRDASAITDRRENL
                     DWESVDVLDAASIAAVLPGLDVLISGFQPGNAAKDFADTVQRSIADPTVYAAAARALL
                     KALESHPRTRLIVIGGAGSLEIEPGVVRADHEDLIHASLDELGLPRQYAAAVRGHREA
                     LNVLRASNRLWTYFSPAEQIAPGERTGRFRIGGDQPVTDADGLSRISAEDAAVALVDE
                     AELPRFVQRRFTAGY"
     CDS             389659..390369
                     /codon_start=1
                     /locus_tag="KSE_03480"
                     /product="putative TetR family transcriptional regulator"
                     /protein_id="BAJ26195.1"
                     /transl_table=11
                     /translation="MAGTRSTGRRERLRAETTAEIKRTALELMGSGGPDAITLRAIAR
                     EMGMTANAIYGYFATRDDLVTALIADVYTALADAVDAAWAASAQDAPAQRIQTWAHAF
                     RDWTLANPEGFRLIYGDPVPGYQAPAGGAAPDAARRVCVGIAALADTAWGSAERSHGD
                     GDFGWDDFDPGLLDKVRPAFPALPPAGVALALRIWGHLHGLVALEVYGHLRAQTLSPD
                     KLFHAELTQLVRSLGLDA"
     CDS             complement(390581..391108)
                     /codon_start=1
                     /EC_number="2.3.1.-"
                     /locus_tag="KSE_03490"
                     /product="putative acetyltransferase"
                     /protein_id="BAJ26196.1"
                     /transl_table=11
                     /translation="MPAETRIRLIEPADAAPIAAHRARDAAAFRRWEPAQSAALLTPE
                     GQAARIDRLLAGHRAGTAWPAVVLADGEVVGQATVSGILPQPHLRRATVGYWIATTAQ
                     QRGHAGRALALLLRLMTDDLGLHRAEASTHLENLPSQRVLRRNGFTPYGVAHSAILLD
                     GAWQDSLLWERILAE"
     CDS             391285..394203
                     /codon_start=1
                     /locus_tag="KSE_03500"
                     /product="putative oxidoreductase"
                     /protein_id="BAJ26197.1"
                     /transl_table=11
                     /translation="MASDLARALAAAVRGEVRFDTAERAVYGQDASNYRQVPRGVVKP
                     ADRGDVREALRVCREFGVPVVARGSGTSIGGQAIGPGAVVLDFRRHFGRVLEVDPERR
                     TARVEPGAVLDELQRAARPFGLRFGPDPSTHSRCTVGGMIGNDACGSHSLAWGRTSDN
                     VHGLDLLLADGTELSVTGPLPPAERAALAAAPGRVGRLHRELQALAADNLALLRRAMP
                     VLPRRGSGYPLDALLPERGYDLVRAVTGTEGTCALVLGATVRLVPEPAVRALVVAGYP
                     DETAAADAVPALLPLAPLTCEGMAADLVAALLASGPRPPVLDRLPDGACWLFLEVGGP
                     TAAEAADRARELAAAVRRERSAAVALVTDPGEQRALWAIREAGAGIVTRLPPGPDGRP
                     GGAAWPGWEDSAVPVNQLGSYLRQLRMLLKRHGLRGVPFGHFGEGCVHLRLDFPLRER
                     PSAFREFMLEAADLVVAHGGSLSGEHGDGQARGELLPRMFPPEVIDLFARFKRIWDPD
                     GLLNPGLLVDPRPLDADLRFPGRELPLALAYPEDGGSLLSAVHRCVGVGTCVDTSSGV
                     MCPSYMVTGEERHSTRGRARLLGEMLRGELVADGWRSPEVREALDLCLGCKGCASDCP
                     VHVDMATYRSEFLYHHYRFRPRPAAHLSFGWLPLWLRLAHLAPRAANAALRGRFSAPV
                     LKRLGGIDPRRALPALPERRFTAWFRAHRAANQVPAGTGAGPGTGPDAPAVLLWPDSM
                     SELLDPAPARAAVLVLERLGFRVLLPSGPVCCGLTLIASGQLGLARRVAARSARTLGE
                     LPPGLPVVGLEPSCTATLRSDWPRLLPDGAGELPSRVRTLAEFLDEQDVELPELTGRA
                     MTQVHCHQHAVLGTGADRRITGRLGLDNRELDAGCCGLAGAFGFERGHWEVSVAAAER
                     ALLPAVRAADPGTLLLADGLSCRTQLTQLEPSARPSHLAEVLLRAFEQAEEPPGHSPG
                     "
     CDS             complement(394188..395186)
                     /codon_start=1
                     /locus_tag="KSE_03510"
                     /product="putative oxidoreductase"
                     /protein_id="BAJ26198.1"
                     /transl_table=11
                     /translation="MQPITDRPIRWGVLATGGIATSFVEDLAAVPGAEALAVASRRED
                     SARAFADRHGLPRAYGSWQELAADPEVDVVYVATPHSAHHRAAALLLEAGKAVLCEKP
                     FTLNAAEAAELVALARKREVFLMEAMWTYLDPTVRRIAALVADGAIGEVRSVQAEFGF
                     ATAEDPTHRLWDPAAGGGALLDLGVYPVAFAHLLLGAPESVQAWARLTDLGVDANTGI
                     LLGHPGGATALLSCSLDVQCGQRAAVQGSTGRIEIDRDFFHPAGFTLHRDGAEPEVFT
                     APVKTGHGYGLEAAEVMRCLRAGETESPLVPLDSTLSVMRTLDAVRERIGVRYPGE"
     CDS             complement(395322..396422)
                     /codon_start=1
                     /locus_tag="KSE_03520"
                     /product="putative serine/threonine protein phosphatase"
                     /protein_id="BAJ26199.1"
                     /transl_table=11
                     /translation="MRRRLAGLLSEWRTGHLMVLLPLGLIVLISAIDISISPNIHLGP
                     LLVVAPAITPSFAGTRLTVLIGVLALTAQAVIAVLHGGLFTPNHQAQLAALAVVTGVI
                     VAYTRIHERHGRELTRVRTVSDAVQHVLMRPLPDHAGPLRIATRYLAAEDEAHVGGDL
                     YAAVRTPHATRLLIGDVRGKGLPAVGDAAALLGAFRELAHRHDDPAELADALETSYRR
                     HLAELADSGQDVQENFVTALVLDLPDDRSTARVADCGHPPPLLLTPTGAHPLPLRRTA
                     PPLGMSALGPVDRRTEEFDFPPGATLLLHTDGVTEARDAADAFYPLAERAAALPADTP
                     DVLLDALRRDLLDHVGGHLSDDAALIAVTRPR"
     CDS             396528..397043
                     /codon_start=1
                     /locus_tag="KSE_03530"
                     /product="hypothetical protein"
                     /protein_id="BAJ26200.1"
                     /transl_table=11
                     /translation="MTSTGTGTRAPEPSEPSEPAQPSAPVELTASAEPSGLSPAEGDA
                     ILAEYVAPWVRELGLTVLETGGRHAVLRLPWSDRLAREGGGLCGQAMAAADTATVIAV
                     SAALGGFAPMTTVQLSTTFQRPARGTDLLVTARLTKLGRRMAFADITLATPDAPDDPV
                     AHATTVYAFPG"
     CDS             complement(397076..397498)
                     /codon_start=1
                     /locus_tag="KSE_03540"
                     /product="hypothetical protein"
                     /protein_id="BAJ26201.1"
                     /transl_table=11
                     /translation="MTTAKEIMHPGAECVTGEQTLAEAARIMRDRGVGALPICGDGQQ
                     LLGILTDRDIVLKCVAEGRDPAAVRCRELAVGRPMVIEEDEEAELVLALMEEHRVRRL
                     PVINHPDHKLVGMISEADIARGLSQDRLAEFVTTITAR"
     CDS             complement(397610..398602)
                     /codon_start=1
                     /locus_tag="KSE_03550"
                     /product="hypothetical protein"
                     /protein_id="BAJ26202.1"
                     /transl_table=11
                     /translation="MEARVRARSGHRAGRGRSRRVEVTAMIVVDALVALLVLLAVYAG
                     LSVRLVQQTQRGVVFRFGRVLDGVRGPGLARILPVADRLRRVNVQIITMPIPAQEGIT
                     RDNVTVRVDAVVYFKVVDPVKAIVNVQDYGFAMSQVAQTSLRSIIGKSELDDLLANRE
                     PINQGLELMLDSPALGWGIQIDRVEIKDVALPESMKRSMARQAEADRERRARIITADG
                     EFQASARLSEAAKVMSATPAALQLRLLQTVVEVAAEKNSTLVLPFPVELLRFLESATD
                     RATAQAARIEPVPGSQPGPEAGSDEDARGVEQLELPVELTAGPGPLRVAPPHAA"
     CDS             398663..399472
                     /codon_start=1
                     /EC_number="3.2.2.-"
                     /locus_tag="KSE_03560"
                     /product="putative uracil-DNA glycosylase"
                     /protein_id="BAJ26203.1"
                     /transl_table=11
                     /translation="MEPPAPPALPTRPDPNDPNDPNDPGYPAALAPRTRDLAALDALV
                     VDCRACPRLVAWREETALTKRRAFREQEYWARPIPGFGPHDARLVLVGLAPAAHGGNR
                     TGRIFTGDPSGDLLYASLHRLGLANRPESHWRDDGLRLRGVRITDPVRCAPPENKPSN
                     TERDTCRPWIVREFEQLRPTVRAVVALGGFAWQAALPVLAAAGWRVPRPKPVFGHGAH
                     AVLPAADGGAELHLYGCFHVSPRNTYTGRLTPAMVDDLLRTAATAAGLEPS"
     CDS             complement(399478..400335)
                     /codon_start=1
                     /locus_tag="KSE_03570"
                     /product="hypothetical protein"
                     /protein_id="BAJ26204.1"
                     /transl_table=11
                     /translation="MAHRIQGTAGDLITARLRAQTAELAALEPDVRAGRPDAVHRMRV
                     AARRLRSTLRTHRRHLRGDHTATEDELRRLGRALGPARDAEVLGPRLLAHARELPPGT
                     DRDRVLAELTAWSARETRDARPRVLAALDDERFRRLLATLAALAADPPLNRRAQRPAG
                     PELTRVLRREHRRTAERLAAARHAPAGPALEHALHDARKAAKRARYAGETAGRPARAF
                     TRRMKALQDVLGRHQDAAVARDTLRALSDGGFGYGALYGRQSAELAFARELLPQIWEQ
                     AARRPGKLR"
     CDS             400466..401149
                     /codon_start=1
                     /locus_tag="KSE_03580"
                     /product="hypothetical protein"
                     /protein_id="BAJ26205.1"
                     /transl_table=11
                     /translation="MDVIEVLPGLRMLVLPVGAAYLWSDGRELTLVDSGAVGTEERVA
                     ELVESVPGGELARIVLTHWHEDHTGGAARLAARFGGVPVVAHRLEAPVIRGEAVGAPP
                     VLEEFERPIRASVPALPPAPPCPVDVEVVDGDVLPFGGGARVLGVPGHTDGSLALHLP
                     GPDLLFTGDAVANVGRAMLGVFNTDRARAVESLHRLAGVGAANAVFGHGTPLVGDAAA
                     ALRAAAAEY"
     CDS             401438..401659
                     /codon_start=1
                     /locus_tag="KSE_03590"
                     /product="hypothetical protein"
                     /protein_id="BAJ26206.1"
                     /transl_table=11
                     /translation="MRKAISALGLTGLLTAAALLAAPTAQASGFVYVGMYPSGAACEA
                     AGKAYVARGETVNYFCDVAPNTARLSIWA"
     CDS             401805..403202
                     /codon_start=1
                     /locus_tag="KSE_03600"
                     /product="putative cytochrome P450"
                     /protein_id="BAJ26207.1"
                     /transl_table=11
                     /translation="MSQTAAVPAVPAFTAATAPGALPLLGHGHRLLSGPVDFLSSLHA
                     HGDLVAVRLGPTTAQVPCHPALLARVLGDDRLFDKGGVFYDRARDVAGNGLVTCPYGD
                     HRRQRRLVQSAFRRSQLAHYAGAAQAEVDAAAADWRPGLVVDAFPLFYGIALRTLART
                     LYSTAISAELAAGVERSFDTVLNGLFRQMFLPAPVRRLPLPANLRYRRSLAYLHAATR
                     QLITSYRSERGDRGDRTPGDEGATDLLSALLDAVDEEGGGSGLSDAEVHDQVITLLAA
                     GTETVAATLTWALWRLSLHPAAAEQVRAELAGVLPGGRPPTPEDLPRLAAVDRVLSET
                     LRLHPPGWLFTRLTTAPTELAGRELPPGTTLVFSPAAVSRHPAAYDSPAVFDPDRWRP
                     ERVTPAARQAFLPFGTGARKCVGDLFARTECAVALATLLSRWRFTPEPDADLRPVPLA
                     TVLRPRRLRLRVAER"
     CDS             403357..403860
                     /codon_start=1
                     /locus_tag="KSE_03610"
                     /product="hypothetical protein"
                     /protein_id="BAJ26208.1"
                     /transl_table=11
                     /translation="MGAIWGAVREPGRWRAAGGSRAGRAAAVGAGLGLCWIALTLVDW
                     NDLLPCDHQAEWDCLGVGLLFLGLVALVSLLASWLALRLAGVRPAWWVVAVAVLLSRP
                     ATVLGFDLLSWGPPWAVLPVGTAALFALAAALTAPGPRFRRSRTALLAALLLAWLLAW
                     FLGRFSW"
     CDS             complement(404097..404819)
                     /codon_start=1
                     /locus_tag="KSE_03620"
                     /product="putative TetR family transcriptional regulator"
                     /protein_id="BAJ26209.1"
                     /transl_table=11
                     /translation="MTRPRSRPADRPDRERRRASHSIDAVLTAAVALLDEAGERALTL
                     RALAGRLGTGVGSIYWYVSSRDDLLDRAVDHVLGGVLAEAAKRPPAADPVDDLRATAV
                     TLYDAVVDRPWLGARFMRGLDLPGNSLRLYEELGRPALRLDLTPLQRFHAVSAVLGVV
                     ASAAAELGGQEPPEEVTDGLVDRAEFFGRYARTWRDLDAGEYPFLHDIVDEFEAHDDR
                     EQFLAALDLTLSGLRAQVERRA"
     CDS             404928..406406
                     /codon_start=1
                     /locus_tag="KSE_03630"
                     /product="putative drug resistance protein"
                     /protein_id="BAJ26210.1"
                     /transl_table=11
                     /translation="MAGTTTAAPAAPPSRTYPSLRAAWIPLAALCLAFFVEMVDNTLL
                     SIALPTIGRDLGSGTTALQWVTSAYSLTFGGLLLTAGSMADRLGRRRVLLVGLAVFGV
                     LSLCVVAVTGAGQLIALRAGLGVAAAAMAPITNSLVFRLFDDQKLRMRAMTVMIVVGM
                     SGFVLGPLLGGTALAHVKWQWLLLVNAPIALIAAVGVRLGVPADRPEDLTRDRLDLPG
                     AVLSIAAIGLACYSLTSGVDHGWLSTGTVASVVGALVAGTAFVWHERRTPSPMLDLKL
                     FTNGTVRGAAVAQVGTAIAMAAIMFGLILHFQYAYGWSPVKAGLANLPIILTMLGATP
                     LSEWLARRFGHRVACLIGAACLAGSLAGLAWGVYHGYAAIAVCMVVMTVGLRTVMTIC
                     AIALVEAVPENRTSIGTALNDTAQEVGSSVGTAVVGTLIAALVTTQLPAGTWDSGLVD
                     SFFHGERITYAVLAVVVALVTTVGALSLTDSRSTEEHPDAAE"
     CDS             complement(406500..406799)
                     /codon_start=1
                     /locus_tag="KSE_03640"
                     /product="hypothetical protein"
                     /protein_id="BAJ26211.1"
                     /transl_table=11
                     /translation="MKSGANERPAAAGRARTRSEVDAAQGQAALRSLFDTLEPADGAD
                     AVDLRFGPERPAGADGRWIQTVPGRGWFACFRICGPERAAFDGGWRPGDFEPRDG"
     CDS             406984..415437
                     /codon_start=1
                     /locus_tag="KSE_03650"
                     /product="hypothetical protein"
                     /protein_id="BAJ26212.1"
                     /transl_table=11
                     /translation="MPRKYSASHAFAGGAFTIRRTRRIAVLAALGLLVETGVALDALS
                     ASPAAAADAKPSAQQTASQVTEAPDQSSALLAARLNNRRIEVTGARTENTTLWAEPNG
                     GLTQELSAGPVRMRVGDAWVPVDTTLVETGDGSVAPKAHPEGLVFSGGDASVKVGDAL
                     PGSTAPAAPPATASATPSATASPSASPSAAPSASASPSASEHASRALARPALAAADAA
                     PAERELVKLGSDGGRVELGWLGRLPKPKLSGSTATYTDARPGVDLVLEATRTGFEQYL
                     VVKSRDAVSQAGTLTLPLDTTGYRVERQEDGSIHLTDPAGAKPTVRIPAPVMWDASVD
                     ERSGEHLRRGAVSMELRNEGADAELVFTPDAAFLADPATAFPVTVDPVVDVGTNFDTF
                     VQSDYASDQSSATELKIGTYNGGAVKARSFLHFAGAGFNGKQIQNAKLYLANYHSYSC
                     SPRQWEVWAAQYASTGSRWSNQPGLISRYAVSDETRDIAGDGDGYDCYGNGGTYWVGA
                     DVTNLVRDWAGMGAGTYALGLKAADENDSYGWKRFESSEGAHSPFLSITYNSVPPTPS
                     TVDVLPSQQGNPRYTSSANPVFQVLASDPDGGPVGADFDLYRDGTYVRRVYKEGPNGS
                     YLQVRPTDFGLSRLDEGVSYAIGARLWDGQVNSGWTPSVTVVADTVKPGAPLVASATY
                     PSDGLWHGAAGQAGAFTFTPASGVTDQTAFVYSLDGAAAVTVDATGTANATVTPAADG
                     HHTLKVQSKDRAGNLSDPTAYAFSVGQAGLASPVDGSQSARRVKLQVDAQTQYKRVVY
                     QYRRGPGAAEYNVPTANLTKADNTPVTDPKPLLSDLGPHANWTVVDTLGNVGGVVQVR
                     ALLFPQDGSGSGYATAWNTITVDRNADGAAGAEIGAGSVNLLTGDYSVSVTDADEAGS
                     SVARSSSSRDLARGWQPQGERLTPNQRQVTYDTNGFVTGQNTVERSTARGHDNSTDSL
                     RIVPTGTDSYAALGADNALAMGLKPGRTYRLTGWIYVPAATGLSPDYTDRGLRLAGFV
                     RTSAGYAQTTSNKASFTDGWQQLTVDLAVPAGATEAFFRLYNGFSAAGKEVFFDDLSL
                     KEIVAPFGPQWSGGPDAGAGSDYRSLSFPESDLAEIKLNDDSALTFAKGTGGTFFPEP
                     GAESLTLTAQPAAAGRITTPTTGRCLDVNNSGTANGTVVQTWDCNPSTAQQWTLADDG
                     SLRALGKCLDVPNSSTADYVKLAIWDCNGGGNQKWELRPDGSLMNANSGKCLDAPDSG
                     GQGTQVTQHWCHGGLNQKWNPDNTGTTYTLTDLDGSATVFARGAGTDQFQVRSESGPE
                     AASTTRYVYDVTDGRVLPKRAVPAVEPGVDDTNRCTADPLPRGCDAMDYEYATGTTAV
                     PGTPGDFTDRIRAVKSWSWNPATSKQEAVEVARYLYDEQGRLVQVWDPRLAQPLKTAY
                     AYDAAGRVTRISPAGELPWDFDYGAAAGDPDAGRLLKVRRGALAPGSKSQVNGEIATK
                     VVYNVPLTRGAGGPYDLSGADVAQWAQTDAPTDATAVFGPEDEPGTHSATATAPGPNG
                     YRPAVVHYLNASGNEVNTATPSVVDKGDIDTSEYDRYGHAVRALSATNRSIALGTHPD
                     TARFAAELGLPANSADRARLLDSRTTYSADGLDVLETLGPLYRATLAEDVAGSSTPAT
                     VTVEGEALPRLGTTAQVITQNGSSAWVGGGGWSGNAQVMLVGTKAGDSASFRVTVPEE
                     GTYLLSARMTRAVDYGTVKFVLDGTDVTGTFDGYNNGVTTSPWSAGAPVRLARGDHQL
                     DLVVTGTNPSAVSPFYQAGIDTLTLTKTTVNPSLAAGTPVLARDHNTNTYDEGKPDGR
                     AYHLVTTATDGARIDGYAQDAEQRVTKNGYGAPIGGASGWTLGVATSVTTDATGQALT
                     ATVRYDASGRAVESRKPGSTGTDASTVKTVFYTAGANPDDAACGNRPEWAGSPCTTGP
                     GGAITGADAARMPTTLPVKRVTRYSRFGDVEEVTETNAGKSRTSVTVYDGADRIVSAQ
                     ITSDQGQALPQVTTEYDPATGDIVRTTAGGKSLTRVIDALGRLISYTDADGGTTTTEF
                     DAYGKPTKVTDPTGSTTYAYDRAKEPRGLVTSVNDSVAGEFTAKYGPDGQLVEQTYPG
                     GIVRKDTFNAVGEATGRTYTRASDGAVVWAQSVDVSTQGVVATDTSSTATRSYAYDRL
                     GRLTKARQSTVAAGCVTRQYAFDAHSNRLAKSTSPSTATGDCGTDNPATETHTYDSAD
                     RLTDAGFSYDAFGRTVTTGTGSTNTYWANDKAASQQKGDDKQTWQLDPAHRSTAFTTE
                     KKQADGSWANATSKLNHYGDDSDEVRWTIEDTTQGTLTRNVSGPDTDLVATTSGTGDV
                     QLQLTNLFGSVVVTTDTALTTPKVLDYDEFGIPQDGQAGVRYGWLGGKQRSAEALDGD
                     ILMGARLYSPALGRFLQVDPVPGGNAGPYDYCTGDPVNCTDLDGNWGMPKWLKKTVEV
                     VAKVAEVASYIPGPIGGFAAAVSSVSYAATGNWGKAAEMAVTAVAATVGANTAVKAAV
                     TAVKATRAAKAVGRAAGAARTGYRATANAARRVIGRCNSFTAGTLVLMADGSYLPIGL
                     VEEGDLVAATDPATGETTERPVLTVFTSFATKHLVEIRTGSATDGEGIEATAAHPFWV
                     VDRGWVDAVDLRPGDGLLAPDGTVTTVTGVTDRGELADQLVYNLNVGDVHTYVVSDGE
                     HDVLVHNASCTTLPTAASNAPSARGIYIIRYKNGEAYIGKSKNIHRRLHEHNRKGKLG
                     NVASVQYQLRPKGSLRKLEQGYINRFKCYAGVKLTNKIRASRKYAHC"
     CDS             415560..416405
                     /codon_start=1
                     /locus_tag="KSE_03660"
                     /product="hypothetical protein"
                     /protein_id="BAJ26213.1"
                     /transl_table=11
                     /translation="MKIKKLRSGPQELQLTCEDWRPEYAEHFSAGGCDGLFVGCPRPD
                     AAIDLSFVRTLPGLRSVRLGLGVRDPSPLSDCAGLTDLRIGLGQRGRVDFSGLTGLRR
                     LEAPAGVGLETVAALTALESVTAPGWRRGSLASVLGPKPRLTQLRIECPRTGEVSMSG
                     AEDLPALRELRVYDGRLLDADALTAVPGLGSVELYGAKPAGVEFVSGLLRLERLVLEN
                     CGPIPSLAPLADHPALREVVLAGRTVVEDGDLSPLVHHPGLRYVALERGAEHYSHRPA
                     EVRRG"
     CDS             416500..416913
                     /codon_start=1
                     /locus_tag="KSE_03670"
                     /product="hypothetical protein"
                     /protein_id="BAJ26214.1"
                     /transl_table=11
                     /translation="MQQQQLVELELPDGQTVWALVDGPSGPRDTGFGDQLATRVEGLR
                     ESLQAVASNVRDAVAAARPDEVSVEFGLELAAGRGGVVAALTGVGGKATFKVGLKWTS
                     GGTPSAAVAPPEEAAAEAGSEPGSEPGAGAPAVES"
     CDS             416931..418958
                     /codon_start=1
                     /locus_tag="KSE_03680"
                     /product="hypothetical protein"
                     /protein_id="BAJ26215.1"
                     /transl_table=11
                     /translation="MRHSDQLSALQGLLEHCRVRVDGRTTGSGFFVAPGVVLSCAHVA
                     GGTVGGPASVEHEGRAYAGRVLAAAPDAAAAAASGQSLYPFPDLALLELDDPPPGHPC
                     VWLDPEAPPFRTELTAAGFTPLMGARLAKLEAGGRTGRPGQAMLELVGGEVNPGLSGG
                     PVLSSRSGGVVAVVKATREADTAMGGYGVPVSALRLLDPAVYRRVLAAHDRFHAADGR
                     WRALADPLADAPGRERRPLAERDADRAFLELLADLPASPEQGQGLGAELRAAFLRAAP
                     AGAFEPELPLLDRRDVYLELAALLPAGDGQLPPELAYCADLVRSLPPGGPLARRLRDR
                     VLIRAAESGLGEAARRLTDGDAPEPPRPAASVRPSVIARVRHSLRDRTRYHVMLWRFH
                     GPEEIVPAGAESAELPLPGALALLAGSLPAQIETVEALDDAGRPALVELILPHEALDE
                     DYADWQLWPEQFWSTLGRDHHLVVRSLERHQEPRLHRPWQVRWERLADRPLGGALVCV
                     CGRGRLQQPRALNAAFNTAPGVAALALAGSPREGELAQAFRVAVASGVPVMLWERGGE
                     PHSLGADACATGCAAPGRGDCAGGRFLRAARAALADTHRDAAPDRVSVLRNEAELLVA
                     ADGPDPAPEPPLGDRVVLLWDDPARRLPRTRLAPAGPAGPVAPDPLEGLPR"
     CDS             418955..419983
                     /codon_start=1
                     /locus_tag="KSE_03690"
                     /product="hypothetical protein"
                     /protein_id="BAJ26216.1"
                     /transl_table=11
                     /translation="MTLRRIYQGVDEPHDRISELPPPPPWREFDGGADGTLAAVDRDA
                     AGGGRRRLPRRAAYRADERTVDAVNTALYLRRPLLVSGDPGVGKSTLADAVARELRLG
                     PVLRWSVNSRTTLRDGLYRYDSLGRLEDAGLARNQGPFAETSPSDLGRYVSLGPLGTA
                     LAPYALPRVLLVDEIDKGDLDLPNDLLDVFEEGGFEVPELTRAADQQPVVAVRPYDGG
                     AAVRVVRGAVQCRAFPFVILTSNGEREFPPAFLRRCIRLRLPSVHQDGERLRAIVEAH
                     LPGAGAAAEAAIGAFLARAATGELATDQLLNAIYLLAPDSGSGGPDRERLLDLVMQHL
                     NDSAPGRP"
     CDS             419980..423666
                     /codon_start=1
                     /locus_tag="KSE_03700"
                     /product="hypothetical protein"
                     /protein_id="BAJ26217.1"
                     /transl_table=11
                     /translation="MTGAAPDPERDAVRRLAALLAALPALAGEDGPAPTGRELADLLW
                     LRARLGGTEPHPLEPDVPSTTLPDRPVAPPDPSPEPHRPPAAPEAPATGRRPLHLPGP
                     APAAPPADGPRAAAPIRVGTARALPRRRELVRALRPLKRGVPSSDRTVLDEDATAERL
                     ARDPRWWPVLVPAVDRWLGVRLVVDAHGDSAALWEPLARELLAVLAESGIFRDVRLHH
                     LTGLEPGSRPGPGSGTGPVLPDEDSAARPPGRTATLLLTDGVHPGWAGPRLRAALRRW
                     ALAGPTAVLHTLPEHLWSQTALAPEPGRFRTAHRADPRPRFTPYGLVPPPQPPGTLAV
                     PVLGLTPEWLAPWARATAGAHAYDAPAVLLAPGQSAGSAPPPAQFPPPTGDFDSFLAQ
                     AQPRVFRLAALLAAVDQLSLGVMRLVQSALLPDSPPADLAEIVFSGILRIGESAPGAE
                     PLGRAYEFAPGVRQRLRATLRRDEAEQVVATLSAHLATRSTALADRFTALVPDPAGPL
                     PLPGAAAWAHAAAPGPATGPGRRFFLALTGVAVPGPDEPDAAALAVGAELVAEAFERL
                     GYRPTGIDSRRGTVEAVHGWAEDARLGSDDLVAVYLAGQVMAGFGQQVELLLRESLLI
                     VDRLTLEEFGRTFGRLGRLLLIVDQQPLRTPPSLPVHTRPSLTLLTRGDVPGLDFPLL
                     LADRVQQVAAGADPSRLLEFTRLAPPATASALRPFLVPEGRPGTHPGPEGPYLLDQLA
                     AWVNAEQPDPAHRELRAVRAGQLDLFLGVLRLLSRRVRQSVLNVAAVGLDGVRPVIDD
                     LTTRPTRRERTLLVLLFDPMAPPDRARLSALLRTLHALTGPPVFLLLVNSFTVPPAEQ
                     LRLELAEQLVLLDLARIQDLADISPGHATREYHRLLAATPVSGSPAWQAALIRLYERA
                     ATPYPARLDRVQAALTTVPGAADAVLDLSDLIRADPFELVEQVYAVLLALADREPAPG
                     LHAVVDRGELDMLDRKDRVTVHDWIDNGLVEVSGGPARALEVALLLGLPVVSTEPTRV
                     PNSGLTYLVVTPADDRSVQLLALRNPLHGKYDAAHYTGLALHIWRCPVPTCTRYLPRF
                     DAPPPLPSLDGGSAVCAEHRGPLLASGPRPAVAHFKAVADDDRFRTGQYAVEEGTSVT
                     LDNLSATAYSVPLTVSFRDGAVTVQAGDIGASYRPPGSESTRWQDLIPDAPLRCPPGT
                     RITVAPNTVLVRTGAPAPGELPSP"
     CDS             423718..424152
                     /codon_start=1
                     /locus_tag="KSE_03710"
                     /product="hypothetical protein"
                     /protein_id="BAJ26218.1"
                     /transl_table=11
                     /translation="MTDDEIIAACLRVARERQAPPPAPPEAVAEAERVIGFAFPVLLR
                     RLYTEVSDGGFGPADGVPPLGTGSGRELLTVPYEHGPDPTGTVPAGVVPLYDLGCTMW
                     WMVDFRDPDGAMWYNAEGDCQPEGITLAQWLAGVLDGEPGPA"
     CDS             424215..425519
                     /codon_start=1
                     /locus_tag="KSE_03720"
                     /product="hypothetical protein"
                     /protein_id="BAJ26219.1"
                     /transl_table=11
                     /translation="MITEVRPPGRDEMRAYYRVLPFANGLPQWEPTDAAWHGGPEPWP
                     PRRRPATDEQLDEWARKDVGGGLFHPVAAFADGVCVGGSAMLSYRVTVPGGGTVGMGG
                     VTSTAVVATHRRRGLLRRMMRAMFDAALERGELLAMLSASEGGIYGRFGFSPATHRTR
                     WELARHQGGLRPAAPDPGSLELVDAAGAQAAWPIVHALVRAGRAGRAGELTPLPGHWE
                     RLSDEPNGTDGPPRHLVHRDRHGAVDGAARFRLPWSPTAAHAGTLVVEALEAANPAAY
                     RALWALLLDFDLTRTVVAPGRPRDEPLRWMLADPRAMRVTRQSDNLWARLLDVPAALS
                     RRAYGGADELVFGIDDDLMCPANNRTWLLRTDGVETVCVATDRAAELTLTTPALGSLY
                     FGGASVHDLAYAGRATPHTADALARTARLFRTDTEPHNSFGF"
     CDS             425575..426336
                     /codon_start=1
                     /locus_tag="KSE_03730"
                     /product="hypothetical protein"
                     /protein_id="BAJ26220.1"
                     /transl_table=11
                     /translation="MDISTTVERARRLAQLHADHKPLVLPTVWDVWSARTAVAAGFPA
                     LTVGSHPLAESRGAADNEGQTFEEVLAAVRPIIAAVDVPVSVDLEAGYGQSPADLIAG
                     LVGVGGVGLNVEDTVHSEGGRLRGTEEHARYVAGLRAAADDAGVPVWINGRTDLFLRA
                     PEPAAVLDEAVERLLALERAGADSVYPVRIQDDDALLTAVVGAVRVPVNSTAHPVRHD
                     LERFRRLGVGRITNGPLLQLAATDAVKGLLGAWKS"
     CDS             426428..426961
                     /codon_start=1
                     /locus_tag="KSE_03740"
                     /product="putative MarR family transcriptional regulator"
                     /protein_id="BAJ26221.1"
                     /transl_table=11
                     /translation="MASQQPDPTRPSGPTDPTDPTEQSLWRPLRLLQDAVEADIARLY
                     AEAPVEGLRSSFVMELLRLHARGPMTIGELAESVHRTHSALSQKVAAMRRAGWVETVP
                     GADARSKKVTLTAKARAVVARLAAEWEATEAALAELEAELPYPLSRVVADIEQALARR
                     SFHDRLSAKLAEDPRWH"
     CDS             426952..428277
                     /codon_start=1
                     /locus_tag="KSE_03750"
                     /product="putative major facilitator superfamily
                     transporter"
                     /protein_id="BAJ26222.1"
                     /transl_table=11
                     /translation="MALTRHLVLDVSPLRGSSAFRRWWLGTAVSGLGGQLAVVAVVFQ
                     VWEGTGSTVWTGTVGLAQAVPLLAFGLFAGALVDRSDRRTVYLLATAGQAGCALLLAL
                     QAALRPLPPAGVVALVAGQSACAAFAGPAARAFLPRLLPPERLAAGLALQRVAFQGSM
                     LLGPALGGLLIASAGVGGCHLLDALSFAAALYAALRLPRLRPTPATAPTPATAPGANP
                     DPAPAARPLRDVREGLAFLARTPAVRAALLADLATTVLSMPISLFPLVNAERFGGGPR
                     TLGLFLTAIAAGGLLASALSGTFTRRPNQPLVMLCAAATWGGALALFGLASGGWLGLA
                     LLAVAGAADTVSVVARGTVVQLHTPDGLLGRVGAAEQIVGTAGPDLGNLRGGLVAAAT
                     SGTTALVSGGLLCVAAVAVIGAGTPALRRPRSPHRATRSPDRPAGRPFA"
     CDS             428552..429847
                     /codon_start=1
                     /locus_tag="KSE_03760"
                     /note="Contains an phosphopantetheine-binding domain
                     (IPR006163)."
                     /product="hypothetical protein"
                     /protein_id="BAJ26223.1"
                     /transl_table=11
                     /translation="MFPGQGAYLPGGLARLAEDEPLVADTLRTLDAAAVRLGRGAPSR
                     LLLDERAPALEELARDAPADLHVALFAAEMALFRLLTERHRLRPDVLLGHSFGELVAL
                     TAAGAFRLTDGLALVAARDEAFAACPPEPGGMLALELSAARTEALLAGLAEWEVMLAA
                     DNGPRQCVVSGPSAALERVRGKAEAVGVRSTPLHVPYAFHHRLLAAVAGEFARRADAL
                     PTAPVGRLLHSAILGRRITDGDAVGELVAAHLVRPTRFTDAVRLLHAEGVELFVECGP
                     RGVLSGLVAATLPGVRTLAPLRRRLGGPELAAELRGLTGTTPPPAPSPLPSSPPPPPP
                     PPAAAAPIVPDRGEVVAVLRELYATALGYPPEVLTADADLEADLGVDSIKQTELFAQA
                     VARFGRSLPTEGSRLTSYTTLDALAGLLPTLPSASGART"
     CDS             429844..435666
                     /codon_start=1
                     /locus_tag="KSE_03770"
                     /product="putative fatty acid synthase"
                     /protein_id="BAJ26224.1"
                     /transl_table=11
                     /translation="MNERPAPSPASAPGQDLAGKVALVTGGGKGVGAAISRELAARGA
                     LVVVNHFHSPQAAEETVAAIRAAGGRAEGLRGSVAKRDQVAAMFATLAERHGGVDVLV
                     NNAARGVFARYDDLTDTEWQRALDTNLHGARWCALAAAPLMAARGGGAIVNVSSIGAG
                     LAMDNYLLVGVCKAALEALTRYLAADLGPSGIRVNTASAGLLDNPTAALFPGSDALRA
                     TCAAAAPLGGVGHEDDLARLVGFLASPQSRWISGQCLLADGGLSVGRAMLTPQPPQLP
                     QLPQPPQRHQEATPPPPKAVPFLAPSTPIRGAARTVAVVGAGLVAPGVDDPEELWRRL
                     VEGVPQFGEPGERFPLEHFWSPENAPDRTYSRVAGYLRPAPDPAEDYLTAWTRAALLQ
                     CEAPILAARPGVRTACFAGAWAEGSQHVEESVLVEAAAAGIAAHWPDPAGRESLRTRL
                     QQRLRAVYRHAGDPDDHLPPAAVRAAVAGLLPGPVPVQVVDTACSSALYAIDLGTRAI
                     LDGECELALCGGAFSLGARYGVLFSRLRGLSRSGAVRAFDADADGVLFADGAAFVALK
                     RLDAALADGDRVLAVLAGFGAASDGRGRAVHAPNPSGQRRALARARKAAGIPAERIDW
                     VVAHATGTPVGDGVEREVLAEQLPQAWCTSNKSVLGHTGWAAGTVSVVHALQGLAHST
                     VPPQLPYRAPDGAPPLRVPTTPAPWPRPADRPRTVGVSSFGFGGTNGHLLLQDAPRPG
                     ESAPPSLPEPVPDDPVVVVAWSAHLPGSPDVAHQLTHHHNPSSARSFGAAYPIPPFAE
                     VRLPAPTAARVDRAQLMALQAVAALTRPDAPPWWEELRDGCGVFAAHTGVPSASPDLT
                     VRCHATALTAALGQPATQPDSPDDNHGLDPAALRKATEAFLDAVRGRTDPGEDTLAGL
                     MPNVIPARVAALHDLHGPTMTLDTGLTSGRTALRAAASHLRRGELELALVIGANGVST
                     PERSTPELTTPEQTAPEQTVPERPTAEGAFALVLTRASVARARQWPVLDTLAGVLERL
                     ERPAPEEPPAPDRWSYLGADDLLAAVRHLVATHPTPPAPPTPPAPITRLTWRHTLCWT
                     PTGAPDPRSLASPAETLVITGAAQADVLRPVAAAGARLLAVRPAEDPGAAVDRVLAEH
                     PGGFRHLRVLADLHAAPPWPAPPTAGLLAVQEAAFWAVRRLRDTLDTLAVGVRTPFRV
                     GEPAPHAHLFTGFVKSLAWELEGCTVRALVADSADSANPANPADPADPADPLAVLAAL
                     EGELAHPADGLPLARRHAGTRLVQRLTPQESAPVPADAPLLPPHPVVVATGGARGITA
                     ACLLGLARQLPLRVHLVGSSRPAEVPPELLAAGADELPAARARHIAAEHARHPGRPVG
                     EISADFDRLLHARESALTLRALRAACGAEHVHFHTCDVTDPDAVRAVADAVGAREGRV
                     DLLVNGAGLHHPGDITRKTLPGMRRIRDVKLAGYHHLRAAFAGPLAPGLWCNFGSVTG
                     VVGLPGESDYSPANDFLSAAAQSAADEREFTIAWTVWDETGLGSGPVVQSYTARTARL
                     SRMSTAEGVAHFLAELRRRTRPEGRADRVVTFVGAAEYQSFDTRFPGLRTPAPTVPAP
                     TAPTLLPGLLGAPVLRRPDHAVWEVLFGLDSHPFLRHHLVDGRPTVPGVLLADLAVQA
                     ARTLRPDAPFRGVERLAFRSWVRARADGRPARFRVEAHLRPTRPGYAVRVSVRSDVVA
                     PDGQVLAADREHFHATVRLGGPAPLPAPPGPAAAGARPVDGSYDDPHDAPSYDPYYDP
                     ASPVLLTGVFRATTDCRATPTGTAAHWRPDPDALGSLPRLGTPAVLLDSLARTPALSP
                     GPDGRHPVAVPHHIERITLHLPGDDHDLLLAHPNGLHLRHSAASGTSTASTPDGRVVA
                     QVTGLHATVLAHLSPTETPPAPAPIQTTAPFPAGSPPPAR"
     CDS             435663..436361
                     /codon_start=1
                     /locus_tag="KSE_03780"
                     /product="putative phosphopantetheinyl transferase"
                     /protein_id="BAJ26225.1"
                     /transl_table=11
                     /translation="MSAPVPALSGARRRRLPTAAGPVDLWWHVSPGPAPVRGRALLQH
                     AVGARRGRPAAEVAVLRDPLGRPVPAPDRFPPLCLSAAHSGPVTVAAVLAAPRPGTLL
                     GIDVEHLAAPPSAQLLDLALTAAERAALAELPPALRLPRFLALWTAKEAVAKALGWPL
                     LRALTDVELVLRPRPAVARLGRNRAPAGWQLLPLRLPGRPHTATLALYQPPATPPPPP
                     RREHRPWTSPEASP"
     CDS             436334..437107
                     /codon_start=1
                     /locus_tag="KSE_03790"
                     /product="putative oxidoreductase"
                     /protein_id="BAJ26226.1"
                     /transl_table=11
                     /translation="MDLTGSVALITGGTRGIGLAIAHTLHAHGARLLLTGRSEPSGRA
                     ALGQLDGGPDIAFHRSDATVRAEAEDAVDETVRRYGRLDVLVNNVGGASGFATVADTT
                     DDLWRATLALNLDSALLTTRRALAHLLPQRSGRIVNIASVEGRDPDPGLSAYAAAKHA
                     LIGFTRVLAKEVGPHGVTANCVCPGPVETDWFTEQGPRAAAVLGTDYPGLVRHFTGRT
                     ATGRLTRPDEVAAAVLLLASGPGAGITGACLPVDGGMTG"
     CDS             437270..438832
                     /codon_start=1
                     /locus_tag="KSE_03800"
                     /note="Similar to VarS in Streptomyces virginiae
                     (Q9XE01)."
                     /product="putative drug resistance protein"
                     /protein_id="BAJ26227.1"
                     /transl_table=11
                     /translation="MSQAPVPPPAAPHPRRWVILAVVCLATLVVLLDNTVLNVAIPSL
                     TEDLGAGTADIQWMINAYALVQSGLLLTAGSLSDRYGRKRALLVGLALFGLGSAAAAL
                     AQSSGQLIAARAGMGVGGALLMTTTLAVVMQVFQGAEVPKAIGVWGAVSSLGFAGGPL
                     LGGVLLAHFWWGSVFLINVPVALLGLFAVARLLPESKDPAARRPDVPGAVLSTVGMVG
                     LVYAIISGPLHGWGSGQVLLSGAVGLAALAGFVAWEAHTPAPMLDMSFFRNRRFNGAV
                     AGGLLVAFGMAGSLFLLTQYLQLVLGYRPLEAGLRMSPLALLIVLLNLSGVGARLLPR
                     IGFAGAVAVGMGLLAGGLALVAALGSGHGYPGLLAGLVLMGCGIAIASPAMASAVMGA
                     IPPERAGAGAGVQGTVTEFGGGLGVAVLGAVLGSRFAAGLPGSVPAASAKSLPEALAA
                     APDAAARTAVHDAFAHGLTSSQLIGATAVLLGGLLSAALLYRADRPSAPATATAPADT
                     PTDTPEAVPTTH"
     CDS             438916..439665
                     /codon_start=1
                     /locus_tag="KSE_03810"
                     /note="Similar to VarR in Streptomyces virginiae
                     (Q9AJL5)."
                     /product="putative TetR family transcriptional regulator"
                     /protein_id="BAJ26228.1"
                     /transl_table=11
                     /translation="MATKRASQVKKSVWLTPGPVRGRRSPRAGEGGPGSLDREVIVAA
                     AVRLLDEQGEARFSMRGLAARLDVTPMSLYWYVADKDDLLELALDVVGGEMVLPPAGD
                     GSDWEAGLRALAATWRAAMLAHPWAIRIYSDYLNIGPNSIRFSARALEIARASPLSEA
                     DSMAALSAIFQYTYGFTATEVNWAEKAAEAGSSTEELIEEITEAVREIPGVADSGVLV
                     DRAGEPETVLREREFHRALDWLLTGMRAGLP"
     CDS             complement(439719..440222)
                     /codon_start=1
                     /locus_tag="KSE_03820"
                     /product="putative PadR family transcriptional regulator"
                     /protein_id="BAJ26229.1"
                     /transl_table=11
                     /translation="MRLPLLALLATGPAHGYQLRQALESTFGPAYSRTNDGQVYVTLG
                     RLEKSGLIEGQAVSQERRPAKRVFVLTDDGRRVLSDWFARPSDGGKVREEFFLKLVLA
                     PRTRLADPRTLIDLQRSHCLAAIRGLHATADQTPEHGVSRLLIEGEVLHLQAELDWLE
                     RCQQELT"
     CDS             440526..442241
                     /codon_start=1
                     /EC_number="3.2.1.20"
                     /gene="aglA3"
                     /locus_tag="KSE_03830"
                     /note="protein synonym:maltase"
                     /product="putative alpha-glucosidase"
                     /protein_id="BAJ26230.1"
                     /transl_table=11
                     /translation="MITPVVPADPPRPAEALGAVEASAVLTADGLLPEERTAPLTPDA
                     LWWRDAVIYQVYVRSFQDSNGDGIGDLPGVRARLPYLKRLGVDGVWLNPFYPSPQHDH
                     GYDVADYKGVDPMFGTLEDFDLLVEDCRKLGLRLVLDTVPNHCSAEHPWFLEALAAAP
                     GSASRARFHFADGRGAAGELPPNNWRAMFGGPAWSRITEPDGTPGQWYLHMFTPEQPD
                     LNWRNPEVPVEFEKVLRFWLDRGVDGFRIDVAAGLFKHPELPDSPDPEADERTRDSVN
                     PLAWNQPEVHEVWRSWRAICEEYTALDGRQRLLVGEASVPTPAEQAKYVRGDELHQAF
                     FFHLLHAPWDAEHFHQVIDAAVRDITATGSTVTWVLNNHDQVRTTTRFGSPERARAAA
                     LLMLSLPGAAYLYQGEELGLPEVDDLPDEVITDPIFHRTGSRKGIRDGCRVPLPWAGS
                     RAPYGFSPEGSAPTWLPQPASFAGHTAERALADHTSPYHLYREALHLRRLLPQLGEGT
                     LRWIETPPNVLAFTRGDGLLVATNFGTVPAPAPVTGQPLLSSGPCQAGVLPAGTTAWW
                     ILPRR"
     CDS             442672..444051
                     /codon_start=1
                     /EC_number="1.4.1.4"
                     /gene="gdhA"
                     /locus_tag="KSE_03840"
                     /product="putative NADP-specific glutamate dehydrogenase"
                     /protein_id="BAJ26231.1"
                     /transl_table=11
                     /translation="MPATPTSAASTDAGARLIEPLYQEVLRRNQGENEFHQAVREVLE
                     TLGPVLRQRPELVDARIIERVCEPERQLIFRVPWSDDKGGIHVNRGFRVEFSSALGPY
                     KGGLRFHPSVNLGIVKFLGFEQIFKNALTGMPIGGGKGGSDFDPKGRSDAEIMRFCQS
                     FMTELHRHLGEYTDVPAGDIGVGGREIGYLFGQYKRITNRYESGVLTGKGLGWGGAQA
                     RTEATGYGCVMFTEEMLRTRGESLAGQRVVVSGSGNVAIYAIEKAQQLGATVLTCSDS
                     TGYVVDEKGIDLALLKEIKETRRGRVSDYAEARGPHVKYVAGTGVWNVACDVALPCAT
                     QNELHEADALALVRGGVKAVAEGANMPTTPEAVRVFQEAGVAFAPGKAANAGGVATSA
                     LEMQQNASRDSWTFEHTEARLGEIMKHIHDSCYTTAEKYGSPGNYVVGANIAGFELVA
                     DAMLAQGLI"
     CDS             444456..444962
                     /codon_start=1
                     /locus_tag="KSE_03850"
                     /product="hypothetical protein"
                     /protein_id="BAJ26232.1"
                     /transl_table=11
                     /translation="MALAGLALGVGVALGGVSALGDVRALHHQPELRMTVTDCHTTGR
                     SRSLANHCRGTGDPAGTNVATGTWTYDGAPLDYRPGTVATVRCAPDGECARLGVGDHV
                     LALAFVAGGLLLAGGALTALAATVLGAFAPGLAAALRRPRTVRVLATAAGAALLVVLT
                     AALCYALG"
     CDS             445126..445833
                     /codon_start=1
                     /locus_tag="KSE_03860"
                     /product="hypothetical protein"
                     /protein_id="BAJ26233.1"
                     /transl_table=11
                     /translation="MWAAVLTGCADPGSAAPPGSPTSATAATAITDRSAEIQRLRAAV
                     DAPAEPFSAEISVEAADGRTSARGRGRVSIGEVQTSSMRLTASSGDAQGQVSTTTRSR
                     VYSRVDDQPWTSHPRGEEVLLADHRPMVRTLLAADPASYRGRVPLPGDADGASAYHLA
                     GRLPVGEVSAALGVAVRRKVAEHGIADCAADLRVDDRGRLAELSLVCEGDGYRATSTL
                     GLHGYGPPADIEPPADL"
     CDS             complement(445939..446973)
                     /codon_start=1
                     /locus_tag="KSE_03870"
                     /product="hypothetical protein"
                     /protein_id="BAJ26234.1"
                     /transl_table=11
                     /translation="MTVLRAPEWRRRLSLLLAAVALPFLGGGVLAAPPVAAASAVAWP
                     GGSGVATADGSNVFGSDLSGLYQEGGVMWGVQNSGKLWRLVPNGSGGWKPDTANGWAS
                     GKSLRFPGGSGTPDDEGVTLTGAGSAGGVYVSSERNASSSSTSRLSVLRYDVSGTGGT
                     LTATREWNLTADLPSTGSNAGLEGVTWVPDAYLTGAGFKDASTGAAYDPSRYAAHTGG
                     VFFVGVEGSGTVYGYVLLEAGGFTKVATVSSGMSGVMEVTWEPQANRLWVVCDDNCSG
                     QLRTFQVNGSGAFALTSIYNRPSGMPNINNEGFTLAGADECVGGSKPVYWADDSNTSG
                     HALRKGSITC"
     CDS             447288..447431
                     /codon_start=1
                     /locus_tag="KSE_03880"
                     /product="hypothetical protein"
                     /protein_id="BAJ26235.1"
                     /transl_table=11
                     /translation="MVESGLECAEAVRSVRERRSPWALNNGLFVDYLSVGLDSARLLA
                     SLG"
     CDS             448090..449019
                     /codon_start=1
                     /locus_tag="KSE_03890"
                     /product="putative chitin-binding protein precursor"
                     /protein_id="BAJ26236.1"
                     /transl_table=11
                     /translation="MSWSRRLLAASAVGAGALVATTFAAGTAGAHGAMFGPPSRIAAC
                     YAEGPETPKSQVCKDLVADSGTQPLYDWNEVNIASANGQSQQIIPDGHLCSANRDKYR
                     ALDWARTDWPATSVAAGAKNFDFRVTAPHQGTMKLYITKAGYDPTKPLKWSDLDLASP
                     VAVYDTARSSDNGYYHVNVNLPQRTGRQLVYMVWQRSDSPEAFYGCSDLDFGGTTAAA
                     AAAAVPLSANAPSAPTQAQIDAGAARSTVSHSGHGGDLTTAEAVVAASGTATVNRTSH
                     SDLLLGLAGAGLLAATASGVHLARRMRGTAVSA"
     CDS             449412..451031
                     /codon_start=1
                     /EC_number="3.2.1.-"
                     /locus_tag="KSE_03900"
                     /product="putative glycoside hydrolase"
                     /protein_id="BAJ26237.1"
                     /transl_table=11
                     /translation="MRRVTLSLAAAAALIAAPLGATAAGAAGVSGLTADYAVSQSWSN
                     GFQATYTVTNHTNATVNSWSLSFDLPTGESVSSLWNGTLTSTSTSTGTHYTVTSPSWA
                     APLAPGAAAPAVGFGVTTGAVQSAPVNCTINNQPCAGAPADTVAPSVPGSPRSTGTGP
                     GSIVLGWTASTDNTAVAGYHVREGSTVVATVTGTSATVRGLLQGSSHTFTVSAFDAAG
                     NESANSAAVTATAGTGTSAGTAAPYVDLGAYPTPSLPALSAASGIKEFSLAFIINGSQ
                     PCTASWFGAYDPATGWNKADMDAVRDAGGDVRPSFGGANGTELAQSCTTVAALAAQYQ
                     KVVDVYALDRVDFDIEGTAVTDHASVDRRSAALAQVQAAQRAKGRDLKVSLTLPVLPS
                     GLTADGVYILQSAKNAGLAVDLVNVMAMDFGDWAAPSPAGKMGAYAIQSAQSTQAQIR
                     SVWTNLTDAQAYAMVGVTPMLGQNDTTSEVFNISDAQQLLAFAQQNHLGELAFWEMTR
                     DANACTGSLPKCTNVPQTPYQFSKIFAAYQG"
     CDS             complement(451125..452639)
                     /codon_start=1
                     /locus_tag="KSE_03910"
                     /product="putative drug resistance protein"
                     /protein_id="BAJ26238.1"
                     /transl_table=11
                     /translation="MTDTVGPTTAAPPSGAAAEPYRWRWVALFVILAAEVMDLLDSLV
                     TNIAAPAIRADIGGGESTIQWLGAAYTLAMAIGLITGGRLGDIFGRRRMFMIGAAGFT
                     VGSLACGLAQEPWQLIAARVLQGVLGAVMLPQGLGIMKEIFSPKEQGAAFGMFGPVMG
                     LSTVGGPILAGWLVDADLAGTGWRMIFLINIPLGLFALVGGRVFLPAQAQGPTVRLDL
                     VGALLAAVGAATVIYPLVQGREHDWPLWAFALLAVGVAVFGLFGWYEARRKASGADPL
                     VEPSLFAKRGFSGGMVLGLVFFTAMTGFWLTFSLYTQLGLHYSAFKSGLTGVPSSVGM
                     VIAFVASQALQKYGRKVMHVGLLVMLAGVLGLMYTLHSQGLAVTPWQMVPALVVSGLG
                     MGLVMAPFFGMVLASVEPHETGSASGTLTSVQQLGGALGSAILGTVFFERLKTADFAG
                     AERVTLWTEVGLLVVVFAAIFLLPMHGRPEHETGEGGAPEEEGALRKEGEHQPA"
     CDS             452939..453679
                     /codon_start=1
                     /locus_tag="KSE_03920"
                     /product="putative TetR family transcriptional regulator"
                     /protein_id="BAJ26239.1"
                     /transl_table=11
                     /translation="MERSAKAGDPLSAQMPENPWHKPRKAEPRQPLSRSLIVETAVRV
                     LDAEGLSGVTMRRVAQELGTGPASLYAHVSNKEELFELVLERVVAEIRLPRRPEPARW
                     KEQITEICFEAQRVLTSHRDVSLVSLGSIPLGESQLTISEFLLDLLLRVGLPPQVAAW
                     ALDGLGQLIDTDAYEASVYAERIARGTDIGAYFDQLRAFLLALPTDRFPNLQEMADTM
                     VTGDGDERYAFKIEVFLRGLETYLPAGR"
     CDS             453940..455223
                     /codon_start=1
                     /locus_tag="KSE_03930"
                     /product="hypothetical protein"
                     /protein_id="BAJ26240.1"
                     /transl_table=11
                     /translation="MERALPPHSPATAPARPRRPRRAVAVALSVFGLLAGGVSAVAAS
                     GSANAATTDGLGSNWYASAPYLMPEDNSPPDAAAVMDATGQKAFQLAFILAQGNTCSP
                     SWGGTSSIDTDTTMPAVIQTIRNKGGDVSVSVGGYGGTKLGQTCGTPEATAAAYQKVV
                     TKYNLKAIDFDLEEPEYENTAAIHNEIGAARILQQNNPGIYVSITTAGTNAGTGWFGT
                     QMLLEAKSQGFTPNNYSIMPFDGGFNGAAAQTDALVKFNQILQNTFGWNEATAYAHEG
                     VSLMNGRTDAAEYFKQADFQTVLDFATAHKLARYTYWSVNRDRQCPGTVDPGLSGACS
                     SVAQSDWDFTKFTVKFAGATPPTSPSPSPTTSTSTSTPPGTPCAPPWGAGTVYTGGNP
                     VSYKGHNYHAKWWTTNEVPGSTGQWGVWADDGPCV"
     CDS             complement(455358..455849)
                     /codon_start=1
                     /EC_number="3.6.3.14"
                     /gene="atpF2"
                     /locus_tag="KSE_03940"
                     /note="protein synonym:ATP synthase B chain"
                     /product="putative ATP synthase subunit B"
                     /protein_id="BAJ26241.1"
                     /transl_table=11
                     /translation="MGPLEPNVPELILGLIVFFALFWALGKVLLPRIERTLAERHDKT
                     DGGLARAEAARAEAERIRQEFQAELAAARHEAAAIRQAAAEEGAALVATLRAEAQQQR
                     EQLVAEAHVQLAADKVLAEAELREDVIALASELASRVVGEPLADLPSTRAIAEEFRNR
                     AEV"
     CDS             complement(455961..456488)
                     /codon_start=1
                     /locus_tag="KSE_03950"
                     /product="hypothetical protein"
                     /protein_id="BAJ26242.1"
                     /transl_table=11
                     /translation="MIGHMTWTLPATVRTGGSLTAPETELLPDYLAWHRATFLHKCAG
                     LTGEQLALRPLPASSLSLLGLMRHLAKVERTWFRIRFAGQDVPPLHFVEGHKDADFDL
                     LEPERAEREYLALLEEQRLADLAAAGAGLDELLAAHGEEQSLRMTYLHVITEYARHNG
                     HADLLREHIDGVTGS"
     CDS             456745..458193
                     /codon_start=1
                     /EC_number="2.1.2.1"
                     /gene="glyA2"
                     /locus_tag="KSE_03960"
                     /product="putative serine hydroxymethyltransferase"
                     /protein_id="BAJ26243.1"
                     /transl_table=11
                     /translation="MNEHLPAHTHGSPAADTAFRSALDVVRAVEPRVAAAISGELADQ
                     RASLKLIASENYASPAVLLAMGNWLSDKYAEGTPGRRFYAGCRNVDTVEELAAEHARE
                     LFGARHAYVQPHSGIDANLVAFWAVLSQRVESPALRRAEVRNVNDLSERDWAELRREL
                     GNQRMLGMSLDTGGHLTHGFRPNISGKMFDQRSYGTDPVTGLVDYAEVRRIALEFRPL
                     ILVAGYSAYPRLVNFRTMREIADEVGATLMVDMAHFAGLVAGKVLTGDFDPVAHAQIV
                     TTTTHKSLRGPRGGMVLCDSELAEHVDRGCPLVLGGPLSHVMAAKAVAFAEARRPEFR
                     GYAQQVVDNARALAEGLAKRGAKLVTGGTDNHLVLADVTSYGLTGRQAEAALLDSGIV
                     TNRNAVPQDPNGAWYTSGIRLGTPALTTRGLGAAELDEVAELIHTVLTAAVPVGSSKA
                     QYALDDAVRDAVAKRAVDLLAGFPLYPGIALD"
     CDS             458608..459114
                     /codon_start=1
                     /locus_tag="KSE_03970"
                     /product="hypothetical protein"
                     /protein_id="BAJ26244.1"
                     /transl_table=11
                     /translation="MRRAIGLTVLAALAPAGAGAVRWAAEAGQPVGGERACAGAVVPL
                     RQTLAATGLDLPAGAEDVHHLAREDPATGRVSLSLVLHTTHPAMTDYLTAHGIPVDRP
                     GRLDDPRYSHVDAGMELGLCDDPLRTPAVLLPLALPLPTGGGAGAELDDGDAIRANTT
                     VMLHASTG"
     CDS             459203..459958
                     /codon_start=1
                     /locus_tag="KSE_03980"
                     /product="putative tyrosine phosphatase"
                     /protein_id="BAJ26245.1"
                     /transl_table=11
                     /translation="MAAMIVDEPMATAEATAAATAAAPTVPGVRNFRDAGGTGALPRG
                     VLYRSGALDRLTPDGARTLRGLGVRTVLDLRSAPEVADRPDALGGSGIRYLHVPVFAE
                     RRWPAEQAELYPLMGELAGRPVTAAVRQLLLPEHRAVLVHCASGKDRTGVVVALLQSL
                     LGAPEAEVTADFLRSNTALGLTGADRAAAGAAAPGHAGLPVSAVHLRRALLSVRSHHG
                     TLDGHLLAHGARAAELAALRGAFPPRSGAAAHG"
     CDS             460076..460357
                     /codon_start=1
                     /locus_tag="KSE_03990"
                     /product="hypothetical protein"
                     /protein_id="BAJ26246.1"
                     /transl_table=11
                     /translation="MLKVNEYFDGTVKSVAFTSADGPATVGVMAPGEYEFGTAAPEVM
                     HVVSGALTVRLPGAEEWQTFSAGERFSVPGDSKFQLQVSVDTAYLCEYR"
     CDS             complement(460457..461812)
                     /codon_start=1
                     /locus_tag="KSE_04000"
                     /product="putative major facilitator superfamily
                     transporter"
                     /protein_id="BAJ26247.1"
                     /transl_table=11
                     /translation="MTLETGHPPQVSVPPEPPEPPESSESSALPARPLSAVPAGGRPI
                     TFGLRANLAQFGLLVAVNALVGGMLGQERTVLPLLADRAFQLSAYTGALTYILAFGAT
                     KAVTNFFAGTLSDRHGRKPVLIAGWLIALPIPAMLAWGPSWGWIVVANVLLGVNQGLT
                     WSTTVVMKIDLVGPARRGLAMGLNEAAGYLAVAVTATATGAIAAHWGLRPAPFLLGAA
                     YVALGLGLAAAAVRETREHARAEAAAHPVAVGGQAVLGTARIARTVSFGDRALSAASW
                     AGMVNNLNDALAWGVFPLLYAAHGLDLGRIGILAALYPAVWGAGQMLTGWWSDHVGRK
                     HLITAGMLLQAAALGLVAVGGSFPVWAAAQALLGAGTALVYPTLLAVIGDVAHPAWRA
                     RAVGVYRLWRDGGFAVGALVAGLLADAYGLTTAIWAVAALTAAAGLTVAIRMYETHPR
                     N"
     CDS             complement(461935..463284)
                     /codon_start=1
                     /locus_tag="KSE_04010"
                     /product="putative major facilitator superfamily
                     transporter"
                     /protein_id="BAJ26248.1"
                     /transl_table=11
                     /translation="MRVLVPEVLRTERRFARLFVGQSLSVLGDRVSFVALPFAVLSIS
                     DSAADVGLVATAGLLPLLVFTLVGGVWADRLPRQRIMLASDLVRCAVQAAIAVLLLTG
                     TARVGLLALLAAVFGVADAFFLPASTGLLLLLVPADRLREANALRGFVQSASLVVGPA
                     LASVLIALAGPGGALALDAVSFAASAAVLARLGAVGAVGAGGGGVGGAVGGVAGAAAG
                     GRQGFLAELRVGWQHVRGRTWVWSGMLAIAVYHVVVLPSVFVIGPLLAKREWGGASAW
                     AVVVVAFGVGAIVGDVCAYRLKPARPMAVAAVAMAVASCQAVVIGSGAPVWVIALLEG
                     VTGVGVSLFFVLWETSLQVHIPEQVLSRVSSYDHLISVGLMPLGLLLAGPLAEGLGVR
                     LALFGMTAIAVPVSLALLLLPAIRRLPASPSAEAEPAAGSVAEPVGARSGTAPEAAV"
     CDS             463948..465165
                     /codon_start=1
                     /locus_tag="KSE_04020"
                     /product="hypothetical protein"
                     /protein_id="BAJ26249.1"
                     /transl_table=11
                     /translation="MLFTGSGRHRRQSQAEKTAERAIAAAGVAGLGIALPLLTVSGAH
                     AAPSAVWDRVAECESGGNWGSNAGNGLYGGLQINAQRWTDYGGTQYAPLPDGATRSQQ
                     IAVAERILATEGPSPWSACADGAGLNTASAPGVVDDNDSASETGSLRGARGIAAVNAA
                     PDGSTAPADGSTAPVFSGLPGYDPVAHVYWYEKNGAWFWTSHQSLYERYLQLTHPQPQ
                     PSTPTPPAPTDSATPAPGTPTTPAPDASATPTVPPASPGTPLVPTGPTTTPTPGAPAE
                     GNNGNGNNGNGGNGSGLFPTAPVSPTPDAPTSPTPSTPSASSATTATPSAPATPAPST
                     AAPTDAAAAATPAGPAAGSAQPYTVGPGDTLASIARTHAVDGGWSELYASNQQVVGGN
                     PDLIHPGQVLDLK"
     CDS             complement(465188..466411)
                     /codon_start=1
                     /locus_tag="KSE_04030"
                     /product="hypothetical protein"
                     /protein_id="BAJ26250.1"
                     /transl_table=11
                     /translation="MRRATVGTTAAATAVLLLTAVAGCGGPTPAQDRTAAGGGAASGT
                     SAASGTSGDPSGSGAPTAPGQAEGTPDGTASGTAGGTAPAAGATKGGGADGSITVAFA
                     GDVHFEGRTASRLGASKTETALGPIAATLSAADLSVLNLETAITSRGKAEAKTYTFRT
                     TPKALDALKDAGVDVVSQANNHAVDFGPDGLADTLAAKAASPIPVVGIGKDAAEAYAP
                     YVTTVRGVKVAVLGASQVNEITNQKWRAGAHKPGIASALDEPALLRAVTAAKAQAPVV
                     LVYLHWGDEGVACPTRAQTSLAKKLADAGATAVVGTHAHTMLGSGMLGKTYVAYGFGN
                     FLWYGTSNYAASDETGVTTLTVTADGRVTGEVFTPAHIDGRGVPVPQNGNAARTAQQR
                     RDGLRGCTGLAAAPK"
     CDS             complement(466567..467466)
                     /codon_start=1
                     /locus_tag="KSE_04040"
                     /product="hypothetical protein"
                     /protein_id="BAJ26251.1"
                     /transl_table=11
                     /translation="MSPQPARTAPDRERTAERLLASSAKLSFNPLTDVDWDADPVPGA
                     YYCPPRHLSLYGTDLWERMTDEQRIELSKHEVASIASVGIWFEEILMQMLLRHAFDRD
                     PTSNHVQYALTEIADECRHSIMFARMIAKMGVPAYGAGFVAHNLGRLFKAISTHSQTF
                     GGTMYVEEILDAFQREVMNDDTLQPLTRQVSRIHVIEEARHISYAREELVRKRLGPVR
                     RRYEQLFIGLIVYYATTALIHPRLYAAVGIAPKTGRAVARANPHWRTTKVEMAQKVVS
                     VLDRAGLVGRTNRWLLRAAGVVR"
     CDS             complement(467623..468579)
                     /codon_start=1
                     /locus_tag="KSE_04050"
                     /product="putative pseudouridine synthase"
                     /protein_id="BAJ26252.1"
                     /transl_table=11
                     /translation="MVRRKPAPVSPLPQRDGIDPVHVKLPLDGAWPTVRAYLEERYGA
                     AAGDGRIAAMLAAGEFAAADGPVTADTPYRPGGHLWFHREPGPPEPVVPFPVEVLHRD
                     ERIVVADKPHFLATTPRGSHATETALARLRRDLDLPRLSPAHRLDRLTAGVVLFVADP
                     ALRGAYQGLFERREAVKEYEAVARHEPDAAARLPVVVCSRIVKDRGRLDAYEVPGEPN
                     AESLVELAEERGGLGRYRLAPRTGRTHQLRVHMNGLGLPILGDPLYPEVLGEGDPEDY
                     RRPLQLLARSLEFTDPVDGRRRRFSSGRELAAWRDPAGWTTG"
     CDS             468715..471813
                     /codon_start=1
                     /locus_tag="KSE_04060"
                     /product="putative serine/threonine protein phosphatase"
                     /protein_id="BAJ26253.1"
                     /transl_table=11
                     /translation="MDTDKQGTIVRARPASPLAAGSVPVPDGLLAIPVATALIASDGR
                     ILHWSPDAEALLGFPPAAAVGRRAADILVGPERRPAALELFGRILGGRAWAGVFPVRH
                     RDGHLVRLDFRTFPVLDRGGSPMVLAVASDVSEVRRLAADLAVLDGFFTQSPVGMAVF
                     DTELRFVRLNEALARINGLPVARHLGRRLSEVLPGIDSRTAEATMRRILADGRPLVDS
                     RTHGRTAADPEREHAWSVSSFRLEQPDGTVLGVSTTVVDITDRFEAETAADAAQQRLA
                     LLNEASARIGTTLDLATTARELAETAAPRLADAVAVEVLDGLVRGEPAALPDRADRSA
                     VLRRLAFHAVPDSGMASIAPVGAVQRLHPSTPHAWALSHGKPVLVPRTDGAAMSWFAD
                     DPVRGGAIRAQGVRSLMVVPLIARGAAIGTATFFRSRTEAPYDRTDLALASELAARAA
                     VSIDNALLYTRERDAAEQRQRALEAAEAAQQRLALLNEASTRIGTTLDLAITAQELVD
                     VVIPRFADFATVDIREAVLTGEDPEPVPESGSVALRAVAVGERAGGSLLTGAADQIGS
                     TSRSAKLYARAMRTGRPILVPHVDEYELRRIVAHPDRVQPGLDAGIHSYLMVPLLARG
                     QVLGGVEFVRLANPEPFTPADLALGEELAARAAVCIDNARLYRRERDTALTLQRSLLP
                     QDVHRTPGLEIAHRYLPSTVGDEIGGDWFDVVPLTGGRVALIVGDVMGHGIRAAATMG
                     QLRTVARTLVTLDLEPARVLRRLDEATAQLGEGQFATCVCAVFDPVDEECILASAGHL
                     PPVVSERDGQARLVTPPPGAPLGVGGVPFESVRFPLRADGLLVLYTDGLVERRGQDLD
                     EGLELLRETVTHRQPTLERGCDAVLGALGATMGQDDVAVIMAHAGPVGADRLATLPLT
                     GDPALLRHAREFTRRTLTDWGLASLVEPVVLLTGELLANAVLHAGSPMQLRVFRGALL
                     TVEVSDADSREPRLRPVGEQDESGRGMLLINELAHRWGSRATKDGKVVWFEMELPVRS
                     SH"
     CDS             471909..472439
                     /codon_start=1
                     /locus_tag="KSE_04080"
                     /product="hypothetical protein"
                     /protein_id="BAJ26254.1"
                     /transl_table=11
                     /translation="MCPGRVTGRPAACGAGPRTPMIVASGTNPRSTPRRSAPSLENSM
                     RSSLAKVTTATLLTGLALLGSAGTASAHCHHVHPHGALAVGGDSAAQGGDAGAIGGDA
                     WAEGGDALGVGGDAGAIGGSAGAVGGSAWAEGGDAGAIGGDAEALCGSALAVGGNALG
                     NGGDALAVGGDAFSSH"
     CDS             complement(472521..473300)
                     /codon_start=1
                     /locus_tag="KSE_04090"
                     /product="putative oxidoreductase"
                     /protein_id="BAJ26255.1"
                     /transl_table=11
                     /translation="MSDMSKRLDGRVAVVTGAGSGIGLATVRRFAAEGAKVVCADIDE
                     ESGAKAANEAGGLFVRTDVTDEEQVRALFDTAVAHYGSLDVAFNNAGISPPDDDSILV
                     TGLEAWKRVQEVNLTSVYLCCKYAIGHMRRQGKGSIINTASFVAVMGAATSQISYSAS
                     KGGVLAMSRELGVEFAREGIRVNALCPGPVNTPLLRELFAKDPERAARRLVHIPLGRF
                     AEPEEIAAAVAFLASDDSSFMTANTFLVDGGISGAYVTPLS"
     CDS             complement(473297..474673)
                     /codon_start=1
                     /EC_number="1.2.1.-"
                     /locus_tag="KSE_04100"
                     /product="putative aldehyde dehydrogenase"
                     /protein_id="BAJ26256.1"
                     /transl_table=11
                     /translation="MSQEHDPYQVVNPATEEVIATVDLAGPAAADAAIARARRAFESW
                     RNVAPGDRARLLRRFAAEVDAERESLAALEVANAGHTIGNARWEAGNARDVIEYYAGA
                     PERLFGRQIPVAGGLDVTFQEPLGVVGVIVPWNFPLPIAAWALAPALAAGNTVIVKPA
                     ELTPLTALRLAELALRAGLPEGVLQVLPGRGPVVGQRFVTHPDVRKVVFTGSTAVGRS
                     VMAGCAARVKPVTLELGGKSANIVFADADLEKAAATAPYAVFDNAGQDCCARSRILVE
                     ASAYDEFMDRFERAVRGVRVGDPADEKTEMGPLISAAHRARVASYVDGDTEVAFRGGA
                     PEGPGFWYPPTVLAPIAPDHRAFTEEVFGPVVTVVPFRGESDAVRIANATEYGLSGSI
                     WTRDVGRALRVARAVEAGNLSVNSHSSVRYWTPFGGYKQSGLGRELGPDALHAFTETK
                     NVFIATEE"
     CDS             complement(474712..476070)
                     /codon_start=1
                     /EC_number="6.3.1.2"
                     /gene="glnA3"
                     /locus_tag="KSE_04110"
                     /note="protein synonym:glutamate--ammonia ligase"
                     /product="putative glutamine synthetase"
                     /protein_id="BAJ26257.1"
                     /transl_table=11
                     /translation="MTEARLTVERLRELVAEGAVETVVLAVTDMQGRLQGKRLDAGYF
                     LTEVLTGGAEGCGYLLAVDVEMNTVDGYAVSSWESGYGDLVFAPDLDTLRMVPWHPAT
                     AMVQCDLAQHDGTPVAVSPRQVLRRQLERLAGYGWRAYVGTELEFMVFRDSYERAWER
                     HYQDLTPVNQYNVDYSILGTGRVEPLLRRLRTGMAGAGLTVESAKGECNLGQHEIAFR
                     YADALTTCDDHAVYKTGAKEIAAQEGVSLTFMAKYDQREGNSCHVHLSLRDELGHPVF
                     PGAGAHGFSRTMEHFLAGQLACLDQFALLLAPTVNSYKRYVPGSFAPTAIAWGRDNRT
                     CALRVVGHGASLRFENRVPGGDVNPYLAVAALIAAGLHGVERQLPLEGEFTGNAYASD
                     APRVPATLREAVERFDRSEAATAAFGKDVVRHYAHAGRVELAAYDAAVTDWERRRGFE
                     RL"
     CDS             476373..477281
                     /codon_start=1
                     /locus_tag="KSE_04120"
                     /product="hypothetical protein"
                     /protein_id="BAJ26258.1"
                     /transl_table=11
                     /translation="MTFRLTALTDPAVGPYSHRLAWLAAAPDGTPLGSAFLRLFTSPG
                     QSHLCELALDVHPAERRRGAGSALLAAATAAARADGRRSLLAQAVEGSAGDAFLSARG
                     FERALVLDFARLDLGSGSGSKPAAAPPADGSTGSGNGLPPGYRLASWIGSCPEEWLSA
                     FARARTAMDDMPMGETGFGTVAWDEERVLSAARAVADRGELLHTVAVVETAGGDLVGF
                     SELVLPAGRTGDAQHYGTAVQPAHRRRGLARAMKAETIRWVRTEHPGITGLLTDTADH
                     NTGMLAVNRALGYRRTHRSIAFRLPL"
     CDS             complement(477322..478008)
                     /codon_start=1
                     /locus_tag="KSE_04130"
                     /product="hypothetical protein"
                     /protein_id="BAJ26259.1"
                     /transl_table=11
                     /translation="MDGGSGRSGYVDLLRAGAIVLAMLAWLLAQCGLCLLLAPHAQRA
                     LRAGRSRQSGQTRRSERGPARLVEPLGRASMSLYLWHMVPVLAAGGVFYLTDLAPEPE
                     VGSLTWWAWRPVWVLVLGVLLGALLALLRPVDGLLLRLAGRIRPQDRTTGAARVAVLC
                     LGLAGAGWALARWAVQGLARDGAPDWRILLAFVVGTALVCGAAGRREAAAETAGEIGA
                     AREGALEEAG"
     CDS             479076..480443
                     /codon_start=1
                     /locus_tag="KSE_04140"
                     /product="putative magnesium transporter"
                     /protein_id="BAJ26260.1"
                     /transl_table=11
                     /translation="MTTSTLFGSTTARLRDRRVNLDHRATTSRAVRSSLVSLAGLIGG
                     PVTNQAGAEVGRLADVVARLYGPDPYPPVTGLILRIGRRRAFLPADAIGRLEAGHVRL
                     RASRVDLRDFQRRPGEVLLARDVLDHQLVDVDGVQVTRAADLYLAPLVGRVVLVGVDV
                     SLPTLLRRLGPRRWQVRPTPERVLDWQAVAPFGEQATEGPAEVRLRASRSALHRLRPA
                     DLADILEDLGRSERQQLLGWLEPEQAADALEEMEPAELENLLREARPEHAARLVDEME
                     PDEAADALRDLHPRERETLLDRMPREEAAELRGLLAHREGTAGGAMTTRLVTVRLEQT
                     VAEVRAELAAQAEHRTEIDAVVVLDPAGRLVADLPLFDLAVAEDSTPVTDLVAWLAQF
                     GPPVTLSPDTRLAKAADRLVAARKSSLLVVDEDDRPLGRILADDIIDALLPERGRLHF
                     RRFLQ"
     CDS             480647..481849
                     /codon_start=1
                     /locus_tag="KSE_04150"
                     /product="putative NRAMP family transporter"
                     /protein_id="BAJ26261.1"
                     /transl_table=11
                     /translation="MVAGPGLVAANAGNDAAGIATYASAGSQYAYGTLFFMVLVTIAL
                     VMVQEMAVRLGAHTGKGLGALIREQFSLRLTALAVGCLLLANTGLVVSEFAGIGAAFE
                     LLGVPKWAVVPPAAVLLWALVLFGSYRWAERIFLVMSLAFFSYPIAMVLGHPHWGEVG
                     RNLAVPHLQPSSDFVLLAVALIGTTVSPYMQFYAAAGVVDRGAKPEDYKLIRADAVLG
                     AVFACVISLTIIIATASAIGGTGPLQSAAEAARALEPVAGPGAELLFAFGLLGASALA
                     GAVVPLSASYAIGEAAGVERSVSRRFRDAPLFLGVFTAQMALGAIVALTPVDVIRLLI
                     GTQVLQGLISPIVLVYLLVLTNRRSLLGAAANGPRYRIAATAVVVGVALMSTVLLGQT
                     VLGWFGLA"
     CDS             482039..482416
                     /codon_start=1
                     /locus_tag="KSE_04160"
                     /product="hypothetical protein"
                     /protein_id="BAJ26262.1"
                     /transl_table=11
                     /translation="MSAHEPPATLAAFFTDGHLTSIPRKPARRTALLEHLAGSLFDPA
                     RSYTEQEVNEALLTVHSDTSMLRRYLVEALLLTRTRDGSSYRRTAAADLGAPTDRTGP
                     ATRTAPVGPINPIGPTDAHPPAA"
     CDS             complement(482398..483498)
                     /codon_start=1
                     /locus_tag="KSE_04170"
                     /product="putative esterase"
                     /protein_id="BAJ26263.1"
                     /transl_table=11
                     /translation="MLERWFADGVVPGAVALVAREGQIEAAAVGELDRESPVRIASVG
                     KPVTAALVLQLVDDGVLALDDPVERWLPELADRRVVRTPGAPVTDTVPAVRPFTVRDV
                     LESRAGYGFPADFTLPALAPLVAELGQGPPQPQRVAPPDEWTATLAGIPMLHQPGEAW
                     LYNTCSDLQGVLAARATGQPLEHLLAERLFEPLGMPDTGFHAPPGSLSPLYRPGPDGT
                     LMVADPPDGQWSTPPPFPSGAGGLVSTLDDVFTFLRMLRSGGRVKDGRRVLSPHAVRL
                     MTTDHLSDRQRADSKLFLAGQGWGYGGSVDVARREPWNVPGRYGWVGGTGTAAHVVRS
                     TGLVTVLLTQREMTDPTPPPLMREFWRYAAGG"
     CDS             complement(484132..485265)
                     /codon_start=1
                     /locus_tag="KSE_04175"
                     /product="hypothetical protein"
                     /protein_id="BAJ26264.1"
                     /transl_table=11
                     /translation="MPPGGGRPTAGGGASSSDGGGDGGRPWWRRGPVLAGAVLVAGLG
                     IALGVVATGGSGGGGSAQAVEMQPVSASGQEPFTDSVANGGPPASASPSGGTASGATP
                     STAGSPSAPGGTVDGSQPGLYGGTREVASCDVPKLSGYLDANPDKAHAWAGVEGIDSS
                     QIDGYLHGLTPVVLRQDTRVTNHGYQNGQATPYQAVLQSGTAVLIDSQGVPRVRCACG
                     NPLTPPTGTGGTYTGTAWSSFHPDGVVTVQLAAAPVTQIVLVDQTTGGQFGRPVGGTG
                     GSDGSASPSASGSGSSGSHSGTGAPSGASSSAPSSGASSGPSSGSPGSPGHSGSSGSS
                     GPSGSPKSPGAGSGSGSAPGVPSGGASGPASSAGAAGVSAGTP"
     CDS             486057..487439
                     /codon_start=1
                     /locus_tag="KSE_04180"
                     /product="hypothetical protein"
                     /protein_id="BAJ26265.1"
                     /transl_table=11
                     /translation="MSGAATPANPRSPSPAPPGSALGRAPAPVTVLLSALVTVVGALA
                     AMALVGGVGLWLAGADELPGGGFGAVLAATLLMALGAPAQLGGDAAFVATTQGGIAAM
                     PLSVTLVGALVTAYLFVRPLRRHAVVSGRLLSARVLALASCWTVAVLLLSTAARHSFT
                     VSTGDPLLDELGGAFGAAPTVGFRVDPGPAVGFGLLWLAVVVLLALAASRRAPLPTAL
                     VRWHGTLRPTVHAVLSLLLVYVGLALVGGLVAAVAGNEPRETLAVVLLGLPNLAWLGF
                     GVGLGASWHGHVTDSLGLPFPHPLAAVLRSGRDVTLDLGALAEQNGWAWLLLPLAALL
                     VLAAGAAAALRTRPPLPLWRSAVQSAVVLALAVLSVGVVTRVSAVFGLSMLGMGGGGR
                     TVLEPDLLTAVPIAAGWGALAGLLGALLARNRRAAATHPGTGPGPGSPPPPGPSPDPD
                     PGPGSGSAPG"
     CDS             complement(487510..489372)
                     /codon_start=1
                     /locus_tag="KSE_04190"
                     /product="putative peptidase"
                     /protein_id="BAJ26266.1"
                     /transl_table=11
                     /translation="MSDRLRALATRAAAVLGTTVLVAAGAANASPTATAAQAAACTPA
                     QVLANGGFESGSTPWTSSSGVITSGGSQSPHGGTSYAWLDGYGSAHTDTLAQTVTLPA
                     GCTNATLSFWLHVDTAETSTTSAYDKLTAKVGSTVLAAYSNLDAAAGYQKKTLDLSAY
                     AGQTVSLSFGGVEDSGLQTSFVLDDLALDTSGGTTTPPPGTDATRTPAPAGYTVSLSS
                     DASGATWTGHQSIAFGNPSATPLTEVYLRLWDNAHGSCPSTPVTVANLTGGTAGPLSA
                     DCTSLKVTLPAPLTQGQSGSLGFDLSISVPSGADRFGRDGAFAFVGNALPVLAVRDAA
                     GWHLDPYTNNGESFYTLASDYTVTLDHPSGLLVPATGTSVDTPGSGGRTVTTATAKKV
                     REFAWAAGPFSKVSGTSAAGTAINVYSVSGISTGDAQSMLSTAKSAVDAHAGRFGAYP
                     YGELDAVIDNNFWFGGMEYPGFVLDLVSTTALTHEIGHQWWYGIVGDDEYNSPWIDEA
                     FTDYATDLALGKTGTNCWNSTSWASSAEKISNSMAYWDANSSRYSTVVYGYGKCALHD
                     LRRTIGDTAMTKLLHDYAAAHWYGISTTAEFKTAAQAATTVDLTSFWTQHRIDG"
     CDS             complement(489509..490516)
                     /codon_start=1
                     /locus_tag="KSE_04200"
                     /product="putative serine/threonine protein kinase"
                     /protein_id="BAJ26267.1"
                     /transl_table=11
                     /translation="MPGEPPEQPSLAAAEPGELDGRTLAGYRLEHVLGRGGMAVVYRA
                     EDLRLGRTVAVKLLAPELARNETFRQRFVRESHIAASLDHPNIVPVYDAGEVEGVLYL
                     AMRYVRGRDLRALLDREGPLGHAQTVRIAVQVASALDAAHAHDLVHRDVKPGNVLIAE
                     GTDPDHPEHAYLTDFGLTKKSLSLTGLTTVGQFVGTLDYVAPEQISGKPVDGRCDVYS
                     LGCVVFEMLTGGPPYRRDDDLALLWAHLNDPPPDLREQRADLPAGVGAALERAMAKRP
                     EARYGSCLEFVAALRAAGDAGVVGAAEGAGGVKGAGDAGGARAGSPPRPPEWARPVFE
                     P"
     CDS             complement(490520..491062)
                     /codon_start=1
                     /locus_tag="KSE_04210"
                     /product="hypothetical protein"
                     /protein_id="BAJ26268.1"
                     /transl_table=11
                     /translation="MGPPDGFRPTHVVPADGLPTWTAPDPAAAGVPLDPLLPVALAEA
                     DGNWARIVCSNGWSAWVDGRLLVTLPQRPPSTGGPLATTDDPRPLLAALERSLATYRR
                     LIDDWAAGRIDLEAFRDGTRDLRLGAVLDGSDAWLLDLDRGRWYYCDAAQLQGYAAAG
                     RDGPEGRAVRAGRDSRDGRS"
     CDS             complement(491066..493447)
                     /codon_start=1
                     /locus_tag="KSE_04220"
                     /product="putative ABC transporter ATP-binding and
                     permease protein"
                     /protein_id="BAJ26269.1"
                     /transl_table=11
                     /translation="MGEREGALTAPKLILETGGDSTVITPSRRYALGRDPTGDIVLTD
                     PRVSWHHAELHAGGGHWIVDDTGSTNGTYAADGHRVVHLEIEPGTVLCLGSPGDGPRC
                     TFSALPEPTAVHPLPGRRPSALTAITGSHRPPSSVMPLPARVVRIGRATDNDLVVGDL
                     SVSRHHAELRATPDGRYEIADLGSHNGTYLNGQAVRRAPVGPGDLVGIGHSVFCLVGD
                     ELQEFVDTGDIDLDVEDLTVQVDGGRTLLDQVTFPVGQKCLLAVAGPSGAGKSTLLNA
                     LTGLRPADRGTVRYDGRDLYRDYAELRRRIGLVPQDDILHTQLPVRKALSYAAELRFP
                     DDTAPEERSARVEEVIDELGLGKRADQVISSLSGGQRKRVSVALELLTKPSLLFLDEP
                     TSGLDPGMDRSVMQMLRGLADDGRTVIVVTHSVLSLDLCDRLLLLAPGGRIAWYGPPG
                     ETLGHFGFAHWPEAFEAFENQADRDWAGEFRDSAPYRTYVAGPAGRPGDRPGALAPAE
                     RALPADATPAPPPEPRRWRGQVGTLCRRYASALAADRTFLAVMIALPFVMGAMAHALA
                     GSRLNQDTALNALLILCVGGVLTGAANAVRELVKERTIYQRERAVGLSRSAYLCSKVV
                     VLGTVTVVQSVVLTMVALIGVQLRPQGGGGVFLPPLLEITLAVALLSLTAMMLGLLIS
                     ALVKKEEVTMPLLVLVAIVQVVFCGALLQLDHVPVLNQLSWLVPSRWALGAMAATIDL
                     HTTVPGALTDDPLFAHRQGVWLLDMGMLVVLAVAYGLVVARLLRRHEPAVMRR"
     CDS             493593..493871
                     /codon_start=1
                     /locus_tag="KSE_04230"
                     /product="hypothetical protein"
                     /protein_id="BAJ26270.1"
                     /transl_table=11
                     /translation="MNTWATWTTQGILSGHGGVKTVEISVITGDLTVHTMWIEGEARL
                     TVQYSGALDWFTVEGSPVAAADEAAAREVHQRMVEAVKTGGGATAPQV"
     CDS             complement(494027..494749)
                     /codon_start=1
                     /locus_tag="KSE_04240"
                     /product="hypothetical protein"
                     /protein_id="BAJ26271.1"
                     /transl_table=11
                     /translation="MTELPPDPGFRLGPVRRPAPPALPDPTVELRPAAPRGDLRTVQL
                     RPAVPSPDAEQTVRLDPVETLPAPAPVPPSAPASAPEGGLRRFGPGVPPGAAAVWRGE
                     AVAVAPSRRWDRWLLVPLALLLALLGYLLWDRYGRPVGVVGVTVGTSAAGPGCDGTAV
                     VAGTLETDGGEGEVRYRWVRSDGTDSGPVVQHVAAGHRRTGVTLEWTFQGRGEFAATA
                     RLEVLEPVGVRPAEAVFGYSCP"
     CDS             complement(494763..496451)
                     /codon_start=1
                     /locus_tag="KSE_04250"
                     /product="putative serine/threonine protein kinase"
                     /protein_id="BAJ26272.1"
                     /transl_table=11
                     /translation="MDKVTNDRQPDGGPADRPARDARWELPDYAHGRELGAGASGRVV
                     LARHLATGTPVAVKYLLGDHPDQAAFRGEAELLAALDSPHVTRLYEYVESPHGAAIVM
                     ELVEGVSLRDLLRAEGGTGPEAALAVLKGSLLGLAAAHRAGVVHRDYKPGNVLVTADG
                     ESKLVDFGIAVRDGAGGTVAGTPAYMAPEQWAGRPASPATDVYAATATFFECLTGAKP
                     YAGTTLMELAVQHTEAEIPDTQAPEALRPLIRAGLAKTPEQRPPGAEALVGELEAAAG
                     AAYGADWEERGRKRLAALVALLPLLLPSALGEGALPGATSYATTVLAAPRPAPRVPYR
                     GRLIATAGAVVLVAGALATVASAGQNAAVADPRPATAPPATTSVRPAAAPTAEAPPSP
                     PPSAPPTDDPGPSTSPDPTPSPSPSLSPSPTAKPSPTPKPSPTQTATPTPSPTPPPTP
                     STAPPVTVRTGQPTGSLDGYTLTVRVPVSVQPAGSSGVTMTFTWTDIAGAAKSDAPVQ
                     VQAGPRGTVTVTQQHTFSCPGRGGFYDVSASVTTTPAAAGGPVTLTKTLMCPVG"
     CDS             complement(496707..497021)
                     /codon_start=1
                     /locus_tag="KSE_04260"
                     /product="hypothetical protein"
                     /protein_id="BAJ26273.1"
                     /transl_table=11
                     /translation="MAVSGHAAAPEPHSSEWSVRLRVVEVGDLTQAHAVLDTGLNLIE
                     VEAEAHRSRQDPADPAIGDELAVGRALTALGQQLIHHGSAAAEAADSARRRGAPPPDS
                     AW"
     CDS             complement(497012..497185)
                     /codon_start=1
                     /locus_tag="KSE_04270"
                     /product="hypothetical protein"
                     /protein_id="BAJ26274.1"
                     /transl_table=11
                     /translation="MSEMSDRLDEKARRDEDDVRAADPEEGITSYQTMHAWEESQAEG
                     DRIADPPQQEEWR"
     CDS             complement(497244..497777)
                     /codon_start=1
                     /locus_tag="KSE_04280"
                     /product="hypothetical protein"
                     /protein_id="BAJ26275.1"
                     /transl_table=11
                     /translation="MEKGRHRMSSTPFLTLDEVDALAARAHAGQYDRIGVPYVEHVRA
                     VAAGVAPFGTGLRMAALLHDVLEDTPLTAGELLAAGIPAAVVATVRRVTRRPGTDYRT
                     MLLDVATDHAATLVKIADNAHNSRADRAALLPAADRERLAERYRAARAVLWPAVAAAD
                     VRTVVGLVNPDLLAELD"
     CDS             497937..498569
                     /codon_start=1
                     /locus_tag="KSE_04290"
                     /product="hypothetical protein"
                     /protein_id="BAJ26276.1"
                     /transl_table=11
                     /translation="MRVTPISPERLVELLAGRIHELADDDRRLRVAFDGAAATRPGEL
                     ADALVEPLRLLGRPVRRVSADDFLRPASVRFEYGKQDADAFHDLWLDQGALLREVLDP
                     LEPGGDGRVLPTFWDRTADRATRARYVELPPRGVLLLDGPLLLGRWLPFELAVHLDQS
                     AAALARRTPEAEHWTLPAFERYRAETEPGALADLTVRVEDPRHPALVERD"
     CDS             complement(498600..499391)
                     /codon_start=1
                     /EC_number="3.2.2.-"
                     /EC_number="4.2.99.18"
                     /gene="nei1"
                     /locus_tag="KSE_04300"
                     /note="bifunctional protein"
                     /product="putative DNA glycosylase/AP lyase Nei"
                     /protein_id="BAJ26277.1"
                     /transl_table=11
                     /translation="MPEGDSIYLVATQLNRALSGHPLTASDFRVPAHATADLTGRRVL
                     ETVPRGKHLLTRFEGGVTLHTHLRMDGRWQTFQPGERWRSGPAFQIRVVLGTGNGTAV
                     GYRLPVVQLLRTAEEHRVVGHLGPDLLGPDWDAAEARRRLLADPRRPLGAALLDQHVL
                     AGIGNVYANELPFLAGVTPWLPVGDLPDPDELLDGARQLLDANRLRPGHVTTGDPRPG
                     HRNWVYGRARRPCLRCGTPIRTAKHDRERAAYWCPRCQHGPAPTG"
     CDS             499567..500328
                     /codon_start=1
                     /locus_tag="KSE_04310"
                     /product="putative peptidase S33 family protein"
                     /protein_id="BAJ26278.1"
                     /transl_table=11
                     /translation="MTITHEVAGSGPAVVLLHSSVCDRRMWDGQWDALREAGYRVLRC
                     DFRGFGETPCADRPYDNLTDLAELLDGLGIERAALVGSSFGGRIALQFAALHPGRVGS
                     LTLFCPGSPDHRPSAELEALDDLEVDLVESGRLDEAVELMVRTWLGPDADEATRAKVR
                     VMQRNAYEVQLAPETEISPTRVEVDLRAAVAPTLVYSGAHDLDDFRRIAADLAALLPD
                     AEHRELPWAGHLPPLERPAETAELLLTRLAEVAGR"
     CDS             500666..501550
                     /codon_start=1
                     /locus_tag="KSE_04320"
                     /product="hypothetical protein"
                     /protein_id="BAJ26279.1"
                     /transl_table=11
                     /translation="MRDTNSNNTPDSGPEAVLARLETYYDAVPRFSATTEEHGPFTLF
                     VRTGQGWHYYGRPALNGPGTFTAEDVERVRARQRELGAPESFEWVHETTPGLRTAVEA
                     AGLKVHEHPLLVLDLDAPPTTTASATTPAAADGDPEVRVLGADDPLLAGAVTLPHLAF
                     AEAGTGIGAAGPEQLVEALKDPGTDAAVSRMAGRITAGRTVLTAAVGPDGSPVASGCH
                     QPVGEVSEIVAVATLPALRRRGLARRVTTHLVEHARTSGVRTVFLSASDDAVARIYES
                     VGFRRIATALIAEPPAAD"
     CDS             501887..502213
                     /codon_start=1
                     /locus_tag="KSE_04330"
                     /product="hypothetical protein"
                     /protein_id="BAJ26280.1"
                     /transl_table=11
                     /translation="MDGPALSPRELLILQQIESELGSDQELERELRTMRPARLARLRR
                     TLVARPWIVVAVISCCLAVSFGLLALAVVLNQPVLLLAVVIGWAVVLVMLTVVATHLR
                     RRGRIR"
     CDS             complement(502413..503273)
                     /codon_start=1
                     /EC_number="2.4.2.28"
                     /gene="mtaP"
                     /locus_tag="KSE_04340"
                     /product="putative S-methyl-5-thioadenosine phosphorylase"
                     /protein_id="BAJ26281.1"
                     /transl_table=11
                     /translation="MADVHPPRTDGTPNADLGVIGGSGLYALLDDVTEVHVETPYGPP
                     SDALFVGEVAGRRVAFLPRHGRGHRLPPHRINYRANVWALHALGVRQVFGPCAVGGLR
                     PEYGPGTLLVPDQFVDRTSGRAQTYYDGRILPDGSLPEVVHISMADPYCPDGRAAALA
                     AARDLAWEPVDGGTLVVVEGPRFSTRAESRWFTANGWSVVGMTGHPEAVLARELGLCY
                     TSLALVTDLDAGVETGEGVTHAEVLEVFARNVDRLRTVLFKALESLPAARDCICSHAL
                     DDLETGLPGV"
     CDS             503700..504458
                     /codon_start=1
                     /locus_tag="KSE_04350"
                     /product="hypothetical protein"
                     /protein_id="BAJ26282.1"
                     /transl_table=11
                     /translation="MSGRAAVHSGGAVAEAHRSLVWRALPEAPDAAVLVLHGGKEFGA
                     APPSALNLPGLRMLPFAKAVRRGAVAADGRSLAVGTVRYRCRGWNGDRADAARDAEAA
                     LSDLVERLGPVPTVLIGHSMGGRAALRAAAHPCVRGVVALAPWCPRDEPTAHLRDRSV
                     LMLHGDRDKITPPDDTDLFALRARGDGARVAGYRVLGSGHTLMRRAGDWHRAAAALSL
                     ALLGLAPLPEEVDTALALHGRNPEGLHIPLPGRR"
     CDS             504701..505243
                     /codon_start=1
                     /EC_number="2.3.1.-"
                     /locus_tag="KSE_04360"
                     /product="putative acetyltransferase"
                     /protein_id="BAJ26283.1"
                     /transl_table=11
                     /translation="MGISLTTDRLVVRDWTPDDADDALAVYGSTDVARWLTPVMDQVV
                     DAEAMRSVLRGWVEEQSALLPPRGRWAVERREDGKVIGGLGIRPLPPYDEDLEITWQL
                     SPLAWGQGYATEAGLALLRWVFTQDIEEVFAVARPKNDRAHAVAKRLGMRWVGETTKY
                     YDLNLQVYRIRPADLPDNRP"
     CDS             complement(505344..506573)
                     /codon_start=1
                     /locus_tag="KSE_04370"
                     /product="putative beta-lactamase"
                     /protein_id="BAJ26284.1"
                     /transl_table=11
                     /translation="MPVMRRPRARRLAVALLALSTLVPAAPAAADSGAPFARPALKPA
                     HRPVHPPADEDCPLDPALAARLDAAIADVRERTGTPGVIVGLWLPGRGTYVHADGVAD
                     RATGQPMTPNLNLRIGSETKTFTVTAVLELVDRGLLGLDDPIGKYLDGVPDGAHITIR
                     QLAEMRSGLYSYTFDDDFVQALLTDPERPFSPQELLSYAFKHDNVFPPGTDYQYSNTN
                     TVLLGLLVEKLGRMPLRDFIHRNVTGPARLNHTLFPRAAELPRPYAHGYTDQTLDGST
                     TDSTHWNPSWGWAAGAMISDLHDLHRWAKTLATGTLLSPATQAEREKFRPVPGFGDGA
                     GYGLGLFRVGGWVGHNGSLPGYESVTLYLPEQDATLVVLLNTDIIHEGSEPSTLFAEA
                     VTSLATPGHVYELPAEK"
     CDS             complement(506744..507229)
                     /codon_start=1
                     /locus_tag="KSE_04380"
                     /product="hypothetical protein"
                     /protein_id="BAJ26285.1"
                     /transl_table=11
                     /translation="MTEVTEVATTTGRVYVDKQTPQAFRAMVGTAEAVRQAAADAGLD
                     RRLVELVNLRVSQLNGCAYCLDVHTKAALKEGESVQRLGVLAAWRDAAVFDARERAAL
                     ALAEATTHPADAAAQEAAYAQAREVFGDPEISAVIWVAIAINAFNRVSILSKHPVRPA
                     R"
     CDS             507357..508358
                     /codon_start=1
                     /locus_tag="KSE_04390"
                     /note="Similar to Pirin in Homo sapiens (O00625)."
                     /note="Similar to Pirin-like protein in Serratia
                     marcescens (Q2V6P0)."
                     /product="hypothetical protein"
                     /protein_id="BAJ26286.1"
                     /transl_table=11
                     /translation="MSTTENGPVPTTDPAATANTPTVEGAPAARTGGAEVLPPRDVPL
                     GGPRAMTVRRTLPQRERTLIGAWCFVDHYGPDDVATTGGMDVAPHPHIGLQTVSWLFS
                     GEIEHRDSLGVHAFVRPGELNLMTAGQGIAHSETSTAATTVLHGVQLWVALPDAHRHT
                     ARDFHHHVPSPVPLPGGGEARVFLGTLAGDTSPVPTFTPLLGAELTLPAGATTTLDVD
                     PAFEHGLLVDQGDVLFADTPLHSADLGHLPPGRTTLTVTNTSAAPARLVLLGGPPFGE
                     DIVMWWNFIGRTGEEIVQARLDWEKGTRFGEVQGYPGDRLPAPELPNVALKARGNRH"
     repeat_region   508431..509842
                     /note="IS candidate"
     repeat_region   508431..508459
                     /rpt_type=inverted
     CDS             complement(508595..509785)
                     /codon_start=1
                     /locus_tag="KSE_04400"
                     /product="putative transposase"
                     /protein_id="BAJ26287.1"
                     /transl_table=11
                     /translation="MGGDISEVDARRWSDGLADLHERFAHRFARSESRESALAYMRGL
                     LAPLERKNGWTVAEEAGHGGPDRIQRLLNRIDWDADGVLDDVREYVVEHLADPCGVLI
                     VDDTGFLKKGVRSAGVQRQYSGTAGRTENCQVGVFLAYSSELGRTLIDRALYLPKSWT
                     DDRVRCRTAGIGDEVEFATKVQLARAMVRRAIDDKIPFRWVTADAGYGYSKGWRYELE
                     QADVFHVMATTSHDTVVTWQAMDHRLHDLVADLPRQRWKRRSCGEGAHGLRIYDWARV
                     EVRPWHRPDRRHWVLARRSISDPTKVAYYIAYAPAEATLNELIAVAGARWAIEECFQT
                     AKGQCGLDDYQVRRHPGWYRHITLAMAAHAYLTVVRAQQLEKGPDPLERQTWYPSPSP
                     RSAG"
     repeat_region   509814..509842
                     /rpt_type=inverted
     repeat_region   509845..510732
                     /note="IS candidate"
     repeat_region   509845..509857
                     /rpt_type=inverted
     CDS             509870..510268
                     /codon_start=1
                     /locus_tag="KSE_04410"
                     /product="putative transposase"
                     /protein_id="BAJ26288.1"
                     /transl_table=11
                     /translation="MDHGEVIRRHELSDAEWGLVEPLLPRPGTGRPRLDDRTVLNGIV
                     WKFRTGVAWRDVPSRYGSWATLHTRFRRWAEDGTFDRMLRAARAKADAAGDIDWLVSV
                     DSTVVRAHQSAAGARKGGPETRRSAAPGAG"
     CDS             510316..510717
                     /codon_start=1
                     /locus_tag="KSE_04420"
                     /product="putative transposase"
                     /protein_id="BAJ26289.1"
                     /transl_table=11
                     /translation="MVLTGGNTNDCTQFTAVMNAIRVPRIGPGRPRTRPDHVLGDKGY
                     SSKAIRTWLRQHGIGHTIPERADQIANRLRRGSRGGRPTAFNRRLYKHRNVVERCFNH
                     LKQWRGLASRYDKTAVSYQAAATLASLLMWA"
     repeat_region   510720..510732
                     /rpt_type=inverted
     repeat_region   510735..512146
                     /note="IS candidate"
     repeat_region   510735..510763
                     /rpt_type=inverted
     CDS             510792..511982
                     /codon_start=1
                     /locus_tag="KSE_04430"
                     /product="putative transposase"
                     /protein_id="BAJ26290.1"
                     /transl_table=11
                     /translation="MGGDISEVDARRWSDGLADLHERFAHRFARSESRESALAYMRGL
                     LAPLERKNGWTVAEEAGHGGPDRIQRLLNRIDWDADGVLDDVREYVVEHLADPCGVLI
                     VDDTGFLKKGVRSAGVQRQYSGTAGRTENCQVGVFLAYSSELGRTLIDRALYLPKSWT
                     DDRVRCRTAGIGDEVEFATKVQLARAMVRRAIDDKIPFRWVTADAGYGYSKGWRYELE
                     QADVFHVMATTSHDTVVTWQAMDHRLHDLVADLPRQRWKRRSCGEGAHGLRIYDWARV
                     EVRPWHRPDRRHWVLARRSISDPTKVAYYIAYAPAEATLNELIAVAGARWAIEECFQT
                     AKGQCGLDDYQVRRHPGWYRHITLAMAAHAYLTVVRAQQLEKGPDPLERQTWYPSPSP
                     RSAG"
     repeat_region   512118..512146
                     /rpt_type=inverted
     CDS             complement(512143..513624)
                     /codon_start=1
                     /locus_tag="KSE_04440"
                     /product="putative drug resistance protein"
                     /protein_id="BAJ26291.1"
                     /transl_table=11
                     /translation="MTEARANTNRRPNRAALLTVTCLGQFMVLLDNTVVGAALPDMQQ
                     RLHTQLTGLQWIVDAYVLLVAMLLLSGGVFVDRFGRKRVYLIGVAVFTAASVLCSLAP
                     SLGWLVAGRVLQGAGAAALSPASLVLLVSAHPVPQERIRAIGLWAGLSGIGLAVGPVA
                     GGVLTDTFGWPAIFLVNLPVGVVLLLVGLRHLDESRNPGAPAIDVPGTVLSALGVGAL
                     TYGLIEGGARGWLSPTVPGSFAAAAVLLAAFVTVEARASAPMLPLRLFRQRLFTVSNT
                     AMGVVGFALMGSTFFFSQFFVSVQGSSVLHAGLQTLPTTLAMVLVSPYAGRLAARYGF
                     RAVVTTGLALAGPGLLALGTVHADTGYGNVWWRLAVVGIGFGLTLSPLTGAAVQSVSP
                     QEGGLASGISSTTRQIGAVLGVALLGAVVRTRQSGGASFETCLDDAFLAAGAVTTTSA
                     VLTGLWLTRSKPAEPGPAAPQHFADPRPDTLTASNEASAGTPT"
     CDS             513775..514365
                     /codon_start=1
                     /locus_tag="KSE_04450"
                     /product="putative TetR family transcriptional regulator"
                     /protein_id="BAJ26292.1"
                     /transl_table=11
                     /translation="MNERQQARRPGGRSARVGAQVHQAVTELIGERGYGNFTVGEVAA
                     RAGVADSSIYRRWGSLEALLTDVALTRLNARSPMPDTGTLAGDLRTYAAQVAREITGP
                     DGPAVLHLAIALSGSGEQGVRAGQELRAERTRQLQSVLDRARERGEDAPDVLELLDHV
                     LAPMYVRVLFGMVPLAPEYVDGLVDRLLLTHGMDQG"
     CDS             514444..514833
                     /codon_start=1
                     /locus_tag="KSE_04460"
                     /note="Similar to Glutathione transferase FosA in
                     Serratia marcescens (Q56415)."
                     /product="hypothetical protein"
                     /protein_id="BAJ26293.1"
                     /transl_table=11
                     /translation="MSVDLNHTIVHARDNRESAEFFADLLNLEITAEWGPFIAVALGN
                     GVTLDFAAVPADSITPQHYAFLVSEEEFDAAYARIEQRGVEHYADPRRQQPGTVNHND
                     GGRGVYFMDPAGHAMELITVPYGGWPS"
     CDS             complement(515449..516339)
                     /codon_start=1
                     /locus_tag="KSE_04470"
                     /product="putative DNA-binding protein"
                     /protein_id="BAJ26294.1"
                     /transl_table=11
                     /translation="MTSSTSDRSALGAFLRARRARLTPGDVGLPAAGRRRTPGLRREE
                     VAQLAGVGVTWYTWLEQGRAKNASDQVLDAVARVLRLDPAEHRHLMVLAGRGAATEPG
                     PPVDLRPEQTALLAKLLPYPAAVQTDCYDLVAANRTYRYLFADLDAYPVEERNCAWLM
                     FTEPSWRNSLLDEDTVLREITAKLRTRQPEHRDDPRWNALITRLRQESPDFVRHWESY
                     EVVGDRTQLRRYQSPRVGTLDVQFQSLWLDRARDARIVVMTPTDTATAQRLERLDSLV
                     GAAPAWTSRDDSADRAATGA"
     CDS             516442..517932
                     /codon_start=1
                     /locus_tag="KSE_04480"
                     /product="putative drug resistance protein"
                     /protein_id="BAJ26295.1"
                     /transl_table=11
                     /translation="MTAQTVSLTRPVVPRPARALTGGGLAVLLLAYLPVNMTFGSVNL
                     LEPAITADLGVGVSGGQLVLSAYTTAFAATLVVAGRLGDRFGRRRLLAAGVGAFGAAS
                     VLAALAPDLVVLVVLRAVLGAAAGLFTPQVLSTIQSTAPGRLRALGVTLFAAVSGIAT
                     VTGQLLAGAVAQAAGEHWGWRLVQVLTGALGAAALVALRTVPESRSTAPLALDLRGAA
                     LLGTGLLLVVVPLTLGTSAGGPAPVSVMLAAGAAVLAVFARSQRAAERRGELPVVPPS
                     VLRTPAVRRGLVMTLLFFVGYGAFLYEFSALAQSAFGVDAWGTVLLLLGFGAAFVVTA
                     LVLPAVERRTGRWTTTGAAVGQAAVLLGLALAVDGTRDGAPAALQPLLVLLGVTQALM
                     YGPVLRTVLSRTPTWAAGVAGGLFTTLQQLGLGLGVALLGGLFHAVATATAGGGGAGG
                     GLSRGFAVAVTVQAVLALAFAFLAARIARAGEGIGDGVQARGLSGR"
     CDS             518202..518555
                     /codon_start=1
                     /locus_tag="KSE_04490"
                     /product="putative LuxR family transcriptional regulator"
                     /protein_id="BAJ26296.1"
                     /transl_table=11
                     /translation="MSAIIDPARRERSVPVWQQPHAAALRGPAGGPEPGRDPGAPAVH
                     RDLTALTPRELEVLALLGRGLSTTELAGELTLSEATVKTHVARIFAKLGLRDRAQAVV
                     VAYETGLVAPGDRSG"
     CDS             518710..519660
                     /codon_start=1
                     /locus_tag="KSE_04500"
                     /product="hypothetical protein"
                     /protein_id="BAJ26297.1"
                     /transl_table=11
                     /translation="MTVETDPLFDPFSRARADGVERTSTRVLLTDPAGRVLLLRRTAG
                     APQGGRWELPGGGTEPGEDVVAAGLRELGEETGLTGVRVTARLGHADYPNTRGAVTRA
                     FVVAAQLDRPREVRLSPEHDAYRWVLPAGLPRPVAAHEAELIRRHSAPPPVLPGHRPL
                     PVYLPTIPAAPMWGSVFFTAEGGAAVLLRATDPAKGLQWAGGDVEFGDPSPLHTAVRE
                     CWEETGILLEPDPERLPLLATVFEQPRGGWPAKVGFAFHGGELSAERLAAIRLDPAEH
                     TEVVLLARDELAARTDPRRARLTRAALDAVRTGVPAYVVC"
     CDS             519770..521128
                     /codon_start=1
                     /EC_number="6.3.2.17"
                     /gene="folC2"
                     /gene_synonym="fpgS"
                     /locus_tag="KSE_04510"
                     /product="putative folylpolyglutamate synthase"
                     /protein_id="BAJ26298.1"
                     /transl_table=11
                     /translation="MDYQQCAEHLAGLYALAPAERVARRRNLPGLLDALGRPQDGLRG
                     AMVIGTNGKGSTAAFAVSALSAAGERIGSMPSPHLQEPRERIRVDGRPIGRDAYAAAY
                     REVLAVIGEHGLPVGAGAMCAAVAAAHFRQAGVTRVVAEASIGGRGAAVRFLDLDVKV
                     VTGVGLDHAGVLGDTLGRIAAAKASAVRDGEHLVLGRLDPQAQAGVGEVLAERSGLTC
                     WQVDREIRYADRPDGALDVSTPLGEHRALPCPLPGVHQHHNLALGLATAAALADRGHA
                     DLPSDRLLRPALAATRWPGRLELLTDARLDGWRGRVLLDGATNPQGVATVMPEIERLA
                     TAAPGAARGADTRAGADAPSTAVVFAAMRDKDVPEMLAPLPAPWPLVLTRTGSPDAAE
                     PDALRTRLPAARRDRVHTAPDTASALRRAAELVGPGGLIVVFGSLRLVGESRTALGLA
                     PA"
     CDS             complement(521207..522769)
                     /codon_start=1
                     /locus_tag="KSE_04520"
                     /product="hypothetical protein"
                     /protein_id="BAJ26299.1"
                     /transl_table=11
                     /translation="MFKRLAARRSAAALGAGAVVAGALTLGATPAQAVQAGDLTSTIA
                     LSNCSASLVRYPSSVDTDRAMMLTNGHCLPTMPTAGQVIQNTSASRSGTLLDSAGNSL
                     GTVQADKVLYATMTGTDVALYQLTDTFAAVTSKYGATALTISDTHPVDGSAMYIPSSY
                     WKQVWNCSVNGFVGTLREDQWTWRDSLRYSAGCNTTHGTSGSPIVDAASRKVVGINNT
                     GNDDGAMCTLNNPCEVAADGTTTATKGQSYGEQTYWFTTCLGTGRVIDLNVSGCLLTK
                     PAGTAVTVTSPGNQSTALNGAASLQIQASGGTAPLGYTATGLPTGLSINASTGLISGT
                     ATAAGTYNVTVTAKDAANKTGTASFTWTVTSGGGTGCTSAQLLGNPGFETGTASPWTA
                     SSGAVDNSSGQAAHGGTWKAWLDGYGSAHTDSLSQTVTIPAGCKATLSYWLHIDTAET
                     GSTVYDKLTVTVNGTTVATHSNVNAATGYTQKSVDLSAYAGQSVTVKFNAVEDASLQT
                     SFVIDDTAVQTS"
     CDS             523183..523446
                     /codon_start=1
                     /locus_tag="KSE_04530"
                     /product="putative chaplin"
                     /protein_id="BAJ26300.1"
                     /transl_table=11
                     /translation="MRNQGVDMSRTRKYFAVVALAATAVLGTAGMASASAGAQGVAVG
                     SPGVLSGNLIQIPVHIPVNVCGNSVGVISALNPAFGNSCANIG"
     CDS             complement(523561..524370)
                     /codon_start=1
                     /locus_tag="KSE_04540"
                     /product="putative hydrolase"
                     /protein_id="BAJ26301.1"
                     /transl_table=11
                     /translation="MTIDTGTTTGTTTTASATSRAATYVLVHGAWHSGRVWERVAPLL
                     ARAGHRVLAPSLTGHGERAHLLGPEVGLDTHTADVVGLLLDEDLTDVVLVGHSYAGMV
                     VSAVADRVPERLAALVYLDAMVPVDGESVLDVMPATRHLLELAATTGTPWRIPPLPEQ
                     PAPVGLFGVTDPADAAWLRTLLSDESARCFRQPVGLANPAAAAVPRTHIHCVGALPPG
                     AVRRPVPARQPNGAPSRVRELRSGHDCMVTAPEQLAELLLEEAEFASEPAR"
     CDS             524434..524862
                     /codon_start=1
                     /locus_tag="KSE_04550"
                     /product="putative HxlR family transcriptional regulator"
                     /protein_id="BAJ26302.1"
                     /transl_table=11
                     /translation="MRDSAGDVFLADCPARLAIEIVTGKWAAVVLFALSRGPCRHGEL
                     VDLIGGVSRKVLTQTLRRLQGYGLVERHPPAGAPPRVEYALTELGLTLVGPIAALTDW
                     ARTHGAAVADFQEETEREETGREEAEQGEAELGGGVTRPR"
     CDS             complement(524846..525139)
                     /codon_start=1
                     /locus_tag="KSE_04560"
                     /note="Contains an Antibiotic biosynthesis monooxygenase
                     domain (IPR007138)."
                     /product="hypothetical protein"
                     /protein_id="BAJ26303.1"
                     /transl_table=11
                     /translation="MSKVTVIALLKAAPGAEQQVRAQALSLVAPSRAEAGNISYQAYV
                     HPEDPSAWLVFEEWEDRAAFDAHLASPHLTEALAAGPGLLLGPPAEHVFTAAG"
     CDS             525423..527210
                     /codon_start=1
                     /locus_tag="KSE_04570"
                     /product="putative serine/threonine protein kinase"
                     /protein_id="BAJ26304.1"
                     /transl_table=11
                     /translation="MTTHGGTGGSGFDLAGSGAEPLAAEDPRAIGPVPLLGRLGAGGM
                     GRVYLGVVGDRYAAVKQVLPQFVEDPDYRRHFGHELDNLARLPEEATAPLLAADREAR
                     PPWLATAYVPGLTLDRVLAVHGGPLDTARVWLLLRETAASLRAVHALDMIHRDLKPSN
                     VMLTARGATLIDFGIARAADQSRLTRTGMVLGTPAYMAPEQANGDREFTSAVDVFALG
                     ALLAYAATGRPPFGEGSGVDMLYRVIHTEPDLDALRELSPVLAETVAACLDKNPAGRP
                     SADRLVRLAAQHGPAPAERAGWPEPVLGTLLARSAFAEQPAPAADPAADGAAEPLPPD
                     GAPTKVLRVTGPPPEPGRRWHRRLVPFVVPVLLVAGGTAAVQLLPFGGPPQQSQGQGQ
                     GQGQGQDASSPGLAGTPGGTPGGGAASGPTPAADPDRSPNQDQGPTPSTPPTDSPAQS
                     SADPDRKSTPSAPKSTAPAAKPTTPPANPANPVNPATPAKSSAPARAYGPRCVFTTAA
                     SCTSDDPTVELTSSGGWTDCTFTFTTDWGDGNTTYTDTNGTGSADVRKTYATHRYAAP
                     GTYRINVRAVTDSGFCLATGASLTFTLTP"
     CDS             complement(527200..528612)
                     /codon_start=1
                     /EC_number="2.8.1.7"
                     /EC_number="4.4.1.16"
                     /locus_tag="KSE_04580"
                     /note="bifunctional protein"
                     /product="putative cysteine desulfurase"
                     /protein_id="BAJ26305.1"
                     /transl_table=11
                     /translation="MTTPDTPAALRPHRHPGPGSGPGPYGVPVPAALAHAEPGTRYWL
                     PAAPAVVPAPAVAPSALLFDVEAVRRDFPQLHREVNGHPLAWLDNGATTLKPRQVAEA
                     VARYCTAGASNVHRGAHTLAREATEAYEDGRAEAARLLGAPDPAQVVFVRGTTEAVNL
                     VAQSWGRANLGTGDEILVTAAEHHSNLVPWQLIAAERRARVRPVPLLPDGRIDQDAYR
                     DLLGPRTRLVALTHASNVLGTVPPVAEMTALAHRHGAVVLVDGAQAVSHFPVDVTESD
                     VDFYAFSGHKVFAPTGIGVLYGKRPLLEAMPPWQGGGNMIESVGFDRTTYAPLPHRLE
                     AGTGHISGAAGLAAALRYLRGLDRAAATAHEERLTAHAATALAAVPGLRLVGGPPGRI
                     GVLTFVLDGTDPLDVAHALDRLGIAVRAGHHCAQPALAAYGLTAAVRASPALYNNHQE
                     VDRLAAALHRIAAGEEPLRE"
     CDS             complement(528599..529822)
                     /codon_start=1
                     /locus_tag="KSE_04590"
                     /product="putative nucleotide-binding protein"
                     /protein_id="BAJ26306.1"
                     /transl_table=11
                     /translation="MTTGPDQQHRQGPRSLSTSAARNLATTTKTAPQMLGITPRYLLR
                     ALPWVELEAGVYRVNRRRGFILGDGLVSSYQDGDGRWRVIAEDLRELPLLSQLDGPVL
                     AALADAFTEHEIPAGQPIVAQDAPADRLHVLAHGRAEKRATGAHGADALLEVLGDGDY
                     FDAAAWAAGRPMPYRVTAASPCTVLTLDRRMLLELADREPALRARLDAFDAAATAAGR
                     TAPEHPLDLTSGHHGEPYLPETFVDYEESPRAYELSIAQTVLKVHTRVWKQPAFFLAH
                     PRAIAAFGRECTRRGVPPQIVELFGSPFLTWRGVPLLPSDTLDLRGTADSAPGTTNIL
                     LMRVGEDRQGVVGLRPAKVPDEAEPGLSVRPMGVDRQAITSYLVTGYFSVAALVDDAI
                     AVLQDVEVAHYHDYS"
     CDS             complement(530022..531392)
                     /codon_start=1
                     /EC_number="4.1.99.1"
                     /gene="tnaA"
                     /locus_tag="KSE_04600"
                     /product="putative tryptophanase"
                     /protein_id="BAJ26307.1"
                     /transl_table=11
                     /translation="MEPYRIKAVEPIPFLTPGQRAAGLAAAGYNLFRLDAAEVTIDLL
                     TDSGTGAMSARQWSALMNGDESYAGARSYRRFEDAVRELTGHRHVLPVHQGRAAERIL
                     FQSLPVAGRVTLANGHFDTTIANVLLAGGDPVDLPGPEARDDAPHPFKGNLDLDRLAA
                     HLAPGHPGPPAALVVLTVTDNAGGGHPVSPAHAREVAARARAAGVPFFLDAARFAENA
                     HLVTRRDPAAAGRSAAEVARELFRLADGSWCSMKKDAFGNIGGFLTLQDDELAERCRN
                     LLIATEGYTSYGGLSGRDLEALATGLAEATDPDYLADRESTTAWFARALQDAGVPVLT
                     PPGCHAVYLDAAALLPHLPARSLPAVSLACELYRAGGVRCAEMGSLTFGRPDPAGGPD
                     TPARRELLRLALPRRVYTRSHLEHVVRTAAAAAARADRLGGYRIVRQPPHLRHFSAVL
                     APETAA"
     CDS             531633..532664
                     /codon_start=1
                     /locus_tag="KSE_04610"
                     /product="hypothetical protein"
                     /protein_id="BAJ26308.1"
                     /transl_table=11
                     /translation="MRLDLAATALPAESPGLARLAEEAGADRISLAETSHDPFLQLAR
                     AADRTGRIGLATGVAVALARTPMLLAYQAWGLHESSGRRAAIGLGTQIKPHVVRRFGM
                     PWDRPADRMREYVAAVRAVWHSWQTGERLAFRGEFYRHTLMTPVFAPDPLPYGPPPLL
                     LAGVGPLMTAAAGAVADGFLAHPFCTPRHLAERVLPGVRAARAAAEAAGEPWTARPFE
                     VVANVLVATGRDEPEYLANLRLVRERLAFYASTPAYRPVLETHGWGGLQEELHRLSTR
                     GRWQEMGEALDDTVLRAFAVTGTPAEAARELLDRYGPLADRLCLTVPDGTDPTPLLHT
                     LTAARALTR"
     CDS             complement(532725..533333)
                     /codon_start=1
                     /locus_tag="KSE_04620"
                     /product="putative N-acetyltransferase"
                     /protein_id="BAJ26309.1"
                     /transl_table=11
                     /translation="MTSSNPSGPDRTATPADLDAMVSTLTSAFFHDPLWGPAFPDPAR
                     RAEQAAVMWRLYAASALRYPWTRVTPGAEAVAVWIPPGGTELTAREAELLPGLLTEAA
                     GEEAARAILAVYDQLEAAHPGVPCFYLTLLGVHRDHRGKGLGTALLARGLERIDALGA
                     PAYLESSNPANLARYRSLGFVPRTEITTATGHVVTTMWRPAR"
     CDS             533560..533994
                     /codon_start=1
                     /locus_tag="KSE_04630"
                     /product="hypothetical protein"
                     /protein_id="BAJ26310.1"
                     /transl_table=11
                     /translation="MSEELSRLAERARPTVLGLARIVVSLLFACHGAATLFGVLGGAY
                     GKAPQVGEWPGWWAALIQLVGGALVLVGLAVRPAALLCSGSMAYAYFSVHQENALWPI
                     QNGGEASVMFCWAFLLFAVVGPGGLALGVLLRRPARPQPATA"
     CDS             complement(534096..534884)
                     /codon_start=1
                     /locus_tag="KSE_04640"
                     /product="hypothetical protein"
                     /protein_id="BAJ26311.1"
                     /transl_table=11
                     /translation="MHVRTEPAGPRKGTAARPPLVRELLLVLGLFLVYKFGRRLAIGH
                     TTAAFHNADRVWGLERAVHLPGEGGVQSLLLHSGAVVHLANTYYATVHFPATVLFLVW
                     LYVRRPAHYLWSRRVLAAVTSVALVLPFAFPLAPPRMLESTGLQDTARLYGPSVYGPP
                     DADHLSNQFAAMPSLHFGWALMVAIGLIAATRSRWRWLWLLHPLITLTVIVGTANHYW
                     LDSIAATALFLLAFTFIRAPDRAGRPRAGRPRCGRRRALAPSPG"
     CDS             535036..535632
                     /codon_start=1
                     /locus_tag="KSE_04650"
                     /product="putative TetR family transcriptional regulator"
                     /protein_id="BAJ26312.1"
                     /transl_table=11
                     /translation="MPLRRIPPASRSKISPAREREFFEAVLDEVRTHGYQAVTMEGVA
                     ARTRCGKSTLYRHWGGKARLVAAALRAGREPRCAGIDTGSLAGDLRRVAAAAGAWSDH
                     DTSLLQALGYAVMTDSDLRDAVRETVIAPELAALEALLRRGVRRGEVAADHPALEFVP
                     GMIFGMTRIRPLFSDRPADAAYLARYVEAAVLPALGLT"
     CDS             complement(535727..536548)
                     /codon_start=1
                     /locus_tag="KSE_04660"
                     /note="Belongs to Phenazine biosynthesis PhzC/PhzF
                     protein family (IPR003719)."
                     /product="hypothetical protein"
                     /protein_id="BAJ26313.1"
                     /transl_table=11
                     /translation="MRIRIVDAFTDRPFGGNPAAVVLLDSAGFPADDWLQRVAAEVNL
                     SETAFAHPLPPGGDADWALRWFTPVTEVDMCGHATLATAHVLHTTGTATGPVRFTARC
                     GILTAETGPDGAVTMDFPTSDLTPVAVPDGLAAALGAEPVAVRDTSADVGDLLVELAD
                     ERTVRALAPDFAALVARPLSARGIIATALAEDPDGAYQFVSRCFFPAYGIDEDPVTGS
                     AHTALAPYWSARLRRDDLTGHQGGRRTGLVRTRLRGPRTLLTGRAVTVVDGELHA"
     CDS             complement(536664..537629)
                     /codon_start=1
                     /EC_number="3.1.1.-"
                     /gene="axe1"
                     /locus_tag="KSE_04670"
                     /product="putative acetyl xylan esterase"
                     /protein_id="BAJ26314.1"
                     /transl_table=11
                     /translation="MAFLSMNLSELREHRPARTEPDDFAAFWAGTLAEARAVPARLDT
                     VAVETGLATVTVEDVTFPGYAGQPIKGWLVRPRGAGGPLPAVVSYVGYGGGRGLAHEH
                     LLWASAGYAHLVMDTRGQGGGWAVGDTSDEAPSAGPAHPGSMTRGVLDPAAYYYRRLY
                     TDAVRAVDAVRTHPGIDPERVLVAGSSQGGGLALAVAGLVPDLAGVVAEVPFLQHIRR
                     ATEITDAFPYKEVADFCKVHRDKVETVFATLAYVDGLHFAARATAPALYSVALMDEVC
                     PPETVFASYHHYRGPKEIAVYPYNGHEGGGAHHVPAMLAFAAKVL"
     CDS             complement(537816..539027)
                     /codon_start=1
                     /locus_tag="KSE_04680"
                     /product="putative beta-lactamase"
                     /protein_id="BAJ26315.1"
                     /transl_table=11
                     /translation="MNEHPPRRTARRIRAVRHAMTATAAAGLALTALVPTSASASASA
                     SAAPAAAPRPDVVQQRLDALVKADGMPAALATVKGRDGRSRTYTAGVGDLATGAGVPV
                     DGQIRAGSNTKAFTAVVVLQLVAEGRVGLDASVDTYLPGLLRGDGVDGRNITVRQLLQ
                     HTSGLPDYMLAPALLDFTTIQYRYFEPRELLDGALAQRAVFAPGTGWGYSNTNYLVAG
                     LLIQKVTGRPYAEEVTRRVIDRIGLRHTYLPATGETALREPHPHGYLNTGDTGEPASG
                     ARLVDYTEMDSSMAWAAGAVVSTNSDLNAFYGALLGGRLLPAAQLAQMRSTVPAELLG
                     PGVRYGLGIQSRPLSCGGLVWGHGGTAPGHRSRGGVTEDGRAANITVTTVPEPPAAEH
                     VTDAVDAALCR"
     CDS             complement(539084..540322)
                     /codon_start=1
                     /locus_tag="KSE_04690"
                     /product="putative beta-lactamase"
                     /protein_id="BAJ26316.1"
                     /transl_table=11
                     /translation="MNENALRPHRAHRLREDRQTDRPTGRRTDRRTGRRPGREAGRGV
                     TAVTVAALAAAVVAGVLAPGSASAAPRPDATRQRLDALVKADGVPGALATVKGRDGRS
                     RTYTAGVGDAVTGAKVPVDGQVRIGSNTKAFTAVVVLQLVAEGRVGLDASVDTYLPGL
                     LRGDGVDGRNITVRQLLQHTSGLPEYVDTEGVLADPGRYFEPRELLDAALARKAHFAP
                     GARWEYNNTNYLVAGLIIQKVTGRPLGEEITKRVVDRIGLRHTYFPAPGETTIREAHP
                     KGYLRAADGSLRDYTKLDPSWGWAAGAMVSTNSDLNAFYGALLGGRLLPAAQLAQMRS
                     TVPAELLGPGVRYGLGLISRPLSCGGVAWGHGGALPGYETFGGTTDDGRAASIAVTGF
                     PAGEEVGKHADQAVDEALCG"
     CDS             540609..541949
                     /codon_start=1
                     /locus_tag="KSE_04700"
                     /product="hypothetical protein"
                     /protein_id="BAJ26317.1"
                     /transl_table=11
                     /translation="MSTDIDGHGVTPARPPGVADRPAPHLRVPDVTPAPPTGGPNPPP
                     RPPWWEENVGAGRWAGVEADLLALPRSRRADRSPTPLQILGARRRESSHEHYLAFLLD
                     PREDHGLGAGLLAALLELAGRPDLAADPRLDRTRLHRQVSGDASRPDLVATGPAASVV
                     VELKIDAPEGHRQTTRQADDFAGLAQSAVFVYLTPDGTAPGDGRFRPVAQRDLAGRLA
                     RLLARTSTGPDAAGPDGAGPGAAGRRHAEDYLNDLEAVVGISTDDDEDARFWATHRTA
                     LLAAQAATRRLLTRLPAHTGVALAALADGLGADLVVGHVDYTTSGGHAESAVVLSRPG
                     WLADGVPQLGFGLGIRRRSGGTQGPDLDGAAQHPFHGIYCTHPAVRAELGRRLAHRGW
                     GGHWAWWQYAELTPQPAGTGFLDHNAANVGAAVRDSWLDHIAAVDALWAARHTL"
     CDS             complement(542350..542808)
                     /codon_start=1
                     /locus_tag="KSE_04710"
                     /product="hypothetical protein"
                     /protein_id="BAJ26318.1"
                     /transl_table=11
                     /translation="MLRIKRTAAVTMAFLSVALGGAVAGATTAQAAVPAKFPRVHCST
                     TKIEVRSLDVAGGPVKCGGALGDPLYCTINGVDHVFAVGTDNAMWARWISPSGVPSDW
                     VSFGGSLTSEIRLYADGSGSLDFSARWSDGHLYEITRNDNGSWINWRRVD"
     CDS             complement(543117..543797)
                     /codon_start=1
                     /locus_tag="KSE_04730"
                     /product="hypothetical protein"
                     /protein_id="BAJ26319.1"
                     /transl_table=11
                     /translation="MWGKWIGCRVPVAARGRFATAQAAWPAIGDQPGLLGQVGGWDPD
                     GGGALLLGLWADEGAYLRFMRDRHAAVAADSRRSADERHGRAGSGAGYTAIDAAAGEV
                     VLDMPGDAAGLPQALERAALLRVADCRLAPGRGRHFLDVQREVWAPGMAAAGGMLAGV
                     VVRLGEDRHLVATLWSDPAAHRRYADRHLPALRARAVPEDDLRSVSGGALPLEPAWRV
                     LPTGRPRR"
     CDS             544340..545290
                     /codon_start=1
                     /locus_tag="KSE_04740"
                     /product="hypothetical protein"
                     /protein_id="BAJ26320.1"
                     /transl_table=11
                     /translation="MLTELTGDADAFAKAVAEGIPQVFRPTGRPAGLPGVEELETVLN
                     GGLLRVPYVEMVRDGAVVEPELFCATRTVAGRRESGWADPARISALLAEGATLLLPQL
                     DQWHAGVRAMATDIALHLGRRTEAFCFTTGAGRRGLDVHRDDADVLVVQLAGAKDWTV
                     HEPPADGHWRPGLAPAPGPVALRTALTPGEILYVPRGAPHTATGHRGLSVHLSFTIRE
                     ATTGRLHAALGEFLTTPGLPTGDLPERPDTSEVLATAAEVLRLGRERLAALTPEELLQ
                     LARGPLPAGAAAAPGATSLAGAGLAGAGLLGVEWGMRDTA"
     CDS             complement(545711..545842)
                     /codon_start=1
                     /locus_tag="KSE_04750"
                     /product="hypothetical protein"
                     /protein_id="BAJ26321.1"
                     /transl_table=11
                     /translation="MATDMQELFDLDVQDLVAAESPEHEEAAVSLSCEGSCTRPFCI"
     CDS             546145..549696
                     /codon_start=1
                     /locus_tag="KSE_04760"
                     /product="putative dehydratase"
                     /protein_id="BAJ26322.1"
                     /transl_table=11
                     /translation="MGKKSHTAHQDAIFTATGPVLLRTPALPLPPRHRRAEPAASASP
                     AGSADSAHWGSPGGDPLGEQIGECFADRLVEAAADPVLREAIEISSPSLADLLERAVP
                     AVAAPEDGPRAAELHLAELRPAALRRAAEAVGRYRLRMATRATPFGLMAAVGTARFGA
                     RAEVGWEGGERRAFRPDLGWLLPLLDRLRTDPQVLGSLLLAVDQQAVLRGDRLVLPYL
                     PDRSTLPESTAEAVPGAGRPVAERTVRATPVVRAVVRLAERPVSHAELLAGLAAGFPT
                     APAEAIAGLVRTLVAQGFLLTDLVPPPHSTDLLGHVLERLPGEHPVRGELAAVRGLLA
                     RAAGLPRGRATGVLREARRRMLRLGPAERPLHADLALVGGVVLPEQVRVEVEQAAGVL
                     WRLSPPVGAPEHLRSYHAEFVERYGIDSPVPLAELLDADTGLGPPAGYRRPVGPRGAA
                     NPEPARARTEREAARNRVLAELVAGALVDREPGGPLPEVVLDDELLDRLAPLAEESEE
                     QESQAGSAAETPPASLELYAELAADSLAELDAGRFRLVLSPTAGSDRAGATFGRFASH
                     LANSGSNSGSGSGSGGSDPDSYGNDSYGDDNSNGGGRLLAEAAGALPDDDEVLYAHLE
                     FTPYRPRHANIALTPRWLGHRVVVSAFPDPSGPAVLALDDLVVVADAERLGVYSRELG
                     REVRADAHHALNLRTGAPNAARFLQETALGGHRPWQPWDWGAAASSPVLPRVRRGRVV
                     LAPASWRLTAPVPDSAAPYGDWADGLARWRRRWGVPAAVRLLSGDQRISLDLDDPWHR
                     RLLYGQCRADRPTVLQEDLGAGSSGGWLPGPDGAHAAEIVVPLRPAGTGPTAKATAAK
                     ATTAQASAQATARTGVPARRVLPAPHPRTVELPGGEWLFARIGAVETRHDEILADRLP
                     ELLARVPGQVDRWFFVRYRDPAPHLRLRFHGEPSALTGELLPALHDWAHGLRRSGLAA
                     DLRLEGYAPEADRYGGPEVLADAERVFHADSLVALAALRLVRTARGTPGELLAAANLT
                     ATARDFLAARPVPVPVGPWVAATYPKSEAHQRIFRTQRAAALRAIGPDGPAAPAGGLL
                     PADAALAGAWRLRAERLAAYAPRLAGPVAGPALASLLHMGHNRLIGIDREAERRAYAL
                     ARGALEAHRARHRTTTTTTTTAPAPTAPAPVTPDEER"
     CDS             549693..550928
                     /codon_start=1
                     /locus_tag="KSE_04770"
                     /product="putative lantibiotic modifying enzyme"
                     /protein_id="BAJ26323.1"
                     /transl_table=11
                     /translation="MTPTEALQAVTARLSRPDATATTADSAGLGTGRSGAALALAVLA
                     GPDQEVRRAAHGHLAAAVRAPGAMRGGGLYSGAAAVLFAARVMARGPGEYRGLVDTLT
                     PRVAESAAGRAAALRADLAAGAGLRAHTFDAVSGAAGLGRLLLELAPDGPGTAEVLSA
                     LVELAAPTDGPLPRWWTAAAPDPEPVPAPEPVPAPGPGGGPTRSRGHLNFGLAHGIPG
                     PLALLSLAGARNVRVPGQDEAVEALADRLIAHQLPSGGWPLTLSIEQAERRAVPADPP
                     VRAAWCYGTPGAARALFLAGRALGRADWQQAAVAALDNALADSGSWNLNGPGLCHGTG
                     GLLRIVQRMAADSGSAALAARLPALATATARDLTAALAADAPATLLEGTAGAALALHG
                     HLNSPAGEGTDWDACLLLS"
     CDS             complement(551256..552005)
                     /codon_start=1
                     /locus_tag="KSE_04780"
                     /product="hypothetical protein"
                     /protein_id="BAJ26324.1"
                     /transl_table=11
                     /translation="MVRDHNEDSLVLGPWTLCATSTDSPQSLVFPYGETPVVVAVADG
                     LGGHPAGDVASALTVRHLAAAGPHLRGEQDVTDELHACHAALREASEADPALAGMATT
                     VAGAVFADGHVTVFNVGDSQVYAITPDRGDGVGLRLLSTDDSPPPAPGRRTSHLITQT
                     VGGATAPEDFRPHLVRLPAEPGARYLLCTDGLTDPVAPEELAALLTEADAEADGDAQG
                     DDQRALVDLWRAAIRAGGPDNVTLALVRIEE"
     CDS             complement(552165..552338)
                     /codon_start=1
                     /locus_tag="KSE_04790"
                     /product="putative CsbD family protein"
                     /protein_id="BAJ26325.1"
                     /transl_table=11
                     /translation="MSTGDKIQNAAEKAKGAAKEAAGKAVGNERMEAEGKAEQAKGDL
                     KQAGEKAKDAFKH"
     CDS             complement(552429..552857)
                     /codon_start=1
                     /locus_tag="KSE_04800"
                     /product="hypothetical protein"
                     /protein_id="BAJ26326.1"
                     /transl_table=11
                     /translation="MPHHDARPPLPEAAVPGGQPPPSVRTAGQARAALTRLLEAAGHP
                     GGRVLADAHLAVTELVANAVHHGGGLTGFVARIGPGGTRLVVEVEDADDRHPVAQPLH
                     DRDPAAAGGRGWAIVQALTDSCHVEALPVGGKRIRVTFAL"
     CDS             complement(553019..553390)
                     /codon_start=1
                     /locus_tag="KSE_04810"
                     /product="putative antagonist protein"
                     /protein_id="BAJ26327.1"
                     /transl_table=11
                     /translation="MAAMTDHTPGTPEPTVLHLRGDLDHDNEREVAAEVEAAAARSAG
                     LLVLDVSAVTFADSSALRTLVLAQQRAEEAGGALVLLGPLGPALRRLLEITATDGYFT
                     VADTLPQARAAAGAARRPDSA"
     CDS             553635..557378
                     /codon_start=1
                     /locus_tag="KSE_04820"
                     /product="putative two-component hybrid sensor and
                     regulator"
                     /protein_id="BAJ26328.1"
                     /transl_table=11
                     /translation="MFGADPVVGADLARVDWAATPLGDPARWPQSLRSAVDTMLSSRF
                     SMWMAWGPELTFLCNGAYRRDTLGGKYPWALGRPFREVWAEVWADARPRIEHVLTEGE
                     ATWDEALLLYLERSGYPEETYHTFSYSPLRDEADEVAGVLCVVSEDTQRVVAERRLAT
                     LRDLGSDPGAVRTEDEFLAFGAGQLARNPHDLPFTLVYLFDERGGARLAAASGVPDGH
                     PAAPALIGPGQEGPWPVAAVRGGAPASVALPARGAFADLPRGAWEVPPRQARVVPLNG
                     PDGGGPSGFLVVGLNPHRPPDDGCLDFVGLVADRLAAGVASARGHEAQRRRAEQLAEL
                     DRAKTVFFSNISHELRTPLTLIAGPAEDLRRRLADADPDVREDAETIHRNALRLGRLV
                     DTLLDFSRIEAGRMRARPRPVDLAAVTAELAAVFRPAVQRAGLTLEIDCPPLSAPVAV
                     DPGLWEKVVFNLLGNALKFTPEGTVRVRVRERDGRALVSVEDTGIGVPAAELPRLFDR
                     FHRVEDARARSHEGSGIGLALAKELVELHDGTITAASTAGSGTTFTVDLPLAVGHSPA
                     PAERPAAEAEAFLQEALRWDVLPDEPGTEPATAPATDPAPGTAAHVLVVDDNADMRDY
                     LARVLRGAGHRVTAVGDGGRALAVLRAAPPGSPPGSGAGSPPELVISDVMMPGVDGLQ
                     LVAALRADPRTAALPVLLLSARAGRDDAVDGFESGADDYLVKPFATADLLVRVRAALR
                     LARLRERHSRWQEALVDSLQDAFFVCDEDGAVVRVNAAFGAVLGYGPEGVPYPVPHPW
                     WPDPAADPEGRRRATEALAGAQESGRGSATVPAVHRDGHRVWTHSTFNRVTDPATGRA
                     VTVGTFRDVTTEYYAVQRESAMAALTDCLARAAGAEEALAGALAELRGLWRADRVLAV
                     RFDRGGGRPRLVAAGPGPDWAGLPEEQRAALAALADAPALTPVPGPSWTGVRLEHPDG
                     PLALAVELGGHRPFTREDELLLALLGGRLAQGLGRAHRIDQQRETAIALQHAILGPAR
                     LPEGFAARYEPATPPLEVGGDWYDTVPLPDGRIGVIVGDCVGRGLAAAGVMGQLRSAC
                     RALLLQDHSPSRTLSALDAFAAALPGAVCSTVFCGVLDPASGELRYSSAGHPPGVLVL
                     ADGGTELLEGGRALPLAVRIGRPRPEAAAVLPGGSTLLLYTDGLVERRREGLAEGIAR
                     AGRAVVSGAGLPTAELPDHVTARLAPAGGYEDDVAVLLYRRPA"
     CDS             557598..561836
                     /codon_start=1
                     /locus_tag="KSE_04830"
                     /product="putative two-component hybrid sensor and
                     regulator"
                     /protein_id="BAJ26329.1"
                     /transl_table=11
                     /translation="MADRSTIGEAELRSLLAGLTAVRDGNFSTKLAGTSDGLLGEIAT
                     VFNGMVDQLSRFTSEVTRVAREVGTEGQLGGQAVVPGVSGTWEDLTDSVNAMAGNLTT
                     QVRDIAQVATAVAKGDLSQKITVDARGEILELKNTVNTMVDQLSSFAGEVTRVAREVG
                     TEGILGGQADVKGVSGTWRDLTDSVNSMAGNLTGQVRAIAQVATAVAEGDLSQKITVD
                     ARGEILELKDTINTMVDQLSSFAGEVTRVAREVGTEGRLGGQADVRDVSGTWRDLTES
                     VNVMADNLTAQVRAIAQVTTAVAKGDLTQKIRVDARGEILELKETINTMVDQLSAFAD
                     EVTRVAREVGTAGNLGGQATVRGVSGTWKDLTDNVNVMASNLTGQVRSIAQVATAVAR
                     GDLSQKITVEAEGEVAALAGVINTMVDTLSAFADEVTRVAREVGTEGILGGQARVPNV
                     AGTWKDLTDNVNFMAHNLTSQVRNIAQVTTAVANGDLTRKIDVDARGEILELKTTINT
                     MVDQLSSFAAEVTRVAREVGSEGRLGGQAEVEGVSGTWKRLTENVNELAGNLTRQVRA
                     IAEVTSAVAAGDLTRSITVDASGEVADLKDNINAMVGSLRETTRANEEQDWLKTNLAR
                     FSGLLQGRRDLAVVAEAVMDELTPLVGAQVGAFYLAEETDGGTVLRLIGSYAYPDGGR
                     PTSFRLGESFVGQAARSRRTIAADALPAGYLAASSGLGRTEELSLLVVPIVVEDQVLG
                     VIELASIRPYPAVHRAFLDQLMETVGVNLNTIVANARTDELLGESQRLTSELQARSQE
                     LQARQEELQASNAELEEKAALLAAQNRDIETKNLEIEQARQELEERAHQLSLASTYKS
                     EFLANMSHELRTPLNSLLILAQLLAQNPTRNLTAKQVEYAGIIHSAGSDLLQLINDIL
                     DLSKVEAGKMDLSPEPVALRSLLDYAEATFKPLTGQKNLAFTVRTSPDVPERLVTDDY
                     RLRQVLRNLLSNAVKFTEQGRVELRIGLAPQDRIPEGVRRGGPVLAFQVSDTGIGIAP
                     QHLESVFGAFQQADGTTSRKYGGTGLGLSISREIAYLLGGAITAESVLGAGSTFTLFL
                     PVSRPEFLALETEPRSGAPERGPDAAGDAPVQGADESAAPPQSRRLLVVEERAGGLLS
                     LVAENATAEPAGLSGSGDGRPRIEVVTAVGAAEAAAVLASAPSHCVVLALDLPDGAAP
                     ALLRDMDRDPALQGVPVLVHSNRGTPGGADALTRPDGRPLEVISSLDELRERIALHMS
                     ADRPGDVPLVRPAPPEAPWEAGDSPLNGRLVLVVDDDDRNLYAITGILELHGMRVLQA
                     ENGRAALETLAANPGIDVILMDVMMPEMDGYTATAAIRAMPQHAALPIIAVTAKAMLG
                     DREKSLGSGASDYVTKPVDAGELISRIEAQLLAR"
     CDS             561926..564394
                     /codon_start=1
                     /locus_tag="KSE_04840"
                     /product="putative serine/threonine protein phosphatase"
                     /protein_id="BAJ26330.1"
                     /transl_table=11
                     /translation="MHQSREPRPDQGPPTALDATGLIGAQRHAPTVAVAVTGAETETA
                     PEATAAGGAIGRLAGTVEKLRRQLEEAQAHAAGRSVVEMAVGVLVERLRCGPTEAAGQ
                     LRALAEQAGTTPLELAAGLVNQSAADKISEAAREFVARAADPASAGVGVRLRSTEADA
                     LSGSDTAAAARAMLEHALRPLGAVAVAIWAARPDQSLALAGSAGFADAEARRWRHVPP
                     GVVTAARRALDERGPVAYRTLADAAVPTIGRHEAGGGRVAVPAGVGGRLTGVLEVCWR
                     EELPPWSQSLERQFEVLAGLCAATLETWPDGSGEDGPASGRLDELTRLVDGLLDPCMV
                     LEAVDDGAVPVFVIRHANPAFVDFAGRPAGAVVGSPLLEAYPLAARPGNLLEAVEDVY
                     ATGAPFKDPRMRLAAQVDGVPLTADAYVSVSRHGDHVTVLWRLEDSTPKIARLLHHAQ
                     RLGRIGGFEEDLDARQVVWNDTLFELHGLPATARPIPLDRLAEHAHPDDRDAVGRFLR
                     TLLHHRRPASTAFRLQRADGVTRHIRVVAEPVHDGGPERLSAIRGAYQDVSAQHWTEV
                     ALAATRDQLAQTEQQAAERHRLVLQLQHAIMPPSDGPRRLNNLEVAVRYRPAEKEHLV
                     GGDWYDALPLPSGQVLVCVGDVAGHGIEAATGMVALRNALRGLAATGAGPAQLLSWLN
                     SVTHHLTDNVTATAVCGLYDPERRRLRWARAGHLPPVLTRGGTAACLPQVDGILLGVV
                     DRADYQESEVELEPGDRLVMYTDGLIERRDQGLQASLANLVALSEAAPRAGAAALESH
                     LDHLLRFSGADTDDDTCLVGIEVR"
     CDS             564623..565996
                     /codon_start=1
                     /locus_tag="KSE_04850"
                     /product="hypothetical protein"
                     /protein_id="BAJ26331.1"
                     /transl_table=11
                     /translation="MPSTSSPAGRTRALRATALGSFTTAAVLFVAAPPGAVATTAVPG
                     AGASARLLTLENPDVPAIGLTAFAGHYGYAASPTRAAEDTGDFSDPDGVLGRVTVGSM
                     TAHTATAADRSYAQAQLTGLEVHFRSTTLVGIEAGAIGSLDSYAQCIPAPVGPWALAY
                     TRTDSAQITVLGRRVPVGTTELAITGNDLGTPQIGPSTLTVTVTPHQDPPTQVRQATA
                     EAWIDITVTGTLDDLQGQPVYQGPLTTLRVGEVQVDCRAATPSPSPSPSPSPSPSPSP
                     SPSPASHSSPPPSPSPSPSPSPASHSSPPPSPSPSPSPSPSTSASPSTSPPPAPSSSP
                     TLPPSPGPSPALPSGPLPTTVLVVSPPEPSTSSPPAGGPAGPASAPASAPGSPSHPGP
                     AVLAPPADDRAGAAPATRPTGRGAAGSRLADTGDASAIRVAAAFGLLATGALCLLLSR
                     RGAFRAP"
     CDS             complement(566056..566307)
                     /codon_start=1
                     /locus_tag="KSE_04860"
                     /product="hypothetical protein"
                     /protein_id="BAJ26332.1"
                     /transl_table=11
                     /translation="MRDGNALAGPLSELFVPDPTTALRLCPGCGADAALATLHVYDHG
                     PAAVARCPRCTRLAFRIAHHPGELWFDFGHGGALRFPTA"
     CDS             complement(566325..567047)
                     /codon_start=1
                     /locus_tag="KSE_04870"
                     /product="putative oxidoreductase"
                     /protein_id="BAJ26333.1"
                     /transl_table=11
                     /translation="MTDWRRAELRARTPESATARTLYLTVDGWPGHLPGQHVDVRLTA
                     DDGYQAVRSYSLSAPADGDRIELSVQPAPHGEVSPYLADDFPTGAAIEVKGPLGGWFV
                     WKPGRPDPVLLVAGGSGVAPLAAMLRARLDLGGDVPPFHLAYSLRDPGQRWFGPLLDG
                     IAEAEDPAVTVACLYTRAAPPGHPRPVGRITAADLDLPGFRPADGPLAFVCGPTAFVE
                     RAANLLVHLGHRPDRVRTERFG"
     CDS             complement(567063..567662)
                     /codon_start=1
                     /locus_tag="KSE_04880"
                     /product="hypothetical protein"
                     /protein_id="BAJ26334.1"
                     /transl_table=11
                     /translation="MATLTPGFHGHRRTRGDRLPPGQFRTEDFPVLSAGPTPDIPLDR
                     WEFTLTTESGEQHRWNWEQFQALPQQDVTTDLHCVTRWSKFDTRWRGVSLDTLLADVT
                     TDARYALAECYGDYTTNLPLDDLRGGRAWIAHTYDGAPLAAEHGGPARLLVPHLYFWK
                     SAKWITGLTLGRTDRRGFWEQLGYHDYGDPWREQRTWTD"
     CDS             complement(567693..568289)
                     /codon_start=1
                     /locus_tag="KSE_04890"
                     /product="hypothetical protein"
                     /protein_id="BAJ26335.1"
                     /transl_table=11
                     /translation="MSLSPGFSGRRGFDTSRLPPGQYPTHDFPVLSAGPTPRIDTDDW
                     EFTLDTETGQHTAWTWEQFQALPQQDVTTDLHCVTRWSKFDTRWRGVSLDTLLADAET
                     AADFVIAHCHGGYTTNLPLEDVLDGQAWIVHEYDGFPLSPEHGGPARLLVPHLYLWKS
                     AKWVRGLTLSPVDEPGFWEAAGYHNHGDPWREQRTWQD"
     CDS             complement(568404..569489)
                     /codon_start=1
                     /locus_tag="KSE_04900"
                     /product="hypothetical protein"
                     /protein_id="BAJ26336.1"
                     /transl_table=11
                     /translation="MATRAQDPRPRPPAPTRLLRDAVTPRAALVMFGVLLLQLGFALS
                     YMGAFHDPRPHGLRVAVVAPPAVLPQVVGRLDALPGDPVDASPAADEAQARQLLLDRD
                     TDAAALIDPARDQDTLLVASAAGTSVSDTAARIAQAIEQTQGRQVAVQDVRPPAKGDS
                     RGLSSFYLVLSWTIGGYLAASALNMVSGSPRPTPARIGVRLAAMLPYAFVSGIGGALI
                     VGPLLSCLPGAFWELTGIGTLVVLASGVVGVAMQRLLGTIGLGLTIVLFTILGNPSSG
                     GVYPAALLPPFWRAIGQALPPGAGTTVVRNTVYFDGAATAGAVWVLVAWAVGGVLVAV
                     AASFLLPARSGPATAPVPAPTAAPDAG"
     CDS             complement(569652..571907)
                     /codon_start=1
                     /EC_number="1.11.1.6"
                     /gene="cpeB2"
                     /locus_tag="KSE_04910"
                     /note="bifunctional protein"
                     /product="putative peroxidase/catalase"
                     /protein_id="BAJ26337.1"
                     /transl_table=11
                     /translation="MPDDSDARQVTNAFPENTDPAAGGCPVQAAAADPMKGDGIHQWW
                     PERLNLGVLRRHAAAHDPNGDGFDYPAAFGALDLAEVKRDIERVLTTSQDWWPADFGH
                     YGPFVIRMAWHLSGTYRVTDGRGGNGAGLQRFAPVNSWPDNVNLDKARRLLWPVKQKY
                     GKALSWADLMVLSGNVALESMGLATFGFGGGREEVWGPDEAIYWGPETAWLTDERHKD
                     DGELLAPLAADTMGLIYVNPEGPRGNPDPMASATDIRETFARMAMNDEETVALCAGGH
                     TFGKTHGAAGSEHLGPEPEAAPLQQQGLGWKSDFGTGHGNDTITSGLEVIWTDTPTRW
                     DNRYFEILLGYEWELTTSPGGAHQWRPKDGAGQDTVPDPHDPAARRTPAMLTTDVAMR
                     VDPDYARICRRFLEHPEEFADAFARAWYKLTHRDMGPITRYLGPEVAAEHLIWQDPLP
                     EPTEAPLDADAVGQLKSRVLAAGIPVADLVWLAWSCASTFRRSDKRGGANGARIRLEP
                     QNGWEVNEPHRLAGLLARLEEIRAAFASSRPAGHGVSLADLIVLAGTAAVEKAAADAG
                     HELRVPFTPGRVDATREHTDIDGFSHLEPAADGFRNHLGKDDTLPAEYRLVDRADLLG
                     LSARELTALVGGLRTLGATYQSSDLGVLTARPGVLTNDWYVNLLDQDTTWTPTAHDPA
                     LFEGRDARGSLRWTASRTDLVFGSNAELRALAEVYASAGGEQQFATDFAAAWAKVMDL
                     DRYDLPGHRHT"
     CDS             complement(572098..573066)
                     /codon_start=1
                     /locus_tag="KSE_04920"
                     /product="putative esterase"
                     /protein_id="BAJ26338.1"
                     /transl_table=11
                     /translation="MTQLPPPITPYLEPAAKELAEATDPHPRIYEVPPPEGRDILLGL
                     QSGEGVERPAVDEEWVTVDAGEWGQVRTRIIKPKGATGPLPVVFYIHGAGWVFGDDKT
                     HDRLFRELAVGAGAAGVFPVYDRAPEAKYPTQVEQNYAVGRWLLEHGAEHGLDTSRVA
                     VAGESVGGCMSAVFANMNKERGGLDLKAQVLLYPVTNADFDTPSYHQFAEGYYLTRDG
                     MIWFWDQYSDPDQRKEPHASPLQTPLEDLRGLPTTLVITDEADVLRDEGEQYANKLRE
                     AGVDVTAVRVAGMVHDFLLLDSLRDTRAANVARHLAVDALKKALHG"
     CDS             complement(573199..573348)
                     /codon_start=1
                     /locus_tag="KSE_04930"
                     /product="hypothetical protein"
                     /protein_id="BAJ26339.1"
                     /transl_table=11
                     /translation="MSVADSTAFSPTDTMSLSARAKALMAVEGIAALIASLLVIAHAV
                     GVPDR"
     repeat_region   573445..574290
                     /note="IS candidate"
     repeat_region   573445..573461
                     /rpt_type=inverted
     CDS             573479..573832
                     /codon_start=1
                     /locus_tag="KSE_04940"
                     /product="putative transposase"
                     /protein_id="BAJ26340.1"
                     /transl_table=11
                     /translation="MTIVERLVPDELWELFQRVVPPAPTRPQGGGRRRHGDREVLAAI
                     VFVASSGCTWAQLPHCFGPSGPTAHRRFTEWTGARVWAKLYRLVLDELGARGELDWSR
                     CAVDSVNMRALKKGI"
     CDS             573784..574281
                     /codon_start=1
                     /locus_tag="KSE_04950"
                     /product="putative transposase"
                     /protein_id="BAJ26341.1"
                     /transl_table=11
                     /translation="MRGRLGEHAGPEKGDLTGPNPVDRGKYGSKIHLLTERTGLPLSL
                     AVSGANLHDSQALIPPVEAIPPIRSRRGPRRRRPGKLHGDKAHDHRFIHSHLRRRQIT
                     HRIARRGLESSTRLGRHRWVIERTVAWLGGFRRLHRRYERKADHFAAFAAIAAALVCH
                     RRLTK"
     repeat_region   574274..574290
                     /rpt_type=inverted
     CDS             574572..574961
                     /codon_start=1
                     /locus_tag="KSE_04960"
                     /product="hypothetical protein"
                     /protein_id="BAJ26342.1"
                     /transl_table=11
                     /translation="MSQVDNALTQPGNPAPDVPAAPASAPVTLVAGVRLVLTGPADPA
                     NPADCTGYLAALASGLTGPQMTGLEIDSGLVRAAARRSPRTGRLLSRGVRAACGRRPK
                     RCGPAGPRRAAPSRTTSISARPGRCGR"
     CDS             575050..577020
                     /codon_start=1
                     /locus_tag="KSE_04970"
                     /product="putative ABC transporter ATP-binding protein"
                     /protein_id="BAJ26343.1"
                     /transl_table=11
                     /translation="MNDHTTTTASVPGPRTPELPPPPERVRAVPADGDLGGQITQGYW
                     ETFEGEASRTGLVTIARRLPAIVVQVWGTAWRADARAAVLVAVLQLVSAAMVSAGLIA
                     SLGILQKVFAGGATGERIRAALPALAVVAVLLMLRGLVDAGISHWQARLGPRVRQQLE
                     ADFLALTSRIELAAVDDPTWADEVRRANDRGLYYAKESVNKTIELASAVLALLGAAGV
                     LGVLHPVLLVLLLAAVVPKGAASVHSIRAGYLSAVRQSTLRRRMLQFSWVLFERDTAP
                     ELRASNAQQALLDEHRALSARITDEEVALGEHQSRAALLGRALGGLGMFATYAALAWM
                     LGAGWMPLATGGAAYLAIQASQSALLRLVIAGHQVFEHALWVEDLKRFEESCRARLPR
                     TGAPAPAAVKEIEVRDVHFTYPQGKQALRGVSLTLEAGRRYAFVGANGSGKSTLSRIL
                     AGLYEPTEGTVRWDGTDVRRFDAASLTGRVALVLQDPGHWPLSALANITIGSGNITTA
                     DPDRVMRAVRATGADRVIADLDHQWDTVLSPQFEGGAELSDGNWSKIACARALNDDDA
                     PLLVMDEPTASMDPLAEDRLFRAVLDEYAGPDTITVLVSHRLAPAVACDQVLVFDQGR
                     IVEAGSHRELIALGGTYAEMFETQAAAYRSNR"
     CDS             577376..577933
                     /codon_start=1
                     /locus_tag="KSE_04980"
                     /product="putative hydrolase"
                     /protein_id="BAJ26344.1"
                     /transl_table=11
                     /translation="MIEDWATEESTEVYRGRWVVVRRDTVRRPDGSPGSYEYTEAVDG
                     VRVLALDDRGRIALVAEDVYVCGRRLLLCPGGGCGADEDPAAAARRELLEEAGIRAAR
                     IEQLTTMWRMPAGARTREHLYLATGLTVGEHQREASEADMELRWVPLEEAAAMCADGR
                     ITEAGTLTAVLLTARQHRPAAAPTH"
     CDS             577941..578420
                     /codon_start=1
                     /locus_tag="KSE_04990"
                     /product="hypothetical protein"
                     /protein_id="BAJ26345.1"
                     /transl_table=11
                     /translation="MRPPPQDGPTTPRGEEPADRPSPRSAPAPTATARYRCGTRLRRC
                     RPVPAPAPRPTSRYAPGAGRKEPARCPRGPGAHGTRPGFRAYRGRTWSRQDFVLGFAG
                     DVGDLAKLTQAADGIRCGSASGDPELLERGLRTMARLRTATKDPTAPRAATGSEGTA"
     CDS             578557..578778
                     /codon_start=1
                     /locus_tag="KSE_05000"
                     /product="hypothetical protein"
                     /protein_id="BAJ26346.1"
                     /transl_table=11
                     /translation="MGVGRFESLIRPPADVPVTARDVAQTGITAAVPARRRPGPPVRG
                     FPDQPDHRPRGTARARSVRSVPCGRGGPG"
     CDS             578818..579003
                     /codon_start=1
                     /locus_tag="KSE_05010"
                     /product="hypothetical protein"
                     /protein_id="BAJ26347.1"
                     /transl_table=11
                     /translation="MTTQDGKDRAAEEAPGESVRERSAEEREITAPTPADVRAKAAGR
                     DGGDEDPEPPAADSQAP"
     CDS             complement(579081..579389)
                     /codon_start=1
                     /locus_tag="KSE_05020"
                     /product="hypothetical protein"
                     /protein_id="BAJ26348.1"
                     /transl_table=11
                     /translation="MERAAETSRQWTFLTNHARVLIQIYRDPGIRVRDIAARCLLTER
                     AVQRIIADLEDAGYLSHERRGRTNHYHVIDGQLRHPADAGPTIAELLSALLTPPPDPR
                     "
     CDS             579485..579766
                     /codon_start=1
                     /locus_tag="KSE_05030"
                     /product="hypothetical protein"
                     /protein_id="BAJ26349.1"
                     /transl_table=11
                     /translation="MPVPRSAPGGEVVECPTRAQLQELTDALTGGTGAVPALPPQLRY
                     AIAGVSAYLAAVEDGTPATGQLRGNAVALWATLRAVAGAARAPDPLPAS"
     CDS             579841..580248
                     /codon_start=1
                     /locus_tag="KSE_05040"
                     /product="putative antagonist protein"
                     /protein_id="BAJ26350.1"
                     /transl_table=11
                     /translation="MVRAPDLRIETRRSGGTVRCALVGALHQDNQEAFARALARGLRA
                     RPDRLRVDLRAVDLFTSAGLNALLRAGLAARVLGVALALDSPSRCVRRVLESTRSAPY
                     LPVENSDPLRERRADRGRPPGRPRAGRDPAGPR"
     CDS             complement(580257..580565)
                     /codon_start=1
                     /locus_tag="KSE_05050"
                     /product="putative WhiB family transcriptional regulator"
                     /protein_id="BAJ26351.1"
                     /transl_table=11
                     /translation="MTMVSRLPGAQTHHWDWQLEGSCRTVGGEVFFRPAHEGRAEARE
                     REEAAKRVCGGCPVRLECRRHALATREPYGVWGGLTEDERRVLLVRRGAGADVTSTAA
                     "
     CDS             complement(580789..581865)
                     /codon_start=1
                     /locus_tag="KSE_05060"
                     /product="putative ribonuclease"
                     /protein_id="BAJ26352.1"
                     /transl_table=11
                     /translation="MRDGEPSRERHDGKRHDGKRHDGKRHDGKRDGNGGRSGWAARFP
                     ARGRLAVLRRTAGEFLDDELPDRAAALTYYGVLAVFPALLVLVSILGLLGGPVTGAVL
                     DNLRQLAPGPARDVLSGSVEQLRDGRGAGGVFAAVGLLGALWSASGYVAAFIRAANAV
                     YDIREGRPVWKLTPLRVGLTLVLMVLLLASAVIVVFTGPLAERAGDLLGIGPTAVTVW
                     SVAKWPVLVLLVSVMIALLYWAAPNVRGRGWHWISPGSLLAVLLWLALSGGFAAYVAW
                     FGSYNRTYGTLAGVVVFLVWLWLSNLAVLLGLEFDAELARERAVEHGLPPDAEPFLPP
                     RDTREWPEDAAAPDTRTHRTGEQR"
     CDS             complement(582093..582428)
                     /codon_start=1
                     /locus_tag="KSE_05070"
                     /product="putative antagonist protein"
                     /protein_id="BAJ26353.1"
                     /transl_table=11
                     /translation="MSAHPVPPPGPAAPHRAVTVRVEGELDHESCEELVRAVAAHLAA
                     QPPYQVVRVDCAAMSLCDSMGLSALLQIRRDTDAAGRRLLLEHRPAHLDRLLRLTGTA
                     AYLLADRAP"
     CDS             complement(582425..583627)
                     /codon_start=1
                     /locus_tag="KSE_05080"
                     /product="hypothetical protein"
                     /protein_id="BAJ26354.1"
                     /transl_table=11
                     /translation="MNDRASTATLGPETGTGPGTGTGAGPATGTGPEAGPVDRTEELW
                     EAVLGGDQARAAALAVAALERGLHPEELLLDVIGALQARIGREWAADRITVIQEHAAT
                     AVNERVVAVVTGHPAFAAATAPRRPGRIAVACVEGEWHAFPARLLAEVLTLRGWRVDY
                     LGAQCPTPHLIAHLHRTAPDVLALSAALPTRLPAAHSAITAAQAAGVPVVVGGAAFGP
                     DGRHARLLGADAWAPDARAAARRLARGLPLPASPHRPVDDLPHLADQEYTLVGRDPRA
                     PAAAVLAALADRHPAVRAYTGAQREHTLDDLTQIVEHLAVALYTGDAELFTAFTDWTR
                     HVLLARSVPDALLTSALSVLREHLRDLPRSVAILTAALAAAPPATPLTAAAPPRTDTA
                     RPTTGTPA"
     CDS             complement(583624..585237)
                     /codon_start=1
                     /locus_tag="KSE_05090"
                     /product="putative serine/threonine protein phosphatase"
                     /protein_id="BAJ26355.1"
                     /transl_table=11
                     /translation="MASSISSAAITDGDFLAGSPYPVALLGPDGRILHASDRARRLLA
                     DRDGTPGWLRRAHLALPDDGPRPRPVRHTDPMAGPVEAHPTRRPDGSAVWWFVSREDR
                     PAGPSPADGGGPHDWELLARLSGLLLSSLNADRVLETAARQAALHLADAAVLVAPGSG
                     RVLRLVTCLRGADPAHAQVRADPAEVPGLAEALRGFPPVPSRWIDPGAAPHWLVPDGF
                     GRVGSVLVTPLPGHGVPAGALVLLRTPAAGPFDPAEESFARMFAVRAGAAVSAAVMYS
                     EQAAVTDLLMRELLPPRLEHLDGVDFAGGYRASGDRDRIGGDFYDVHPAAEPGGETLA
                     LLGDVSGKGLEAAVMTGKVRNTLHALLPLADDHQRVLHLLNRALLTSRHTRFASLVLA
                     SVRREDDRVRVRLSAAGHPAPMVVRADGRVTESTTLGSIVGVLPEATTRTDTVLLDPG
                     EACVLYSDGITEAKGGPTGREQFGDHRLRRALAECAGLPAEAIVERVQMLAAQWLREN
                     RHDDMAVMVIAAPPRGHVPVIGRQRGLPE"
     CDS             585495..585875
                     /codon_start=1
                     /locus_tag="KSE_05100"
                     /product="putative antagonist protein"
                     /protein_id="BAJ26356.1"
                     /transl_table=11
                     /translation="MPVMTDHTHGAAGTGRRADVETVRARGELDWEDAQDFGQRLAAA
                     LDRRPRLLVVDFAEVTFADSSVLHGLLVARRRMAEDGGRLVLAGPLRAAVRRLIDLAA
                     AGSHLPVAPDMAAALRGDVPGSPV"
     CDS             585950..586363
                     /codon_start=1
                     /locus_tag="KSE_05110"
                     /product="hypothetical protein"
                     /protein_id="BAJ26357.1"
                     /transl_table=11
                     /translation="MSGAETDLTQRPGLPARPPVRTAAEARAAVTEALARCFPVGGRL
                     HGDACLAATELVTNAIRHAGGVTGFAVRADRAAGLTIEVEDAADAGPSGDAAHLDDPT
                     RLGGRGWPLVRLVSSHWEVEPLPGGGKRIRITLTG"
     CDS             complement(586611..587024)
                     /codon_start=1
                     /locus_tag="KSE_05120"
                     /product="putative sporulation and cell division protein"
                     /protein_id="BAJ26358.1"
                     /transl_table=11
                     /translation="MPAAVFRSFSVTLPESAYPDTRVAARLRFDPALPYGVELAFPPH
                     RPGGEEITWRFGRDLLAEGRLTPAGEGDVRVAPGPDGRILITLGALGPQAERALISTP
                     DTAVAAFLAEAYTEVPPGTETAHLDLAPGLARLLA"
     CDS             587296..587772
                     /codon_start=1
                     /gene="dps"
                     /locus_tag="KSE_05130"
                     /product="putative DNA protection during starvation
                     protein"
                     /protein_id="BAJ26359.1"
                     /transl_table=11
                     /translation="MMDIADGSPLNAHDRETAGEALQGALVDLVDLSLVGKQAHWNLY
                     GPRFRSVHLHLDEVVATARDYADQVAERAAAIGVSPDGRAATVAAGGLPGAPAGWQAD
                     TAVVEWLVEALGTVVGRMRERIAKTGDADPVTQDLLIGVTAALEEHSWMFRAENRG"
     CDS             587975..588814
                     /codon_start=1
                     /locus_tag="KSE_05140"
                     /note="Similar to Modulator protein RsbR in Bacillus
                     subtilis (P42409)."
                     /product="putative regulatory protein"
                     /protein_id="BAJ26360.1"
                     /transl_table=11
                     /translation="MAVEQASERLVELLTRDDAVQDQWVNAVAAALGARISRAELERE
                     LSDLYQALLQALDKGGLDWQGEAYSEVRALLVELSRSRARYGFTPTETAVSVFACKDV
                     LEPTSISTPEDITAYLQLTRLLDALGLFTIEAYARTREEIISAQAEQLLELSTPVVKL
                     WEDVVAVPLVGTLDSARTQVVMEKLLQSLVDSGSEHAIIDITGVPAVDTEVAQHLLKT
                     VVAARLMGAECTISGIRPQIAQTLVALGVQFGDIVTKATLADALRHVLQLSGAQAPAG
                     GAR"
     CDS             588811..589188
                     /codon_start=1
                     /locus_tag="KSE_05150"
                     /note="Similar to Antagonist protein RsbS in Bacillus
                     subtilis (P42410)."
                     /product="putative antagonist protein"
                     /protein_id="BAJ26361.1"
                     /transl_table=11
                     /translation="MSDRVPVLKIGQVLLVSIQVDLEDQVVLDLQDDLAERIVATGAN
                     GVVIDITALEIVDSFVGRMLANTAAISRMLDAETVVVGMRPAVAITLVELGLSLGGVR
                     TALTLEKGLALLERDRTARTGRP"
     CDS             589185..589601
                     /codon_start=1
                     /locus_tag="KSE_05160"
                     /note="Similar to Serine/threonine-protein kinase RsbT in
                     Bacillus subtilis (P42411)."
                     /product="putative anti-sigma factor"
                     /protein_id="BAJ26362.1"
                     /transl_table=11
                     /translation="MTGPRVEDEQRVPIGSNDDVVRARQTVRTYAQQCGLSLVDQTKL
                     VTAASELARNTLVYGGGGLMRCATVRSGARVGVHAVFEDSGPGIPDLDLALTDGWTSG
                     GGLGLGLSGARRLVDEFELHSEPGAGTKVSVTKWAR"
     CDS             589598..590842
                     /codon_start=1
                     /locus_tag="KSE_05170"
                     /product="putative protein kinase/phosphatase"
                     /protein_id="BAJ26363.1"
                     /transl_table=11
                     /translation="MTPPAAPAVALGEDTVWLRHSDSLPAAARNAARQLAHRIGLLPE
                     RAAEVALAVSEAATNLRRHAVDGAMVLRVVRTDAEAALEFLTVDSGPGMADVPAALAD
                     GYSSGPTLGIGLGAVSRLADAFDLHSLPGRGTVLAARFWNRTPSGRAAAAAGEPVAAG
                     LTRPMSGQELCGDAWAVRPAGGPPPPAADRRPVAAAHLDWAVLTNRAPRTHSPAGPRT
                     EAARTEATSTGAGPAGGDGRRGGGGAGDGAFLLMFCDGLGHGPLAARAAAEAVAAFHR
                     TSAHRPEEVLAELHRALRSGRGGAVAVALVEPAEARLVFCGVGNVSAFVVDPVGGTRR
                     ALPSSPGIVGHQLPTAHIVRQQLAPGSAVVLHSDGLTDRWRAPDVPGLFSHLPVTAAA
                     LLLREAGVRRDDAGVLVAKGAW"
     CDS             590839..592650
                     /codon_start=1
                     /locus_tag="KSE_05180"
                     /product="putative two-component hybrid sensor and
                     regulator"
                     /protein_id="BAJ26364.1"
                     /transl_table=11
                     /translation="MNAPEFPAPTEQAVPPVHLETVPVGNERDTFGLRRGARAVADLL
                     GVDGQDAVRLATALSELGRGLLGADRLAAAFDLVPGPPAALRVTLAWRGGHRLPAEAL
                     EASGRLLPTHHEYGGGSGLVRVEQRIGPVPGTLPDLAGLARDVLAGHTGHTGPSARED
                     SRSQTRDLIAALEHTRAQREELLRLNSELEETNRGVLALYSELSEELEETNRGVVALY
                     AELDEKSRQLRDASEAKSRFWANVSHELRTPVNAVVGLAELLRTDADAPAEERARQLS
                     LIADSGRTLLALVDELLDVAKAESGTLEPQWAPLDLRAVLSHLEGTLRGLARPGVALR
                     IGPAPDGTEALLGDETMLVRVLRNLLSNALKFTEHGSVRLDAVVEPHPDGAPDLVLTV
                     SDTGVGIPADQHERVFEEFYQVRGPHQRGRRGTGLGLPYARRLTEILGGTLHLDSVPG
                     RGTSITVRLPVHPVPPAGARLALLVAVDDDPVFREVLRPVLHGIADRVLEVPDGAGAL
                     GAIRAARPDGVVLDLHLGPVDGYQVLAGLRADPALRQLPVVVLTSASLSAAELGRLSH
                     ARAVLPKSALDGGRIAAALSAPRPAVPRRPLPPEDGS"
     CDS             592647..594284
                     /codon_start=1
                     /locus_tag="KSE_05190"
                     /product="putative response regulator"
                     /protein_id="BAJ26365.1"
                     /transl_table=11
                     /translation="MTPTSPDAGPATVLVLDDNDTTRYVVGSWLRRSGHTVVEAVDGA
                     QALALLERSPATELPELAVVDISLPDMTGFEVCERIKGAPRTAALPVVHISATAIEAS
                     DRTQGLHRGADAYLTEPIDPAELQATVTAVLRYTRARRRAERLAARVAALHRSTLALY
                     GATDPDALAGSAALGAVRLGAARATAIALGPDRDTLHLAHHDPGLPDGPEVRLFEAPP
                     VLLDLLAHHTLGDATGAGTALLDAEAWSAVLADHGLAGTGLPTGPVAVVTARTKPGRP
                     PLAVVVDGDALAAPDERDLLPQLTQAAALALEAQRSQAEEHALALTLQRSFLPGRLPA
                     VPGVELAVRYEPASARSEIGGDFYEAIDTPDGLLLAIGDVAGHSLEAAMAMGELRHAL
                     RAYAIEGHDPQTLLHRLDTLLTRLRPGLTATVCLVLIAPDRRSVRIANAGHLPPLLRL
                     PDGSARYLSEHGILLGLNVPQPPTTEYPVPPGSTLLLVTDGLIEVPGEHLQTGLDTLR
                     DAFADAPPELDRAGDLLLSAFARAQTDDIALLIARLD"
     CDS             594397..594753
                     /codon_start=1
                     /locus_tag="KSE_05200"
                     /product="putative antagonist protein"
                     /protein_id="BAJ26366.1"
                     /transl_table=11
                     /translation="MPEYDLTIDVRRHPVGATVVVLAGELDYHTAPRLHRAVERTAEA
                     LPLVLDLTLLRFCDSLGVAELIFAFRRTRAAGTSLALVGTTPDVGRLLAMTGLDRLLP
                     RHESVDAALGALRPDG"
     CDS             complement(594760..595539)
                     /codon_start=1
                     /locus_tag="KSE_05210"
                     /product="hypothetical protein"
                     /protein_id="BAJ26367.1"
                     /transl_table=11
                     /translation="MTRRHLTRPRAADPRAADLRLGERLLAAVAAFAVAAVPAALLLV
                     LVEANWAPLHRLDAGAARRLHAVVREHPAVLAVLRVLSDRVWDPTTMRLLVAAAVAWL
                     LWRRAWRLAVWAAATVTASGLLGWAVKAAVARARPALPDPVAHAPGFSFPSGHAMTAA
                     TCAAVLLLAASPALRPAWRLAARTVAGLSVLGVGFTRVALGVHWVSDVLGGWLLGLAL
                     VAATARAFEGWRRDTGRPVPPPFADGLEPELAPGGPARPEG"
     CDS             complement(595536..596546)
                     /codon_start=1
                     /locus_tag="KSE_05220"
                     /product="putative ribonuclease"
                     /protein_id="BAJ26368.1"
                     /transl_table=11
                     /translation="MGTASRVRPGSEHLSADEAVGTLRRREWWALARDAFVRFRYADG
                     FSHARALAFQVVLALVPFTIAVVGLAGSLHGGPVGRLVAAVIERMVPEPSSDLVREVL
                     DRGREHTGGTFALWFGALFALANLVTAMSQIERGANRIYGIERDRPFDRKYGRSLLMA
                     AGAGLPLGAGFLVLVAGPQLAAAADEVFGLGPRTATAWTLLRWPVGVLLTLTSAAVIF
                     RRAPRRRQPGYSWLAFGAGLYLVLWLAATWLLSLYLRLSGSFDAVYGPLSAVFSLLVW
                     AYLTAIALFLGLSFAAQLEAVRTARPGPIRPDPLAPSEQGSEQGSEHESEQGSEPGEE
                     DR"
     CDS             complement(596546..598222)
                     /codon_start=1
                     /locus_tag="KSE_05230"
                     /product="hypothetical protein"
                     /protein_id="BAJ26369.1"
                     /transl_table=11
                     /translation="MTRTKRRAPLLGALAAATVQGLLLFAMGVLVTHPPGGWWDPREE
                     TLVRRLAEHRTPALTTLSSWLSGLAFTPAIVAVTAAAAALLLLRRRPRPAALLAGAVA
                     LQATLFVTAAHLVGRARPDVLRLDGALPTSSFPSGHVGAATALYGGLGLLALRAPRGR
                     WRVPLCALAWTVPVLVAASRLYRGMHHPSDVLAGALNGAAALWVVWRALPPRAPRTPA
                     RHPARTDAPARADAPPTALVYNPLAVDDALLERLSAVLVAHGHRPPSRLPGDPDDCGR
                     AAAERALADGARLVAACGGDGTVTACAEALAGTGATLAVVPCGTGNLLARNLGLPVEP
                     VAALAAALDGRTRRIDLIRAEGDGLPARAAATMAGMGLDAAVMADTAPALKRRLGWPA
                     YLLAAVRHLADRRFAVTVRVDDAPPLRRRVRTAVVGNVGRLQGGVRLLPAARPDDGVL
                     DLVLIGPHGFLGWWRTLLSLLTGKPPAGPDAPLEHHRGHRIELTATRPRPRECDGDPV
                     GPGRTLVLTARPAALLVRVPGPAGPEPAAGARTAGTEPAAGARTARTEAA"
     CDS             598339..599556
                     /codon_start=1
                     /EC_number="2.7.8.-"
                     /locus_tag="KSE_05240"
                     /product="putative cardiolipin synthetase"
                     /protein_id="BAJ26370.1"
                     /transl_table=11
                     /translation="MTTTETAPVPAPVPAPDPLPADRGRALRRRLEGLLGIAATEGNL
                     LTPLRNGDEIFPAMLEAVDGARRTVDLMTFVYWRGDIARLFAQALARKAAEGLRVRLL
                     LDGFGCRLIEPDLLELMESAGVRICWFRRPVRLSPFKQNHRCHRKVLVVDGRTAFTGG
                     VGIAEEWCGDARNPGEWRDTHVRVVGPAVDGIAAAFAQNWAECAPGALYDAADRFEEH
                     EQPGDSVVQVVRGSAAVGWQDLQTLMRVVISSAERRLRLATAYFAPDDYFVDLLCAAG
                     RRGVAVDLLVPGEHTDKRVCQLAGERHFGRLAEAGVRVWRYGPTMMHAKVLTVDGTAA
                     LVGSANFNRRSLDHDEEVVLAVVDPEFTAVLDRHFDEDLARSEAVVPARWSRRGLGLR
                     ALEAATAPIRHFL"
     CDS             599629..599898
                     /codon_start=1
                     /locus_tag="KSE_05250"
                     /product="hypothetical protein"
                     /protein_id="BAJ26371.1"
                     /transl_table=11
                     /translation="MRRTTSVISVVAHAIAAILVIWILLDLFEANPDNSLVHWFHTAA
                     DWLAGWSRGLFTVSNRTAQILLDYGLPAVVYVVVGNLVTRGRALD"
     CDS             599938..600759
                     /codon_start=1
                     /locus_tag="KSE_05260"
                     /product="hypothetical protein"
                     /protein_id="BAJ26372.1"
                     /transl_table=11
                     /translation="MTATGTATGTGPGGGTSARAVRAAGRSGFVARGVVYALVGVLAL
                     RIAFGTGGEDADRQGALHQVALRPFGAVLLWVLAAGFLGMALWRAWTAVFGEAGERKT
                     GSRVLSAGRAVFYASVAWGTAAYAAGSGGGSDSDAASRDWTATVLGWPGGRWLVGAAG
                     LALAGVGVAIGVRALQRRFLRKLDTSGMRPRTRTAVTGTGVSGNLARGVLYAAAGAFA
                     AVAAVRFDPGRAKGMDDTLRALATSPAGPWLLAVVAAGLVLYGVFSFLSARWRRF"
     CDS             complement(600785..602332)
                     /codon_start=1
                     /locus_tag="KSE_05270"
                     /product="putative transporter"
                     /protein_id="BAJ26373.1"
                     /transl_table=11
                     /translation="MNTEKRSEKSGTPGTNGVNGAGAALLRRAFVHWRHDLPASLVVF
                     LVAVPLCVGVAVASGVPAERGLVTGIVGGLVVGLLPGSSLQVSGPAAGLTVLVFDAVQ
                     RFGLESLGVLVLAAGLLQVAMGLLRTGRWFRAISLSVVHGMLAGIGLILILGQLYAVS
                     GRTAPGSGGGKIAGLPGLLGDWFTGRAATTALLMGAATVVLLTLWKKLPGPVRAVPAP
                     LAAVALAAAATAVFGLDVPRVRVDGLLDAVALPTRDGLAAVTGLAGLGTVLAFALIAS
                     AESLFSAAAVDRMHHGPRTDYDRELTAQGIGNTLSGLLGALPLTAVIVRSAANVQAGA
                     RSKTARVLHGLWLLLFAALLPAVLGLIPLAVLGGVLVHAGAKLIPVAPTVTLWRGHRG
                     ELAVMAVTTAAIVFTTLFEGVLVGVALAVAKSAWQTSQLHIDLTDTGPGGPLRISLSG
                     NATFLRLPRLLDTLEALPAGRAVELDWTGLRHLDHACHTALHTWAARHSAHDPTTVSW
                     EPPLSVT"
     CDS             complement(602559..602921)
                     /codon_start=1
                     /locus_tag="KSE_05280"
                     /product="hypothetical protein"
                     /protein_id="BAJ26374.1"
                     /transl_table=11
                     /translation="MTGRGAAWGGRFAVLLAVALAAVLAVLTAGPPAQARMPRPPAAS
                     VAEEHVECGHQHEAQVPTGRAAGRHRANGGPPARTGARPDEDAATGVPRAPLPAGPVP
                     AAGGSRPAALARIQVFRC"
     CDS             603338..603718
                     /codon_start=1
                     /locus_tag="KSE_05290"
                     /product="hypothetical protein"
                     /protein_id="BAJ26375.1"
                     /transl_table=11
                     /translation="MLAVLLAALLHALVCAHGPLTGGATAADTLPAAAAHCAPTAVED
                     GTGRHTGHRAACADTDQPVTDRWQASPLTAPAELDGAAALPASAARPPSGAPRRSPAA
                     GADSGAGAGAGGGRGRAALGTWRT"
     CDS             603829..605022
                     /codon_start=1
                     /EC_number="2.5.1.47"
                     /locus_tag="KSE_05300"
                     /product="putative cysteine synthase"
                     /protein_id="BAJ26376.1"
                     /transl_table=11
                     /translation="MPQHTLPGPHPADPPAPSAAPDARYARSARTPAGLVGDTPVLWV
                     GEPFTAPGRGFWAKLEGRNPGGIKDRPALHMVRAARERGELRAGARIVESTSGTLGLG
                     LALAGVVYGHPVTVVTDPGIEPLVTGLLAAHGAETVVVDAPHPVGGWQQARRAKVREL
                     LAAHPGAWCPDQYNNPDNVAAYRPLALELVAQLGRIDTLVVSVGTGGHSAGIAGVLRG
                     RFPELRVVGVDTTGSTIFGQPALPRLMRGLGSSIHPRNVAYGLFDEVHWVAAPEAVWA
                     ARALAVSRYASGGWSVGAVALVARWLAATGSPEDRIAAVFPDGPQRYVGTVFDDPWCQ
                     AHGLLGHRPPERPDEIAHPGERVVTRWTRCRTVLDPLARRPLTETETEAGSGAGAGAE
                     TEAAR"
     CDS             605019..606293
                     /codon_start=1
                     /locus_tag="KSE_05310"
                     /product="putative major facilitator superfamily
                     transporter"
                     /protein_id="BAJ26377.1"
                     /transl_table=11
                     /translation="MRALWRQTRSFGPTARLLMANQFAINLAFYMLMPYLAAHLAGDL
                     GLAAWTVGLVLGVRNLSQQGMFLVGGTLADRFGYRAPIIAGCLLRTAGFALLGWVDSL
                     PALLAASAATGFAGALFNPAVRAYLAAEAGERRVDAFAAFHVYYQAGMLLGPLVGLAL
                     LAADFTAVCTAAAAVFAALTALQWRALPPRRERPEPARAGVLGQWRTVVANRPFLLFS
                     GAMIGSYVLTFQVYLALPLAAGLALDRNGGNGGAGAAATSGLFTVSAAVAVTGQLRLT
                     AWAKRVWTPSGALVRGLAAMGAAFLPLLAFPWAGTAARLAALGLAVAVLAAAGAVVYP
                     FEMDTVVALSGGRLVATHYGLYNTVSGLGITAGNLAVGALWDYGARHDALLLPWLALG
                     ATGLAGAAAVHRLSRAGLLRPSPAPEPALTGA"
     CDS             complement(606461..606982)
                     /codon_start=1
                     /locus_tag="KSE_05320"
                     /product="hypothetical protein"
                     /protein_id="BAJ26378.1"
                     /transl_table=11
                     /translation="MIDLDPAGDDFEPVRRAAAATRGLLDELGLPADLMTTGSRGLHV
                     LVRLDRRADFDEVRAFARDAAAVLARRHPALLTTEARKAARRGRLYLDVQRNAYGQNA
                     VTPYAVRALPGAPVATPLAWDELDDPALTARRWTIATLPERLAAPDPWQPARRARSLG
                     PARRRLERLERLG"
     CDS             complement(606979..607383)
                     /codon_start=1
                     /locus_tag="KSE_05330"
                     /product="hypothetical protein"
                     /protein_id="BAJ26379.1"
                     /transl_table=11
                     /translation="MTGTDLRAGGRTVRIERADKVLFPADGGTGALTKADLAAHYRRV
                     ARRILPRLRGRPLMLERYPDGIDGPRLVQKDTPGTSRSGSAAANCPRRAAPSPTPSAT
                     TWPPCSTSPAKPASPRTAGSPGPTGPTTPTCW"
     CDS             607644..607898
                     /codon_start=1
                     /locus_tag="KSE_05340"
                     /product="hypothetical protein"
                     /protein_id="BAJ26380.1"
                     /transl_table=11
                     /translation="MTVDAVVLAAESSGPPLLVVIVPALIVAVLLIGAFVWGSRRWNR
                     RRPPAGPGPAAGRADSWRTPDDREPERGTRPHGADDPSER"
     CDS             608017..608487
                     /codon_start=1
                     /locus_tag="KSE_05350"
                     /product="hypothetical protein"
                     /protein_id="BAJ26381.1"
                     /transl_table=11
                     /translation="MLVLCLGVMAGYLLGGLVTARAVFRQERERFLRAGGARTATDAA
                     DGGLVRRFERQERQQTEAFALCAGALWPVALPLLALHGLFGAVALDRGRTGVAARPDP
                     AAVAARIDELERELRLDAPAFPLPSPAPPSGGFRRTERTEQPAGAARARPRGSD"
     CDS             608491..608847
                     /codon_start=1
                     /locus_tag="KSE_05360"
                     /product="hypothetical protein"
                     /protein_id="BAJ26382.1"
                     /transl_table=11
                     /translation="MSEHESTAPPLNLGEQLLEQFLTAGRTLDPRDAPRFAEQYARAL
                     GLGSAAVYLAVLRRPIRYREHSDSEQGSRSDSEDHQDRADGPPIMPSTCANGLLNGCC
                     RRNGPLARHHADGFAA"
     CDS             complement(608812..609498)
                     /codon_start=1
                     /locus_tag="KSE_05370"
                     /product="hypothetical protein"
                     /protein_id="BAJ26383.1"
                     /transl_table=11
                     /translation="MGRLDEAVTHGAGALALCRALATAIGGVDPTGPMSCPHAEIQAL
                     TGRLLAQDAADPAGLAEPRLTMYGLYAVLGLHTLQEEESHLSPADTAPRPPDRPPGGP
                     GGPAVGGGARQSPGKGSGPSRIDLGEQCPNALGVVEGVFGIFGAMLDPARLLPPQGSR
                     PSPAPTVALAAVGTAPARESGLADCQVRSAKVSIGLSTPCSTCPHRGIEAPAAARCRS
                     RGEAVGMVPG"
     CDS             complement(609565..609765)
                     /codon_start=1
                     /locus_tag="KSE_05380"
                     /product="hypothetical protein"
                     /protein_id="BAJ26384.1"
                     /transl_table=11
                     /translation="MLGGALWQVGRYAEVPEHIDRAVESCHDAGATLRLAEVLAVRTI
                     GDGARNGFTDESVTALHGVLAM"
     repeat_region   611758..611760
                     /rpt_type=flanking
     repeat_region   611761..613046
                     /note="IS candidate"
     repeat_region   611761..611786
                     /rpt_type=inverted
     CDS             611817..612137
                     /codon_start=1
                     /locus_tag="KSE_05400"
                     /product="putative transposase"
                     /protein_id="BAJ26385.1"
                     /transl_table=11
                     /translation="MMSIMESMGKKKPRPRRAFAPEFKAEIVELCRRGDRSVGQVAKD
                     FDLTETAVRDWIRQGEVDAGERDGLTSDEREELARLRRENRRLREDVDILRRATAFFA
                     KETR"
     CDS             612134..613006
                     /codon_start=1
                     /locus_tag="KSE_05410"
                     /product="putative transposase"
                     /protein_id="BAJ26386.1"
                     /transl_table=11
                     /translation="MTLHPFIEAEKRGGHNVKRACELLKVSRAAFYARRTADPGPRAV
                     RDAELAEKITEVHSASRDSCGAPRIHAALRRDGDRCGRRRIARLMRQAGLEGRHRKRR
                     HRTTIPDLQAAGRPDLVLRDFTPDRAGLDARWCGDITYIPTGEGRLYLATVIDIASRR
                     VVGWAAADHLRAELVADALRTACQTRRPSGTALFHSDRGCQYTSREFAIMASEFGIRL
                     SVGRTGQCWDNALAESFLATLKRELPGDRPWPSRAAARTAIFEWIEGWYNIRRLHSSL
                     GYRSPAEYEAALAA"
     repeat_region   613021..613046
                     /rpt_type=inverted
     repeat_region   613047..613049
                     /rpt_type=flanking
     repeat_region   complement(613201..613838)
                     /rpt_family="CRISPR"
                     /rpt_type=tandem
                     /rpt_unit_seq="CTCGGCCCCGCGCTCGCGGGGGTTGCTC"
     CDS             complement(613848..614126)
                     /codon_start=1
                     /locus_tag="KSE_05430"
                     /product="putative CRISPR-associated protein"
                     /protein_id="BAJ26387.1"
                     /transl_table=11
                     /translation="MTVIVLIAAPEGLRGHLTRWMVEVHAGVFVGNPSRRIRDRLWDL
                     LATRIGTGQAILVEPATNEQGWTVRTAGTDRWKPVDFDGLILSARPTR"
     CDS             complement(614123..615157)
                     /codon_start=1
                     /locus_tag="KSE_05440"
                     /product="putative CRISPR-associated protein"
                     /protein_id="BAJ26388.1"
                     /transl_table=11
                     /translation="MADIWWKAHPHDLHRLSDRVSSVYVERSHIDRDENAVVVINKRE
                     TVRIPAAMVAVVLLGPGTRITHGAVNLLADSGTTVCWVGEQGVRMYAAGLGPSRGAGL
                     LNRQAWLVSRTKERLAVARAMYRMRFPGEDVDTATMQQLRGREGARIRKLYQAHARRT
                     GVPWNGRVYQPGDAHAAGDDLNRLLSAANAALYGICHAVITGLGASPGLGFVHTGLAT
                     SFVLDIADLYKADYTIPLAFDLTARGHTEERDARLGLRDRIAEDRLLGRIVRDVKALL
                     TPDGIDLDDQDVNQLWDEKVGTVQGGVNWSAESAGSVLRAIDPGMGDENEHLAIIGPE
                     FDNDPKQPPR"
     CDS             complement(615161..615928)
                     /codon_start=1
                     /locus_tag="KSE_05450"
                     /product="putative CRISPR-associated protein"
                     /protein_id="BAJ26389.1"
                     /transl_table=11
                     /translation="MTYLSRVRINPLRAASRTLLANPRALHGAVQAGVPDQAPGDRIL
                     WRLDTDQPRRPQLLVLTPGKPDWTHLVEQAGWPDAEGEHYAVRDYSPLLAQLALGREY
                     AFRLTASPVQNTSKPTGGSTHRTRTAEELQHRSYRLPHRTAAHQLAWFLDRTTRWGFT
                     VPEARTDTPAPGLGTPDGDGEAAREVRITDRDRRTFTKPGTRTPVTLTTATFEGHLRI
                     SDPDLLKTALLEGIGPSKAYGCGLLTLAPLPGTGTAR"
     CDS             complement(615937..616770)
                     /codon_start=1
                     /locus_tag="KSE_05460"
                     /product="putative CRISPR-associated protein"
                     /protein_id="BAJ26390.1"
                     /transl_table=11
                     /translation="MPADTTPQGDRAVLLLRLAGPLQSWGDRSAFNRRDTTPQPTKSG
                     VVGLLAAAAGRPREADLTDLVGLRLGVRVDQPGTLLRDYHTVSDYRGLPLPQAGVNAK
                     GVQKPTSPSKHTHVTHRYYLQDAVFLVAVEGPAELVTALGEAVTRPAFPLALGRRSCT
                     PTQPLSLGVRRGTPLETALAEEPWQANEPTRKAHERQAKRGQAPRRTDRVDLAASFDD
                     PHGDDTCRDVPLSFDPRRRGFGTRKVRHAWLSVPTGLRAALPTEPPADGGHDPFALLG
                     W"
     CDS             complement(616770..617918)
                     /codon_start=1
                     /locus_tag="KSE_05470"
                     /product="putative CRISPR-associated protein"
                     /protein_id="BAJ26391.1"
                     /transl_table=11
                     /translation="MPSRPRLYIDVHILQTVPPANLNRDDNGSPKEAYFGGKRRSRVS
                     SQAWKRATRLHFAERYEPQDLGTRTKRIAGKLAERLAARAGAALSAEDAQRVAGALLK
                     PMGIAAGKKAGDTAYLLFYGRRQLEGIVDLVAADAAELAALDDQQLEERVKNLPVREQ
                     LQQGHPVDVALFGRMVADIPGLNVDAATQVAHALSTHATELEFDYYTAVDDETGDEET
                     GAGMIGTIGFNSATLYRYATVGLHQLTDNLGEEKTAVEAVDLFVDSFARSMPTGYGNS
                     FAHRTRPSLVAVVVRTDQPVNLVSAYENAVPAGDGILAESARRLAAEYRTATSQWGDE
                     PLHTAICHTLDAASPETAALAEAFGANRTFAELREGLRTALTERTATR"
     CDS             complement(617984..618586)
                     /codon_start=1
                     /locus_tag="KSE_05480"
                     /product="putative CRISPR-associated protein"
                     /protein_id="BAJ26392.1"
                     /transl_table=11
                     /translation="MTTDQPTARRRYWDEYTAPDHGWRIDGPSKQPRRPPGEELAALR
                     SGLGRPVMDSPKMWPYYSTEVGDVLALRDRVSDEQQAEHAALALYGLHQQGQSRPMHR
                     SGVKLGRALRELRRDGKYSENALDARVAQLAAATSVPALLVHLRGLVTQLRTVGQPLD
                     YDHLMADIRAWHQSERRPQVRLKWALGYRAWQSKTPDDDE"
     CDS             complement(618576..620288)
                     /codon_start=1
                     /locus_tag="KSE_05490"
                     /product="putative CRISPR-associated protein"
                     /protein_id="BAJ26393.1"
                     /transl_table=11
                     /translation="MPKYNLVDEPWLAPRPLDGGPPVHLGIAEALTRADEFDGLSVDF
                     ATQLPAVLRQVLLPVLVAALGAPATAAAQGERLARGEFSAQEKERLLAYLAAHRARFE
                     LFDESAPFAQVAGLRTAKDETKGTAALVATAASGNNVPLFASRSDADPLDLTPAQAAH
                     WLLHTHCWDTAAIKTGVVGDDQAKAGKTTGNPTGPLGQLGVIVPMGRTLYETLQLNIP
                     VTAAANLGKPQWERPPATPAWEQRPADGLLDLWTWQARRVRLIPEQDEAGGTKVTRVV
                     ISAGDRLPATPEWEPHTAWTFTPPAKKASSRAPERRPRRHAQGKAAWRGLEALLAPVR
                     QNDGGVFETSVLLDQIGALQEDGRLAADYPLRVETFGMVYGTQSAVVEDVVHDAIPLP
                     LLALHQDGETRLFLLDVAEQAEQLARALNNLSADLRRAVGTDPIPWDKGQRPGELLLH
                     VLDGLVRRVLAGAREAGGDEDRLERGRFAWEEAAAWRTWEHADALLAVAPASAFAGRT
                     VSQTGKPGKTHTFSLGTAADSFSREAARILPRHAHTARTAVRDRAGAPEDTVKTPSGA
                     RVDH"
     CDS             complement(620511..623372)
                     /codon_start=1
                     /locus_tag="KSE_05500"
                     /product="putative CRISPR-associated helicase"
                     /protein_id="BAJ26394.1"
                     /transl_table=11
                     /translation="MSRWGLSGEAAGWLGALWGKSAGKAGGTANLLISHMLDTAAVAE
                     VMWEEYLPPVTRRRLDVIAGGRGRGRLLFVWLCGVHDLGKATPAFQFMDAAGAAAVRA
                     AGLRWNEYTLAAGKKWRHDRAGGRLLRRLLAGAGWSEEQTAWVWPLVAGHHGTIPTVG
                     DLAPPKKNEEFQGRGAAWQEAQAALLEVFSREVGFGGECLLAEVQPCEVPPRAVQLQL
                     SGFVVMADWIASNEQHFHGVADLAQVSMEGARRRSRAAWSALQLRGGWGQLEFSGPEF
                     FQDRFGDGPRSSQQMVLDAVYRMGGPGLVIIEAPMGEGKTKAALAAAEVLAARSGADG
                     VFLGMPTQATADPMFTQVRSWLGKIDERLAGQVALLHGKRIFNKEWRALLDGADGFGA
                     QDCYGSVGEDEYGMTWSFGEDESEPQRRGPSEWFLGRRRGLLSPFAVGTVDQLLQAAT
                     RTKHVMLRMAGLVGKVVILDEVHAADVYMSQFLLEGLRWLGQAGVPVLLLSATLPPGQ
                     RRDLVAAYLAGAQSAETLPEIELPQPGGYPNVTTAWVGEDGPQLLVDSTDPWREDLKV
                     KVRVLDEPVVDQRSEDPSGPTAEAVAEFLQDQLVDGGCALVIRNTVDRAQRTFEALCA
                     KFGDQEVHLLHGRLHAGHRADRTAAVLEALGRRDDGRPRPQRMVVVATQLAEQSFDVD
                     ADLLVTDLAPIDLLLQRIGRLHRHDGNPRPSKLTHPTVVVTGLRRAGGGVPWLLRASE
                     GIYGRYPLLRTAAEVIAADGGGWSIPGQVPQLVARVYGTDRIVPSEWAEEESTARKLW
                     NENRSKRREAAAPYLLVRAGEHGQPTLEGLHYGGQGVLRDGQMEALVRDGDPSVEVLL
                     VRRAGEGYRAMTGRALGPNGETAAELLDDVLTGTVRLPAKLTAAVEQHALGPLPGWRD
                     HPWLRYGRALELDERDEARLGGCRLRYDDRLGLVVTGRP"
     repeat_region   623530..625875
                     /rpt_family="CRISPR"
                     /rpt_type=tandem
                     /rpt_unit_seq="CTCGGCCCCGCGCTCGCGGGGGTTGCTC"
     CDS             626003..626344
                     /codon_start=1
                     /locus_tag="KSE_05510"
                     /product="hypothetical protein"
                     /protein_id="BAJ26395.1"
                     /transl_table=11
                     /translation="MSDLKMFRLGVDSRDVEVRGSTVALEVELQRRVEAGMERMLGIR
                     FLASEYPTGPWHRGRVDSLGMDENGSPVVVEFKKGSDSGVVSQALSYLTWLKSSRLEF
                     EALVRATTADR"
     CDS             626394..627044
                     /codon_start=1
                     /locus_tag="KSE_05520"
                     /product="hypothetical protein"
                     /protein_id="BAJ26396.1"
                     /transl_table=11
                     /translation="MTGLRLFRVDGGSAEEVAGSEVELERHLQTLIEQNMGTMLGVRF
                     LASEYSTGPVHGGRIDSLGLDEDGSPVVIEYKRSRSENVINQALFYSAWLRDHKAEFE
                     ALVARQLGTEAADGVDWSGLRIICVASGYSRYDVHAIGEMNRRIDLVRYQQFEGDILA
                     LELHASVSSGPSALTRSQVDGNSRATGGPGRKTVREAIERASLGSVVKVILGNGSW"
     repeat_region   627006..627018
                     /rpt_type=inverted
     CDS             627031..627429
                     /codon_start=1
                     /locus_tag="KSE_05530"
                     /product="putative transposase"
                     /protein_id="BAJ26397.1"
                     /transl_table=11
                     /translation="MDHGEVIRRHELSDAEWGLVEPLLPRPGTGRPRLDDRTVLNGIV
                     WKFRTGVAWRDVPPRYGSWATLHTRFRRWAEDGTFDRMLRAARAKADAAGDIDWLVSV
                     DSTVVRAHQSAAGARKGGPETRRSAAPGAD"
     CDS             627477..627878
                     /codon_start=1
                     /locus_tag="KSE_05540"
                     /product="putative transposase"
                     /protein_id="BAJ26398.1"
                     /transl_table=11
                     /translation="MVLTGGNTNDCTQFTAVMNAIRVPRIGPGRPRTRPDHVLGDKGY
                     SSKAIRTWLRQHGIGHTIPERADQIANRLRRGSRGGRPTAFNRRLYKHRNVVERCFNH
                     LKQWRGLATRYDKTAVSYQAAATLASLLRGR"
     repeat_region   627867..629227
                     /note="IS candidate"
     repeat_region   627867..627889
                     /rpt_type=inverted
     CDS             complement(628270..628797)
                     /codon_start=1
                     /locus_tag="KSE_05560"
                     /product="putative transposase"
                     /protein_id="BAJ26399.1"
                     /transl_table=11
                     /translation="MIIDTRSVRVAAGVPKATTGLDANKKTPGRKRGLAVDVLGLVIG
                     VVVLAASAHDNEAGIALLDQAAVRCGMRLEKALVDQGFKDAVIIHGAVKDIIVEVVRR
                     NPDDAGKGFVPQPKRWVVERTNGTLMLHRRLARDYDHRLDNAASRVYWASTAGMLRRL
                     TTPSPAWRDDVEPAA"
     CDS             complement(628813..629124)
                     /codon_start=1
                     /locus_tag="KSE_05570"
                     /product="putative transposase"
                     /protein_id="BAJ26400.1"
                     /transl_table=11
                     /translation="MERMPYSTDLSDGQWALIEPLVTAWKQERVSRSATGDPGSCDLR
                     EVVNALLYQNRTGCQWRLLPHDLPAWSAVFYYFTLWRQDGLDQRIQEILRCQVRERAR
                     R"
     repeat_region   629205..629227
                     /rpt_type=inverted
     CDS             629360..629728
                     /codon_start=1
                     /locus_tag="KSE_05580"
                     /product="putative Hit-like protein"
                     /protein_id="BAJ26401.1"
                     /transl_table=11
                     /translation="MTTSAPQAPKVSDFYCDEALNGRTPVKVVEETDSVLAFEHTRPS
                     YPVHIVVVPKKHIPSLVNLGDGTEEDLVDVFRVVRAVAARVREEYGAACVVTNEGVYQ
                     ESKHLHVHVLFRGDLPEGLA"
     CDS             complement(629741..630835)
                     /codon_start=1
                     /EC_number="2.4.1.227"
                     /gene="murG3"
                     /locus_tag="KSE_05590"
                     /note="protein synonym:undecaprenyl-PP-MurNAc-
                     pentapeptide-UDPGlcNAc GlcNAc transferase"
                     /product="UDP-N-acetylglucosamine--N-acetylmuramyl-
                     (pentapeptide) pyrophosphoryl-undecaprenol
                     N-acetylglucosamine transferase"
                     /protein_id="BAJ26402.1"
                     /transl_table=11
                     /translation="MNRKIGITGGASAGHVVPALAVAAELRRAECELVYFGRAGSIEA
                     DLAAKAGIRLAAVPSAGLQRFRSWSNLAMPLTVARGVFAAWRALRRERPDVVFSKGSY
                     VSVPVGIAAWLTRIPLAIHESDHTLGLANRILARFATSVFLAEDTPGLPRWLSRKTVV
                     TGLPLRDDLADGRPEDFRARLGIPAGPPVLLVFCGSSGSQRVNAAVRRQLGGLTRHFS
                     VVHICGRGNLDPALASAPGYWQQEYLHGDMVDALTLADLVIGRAGATTLAELHALAKP
                     AVLVPLPASVSRGDQLDNAKAYARHATCLVVADEEMADGTPLLRACEQLLPALGGNRR
                     RPAPEAVRRTARDIAARTIALARPRGRHAR"
     tRNA            complement(631024..631098)
                     /locus_tag="KSE_t0002"
                     /product="tRNA-Thr (AGT)"
     CDS             complement(631239..632909)
                     /codon_start=1
                     /EC_number="6.1.1.15"
                     /gene="proS3"
                     /locus_tag="KSE_05600"
                     /product="putative prolyl-tRNA synthetase"
                     /protein_id="BAJ26403.1"
                     /transl_table=11
                     /translation="MTTAPAPLFASRLFPTPRPRATDPTAPTKDLLEHLGLVGRTDTT
                     GVHTLLPLGLRVRDQLDRITRDAFERNGFNSLALPTLQSRTLWEESGRWKVYTAEGAL
                     VTTRVGGADMCLAPTSEEMATATVRSHLRSHRDLPVRLTLNTTKFRDELSPRGGLMRG
                     REFTMADAYTFDPDRAGMLESVRLLNRACTDALTGIGLHGVFQAPADGGAISAGPTTE
                     HLVLADFGQSSILACDHCGHRGDGTVLTAAFPRTAPRGEPVVNVIVFAVTGPDDATRP
                     TAVCIRSDLTISVRKLTAALGSGHHVELLDPDELPALLGKAAGTLTPWDCTGIDVLHD
                     HSVTHLERFTIADGPDGLRTGASWTGATGLAPLALYPADVHTAADGLDCGRCSAGRYR
                     ATEAVEVAHVFELGTQYSGKMHLTFTDDNGIQRTPYMGCSGIGLTRCIQTLAGIHRDA
                     NGLRWKPGTGPADVHLVVLRSDQAEQQERTDRTARRLQQLGLRLLIDDRPLPAGEKFH
                     YAQALGVPTALVLSPQRADGELEAIDRWTGRRSTITSDQLHTLLRSAA"
     CDS             complement(632906..634033)
                     /codon_start=1
                     /locus_tag="KSE_05610"
                     /product="putative glycosyltransferase"
                     /protein_id="BAJ26404.1"
                     /transl_table=11
                     /translation="MSATARLRITTGIDLPLAPSCGSMIFCSDLYREMADRARTTFLA
                     LPPADPAWQHGFEETVFATAAKAPYGPGFAAYVDALTGEVRRHLDRARPDVIHAQHLG
                     FGLSLAFVRAAQGTPVVAIAHGTDVIAADADPLARDVLTEIVAGATTVVAPNHALAER
                     IGDLTGHRYRDKMALVPWGIPLARAARTVPATHTDTRPLRLLHAGRLDANKSTRTAVE
                     AMALTDHRHELTVIGSGPEQDALQQQARDLGLTGRVRFEPFAPRDALWQRFADFDAFV
                     FTTSGLEAFGLVAIEAQAHALPVIYSDVAGMTRTLGAAGLPYTPGDAADLAQVIDKLA
                     ADRTLRAELSTAGLANGSCYGIVHSAHRLDQVTRDAIGAAA"
     CDS             complement(634030..634776)
                     /codon_start=1
                     /locus_tag="KSE_05620"
                     /product="hypothetical protein"
                     /protein_id="BAJ26405.1"
                     /transl_table=11
                     /translation="MNNRLYIEQPPFAPWLGFCEALFACSTVALYDNVQYEDGGFQNR
                     NRIKTPDGVKWLTVPVVKNHGQLIKDVRIADAFDPNKILRQVRLAYGRSRHLDEVLQV
                     LAPVLGAGHRWLLDLNLDLSTGLVAALGAPARLTLTSRLPIEPTADRASRIARICQAA
                     GADELWAGSGTRGYLDPADLAADGIAVTWNEYLPRHPVYEQAWPQQGFTPNLSVLDTA
                     SAIGWAGTSALLRNGLAAYLDSLQQEGQPA"
     CDS             complement(634773..635471)
                     /codon_start=1
                     /locus_tag="KSE_05630"
                     /product="hypothetical protein"
                     /protein_id="BAJ26406.1"
                     /transl_table=11
                     /translation="MAAPPEHVVAVVAHPDDAELMCYGTLLRYREQGAAVTVVVVTTG
                     INGVSLADRGLGVSLTGRERTDESAASYAGSGIDLVTLGFTDGALVPDRELVSHIEAE
                     LARLGCTVLITHSLHAGPDHQDHLAAAQAAVNAATRIGTCATILHGQPHAPRGDFHPT
                     VLVDITDLLPDKVKALAAHRSQAGRWYLGAEFTRHRAAEAGWSLAPVRAAAGRRFEAF
                     ETSLISLLAPEGDR"
     CDS             complement(635455..636015)
                     /codon_start=1
                     /EC_number="3.5.4.13"
                     /gene="dcd2"
                     /locus_tag="KSE_05640"
                     /note="protein synonym:dCTP deaminase"
                     /product="putative deoxycytidine triphosphate deaminase"
                     /protein_id="BAJ26407.1"
                     /transl_table=11
                     /translation="MILTGPQIGAEVEEGRIAISPFDASLLSPNSYDFQLSSDIGWYA
                     RHWWGGHTLDCRRPNPFVRATIPEEGMVLRPGRIYLASTAETIGSEHFVPIIRARSST
                     ARTGLFVHCTADLIDLGSLGRLTLQFHAVQPVRVYPGQRIGQVTFWVPTGRRELYRGK
                     YQGSTLPEPSQIWRDFRAEDPRGSSA"
     CDS             complement(636012..636566)
                     /codon_start=1
                     /locus_tag="KSE_05650"
                     /product="putative hydrolase"
                     /protein_id="BAJ26408.1"
                     /transl_table=11
                     /translation="MILTGSAIADAVQAGHITIEPFLPQHTNPNSHGYRLGDTLKVFT
                     RTPVDPRTSPPTRTVTIPARGYRLRPGRVYLGSTVERIGSDRYVTSLIGRSSVGRLGL
                     FTQISADLAQLGAVHRWTLEIVVTQPLRVYAGMVIGQVSFWDAVGDHMPYGGYYGTLS
                     DPSPFAPHALAGGAAVPFPEVSAA"
     CDS             complement(636563..637369)
                     /codon_start=1
                     /locus_tag="KSE_05660"
                     /product="hypothetical protein"
                     /protein_id="BAJ26409.1"
                     /transl_table=11
                     /translation="MTAPQPLPAAGFLNRPTAPRAFAEHITGDGDGRALVAFDPADHR
                     LNQELALGLLSALGPVPAVYPADGCWSSLQVRTEADPGRTHGTGENQLHVDLVDRDLI
                     PRYIALYCEREDPAGGGASALADLRAAATELGDTERALLQQPVFSYWTDQGVHGVGDP
                     LERFAVLPERLEPGLPIRFTSKMRPHLLRGELLEGTGSARQETAAAFGALADAALRHR
                     TTVRLRPGQLLVFDQLRWAHGRMPLGEGQEAIEPGRRRLLRQAYVQGGAR"
     CDS             complement(637366..638577)
                     /codon_start=1
                     /locus_tag="KSE_05670"
                     /product="putative phosphodiesterase"
                     /protein_id="BAJ26410.1"
                     /transl_table=11
                     /translation="MLSVDEALGINTVTVVATGCFHSAVPDSTGMLAEVRALREQGAL
                     VVDVGDFFGGSAFHEYSRGRTEERLLADLYDAVVPGNHDLVDLMRLHEPERFPPVVCT
                     NLTPPPAFAGRWERGLLLEAAGRRIGVVGVLGVQAFGAVPAAERDGFVFEEPTPALLT
                     AERDRLLEAGADVVVGLSHSGFEADVALQLAGGPLEIVVAGHCHSPTGHWAIPPRYVV
                     KPPECGTGVLRIELGPAEPSFGIEYTGGREAPRGLVPPYVREAVGAFRAWGSTAIGHL
                     AAPVHDRHRLAELVAERGRRAAGADAFVLNLATLRTGLPRHVDRQALVAAAPFDTALV
                     VLDGPRTAEQVAALAEARGESPVTAGTTIRPGTVATTAYLAERLGLPARALDSPRTLR
                     GLLTDHVKEAS"
     CDS             complement(638571..639179)
                     /codon_start=1
                     /locus_tag="KSE_05680"
                     /product="hypothetical protein"
                     /protein_id="BAJ26411.1"
                     /transl_table=11
                     /translation="MPPGATAPPTGENPVVAELRGGDFRARRDLGQHFLRSPGIATRL
                     LELAGLHAGDAVLEVGAGLGTLSAAVARAGHRIWAVEKDPRVAEALCAALEPYGERAR
                     PLLSDVRAVDLDRELPVGTVFLSILPFDWPLAFGIAAHVFGSTAKVARGLAVLPAATV
                     DHTAAGDWFGAGLRLEEVDGISRDDFWPQAAVPLRVVSITRC"
     CDS             639549..640982
                     /codon_start=1
                     /locus_tag="KSE_05690"
                     /product="hypothetical protein"
                     /protein_id="BAJ26412.1"
                     /transl_table=11
                     /translation="MTLGESQSGGEATAAGERPGTVLAEALKIADWSPRDLVRVINGQ
                     LAGLGERRLDLTAAHAWSRGAVPRSETVRRLAATVLSDRTGRSYSQAMLWGRPEPVAR
                     SDERTVTDGLLGRHSLPAVLATATAWNSIDPATQATLRSADDLFIAVWDADRQAVHST
                     GRESGTDHVLPPMMAVLESHLADLRRLDDATGGGAISQRYVRTALDGVLALLRNSRYT
                     PDIGTRLLRTAAGLAQLAGWMAFDADLSPSGQRYQLLAIRLARASADHDTVANVLGML
                     AYQHAAGGKATAAIRFAEAAVETAARSVPTVRARALGRLATAHAAAGDIDAFRTSTDR
                     CLAYLEHRRDDDPPSLYYFTAEQVAAENGQGLVDLAAANPGRCRRLLAEAHGLLSPLT
                     AHGPTSGYTRSALLHGVHLARAHLLAHDTEATLDTLGRLTAYVPAVQSVRCRNLLTDL
                     RRHAGSRIKSPTGIDALDRIDRALSGL"
     CDS             640979..641482
                     /codon_start=1
                     /EC_number="2.3.1.-"
                     /locus_tag="KSE_05700"
                     /product="putative acetyltransferase"
                     /protein_id="BAJ26413.1"
                     /transl_table=11
                     /translation="MTPTGLARPAVTAAALSTVPYDHPEAQRLTSALHAEQLALYGFA
                     DDPRAADPAHFVPPNGLFLIAHADGHDEALGCGGWHLVAPGTVEIKRMYVSPVARGLA
                     IGSAILRGLEQQARGIGARRAILETGSRNLAALALYAHLGYQPIPSYAPGRDPLVNRA
                     LAKQLTV"
     CDS             complement(641499..642086)
                     /codon_start=1
                     /locus_tag="KSE_05710"
                     /product="hypothetical protein"
                     /protein_id="BAJ26414.1"
                     /transl_table=11
                     /translation="MEREFDGEGAVGVARLLFEAGSLRALPRTGWRQDGIPLAATETV
                     AEHSHRVAVIAAALAALEGADPNRTALLGTLHDVPEARTGDLTPLTRRYVTAADPRKV
                     VADQTAAAPSAVRGLFADAIAEFEEGTTPEARCAKDADKLDCLLRAVEYRAAGVPAVQ
                     GKIDRCRAALTTASARRIADAALALDPSDWQVAPA"
     CDS             complement(642107..643204)
                     /codon_start=1
                     /locus_tag="KSE_05720"
                     /product="hypothetical protein"
                     /protein_id="BAJ26415.1"
                     /transl_table=11
                     /translation="MKGDTVSAKAPSIGLVSGYLLRLVRESIPRTQEGLAESLGLDVG
                     TVQGWESGRRPLPHLRTGDYLDLHRRLALLGADPLLLAHSGAALDADRVLAAVLDPPA
                     ETGRHPLAGWVQPRDTALLIAWALRGTPPPALAARASRPRRGPARPGPLLPAADRARF
                     FTNLRATAERATAGGHGGLLHRQTLYLASYDTAPDAAAWSEQALRGMRPALGRRGYGP
                     RSIEARTVATVAARQGDPDQLRHFISTALLDDEHGELANLAYWALWLGAMPADQSDDG
                     FMHRPDPASWDPIRLFRALVSSFHLAPGTVDLYVHSISTLLRLYPWLPHAAPDADQAF
                     GAFTVQLLDGALISPTSRRDLGRLRYGRADG"
     CDS             complement(643412..643717)
                     /codon_start=1
                     /locus_tag="KSE_05730"
                     /product="hypothetical protein"
                     /protein_id="BAJ26416.1"
                     /transl_table=11
                     /translation="MAAGARQRDPPVRPGQRGAAARAHPPLPPHLAGHYLLTGYTVTP
                     DHLRTALTPLLAGPDRCAAIAARAREHGRPDAAQRLVDVLFRAVASSRTKPSSGPLR"
     CDS             complement(643606..643740)
                     /codon_start=1
                     /locus_tag="KSE_05740"
                     /product="hypothetical protein"
                     /protein_id="BAJ26417.1"
                     /transl_table=11
                     /translation="MLVPAVLPWLLERANVIHQCGPANEAPLREHTRPCPRTLPGTTY
                     "
     repeat_region   643956..645316
                     /note="IS candidate"
     repeat_region   643956..643978
                     /rpt_type=inverted
     CDS             644059..644370
                     /codon_start=1
                     /locus_tag="KSE_05750"
                     /product="putative transposase"
                     /protein_id="BAJ26418.1"
                     /transl_table=11
                     /translation="MERMPYSTDLSDGQWALIEPLVTAWKQERVSRSATGDPGSCDLR
                     EVVNALLYQNRTGCQWRLLPHDLPAWSAVFYYFTLWRQDGLDQRIQEILRCRVRERAR
                     R"
     CDS             644386..644913
                     /codon_start=1
                     /locus_tag="KSE_05760"
                     /product="putative transposase"
                     /protein_id="BAJ26419.1"
                     /transl_table=11
                     /translation="MIIDTRSVRVAAGVPKATTGLDANKKTPGGKRGLAVDVLGLVIG
                     VVVLAASAHDNEAGIALLDQAAVRCGMRLEKALVDQGFKDAVIIHGAVKDIIVEVVRR
                     NPDDAGKGFVPQPKRWVVERTNGTLMLHRRLARDYDHRLDNAASRVYWASTAGMLRRL
                     TTPSPAWRDDVEPAA"
     CDS             complement(645226..646260)
                     /codon_start=1
                     /locus_tag="KSE_05770"
                     /product="hypothetical protein"
                     /protein_id="BAJ26420.1"
                     /transl_table=11
                     /translation="MATTGLTRGMGSFFKECEHPESRWTRCPHEYKIRYRNAAGQQTE
                     ESGFATQEKARTRLAEVYHARKNSPQSQRKAERVQKYGGTHFSAYTAEWLKGQRHQAP
                     SSLRTIESNLRNHLLPVFGSRRMGTFDHKVVEAFIETMERNNVGLAAQKQAFVRLRTI
                     LLDAHRLGLYEGSPLDGVQPPQYDPKRAVIPSLAQLAVVRTAGDDAFNLVAELMSGCG
                     LRNGEALAVNIDNIVADDVYRVTEQVNHATKTYARLKHRKVDEYRDVPLPARTKRAIE
                     QYAHTHGAVDGYLLRNPKDINQAMPHYIISNQWRKIRVSEGVKSVSGSGRVRVGRGFP
                     GGRVVPGGSG"
     repeat_region   645294..645316
                     /rpt_type=inverted
     CDS             646382..647437
                     /codon_start=1
                     /locus_tag="KSE_05780"
                     /product="putative serine/threonine protein phosphatase"
                     /protein_id="BAJ26421.1"
                     /transl_table=11
                     /translation="MALAEGPDLPIDGTLAGWAFRTGSMRVAEDEGTGLAAWFPLTDG
                     AERLGVLGLRTPSLDREAVRRCRLLASVLAMVITSKRDTSDSYAHGTRADTMSLPSEM
                     LRAFLPPRTVCTDRAVSTAVLEPAYRLGGDAFEHSLADGVLHAAVLDAMGHDLASGLT
                     AALALAACRNARRNGADLPDLVDTIDRALHDWFPDRFATGLFLRLDIATGTLHWANCG
                     HPHPLLIRSGQVVEGALDGPGELPLGLGHHTGAPRSVRTFSLKPGDRLLLYTDGVVDA
                     KGAHHEFFGLARFTDFVIRAAGAGETAPETLRRLMHAILEHQDENLTDDATIMMIEWQ
                     PLSPPLLDDTRARPSPW"
     CDS             complement(647560..647730)
                     /codon_start=1
                     /locus_tag="KSE_05790"
                     /product="hypothetical protein"
                     /protein_id="BAJ26422.1"
                     /transl_table=11
                     /translation="MVPLLLVLLLALLLFGAGFAVKILWWVAVIVLVVWLVGFVARGT
                     NATGGRGRWYRW"
     CDS             complement(647846..650047)
                     /codon_start=1
                     /EC_number="1.11.1.6"
                     /gene="katE"
                     /locus_tag="KSE_05800"
                     /product="putative catalase HPII"
                     /protein_id="BAJ26423.1"
                     /transl_table=11
                     /translation="MTADDTRPDLPGTPSAGEPTVEEPVEPRPPLPPKPDQAAPEPRS
                     ATGRGPQDDSGPARAQAGAYLTNAQGTRLPDSDHSLKAGPRGPVLLQDHHLREKITHF
                     DHERIPERVVHARGAAAHGVFESYGAGAGLSKAGFLAAGARTPVFVRFSTVLGSRGSA
                     DTVRDTRGFATKFYTDEGVFDLVGNNIPVFFVQDAIKFPDVVHAAKPHPDREIPQAQS
                     AHDTFWDFVSLHTEATHHTLWNMSDRGIPRSYRTMEGFGVHTFRLVDAEGATCLVKWH
                     WKPKLGVHSLTWDEAQLIGGADPDFHRRDLYDAIEAGAYPQWELGVQVMPDTPEQTFE
                     GIDLLDPTKFVPEELAPVQPLGLMTLHANPTNFFAEVEQVAFHPGHLVPGIDVTDDPL
                     LAGRLFSYLDTQITRLGGPNFAQIPINRTHAPVNDMLRDGFHQDAVHTGTAPYKPNSL
                     DGGCPFFAGADPHAFIEHPQPVPAAHKVRELPASFDDHFSQPRTFWASMTPVEQEHII
                     AAYGFELGKCTEPAVRERNLRVLARIDDRLCAEVAAALGLPAPEPEAAEPPARPSPAL
                     SQLGREWPVAGRTIGILVGPGTDPGVLDDVRSAALAADLVPLVVAPSGGDPAEVQRSF
                     ATARSVEFDAVLLAGAPAPAADAAPARDARAAGPRTLLDPRLALLLGETWRHAKAIGG
                     WGDARDALAAAGLPADGPGVVLGTDPVQVLREVADLLAGHRVWDRFPPPAA"
     CDS             complement(650233..651195)
                     /codon_start=1
                     /locus_tag="KSE_05810"
                     /product="putative F420-dependent glucose-6-phosphate
                     dehydrogenase"
                     /protein_id="BAJ26424.1"
                     /transl_table=11
                     /translation="MRIGYTLMTEQRGPRDLVADAVRAERAGFDFAVISDHYFPWLDE
                     QGHAPYAWAVLGAVAQATDALPLMTYVTCPTVRYHPAVVAQKAATVQLLAQGRFRLGL
                     GSGENLNEHVVGRGWPPVAVRQEMLAEAVEIIRALFAGRYVTHHGRHFRVDGAKLWDL
                     PEQPPPIGVAVSGPASCATAGRLADLVIAVQPERGLLTAFAEAGGAGKPAVGQAPVCF
                     DRDRDAAVARAHAQFRWFGGGWKVNADLPGPAGFAAASRYVRPEDVAASVPCGDRVQD
                     FLAAVRPYAEAGFDELALIQVGGDSQPAFLDWAEHELLPALRAA"
     CDS             complement(651302..652768)
                     /codon_start=1
                     /locus_tag="KSE_05820"
                     /product="putative decarboxylase"
                     /protein_id="BAJ26425.1"
                     /transl_table=11
                     /translation="MDQSQAPVLEALAAFHANPPTVFTPPGHKQGRGADPRVLAVLGA
                     EVFRSDVLATGGLDDRTGSHGVLPHAQALMAEAVGAEHTFFSTCGSSLSVKAAMLAVA
                     GPHEELLVGRDAHKSVVAGLILAGISPIWVDPCWDADLHLAHPPRAEAFRVALERHPE
                     ARGALVTSPTPYGTCADLAGIAEVCHAAGKPLIVDEAWGAHLPFHPDLPQWAMDAGAD
                     VCVTSVHKMGSGLEQGSVFHLRGDLVAPDALKQREDLLGTTSPSVLVYAALDGWRRQM
                     VQHGRDLYGAALALAADTRERIGALDGLRVHGRDDFCGPRLAADLDPLQVVVDVSGLG
                     TTGYRAGDWLRSHHRLTLHVCDHRRISAQLTHADDPATADALLHGLRGLAAAADTLRP
                     AARVRVPDPAELRLPQAALPRDAFFGPTEQVPPARAVGRIAAEMLTPYPPGIPAVLPG
                     ERLNHAVLDYLRTGLDAGMLVPDSADPDLATVKVAREP"
     CDS             652957..653922
                     /codon_start=1
                     /locus_tag="KSE_05830"
                     /note="Similar to Putative ABC transporter ATP-binding
                     protein Orf18 in Streptomyces sp. WA46 (Q7X292)."
                     /product="putative ABC transporter ATP-binding protein"
                     /protein_id="BAJ26426.1"
                     /transl_table=11
                     /translation="MIEAQQLTKRYGEKTAVDGLDFTVRPGSVTGFLGPNGAGKSTTM
                     RMIVGLDAPTGGSVRVNGRSYAEHAAPLQEVGALLEAKSIHPGRSAFNHLMALAHTHG
                     IPRSRVEEVIGLTGLESVARKRAGAFSLGMGQRLGIAAALLGDPATVMLDEPVNGLDP
                     EGVLWIRNLLTGLAAEGRTVFVSSHLMSEVALVADHLVVVGRGRLLADTTVAELVRQA
                     GGDRVTVASADPARLRGLLTGPGVEVTGLAGAEELEVTGLTARHIGTVAAEHGIALYE
                     LATRTVSLEQAFMDLTRDAVEYHGSTTTPATTTVTSPAEASRSAA"
     CDS             653919..654767
                     /codon_start=1
                     /locus_tag="KSE_05840"
                     /note="Similar to Putative ABC transporter transmembrane
                     protein Orf19 in Streptomyces sp. WA46 (Q7X291)."
                     /product="hypothetical protein"
                     /protein_id="BAJ26427.1"
                     /transl_table=11
                     /translation="MSTTTATEPAATAAARPARPPYRVTAVRVLRSEWAKAWSLRSTW
                     ITLGLGLLFLIAFGLIAAFQFKSRLTSGRHLDRDFADANALTLSLFGTNFAQLALGVL
                     GVLIAAGEYSTGMIRSTLAAVPRRLPVLWAKALVYGVVALVLATAGVFVAFLCGSGIL
                     SGTRAALTLADAGVVRGLFGAGLYLGLVGVIGVALGVLLRSIAGGISVLVASLMLVPG
                     LVSLLPDSWHSHISPYLPSNAGEAMFALHHDSTTLSPGAGLAVFALWTVAALAGAAVR
                     LRRQDA"
     CDS             654832..656247
                     /codon_start=1
                     /locus_tag="KSE_05850"
                     /product="putative two-component system sensor kinase"
                     /protein_id="BAJ26428.1"
                     /transl_table=11
                     /translation="MPDPAPRSAGPAAAPFAAAPFPALPGHPLLDRLARSGQRLRGWA
                     ARHPWLLDGAVVAVSFLAFCVPDLVHDGDGDGPRGRRIVFTHLPPAAVLAFQAALLLP
                     LLWRRRRPAAAFAAVTAVFLAQWSLGAALRADAALLLALYALALHGRLRDLAWACAVT
                     ALGIGLVAVRLSAAVSVWDVLFFLAAAVTAAVALGIAVRVRRAQLAGLRERAARLEVE
                     RDQRSRLAAAGERARVAREMHDIVGHNLSVIITLADGGAYAARSAPERGQEALALIGD
                     AGRQALGELRRMLGVLREHGDGPGLAPQPGVADLAELCGRIRAAGPEVVHRTEGDLAA
                     LDRGVQLVVYRIVQEALTNTLKHAGPRTRCRVSVSLAGPRLLVRIDDDGPPATGPAPV
                     PAPGSPPDTPPDEGQGLTGMRERAALYGGTVSAGPAPGGGWSVRADLNVTPATPAPHP
                     PAPHAPYAPAPYALDPAGGQP"
     CDS             656244..656918
                     /codon_start=1
                     /locus_tag="KSE_05860"
                     /product="putative two-component system response
                     regulator"
                     /protein_id="BAJ26429.1"
                     /transl_table=11
                     /translation="MTSVLIVDDQPLQRFGFRMLLESQPDTSVAGEAGHGAEAVRLAA
                     ELRPDVVLMDIRMPGMDGIEATRLIVATGGRSRVLVLTTFDLDEYAHAALRAGASGFL
                     LKDAHPEELLAGVRAVAGGDAVVAPAITRRLLDAYAHHLPARPPGPVDDDPRLAALTG
                     REREILLAVARGWTNGEIAARLVLSESTVKTHVGRVLAKIGARDRVQAVILAYDLGLT
                     RPNPPA"
     CDS             complement(656928..658331)
                     /codon_start=1
                     /locus_tag="KSE_05870"
                     /product="putative two-component system sensor kinase"
                     /protein_id="BAJ26430.1"
                     /transl_table=11
                     /translation="MAEHPAAPGARPGAPRARLRVRKARFVPRSVRARTTIAACAAVA
                     AVLLVASAAVLLLLRVNLERTVQDGAREQALAVAGLAGDGHLPGQLPLGHGTDFIQVT
                     DATGRVVAASQNLAGRPALTPTGTRDGHATYDLGLLGDEHHQRVTTVTADTPTGPVTI
                     RVGASLHTADTAEDLTTAALAALSAVLVATVGAVTWRATGRALRPVEAIRSEVAGIGD
                     RDLDRRVPEPGSRDEIARLAHTMNAMLDRLEAAGVRQRRFIADASHELRSPLAVLRTQ
                     LEVAHTHPDPAVRAQMVDGALQDTDRLQSLAADLLLLARLDAAGHDGPRETLDLAELA
                     RTAVADRPRVELRAQDGALVLGDRLRLGRLLTNLLDNAQRHARTRITVEVAADPATGT
                     VRLDVANDGPAIAPADREKVFERFTRLDDARSRDHGGTGLGLPIARDIATLYGGTLVV
                     ADGPGTVFRTVLPAAGS"
     CDS             complement(658324..659001)
                     /codon_start=1
                     /locus_tag="KSE_05880"
                     /product="putative two-component system response
                     regulator"
                     /protein_id="BAJ26431.1"
                     /transl_table=11
                     /translation="MRVLVVEDEQRLALAIKHGLEAEGFTVDTVHDGLSGLARATDHS
                     YDVVILDIMLPGLNGYRVCARLRAAGSDAGILMLTAKDGEWDEAEALDTGADDYLSKP
                     FSFVVLVARLKALARRIGSRAPRRAVLGDLVVDSAARTCSRAGRPIALTPREFAVLDH
                     LARRAGEAVSKREILEQVWDAAADSDPNTVEVHISALRRKIDTPFGRSALQTVRGAGY
                     RLEPDGG"
     CDS             659129..659665
                     /codon_start=1
                     /locus_tag="KSE_05890"
                     /product="hypothetical protein"
                     /protein_id="BAJ26432.1"
                     /transl_table=11
                     /translation="MGTVDEREPERSGRAIPPWLRGRAARWGGGVVVAALLVGGGAAA
                     LAEHDGHGGHGGHAGRADARDEEHGGRTHGRGGRDGRSEEHDRHTRQNGGNAKQGKSG
                     GRTRTAPAPLPALDAAEALAKAAATVPNGRVESLETATATDGGRAWRAVVIGPDGVRH
                     LVTLDGTTGTPTGNTVLD"
     CDS             659792..660583
                     /codon_start=1
                     /locus_tag="KSE_05900"
                     /product="hypothetical protein"
                     /protein_id="BAJ26433.1"
                     /transl_table=11
                     /translation="MSSTAVGTPPVPRRRRAAGTGVASKVPEVTAVFWAVKVLTTGMG
                     ETTSDFLAHTLGPVPAVGGAAVLLAAALFAQARAGRYRPAVYWAAVVMVSVFGTMAAD
                     VAHVAAGVPYAVSAGVFALVLAGVFALWRRTEGTLAVEAVTGGRREVFYWSAVLATFA
                     LGTAVGDLTAATLGWGYLPSGLLFAGLIAVPALGHRLLRLPQVLAFWWAYVLTRPLGA
                     CFADWAGVSRARGGLALGTGPVSLVLAVLIAGAVLWLVRVERRSA"
     CDS             660687..661331
                     /codon_start=1
                     /locus_tag="KSE_05910"
                     /product="hypothetical protein"
                     /protein_id="BAJ26434.1"
                     /transl_table=11
                     /translation="MLSSTLLAVNPLDAGSLLASFGALGIAVVMFAETGLLVGFFLPG
                     DSLLFTAGLLCTTGAHSGPHLNLGQVLAAAVVGALAGAQVGYLIGKRGGPALLARSRS
                     RHLHEGAVRAEGILNRYGHAKAVVLARFVPVVRTVLNPLAGALGVDVRTFTVWQVAGG
                     LVWTVGLVLAGYALGSSIPNVDHYLLPIVALVVVVSLLPLGLELLRSRRRTGAE"
     CDS             661328..662011
                     /codon_start=1
                     /locus_tag="KSE_05920"
                     /product="hypothetical protein"
                     /protein_id="BAJ26435.1"
                     /transl_table=11
                     /translation="MSTTLPRRPAVLASACGGAFALLAAAVAVHGWAPFGFEAAAVRW
                     GAAHRPGWARSTALAVTALGTDVFPYLLALAAGALSVRARRPGTARRVAVVLLAPLVW
                     LLAGQLLRQGLMRAFARPRPPVGYWAFEANGLSFPSGHAFTAALSAGLLAVAVALARP
                     TATRTAAAVAALFTAVIGFTRVFLGVHWPLDVLGGWLLAATWLALGLCLLPRLPSGTA
                     APTEPATPA"
     CDS             662855..663403
                     /codon_start=1
                     /locus_tag="KSE_05940"
                     /product="hypothetical protein"
                     /protein_id="BAJ26436.1"
                     /transl_table=11
                     /translation="MRKNLLALLPAAALALATAAAPSAYGASTRALTTVSVVCTGSDT
                     TNYNPGLRTFSQTVDTYGTDTGSGCTGVGRITGLTSFSASFSGTYTASCISPIQSGSG
                     TETLTWNDGSTSVWAWHSTVATNSAGQLVGTYDGTITTGRYAGANLNNTDVEPNTNVT
                     ACFSSPGLTQTTGTATWTFTEL"
     CDS             663581..664132
                     /codon_start=1
                     /locus_tag="KSE_05950"
                     /product="hypothetical protein"
                     /protein_id="BAJ26437.1"
                     /transl_table=11
                     /translation="MKHLRALATAVSATLLGLAVPLLAPAAARASQTAGVDITCLGST
                     HATYDPPITNTEQDTTAHRTTNFSCTSLLTAVSSGYLDRTVVQTLSCLLAVTPPTSTM
                     TETYSWNTGQSSTATYVSSTAVHAADGTTTVTAVGAITSGLGLGSTVTKTVVIPQLNP
                     TACATTGLSEVNGTASLAILPAD"
     CDS             664463..664849
                     /codon_start=1
                     /locus_tag="KSE_05960"
                     /product="hypothetical protein"
                     /protein_id="BAJ26438.1"
                     /transl_table=11
                     /translation="MPDDLRERVAPLLPPGGARTRSCSPSRGRRACRRRTTRRSTART
                     SGPSKEAHTGPPPVDRGRPGSKQHLIVDRHGTPLAVALTGGNRHDVTRCVGAPAGRLL
                     RLRAVHGGHRCRRRPLARHRPAAASR"
     CDS             complement(664822..665514)
                     /codon_start=1
                     /locus_tag="KSE_05970"
                     /product="putative two-component system response
                     regulator"
                     /protein_id="BAJ26439.1"
                     /transl_table=11
                     /translation="MIDVLVVDDDFRVADVHAAYVAKVPGFRVTGTAHSAAQALATLE
                     RAPVDLVLLDHHLPDETGLALVRRLRDAGIRCDVMMVTAARDVSTVHAAMQHGALQYL
                     VKPFSFAGLRDKLTAYADLRHALAGPAARETSQDEVDRMFAALRTGTPTTAPLPKGHS
                     APTTDLVLDALRRAGTPLSAQEVADATGLSRSTAQRYLKQLARDHRLRLSLRYGDTGR
                     PEHRYLLAAAGR"
     CDS             complement(665511..667109)
                     /codon_start=1
                     /locus_tag="KSE_05980"
                     /product="putative two-component system sensor kinase"
                     /protein_id="BAJ26440.1"
                     /transl_table=11
                     /translation="MRRLRWPRRVFAQLLLSQAVVTVGVTAVTAGLFLAPVSAELDRD
                     AMQRALSIAQVTAADPAVARAAADRDAATAQDTAERIRRASRAEFVVITDDRGIRLSH
                     TDPARIGLRVSTDPEPALRGESVTAIQDGTLGRTARGKVPLRLPDGRIVGEVSVGLSD
                     DSIRGRLVSMAGGILLCAGAGLVVGLAATLVLARRLKRRTHNIAVADIAALLIEREAM
                     LHGIREGMLALDPAGRIRLANDEALRLLALPDDCAGRTVDDLLPPGRLADVLTGRVEG
                     ADLPAVRDDRVLVVNRMATADGGAVTTLRDRTELESLVRELDHTRGLTEALRAQDHEH
                     ANRMHTLLGLLELGRHDQAAAFISEQSGTQAARAARIGRHVQDPHTAALLAGKAAVAD
                     ERGIRLTVTPDSHLPDALHDPRALLTVLGNLVDNAMDAAPGGTVEVRLRAVGSTLLVE
                     VADSGPGIPADLRERVFEEGWTSKDAPAHRPRGLGLALVRRLAERTGGRLAVGTGPLG
                     GARFTVELPEALRAAGTEPVLENA"
     CDS             667402..668226
                     /codon_start=1
                     /locus_tag="KSE_05990"
                     /product="putative ABC transporter ATP-binding protein"
                     /protein_id="BAJ26441.1"
                     /transl_table=11
                     /translation="MDPQQAGAVPAIELTGATKRFRTPSGALHTAVRELDLTVAPGEF
                     VAVVGPTGCGKSTTLTLVSGLEEPTEGEVRVYGEPVSGINEHVGFVFQQDAVFPWRTV
                     LSNVMAGPRFRGVPADQAREKARDWLSRVGLSAFEDRYPHQLSGGMRKRVALAQTFVN
                     DPRILLMDEPFSALDVQTRALMSDQLLDLWAGTGSSVVFVTHDLDEAIALADRVVVMT
                     AGPATVKEVFTVDLPRPRTVEAVRLEPRFVELYREIWASLGEEVRITRERGAGRAA"
     CDS             668216..669079
                     /codon_start=1
                     /locus_tag="KSE_06000"
                     /product="putative ABC transporter permease protein"
                     /protein_id="BAJ26442.1"
                     /transl_table=11
                     /translation="MPLETAVAPAAPAAATRTEVRERAARNRRLGVYGARAAVLAGFL
                     GLWEVAARTELIDPFNFSQPSKIWAQIWQWVTHGTAQGSLGEQVGYTLYEALTGWVIG
                     VVGGVLLGIALGRIRFLADVFGPYIKVLNAIPRIVLAPIFLIWFGLGPASKVASAVVL
                     VFFPVFFNAFQGAREVDRNLVANARILGASNRKVTLQVVIPAATTWIFTSLHVSFGFA
                     LIGAIVGEYIGATKGLGLMVAAAQGTFNAAGVYAAMTILAVVALFTEGLLTFAEKRLF
                     RWKPADAGDGR"
     CDS             669120..670178
                     /codon_start=1
                     /locus_tag="KSE_06010"
                     /product="putative ABC transporter substrate-binding
                     protein"
                     /protein_id="BAJ26443.1"
                     /transl_table=11
                     /translation="MRRTAAAALAAVLLLPLAACANDAATSHNGAAPAGKKVDGPTVK
                     IMVGGLDKVIYLPAMLTQQLGFFADAGVNVELLSEPAGVNATTALLAGDVQGAVGFYD
                     HTIDLQAKGKSVESVVQFSQAPGEVEVVSAKQADAIKSGADFKGRKLGVTSIGSSTDF
                     LTKYLAVKNGVNVSEFSPIAVGAGQTFIAALQQGSIDAGMTTDPTVANILSKQLGTVL
                     YDMRTPEGSKAALGGLYPSSSLYMNTAWVDGHKETVQKLADAFVKTLKWMNTHTPEEI
                     AAQMPADYAQGGSAEYAAAIKATLPMFTTDGVMPADGPKTVLAVLAAFHPDVQGKEAS
                     IDLAKTYTTEFVAKAATG"
     CDS             670327..670830
                     /codon_start=1
                     /locus_tag="KSE_06020"
                     /product="hypothetical protein"
                     /protein_id="BAJ26444.1"
                     /transl_table=11
                     /translation="MGGERRRPVPGQRLPGRPGLVVSCAHVVRAGCGSGLAVRHGATT
                     RPVRAEDVRMDPVEPGPGPLHAFPDPALLRLPAAAPAVAPLADVERYRQAVILSTRVL
                     GPEHPHTLVARSALGHAHTAAGRPQHAAVLLEETVSAMRLVLDLRHPDPGTALGRLAA
                     ARVSRST"
     CDS             complement(670814..672550)
                     /codon_start=1
                     /locus_tag="KSE_06030"
                     /product="putative serine/threonine protein kinase"
                     /protein_id="BAJ26445.1"
                     /transl_table=11
                     /translation="MTTAGPGGQLIDGRFELLARLGGGGMGLVWKARDTMLQREVALK
                     EVRPPDPAMLAADPAAAHELRERVLREAQALARLQHPNVVTIHHIVDNAELAHPWLVM
                     ELVTGGSLHDRITRGPLAPQEAARIGRGLLAALTAAHAAGIQHRDVKPGNVLLRADGT
                     PVLTDFGIAALSESTSLTATGALIGSPEYIAPERIRGHEGDPASDLWSLGMTLYVAVE
                     GHHPLRRATSIATLAAILDQPLPPPARSGPLGPTLSALLDRDPARRPDAVRLDRLLAA
                     AEQGIDGTLGGSPAFSPTETNGTVPYSPTQTHGAHGAHGTHGGGGGYAPTEQVRPGPA
                     PAPESRRRSGAVLTAVVAAVAALGLLGWAFGPKLFEEQKKGGTSAAGASAPATAGTAA
                     GTATGAAPPATPSGAVPSATPPKGGSGSGSGAPAAGTDLLTPDGARALVESIRTSTGS
                     STIIDMTVRSDNAHARVVRKDNPARYDMVDYRAGKITVSNGSTVDSISAKKLVDLGKI
                     DWNQLPTVTATAKSRLDVPQPKDRYLLVDYGWFADEITIRYYLSDDQGSGGGYLTAGA
                     TGKVLKVVKSTD"
     CDS             complement(672643..673128)
                     /codon_start=1
                     /locus_tag="KSE_06040"
                     /product="hypothetical protein"
                     /protein_id="BAJ26446.1"
                     /transl_table=11
                     /translation="MPPCRGGQTDQPAVPALFDRRMRREVLPDSPTARVERDGAVVRQ
                     VGEPHDWNGVLPSGLGADGAGRTRRSPGRPGTSPPADCPARGRRTRPTGPRTSGGGCA
                     RPGARRSQLATWALSPLAALWSWTVLRPLRWYAALTCPRTGWGTRQHGPEVELAPAGG
                     R"
     CDS             complement(673139..673411)
                     /codon_start=1
                     /locus_tag="KSE_06050"
                     /product="hypothetical protein"
                     /protein_id="BAJ26447.1"
                     /transl_table=11
                     /translation="MFVSGEIRHATPHPAFFAAVERALGPDRTVCCVIGDSRTADLAP
                     AAARSWPAVHVCGPDTPCPPGDPAGPAAPVRHAPGPGAVLLPCAHS"
     CDS             complement(673438..673611)
                     /codon_start=1
                     /locus_tag="KSE_06060"
                     /product="hypothetical protein"
                     /protein_id="BAJ26448.1"
                     /transl_table=11
                     /translation="MDAAAADRLFGAHRRALVRPLVRPLPGASVLPARVTAGHHAWLI
                     TNGAPGSSVSSSD"
     CDS             complement(673970..674626)
                     /codon_start=1
                     /locus_tag="KSE_06070"
                     /product="hypothetical protein"
                     /protein_id="BAJ26449.1"
                     /transl_table=11
                     /translation="MRTITRLTATAAVALLAGLTLTACDDDGAATGTAASSSAAASAP
                     AAAPTTSATGAGKGGATGSASAQAAGSAKCTAKDVKLTVTGPNDRATQQSSALAELRA
                     QNTSGKACTLTGFPGVRLADDQGKSAPLDAVRQKETAAGTVTLSPGKSAVAQLLYSNV
                     NFEGSASGRLVCPVTGTKVAVILPDTTEQVQVPVSGGVDNGTLNVCTDFTVRPFEAVA
                     "
     CDS             complement(674799..675293)
                     /codon_start=1
                     /locus_tag="KSE_06080"
                     /note="Similar to Acetamidase regulator AmiA in
                     Mycobacterium smegmatis (Q7PC60)."
                     /product="putative acetamidase regulator"
                     /protein_id="BAJ26450.1"
                     /transl_table=11
                     /translation="MSADATTRGAAAREAATPGAAAREAATPGAAPAPLLVELVALAH
                     RRLTGGLAAALAEEDCTVDQWRVLRALADEQGHAMGELAQSLLIPQASLSRLVDALAD
                     AGLVYRRQGDQDRRRITAHLSRRGRTRLTRLDALAAAHDAAVRAACALAAAEDGALAR
                     LAAL"
     CDS             675383..676447
                     /codon_start=1
                     /gene="amiC"
                     /locus_tag="KSE_06090"
                     /product="putative acetamidase regulator"
                     /protein_id="BAJ26451.1"
                     /transl_table=11
                     /translation="MTLDARLVDPLDALHLGREGGAFRVGLVVPQSGTLGLTGPSALD
                     GALLAAHEVNARGGVLGRPLELVLVDGGGAPQPVAAEVRRLLAAGALDALAGCHTSDV
                     HRAVEEVAAERIAYVFTPPHEGGSRRPGVLCTGIAPAAQLGPAIARLTELHGLRRWAL
                     VGNDYIWPRSVHRAAARLAAGAGARVVLERRLPFGTVERSVEPLLDELRATRADALLL
                     SLIGRDQVLFNRALRRSGLDRRLVRLSGSLEENGLLALGGDGTGTLYAAMPSFATLAE
                     EPRQLLAERHRALCGPWAPVLDAYAVGLYDGLHLLATLAARRALEPAGLARAAAPLLR
                     AGRRTVHLARAEGPGFAVLP"
     CDS             676574..678061
                     /codon_start=1
                     /locus_tag="KSE_06100"
                     /product="putative amino acid transporter"
                     /protein_id="BAJ26452.1"
                     /transl_table=11
                     /translation="MADTPAPQGIENYGYRQELRRSLTFTDLLVYGLVFMVPIAPFGI
                     FGSVFQGSGGMVALAYVLGMVAMMFTALSYAQMSRAFPMAGSVYTYAGRGIGAPVGFL
                     SGWMILLDYVLVPSLLYLIAGVAMNSLVASVPVWLWVVGFVLLNTAVNYLGIETTAKV
                     NKAVLVGELVVLALFVVVGVVALAGGKGRGFDFTPLYNGHTFSWSLVFGAVSIAVLSF
                     LGFDGISTLSEENRDSAKAIGRSMVAALLLAGTLFIVQTWIASLLVADPDALVADGDP
                     DGTAFYDAARTAAGGWLATLTAAATAVAWGFANSLVAQAATSRLLFAMARDRQLPSFL
                     AKVHPTRRVPVNATLLTAGVSLALGLYMTSRADGITLLSSLVNFGALSTFLVLHVAVV
                     VHYLVRKRSRDYWRHLVAPVLGFAILAYVVVNANIAAQRLGFVWVLVGALVLTGLIAT
                     GRKPQLSVAEPIAAVPAQAPAPAPAPAEAPAPADSPTDSPAKENP"
     CDS             678058..679080
                     /codon_start=1
                     /locus_tag="KSE_06110"
                     /product="putative acetamidase"
                     /protein_id="BAJ26453.1"
                     /transl_table=11
                     /translation="MTLPDEIVRLSPGPEDWAYTFGGRGPLTTVRPGSVVELTTEDCF
                     GGKVRGVDDLPSRVCVFPYLNPVTGPIAVAGAEPGDVLAVHFVEITPARDRGFSSTFP
                     HFGALTATHQTAMLHPALEERVWVYELDVAAGLCHFRARNSDFAVALPLDPMHGTVGV
                     APAAGEVLASITPGAHGGNLDTPEMRAGTTAYFGVNVDGGLLAIGDGHARQGEGEVCG
                     TAVEAAMRTTVIVDLVKGGGPAWPRLENDDFLISTGSARPLEDAFRISQHDLVGWTAE
                     LLGLDQLDAYQLVSQAGLAPAANVCDTNYTMAAKLPKSVLGRARAYDGLHDRLRETAA
                     AYLRHR"
     CDS             679164..679490
                     /codon_start=1
                     /locus_tag="KSE_06120"
                     /note="Contains an Antibiotic biosynthesis monooxygenase
                     domain (IPR007138)."
                     /product="hypothetical protein"
                     /protein_id="BAJ26454.1"
                     /transl_table=11
                     /translation="MIFIAVKFTVRPEHSAGWIERVGEFTSSTRAEEGNVFFEWSRSV
                     DDPHQYVLLEAFRDGEAGARHVESEHFKTAMAWMPDFISRTPEIVNVEVPGTGWSAMA
                     ELSPRG"
     CDS             complement(679519..680481)
                     /codon_start=1
                     /locus_tag="KSE_06130"
                     /product="putative tellurium resistance protein"
                     /protein_id="BAJ26455.1"
                     /transl_table=11
                     /translation="MDVSAGLWAATIAVLIALIVADFFIGGRKPHEVSIKEAGIWTTV
                     WVVLAGLFGGFVWWYGGSKPAVEFFAGYVTEKSLSVDNLFVFILIMGKFAVPKIYQQW
                     VLMFGVIIALVLRGIFIAGGAALVAKFSWVFYLFGAFLVWTAVKLVKEAGQDKTEEEF
                     EEGRLLRLIKKRVPSTNEYHGTKLFVRIDGRRLMTPMMTVMLAIGTTDMLFALDSIPA
                     IFGLTQDAYIVFTANAFALMGLRQLYFLIGGLLTRLVYLSYGLSVILGFIGVKLILHA
                     LHESGVHVPEISIAFSLAFIVVVLAVTTVASLLASRRQDRAAGA"
     CDS             680609..681037
                     /codon_start=1
                     /locus_tag="KSE_06140"
                     /product="putative tyrosine phosphatase"
                     /protein_id="BAJ26456.1"
                     /transl_table=11
                     /translation="MTPSWPPGTAGLLPLPSGRLVRGRGLRRPLPAGPPPDFALYLLG
                     GRPPATDWESRWLRWPDFRLPADRADAADALRETWARAAGERVEVACGGGHGRTGTAL
                     ACLAVLDGVPAAEAVAYVRAHYSPRAVETPWQRRFVARFR"
     CDS             681121..682191
                     /codon_start=1
                     /locus_tag="KSE_06150"
                     /product="hypothetical protein"
                     /protein_id="BAJ26457.1"
                     /transl_table=11
                     /translation="MNDVLSVRTLNRTLLERQFLTERTGLGVPGMVERLVALQAQEPN
                     WPYLGLWARIEGFRREQLAELLADGRLVRGASLRSTQHLSGGADYDRWRPLLQPVLER
                     TSRAGYFTPATGGLDLDALAAVGRELLAGRRLSRQQLAAELGARYPGRDGKLLAGAVQ
                     LRVPMVHGPDSSAWGGWSPRTNTSLVLAEPRPGELSAGAAVLRYLAAFGPAGVKDFQA
                     WSGLTRTRAVFEELRPGLRVYRDERGTELFDLPDAAPADPDRPVPVRFLPAYDNLLLG
                     HADRTRVLAEPDRPRVMPGAARVLPTFLLDGFVAGSWAVKGAELLVTPFRPLPAEAAE
                     RVAAEAGRLAAFLDPGQRVAFA"
     CDS             complement(682231..683724)
                     /codon_start=1
                     /locus_tag="KSE_06160"
                     /product="putative serine/threonine protein phosphatase"
                     /protein_id="BAJ26458.1"
                     /transl_table=11
                     /translation="MPLRPVAPPSLSAVALSVSALVAGAAAVGGYLVNERHESTVRHL
                     EDRIRPAQAALAQARTAVGDARSACLADGGAQAAALHADARGRLAGRLPELRELSDWH
                     PRLAAAARELDLTTTRWLDTLPTADRDAALESCAASGTAAEGYPAVRGHADRLTALLA
                     AEAHTTTADADRESRAVLFYLLALCGGLVVLAGLTARQITRRLLAPLAGIERRMRHDG
                     APRAVDARAPVALNRLAQAADTLRTRLRAAQWQARRDHQALEQNGRCVQGLGAILASR
                     HRAGPGVRAHGELVAAEGLLAGDYLGVLALPDGTTALLLGDVSGHGVDAALLAVQLKC
                     ALRGSLRTAADPVAAVRAAWHTLDPDEDRFTTLVLVRLDPRTGRLGWLNAGHERPFLR
                     RADGTVERLEPTGPLLHPLIEPEPGTWTERHTAFHPGDLLLLCTDGLTEGRGPAGEFG
                     EPRVADLLAAHPGAAPAGAVRALHAEAGRFGLDWGRDDVTVLAAALD"
     CDS             complement(683932..684654)
                     /codon_start=1
                     /locus_tag="KSE_06170"
                     /product="hypothetical protein"
                     /protein_id="BAJ26459.1"
                     /transl_table=11
                     /translation="MSTPPLSDTLSATGDRHGHRFLLIGKKTVFSYHLGLYFVPIHAF
                     QLITAFGLDDRLRTTYLDDLAAHEDQQVYYSLFTEGHWPLRELVDGTRTSLPVELERV
                     TVDAEGRRTFTPLLPAIDVSSRKEDVVHYLPLVADAGYPDHLTELVFGRGDEVHLTHT
                     LAGAPNWDEVITTVDPQGFQAADLAPAATLTVPSVKDPHGAAPRSPLATGTRYEARIG
                     ERAVAFTAGRQGWWNNTSLNAQ"
     CDS             complement(684651..685826)
                     /codon_start=1
                     /locus_tag="KSE_06180"
                     /product="putative oxidoreductase"
                     /protein_id="BAJ26460.1"
                     /transl_table=11
                     /translation="MAGGAVVSGARYDVVVAGGGPAGVAAAIVLARAGRVVLLADAGR
                     GPGSVGEALPAAARVLLRDLGADRVLADGHLPCPANRSAWGGPELASTDSIRDPHGHG
                     WHLDRPRFDGRLRDRARAQGVQLAERTAVRPLARTPDGGWTVELRGPARETARCRWLL
                     DATGRRAALARACGARTLTRDRLVAVHLTLDPADPPGADTTTTVESAPDGWWYTAPLP
                     TGHRLLAWYADADGGDARPAGEAFAARLADTRHVGPLAAAHPWPAGGGALRRAPAHTA
                     WLDRVDGEGWVAAGDAALAFDPLSSQGILTALFTGLRAGQAVHARLGGDGEALGGYAR
                     EVAAVRAAYLRTLRSHYAAERRWSDRPFWRDRQYPQHPQHPQRTATTTTTTTEETPV"
     CDS             complement(685969..687963)
                     /codon_start=1
                     /locus_tag="KSE_06200"
                     /product="hypothetical protein"
                     /protein_id="BAJ26461.1"
                     /transl_table=11
                     /translation="MTDDISYAKIHPAIGLARLGNSTRPDGWFHGPETPEPEPVTPGA
                     HKDDTGAIKRQAARFRIYGYDAQDRVVRELTTAEAGVAIEWAVHVANRKSAWYNFDLA
                     FDIPDMAGMQSARRNPEQADRGQLVIDPGRRTLRAGSGEQVEFTGGTFLGVDVPLGRM
                     HTDDHGRLVFLGGTGTSGAPNGEELHSFGNNDGWYDDTSDGPVTATLTLDGRDVPVHG
                     AWVVVAPPNYAPDVKTPRTLWDLLHDVFLRQGSIPPDPRVNFERDVLPILRRFHELQW
                     VNHGFAAQYGFGGPQDFLAPATLARLGSTAERHREARRQIWTAIRDHARDGLSPQPWP
                     WFYGDAMASKPKSPLQYMTLSDTQIARLGAWAKGDFDTTPWPGFPRRLEDAPVADQPA
                     LLDRAALDFCLADAFHPGCEVTWPIRHPTMYQEPFRILHRPDGQTEPDYGPALTTRQA
                     LAEDGPLHAQGPGDLTRWMAIPWQTDTASCRSGYESTALPSVRYDPYVPTFWPARVPN
                     HVLTEEDFRIVNQENAGTVHTDDEREDAFARRSSWLRGLRGDYLEQLARSIGEWHEFG
                     IVETRRYTVGDGRFPATLQVESTPGFPLEGVSPDRNTVTLHIPETTLGTATHTTLLAA
                     TAAHTGYSADEIAVGYVDKLDPFGEESASGGGARPEGGAA"
     CDS             complement(688187..688801)
                     /codon_start=1
                     /locus_tag="KSE_06210"
                     /product="hypothetical protein"
                     /protein_id="BAJ26462.1"
                     /transl_table=11
                     /translation="MAGQASGGGGGTGGTGGAGGRRGAAGGRRGRPLPWPALLTAIAA
                     VITAVATLIGVFLATSSDGGGPEAAGAPSAPAPGTSAPPAGSPSAAAPPSASAPPSPA
                     GGWVGDWQGTITQSGRKYVLKVSIREPKLGEEFADAEYTPLGCTTRWTLTERTDRRLT
                     GHEAVVRNTVTTCVSGDFTLDLRKDGGLDFAWNRTVAVGTLTRQ"
     CDS             complement(688858..689856)
                     /codon_start=1
                     /locus_tag="KSE_06220"
                     /product="putative LacI family transcriptional regulator"
                     /protein_id="BAJ26463.1"
                     /transl_table=11
                     /translation="MKIGIVEIAAHAGVSEATVSRVINRRQGVAKRTRDAVERAMADL
                     GYERAVEGQLVAVVTEHVSNPFFADVAERIESALAPHGLKTVLCPSFAGGVQEPEYIS
                     AIIDKGIAAVVFLSASNTVEGVATESYEILRSRRIPYVGVNGEFADGVPAPVFSTDDR
                     LAAELAVDHLHRLGHRVIGMVSGPAGNRPADRRVRGFLDAMARRGATHPEELVIRQSY
                     TVEGGQAAAGALLVRGATAIVAASDYMALGVIRGARRLGRSVPGDVSVVGYDGTMITE
                     FTDPPLTTVRQPADRLALEVGRSVLALVAGRDTPTGELLFDPELVIRSTTGPVPTA"
     CDS             complement(689906..691720)
                     /codon_start=1
                     /locus_tag="KSE_06230"
                     /product="hypothetical protein"
                     /protein_id="BAJ26464.1"
                     /transl_table=11
                     /translation="MTTPALGPVTTPAPGPVTAAVATPADEAVTTAELAPARYAPLLD
                     TVRAAVLADGADTAWTATRDPSGLTVLAVHAPGAHVEVRLTLPLGDAAGYWHPGADWR
                     RTPVADWEGRAATSLVKGLPAGCLHDHSGATLLTFAAADPVRETTLRYGVSEENDSYV
                     VHLHLAPADRVHRVLFAPRAPSVAAALRPLRAWYAARTAAMPVPEAARLPLWCTWYAY
                     NQRVSAAEVEKQAALAAGLGFGAAILDDGWQRHGSGRGYAGVGDWRPDEAKFPDLGAH
                     VAAVRATGLRYLAWTAPLLLGPDADCHAAWARYAPRPAGVPGAHVLDPRRPEVRAHVV
                     DTCVRLVREHGFDGLKVDFLDEAMVYARDGGGDVGAALIGLLTDLRAALEAVRPELLL
                     ELRQPYVGPAMAEFGNLLRSFDCPGDTTANRIRTLDTGLLAAGGAVHSDPLLWDAGAP
                     VETAARNLISTLHAVPQVSVRLDELPAEHLDALRFWLARWRELRPQLLDGDVEPGRPD
                     EQYTLVESVADGVRVVDVHTERVVPLDPAAHRETVLVNGSAADRVVVEVRGGPVDAEM
                     EVHGPDGRMIGRTRNTLAPGLHGVRVPRMGLARIRGVQ"
     CDS             complement(691726..692547)
                     /codon_start=1
                     /gene="araQ"
                     /locus_tag="KSE_06240"
                     /product="putative L-arabinose ABC transporter permease
                     protein"
                     /protein_id="BAJ26465.1"
                     /transl_table=11
                     /translation="MRTTARSITLTWGLALTLAAVLLPFYWLVVAATHSNTDIFGSPP
                     PLAPGGHLGANLRTLQDQAHFGRVVLNSLLIAGIYTLCAGTVCTLAGYAFAKYRFKGR
                     HGLFALLMLGLVVPAQVTLVPLFQLMADLRWLDTYQAVILPNLALPFGIFLMRQSMGT
                     IPDELLDSGRIDGCGELRLFLRVVLPPMRPALAALAIFLFLFQWNDFVWPLIVLRDSA
                     ALTVPVALASLKGVTDTDYGAILAGTAVAAIPMAIVFLALQRHFVSGLLAGAVKE"
     CDS             complement(692544..693515)
                     /codon_start=1
                     /gene="araP"
                     /locus_tag="KSE_06250"
                     /product="putative L-arabinose ABC transporter permease
                     protein"
                     /protein_id="BAJ26466.1"
                     /transl_table=11
                     /translation="MSSPGTTTARRPGTATARRRPGSGARRAAPYLFVLPALALFAVF
                     KLYPIARSFVLSLHKTVDGQDTFVGADNYTRLLHDPLFWTALKNTATVLVVQVPLMLA
                     LATGLAVALDSRLLRARAVFRLGFFLPMVTGLVAYGVIFSVLLNEKYGLVNWLLQFAG
                     IDAVPWLTDPLWAKLSLALALTWHYTGYNAVILLARLQTIPTELYDAAAVDGAGGWTS
                     FRHVTLPGLRPALLLTTVLSTIGTLQIFDEPYVLTRGGPDNATLTIGMYLYQNAFSYF
                     DFGYASAIAYALAVLIGLLGLVQFKVLGDRDGDKSGHKPGHKPGGKR"
     CDS             complement(693512..694858)
                     /codon_start=1
                     /gene="araN"
                     /locus_tag="KSE_06260"
                     /product="putative L-arabinose ABC transporter
                     substrate-binding protein"
                     /protein_id="BAJ26467.1"
                     /transl_table=11
                     /translation="MSLSRRTVLRAGGALAAGAGLTGLAACSGSGSGGGGGAVGAADQ
                     GEISVWSWAGPAAELKALVPAFNVQYPGVKVTVEDIGNPAIWDKITTGLAAGGAGLAD
                     VLHIGIDYLPGYTEKFPNGLADLAKLGADRYKDAFAQGLWATVGGRNGRINALPWEAN
                     SGGFYYRSDVFEQAGVDVKALDTWDDTVEAGKTIKAKTGKYLLGIDKPASVPDAANFF
                     QLLLQLQGAFYFDLDGAITLDSPEAVKAMTIIKQLNDADLLADLSGGWNAQIAAIKAG
                     TSAVLPMPTWYGGIIEETVPEEKGKWGVRLPPAVRRGGSTAATVNSTHLAISGTSKHQ
                     AAAWKFVEFALTRPASQVKIYQDKGIAPALMAAYDDPAFHTPSAFFGGRQKGEVFLEA
                     LKAPSPAFNYSADYARALKVVTDAQTKVLLKGAAPADVLKQAADQLAQQTGRKVVR"
     CDS             695078..697459
                     /codon_start=1
                     /locus_tag="KSE_06270"
                     /product="hypothetical protein"
                     /protein_id="BAJ26468.1"
                     /transl_table=11
                     /translation="MRPARPARTARSGRPARTTLLAALSTAAVLAPLTVAVPTADASA
                     ALPKLTNAGFEQGSAAWHFTDGTGVATNNPHSGSKLVYLDDGTGKKVWQTVSARKGGS
                     YDVSAWIATGWTGGRFTVRVNGAVAGGVDLPYRAAYARYTVPRIAAKAGDRIEIAFES
                     GDGWINADDVSLALSGPAVTDPGFEQGGGGWQFTDGTGVATNNPHSGSKLVYLDDGAG
                     PKVSQTLTANGPGTYSFSAWIATGGPGGTFTVRVNGTAAGTVALPAAPKYARYTVPRV
                     ALKAGDRVEIAFASAAGAGWVNVDDVMVSPLPATRPKVASSDPKIAELFAWAADKAGS
                     WAQLPGATGPVNADERQTGGTGSTTYEASYWAGYAHRSAFYGRDTAHQVDGAAVLGLD
                     AENRDMLGAFAATATEEHAYYPVWALNFDDRTNLSIDYRSPSVFVREVPSTFELVEKA
                     DKAYRWSGDASYVNDPALWAYYQHATNEFIALHDSAKPNGVAEGTGKGIFSGAASYDE
                     SGDDRFAEAGDSIGSQYQALLAVADLAAGRGDSALAARYRQRAADLKTYFNTTWSGTG
                     TGADMVRGYSTSGTPITGWGRENSWFMPLKKIVDAGPRNDAYLDYIDEQSQGDERPSN
                     IEAYTYLPDTFFAYNRNDTAWKWMQYVYDRRDERHIVTKQGPNGDYPEVSFTLLSQTV
                     QGLLGVDPDAPAHTLATASHLPTGTDWLGIDDLAVGRNTFALRHDGATASTLTNKTGA
                     DTYTWEARIPGTHATLTVDGTPRPAATKTVDGTVYSYVTVPVAPGATATVRAS"
     CDS             complement(697538..697885)
                     /codon_start=1
                     /locus_tag="KSE_06280"
                     /product="hypothetical protein"
                     /protein_id="BAJ26469.1"
                     /transl_table=11
                     /translation="MSDGMWGYEKAEGYQPGVDLTGYRVEATDGHIGKVDKHSYEAED
                     GYIVVDTGPWIFGREVLLPAGVIRLIDESEKTVWVDRAKEEIKNSPEYHRESHALDAD
                     YRRGVGGYYGTGM"
     CDS             complement(698030..698545)
                     /codon_start=1
                     /locus_tag="KSE_06290"
                     /note="Similar to HTH-type transcriptional regulator PecS
                     in Dickeya dadantii (P42195)."
                     /product="putative MarR family transcriptional regulator"
                     /protein_id="BAJ26470.1"
                     /transl_table=11
                     /translation="MEQPLDHVARIQAAWRRERPDLDVAPQGVIGRLHRVATLLTHQL
                     TAVYARYDLGEGEFDVLAALRRAGAPYERAPGELAAHTMVTTGAVSKRIDRLERAGLV
                     ARRPAADDRRGRVVALTEAGRDLFDRAFTDHIRNEHDLLAPLTPAEAAQLEALLTGWL
                     ARLEPPGEPAR"
     CDS             698594..699556
                     /codon_start=1
                     /locus_tag="KSE_06300"
                     /note="Similar to Prontein PecM in Dickeya dadantii
                     (P42194)."
                     /product="hypothetical protein"
                     /protein_id="BAJ26471.1"
                     /transl_table=11
                     /translation="MEAILRWGALTALAPVAWGANYYVTHHYLPADAPLWGAALRALP
                     AGLLLLAAARRRPRGAWWWRSTVLGALNTAAFFVLVYLASQRLPAGTAATVMALSPLA
                     LMLSAWPLTGERPRPAQLAAGAVGVTGAALLLAAPTGPPSPAGLLAALGALLVSAVGH
                     ALTKRWTPPDGGPGVLAPTAWQLTIGGLLLLPVAVLAEGPPPALTGAALPAFAYTSLI
                     ATALAFLAWFAGLRRLPAATVGLIGLLNPATGALLGTTLDHEPLGPAQFTGMALIAAG
                     LLLGRPRAAPGVSTTAGTAGTAAGATEGARDGNRLPGQRRPGAR"
     CDS             complement(699669..700058)
                     /codon_start=1
                     /locus_tag="KSE_06310"
                     /product="hypothetical protein"
                     /protein_id="BAJ26472.1"
                     /transl_table=11
                     /translation="MERTDGGDRARPPWPDLLADHRPALVAPAAPHRPAPAGEGWTGP
                     DTLPALREDWAAAYDGTRLVVTRPDGTPWYDGPLAAAREWARALRAHRTLILVTGPFT
                     SPFDFRPAAAAGRLAVLAVPARLVDTH"
     CDS             700364..703561
                     /codon_start=1
                     /locus_tag="KSE_06320"
                     /product="hypothetical protein"
                     /protein_id="BAJ26473.1"
                     /transl_table=11
                     /translation="MPAAPVPRRLRSATLAVLASAALLLGALTAQPAAGAAAGPVPAA
                     GDPCLGQCQDILTAGENGHATLAGILLHQSVGTRPAHSADQVDAYDALLHDYSGLTPD
                     QLSAYFDDASFGVPAGQVESTATPRPGVTITRDKATGTPHVKGVTRSDTEFGAGYAAG
                     QDRLWLIDVLRHVGRGQLSSFAGGAAGNRALEQSLWAVAPYTEADLQQQLDRVRASGP
                     RGAQAWQDVQDYVAGLNAFAAADVAANNYPGEYVLTGHGSTIAPFTATDVAAISSVIG
                     AIFGGGGGGEVGNALARIALRQQYGAEAGDRAYAAWRAGDDPEATATVHDGTSFPYAA
                     SPANPVGTALPDPGSVAAVPHTANGTGTGAAVASTAQSAEGVLPADLITAKKGMSNAL
                     LVSGAHTASGHPIAVYGPQTGYYAPQILMVQELDGPGLRSRGASFPGLSFYVEIGRGL
                     DYSWSATSANQDITDTFAVDLCEPGGGTPSTSSTGYLLDGACTPFERLTQHNAWQPST
                     ADSTAAGSYDLVALRSAYGLVTHTGTVGGRPVAYTALRSTYRHEVDSVIGFQQFNDPA
                     AITSAAAFQRAAQDIGYTFNWFYADADHTAYYNSGTEPLRAPGTDPDLPILARSGYTW
                     QGWDRAANTSAVEPPARHAQSTDQDYYVSWNNKQAPGFTSAWGNGAVHRADLLDTRVK
                     ALAQRGGVTRTDLVQAMEDAANVDLRAERVLPELLAVLDSAPVADPAAAAAIAKLRAW
                     AAGGSHRREASKGAGAYTDAEAIRILDAWWPLLVEGEFRPGLGDAAWGALTAVAPINE
                     TPSGGQLGATSGGDDIAAGQAHKGSAFQHGWWSYVDKDLRTVLGRPVTGPLDRAYCGG
                     GAPAACRQLLLTTLGQAVATPATTTYPADKYCAAGDQLCADSIVHRAMGGITVPRIAW
                     QNRPTYQQVVEFPARRTDDLTNLARGATATASDYQDAVVVAYPPKQAVDGDPGTRWAS
                     KTVATAWLNVDLGSVRKVGRVVLDWSDQYATAYRIDLSTDGTTWRTAYSTTTDRGGLE
                     NRAFPPTDARHVRIVLLARGTDNRYSLDEVGVYAK"
     CDS             complement(703580..704107)
                     /codon_start=1
                     /locus_tag="KSE_06330"
                     /product="hypothetical protein"
                     /protein_id="BAJ26474.1"
                     /transl_table=11
                     /translation="MELSRYGTLTGGARRELLAVYADVRAPLLHLPNYRVAAFAERLD
                     GYAAGPGFGLVLGRAEGSGVVGYAYGTTVAAGDRYWARMAEPLPAGFTDAPVLALREI
                     GVRAAWRGSGTARRIHDALVAGRAEGRAVLMVNPLAGEGKVLRVYESWGYEAFNSQAA
                     TADSPRLLVMVRPAR"
     CDS             complement(704145..704684)
                     /codon_start=1
                     /locus_tag="KSE_06340"
                     /product="hypothetical protein"
                     /protein_id="BAJ26475.1"
                     /transl_table=11
                     /translation="MRTPRRSATARSVPALAAAVLAAVLVPAGTAHGQTVLLDCAAST
                     TATYSPAVTDTAQSVTVDASTSWTCTGLPTGYTSATASDHYTTTLTCTDLLNFPTGSK
                     TYTWNDSTTSTFSFTRINTRVVNGTTVVELAGSITAGTFQGATVSSTAVAANTQLDAC
                     STTGVAELDFTGDTVITGL"
     CDS             complement(704806..706902)
                     /codon_start=1
                     /locus_tag="KSE_06350"
                     /product="putative peptide ABC transporter ATP-binding
                     protein"
                     /protein_id="BAJ26476.1"
                     /transl_table=11
                     /translation="MTVPLLSVRDLGVDFDGHPAVRGVDLDLWRGETLGLVGESGSGK
                     SVTALALLGLLPDGARVRGSVRLDGRELLGLPDRQLSAVRGRRIAMVFQDPLSAFTPV
                     HRIGDQIAEALRVHQDLGRAAARRRAAELLDLVGLPDPARALDAFPHEFSGGMRQRAM
                     IAMAVANDPDVLLADEPTTALDVTIQAQVLDVLRTARRETGAALVLVSHDLGVIAGTA
                     DRVAVMYAGRIVETAPVHDLFTAPRHPYTLGLLGAVPRLDGPGGPLVPIPGRPPTPDD
                     PPAPGCAFAPRCPLAEARCHDAEPALAGLEGAQASVLLAAPPAPAAEPLPPAADAHLA
                     ACVRAAHLAAVRPAPAEVYPVPALPAAVPGAGDGREPVLVVRGLRRSFAGRRGGVLRR
                     RGGEVHAVDGVDLDVRRGETLGLVGESGSGKSTTLSEILRLAAPQGGRIELLGQDTGT
                     LDRAAVRRLRPRVQMVFQDPAASLDPRMPVGDVLAEPLLAQRVPTAEARRRVPALLRQ
                     VGLDPAHADRYPHEFSGGQRQRISIARALAVRPDLLVLDEPVSALDVSVQAGVVNLLQ
                     QLKAELGLAYLFVSHDLSVVRHLADRVAVMYLGRTVESGPAADVLGRPRHPYTRALLA
                     AVPLPDPAAERARPRLLLAGDPPSPTARHTGCPFRARCPLHTTLPPARQARCATEPPT
                     AEPGDGHTAACHWSDG"
     CDS             complement(706899..707912)
                     /codon_start=1
                     /locus_tag="KSE_06360"
                     /product="putative peptide ABC transporter permease
                     protein"
                     /protein_id="BAJ26477.1"
                     /transl_table=11
                     /translation="MSAPATALAEPAEPAEPADAADPVVPRGRLRLAAARLAASRGAL
                     TGLAVLALLFLLAFAGPWLTPWDYAAPDYTALRQPPSATHWFGTNGLGQDVFAQTVRG
                     LQKSLAIGLLVAVLSTGLASLVGACAGYFGGWTDRLLTFLVDLMLIFPAFLVIAVLSP
                     RLRGSGWIAFVLLLAGFNWMVTARVVRSLTRSLREREFVAAARYMGVGPFRTIWRHVL
                     PNVSSFLIVDATVAVGGAVMSEAALSYFGFGVRPPDVSLGTLLAAGAAEAPVFPWLFY
                     FAAGLLVLFVLAVNLVGDGLRDALDPTAAGDRRSRRPSGSRGSRGSRGSRRFRRSRRG
                     GAA"
     CDS             complement(707909..708892)
                     /codon_start=1
                     /locus_tag="KSE_06370"
                     /product="putative peptide ABC transporter permease
                     protein"
                     /protein_id="BAJ26478.1"
                     /transl_table=11
                     /translation="MTRYLAGRLGYYAALLLAAVFLSYVLTGSALGPRAYFEAKQPRP
                     SAASVDRQLTALNLNDRTPVVERFGTWAGGLLRGDLGRTIHGTAVNDEFGRRIWVSLR
                     LLLVGSLLGMLLGVAAGAWSAVRQYRISDRLLTVFSFVLLSTPVFLVALLLKNGAIAA
                     KDAAGHEVVPFTGYETPNLAGGLGTHLADWALHLLLPTLSLALGGLAAYSRYQRATML
                     DVLGADYLRTARAKGLTRGRALVRHGLRTAVIPMTTMFAYAFLGLFTGAAITETVFGW
                     HGMGEWFIQAVNEQDVNSVAAVNLFAAVVVLAAGLLADTLHAALDPRVRTA"
     CDS             709253..710959
                     /codon_start=1
                     /locus_tag="KSE_06380"
                     /product="putative peptide ABC transporter
                     substrate-binding protein"
                     /protein_id="BAJ26479.1"
                     /transl_table=11
                     /translation="MRRPPAPRPTGHRTGRAAAAALAVLLAATACSSAGGGSADVAKT
                     VAPTVDAEDNNPQPPENVKDGGELRLPLQQWITQWNPYQVDGRYGDAVEIMYYTEAKL
                     FRVDAKGVFHPDPSYLVSAEVTSTSPQVVTYKLNPKAVWSDGTPIGYRDFAAVWKASN
                     GKDPAYNIADPSGYEQISAVEQGKDPGEVKVTFAEPYADWQNLFNPLLPAAGISAPAD
                     FNEGWVEKVPLFGGPFVVSKADKTAQTITLTPNPHWWGPKPKLDRITYRVLDAAAITQ
                     AFLNNETDFASAGSAASYGQLKDAPDAAIRTGTPWDEVHISFGGNGPLADQKVRQALG
                     RALDRASLIKIANKGVPVEFKPLGNHLFMTNQNGYRDNSADWAAYDPATARKWLDEAG
                     WKDAGGSRSKDGQPLELHYVLNDSSNQAQADLATAVQNMLQQVGVKLTVDKVPSKEYF
                     TKYINQGKFDLASWRNTDSFPLSQTVSIYRAPQGDNVFGNYSKLSTPEIDALLRKAAA
                     TLDPAAAAELYNQADAKIWELGHTLELYQRPSIVAVRKGLANYGAGSLASTVITSVGW
                     QK"
     CDS             complement(711005..711976)
                     /codon_start=1
                     /locus_tag="KSE_06390"
                     /product="putative prolyl aminopeptidase"
                     /protein_id="BAJ26480.1"
                     /transl_table=11
                     /translation="MDDLLYPPTGPYDRGFLDTGDGNRIYYEQLGNPAGKPALYVHGG
                     PGAGTPDRPTRAWDPERYRLVRFDQRNCGRSTPHASDPAADMALNTTDHLVGDMERLR
                     EHLGIERWLLNGASWGSTLLLAYAQRYPERVSEIVIQAVTTTRPAETDWLYHRVAAFR
                     PEAWDRFRAAVPEHTWDGDVYALLAAYARRMEDPDRAVRAAAADAWLAWEDAVITGEP
                     NGIPGMYGDREADDRIAFVRICAHFFSHGAWLAEDQLLRGAHRLKGIPGVLAHGRYDM
                     GSPVQTAWELARVWPDARLHVFDDSGHVGSEALRRTVLAALEEFKHR"
     CDS             complement(712103..713479)
                     /codon_start=1
                     /locus_tag="KSE_06400"
                     /note="Similar to N-acetyl-glucosamine transferase in
                     Leifsonia xyli subsp. xyli (Q6ACT7)."
                     /product="hypothetical protein"
                     /protein_id="BAJ26481.1"
                     /transl_table=11
                     /translation="MTSSEPSGLLGLLSDLSLVLSLLFPLYLLTLVLPLLVRRTRRPG
                     KAADYEWHLFVPCRDEEAVIGDTLHYLRRSCPEAHIWVIDDDSEDRTGDIVRWAAIQD
                     PAIHLVQRRRPNARLGKGEALNAAYDALCAALPPGTDRTRVVVGVFDADGRPAPGCLD
                     HIAARRFLGRADIGGVQIEVRMMNRDDARPAPDGGAVRNLYSRLLIRMQDLEFRAPVA
                     ALQHARKTSRTVCLGGNGQFVRLAALDDLDAERGRPWTGRLLEDFELGIHLMLVGWIN
                     SFCADTYVEQEALFDTKRFLTQRTRWAQGVMQCLGYIPAIWRSNRIPNTGFLELTFFL
                     CQPWLQLLGALLYPLPMIALVLSWQRHPEAALDYLSDGGWRGLLLYAVMAVGQFVIWG
                     PIYRRKCEPGTGFWRALGWGLVYPAYLLFLYVVSWRAVGRMLSGRNGWAKTRRNAEAA
                     AGPVAKEA"
     CDS             complement(713838..714992)
                     /codon_start=1
                     /EC_number="5.1.3.14"
                     /gene="mnaA2"
                     /locus_tag="KSE_06420"
                     /product="putative UDP-N-acetylglucosamine 2-epimerase"
                     /protein_id="BAJ26482.1"
                     /transl_table=11
                     /translation="MAPPPPAPPARDIAVVLGTRPEIIKLAPLIRLLGDRGRIVHTGQ
                     HYDSALSGAFFANFGLREPELRLDGAAGAGGRGDQIGTLTRDLARAFTAEPPRAVVVQ
                     GDTNSTSAGAQAAHYCGIPVVHVEAGLRSGDRAMPEEINRLVVGVLADAHCAATAEAA
                     ANLRATGTDGDRIRITGNTVVEATLHSLPAPAERDRIVRELGAPADFVLATAHRPENT
                     DRPDRLAALLGSLAELGELGHPVLLPLHPRTRGRVKEFGMEHLLAGLTVVDPVDHPTF
                     LALADRAALLVSDSGGVQEEATVLKKPLLVVRTSTERPEAVAAGFSRLVEPGAELTAA
                     ARALLADDGLAGRLRDTPSPYGDGRASERIRAIAVALADGAPLPGDAPGH"
     CDS             complement(715208..716617)
                     /codon_start=1
                     /locus_tag="KSE_06430"
                     /product="hypothetical protein"
                     /protein_id="BAJ26483.1"
                     /transl_table=11
                     /translation="MANGVFHTLYGIELNLTRPDLGHPDRPGLLAEITAPIDRREREL
                     LECLQHHREGRCEAEDRAAERSPWMHVRRRTVGGRTTWVAAHLPLRRTPTPDEDDRRK
                     ALQERIARAADRHGCRYELGARGGGGSGSGGGSADGTGGGSRIRSDVLVTGPGGLRIG
                     WAAQYAPISAEAVRRRSRAAAEHGIVPLWVTCDRRAALIDRAPWARVDDLPWQRIASR
                     STRMTVRAGVRHLQQWKCVRGSARPCPLNGSWCGRMHTGWYLPALCLPARPPLDVEEL
                     VGASAAGELVPLRVPLRPGAAAAAGAAGAARMWAPVADRDRWRETVAEEEPSGPGAPF
                     DAGVDYAYEELDPVCRYREEEGRAHGGPRLPRSRRHAHHRGYPAADAGADADAGAVAL
                     HTRDTVPRRLLVIPPQVRRGLVVTDEERRAAAVLLECHIAHVGPCGGCGAPIDRYGPR
                     GAHACAPCRARVMAGALRG"
     CDS             complement(716798..717229)
                     /codon_start=1
                     /locus_tag="KSE_06440"
                     /product="hypothetical protein"
                     /protein_id="BAJ26484.1"
                     /transl_table=11
                     /translation="MINEPRRPQGGQQAATPPRVPEPAEPHGRPAGPHQLGHHASGHH
                     PSGHQAHGSQQHGSQPHGPQAHGHQPGGHQLGGHPSHGPQSLGHQAAAQLLGLREVML
                     PAAVVAAADLLLGDALGSDDPVTREAAAATRGRLRAALGLG"
     CDS             complement(717338..717634)
                     /codon_start=1
                     /locus_tag="KSE_06450"
                     /product="hypothetical protein"
                     /protein_id="BAJ26485.1"
                     /transl_table=11
                     /translation="MTEPAHTSPLPVVRPQWTLLQPLLASLSAAGVPLRPGDLDQLQH
                     AAAIGPEFAHALARWIRDAHTAGPAQPPAAAVRSLAPRAERPALGPAVADRHAS"
     CDS             complement(717732..718049)
                     /codon_start=1
                     /locus_tag="KSE_06460"
                     /product="hypothetical protein"
                     /protein_id="BAJ26486.1"
                     /transl_table=11
                     /translation="MDTRLTARERVLLAEIEHRLRRTDPRLDRRLARRPGPVARCAHR
                     PGVLVVTVALSATAAAAAALWAGALWVGAGGPWAAPAVLLAVGAALLSALALRRLARR
                     GGA"
     CDS             complement(718159..718704)
                     /codon_start=1
                     /locus_tag="KSE_06470"
                     /product="hypothetical protein"
                     /protein_id="BAJ26487.1"
                     /transl_table=11
                     /translation="MRSHDRTSADRRLSRIHRLGAGLCALLLATFGALGLADGLPYFG
                     TRGEPVAGLSGNGLLSTVSLATAAVLLAAALLGGRQASTVTTTVGALFVLSGFVNLAL
                     LDSPANVLAFRVPNVLFSFAMGLLLATLGMYGRVSGGLPHDNPYWLRRHPNAARPNAL
                     PPNAVLPSAVPGRAALPGGRG"
     CDS             718906..720033
                     /codon_start=1
                     /locus_tag="KSE_06480"
                     /product="putative MerR family transcriptional regulator"
                     /protein_id="BAJ26488.1"
                     /transl_table=11
                     /translation="MPRPHTLPTLTTPPAPPETRPASSPGPDTADDPSAVPDPAPTDD
                     PAPADDPGLPTGAVARQLGVSPTTVRSWERRYGIGPSRHEPGRHRRWHSEDVSVLETM
                     CRLTAHGLPPGEAARTALAQHPGHAQHPGHAPRPADPPEPDRAPRPDRTPPLAAAPRP
                     PAPRPGSRGLAAAALRLDAPEVARLLGAAVDALGTVRAWTEVMAPALRAAGRRWAADG
                     ERYVEVEHLLSWQVSSVLRAVALRAAAVPVRPGPPLLLAAMPGEQHSLPLEAVAAGAA
                     ERGLPFRMLGASVPARALLDAQRRLGPSAVLLWSQNAQTADHRLVRLLAESGWGHRGA
                     RTASAVLVAGPGWGPSGPPSAAALPRSLAGALDLAARALPR"
     CDS             720172..720612
                     /codon_start=1
                     /locus_tag="KSE_06490"
                     /product="hypothetical protein"
                     /protein_id="BAJ26489.1"
                     /transl_table=11
                     /translation="MIEVVRELAVRRPAGEVLAYLADFAHTVEWDPGTVECVPLGAGG
                     GRWRNVSVFRGRRTELVYERVVRESDRLVFVGRNRTVTATDEIVLHPGPDGTVVRYRA
                     RLRFHGLARLATPFLRREFEGLADAVARRLPEVLDGGRRAADGS"
     CDS             720799..722073
                     /codon_start=1
                     /locus_tag="KSE_06500"
                     /product="putative oxidoreductase"
                     /protein_id="BAJ26490.1"
                     /transl_table=11
                     /translation="MAVVGAGVAGLSAAYALARAGAVVELFEAADRLGGHAHTQRTTA
                     ADGRELALDTGFLVHNTRTYPELVKLFEELGVRTQDSDMSMSVSCAGCGLEYAGARGP
                     GGLLAAPGNLVRGRYLRMLGEVPRFHRLARALLADQGQGDPSLRAFLDGHGFSPYFVR
                     HFMTPLVSAVWSCAPDVAGDYPARYLFAFLSNHGLLSVTGSPTWRTVTGGSATYVARI
                     AERVAARSGTVHRDAPVRAVRRHPDGVTVTTEDGRSTRADAVVVAVHADQALRLLADP
                     TAAEQEVLGAFGYSRNPTVLHRDASLLPRAAWARASWNYRMPGCDASADRVRVSYHLN
                     RLLRLGGAEDYLVTLNEDEQAPVPADLVVSRTVYEHPVYTARSVAAQRRLPELTTART
                     AFAGAYHGWGFHEDGCRSGLAAADHLLAAVAP"
     CDS             722070..722870
                     /codon_start=1
                     /locus_tag="KSE_06510"
                     /product="hypothetical protein"
                     /protein_id="BAJ26491.1"
                     /transl_table=11
                     /translation="MSRPAAPLPGPWGAVLYETRTTHVRAQPRRLFRHRGFLWLVDLD
                     RLPELPRPLRPLARFLPRDHTPSDTVALRADLDRELAAHGLPPAGRVLMLTQARSLGY
                     VFNPLTVYWCRDAAGAPLCTVAEVHNTYGGRHRYLLPPDAAGRAETAKAFYVSPFLPL
                     DGRYHLLLPEPAPDGARLHLAVRLDLPGGRAFTATVSGTGRPATPAALLRAVLRHPFA
                     TYAVSLRIRAQGIRLWLRGLPVHPRPTTTAPAPAAAPAAAGPGGATRR"
     CDS             722867..724204
                     /codon_start=1
                     /EC_number="2.1.1.79"
                     /locus_tag="KSE_06520"
                     /product="putative cyclopropane-fatty-acyl-phospholipid
                     synthase"
                     /protein_id="BAJ26492.1"
                     /transl_table=11
                     /translation="MTTTSPSPSPSPSPSPSWRGRPPMTVTTVHPPAVDPLRWPDVAR
                     VPHAPLRAAAAGRLLRRAAALRGLRIELPGSPDAPGSPDAQDAPVLRLHRPAAFAHRV
                     GAGGLIGFGEAYQAGDWDSPDLARLLTALAARPETLVPPGTGWLRRLYVRRPPAAERP
                     TTANAPRNIHRHYDLSNELFALFLDPTMSYSSAVFSAPSAATRWADLVPAQHRKIDRL
                     LDLARVGPGTRLLEIGTGWGELALRAAARGAEVTTLTLSAEQLALARRRIADAGQSDR
                     VDVRLCDYRQARGSYDAIVSCEMIEAVGRPFWPAYFTALDRLLAPGGRVALQAITMPH
                     DRMLASSDTYTWILKYVFPGGQIPSLRAIADTAAAHTRLRVHSADAYGPHYAETLRLW
                     RERFTERAGQVAELGFDEVFRRMWELYLAYSEAGFRTGYLNVHQVLLDRDGER"
     CDS             724201..725019
                     /codon_start=1
                     /locus_tag="KSE_06530"
                     /product="hypothetical protein"
                     /protein_id="BAJ26493.1"
                     /transl_table=11
                     /translation="MNAAAFAVGAAAAAGAALTVMLLAFAVGLRTGRHRDVDTAWGLA
                     FTAVALTGCGLSAGYGDDGRRALATALVTVWGLRLAAHLWWRARGLPEDPRYARMLAK
                     APAGPARTRYALRIVYLLQAALVWFVALPVLAAQYQPTPPGPTAWAGTALWAVGLFFE
                     AVGDAQLARFKADPANRGRVMDRGLWRWTRHPNYFGDACVWWGLFLLAADTPAGWLFV
                     GSPLLMTWLLAFGSGKPMLERHLATTERPGWAEYTARTSSFLPLPPRRHRDNAS"
     CDS             725198..725782
                     /codon_start=1
                     /locus_tag="KSE_06540"
                     /product="hypothetical protein"
                     /protein_id="BAJ26494.1"
                     /transl_table=11
                     /translation="MDWQSESPDLWAFLESLHRGDIVSGTVAAIERFGVFVTLDDGPA
                     HPTFPGVGFITIPELSWRHIDAVTDVVQVGRRVSCEFLQFDTHNAEARLSLKALEPDP
                     LRAFADHTAAGQELRGTVGKVLPFGIFVNLGDGIVGLVPFREVHGRAAVSPVEDFEAG
                     EEIAVIVTEIELPTRRVFLSRPKGGRHEDAVPAT"
     CDS             complement(726052..726819)
                     /codon_start=1
                     /locus_tag="KSE_06550"
                     /product="hypothetical protein"
                     /protein_id="BAJ26495.1"
                     /transl_table=11
                     /translation="MTTTDPYTGTGHPDPHTLTGAYAAHALDPEENDAFERHLVHCPS
                     CTRETAEFAAALARLGAAEAVPPPPELKARVLAALPGVRQEAPQVADRPVAPPGRPAR
                     RAPRWALAACLALALGAGAVAVRQHQDAEQARDRAAALTRQQETLTALLTAPDSHTAS
                     APAGGGGTGTVVWSATRGRAGFLATGLPDPGPGRTYQLWYDDAGTMRPAGLLPTGSGT
                     LLLTGPLDGAAGVGVTVEPTGGSPHPTGAPVLLLAFG"
     CDS             complement(726816..727403)
                     /codon_start=1
                     /locus_tag="KSE_06560"
                     /product="putative RNA polymerase ECF subfamily sigma
                     factor"
                     /protein_id="BAJ26496.1"
                     /transl_table=11
                     /translation="MSHVVSLAPPRRPGPDLRELLARVVRGDQDAFSALYDAVAGPVF
                     GLVRRVVRDAAQSEEVAQEVLLEVWRTAARYRAERGEVLPWVLTIAHRRAVDRVRSAQ
                     AAADRDRRAATAAHGGAAYDEVAEQVEGRLEREQVRRCLRTLTELQRESLTLAYYRGY
                     SYPEVAEVLGAPLGTVKTRMRDGLIRMRDCLGVGA"
     CDS             complement(727603..728004)
                     /codon_start=1
                     /locus_tag="KSE_06570"
                     /product="putative sporulation and cell division protein"
                     /protein_id="BAJ26497.1"
                     /transl_table=11
                     /translation="MAVATCWSTAVTLPHSPHPHLAVEAGLHFDSALPYAVRLVFPPV
                     GRLDAVEWVFGRDLLNEGRLAPAGHGDVTVRPGAEGEVLVTLRGGGGEAVVNVPAEIV
                     TGFLVECYALVPAGREHEHLDVDGLVARLTV"
     CDS             728230..729594
                     /codon_start=1
                     /locus_tag="KSE_06580"
                     /product="hypothetical protein"
                     /protein_id="BAJ26498.1"
                     /transl_table=11
                     /translation="MDRARWRELLGLWSGEWITARQDDPGAGPLAPEVLRDRWLGFAP
                     ATEAAVAAAEARLGRPLPPSLREFLLVTDGWRNAGLFIERMAGTTELAWLRDTPDRTW
                     IRTWEGLAEDAGEGEDTDGDGDADDHDAWLTRQARVLARSLRLSLAGDSAVMLLDPED
                     VDEDGEWAGYWLASWSGLGPERFGSFAELMYRQWRSLHAVCRPAGPTRDFWDGETERG
                     RRAALAGELDTALDLLEEAQAFGRPRAGLLATQLRALLHGWERELPGAFRGARDQETY
                     LAEPLFSREFLPVLLRQEREARHDSLLPLPGLRESAPEPTRAAIAAYEAASAEPGFRL
                     VFGPPEFDAAVHALVERLAAHRAAAREAQRAPAVPPPGVVVLTATVTRWVDGQQRPAP
                     PVEPRFPEEFAERAWAELLAAMPLWRPLDANHLAPVSLLAEPLLAELVTHERAHALLS
                     IPRG"
     CDS             complement(729641..730537)
                     /codon_start=1
                     /locus_tag="KSE_06590"
                     /product="hypothetical protein"
                     /protein_id="BAJ26499.1"
                     /transl_table=11
                     /translation="MMEEPCWSPARRTVGRAGGAEVEGTPMVSKGEPDPRDEVTADEV
                     AAELARIAGEVEDRDEDPRGPLARRMGTLVVKLGGPLGRGGRRLGAGSRTGLRVLTDR
                     LLDAAPRIPVRDLATLRAQHPGAATPEELADLLTTGSVRASTAVGASAGAVAMMPVPL
                     AMPVELASELLASAAIELKLIAELYAVYGQVPPGTARQRSYAYLAVWSQGRALDLTRP
                     GALLALNRGAALRRQVSKRLTRAGLRKLPTLAPLMAGALLGARINRTDTLRLAVTVRM
                     ELRERRPADLGYWDAAEARPER"
     CDS             730659..730886
                     /codon_start=1
                     /locus_tag="KSE_06600"
                     /product="hypothetical protein"
                     /protein_id="BAJ26500.1"
                     /transl_table=11
                     /translation="MGLGGCIILLAVGAILAFGVDWHLAGVNLTVVGVVLMAAGLIGV
                     VVYARVLGRRRYLGGRAVNEVVVEEHHRDVL"
     CDS             731082..732167
                     /codon_start=1
                     /EC_number="1.2.1.66"
                     /locus_tag="KSE_06610"
                     /product="putative NAD/mycothiol-dependent formaldehyde
                     dehydrogenase"
                     /protein_id="BAJ26501.1"
                     /transl_table=11
                     /translation="MAQVVRGVIARAKGAPVEVVPVVVPDPGPGEAVVRVQACGVCHT
                     DLHYREGGINDEFPFLLGHEAAGVVESVGEGVDEVAPGDYVILNWRAVCGRCRACKRG
                     RPWYCFATHNAKQRMTLEDGTELSPALGIGAFAEKTLVAAGQCTKVDPAASPAAAGLL
                     GCGVMAGLGAAINTGQVGRGDSVAVIGCGGVGNAAVVGSLLAGAGRIIAVDVDDRKLE
                     TARQLGATHTVNSRTVDPVAAIRELTGGNGADVVIEAVGRPETYRQAFYARDLAGTVV
                     LVGVPTPEMTLELPLLDVFGRGGALKSSWYGDCLPERDFPMLIDLYLQGRLDLDAFVS
                     ETIPLDGVEEAFARMHRGEVLRSVVVF"
     CDS             732167..732796
                     /codon_start=1
                     /locus_tag="KSE_06620"
                     /product="hypothetical protein"
                     /protein_id="BAJ26502.1"
                     /transl_table=11
                     /translation="MAARIEQLVTSGEFSLDGGTWQVDNNVWIVGDDAEAIVIDAAHD
                     AAAIKEALGGRRLLAVVSTHAHNDHVDAAPELADLTGAPVLLHPADEVLWRQTHPDRA
                     PDGPLADGQELSVAGTVLTVLHTPGHSPGAVSLYAPELGTVFTGDTLFAGGPGATGRS
                     FSDFPTIIESIRGRLLSLPPETVVRTGHGDSTTVGAEAPHLDEWIARGH"
     CDS             complement(732848..733456)
                     /codon_start=1
                     /locus_tag="KSE_06630"
                     /product="hypothetical protein"
                     /protein_id="BAJ26503.1"
                     /transl_table=11
                     /translation="MQVTGYAPREVADLRGRAGGALELRYGPDAVVVVGGVPGSGKST
                     LLRRWDAPAALVDPRLTRLACQARLPAAVPYALYRPAVRTLHLLRTRAAFRRPGPLLV
                     HDCGSRWWMRRALARWARRNGRELHVVLLAVRPAEALAGQRARARTAAPRTFRLHVRR
                     IARLVAGIERRGRAAFPGAASVLLADAASRGRLAGVRFGPRR"
     CDS             complement(733498..733704)
                     /codon_start=1
                     /locus_tag="KSE_06640"
                     /product="putative 3Fe-4S ferredoxin"
                     /protein_id="BAJ26504.1"
                     /transl_table=11
                     /translation="MLVHVDPDRCCGAGQCVLAAPDVFDQDERDGTVVLLAARPPADL
                     AREVADAVAACPGGAIRLEEGVPR"
     CDS             complement(733788..735011)
                     /codon_start=1
                     /locus_tag="KSE_06650"
                     /product="putative cytochrome P450"
                     /protein_id="BAJ26505.1"
                     /transl_table=11
                     /translation="MATAAPATSHPAAAHPATSHPAPRGACPFAPPPAYQQAVRDEPV
                     TRVALWDGAPCWLVTRHQDTRDVLADPRFSADAARPGFPFLSAAARQIGAGKTSFIRM
                     DDPEHSRLRRMLTGDFTLRKTAALRPAIQQVADRLFAAMTTGRTRADLVADFALPLPS
                     LVICLLLGVPYEDHEFFQRCSRSLLNRDSPVEEVLAAQDALTEYLDTLTDSKRGNPDD
                     GILSRLVERGELPTEEIGAMGRLLLIAGHETTANMTALSVLALLRHPDQLAHLRAHPE
                     ATPAAVEELLRWLSIVQTGVTRVAVEDVEVGGVLIRAGEGVICQLNTANRDEDRYPDG
                     DTLDLTRDTRRHVAFGFGVHQCLGQPLARLELEIALDTLLRGLPDLRLAVPFEEIRFR
                     HEMTVYGIETLPVTW"
     CDS             735549..736133
                     /codon_start=1
                     /locus_tag="KSE_06660"
                     /product="hypothetical protein"
                     /protein_id="BAJ26506.1"
                     /transl_table=11
                     /translation="MSFDPLAMLTAFGLIFLAELPDKTMFASLAMGTRMRPLYVWFGT
                     SAAFLVHVALAVGAGSLLGLLPGLAVKLVSAALFGFGAFVLLRSGGDDDDEEGGAKTV
                     TGFWPVWGTAFMTVFIGEWGDLTQITTANLAATNGWLPTAIGSAAALMSVSALALLVG
                     RFIAKRVPLRTVQRVGGLCMVVLCAWTLFEAFTA"
     CDS             complement(736272..737864)
                     /codon_start=1
                     /EC_number="3.4.24.-"
                     /locus_tag="KSE_06670"
                     /product="putative metalloendopeptidase"
                     /protein_id="BAJ26507.1"
                     /transl_table=11
                     /translation="MSPSSARRRALGTAALAALLLASATTATTGSATAAPGRDAAVAR
                     ARANVAGHAALFGYGPGQELVLRDVVLDPDGAQHVRFDRTYQGLPVVGGDLVVHQDAR
                     GRLADSSRAKGHDPAVPTTRPAVPAQRGAAEALGQAPGISGAVSVPELVVWAADGTAR
                     LAWRTTVSGTGKQGQPAGRVVVTDATTGAAIDSYDAEHSATGTGHSEYTGDVPLATTQ
                     QPDGSYALIDPVRGHTTKDAHNLAANSVKATSGTLYTDTDNVWGDGRKFSADRATAAV
                     DAHANTAWTYDYYKNTFGRSGIKNDGKGATVFVHVGTDWDNAQWSDACFCMMTGDGNG
                     TTDPEQVDLDTMGHEMTHGVTSATANLRYSGESGGLNESTSDIFGTMVEWYAGNALDQ
                     GDYLFSDQSTPPWLRRFDKPSLDGGSADCWSKSVGRLDVHYSSGVGNHWFYLASEGSG
                     AKTVNGVAYNSPTCNGSTVTGIGNQKVAAIWYRALTVYMTSTTDYKGARTASLNAARD
                     LYGAGSAEYAAVGAAWSAVSVS"
     CDS             complement(737969..739156)
                     /codon_start=1
                     /locus_tag="KSE_06680"
                     /product="hypothetical protein"
                     /protein_id="BAJ26508.1"
                     /transl_table=11
                     /translation="MVDAAEPERHAGWNELFFDLIAVAGVGQLAHLLHAGPGWGAVGL
                     YGLLVGAFWLSWACFTVYGDVVAERTSSFALFVAMAGMAVMAAAVEGVHEEARANAFA
                     LVYVLLRWYAGRLWRQGRSLLVVPDWPIAQYGAGAVPWLVSVVAPDGWRYWLWGAGLL
                     VDALLLLAVREDGERVASRWAARRERHQGGPGPDRPAPELREAGVDAAHLGERLGLFM
                     VIVLGEGVVQVIRAASDQQHWDVRLAWTGLAAMTLLASLSVLSVRRGAAAFPQLVAGG
                     RPRWVMLCHAAGSAALAALAAGLGRAVEHADGTLPDDTRRLLCAALAGYFAVTLAAVL
                     PTLDGPGQVRGVLVHTVPAVLLSLLLALLPVSLAAGPVVLLLLLATLWARGYRVGRPE
                     RRG"
     CDS             complement(739209..740573)
                     /codon_start=1
                     /locus_tag="KSE_06690"
                     /product="hypothetical protein"
                     /protein_id="BAJ26509.1"
                     /transl_table=11
                     /translation="MTATPLAKGANLPVAATAVRARLDRATGPGTPGLSAAALVLGAD
                     GGPRLLRAGERAAGVAVRPDGADVDLAAQPPGVQRVLLLAVSDGAGLGAVPGLALLLD
                     DARDGVGLVRFEPGAGAETALVCGELYRRAGGWKFRAVGQGWTDGLAGLAVAHGFTLR
                     EPQPQPVPPQPEPVPPQPEPVPPQPVQPAAGPSPSPEPAQLTAEEQALPVDMRKRLTL
                     RKQQVAVSLRKHGAQHLTARVILVLDASGSMSALYHRGVVADVVERMAAVAAQLDDDG
                     AMQAWTFATHPARLPDLRLADLPDWLRLHVRVGELSLFGRRRIRPPLPDGRVDMKAVG
                     FQNEEQRVIAQVRDHVRANPAADPTLVLFFSDGGVYRNAEIERELRAAAEEPVFWQFV
                     GLGDGDYGVLEHFGTLPGRRVDNVGFFAVDDISTLPDPELYDRLLSTFPQWVTAARRA
                     GILR"
     CDS             740748..741521
                     /codon_start=1
                     /locus_tag="KSE_06700"
                     /product="hypothetical protein"
                     /protein_id="BAJ26510.1"
                     /transl_table=11
                     /translation="MNRLQTRPRAEVLVETRGAVSAGAPEYARGKVAAVLERLDEPVL
                     AVRVRLAQEANHAVARPSLAQVVVDLNGRPVRAHVAAATMREAVDLLQDRLAARLARL
                     RHHRRGPEHRPEHRPEQRPAHRPERRVRPPEERQVVRHKSYGLARRAPLDAVGELEAM
                     DYDFHLFTDADSGRESVVYRGTAGGYRLASAGPLPAAAVPGLVASRLGVPVLTPGQAR
                     GRLDLSGLPFVFFTDAATGRGNVLYHRYDGHYGLITPAG"
     CDS             complement(741701..742720)
                     /codon_start=1
                     /locus_tag="KSE_06710"
                     /note="Contains an Endonuclease/exonuclease/phosphatase
                     domain (IPR005135)."
                     /product="hypothetical protein"
                     /protein_id="BAJ26511.1"
                     /transl_table=11
                     /translation="MAAGRRPGRSVVTDDGTPENEPVGEKRRWWRRAAAVLGGVLLAG
                     PAVLVAVRLAGWDDGTWWALPMAGLPYAALLCAVVLAVAAALRLRWVGGVAAVLVVVQ
                     LWWLVPRFVPDGDDAPAGAPRLRVATSNNYMGQVSPKSLVDLVREQRIDVLAVEEQSD
                     SAAAALDAAGIRELLPHRERPADRDTAIYTRLPVTAAADPGWPTVNLTVEVGGRPVQI
                     VAVHTYYPLGDARRWAEDLHELTAAAPGRTRNAVLLGDFNATLDHRPMRDLVDTGLSD
                     THEELGAGLFPTWPENHPDFRGVPPVIQIDHVLHGPALTAVTVSEHALPRSDHRAVVA
                     ELAVG"
     CDS             complement(742865..743719)
                     /codon_start=1
                     /locus_tag="KSE_06720"
                     /product="hypothetical protein"
                     /protein_id="BAJ26512.1"
                     /transl_table=11
                     /translation="MDVLAVLFAVFGAASNAAGTAFQRKAAARLDRGGGLRFLLVLAR
                     DPAWVAGIVGVAGAALFQALALAFGPMALVQPVFVLELPFALLIAAPLLHRRMPAAGW
                     AGVAAVVGGLALFLGCAAPAGAEDQAPMSRWTPVLVGCLGAMALCVAAARGRGPVFRA
                     GALGTAAAVGNALTAALLKSATGTFSDHGPAAFLTAWQTYGFALTGIAAVLLLENALQ
                     AGPLVASQPALTIGDAAVSLLLGVVLFQETIRTGWLLVPELLAVALVAGGVVTLVRAV
                     PNIRDSAR"
     CDS             complement(743822..746578)
                     /codon_start=1
                     /locus_tag="KSE_06730"
                     /product="putative LuxR family transcriptional regulator"
                     /protein_id="BAJ26513.1"
                     /transl_table=11
                     /translation="MPDSATWVSELREPAVAVLPVVPDDLPGTRRVVLFGPPGIGKST
                     AAGLLARRLGRPVLRLAPGPQDAGVPYTGLLELALALPPSPTARDLAAALDEAADPAA
                     APDGTGPALRLRRLTAAALRDAPPVTLVADNAQWLDPASRAVLRWALRLTPELPVITA
                     ERTWRPGSGGHWSGEDAYAVHVPHLTEPQLAALLAPYRPAPGEVARVHTRSGGNPALA
                     LALAEAGGRTPGPPTVRRPADDDPVLPPRARQLVGEWLDTVPDDVRELLTLAALDDRP
                     DLDLLTRLAGPAAAHLLAQAETAGLLDPVPADGRVRFTATAIAAELTTRLPAAARRLL
                     HARLAGASHDSLRRDRHTALAADPTDPRTARHTARAAGHARLRGEHPLAAELSLLAAQ
                     RTPREDPGLLAERALTAVRDASHCGDLPRGRAAARLVLEHDTSPAPRVGALLALLDAS
                     GQRLHGADELFADAIHEAAGRPDLTAQVLLRQAIWANVSEGAPHRAAALAERAARLAR
                     TAGDTTTTALALTMLARVQRVLGHPDADTTLEHALSLPRTALVPVNATPEHLAARHAL
                     FDDRPADARTTLLPLLVQAQRTGDAEAVVDLLRSLAETELRAGRCAEALDYARRAHTL
                     SDRTGMPPGPACYTSALVEGTASRTGTALAHARRGIDASRHEDNRVFLSRNLFALGHL
                     LLTAGRPKEALEPLQEVRALETLQQVRDPSVLRWHADLAEALLAAGRPDEAEELLTDT
                     HRTATDLGRDSVLPALERARALLDAARGQYDTAARRLTDAAEQLRQLPLERGRTLLAL
                     SHTERRARRRAGARTAAQRAADLFTAHGAHPGADAAARALRRLEPGPPADATPQDGAR
                     ARLTDAEQRCAHLAAAGASNRDIAAALTVSVKTVEATLTRVYRKLDLRSRVQLAHAVT
                     PARE"
     CDS             746766..748970
                     /codon_start=1
                     /EC_number="3.4.24.-"
                     /locus_tag="KSE_06740"
                     /product="putative zinc metallopeptidase"
                     /protein_id="BAJ26514.1"
                     /transl_table=11
                     /translation="MSRKNALAAAVAAALALGTLTVVATQSTAAAGTTARPGAGFRAV
                     SADARAEALRTADREAAAVAKSLGFGPDERLVAKDVLLDTDGARHVRYDRTYRNLPVI
                     GGDLVVHYDSNGKATGSDQAHQGAIKVAGVTPKLSASDASAAAAKHAKHVRNAKSDSA
                     DGSTLVVYAVGKIPVLAYRSTVTGDGESGPASREAVIVDAASGAPLDQYELHQGVTGT
                     GNGVTAGQVTIETSQSGSGYTLTDAAHGGTIVYDSYNSPQSNPKQNARTFSKSSNSWG
                     NGSTSSRESAAVDASYGLAKTWDFYQSTFNRSGIRNDGRGAPAYVHVDNQLLNAFYDD
                     NCFCMSFGDGSSQNGNTPVTALDVAGHEMSHGVTAATANLTYSGESGGLNEATSDIFG
                     TMVEFYANNPSDPGDYYIGEKLNMSAGSLRRMDNPASDGNSLGCWTSGAGQVDVHYSS
                     GIGNHFFYLAAEGTGAKTIGGLAHNGTTCNNDTFTGIGRDKAAAVWYRALTTYMTSTT
                     TYASARTATLQAAADLYGANSRERYLISKAWAAVSVGTALPDPGTGSPSPTPSTSASA
                     SPSSSPSSSPSPSASPSTSSTPTGNALANGTFEQGAAGWTQSDNDITNSTLQAAHGGS
                     WYAWMMGYGTSAIESLSQSNIAVPANGSPKLTFWLKVTTAESGPTAYDTLKVNVNGTT
                     LATYSNANASAGYVQKTVDLSAYKGRSVKLEFAGTEDTYLATVFLLDDIAVG"
     CDS             complement(749034..749573)
                     /codon_start=1
                     /locus_tag="KSE_06750"
                     /product="hypothetical protein"
                     /protein_id="BAJ26515.1"
                     /transl_table=11
                     /translation="MSAAPHHPAPATDRTAPTCAGEGFHPHLPAPDAAAQDPAARLHH
                     VRAGELDGDTAQSGGMRRFAAISGRTVGSEKLWMGQTHVAPATASSDHHHGESETAIH
                     VVSGHPEFVFLDDSSGEPVEVRLRTGPGDYVFVPPYVPHREENPDPEHEAVVVIARST
                     QEAIVVNLPSLHTPPPTAS"
     CDS             749787..750224
                     /codon_start=1
                     /locus_tag="KSE_06760"
                     /product="putative Rrf2 family transcriptional regulator"
                     /protein_id="BAJ26516.1"
                     /transl_table=11
                     /translation="MHISAKADYAARALVELACDTGRPLTCEAIASSQEIPFRFLKSV
                     VGDLRRAGLVRSQRGCEGGYWLGRPAAEITLLDVVRAVDGELITLRGEPLTGLAYPGP
                     ADALPGIWREVEERAGEVLAGTTVAALVRRSRRPAPRPLPEAV"
     CDS             750221..751168
                     /codon_start=1
                     /locus_tag="KSE_06770"
                     /product="hypothetical protein"
                     /protein_id="BAJ26517.1"
                     /transl_table=11
                     /translation="MTGPDTPPATGLPPDALPPDALPPGTRPPLEVVEFTDPFCPWAW
                     GSEPALRGLRRALAGAAAHRRVFGILFDDDEEPAPDPDAEAAWYGEFVARVSGHTGAP
                     RAARLRWVAASSWPASLAAAAAERQGPEVAERVLRRLRESAFVRGEPADTPERIAAAL
                     RGVPGLDGAALAAAAASAPVRARVARDRAETRAPRPEVVGLRGPGPHPGGAKEIAAGH
                     RYALPTLLFRGPAGCRVVPGWRSPAEYLGAARAVCPGLAVAADGGPGPAELLCRYGSL
                     TAPEAPDGPPPGAVTVGTAGGPLYLSPREAAVSPLLSAS"
     CDS             751689..753245
                     /codon_start=1
                     /locus_tag="KSE_06780"
                     /product="putative peptide ABC transporter
                     substrate-binding protein"
                     /protein_id="BAJ26518.1"
                     /transl_table=11
                     /translation="MTSSVLPSTASALARRSFLGLGLGAGAALALAACGGATVAQTGS
                     SGSSGTLKWGWALPTSWDPVFSSAGWDVHALSLVYAGLTKLDESGKAVPALATGWTYD
                     ADGTRLTFTLRPGLVFEDGTPLDAAAVKKSLDRGRTEPKSLVAPQLTQVKQVLAPDAT
                     TVVIELASPDYQLPNLLAGKTGLVVNPKAFESDAAALAAKPAGSGPFSLVSYVQNSKA
                     VLRRNPRYWDAGAIRLENFELYPLPDAATVVSGLQSGQFDVAQIPGSQVEAAKAAGLE
                     VQEIPSLVVAVLDVNTTKAPFDNPDVVEALKYAIDREALVKTQLFGHGEVNYQPFPKG
                     YVGHDPASEDLFRHDPDKARALLAKAGHPDGVDLTLTTTTAQGLPEQLQAQLKEVGIR
                     VNIEVIPAAQATQIVYVQHSKTLFTDQFAGRDSAAQAFQVLFGEQGLMNPGRTTPPEL
                     KAAVQQVSRTPLDSPDYPKALRAATALAVRTMPNVFLYSVPRLLARRKSVSPIPAFTV
                     VQRFEGVSVA"
     CDS             753242..754336
                     /codon_start=1
                     /locus_tag="KSE_06790"
                     /product="putative peptide ABC transporter permease
                     protein"
                     /protein_id="BAJ26519.1"
                     /transl_table=11
                     /translation="MSAAAPAGREGTAGSRTAGSRTAGWVLRRAARAPRSLGRVLASA
                     ATVFLLSSLLTFGLGAVSDANPAAAVLGETATPADIARLDHEFGLDRPLWTQFGSWLG
                     HAVQGDLGRSWFTTLPVGDSIAAALPVDLSIAGLALLLAVLLGAAGGVAAALRPGSRL
                     DRSVTALCTLLGTLPAFVVAIGLITLVSVQLRLLPSGGYVPLDQDPAQWLRFALLPAL
                     ALSLDAAAGIARQLRTSLVGALRENWATGAAMRGLSHRRVLFGHVLRNAAGPAVTVLG
                     MSVPMLIGGAVVTERIFNLPGIAQLSLRAAEQHDVPVIQGTLLVTVAVVLAANLAVDA
                     GLLALNPAARRTGRRDARRTTRRPAPAGAR"
     CDS             754333..755262
                     /codon_start=1
                     /locus_tag="KSE_06800"
                     /product="putative peptide ABC transporter permease
                     protein"
                     /protein_id="BAJ26520.1"
                     /transl_table=11
                     /translation="MSAADATGAARRRPVARRPVVRASLAVLAVVALLAVFGGRLAPL
                     DPLAQDTARLLNGPGTGHPLGTDYLGRDVLSRLLAGTGLSVAAAAEAVGTALLLGVLP
                     GLASVRFSAPLAWVSLRAVDALMTLPFTLFAIAAVGVLGNGLHQAMLALGVLLAPLFF
                     RVSRAAALGLDRAQYVEAAELMGAGRLTVLRTHVWRKVLPTLAVTTAHALATALLTVA
                     SLTFLGIGVQPPAPTWGGMLASDLGFLAQQPWAPVVPTALIVLTVGALNLLADALRDA
                     EPAGPAPEAPPGAPVPNPLRAPEEARDDHRVRV"
     CDS             755255..756301
                     /codon_start=1
                     /locus_tag="KSE_06810"
                     /product="putative peptide ABC transporter ATP-binding
                     protein"
                     /protein_id="BAJ26521.1"
                     /transl_table=11
                     /translation="MSDHPSSDRPSSDRPSSGGSAPDRPAPGGTVLEVEGLRVTVGHG
                     AAEAVREVSFTVLAGQSVGLVGESGSGKTLTCRAVLGLAAPGVRSDAGTLALGGTDLL
                     GLDARGWQRLRGARLGAVFQDPGSFLNPALTVGRQLAEPLRVHRGLSRADARRRAVEL
                     LDSVGLRDPEAVYGRYPHELSSGMLQRVLIAIAVSGDPDLLVADEATTALDTVVQAEV
                     LDLLARLREERGLGLLLVSHDLAVVADATDRLLVLYAGEVVEDGPTASVVAAPAHPYT
                     EALLAVAGLGPGARTRFPVIPGRPPAPGTAAAGCRFAPRCAYAEPECSLAPVPLVSAP
                     DGDGDRKVRCLKPR"
     CDS             756419..757375
                     /codon_start=1
                     /locus_tag="KSE_06820"
                     /product="putative peptide ABC transporter ATP-binding
                     protein"
                     /protein_id="BAJ26522.1"
                     /transl_table=11
                     /translation="MTALLEVRSLQVEFDRGTPVLDGVDVRVRAGEILGVIGETGSGK
                     TTLARAVVGLAPVAAGRITVDGRERTGLRGRALREARRAGAVQYMFQDPLRSLDPDLT
                     VLRLVGQPLAVAGVPAGERRGRVLEALDLVGLDHALAGRRPGLLSGGQRQRVALARAI
                     VTRPRLLLADEPVSALDASNRNHVLRLLDELRRELDLAVVLISHDLESLAGVADRLAV
                     LYRGRIVESGPAAEVLERPLHPYTALLAASAPGGGPERRAELARLRAPAPARPESSGC
                     AFAHRCAFADAGCAGRPAESDPLPGRTVACHRSADWRHTEAS"
     CDS             757405..759831
                     /codon_start=1
                     /locus_tag="KSE_06830"
                     /product="putative biotin sulfoxide reductase"
                     /protein_id="BAJ26523.1"
                     /transl_table=11
                     /translation="MTTLPTTSHWGAFRAGPHPAGGVLVEPHPDDPAPSPLLAGVPGS
                     LRHRTRVRRPAVREGWLRGGPGTGAGRGREPFVEVSWERALDLVAGELARVKREFGPQ
                     AVFGGSYGWASAGRFHHAQSQLHRFLALFGGYTASRNSYSLGTSLVLLPRVLGDAEAV
                     LRATSSWPTIVRHTRLLVAFGGVPAKNVYVTPGGVTRHTTPGFLAELAAAGTEVTLVS
                     PLRDDLPDGPATDWLPVAPGTDTALMLALTHTLVAENLHDRAFLARYTSGWPVLERYL
                     DGRADGTPKDADWAAPICGLAAERIRALARKMAGTRTLVTVTWSLQRARYGEQPVWAA
                     IALASALGQLGLPGGGFGHGYGSMGDVGDTGTALRLPFLPQPANPVDEFIPCARIADL
                     LLHPGEEYPYDGTTRRYPDIRLVHWAGGNPFHHHQDLGRLRRAFARPETVIVHEPHWT
                     ATARHADIVLPVTTTLEREDFGGGRRDTHLIAMHRAADPVGEARDDHAILAALAERLG
                     FAAEFTENRTPRQWLEHLYGQWAEQLRADGAEGAGSTGSAGGPPSFDRFWADGEWRLP
                     EQHPERTLFAEFRADPDRHPLATPSGRIELHSPAIAALDLPDCPGHPAWLDPRPDPAT
                     ARRHPLLLIANQPATRLHSQLDVGAASLADKVADREAVELHPADAAERAIGDGDLVRI
                     FNDRGACLAGARLSDRLRPGVVRLPTGAWFDPVPDTEPPLCAHGNPNALTADLPSSRL
                     SQGCTGQHAPVQLERWTGGDPPPVTVRHPPVLLPAPTSDPTSEATPDPASEPAPVPRP
                     EHAPPPEAVR"
     CDS             759828..761006
                     /codon_start=1
                     /locus_tag="KSE_06840"
                     /product="hypothetical protein"
                     /protein_id="BAJ26524.1"
                     /transl_table=11
                     /translation="MSVTTTASPGFPAPALDGLPAVTAALAACAAAHDRDAELPLADF
                     ELLHGAGLLTATVATRHGGPGAGLADTARILRALGAGDPAVALVTAMTLFTHAAEART
                     PYWPAGPLAELLAESAQRPVLVNALRVEPELGSPVRGGLPATTARRRGDGWELTGHKI
                     YSTGAYLLDWLLVWAATDEERPRVGSFLVRAGSPGLTVEPVWDHLGLRASRSDDVHLN
                     AVPVPGDRVGPLALPGADGSRHSIGGAWNGLGLAALYLGVAGAARDWLLGFLHERTPS
                     ALGAPLASLPRFQAAVGEIEVSLAGADRLVDALAAAVDAGEPGAAEQTGGAKLLATRA
                     AIDAVQQAVALVGNHGLTRHHPLERHLRDVLCARVHTPQDDSVLLAAGRAALDRVRPR
                     "
     CDS             761071..762207
                     /codon_start=1
                     /EC_number="1.14.14.5"
                     /locus_tag="KSE_06850"
                     /product="putative alkanesulfonate monooxygenase"
                     /protein_id="BAJ26525.1"
                     /transl_table=11
                     /translation="MPVEFVGMISTHDVSETRPATGPVVDPGYTRRFAQAHEEAGFDR
                     ILIAQSSGSPDPNQVAAFAAAHTERLGLLVAHRPGFLAPTVAARTFATLDQFSGGRVA
                     VHVITGGNDAEQRRDGDYLTKDERYARTDDYLTVVKKAWTEDAPFDHDGPYYRLADFR
                     SDVRPVQEPRIPLYFGGSSEAAYRVGGKHADTFALWGEPLAETAEQIARVRAAAEAAG
                     RTDLPGISVSFRPILGRTDEAAWERARGILGTIEQRGSTPGWRRGTALNGADATPQNV
                     GSQRLLAAAAKGDLHDRALWTATAKATGAGGNSTALVGSPETVARALLDYVEIGVTTL
                     LIRGYDPLDDALDYGRELLPLVRQEVAHRDAAAATAVPAAAGVR"
     CDS             762204..763109
                     /codon_start=1
                     /locus_tag="KSE_06860"
                     /product="hypothetical protein"
                     /protein_id="BAJ26526.1"
                     /transl_table=11
                     /translation="MTATATTTAAVPATATTPDAGADARWDPAPGVAVRGTVLLLPGR
                     GEHPGLYARFGRRLAFDGYRLLVPADHSTAPTALSALFARARSGQPDGGPVVLAGSDT
                     GALLALALAGELGPDGLLLAGLPDGDRPEPVADEPVADEPVADEPVADEPVADEPVAD
                     ELSARTACPVHRGLLATDPGFRPGALFDPVPAALAGAAAAARPAVPVLAFHGLADPVA
                     PVGALRALAGRLPSVEAVAVADGRHDAFNDAAHRSVAARTVLWLERLRAGLDRRPVPP
                     PPLLVPLDSGSDSGPGSGSGSGSGG"
     CDS             763158..763673
                     /codon_start=1
                     /locus_tag="KSE_06870"
                     /product="putative NADPH-flavin oxidoreductase"
                     /protein_id="BAJ26527.1"
                     /transl_table=11
                     /translation="MTTLDERPPTATPAELLRRTLRRHASGVVVITVPGPAGFTATSF
                     TSVSLEPALVSFYLASGASTAPAVRAADVFTVHVLHRGQEELARAFARSGTDRFAGVP
                     WQEGPHGTPLLEGATARLTARRVGLHPVGDHLLVVGEVLAADVRGGEPLLHHDGGFGG
                     FAPGAGEGPWG"
     CDS             763664..764764
                     /codon_start=1
                     /EC_number="1.14.14.5"
                     /gene="ssuD1"
                     /locus_tag="KSE_06880"
                     /product="putative alkanesulfonate monooxygenase"
                     /protein_id="BAJ26528.1"
                     /transl_table=11
                     /translation="MGLTVHWFLPTTGDSREVVGGGHGSVPGASGGDRPPSLGYLGQI
                     ARAAELLGFAGVLTPTGPWCEDAWLTTAMLAARTERLSFLVAFRPGLLSPTLAAQMAT
                     TYQNLSGGRLALNVVTGGESREQRAYGDFLDKDERYARAGEFLSVTGRLWRGERVDHA
                     GRHLRVEGAELTRLPAPVPPVYFGGSSAAAERVAARHADVYLTWGEPPPLVAAKVGRI
                     RELAAAHGRRPRFGVRLHTITRDTSAQAWAEADRLLAGMGAERIRETQLALARSESEG
                     QRRMRELHGGSADRLEVYPNLWAGFGLVRGGAGTALVGSHAEVADRIEEYHRLGVDEF
                     VLSGVPHLEEAYRVGEGLLPLLAARGLLPSLR"
     CDS             764933..765802
                     /codon_start=1
                     /locus_tag="KSE_06890"
                     /product="