LOCUS       AP007177                8921 bp    DNA     linear   PLN 16-DEC-2016
DEFINITION  Aspergillus oryzae RIB40 DNA, Q47Con0163.
ACCESSION   AP007177
VERSION     AP007177.1
DBLINK      BioProject:PRJNA20809
            BioSample:SAMD00067075
KEYWORDS    .
SOURCE      Aspergillus oryzae RIB40
  ORGANISM  Aspergillus oryzae RIB40
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Eurotiomycetes; Eurotiomycetidae; Eurotiales; Aspergillaceae;
            Aspergillus.
REFERENCE   1  (bases 1 to 8921)
  AUTHORS   Sawano,T., Tanaka,T., Machida,M. and Yamada,O.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-JUN-2004) to the DDBJ/EMBL/GenBank databases.
            Contact:Toshihiko Sawano
            National Institute of Technology and Evaluation, Genome Analysis
            Center, Department Of Biotechnology; 2-49-10 Nishihara,
            Shibuya-ku, Tokyo 151-0066, Japan
REFERENCE   2
  AUTHORS   Machida,M., Asai,K., Sano,M., Tanaka,T., Kumagai,T., Terai,G.,
            Kusumoto,K., Arima,T., Akita,O., Kashiwagi,Y., Abe,K., Gomi,K.,
            Horiuchi,H., Kitamoto,K., Kobayashi,T., Takeuchi,M., Denning,D.W.,
            Galagan,J.E., Nierman,W.C., Yu,J., Archer,D.B., Bennett,J.W.,
            Bhatnagar,D., Cleveland,T.E., Fedorova,N.D., Gotoh,O.,
            Horikawa,H., Hosoyama,A., Ichinomiya,M., Igarashi,R., Iwashita,K.,
            Juvvadi,P.R., Kato,M., Kato,Y., Kin,T., Kokubun,A., Maeda,H.,
            Maeyama,N., Maruyama,J., Nagasaki,H., Nakajima,T., Oda,K.,
            Okada,K., Paulsen,I., Sakamoto,K., Sawano,T., Takahashi,M.,
            Takase,K., Terabayashi,Y., Wortman,J., Yamada,O., Yamagata,Y.,
            Anazawa,H., Hata,Y., Koide,Y., Komori,T., Koyama,Y., Minetoki,T.,
            Suharnan,S., Tanaka,A., Isono,K., Kuhara,S., Ogasawara,N. and
            Kikuchi,H.
  TITLE     Genome sequencing and analysis of Aspergillus oryzae
  JOURNAL   Nature 438, 1157-1161 (2005)
COMMENT     URL:http://www.bio.nite.go.jp/dogan/Top
FEATURES             Location/Qualifiers
     source          1..8921
                     /db_xref="taxon:510516"
                     /mol_type="genomic DNA"
                     /note="Q47Con0163"
                     /organism="Aspergillus oryzae RIB40"
                     /strain="RIB 40"
     CDS             complement(782..1183)
                     /codon_start=1
                     /locus_tag="AO090663000001"
                     /note="predicted protein"
                     /old_locus_tag="AO070167000001"
                     /protein_id="BAE66596.1"
                     /transl_table=1
                     /translation="MASFRLSDRTNIFWLLALEGADLLWINKKGQNLAHLLMHHRASH
                     EEILNVLFDTGVDPAVTDLDCRTLAHHGAIHGVFTKDLLKFLEYRGVLDLHTRDSIGK
                     TPLNYAEEEVNREFPEDIFSIHRQRGELENS"
     exon            complement(782..1183)
                     /number=1
     CDS             complement(1613..2029)
                     /codon_start=1
                     /locus_tag="AO090663000003"
                     /note="predicted protein"
                     /old_locus_tag="AO070167000003"
                     /protein_id="BAE66597.1"
                     /transl_table=1
                     /translation="MSSFTQPMPVVACGRIPAMGKSISQHLRPEYEGSFLIYIPEINK
                     VWCQYSSVIHFILSYEAAEAELPHLLAGRDPQSRSPNQIGTHDYSRPPRAVIFGRGYG
                     PQQVEELKKKFAGVAKEPVAWVRGNPADLPAGAAGA"
     exon            complement(1613..2029)
                     /number=1
     CDS             complement(2660..3205)
                     /codon_start=1
                     /locus_tag="AO090663000004"
                     /note="predicted protein"
                     /old_locus_tag="AO070167000004"
                     /protein_id="BAE66598.1"
                     /transl_table=1
                     /translation="MSQYERVRLAKYLATAVLYYHATPWLNRAWRSEDIHFFNYPDPS
                     IEQPQHIPAYMMSSVSTEYLPASPAYHRFIRNPVLFGLGVMFLELAFQVPLAALELSI
                     DLQERGKSDLAEYSTARRVVEFSHGKISKSFKEVTKRCLYCDFGHDDDFHSPALQQAF
                     YNNVITVLDDLEKRFRELQLD"
     exon            complement(2660..3205)
                     /number=1
     CDS             complement(4252..5481)
                     /codon_start=1
                     /locus_tag="AO090663000005"
                     /note="predicted protein"
                     /old_locus_tag="AO070167000005"
                     /protein_id="BAE66599.1"
                     /transl_table=1
                     /translation="MPLPPTPRDRKDFSVAIICALEVESDAVELLFDHIWDANGDRYG
                     KAAHDPYSYRTGVIGNHNVVLAYMTGMGKVQAASVAKSCRWSFPGVRLALIVGVCGGV
                     PGGIEGGVFLGDIVISDEILPYDFGKRYPGTFQCREVTSRSNGDNEVQAFLRKLRSPK
                     GREHLLSRTAHHLDVLRAGAGEYSCPPRQSDQLFEPNYHHKHHGTSKCKTCNEGKACK
                     RAQKATCKALRCDQERLVVRLRSSQREFNIHFGRIASGDTVMKSGRDRDRIADKEKVI
                     AFEMEGAGIDGIMPFLVIKGVCDYADSHKNKIWQKYSAGAAASCMKSLLEQWAVIDQF
                     EKRHYQPRDFSQESHCHIQETASEACALSTRRDEGYHSQYNPDTNNENLLQGDFHVQN
                     LGSRADSDSPARNRLQF"
     exon            complement(4252..5481)
                     /number=1
     CDS             join(5732..5857,5906..6236,6310..6784,6838..7708,
                     7770..8037,8135..8211)
                     /codon_start=1
                     /locus_tag="AO090663000006"
                     /note="predicted protein"
                     /old_locus_tag="AO070167000006"
                     /protein_id="BAE66600.1"
                     /transl_table=1
                     /translation="MKTKAETTDILDDWVVSRIDHSYENPNFGFVETLYQTCSAALKS
                     TLKKDIASIQFWEENFPVGHLDTILAESSGLKIRVLENLRGIGKILIAFFTDYDEVIF
                     STQNERNPECNFANDLLIQVEKAALMLDVEEKSERSSDDETDDDSSPATERIYTPCSA
                     RRKLNMFRLRLLFVCLIVRNPTPCVFATGRCPYRFHFSHTDIYARFANAPTSLVERLA
                     EANLQRSIRLRTQEEEKEEVDDHTNHDSGLGTSIPTMSQYAATVASHTSFLSVAGEEA
                     LGRPRVPPLPQEGGRPFRCDYCHRTISMRNRIEWKMHVFADLESYICTHEDCRDVFKT
                     FPTRQLWADHEFNAHFTLIRWRCFICSIALNTAERFVEHLAQEHGSVLTGHCVTAATS
                     EARETVLTPGFGNYKCLLCLQDGWHTRKGYTTHVGRHLEEISLACLPRDEEDSSDDDL
                     DTNISHALSDVDEPTSTSGESYGVDANSTALTPAPQGNPCIATDAKIELGVHRMAEAT
                     LPQEKEAVEKNAPPHTSHPRGYLGRAKEGMYVFGSTEAEPGMATTEPSEVGYGSLPTS
                     HWSVHEQRDFPRLLAHFGRDFEGISNFMKSKTPVMVKNYYQRRLDSGNRYFEETALTA
                     EERKSRGEPTGPLPVLNAAPMRHYGATRSTIAPHPPAPHGHTRAPAGSMTGGILALKP
                     SAEGSPRKCVIFVQCNKSIVIVEQQHITRLVEK"
     exon            5732..5857
                     /number=1
     exon            5906..6236
                     /number=2
     exon            6310..6784
                     /number=3
     exon            6838..7708
                     /number=4
     exon            7770..8037
                     /number=5
     exon            8135..8211
                     /number=6
BASE COUNT         2339 a         2066 c         2044 g         2472 t
ORIGIN      
        1 ctataatatt taaatttatt aatactatat attttatata taattaaata tttattatat
       61 tattaataat atttatttta atttttaata tttaaattct aatatttata attttaatat
      121 agatattact ctaataatat tctaaataat tataaaaatt ttataaaatt ttatattatt
      181 ttattaatta tattattaat ttaattaata aaaatttttt atttttataa taatttaatt
      241 ttaatttatt atatttaata taattttaat attaatattt tttattttaa taatattact
      301 ttttatagta tattaataaa tattataatt tattaatata tatttttatt tttattttaa
      361 agatttttta atattttaaa tattttaaaa agttttttta tattaaaatt atagttaatc
      421 tattaaatac tatatttttt atttaaaaaa ttaattttaa ttaaaattta atttaataat
      481 ttagatattt ctagtagtat agctaataat taaatagctt caaaaaaata gacgcgtaaa
      541 atttctacgt gtatagccgc ttagttgcgg tggccgctcg cttaccgatt acgttatgtc
      601 tctctattta attctaattc tattataact ttgaaagcta tatcatactt aattatttat
      661 atatagtcta tctatagtgt atatatataa taattgaaaa ttctaattag cctatctatt
      721 taatctatac cttaatatta tatagctttt attataaagt taatatattt atctatgaat
      781 attaactatt ttctaattcg ccgcgttggc gatggattga aaagatatct tcaggaaact
      841 ctcggttaac ctcttcttcc gcgtagttga gtggagtctt gccgatcgag tctcgtgtgt
      901 gtaagtctaa gacacctcta tactcaagga actttaaaag gtccttggtg aacacgccat
      961 gaattgctcc atgatgcgcc aaggttctgc agtcaagatc tgtgactgct ggatccacac
     1021 cagtgtcaaa caagacgtta agaatctcct catgggatgc cctgtgatgc atgagaagat
     1081 gcgccaaatt ctggcctttc ttgttgatcc aaagcaggtc ggcaccctcc agagctagta
     1141 gccaaaatat gttggtccga tctgatagac gaaacgaggc catgtgaagg cctagatgta
     1201 agttcccccc gatatctgat tgattattgt cgtaactcga gctgtacaac gatggtactt
     1261 tctatgtcgc ggatgaaaca tcagctttaa tacatagatt ttggtataaa catttggatg
     1321 cttaatcttc tattcttagt ttatgtctcg actagaagaa gtacatagac cgccagaaga
     1381 tcgaagctcc agggaaacaa ctagcgaaag tccaagacca cttacaaata tccttgatac
     1441 gtattggccc ttgaatttgt gtttgagaga ttcgaactgg caaaaagcaa ggcatcagat
     1501 aatctctccc cgacaaagca actagtacac caaaatctcc tcattttttc ctcccccgtc
     1561 cctccatttt ctaagtacct tcttcatatc cgccgcgata ttctgagcat agtcaggccc
     1621 cagcggcccc ggcaggtaaa tccgctgggt tccccctcac ccaggcaaca ggttctttag
     1681 caacacccgc gaatttcttc ttaagctctt caacctgctg aggcccatag ccgcgaccga
     1741 agattaccgc gcgaggaggc cggctgtaat cgtgggttcc gatctgattg gggctccgag
     1801 actgaggatc gcgacctgca agcagatgcg ggagctcagc ttctgcagcc tcgtatgaca
     1861 agatgaagtg gatgactgag gagtattggc accatacttt gtttatttcg ggaatgtata
     1921 tcaagaaaga accttcatat tcaggccgta ggtgctggga gattgatttc cccatcgcgg
     1981 gtattctgcc gcaggcaact actggcatcg gctgagtgaa tgaagacatg ttgcgagagc
     2041 tgtatgctgg acgctgcgga tgaagatatt tcgcattgga gaaggagaat tatggagtaa
     2101 gctgagatcg gtgattcgac ctatatccct cgttgcggcg cgctcggtct tgatgatcag
     2161 ttgatgaatg acgttcggac ggagccgtta tctccaactc cagccaattt cacagccata
     2221 aataaacttt gggcggcgac atatcgtttc accacgggtg tggaacgcct ctggtcgtaa
     2281 taagggatct atttaatcat ccaccatgta cctagatatc taccaggctt atccgactca
     2341 gccacctggc atttgttgag aattgacgct ttttgtttgt atctctgctc acctcctcga
     2401 aaagttttgg ttttgatata ctagggatgg tgcggtgcgt gtgaccgtgc tgagcagagg
     2461 tgtagtgaga tgtactcatt gtaaaaaaac caaaagttcc ttttgtacaa acagtccgcc
     2521 gtatgaactg tatacccgga gtggggctaa atttctggta gtcccgtagg acttgtcaca
     2581 ctacacgagg tggggtaggg tcgggctaaa aaatgtacag gaggagactc gtgattattt
     2641 catagctcaa aatgcataat tagtcaagct ggagttccct gaaccgcttt tccagatcat
     2701 caaggactgt aatgacattg ttgtaaaaag cctgctgaag ggcaggacta tggaagtcat
     2761 cgtcatgtcc aaagtcgcag tatagacatc ttttggtgac ctctttgaag ctcttgctga
     2821 tcttgccatg gctaaactct accacccgac gggctgtgga atattcagca aggtctgatt
     2881 tccctctttc ttgtaggtcg atcgacagtt ccagggccgc gagaggaact tgaaatgcga
     2941 gttcaaggaa catcacgccg agcccgaaga gaacgggatt tcgaataaag cgatggtagg
     3001 cgggggacgc aggcaggtat tccgttgaga cagagctcat catatatgca gggatatgct
     3061 gtggctgttc aatggaagga tcaggataat taaaaaaatg aatatcttca cttcgccatg
     3121 ccctgttgag ccaaggtgtg gcatggtagt aaagaacagc agtagcgaga tatttggcta
     3181 ggcggacacg ctcgtactga ctcatttcct tcgtaatatc tgatcttgtt tgtgatataa
     3241 gctcagacag ggacttggtt gtagttgtta tactggtccg actggctaaa tatgccaagt
     3301 gtttgcaagt tccattgtcc ccaagtaagc caatgcacct attgcgttct tgttgactta
     3361 agcatctttc gaccacctga caaaagttgc gttggatatg gagatatgga atttcaacga
     3421 cgtctgcttc tgagcacagt ggctgtattg gcgctgtcgg aagcctgaac tgtacccgtt
     3481 tccgttgagt cgataagcag tttccacgct cgacctcttg tcgtcgattg agagaagggt
     3541 tttggccaga gggcgatgtg gatcccagct gagaataacc ctcatgggat ttaatggtgg
     3601 attccacgtc tatccagaca acatcccccg gtgctcttga gtgttgaata agggcgacgt
     3661 tgaatcggat ccgggttgtt gttccgtcaa tggctggctg gaggggtatg tgcaccttat
     3721 ggacagtgtg ggcagcacaa gctgtcccca cggcgtcgta caggctgtga gctgcttgtt
     3781 ggataacacg aaagtcctcg aatttccgac gacattcagg gattttgtct atccttggtt
     3841 cttgccaggt atgggtcttc ttcggttgat ggatgaccga tctgaaattt tcgatcaggg
     3901 atcccaagtc ttctacagag tactgtgtat atgactgatt agactgagcg tgttaacaat
     3961 gattccacgg gggtactact caccttaagc gatgacacgg cactggtggg ttgtgatctt
     4021 gcctgagtag cgacacggag ctgtctggtt agatccttaa tgctttcaag cttcttttgg
     4081 atctccagag ctatctctaa acaggacagc caggacgaac caaggcagtc atccgataac
     4141 aggatttttg catgatcgga gacaagaaaa cgctgatttt ttattattgc cttgagatca
     4201 gcatctcgag gcaaatactg tcggtgttcc ctgagagacc taatgacaca cttaaaactg
     4261 gagtcgattt ctggcaggac tgtcgctatc agcgcgggaa cctaaatttt ggacgtggaa
     4321 atcaccttgc aacaggttct cattgttggt gtcaggattg tattgtgagt gatatccttc
     4381 gtctctgcga gttgacagag cgcatgcttc agatgcggtt tcttggatat ggcagtgaga
     4441 ttcctgtgag aagtcccgcg gttggtaatg tctcttttcg aattgatcaa tgaccgccca
     4501 ctgttcaagc agtgacttca tgcacgaggc tgctgcacca gcggagtact tttgccaaat
     4561 tttgtttttg tggctgtcgg catagtcaca aactcccttt ataacaagaa aaggcatgat
     4621 accgtcaatg cccgcgccct ccatctcaaa agcaatcacc ttctctttat cggcaattct
     4681 gtctctatcc ctgccagatt tcatgacagt gtctcctgac gctattcgcc caaagtggat
     4741 attgaattcc ctctgggatg aacgcaaacg aacaaccaat ctctcttgat cacacctcag
     4801 cgctttacat gtggccttct gggccctttt acaagccttg ccttcgttac atgttttgca
     4861 tttcgaggta ccgtgatgct tgtggtggta gtttggttcg aaaagctgat cagattgcct
     4921 ggggggacaa gaatactcgc cagctcccgc tcggaggaca tctaagtgat gggctgtcct
     4981 gctgagtaga tgctcgcgtc cctttgggct tctaagtttg cgcaagaagg cttgtacttc
     5041 gttgtcccca ttggagcgag acgtcacttc tctgcattgg aatgtcccag ggtacctttt
     5101 tccgaaatcg tacggcaaga tctcatcact gatcacaata tcaccaagga atactcctcc
     5161 ttcgatgcct cctggcaccc ctccacaaac gccaacaatc agggcaagcc ggacgcctgg
     5221 aaagctccaa cggcagctct tcgcgacact tgctgcttgg acctttccca tgcccgtcat
     5281 gtaggccaac acgacattat gattgccgat cacgcctgtt cgataggaat atgggtcgtg
     5341 agccgcttta ccgtatcgat caccatttgc atcccatatg tggtcaaaaa ggagctccac
     5401 cgcgtcagat tccacctcta gagcacatat gatcgcgaca ctgaagtcct tgcggtccct
     5461 tggtgttggc ggaagaggca tcgtcacgaa acttgagcag gagggggtcg catctgaaag
     5521 taatttaagg ataaaaggtc tgtctgtggg ttgcctgaca aaagtaagcg gggctcagcc
     5581 taccatgtca cgccccccgg tctgccttgt tcggcaaata aaaataagat gttaaccgct
     5641 ttacgaaccg cgcataccca gcccctcaaa cttcgcgccg gttttgactg cttacaattc
     5701 acacaatctg ttgccgcttg ccagaaaaac catgaagact aaagcagaaa ctacggatat
     5761 acttgatgac tgggtagtgt ccaggatcga ccacagctat gagaatccaa actttggctt
     5821 cgttgaaacc ctgtatcaga cctgctcagc tgctcttgtc tctctttgga aatcgcatct
     5881 gcgattgaca agtgataatc cacagaagag caccttgaag aaagatatag cgagcatcca
     5941 gttttgggaa gagaatttcc ctgttggcca ccttgatacc atcctggcag agtcgagcgg
     6001 cttgaagatc cgtgtcctcg agaacctcag aggcattggc aagattctca tcgccttttt
     6061 cacggactac gatgaagtga tattcagcac acaaaacgag cgtaatccag aatgcaactt
     6121 tgcaaatgac ttgttaatac aagtagaaaa ggctgcgctg atgcttgatg ttgaagaaaa
     6181 atctgagcga tcgtcggatg acgagacgga cgacgattcc tccccagcca ccgaacgtca
     6241 ccagaatcgc ctcggacgcc tcgactccta cataagctgt ctgatagacc ttacacccgt
     6301 ggtggagagg catatatact ccttgcagtg caagacggaa gctcaatatg ttccgattga
     6361 gactactttt cgtttgtctc atcgtgcgca accctacgcc atgcgtattc gcgaccggtc
     6421 ggtgtcctta ccggttccat ttctcccata ctgacatcta cgcaagattt gcaaacgcac
     6481 ctacctctct tgtagagcga ttggcagaag ctaacttgca aagatcaatc cggcttcgaa
     6541 cgcaagaaga agagaaggaa gaagtggacg accacacgaa tcatgactcc ggtcttggga
     6601 catctattcc tacaatgtcg cagtatgctg ctactgtcgc ttcccatact tcattcctct
     6661 cggtcgctgg agaagaagcc cttggtcgcc cccgagttcc ccctctaccg caggaaggcg
     6721 gacgtccatt tcgatgcgat tactgtcaca ggaccatctc aatgcgaaac cgaatagagt
     6781 ggaagtacgt gtataaaaag gttggagctg aaaagccctg ttatactgac taaataggat
     6841 gcatgtcttt gctgatttgg agtcgtacat ttgcacacac gaggactgca gggacgtatt
     6901 caaaacattc ccaacccgtc aactatgggc agatcacgaa ttcaatgcgc actttactct
     6961 gattcgatgg cgttgcttca tatgcagcat cgcactcaac actgcggaac gctttgttga
     7021 acatttggct caagagcatg gtagtgtact aacaggtcac tgcgtcacgg ccgcaacttc
     7081 agaagcgcga gagacagtcc tgacacctgg gttcgggaac tacaagtgcc tgttatgctt
     7141 acaggatggt tggcatacca ggaaaggata cacgactcat gtcgggcggc atctagagga
     7201 gatatctctg gcatgtctcc cgagagatga ggaagacagt agtgacgatg acttggatac
     7261 aaacatatcc cacgccctca gcgatgttga tgagcctact tccacctctg gagaaagcta
     7321 tggggttgat gcgaattcta cagccctgac accggcgcct cagggtaatc cttgtattgc
     7381 tacagacgcc aagatcgagc tgggtgtcca ccgaatggcg gaggccactt tgccacagga
     7441 gaaggaagct gtggagaaaa atgctccacc acatacgtcg caccccagag gttacctcgg
     7501 aagagcgaag gaggggatgt atgtatttgg atccacagaa gctgagccag gcatggcgac
     7561 aaccgaaccc tccgaggttg ggtatgggtc tctaccaacc agtcactggt ctgttcatga
     7621 gcaacgcgat ttccctcgcc tgctagcaca ctttggccgt gacttcgagg gcatctcgaa
     7681 tttcatgaag tccaagacgc cggttatggt aaaaatcgca aacctgagtt tgatctcgat
     7741 gtttacaagg ttaacgctaa tctgtacagg tgaaaaatta ctaccagcgg cgccttgact
     7801 cgggaaacag atatttcgaa gagactgcgc tgacggcgga ggaaaggaaa tctcgcggtg
     7861 aaccaactgg tcctcttcca gtcctcaacg ctgctccgat gcgccattat ggagcaacac
     7921 gatcgaccat tgccccacac ccacctgctc ctcatggcca tactagagca cctgccggct
     7981 cgatgacggg cggcatactt gctctgaaac cctctgcaga aggctctcct agaaaatgtg
     8041 tatccctgga tggctggtgg cagtgctgtc attgtgagag tttgatgaat ccagcactat
     8101 caactggcgg ttgtacggtg tgttctcatc acaggtgtca tctttgtcca gtgcaataag
     8161 tccatcgtta tagtagagca gcaacatatt actcgcttag tggaaaaatg atacattgat
     8221 ctaactcata cactgaccct tcgcttgcca cttggaccag ggcccctaga gtggtattca
     8281 ggccgggttc gggtcctaga tctagaaacc gcccccgacc cggctccggt ttcgggttcg
     8341 agatatagga cccgccccga ccccgaaccc gggctaatct agatcaacct gactcgttgg
     8401 ggccccgcca agccacagac taaacctagt taggtaaggc gtagcttatt aatcaggcgc
     8461 cttacctaat taggcctagt atagtgattt taaaagcttt atatctctac tatttctata
     8521 tatatgtaac ggcgggttgc ctcaggcaac tagatccccc gcaggcgagc cgccagcggg
     8581 ccgttggctt acgtaacgca caaatatatt tatgttagaa tcgcgcagag gattccgatc
     8641 ctcaagcgat tcgttctgtt atactagata ggggaactgc catacaatcc taaacaacct
     8701 tgagcttcct agtactgcct tcctgaagcc cgttggccga ccgcgctccg caggcctacc
     8761 gcctatagat agtagtacgc cggcagagcg cttacagttc gaatcgcttc aacccaacga
     8821 cttcaagatg gtcagtacac gaagttcgag cgccttaccg ccggtggacc cccagggggc
     8881 cgacggcacg gccactcagt catccgcaac ccagtagcgg c
//