LOCUS       AP007175             2039961 bp    DNA     linear   PLN 16-DEC-2016
DEFINITION  Aspergillus oryzae RIB40 DNA, SC010.
ACCESSION   AP007175
VERSION     AP007175.1
DBLINK      BioProject:PRJNA20809
            BioSample:SAMD00067075
KEYWORDS    .
SOURCE      Aspergillus oryzae RIB40
  ORGANISM  Aspergillus oryzae RIB40
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Eurotiomycetes; Eurotiomycetidae; Eurotiales; Aspergillaceae;
            Aspergillus.
REFERENCE   1  (bases 1 to 2039961)
  AUTHORS   Sawano,T., Tanaka,T., Machida,M. and Yamada,O.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-JUN-2004) to the DDBJ/EMBL/GenBank databases.
            Contact:Toshihiko Sawano
            National Institute of Technology and Evaluation, Genome Analysis
            Center, Department Of Biotechnology; 2-49-10 Nishihara,
            Shibuya-ku, Tokyo 151-0066, Japan
REFERENCE   2
  AUTHORS   Machida,M., Asai,K., Sano,M., Tanaka,T., Kumagai,T., Terai,G.,
            Kusumoto,K., Arima,T., Akita,O., Kashiwagi,Y., Abe,K., Gomi,K.,
            Horiuchi,H., Kitamoto,K., Kobayashi,T., Takeuchi,M., Denning,D.W.,
            Galagan,J.E., Nierman,W.C., Yu,J., Archer,D.B., Bennett,J.W.,
            Bhatnagar,D., Cleveland,T.E., Fedorova,N.D., Gotoh,O.,
            Horikawa,H., Hosoyama,A., Ichinomiya,M., Igarashi,R., Iwashita,K.,
            Juvvadi,P.R., Kato,M., Kato,Y., Kin,T., Kokubun,A., Maeda,H.,
            Maeyama,N., Maruyama,J., Nagasaki,H., Nakajima,T., Oda,K.,
            Okada,K., Paulsen,I., Sakamoto,K., Sawano,T., Takahashi,M.,
            Takase,K., Terabayashi,Y., Wortman,J., Yamada,O., Yamagata,Y.,
            Anazawa,H., Hata,Y., Koide,Y., Komori,T., Koyama,Y., Minetoki,T.,
            Suharnan,S., Tanaka,A., Isono,K., Kuhara,S., Ogasawara,N. and
            Kikuchi,H.
  TITLE     Genome sequencing and analysis of Aspergillus oryzae
  JOURNAL   Nature 438, 1157-1161 (2005)
COMMENT     URL:http://www.bio.nite.go.jp/dogan/Top
FEATURES             Location/Qualifiers
     source          1..2039961
                     /db_xref="taxon:510516"
                     /mol_type="genomic DNA"
                     /note="SC010"
                     /note="phrap>=30:1-2039926"
                     /organism="Aspergillus oryzae RIB40"
                     /strain="RIB 40"
     CDS             complement(join(3111..3660,3862..4925))
                     /codon_start=1
                     /locus_tag="AO090010000001"
                     /note="predicted protein"
                     /old_locus_tag="AO070244000001"
                     /protein_id="BAE65923.1"
                     /transl_table=1
                     /translation="MDPISLIGAIGVAYQVVEITIDAIDYWKRTGDVADDIIMMVARL
                     DMIRARIKSWSFDWGMREQRHLKHPKFRDYGHLALQYLVIIQRRLVRFSEFEAKYTGL
                     FAGARSRRTGSVSRIAAVAAIEQTATNEGHVSSEEELLTQLKSDVGRLNRSNMLERWL
                     WARKDKRGQMMVEHIDTLVKDLEDFFPPPRSDAAGAIVFNLALSSSDTESLQALLKLE
                     AMPEADDNYIIRDVSNLASLKIIAANLGQRAARAKDQTLRWRSITTEEGNSLSLEPCV
                     DGREIAQWRPTTRGEDTEIVLVEWKNIPVSLPREQKTQLDARIYDLGKMLQAADKPAK
                     LLTLDCIGIVQKPVSDSSDAHLPDGVVDLAAPRLAGFEYSRLDEPGALTENTTDFRDH
                     NLYRHPQHRGLPVSDCTGVNNQVSRRRNAFTYKADLYSLGVVLLEAGLWRTAAEIVAG
                     SRGANEYRGDGYANQGNRNDADDNEDEVRSAFLRLIPTLRRTMGPIYADVVYRCLTGK
                     FEPEDDEALETVPEAFYVNGVQPLDSCVV"
     exon            complement(3111..3660)
                     /number=1
     exon            complement(3862..4925)
                     /number=2
     CDS             join(5622..6756,6818..7143,7196..10006)
                     /codon_start=1
                     /locus_tag="AO090010000002"
                     /note="predicted protein"
                     /old_locus_tag="AO070244000002"
                     /protein_id="BAE65924.1"
                     /transl_table=1
                     /translation="MSSYDRLALLTASIAGIPDEAGAEEELLTNICIKKTSFPQEEPL
                     GVGGNFNAIAVPPNRLRQCVDSRSLNSDPLFHLRRNKYIIRSPKADLDMRSMATELSI
                     MKNDSIRKHAHIIKLLGLAWEVTNSPNEQITPVFVLEYAELGDLKSFLRRDPGTLAEQ
                     LALAIGIAEGLRALHDAGVVHGDVKPANILLFPDRYGKPYGKLSDFGSSVLLSEVPHG
                     SYHAITCRTKLWQSPWASQPCTAQQLVRSDIYSLGLVLAVLITRIRPDILEFLHDKGS
                     GGRYLDELKTSDDLGTVLADFAVTAENRMPGGETEHTMHLKRMALGYALSTQAPFVEC
                     IPGALDILKMLRLLLHLGIAARLHEKSLNLSSLTKLEKDVIENPTMGPASDIDEIIQM
                     KMKDAKSEMWEVTNKAVVKATNRHREPSSDFTIERPLSDKEELLVDKGEAEGSSRQST
                     DEAVINAGLFNRTGPVAHLRQSDEQVVRTYGHDTVISHVTSFKRLRNLPSRVFSAVLQ
                     ELEAVASDNKSQNEFRRAKAAYEFAGFSVGRHQIGPPTRDQEIQKAMSLLLQAAQMGH
                     SLAQASVGMVAEGLGLYLEDFSRETEIAWLQELIVHEEEEGQILAKNRLRKLDATKYE
                     DAVRARRAAYRNTWSSLILCLLAENGADLMQVFGELTLGSSDHWMFCHHTIVNGNHEM
                     LQQALPSLGQMLDEPMINGRTLLLEACYAGNVEAVMLLVAAGADVTASLEADGTTALH
                     LLSMFPDDKVDKVAVKLKDAGADIEARRWLPQGRPGCADLQDAVSHATPLLSAVVAGN
                     VAAVQALVRLGADPFDQMKTMSKQDRQLLIAHGGRLYSPVHYAARLHMIEVLQALLPD
                     DRLYEELNSTIRYEEPSFWVLPIWCALDYSAIGLWQRLCLHGKEHVQHCIDTVEFLYR
                     RGSRNSRTCQHRAGNYSRYSFDASCHLGQPFLMKRLWAVADGQLQPPIEDLAKIVQRA
                     IDFEDGPTVHQLVPLLEASLRKVPEHEGFRFKASVQGHKPPEVVDYFITLDQKFNSTP
                     GSRMSVELVRDQNESRVIGPDEYGPAAVPRSQGGIRVSFSIRPGSDGQEKWKFVSAKS
                     VGVPKGEILPEPDASEKASLFESEVLGGYFDHARELSKSSECDLICRRTEKGKGESTL
                     LGRLIRDSKVYQASEAQALFLLSLARHESDELFWNVLEGEDGSNLTALHAAVFYFEPS
                     HVQQGRTAIPILNEVIGLWSKCVHLEQLTSDTDAGTSALHLAVESGNLEALQYIAREA
                     EGPLNWNILNGKGETPLDIALVQSLSAKELLAEAGITQEHPKWHEKVDKHYADFEQIR
                     SLLKENGAKYKSIGGFVIRESEDSWTMRILNRLDLSTTPAAIYERMYGESQHLHRSSD
                     GEVVMVFKGAQADEIIKRRELSWANMDVGDHMFLPVASDFASIAE"
     exon            5622..6756
                     /number=1
     exon            6818..7143
                     /number=2
     exon            7196..10006
                     /number=3
     CDS             join(13226..13256,13314..13775,13823..14163)
                     /codon_start=1
                     /locus_tag="AO090010000005"
                     /note="predicted protein"
                     /old_locus_tag="AO070244000005"
                     /protein_id="BAE65925.1"
                     /transl_table=1
                     /translation="MVLVALITGGTSGMGLDVAQELDKTGLWKVHIIGSNANRGEEAA
                     ASLRNTIFHQVDVTKYEQQGAAFDKIFNEEKRLDFVLANAGIAEDTAMFFASHPTGIP
                     PPPDMTGLTDINFTGAIYTSYLAMHYFRRSPEKTKGNRHLIIMSSIGGLYPCAHTPVY
                     SATKHGLVGFTRSVGKRLLDEGVKVNTVCPGVVLTPLMTTELQAFFPEKIVMKMSDVT
                     NVVLKLISGTEVTDSNGTSVPSDQLHSRAILISGKQYHYVEMPEYFDEKTQLTHQHMM
                     G"
     exon            13226..13256
                     /number=1
     exon            13314..13775
                     /number=2
     exon            13823..14163
                     /number=3
     CDS             complement(join(14783..15372,15430..15591,15738..15804))
                     /codon_start=1
                     /locus_tag="AO090010000006"
                     /note="dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /old_locus_tag="AO080542000004"
                     /protein_id="BAE65926.1"
                     /transl_table=1
                     /translation="MRELKKYVVWKSPRCLVCGIVDSIGFALARYLLQHTDLPIIATA
                     RRNSDNLRHRLLCGMENSAAEQRLSVFDVDVTEEPTVRSLADDIRQTHPKAPLRLALT
                     VPGILHVEKSPSQIDAHAALESLKVNTIGPMLLMKHLTPFLPTRSSPLFDPFDGEVKL
                     PQHAIYAMMAARVGSISDNRMGGWYSYRASKAAVFQLAKTLDLYLEGKCADRAISLAM
                     HPGTVKTDFTKSYQDGREMLSAEESAERLCGVLGSLGLEGRGRCWDWKGCEVRP"
     exon            complement(14783..15372)
                     /number=1
     exon            complement(15430..15591)
                     /number=2
     exon            complement(15738..15804)
                     /number=3
     CDS             complement(15887..17593)
                     /codon_start=1
                     /locus_tag="AO090010000007"
                     /note="predicted protein"
                     /old_locus_tag="AO080542000005"
                     /protein_id="BAE65927.1"
                     /transl_table=1
                     /translation="MTLKNLRLGIAIGHGTGRELTVVFKKVIQELARQHSLQVDFIES
                     SRIYHSYHSLTTSREEKDLIQHIAEETTLDAEEYRKFCETATANGIAAIFRTAIHAQS
                     LYLVRGQLKAVKIENFNLGDSNALLFIRDEAQGFYAGENEYHDSQHSIIRTSPFTRST
                     FDQILEYALERAKEEWGVENVPKTVTLVYKFHLFDGVFQAWAPHWQHRFGIELDFIQP
                     DTMNRNLMASGIQGRRIIIAGNEYADIIQPVFLKWFSNATIETMCAENVYLGPSLHRL
                     SEYQTVHGSADAIAEQGLVNPFATIRAAAAILERHGGCPGVGFQSQTERVIQTLLMKK
                     LTTPDQGGSCSTDAVVEHFLRAMADPATIDNPSIGRDIATGPIDAMAGKKTAVVVVDY
                     QNDFIASTPSHVVSELSSTMPRLVQYARNEGNEVIFVRFLGNSSYQGPSWQCRNALFG
                     KPEKCVEDTWGAELGSGVTPRPGERVFDKKALFDSFLVPEFSEYVSGQGFEHLVLAGL
                     YSDVCVDATARTAFQKGLWVTVVEDCTTALHSYHNDHLKFMEKVYGARIVKLASLIEM
                     KA"
     exon            complement(15887..17593)
                     /number=1
     CDS             18209..19087
                     /codon_start=1
                     /locus_tag="AO090010000008"
                     /note="predicted protein"
                     /old_locus_tag="AO070244000007"
                     /protein_id="BAE65928.1"
                     /transl_table=1
                     /translation="MDHVVNSGFNLGNELDYMLDRSYTAASRLNYQFYLWKDALQFNL
                     HPSILLPQDTSTPLWIADLATGTAVWLLDLLRDPAIAHYPSLQLHGFDIDLTNAPLPE
                     WLPPPITLRQLDVFEDVPRDLLGRYDVVHLRLLVLVVQNSDPLPIIHRVHQMLKPGGY
                     IQWDDLNYPDSEVVKSQAMSDVPTPAHDAFLRFAQSSGRNDWVLDLAYHLMERHGGFE
                     NAQLRNYTDRLEMRKANGDQYILVMEEFSARLKRAKKSEEAANIDLMIRGLAEESRLG
                     VGLSMPRAVCVARKVG"
     exon            18209..19087
                     /number=1
     CDS             join(19415..19543,19599..20234)
                     /codon_start=1
                     /locus_tag="AO090010000009"
                     /note="predicted protein"
                     /old_locus_tag="AO070244000008"
                     /protein_id="BAE65929.1"
                     /transl_table=1
                     /translation="MPIDTSVWYKKHIGPRLSAPMQLILEEWSDIPSGELQRHLHAVR
                     DKAWKYGEFPCVGQWMFLLPGIAAFPQFKHVLECARQGGIVLDLGCGLGQNLRLLAAN
                     GAPPERMWALDLRPELWQLGYELYRDHERLPATFISGNFLQDDDCEGLLKLYAEVDIM
                     IAGQFLHLFSWEGQKQAGKRIVALSKPGTILIGYQQSRGQAREYIRPWGMMFYHNLES
                     FQQMWQEISRETNTEWTVDATVVDLEEWGMQAEDTE"
     exon            19415..19543
                     /number=1
     exon            19599..20234
                     /number=2
     CDS             join(21229..21231,22449..23860,23922..24717)
                     /codon_start=1
                     /locus_tag="AO090010000010"
                     /note="predicted protein"
                     /old_locus_tag="AO070244000009"
                     /protein_id="BAE65930.1"
                     /transl_table=1
                     /translation="MNPTHFHGWRFGALTSCILVGICLGLNVAATIYVRVTYPPSSDN
                     LGLIQESDCDHIHSVDSRLHYALNVVATVLVSASNYNMQCLTSPTRAEVDQAHAQRRW
                     LDIGVHSIRNLSFIGRAKLALWLALLVSTLPLHLLWNSAVVMTTTFNDYSGLVVTENF
                     LESRSDIGLDCTSRAMEEYRSSNMSSYVTCWLFDQARNNRSSLTQMDPSRCISTYQAG
                     LEGRSFNMLAVTKQSDALNQSTTFPPPRNTTLPVLAYFHPLDYPDQIEQWCSGLCQRW
                     GQGNNSTKFCFDENWDEAAVPFACQEHKVNGTGWEPNALSQTSSWMCHPDAILYGECS
                     GSAATRNATKWTILPEHYEIDHCLVTNASHTCQLLYSPIILYIAIACNTMKFSSILLC
                     LLVSREPTLATIGDALDSFLRSPDMASKGQCLRSKMDDTIFPDPDDMGSTQAQRWQHG
                     EGWLGRCYQGTSVRRWGACILLWLASIIVGLVFLFKGINLVGAQNAFTMGFGALSLNA
                     IVNTSGYQGGTAASIVTTSIVANLPQLLLSGLYFMYNAVLTGMASAYEWSMFAYQQTT
                     LRVTLPWGAQRETYWLQLPWRYSLPLLACSTIIHWLISQSIFLINLKIYQPNNELLTR
                     PNTHFPSASDSGVITACGYSPLAIITAIAVAILMFAVLTTVSTFKLKPDIPVVGSCSV
                     AISAACHPPEEDSDAAGKPLSWGAVRHQEGDRPGHCCLTSQTVETPRYGELYAG"
     exon            21229..21231
                     /number=1
     exon            22449..23860
                     /number=2
     exon            23922..24717
                     /number=3
     CDS             complement(25696..26466)
                     /codon_start=1
                     /locus_tag="AO090010000011"
                     /note="dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /old_locus_tag="AO070244000010"
                     /protein_id="BAE65931.1"
                     /transl_table=1
                     /translation="MTAQQSLRGKNAIVTGGSRGIGKGIALELASRGANILLTYNSSR
                     QQAEEVASQIRRVGVDAIAVEGKADDLSAPKNIVDAAAERWGCIDIVINNAGAREDYP
                     VEAMTYEAFDRQIAVNLRFPVFLIKEATRHFGKTPRIVNLSSVYARDGQPGCLAYVAS
                     KGAMESLTRSLAKELGHKYNATINCVSPGPVNTELWASTLQSEEKEQWDQVIQSTPAA
                     PRVAEVDDIAQIVAFLSEEGSRWTTGSLINANGGLLFV"
     exon            complement(25696..26466)
                     /number=1
     CDS             26959..28002
                     /codon_start=1
                     /locus_tag="AO090010000012"
                     /note="proline racemase"
                     /old_locus_tag="AO070244000011"
                     /protein_id="BAE65932.1"
                     /transl_table=1
                     /translation="MRLNRTISVVGCHCAGEVGDVIVGGVLNPPNCKTMYEKLVYFQN
                     EADDVRQLLMNEPRGRPAMCMNVVLPPCDPRADAGFIIMESDEYPPMSGGNTICTATV
                     LLDTGMVKMTEPVTKLVLDTPSGLVGVTADCEDGKCKAISFDNVPSFVYKLDLPVEVL
                     GLGTVKVDIAWGGMHYAIVDARSIGLKIANENGPKLIELGERIKQAVRNTYKPVHPEN
                     DQIREVTIVEFTEPLHQKGDKRVAVNTVVVSPGRFDRCPCGTGSSARMAVLHARGELQ
                     AGESFVHQSIIGSTFTCHIRGTTTVGQYDAVLPTVKGSAWITGFKQMVLDPSDPFPAG
                     FRVGDQWHVRQQQ"
     exon            26959..28002
                     /number=1
     tRNA            28285..28357
                     /locus_tag="AO090010t00001"
                     /note="tRNAscan-SE"
                     /product="tRNA-Thr"
     CDS             join(28660..28722,28858..29000,29319..29427)
                     /codon_start=1
                     /locus_tag="AO090010000013"
                     /note="predicted protein"
                     /old_locus_tag="AO070244000012"
                     /protein_id="BAE65933.1"
                     /transl_table=1
                     /translation="MIELDHYGVASFDCLRWIHLSKSFTVDLVLLFFSLLSSVEPEWL
                     KNNPFEKTSGRTPYSSSGDFRKGRRIPRCQCGHRLGKVESAEEPEEFASDVPGRMNHG
                     GC"
     exon            28660..28722
                     /number=1
     exon            28858..29000
                     /number=2
     exon            29319..29427
                     /number=3
     CDS             join(33420..33493,33561..35547)
                     /codon_start=1
                     /locus_tag="AO090010000014"
                     /note="acyl-CoA oxidase"
                     /old_locus_tag="AO070244000013"
                     /protein_id="BAE65934.1"
                     /transl_table=1
                     /translation="MDLMQQARASSTFNPMKLTVIIYDNEATVSARRAAFHRVEDALG
                     LLDNMKLPHVYSGLDREGLYLEGVRRARVITNDMITHGHSHFKWLNERYQICNSSPFG
                     MNFLMFRRTIELQGTAEQRRYWLQEIDQMRINGAYAQTELGHGTFVRGIETTATFDVD
                     TDTFTIHCPTPTSVKYWPGGLGFSCSHAIVAARLITHGKDHGVHMFIVQIRSLEDFAP
                     VRGVELGDLGMKMAYNGTCNGYARFNYLRVPRSSLLAAHAQVSRDGTYSQAQAKAGTL
                     PLSKRVYSTMLDTRRNIVRCVAFGLAQAATITARYSIVREQGRLMFSDAAEEETAIIT
                     FKSQHYRLLTLIAQSYAILFAAKDFDFRYDQLVREQENDDHARLPFMHALSTGLKAWA
                     TTIASAGATEARKMCGGHGYVALSGLPEIEGSVSATATFEGENYVMWQQLVVYLFKQV
                     RASCAGQDVDAEVKDYIGGVRSYLGNGGSPSRIQSCDKKTLFDGSTLVLIYKKRSQRV
                     LAAAYSSYRDMCNRCSAAEAWNACMMTSLAAGQAFVEYIVLESFVKRTSPSATRDAPV
                     SQALSHLFSLFALTTITSPTPSFAAGSFLEHGLLTPDELNEIRVHINELLASLLPNIA
                     ALTDAWDFTDSSLCSALGCKDGNVYERLLSWTRQLPANSGRAVEKAWEASEGIEEFFK
                     ASRL"
     exon            33420..33493
                     /number=1
     exon            33561..35547
                     /number=2
     CDS             complement(join(36045..37042,37097..37522,37612..37762))
                     /codon_start=1
                     /locus_tag="AO090010000015"
                     /note="cytochrome P450 CYP4/CYP19/CYP26 subfamilies"
                     /old_locus_tag="AO070244000014"
                     /protein_id="BAE65935.1"
                     /transl_table=1
                     /translation="MDSFLFLALDYSLRGFAVSLFGTLWIALVFWYLATYLISPLRKI
                     PGPFLAGWTNLWRMYHVTQGQSQVVLHELHQKYGPVVRIAPNVVDLDLPEMIKTIYNT
                     KGDYRKTEFYHGSSAKSNGRIIYNLFSECDPDIHAQQKRPIAKYYSLTGVLPLEPHID
                     EVINYLCQRLEEEFINGLNAGITCKLDQWLLFYTWDVVGQATFSEPIGYLKNGFDFDG
                     TIAISDTAMDYFSLVGQLPVLDHLLDKNPIYRIGPPAFGNITNISITHLLDRLQGKDT
                     SYHDANKPDFLDRFIDAKDKYPDIVDDSQIISYLMINMIAGADTTAITLNAAIYFALK
                     DRRVWARLQKEIRACQSSLDAAPSAVPYNIASALPYLNAVVREAMRMHPGVAMTLERY
                     VPPGGLTLPNGQYIPQGSIVGMNPYVIARNRSVWGEDSDVFRPERWLRDDSQESEEEF
                     QARLRLMNNSDLAFGAGSRICIGRNLGLLEVYKVMATLISRYDIELAHPHRDWKTHNS
                     FFVRQEGINVKLSRRS"
     exon            complement(36045..37042)
                     /number=1
     exon            complement(37097..37522)
                     /number=2
     exon            complement(37612..37762)
                     /number=3
     CDS             join(38464..38475,38840..39203,39269..39386,39440..39504,
                     39581..39996,40709..40867)
                     /codon_start=1
                     /locus_tag="AO090010000016"
                     /note="predicted protein"
                     /old_locus_tag="AO070244000015"
                     /protein_id="BAE65936.1"
                     /transl_table=1
                     /translation="MASKVFLLLYTVFTTIAGKHGFGQPITSLSMDEAVQAVYMEMVG
                     QTFAVLGMAIAKLSLGIFLLRIVVKAWHRRSIWISMVSLSVVSVMTAIIFWTQRLPSK
                     AIYDPRVPGRTIVSVTPFSVLLGSWCAAVDFYFAILPWIFIWELNMRFKEKMTIAISL
                     SLGFIAGICGVIRTIELGGLSSANYTEDTVPLIIWSAVELAVTLICVGIPTIRPLYRY
                     IVHGSSVKESHEVYKRQDESGSGSGSRGKPTFAMPMRNFARAGRKDELLTTTTTTVDI
                     PDANDNRPDGNSRSYVTGAGQNDEEALVATIEEENSRYRDHICVRQEVHPFPFRSAVG
                     SEERRHQCVLLVKFWRGCVPTAGRCSRGTTTPASPGLGGGTKI"
     exon            38464..38475
                     /number=1
     exon            38840..39203
                     /number=2
     exon            39269..39386
                     /number=3
     exon            39440..39504
                     /number=4
     exon            39581..39996
                     /number=5
     exon            40709..40867
                     /number=6
     CDS             join(41644..41747,41797..42118)
                     /codon_start=1
                     /locus_tag="AO090010000018"
                     /note="predicted protein"
                     /old_locus_tag="AO070244000017"
                     /protein_id="BAE65937.1"
                     /transl_table=1
                     /translation="MDTDLNKYNSKWVEFHIRDHLKDGEISVRHTVIEDGEFQDPNNR
                     RKSIHEDVIDEIVIPSDGIGEICAHGRRGSEGRLDLFHGNDKICELHWDDRDGRRENL
                     VEMLDESDKYRIEHGGWSPEANGPLGHVYVDVWAKDKSK"
     exon            41644..41747
                     /number=1
     exon            41797..42118
                     /number=2
     CDS             join(43200..43300,43386..43752,43813..43995)
                     /codon_start=1
                     /locus_tag="AO090010000019"
                     /note="predicted protein"
                     /old_locus_tag="AO070244000018"
                     /protein_id="BAE65938.1"
                     /transl_table=1
                     /translation="MVSRRLLSWRQLLLILHTLYGISVALERPTGLERASSRNLTYTL
                     KLEGDDIIGPFAHKESGLLPNTVDLVNTRAESERWRSATDASETVNLPSSVEASGSTT
                     SAADQPKTKEGVSSEGIVPTSMSSSKPGRSSQKGSGNDGCMSAMDAVSFVNKVKNRFA
                     EHPELFSEFLLILQAYQRESRPLRKVYEQVEELFDAEPDLMKDFKKFLPEATAYKR"
     exon            43200..43300
                     /number=1
     exon            43386..43752
                     /number=2
     exon            43813..43995
                     /number=3
     CDS             44448..45086
                     /codon_start=1
                     /locus_tag="AO090010000020"
                     /note="predicted protein"
                     /old_locus_tag="AO070244000019"
                     /protein_id="BAE65939.1"
                     /transl_table=1
                     /translation="MSELPKCERDFDIAYQEWERDSAEWFDQEAWDKALESWISPFLE
                     ERDFGYAILQRRRRLLSIKPAARPKCEDKSQMKSPDYQEAERKREEEVNELMEAYWTS
                     NRTLLAMDETMPLAFNVVEIVLLRSHRDRHGRPYSWVMDRLTCALTGGCCGRACGCCE
                     KPLLTYYHPLNYKYPDGKMEVGVYGHCTAECPCCIQVRHRYHPHPRLPKSAF"
     exon            44448..45086
                     /number=1
     CDS             join(45327..45472,45546..45872,45933..46400,46543..46791,
                     46856..46859)
                     /codon_start=1
                     /locus_tag="AO090010000021"
                     /note="predicted protein"
                     /old_locus_tag="AO070244000020"
                     /protein_id="BAE65940.1"
                     /transl_table=1
                     /translation="MPFTIEAAHLWKAFVLMLIWVVTNSSRPLFVVFFDWLSVHFKHW
                     LERMWPLPEGGSPEARPDQENKGSVGAEESEEGKKKKGSLGDSEEESDDESEGGVKLS
                     EGSVGEKKRAWRRVWRVVVEEEEEEEEEKFVRSDLPGYGLLAQTKDILKPRVEKLRHW
                     RGLRREVDLEKGVRGRSKSAGPVPHQSQPKATQVEASGGAAPGDLNAIVSVLIPLVVN
                     LKHRGWRFQGAVLPFVFLFLSFVFFFLVVLFWAFCRSLFGVLVVPFFFLEGLCFVLCF
                     VVFFGVVLFFNITILYITISHITISSITMVRQGARVGGNEPPKTTITFHLPSKGLSRP
                     GTVGTLCRLASSSNPLRLVTISSTSYVLSLWFGSSASVKVWLARSTGSAWNSIVEPAL
                     RYPEC"
     exon            45327..45472
                     /number=1
     exon            45546..45872
                     /number=2
     exon            45933..46400
                     /number=3
     exon            46543..46791
                     /number=4
     exon            46856..46859
                     /number=5
     CDS             complement(47495..48388)
                     /codon_start=1
                     /locus_tag="AO090010000022"
                     /note="predicted protein"
                     /old_locus_tag="AO070244000021"
                     /protein_id="BAE65941.1"
                     /transl_table=1
                     /translation="MSIYRPLSGLPRNCRTETFSNFKRLSTVINSVYDELVEHHGEGN
                     QWIVVLGLSRNAIQRLGDERSRDGISFRFEHDGSTGIIKVPGPGHEITTDRVKTKISF
                     LMLRMGIEDQYWVVATRYQGTGGSKSKEGDQGFLPPTRQPVGTLATGVCPFPTLVIET
                     GVSESLPKLREDVLWWFNHSRGDVRIVLVLCIRKRAQQPVMLIEKWQLAPPTTPRPLT
                     RRALQQLQQQVPYPMPPEVQQQPSSQSAYCAQSIEITPQAVTGPSLILPFLAVFGRPP
                     VAPEADLILTTAMLASCIQHL"
     exon            complement(47495..48388)
                     /number=1
     CDS             complement(48978..49373)
                     /codon_start=1
                     /locus_tag="AO090010000023"
                     /note="predicted protein"
                     /old_locus_tag="AO070244000022"
                     /protein_id="BAE65942.1"
                     /transl_table=1
                     /translation="MHSFPKARAWSIVLSTAAVMEGYDLLLVTSFFASPPWTKQYGTL
                     QLNDKYELSAAWQIALYNGPAVGEIVELCLNDLVVERIGYRRTKGRTYAELDILFEKG
                     VSARRFANTTADLFSRPSRVMSSRMELTC"
     exon            complement(48978..49373)
                     /number=1
     CDS             join(51603..51849,51919..52473,52529..52599,52655..52735)
                     /codon_start=1
                     /locus_tag="AO090010000024"
                     /note="predicted protein"
                     /old_locus_tag="AO070244000023"
                     /protein_id="BAE65943.1"
                     /transl_table=1
                     /translation="MKPYLPEYEGHEPQSGLTPAVAPFAGRLGGNQDFVVDRSDPRNE
                     KVLEKVPDAAPWMSLSEIFDLRGFLSLDLWKFACLECIASMMNVFISAWVTLHEPAAV
                     EAPKTEVGIYHTVTFFSPLFGGLTNLLLTPLLIYTFAPSSGGHISPTITLATLFARII
                     TFPRAILYMAGQTLGGALAGFAIHTAYGSRDFTVGGCHVDTTLVPVNAALIIEFFACL
                     VLIFLAFGVALDPRQAKIFGHAAGPWLVGVVLGVVCWATAFTRPGYIGASLNPARCFG
                     VYVASEFPGYHWVHWVAPLAAAVAHGLVYLIDPLWSDPRLE"
     exon            51603..51849
                     /number=1
     exon            51919..52473
                     /number=2
     exon            52529..52599
                     /number=3
     exon            52655..52735
                     /number=4
     CDS             join(53704..54107,54157..55300)
                     /codon_start=1
                     /locus_tag="AO090010000025"
                     /note="predicted protein"
                     /old_locus_tag="AO070244000024"
                     /protein_id="BAE65944.1"
                     /transl_table=1
                     /translation="MSSAANPSIPVPDYPLDDNPPSYSAAIQSTEPSPGLLTPGPGIY
                     SVIGQSRYHGSTSSLALSHSNTGTNEGKRRLLLVYIHGFIGSEDSFHHFPKHVHDLLT
                     ISLSKSHVVYTKIYPRYKTRGPVHIARDNFSQWLSPHEAPDLDIILLGHSLGGIVAAE
                     VALMPTQSATGRVNTGLNHRILGLVNFDVPFFGLHPRVVTTGIGRLFRHKLDETSDTT
                     NSVTSMNEGIGSPDTTFNPAFQNDVKLTRWTGWDGAWHFISKYSHHLSRSILQYAYSY
                     YDHAGCMNNYPELFKRHKQLMKLEAIDELQEQKAQSRGAARVRFVNYFTKSTGIVRAD
                     RTDKTLEAHIVENEGLHKPNHQQSMESTTDMLEVDYKPGRRKSAPPCSVDADELLGSK
                     NVMRPKSSGSQPSTLHSESAVTMIEESTVSDGQDEDTTVTRESSHQSQEARRQFCYLP
                     KDAYRGREHLWIPVHMEGIDEITAHQSMFLPQGTYYDKLVGDTVAFIERWISDDLTKR
                     AILGGFF"
     exon            53704..54107
                     /number=1
     exon            54157..55300
                     /number=2
     CDS             complement(55592..56422)
                     /codon_start=1
                     /locus_tag="AO090010000026"
                     /note="predicted protein"
                     /old_locus_tag="AO070244000025"
                     /protein_id="BAE65945.1"
                     /transl_table=1
                     /translation="MATSTVSAQQLTEAKAKFKQDGWAVVPNVIDPEKTKEVVDRLWK
                     AKEESERRGDPTYLDWLDPNSSNVRIFYLMELDPIFRELISHPVAVEMVQSALGQNFL
                     VSNFTANIALPGSKSMGLHSDLSLQCPDPWLSTWGLNVIWCLHDVYYENGATLYIPGS
                     HHWKTKAEVPPEEEARKLLVPFEAKAGSIIVMDGRLWHTSGCNVTQDKERALLFGAYN
                     APFLRGQVNWGVGLSEETKKTLSPQLREWLGVNRDGNLGVVTGVNDVFAEGAPPPAQA
                     "
     exon            complement(55592..56422)
                     /number=1
     CDS             join(59078..59100,59163..59208,59260..59529,59598..60148,
                     60195..60249)
                     /codon_start=1
                     /locus_tag="AO090010000027"
                     /note="predicted protein"
                     /old_locus_tag="AO070244000026"
                     /protein_id="BAE65946.1"
                     /transl_table=1
                     /translation="MIVFGGGKQDKDVPPENLLKIVTLLFVIEFVYIFCQWLIKMSFL
                     TFYLRVLSISPLYKKTVYGVMVFTSAQTLAVLLFYGLQCLPLDAFFHPEAHPDAKCIP
                     TAVTLYFPASMNVLTDLLIYILPIYPLWTLQMSARRRVGLIVCFTVGGSTIIVSLLRF
                     IVLVQLASGSRTFYVYGSVAIVTTIELCTAIMTANMPSLRSVWRTHVSGTLYGSSGRK
                     PSSYELGTTSRARGNRKMIKSSIVQRLKQGATNVSHADSEEELCRNGGDIVVSTQVNV
                     SSVADPSVNSPQLPPSYYKPSEYNSLSLDSISSYAANA"
     exon            59078..59100
                     /number=1
     exon            59163..59208
                     /number=2
     exon            59260..59529
                     /number=3
     exon            59598..60148
                     /number=4
     exon            60195..60249
                     /number=5
     CDS             join(60986..62928,63061..63811)
                     /codon_start=1
                     /locus_tag="AO090010000028"
                     /note="predicted protein"
                     /old_locus_tag="AO070244000027"
                     /protein_id="BAE65947.1"
                     /transl_table=1
                     /translation="MGLIRFYTSLALISASAFLVRGQSDDLGLANGYTNLKTNNFDLQ
                     LVTDAQILASLKPSGSSFDFLPSDYLPYRAANGQYHIGDITFRYRAVGEKEWTAGDSS
                     QARAVVKSLDANALAAADITSTLPSSSALQIVRQWLDVEGDLGLSFTLTNKGNSSVEI
                     GSLGFPIESNSIFTNRTADEVTAQCSLVDPYIGRDAGYLQFSPTSGQGPTLIITPLVN
                     TSTPFEAWRNLDEVSDTYTGYGSQTFEGFYEWQTHSKAYAEKEWAQVNPWNEPTARSL
                     KPGESTTVGLRFSVVKDGVRGIQKAVQGTNTPLTIGTGYIVPRDLTAQLFVFHSANVS
                     KVVSDNNAFDIARPSSNLVSLSPTQSAWGRTRVTITYADGKVQTVHYFITDTAPDVIS
                     KLGEFSTTAMWFDDEKDPFGRAPSVITYDEATKAQVLQEARVWIAGLMDEGGAIFLAS
                     TMKEHGLPNAAEVAKLEEFASKVLFGNIQNANFTVRKSVFYYDPDQLPSYEYSNNIDW
                     GNWWSWNKDASYSTDRAYDYIHVIGAYWSLYRAGRDNPTLLKVHPWQWYLGQAYNTTV
                     TCFATNSAGDGLVGYSRLGLMGETVVGELLADLQREGWTEEADAVEAAMKLRAEAWDR
                     QSEPFGSEMAWDCTGQEGVYYWSKSDANGIALGLEWERPAVLGFHVRLSPASACPRLR
                     SFSYAGKLQRIERMIHHYGSSLNALPLLAEFRQNPSDTYLLRVGYGGITGPLSNIRED
                     GSMYNAFHSFPDTLKGDDYSGDYGPSFLGMMLGAGTYVVDDPDVGLIAYGGNLSVESD
                     RVTVRPRDAVRRRVYVASMGVYVTISTGQIEEFSFSATQPNSLELDIVAGSSNTTTAI
                     VWVENPGTTDAYAVTTSGEQTRGGVVVELSAGSVTVTVARQ"
     exon            60986..62928
                     /number=1
     exon            63061..63811
                     /number=2
     CDS             64826..66364
                     /codon_start=1
                     /locus_tag="AO090010000029"
                     /note="predicted protein"
                     /old_locus_tag="AO070244000028"
                     /protein_id="BAE65948.1"
                     /transl_table=1
                     /translation="MFLLLIKLATYAAAVAAQVDSSSPFSFTSKGNPILSNGSWYSGD
                     PAPLVVNDTLYIITGRDSAPPDENAFVMNQWGMLASSSANPEGGTWTLYPDVADPQAV
                     FAWAEPGSAYAAQVVQGHDSRFYMYAPVTQADSANEDAFAIGVAVSDSPTGPFQDAHP
                     SGPIISQSVPPPGNTIQNIDPTVLVDDDGHVYIYFGTFGQLLGYQLDPDMVTVASNVT
                     QVTSLTGYFEAPWLMKRQDVYYMLFAANNAGADSPCTPTSYHACIAYGTASSPMGPWT
                     FQDVILPIVSSTTSHPGAVEWNGEWYLVYHTADAVGGGHFRRSVAFDKLIWDDSQAPA
                     KINVVQQTFGPKSPSPPTHNVAPRAVASSVHSTPIQYWVQALNDGIIRENPLPPDYWC
                     SYEATDSPQTSTLVYTWNETVQLNGTSMVFFADHAAGANEGVAPPQEWYIEYKDGSGT
                     WQRAANTSSYPLEVTDTPDVVAFETVDTVAIRAILVASGAQGQYAGVGVKEWEALSTT
                     LHSY"
     exon            64826..66364
                     /number=1
     CDS             join(68326..68669,68725..68850,68910..69006,69071..69631)
                     /codon_start=1
                     /locus_tag="AO090010000030"
                     /note="predicted protein"
                     /old_locus_tag="AO070244000029"
                     /protein_id="BAE65949.1"
                     /transl_table=1
                     /translation="MKYAAVLTTVAALASRALGAGVSGTAEGFASSATGGGSATAVYP
                     TTTDELVSYLGDDEARVIVLSQTFDFTNTEGTTTETGCAPWGTGSACQVAINKDDWCT
                     NYESSAPSTSVTYDNAGSLGITVNSNKSLIGEGTKGVIKGKGLRIVNGVENVIIQNIA
                     VTDINPKYVWGGDAITINQADLVWIDHVTTARIGRQHYVLGTEADNRVTLSNNYIDGE
                     SDYSATCDGHHYWNVYLDGSSDKVTMKGNYFYKTSGRAPKVQGNTYLHAVNNYWNDNS
                     NHAFEIGSGGYVLAEGNTFADVTAAVEDSSFEGELFSSSSDADTCSSYIGRACKANSF
                     TNSGDLSGTTVDVLSKFKGETVATADTASTAPASNAGQGNL"
     exon            68326..68669
                     /number=1
     exon            68725..68850
                     /number=2
     exon            68910..69006
                     /number=3
     exon            69071..69631
                     /number=4
     CDS             complement(join(70078..70725,70779..70832))
                     /codon_start=1
                     /locus_tag="AO090010000031"
                     /note="conserved protein/domain typically associated with
                     flavoprotein oxygenases, DIM6/NTAB family"
                     /old_locus_tag="AO070244000030"
                     /protein_id="BAE65950.1"
                     /transl_table=1
                     /translation="MFYEPGVTEHGLPHDPFKACVVPRPIGWISTKNKKGQCNLAPYS
                     QFNNLTFDPPYVMFSSNQTATGARKDTVVNAEETGTFVWNLATWDLREAVNISAEQTP
                     YGTDEFELCNITKEQATIVDVPMVKESPVKFECEYHTTVRLPGNPPMGTVDIVIGKVI
                     GVHIADEVLTDGLLDIKKTQPIARCGYYQYTVVRDTFEMIIPNMSADVLYGLEGNAAR
                     NRQKNEENEESSSNQ"
     exon            complement(70078..70725)
                     /number=1
     exon            complement(70779..70832)
                     /number=2
     CDS             complement(join(71307..72083,72150..72263))
                     /codon_start=1
                     /locus_tag="AO090010000032"
                     /note="predicted protein"
                     /old_locus_tag="AO070244000031"
                     /protein_id="BAE65951.1"
                     /transl_table=1
                     /translation="MEAVQSFLSSLWQSVGFWKAAAIFFALLNLKTLPIVWHIRVYRY
                     FFKHGYLITPAVEQPPRPSTEILKPVSIFSRAPIMELDFNMHKSNSTYFSDLDVSRTA
                     LMSSIVVKGAALLEKNLKAEGKKGFLGFILGSVYTNFKREIPAYMKYEVKSHVASFDQ
                     KWIYIITYFLKPGKGSSKKGQDDSEVQKKRLLAVSISKYVLKKGRYTVPPKDAFEAAG
                     YTPLLGTSAANGHATGVENGHANGAAVQRQETADGKSDEWDRLKAEIDRGLTIVEPFI
                     DQEDKLMEDYVHKMGLPGFA"
     exon            complement(71307..72083)
                     /number=1
     exon            complement(72150..72263)
                     /number=2
     CDS             74083..74922
                     /codon_start=1
                     /locus_tag="AO090010000033"
                     /note="predicted protein"
                     /old_locus_tag="AO070244000032"
                     /protein_id="BAE65952.1"
                     /transl_table=1
                     /translation="MFGERLLYLDPALLQTINPEDMMPLEVDDEFIMENEDLAPRIQT
                     PCVVTGFILHSRVFWAAVRDPLPGHSAEEPCPCVQARDPLIQISYLQDRLQNLKYLLH
                     DIPAILRPWGPPNEDLLNSGGTAAISRLNFATMRANLHVTHLWLQSLLIDQLEAAHAG
                     QRGALPASRPGHSLYKTDPKSLWLEREELCRQLFFVLSTLPQASLEANGLHLAYKVRD
                     IAASILACPFHPQEPEAKRAAEYVQDATSWLSRLDRSESINALHLQSWVDTDRVRSEA
                     TIP"
     exon            74083..74922
                     /number=1
     CDS             complement(join(74981..75532,75596..76862,76934..77540,
                     77621..77741))
                     /codon_start=1
                     /locus_tag="AO090010000034"
                     /note="beta-glucosidase-related glycosidases"
                     /old_locus_tag="AO070244000033"
                     /protein_id="BAE65953.1"
                     /transl_table=1
                     /translation="MSFVESVPDRVANGFDRIATADIEQIIQQLTRDEKVALLTGEDF
                     WHTVPIPRLGIPSIRFSDGPNGLRGTKFFGSVPSACLPCGTAIGATFDRDLAVRIGHL
                     LAAEAKAKGAHVVLGPTINIPRGPLGGRGFESFSEDPLLSGIIAGNYCKGLKEKNIIA
                     TLKHFVCNDQEHERMAVNSLVTDRALREIYLLPFMTAIAIGEPDAIMTAYNKVNGIHA
                     AESPKLLQDILRGEWGWDGLLMSDWFGTYSTTESIQASLDLEMPGPTRWRGSALAHVI
                     TANKVSMATVNARVRAVLRLVQKASRSGIPERAPEGQLNREEDRRLLRKIASEAIVLM
                     KNEEGILPLDKRRRVAVIGPNAQVATYCGGGSAALNPYFAVTPFEGITNAALEGVDFA
                     QGVYGHENLPLLGKRLRTPDGHTGFVLRIFNEPPTATTRVPIEERLETDAMVFFLDYS
                     HPHLQSTWYADAEGYFTPDESGLYDFGLCVQGTGKLYVNGHLLINNVDVQTPGSSFLG
                     SGTVEERESIQLEAGREYKIQVQWGCAKTGKFKVPGVVDFGHGGFRFGACKRLSPAEG
                     IEEAVRLAARVEQVILTAGLSAEWESEGEDRTTMSLPPHTDQLIERVLAANPNTIIVL
                     QSGTPVEMPWIHQAKAVMHAWYGGNETGNAIADVIFGDVNPSGKLPLTFPRRLKDNPT
                     YFNYRSEGGRVLYGEDVYVGYRFYDEADIDPLFPFGHGLSYTTFELSSLELTKGSSHN
                     MKVKCTLRNTGQRAGAEVIQLYVAPVSPPVKRPLKELKEFRKVWLAQSAEEVITIPVD
                     LIRATSFWDETSSSWCSYQGTYRIMVGTSSRGNFLEDSVELGETTFWSGN"
     exon            complement(74981..75532)
                     /number=1
     exon            complement(75596..76862)
                     /number=2
     exon            complement(76934..77540)
                     /number=3
     exon            complement(77621..77741)
                     /number=4
     CDS             join(78466..79682,79760..80120)
                     /codon_start=1
                     /locus_tag="AO090010000035"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070244000034"
                     /protein_id="BAE65954.1"
                     /transl_table=1
                     /translation="MGTTKAESTNKPAGEEELAAVLPTGGPAWYRQGYLLRLNSIILA
                     LVMFSSANGYDGSLMNGLQALDQWNNFLDYPTGVRLGWLNAIYWLGCGVGYPTAAWLA
                     NRFGRKPGVYVGYLFLGLGCALQTAAPNQTSFLLARLFVGVASALFGNSVPLLINEIA
                     YPSHRGIVNSLFMSGWYVGGTVSGWVIFASRDYPSSWSWRLPSLLQALLPLVALPGFL
                     LAPESPRWLISVGRPEEARTILTRYHAGGDTNSPLVNYEMLTITSAIEAEQEAQSSAS
                     YLEMLKTPGNRRRLFISITLGIFAQWAGNGVVSYYLSLILDTVGVTSVKDQTLISACM
                     QMWNLIFAITGAYLIDRFGRRPLFLASAVVMFVSYVFVTALSGSFAATQHASTGAAVI
                     PFLFIFFAGYGLSLTPLLTAYPCEIWPFRLRARGLTVTWVASICAIIFNTFVNPIALD
                     AIEWKYYIVFIAVLLIFGITAYFFYPETKGYPLEQIAAIFDGPTSQGGIDPERAAKCL
                     DVFDDVKSLSVTHQESI"
     exon            78466..79682
                     /number=1
     exon            79760..80120
                     /number=2
     CDS             complement(join(80409..81384,81439..81935))
                     /codon_start=1
                     /locus_tag="AO090010000036"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070244000035"
                     /protein_id="BAE65955.1"
                     /transl_table=1
                     /translation="MTTQQSNAQDLEAARSKSDDPTKQFDPDFVTWDGPEDPENPKNW
                     PRRAKWRNTVAVSIFTFISPVSSSMVAPALSQLGADLNMQSDIEVELALSIFILAYAI
                     GPLFFGPASEVYGRVRLLQISNLWYFAWNLGCGFAQTSAQLFVFRFLAGIGGSAPVAL
                     GGAAIGDIWTPEERGKAMGIYTLAPILGPVVGPIAGGFIAEYTTWRWVFWSSSAVAVA
                     IQVVGLIWLHESHPATLLNRKRNRLVKQTGNHKLHTGIGPINLSSKIGGALVRPVRLF
                     TTQPIVMVVALYMGYLFGTTYLLLATFPTVWGTQYGEGQSIAGLNYVSIAIGSFIGLF
                     LNFVLIDRIYRSLKEKNSGIGVPEFRMPTMFIGSGMITIGLFWYGWSVQGHIHWIMPN
                     IGVAIFSAGTMGCLQGMQTYIVDSYTTYAASAMAACALLRSLAGFGFPLFAPYMYRDL
                     GYGWGTSVLAFISIAIGFPAPLLFWHCGAKLRAMSAYASG"
     exon            complement(80409..81384)
                     /number=1
     exon            complement(81439..81935)
                     /number=2
     CDS             82297..84333
                     /codon_start=1
                     /locus_tag="AO090010000037"
                     /note="predicted protein"
                     /old_locus_tag="AO070244000036"
                     /protein_id="BAE65956.1"
                     /transl_table=1
                     /translation="MSTRPVAIAPATSKTSSGSNGGNPTHPTTMSYNCQPCVRRKVKC
                     DKAVPSCASCEKAKLECLYKAPQPPRKRKRRESEDVHQRLARYERVIQENGLLSTTEA
                     RSPSCQGTPGSVHDDGPARTAHSGAAKTGRLVSEDGKSRYIDSRVWLDVAEISTRELS
                     DNEGDDQAAPMAMDLPIDDPLSATLLGMSNDLSSYHPPYPDAMKLWTIYVKNVDPLCK
                     ILHIPTTTEMIEMVSQQPTKATRAQECLVFAVYYFAVYSITDEDCIRRFEKTRTSLMS
                     KYQYAMRQGLVNASWLKTTELQILQAYVLFLIAMRTRIDPHTFWIWTGVAVRIAQRMG
                     LHRDGEDLDLSPFDVEMRRRLFWQLIPLDGYAGQVSGTGISIAPGDWDTKQPLNINDD
                     QIYPDMKQPPNAQDGASEMIFCLTKAELSEFYARIAVKMNSVSSKGQMRDNAHLERLI
                     DDLESDLEMRYLRYCDIINPVHILTLGIVRAAANMVRLRSQMPSLKSQKIDEAQRREL
                     CVLAEKILDTDNALYANSDLRRFQWHIKTFFVWDAMICILSGLATEGFLSRTELDRKW
                     EKIIVAYSNHPEIIESKGALHAVVNEMTLKAWISNPPSNSTVEPAFVSALRSQHETKG
                     FAHVHNPDTTTRHDKPAEAADFLDTLLQSPGGTDLYFDGNINYGAADWMFWDQA"
     exon            82297..84333
                     /number=1
     CDS             complement(join(84450..86165,86218..86369,86423..86825,
                     86877..87090,87143..87567))
                     /codon_start=1
                     /locus_tag="AO090010000038"
                     /note="predicted protein"
                     /old_locus_tag="AO070244000037"
                     /protein_id="BAE65957.1"
                     /transl_table=1
                     /translation="MYEPVFASHAPSVGCIDITNASILIDKEDFEGIHIAAEALAEDF
                     ARVTGNGASPILYDRSQDFDTEVAIVLGSITRSPTIQKLIQDGKLDVTAIDGQWECYI
                     TTVLHDAIQGVKKALVIAGSDKRGAIYGLYTLSDQIGVSPWYWWADVPPKQSSEIYAL
                     NVVTKHGPPSVKYRGIFINDEAPSLTGWVHEKYGPKFNVNFYKRVFELLLRLKANFLW
                     PAMWFGFPHPGSSFFMDDPLNQETADKYGIVMSTSHHEPMQRAMNEWFDHPYYEPEKS
                     WSWSKNKPKITKYFQEGADRARKYESYITMGMRGHGDRAMDAEDPSAVLKDVLSTQRS
                     IIKNTYGEEDAVHQLMALYKEVQEYYENGLHIPEDITLLFADDNFGTVRRLPSGDEST
                     RHGGAGIYYHLEYVGVPRSYKWLNSNSCAKVWQQLEQTYNRGANDIWIFNVGDLKPME
                     VPLTFVLTLAWDARSLQMNQLQEFFYTFVEHTFHLGSAVSQQCSELLLKYDRLVALRK
                     HEHIEPETFSLIHYGEAEDILRRWEELLSQAEELEKSIPAPMMPAYFQLILHPIKASC
                     IYVALRVAQAKNQLFAVQRRNSANTWAYEALRLFEEDFNLSEEYHSLLNGKWNHIMRQ
                     PHYGYTQTWHAPSRDMISGLSFVQNRQDSNPVVGWIGVAVDGHPGIRPGLTNEESDRT
                     HPSRRDLVAGVTLPPMEPYGPKSRYFEIYCRGTKSVSWTLTSTHRWLTLSPSSGTIQP
                     KGGDERVKITVDWERVPSQLDDILLVDLRSSLGDYEQIHIPVSNRTVSADATGFVEAD
                     GHVSIYATSFINSPLSAYRILPFIGRTPTGGVALTAGTPVSHSEYLQYPFITFTPTAA
                     ATLILEFTLTLDTDTSLPITYDIQLDDGALASHRLVPQVEKPGKLPDGWQESVMDNIW
                     TRRHSVDLSLPGLHKLRVRLQTENCVLEKIVVDLGGVRDSYLGPPESFFHQGKYR"
     exon            complement(84450..86165)
                     /number=1
     exon            complement(86218..86369)
                     /number=2
     exon            complement(86423..86825)
                     /number=3
     exon            complement(86877..87090)
                     /number=4
     exon            complement(87143..87567)
                     /number=5
     CDS             90674..91342
                     /codon_start=1
                     /locus_tag="AO090010000039"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000001"
                     /protein_id="BAE65958.1"
                     /transl_table=1
                     /translation="MCTRYQAYEIKDQNKIVDSTRTICYQDEHEGLYMIKDTHLLGYS
                     WDEIWSFENDSDNDYSRVVTTTKCSRVRQGTQFDTNFKVSAGFNGLGLSLSTECGPES
                     KTFNESETTKTETTEDTCTVKANTSVFLYQKVYHFRTDIWFRLDSFAQMWTVGNYKRP
                     GVALVSSDVDIHANSFFQDDKSLVGKGDLDATTTRSVDEKTNIKPFEKCSDRCQDYLH
                     ERGV"
     exon            90674..91342
                     /number=1
     CDS             complement(join(91982..92556,92622..93267))
                     /codon_start=1
                     /locus_tag="AO090010000040"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000002"
                     /protein_id="BAE65959.1"
                     /transl_table=1
                     /translation="MYCFKSSTIFAVLSLLSQALSSSSQEPLGIKDFHTPEPTAKWVH
                     PGVLVSQPQLDFIRLKLAAEEEPWTGAYKAMLGSRLLSPLLEPTPFTNVVCGPFSKPN
                     IGCTNETHDALAAYGNALAWAISGIETYALQSMRFMDAWSQTLQSHNCSNAPLQSGWA
                     GSVWPRAGEIIRHATVGGQNAPWPPASIARFESMLRDVYLPLTARGSDYDSNWELVMI
                     EASMGISIFIDDKSNYNKAMELFAERAPATIYLTSDGSYPKTVHCPNCSKHEIETYWR
                     QSVFQLNGQAQETCRDLEHTGYGLASISHIAETSRIQGEDMFTTDIGRRLMYALELHT
                     DFEDGRAAPCWLCNGTLEGVLSPITEVGYNALHTRLGYDMPKTGKYTIKNRPVAHNGL
                     FVGFETLTHASNPR"
     exon            complement(91982..92556)
                     /number=1
     exon            complement(92622..93267)
                     /number=2
     CDS             complement(join(95570..96306,96404..96788))
                     /codon_start=1
                     /locus_tag="AO090010000041"
                     /note="threonine dehydrogenase and related Zn-dependent
                     dehydrogenases"
                     /old_locus_tag="AO070317000003"
                     /protein_id="BAE65960.1"
                     /transl_table=1
                     /translation="MALTNTSAINATMRAVVWQGDAYNVAVVDLPRPTIINQTDVIVR
                     MSRAAICGSDLHIYRGTTEGMPAPFGLGHEGFGYVSDVGSGVGSLRVGDPVIVPFTVD
                     EGHLHTELTTGLYGAFGNGGDLGGTQVPTLNYTDPSTNDSVSLLNDYVMLSDIFGTGW
                     ASLDYAGFEAGDTVAVFGAGPVGLMAAYSAILRGASTVYSVDYIPERLQLAESIGAIP
                     INFRDADPVEQILALEPNGVTRSIDAVGYEQVNRNLTVQSDVIIRNMLAVTSTGGGLG
                     TVGVYTHESNNTSTAPRASTVNTHVDFSLARFFYGEFTWGAGPSKPIDLAPELLHLVT
                     SGKARPGFIVSDVINIEDAPEAYARFERHNTTKVIISFD"
     exon            complement(95570..96306)
                     /number=1
     exon            complement(96404..96788)
                     /number=2
     CDS             99892..100593
                     /codon_start=1
                     /locus_tag="AO090010000043"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000005"
                     /protein_id="BAE65961.1"
                     /transl_table=1
                     /translation="MVIGIAMMSAMVPTIIGLNEATKGARESEDKRRENEKKSRFHLV
                     AACDIDADSESRRQEVHNASVYLGSDKRVWKVSRQIIVPNSCPLTPHLKLYITKHPTP
                     SMTAFNGHFFELPDLAQGNLNGLVAISGETPPTLRWVYLDKNTYEMRWGGKQDREGHI
                     GGPFDLTRDGDYLALNDTQRWLALRLEDTEQDATEAVAGVWRLCCDWDENNGESLSID
                     TPSMPIYLRRVLADS"
     exon            99892..100593
                     /number=1
     CDS             complement(101379..106781)
                     /codon_start=1
                     /locus_tag="AO090010000045"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000007"
                     /protein_id="BAE65962.1"
                     /transl_table=1
                     /translation="MPVTNTRTIKRWLEPEDLVLAKVVEATAQLAQEREESTCVWMMP
                     YLNRFLKGKRQTLAISGNPASGKSILATVINDHLQHPVGDVSYRTIFVPISEFANDLR
                     IYLLLTVYPDSRVLANTMPRAIAKTILSQLFDQQIGNVRLYRVLSDTYRRCQETFDPE
                     VYDDIIWGVLENALEASRKDAKELVLIVDGVDEANGGEAALLKRLRHATHNAKSTRLI
                     LLTSQQESKTSPREGQDTVRITPELILDDISAVVRSILQGSDSFNKAPQERREIQVTR
                     IAEASNGSFLWAKLASKQIRDEAPSNTQALVKAVDNLVNKKPTVKDFINRTLHSNVTQ
                     EAIKLVVWLATACRPLQVQELSALLSIQQDKQRITEQDKESPLHILKPVASLVFIQNN
                     LVFLRHAKVRDSILEIFNHGNILPTIKNRNLDLAQRLLLYAKLVVPDGRELALEPLES
                     RFTRNLIERHPLLDFALRYWIDHLRTAMGCNTDREISAAAKEIRNILPTSTTLPRLEM
                     AVWERKETPVLVSFHDTQTRLYQSILSSKQQATLQTLLCEVSFYWSIHKAPAQGDHIF
                     YDAIKICQELLSAQHSITMTVAQYFLEITTGQVTTSKTTTMARRIEVLHLLVESYKVV
                     YGSTSDLFISTATQLAEHYHYIKEEHKAEEIRVSIGARHPGGPKDPIKPQLPDDSLHI
                     HLIGRPQPTVGGSSLAIDEIETDVEVSESFEFESMLSQAEQYANAGDHKAAELIYLEI
                     WQRTSWEYRLHRSVEWELRNVKIALAYSNFLMLQKRESEVAAILWGFWQDYEQAVSTL
                     DEAVVSQFMQVAKLMKSVRLHAVALQVLNHCAQSISQHSSIYAELHQAIQSTSQEVIE
                     NESTVSESILEEIVFSTLTTTQFSAQATTSLINKYLSQRRWHDATQAMKRVLRSIWPA
                     LFAPSLQDVILPSKNVDYCVQLAERLSNCYRARQRLVKEENIRLRVYRAARHGRPLGD
                     RLRDRATIAILRFYERSSKTDELINIHQEVLDDYTKKYGQAHPNVLKELWALATLTHL
                     RPVCVDYYGQIVKILNKDSNTCHPDAFEPLLIVVTELLTQGRFSEALHPCQTLFNTLQ
                     HPHVNPKLKDQAFVKLTYERYVHCLRMTRADIVAIHDVTVQYRKTCQSLFGVTATITV
                     QATTTLAQICQESYAYKSEAIELYEELLKLKASQVDIDYEGIKATLDALYEEQENTLT
                     SSTETITTAEFHKVVSIHKKRFEATRQKYGWAHQESLSQMEKLVSLYSRRNEFQTAFS
                     LLQEATSQVLSTETSAFNLCLAAQSIASSFISSGQLQRGKAMAQEIYRELVARDIEVG
                     SISFNFSADQNQALVFLAQLEYSLQEREAMSVSMNEIYTSLVTEYVYFEKLRTAMKSK
                     TSSFQSTLSIVCRLHSVLLSRGRQSTATGLIEKFTHYFISAERDNVDVNFSQGRVFVT
                     TLLEYFKSHSSRDYISSIAIASYNRVTQLLASKNYHTAFDLASVSFKYFRAHYGFSSL
                     TAVKLAFKLGLAISSRDIKSFVEPNVRKDMLSLSATIVKGALDKFEQLKLDITQLDHV
                     NLDRLIGLLDEQKDYSTLVRVLTSLWNARETRSTSQQQHIYTLALGRMLVITRYMIGE
                     YVDAIRLAKDIVYNCARVHGPRHQSTVEMTVLLSQMYTSVAQGYQDQKDYRDLAYRYY
                     KEAAVLHENALRSFVDPSYFSSSLGDTSSPGGSNASSPGEATEGEAKYVRQHLRLLKL
                     AVERLGDWPKEYSEYENLNNDIFKAFGNELKGVEGVDKWDLKKFGCGRAEATDDLILP
                     ASEEGVVLRERLAIPA"
     exon            complement(101379..106781)
                     /number=1
     CDS             join(108952..109454,109542..109548)
                     /codon_start=1
                     /locus_tag="AO090010000046"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000008"
                     /protein_id="BAE65963.1"
                     /transl_table=1
                     /translation="MLEDTSLESPRPRAECSSQMEPGGKTEIGAWTANVSSCLDRSSK
                     HYVPSSPPNHLEPAHSHGDVHNDTTDRPQSPVRNPNERQINSDQSVRLDTDPTEVQVA
                     DEAAVEVNGSETESAPCAEQITLKALLEKIRQEKGTDQVDILSVCFGEPGVDLNVHIQ
                     GDFTVTLLI"
     exon            108952..109454
                     /number=1
     exon            109542..109548
                     /number=2
     CDS             join(110673..110903,110956..111468,111518..112045)
                     /codon_start=1
                     /locus_tag="AO090010000047"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000009"
                     /protein_id="BAE65964.1"
                     /transl_table=1
                     /translation="MEELTRSLVNDVEVLNNHFVSTGHPLPSFDRHTPTVVLPNDASP
                     DAHAARERILDNALRLFQLAAGPSAYLLNLQTGYQYASCVRWLCHFQIFHLVPLEGSI
                     AYADLAVLAKAPEPQLISVVRMAMTNGLFLESPPQHLAHSATSALLRNDADFHDWAVT
                     MSDLSFPTAFAMVEAHERWPNSVEGNQTAYNIAVGSELPFFSHLAEQSDRKRQFAGFM
                     RSMARSQGTDVEKLAEGWDWAALGQACVVDVGGSTGHTSVALARKYPDLNFVVEDLPE
                     VVAEGPGYLSYLDDAQDLKSRIGYRAHSFFDPQPVQDADVYMLRMILHNWSFDDCVRI
                     LSRLVQTLKPGARIIIVDIVLPDPGVVSASKERLLRVQDLIMQQVFNSMERYLENWMD
                     IFRKVDERLEVKRIVEPPGSLMSLIELSMAA"
     exon            110673..110903
                     /number=1
     exon            110956..111468
                     /number=2
     exon            111518..112045
                     /number=3
     CDS             join(112784..113061,113111..116864,116916..119249)
                     /codon_start=1
                     /locus_tag="AO090010000048"
                     /note="polyketide synthase modules and related proteins"
                     /old_locus_tag="AO070317000010"
                     /protein_id="BAE65965.1"
                     /transl_table=1
                     /translation="MVNIYIFGDQTVRVDDAVHKLLHVKNNPILKSFLDGSFAAIRKQ
                     IFLLPANERTSLPDAHTLPLLLEAVRRGRRHVALESALVCLCEIGQYIALLQTTDLCH
                     PPTGSILVGFCTGSLAAAAVSCVRTSIDLLTLGIEAVVVAFRVGMHVARRANALGGDG
                     GSQWKPWSLAVTDGSESETEKILEEFTRDEVSGVHVANRHDAYILAKGLPAIMKPYVS
                     AAGSNTLTISGTPRVLEALKASPHLRGTKSLPVSIYAPYHAAHLYNEADVESIFACKP
                     VESALFHRELRTPLISCATGTVLKEKTFGDLLRALVMEILTCQIRFDKVEESIVQHTP
                     GATAQLIPIHTNIAPRMKTSLTQVGLQVECFKAIANQEPAAEALSESPSNDSSKIAII
                     GFSGRFPEADGLNEFWELLQQGLDVHKPIPADRFDLEAHYDATLREKNTSRIKHGCWI
                     RSPGSFDARFFQMSPREACQTDPAQRLALLTAYEAMEMAGFVPDRTPSSQRDRVGVYY
                     GMTSDDWREVNSSQDIDTYFIPGGIRAFVPGRINYFFKFSGPSITVDTACSSSLAAIH
                     TACNALLNSDCDTALAGGTNILTNPDNFAGLDRGHFLSSTGNCKTFDDDADGYCRADG
                     VGTVILKRLQDAIADNDPIFGVIVGARTSHSAEAVSITRPLADAQAHLFRKLLAESGI
                     HPHEISYIEMHGTGTQAGDAVEMKSVLDSFARDDSRAPDRPLHLGSVKANVGHGESAS
                     GVTALIKVLLMMQKNRIPPHCGIKGRINRHFPTDMEYRNVHIPFMETDWTRPQEGKRR
                     SFINNFSAAGGNTAVLVEDAPLLEQSRAISSPDPQRYHVITLSARSVRSLSKNMRALG
                     EFIGSETSPGLLARIAYTTTARRMHHSYRVAFVGNDLQEVKRRFLDTDVTEAIKPCPT
                     KSPGVGFLFTGQGAQQTAMARELYDRFTSFRADILEFEAVGRGHGFPSILPLITGAVD
                     VEELSPMIVQLGTVVIQIAMARLWQTWGLTPEYALGHSLGEYAALQIAGVLSISDTIY
                     LAGSRAALLEKRCTAGSHGMLAVKASVAHLEEALKGMQVEVSCINGFDDTVLSGTNDE
                     IDRASKELSELKVTFKRLILPFAFHSSQVDPILEELEHIASQLSFQPPRIPIVSPTVG
                     HIITDEGTIGAQYIRRHCREPVNFLGAIQAAQGSGICNSGALAVEIGAHPILTRMMKA
                     AVGSSVTVCSTLSHREDMFKTLTESLSVLHLAGVRLNWDEYHRDFNNQVVMLPAYSWD
                     YQDYWIQYQNNFCLTKGSPERSESVDAIQPMSTRLSPSVQKILEEEMTAAQASIIIES
                     DITDPELLPVALDHKVNGVTLCPSSLYADIGHTLGTYLLGKKEDVTDYKIDVSNMAVE
                     KALVVKGTGPQLFRASLDMDWNMLRGMMKVYSVNNMGTLTTHHAQCTIELQRPHQWQE
                     GWNRQLYLIQRSIEQLKKGVEEGWTHKMRRGVAYRLFSSMMQYGPSYQAMEEVIFDSS
                     GLEATAQVRLQSTTGRYSFNPVWSDSLGHITGFVTNCNDSIDLTENLFVNHGWGFMRC
                     VEPFSPDTVYQTHVKMQPVDGNNGFYVGDVYVLNDHRIIAQYGAVTFQKVARRVLEML
                     LPATTSKGRSSNIRPRNVGTAQSAKIVQSKRRTQTPHVEDAWQQVLEMIARELGVDPG
                     QLTEDVNFTDMGVDSLMSLTIIGNFREFLSLDVPWSLFEDCPSVQSLRIYLNMSSLSE
                     SDSIETSSYPTPDESTTTTITSPSGSDRNVGRNSGIDGVGTTVGLVLSILAEEIGVNV
                     RDLSNADGLSELGLDSLLSITALGRVRDETDLDLPSDFFLEHSSVAAITAALHAIFGS
                     TEQGPEQSLITSHPPAMSINLQGDEGCPQTLFLFPDGSGSSTSYSALPTISKDVRVYA
                     MDCPYLKRPNELAKCQLQDLTPVYVAEIRRRQLRGPYSLGGWSAGGIAAYEAAQYLVD
                     QGERVERLILIDSPNPMGLGKCPPHFYRFLEEAGVFGVHGGRKPPAWLLQHFQAFNDV
                     LSQYTLEPFRPADATPNTTLIYAQDGVCKSPRDPRPERHPGDPEVFSWLLENRVDMSC
                     NGWDQLLGEDNIHLGTVFDANHFTIVRTPAVVRLSEIVRMAMSRKFQ"
     exon            112784..113061
                     /number=1
     exon            113111..116864
                     /number=2
     exon            116916..119249
                     /number=3
     CDS             120263..121426
                     /codon_start=1
                     /locus_tag="AO090010000049"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000011"
                     /protein_id="BAE65966.1"
                     /transl_table=1
                     /translation="MSTGSTLNQRSGKPVKLRASCDFCALSKVKCDRGQPQCVRCIKS
                     GIDCNYSESRRIGKAWHHCAPSAVRSTSATTQGTRRKQQTIAQHSPRRRIHRDTQALS
                     AADDAMSPYDPSGYATPFSMFHTLPSPVPESTIRSQTHIESYPSLDGTMAPILCSPES
                     ADISLPDIPHVAQLRTNELEGESPSVLQYNPSWDRIMAEHSTAIGDAGDCITRAAAVL
                     KSVRDPRTSCVRSRTPPRSHTQSLDATLDDGRTAMDTVKDILACPCAQEIRVALLLVL
                     IIQQVLESYQALLTQQHDTPREESPLGINLSRYDTPMAIGRYLLDNELRSKIIVQVLS
                     SELEKIGLILDILTRHAQSMAHQPDELILGTYIDSLQTTKKEVLESLEQGNDI"
     exon            120263..121426
                     /number=1
     CDS             join(124272..124458,124631..125337)
                     /codon_start=1
                     /locus_tag="AO090010000050"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000012"
                     /protein_id="BAE65967.1"
                     /transl_table=1
                     /translation="MLPSIPAGGKTLVYSTVDGHDIKLDYYLPSKQEGCLPAVIYYHG
                     GGMTAGSRRSIGFQHWLYGEGFQKALPESTSLDTSRIAVTGFSAGAYSARAACVYATP
                     KPAVLLTGYGSAGDWLLDHWTTGRPPTSIAKLVDLNEVPNLLADKTVVSDDTPESGIM
                     SNRFALTVRWELDGTFLDGSLGRPGLGAKLNKLDYAERAAAIPEDLKPAFLQLFVTEN
                     YPPSVFVHGTADEVVPDQESKHHYEQLKKLGVKTELLLVENGPHGLVDFSSGIPPRPA
                     KGSVEAYGRALEFVTEVFNAV"
     exon            124272..124458
                     /number=1
     exon            124631..125337
                     /number=2
     CDS             125761..126159
                     /codon_start=1
                     /locus_tag="AO090010000051"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000013"
                     /protein_id="BAE65968.1"
                     /transl_table=1
                     /translation="MSSAYSALQITKYLSYLSLPAKYHAYVETPHLFPKDEAALTVLF
                     RCQITRVPFENLSVYYSATRQPDIHPETLYSKMMGAEETGPTGRGGYCLEVNIFFHHI
                     LRGLGFDVYTVGARNRDRVNGVPQGDYGGW"
     exon            125761..126159
                     /number=1
     CDS             126216..126770
                     /codon_start=1
                     /locus_tag="AO090010000052"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000014"
                     /protein_id="BAE65969.1"
                     /transl_table=1
                     /translation="MANIVRLPSGVRYHLDVGFGGDGPTRPIPLVSGASVQNLGTQEA
                     RLLYDNISKESQRKQNHWIYQCRNGVDKEWNSFYCYPDLEFFQEDFEVINRFAAWEFL
                     KRDLIVTVKFIRNGEEGEILQHQETLVHIPDGPDEVHIAGKIMLVNNEVKLNMGRKTK
                     VIETLDTEAARMKALRKWFSICLD"
     exon            126216..126770
                     /number=1
     CDS             complement(join(128191..128219,129152..130292,
                     130347..130558,130613..130948,131874..131892))
                     /codon_start=1
                     /locus_tag="AO090010000053"
                     /note="dihydroxyacid dehydratase/phosphogluconate
                     dehydratase"
                     /old_locus_tag="AO070317000015"
                     /protein_id="BAE65970.1"
                     /transl_table=1
                     /translation="MTLVHIGLTSYGDAHFSLFLRKVFIKALGYSEDALSRPIIGIIN
                     TGSGFNPCHGNTPQLIEAAKRGIHLNGGIAIDFPTISLHESFSHPTSMFLRNLMSMDT
                     EEMIRAQPVDACIMIGGCDKTVPAQIMGGISANKPVLPLLTGPMMPGSHRGQRIGACT
                     DCRNNWASYRAGTIDMEEISAINEELAPTIGTCGVMGTASTMACITAALGLIPLQGAS
                     APAVSAARLRIAEQTGANAVAAAESRRSPQTILTSDSFYNAAVVLQAIGGSTNAMVHL
                     MAIINRHPDISGSITLQTLDEVGRRTPLLVDLKPSGDNYMTDFHNAGGMLCLLHRLRP
                     LLRLSAKTITGETLGEVLDRTPFRDFEYSQNIIRTLSNPLHPSSSLVVVEGNIAPHGA
                     VIKASASKDKRLLRHTGPAVVFENPRDLSLRLDSPDLDVTADSVLVLKGIGPIGNPGM
                     PEAGMIPIPRKLAAQGVTDMLRISDGRMSGTAGGTIVLHVSPESAVPDSPFGVIETGD
                     MIVCDVENRVIRLEISDEELQERIAQRRRLTAEDKTSTWNERQTRRGYRGLYEREVNQ
                     AHEESLPSHHLL"
     exon            complement(128191..128219)
                     /number=1
     exon            complement(129152..130292)
                     /number=2
     exon            complement(130347..130558)
                     /number=3
     exon            complement(130613..130948)
                     /number=4
     exon            complement(131874..131892)
                     /number=5
     CDS             complement(132325..133134)
                     /codon_start=1
                     /locus_tag="AO090010000054"
                     /note="dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /old_locus_tag="AO070317000016"
                     /protein_id="BAE65971.1"
                     /transl_table=1
                     /translation="MLRLDGKVALITGLGQTSEDGWGIGAAIAMQLSQQGAVIYGGNR
                     SLASAERTKARIEREGGVCDVQETDVTDSASVKALVDGCIQRHGRIDILINNVGKSEP
                     GCPAEMREEIWDQQVDLNLKSIYLTCHYVLPIMEKQETGGSVVNVSSIAGLRYIGKPQ
                     VAYSATKAAIMQFTKATAVIYAPKNVRLNTIVPGLIYTPYTQALAKRYAPGGNEEEYM
                     KMRDAQVPMGRMGDAWDVAHAALFLVSDAAQYITGQELVVDGGITSSTGRT"
     exon            complement(132325..133134)
                     /number=1
     CDS             join(138965..139153,139221..139709,139761..140279)
                     /codon_start=1
                     /locus_tag="AO090010000056"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000018"
                     /protein_id="BAE65972.1"
                     /transl_table=1
                     /translation="MVCVPSSSSVMELANLISQSIPKLQDESPQRANDARGNVIEACS
                     KMLALVTSPAEMLKEMVLINLASLQVINHYQIASVVPLNGHIPISELANKCGLPVDIL
                     RRILRQAMTYGAFSEPEPDCIAQTDVSREIPRLSPLLTYQLDVCLPSMVRLLDWLKDV
                     DGEHACAYQIAHDTKDTWWSYASKRPELIENYGKYMALITSGGAHDVSYVLKGFAWEK
                     LGNAVVVDVGGADGFVGISLAKEYPNLAVIVEDNLGLKDSADDNIPQHLKSRVVFLPH
                     SFFKPQSALSRDADVFLLRHILHDWNDNDCRAILQALAASMKPGASILVAEQILQRPG
                     AASWQRERVMRALDMQMMIQFGSKERAYEDWDALFKSVDPPLEIVDCVQPVGSADSFM
                     ELKRRA"
     exon            138965..139153
                     /number=1
     exon            139221..139709
                     /number=2
     exon            139761..140279
                     /number=3
     CDS             complement(141060..142253)
                     /codon_start=1
                     /locus_tag="AO090010000057"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000019"
                     /protein_id="BAE65973.1"
                     /transl_table=1
                     /translation="MLYHTVKSLVVALAFGATAASAQNPVTSLVSRRVTEYLMPATTE
                     THEFARVPNTNFVLLTQMSDSELIKIELDPTTEEPIAYHSFPMGKNSSSQLHGVWPST
                     VHPGMMWLSLQADNKLLLVDPGQDLSTEPSIIQTIDIPAPGNGPHCVFEIGNRVWAGL
                     KVASKQTGQYYVFSADVSNSTDQKLYQCLNSPVFIKEEPTTGLIYVTQDNDSSIMRIN
                     VTSGETTQLPIPPSVGNNAVGMTTAYGSMSGVWFTLAGNATGGTGTFGHIGSSGEMEF
                     FKLEHPLLGTNAGLLHVADASTEAGGPALWLLSTSLLSTNSPDALIRVNFDAGVTSIS
                     GEEYISMPTQNAMVHRVLPLDKTVLVSELHTFTLAQLTYNNTIAGQWLPAEAVSNTTV
                     YTEAG"
     exon            complement(141060..142253)
                     /number=1
     CDS             complement(join(147172..147268,147382..147553,
                     147608..148321,148374..149294,149357..149726))
                     /codon_start=1
                     /locus_tag="AO090010000059"
                     /note="ATPases of the AAA+ class"
                     /old_locus_tag="AO070317000021"
                     /protein_id="BAE65974.1"
                     /transl_table=1
                     /translation="MECRQNTSRFPSLLSSLWGPRRSQQSLSVSTSTQTQTQPPAPAP
                     APKIDIASTLQKKRSAEQDRVSRETAQKELVDEIENLVGLENVKRQLLGVQNWVQICR
                     RHGREPRNEWYNIVFQGNPGTGKSTIARIYAKMLYAIGISDSNTIKETSGRDLTIKGP
                     QGVQRLIKEMVNSDSPSAPTAGVLIVDNPHTLMPSKLESHREILDCLLQAMERKTGRI
                     IVVFIGHGPDMETFLQENPRVQHQTCSTVSFADFDRHELHQLLVRRITEAFGGKMQVE
                     GGQDGQYMQAAARRLARSRGEGFTNIYAVRQLVETIAHRQAECLAEQQDVGMEDVDYF
                     FFSKDDILGPNPSDIRSQSVAWTSLQSFVGQEPVKASVREVFGTVEENYWREVKNQKR
                     LLVRVNRVFAGPPGTGKTTAAKLYAQILADLGLLSSGEVTVKPLSAFNNVSDTDDILS
                     STVGKALIIDMNTPETDDNDFQVSDSVLDMLIKELSANGENRCTILVGSDHAVDTLLP
                     ELKEASRMLEHQVVRFQPLTREQMEELFQAKLQEQDVDATPEAFQAAMDILESARMRK
                     DFDNARGIERLLTAANRNFDQRRSRAPDGPLSQRVLEPEYFNADLVGGKAALAFREEL
                     RHSIVPDDIISVLKRYHNEMKIAWFQGHEPRARVPCTLVFKGASGTGKKTVARHLSAL
                     YYKMGVLKTAAMVECSVSDLVTTSVSHTSIRTRSQLERARGKLLTLSGFRPPARQSTS
                     PSKPLPGRDSLPQPNSS"
     exon            complement(147172..147268)
                     /number=1
     exon            complement(147382..147553)
                     /number=2
     exon            complement(147608..148321)
                     /number=3
     exon            complement(148374..149294)
                     /number=4
     exon            complement(149357..149726)
                     /number=5
     CDS             join(152127..152587,152649..153075,153186..153329)
                     /codon_start=1
                     /locus_tag="AO090010000061"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000023"
                     /protein_id="BAE65975.1"
                     /transl_table=1
                     /translation="MSGLEVLGIAASILQVVELGTHLSIKLYTFCRRLKDTDQRIQSL
                     SSDVALTCNVLRQLGDSLQQDEDAKLYSMEAFATAQQVLGECRKLFQRIGDAVDYPDQ
                     KATKGLLKKAARKVGFLCIEEDLEVLRVNLERLKSTMLLMLNVIMYAGQLRSRAELSV
                     LEEQRMLIRTLVEEKKTNETQFERLTKALESAKITDNRLNKPQPVTCLTTTFVCNDAP
                     LANDLLSSELREYYALVKKVLSEIDASQPRLEHDQYRRMRDDILQFYYSEISYCESLH
                     GHQVAQWFREQYSTLCKEDVDHLRRLGKLTLGIVQVWNKTEQAQCSAYASPTAPQHIQ
                     PCKTTGHSS"
     exon            152127..152587
                     /number=1
     exon            152649..153075
                     /number=2
     exon            153186..153329
                     /number=3
     tRNA            complement(154126..154197)
                     /locus_tag="AO090010t00002"
                     /note="tRNAscan-SE"
                     /product="tRNA-Ala"
     CDS             complement(join(154446..155012,155085..155548,
                     155601..155781,155832..156248))
                     /codon_start=1
                     /locus_tag="AO090010000062"
                     /note="amino acid transporters"
                     /old_locus_tag="AO070317000024"
                     /protein_id="BAE65976.1"
                     /transl_table=1
                     /translation="MSESIIPPRNSSGSMKKTIQPTADWAVDIDHGAETDLQRTLSTR
                     HITMIALGSSIGMGLWLGSGTSLANGGPAAIFIGYLLSGTMIWSVSHSIGEMAVMYPL
                     PSAFIQWTSIFVDPAAGFALGWAYWFSYWITIANELQGVVTVLNFWTDKVPTAAWITI
                     FWVVIILINVWAVKFFGEVEVVSSSIKFGWIIIVIISLIVVSAGGAPAEGPIGFRYWN
                     SYAFTNGFKGFLSVMPTCIFAMSGSENCALVAAETSNPRRAVPKAVGSIWLRLSLFYI
                     LGSLMITITVDPKDNNLFGASGVNASPFVIAYRNAGLEPLAHIMNAVVFISVVSTGSI
                     SGYAGSRALMGLAHVKMAPKIFGKADKVGRPLAGLFITLLIGGGLGYLNVNNSGEEVF
                     TWFSNLTSLFTLFGWGMICLSHLRMRYAWKVQGRDVSDLPWKSWTFPYAAIWGLGWCI
                     LLIIAEFYLSVWPLGGQTTAKNFFANYVSVVAIVVIYIGAKIYYRGPFWVDSRTIDLD
                     SLRRFYVKTGDEESVEDKPGAMGHVSKAVRFLFN"
     exon            complement(154446..155012)
                     /number=1
     exon            complement(155085..155548)
                     /number=2
     exon            complement(155601..155781)
                     /number=3
     exon            complement(155832..156248)
                     /number=4
     CDS             join(160166..160211,160495..160546,160605..160680,
                     160745..160931,160990..161516,161575..161865,
                     161921..162298)
                     /codon_start=1
                     /locus_tag="AO090010000063"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070317000025"
                     /protein_id="BAE65977.1"
                     /transl_table=1
                     /translation="MTPLICRIPMFSIVLLLAAFGTIGGALFGFDVSSMSAWIGTKQY
                     LDYFNSPDSNLQGGITASMSAGSFAGAIAAGWVSDIVGRRMSLMIASVIWIIGAVLQL
                     SAQNVAHLVVGRVVSGLSVGITSSQVCVYLAELAPARIRGRIVGIQQWAIEWGILIMY
                     LISYGCGKGIEGPASFRVAWGIQAVPGLILLLALPFFPESPRWLASKERWEESLDTLA
                     LLHGKGDRNDPVVQVEWEEVQEAVRIAREAKDVTFLALFGPKIWMRTMCGVSVQVWQQ
                     LLGGNVAMYYVVYIFTMAGMDNNATLYSSAIQYVIFLVTTGVVLPYIDRIGRRFLLLS
                     GAITCMILHYAIAGVMASYGNPVDQIDGNENLRWEIKGAPGKAVIALSYIFVGVYGLT
                     WAPAAWIYASEVFPLKYRAKGVGLSAAGNWIFNFALAYFVAPAFTNIKWKTYIIFGVF
                     CTVMTFHVFFMYPETARRSLEEIDIMFESNVKPWQSSKLQDKFGEEIARRQQSVSEEK
                     AADASHKEVA"
     exon            160166..160211
                     /number=1
     exon            160495..160546
                     /number=2
     exon            160605..160680
                     /number=3
     exon            160745..160931
                     /number=4
     exon            160990..161516
                     /number=5
     exon            161575..161865
                     /number=6
     exon            161921..162298
                     /number=7
     CDS             join(164365..164414,164473..165277)
                     /codon_start=1
                     /locus_tag="AO090010000064"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000026"
                     /protein_id="BAE65978.1"
                     /transl_table=1
                     /translation="MPHPIIGVGHSMGGMHLASLALLHPSLLQALVLIDPVIQTENPS
                     KDYAPASSYRRDIWPTKEDAIKRFQNNKVYQKWDPRVFEKYVEYGLREVPTEIYPEPS
                     ELGPQPVTLTTPKAQEVFTFLRPNYEGGRVDLEKGEWQNEMHPDDLEEDYPFYRPEPA
                     QLFRRLGEMKPSVLYVFGETSELSSPAARQAKLDVTGTGVGGNGGVRRQRVKEVTLPT
                     GHLVPMERVMDCANAIATFSDAELSRWDAERQKYLRRWNAIPRRDKITVDDKWKQHIG
                     TLSRKPKL"
     exon            164365..164414
                     /number=1
     exon            164473..165277
                     /number=2
     CDS             complement(join(165639..165666,166862..167805,
                     167852..168388))
                     /codon_start=1
                     /locus_tag="AO090010000065"
                     /note="UDP-glucose/GDP-mannose dehydrogenase"
                     /old_locus_tag="AO070317000027"
                     /protein_id="BAE65979.1"
                     /transl_table=1
                     /translation="MVANLFAQGGLTALVLASQNPHIQFSVVDSDARLIAAWNSDRPP
                     VFEPGLENLLFEPNDPPALPTPSPSPKPEASQDEDCLENSSNSTNHGELIALLPRRRK
                     LANVNFSTNMHEAVAAADMVFLCVDAPSSIMNGDKSDIDLSRLEIAIQAIAQVSTGHK
                     IIVQKSTAPCGIVPRLKKLLKETASPSASFDVLSNPDFLVPGAAIRDLLYPPRVIIGH
                     VFSEDMSPEALTALKRLYSPWVPDDRIVTMDAWSSELGKIAANALLAQQISSLNSLSV
                     LCESTNANINYVSETLGLSQRSGLGFGGSSLQSDVLCLVYLARELGLQEVVDYWMAVL
                     RMNEYQRHRVVKRLITRLGDVKEKRVAVLGFVSKGNVMDTRTTTALGLVRTLTSNGVR
                     VNIYDPHVQADRSESTLRLYDCHPEMVTVTESIETACFGCSALVLHTDWEEFRQDQVR
                     WQRISGHMASPRVLLDPHGVFDGFKMQQWGFEVLQVGIRSTKVLSAPKGHGQ"
     exon            complement(165639..165666)
                     /number=1
     exon            complement(166862..167805)
                     /number=2
     exon            complement(167852..168388)
                     /number=3
     CDS             170240..171037
                     /codon_start=1
                     /locus_tag="AO090010000067"
                     /note="proline racemase"
                     /old_locus_tag="AO070317000029"
                     /protein_id="BAE65980.1"
                     /transl_table=1
                     /translation="MENEEYAPMSGSNCICTVTVLLETGMIPMKEPVTELTLDTAAGL
                     VQVRAECRGGKCKSVAFDNVPSFVFQLDYKIDVPGIGTVSVDIAYGGMMYILVDAGSL
                     GLRIRNADGPKLVEVGEKIKQAVNAAYTPAHPENPDIFGYSVLAFTEPVEELSDGSGK
                     TAINTVVTSPGRFDRSPCGTGSSARLAVLHARGQIAVGEKFVHRSILGTEFITHIRGT
                     TKVADYPAVLPTIQGRAWITGYQTVVLDSEDPFPQGFRVGDQWRCKL"
     exon            170240..171037
                     /number=1
     CDS             join(171443..171735,171784..172046,172104..172462,
                     172541..173014)
                     /codon_start=1
                     /locus_tag="AO090010000068"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000030"
                     /protein_id="BAE65981.1"
                     /transl_table=1
                     /translation="MHLPHFKVIIVGASIEGITLAYCLHRAGINYLILKRRNERVPPR
                     EDLLIVMPNGARIWDQLGLLDRITDFIVPIEKAYMTLPDTGSHEIGFPRVLRERFGYS
                     PAFMSKRKVLEMLYTHLPRNDKLKFDKNVVRIETGPNCMRVVTWDGYDYGGDLVVGAD
                     GAHSKVRGEMARLSKLEGLTMDVNNYMTVEYVRITGVSTQDLDYPALTRGTMLTSNCA
                     GQNITCLVGNNAEIIWSIFLKFDCKYPYGSAPELSEKEIRQRCENTELYDQALSTDLN
                     WRDVWDRRKSVSMMPMEEGLRERGHWRDITAPHTGQDTSCSIEDAAELANLLYGRLRG
                     RRTKPSTEEINILLGTFTQRRIRRLKPIYREAKRAIRHMTFCGSWDRHIARYYLTRNE
                     QVIAEWFSKDVAGGVSVKFLPLPERSELAWSDIQLEQYTYWYGPLLMMMLVGVVLVLV
                     GFNVVPGLHYTQ"
     exon            171443..171735
                     /number=1
     exon            171784..172046
                     /number=2
     exon            172104..172462
                     /number=3
     exon            172541..173014
                     /number=4
     CDS             join(173483..173963,174032..174264)
                     /codon_start=1
                     /locus_tag="AO090010000069"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000031"
                     /protein_id="BAE65982.1"
                     /transl_table=1
                     /translation="MTKSLPRIACFHGGGSKGAIYEVQCSQLAGLLKNDFQFVFFDGP
                     FESGPGPGVLPAFRDYKPFRSWFKKDGSEIEQSDGSGYDISGRDGVERVWKLMEAAGP
                     GGEWVGVMGFSQGTRITGGLLLDQQRRTAFGELGNTPKLKFGVLCMGAGAPMVSEIGH
                     QMADTGSTDLVKIPTLHVHGLKDMFLALGRQQHATYYESGTSKVYDVDYHHAMPWYKH
                     EVQRLAELIRELYRESTGY"
     exon            173483..173963
                     /number=1
     exon            174032..174264
                     /number=2
     CDS             complement(175337..176179)
                     /codon_start=1
                     /locus_tag="AO090010000070"
                     /note="Zn-dependent hydrolases, including glyoxylases"
                     /old_locus_tag="AO070317000032"
                     /protein_id="BAE65983.1"
                     /transl_table=1
                     /translation="MTLQHKVFFSKRPSATRTGPAGADDLKWVPTSSTLIYGENDAVL
                     VDTQLTVQAAEELANWVVDSGKNLVAIYITHAHGDHHFGSSTLLKQFPSAKVLAIPEV
                     ASRMENEHSPERLQSVWEKLFPGQITNSFTSAEALPADEFELENEKLVVVRLGHTDCD
                     DTTALWVPSIGLLVAGDAVYGNTHPYMGESGTIESRLAWIVALDKLAALNPKVVIGGH
                     SDPNGSFGPDAITETKTYFETFNQVVAESMTAEEVYLRMMKLYPSRLNPGSLWSGAAL
                     SKGK"
     exon            complement(175337..176179)
                     /number=1
     CDS             complement(join(177221..177744,177863..178307))
                     /codon_start=1
                     /locus_tag="AO090010000071"
                     /note="flavonol reductase/cinnamoyl-CoA reductase"
                     /old_locus_tag="AO070317000033"
                     /protein_id="BAE65984.1"
                     /transl_table=1
                     /translation="MSLPHHSTPLILITGATGFIGSQVVLVSLRAGYQVRLVIRKPEQ
                     EAVLRARYPNYNDQIEISIITDITVRDAFKPAFTGVDYVFHLASPMPGRGSDLQADYI
                     DPAVKGTESVLFSALAFPQIRKVIIVSSVLALVPPTALQQKEVFVKGPHGHGLKYSAS
                     KICAHQATRDFLARQNPHFTIITLHPTFVLGESLIQETPEGIDGINALFWNSLRSEKP
                     TMPNVWVDVRDVAEAHLQTLKTEIPSGTEFLLSAPAASWGEVSELVRRKFPFVGCKLE
                     GPIEGGWTVDARTAERMLGMNWRRQDEIVEVMLEQQLRLREVEASL"
     exon            complement(177221..177744)
                     /number=1
     exon            complement(177863..178307)
                     /number=2
     CDS             join(178672..178982,179489..179510)
                     /codon_start=1
                     /locus_tag="AO090010000072"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000034"
                     /protein_id="BAE65985.1"
                     /transl_table=1
                     /translation="MPLWQIYHPPGTFTTSTEKEAFSKAITENYTSVGLPAFYVVVQF
                     HELDPENVFVGGDQRSKTAKPFVRIVVAHIAIRLPDADESYARVTASIDRVLKPHVLD
                     KGVLTNGN"
     exon            178672..178982
                     /number=1
     exon            179489..179510
                     /number=2
     CDS             complement(180144..180590)
                     /codon_start=1
                     /locus_tag="AO090010000073"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000035"
                     /protein_id="BAE65986.1"
                     /transl_table=1
                     /translation="MAETLPTSLSTALDISPSGDQFSMELPTDIAFGAGEFGLIHAFR
                     VVKVKDLGYRTNKRTSPVSCGGYVASLMAKYAVVHASKHETLRTQTDVRTSLVQFYRP
                     IIASKPVQMQLREVSLGKAWSTLRVETSQFGKIAASADLWWGTLVN"
     exon            complement(180144..180590)
                     /number=1
     CDS             join(180895..181190,181453..182065)
                     /codon_start=1
                     /locus_tag="AO090010000074"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000036"
                     /protein_id="BAE65987.1"
                     /transl_table=1
                     /translation="MPTTRYFDQCPPFPSDLHIVPLPKVSLEGLQNGSEHESQLLFQA
                     CQEWGFFSLDLRQSDKGNELLGDAERMFDLTRETFDLDQSVLDNYAYTPPHDLTGMWS
                     LISITDIILTCLDHQLGLTPGTLSALSPLEQISETSVRLLLGQSQSSPKYDNITLGGH
                     TDIGSITLLFNVVGGLQILPADRENKLENWLYVKPEPGHALVNIGDTLVEWTGGLLRS
                     SLHRVLTAPGEQALVGRQSVAYLMRPRNSASMQRLKGGIIPPVEEGQDDETRSVNEWA
                     GWRARQIMLGQLKPQTRGGKSVVTPA"
     exon            180895..181190
                     /number=1
     exon            181453..182065
                     /number=2
     CDS             complement(join(182249..182670,182722..183805))
                     /codon_start=1
                     /locus_tag="AO090010000075"
                     /note="cytochrome P450 CYP4/CYP19/CYP26 subfamilies"
                     /old_locus_tag="AO070317000037"
                     /protein_id="BAE65988.1"
                     /transl_table=1
                     /translation="MELLPKLVILLLAALGIASVSIRRFLNRRQFARRCGCQPVARSF
                     SKDPFLGLDTIPGTIRAIRQHRVLGRSCEIFRAYGNTFTVKELHQSAIVTIEPENIQA
                     VLSLNFKDYTLRHRLELFMPLLGRGIFNTDGQHWASSRALIRPSFAREQVANLSLLER
                     LMQDLFVLLPRDSTTVDLQELFFRYTIDSATDLLFGQSVGALKKSQSGLAFADALQYA
                     LKAIPVRDMLGPLNAVYRDRKTDECNRICRDFVQQYVEEAVYAAGPKKEEKESRTTET
                     KRRYILSHELASRTSDKQRMVDELINVLLAGRDTTGSLLGNLFFMLAKNPVIWAKLRA
                     EVAVLQNRPPTYEELRGLRYVQCCVNESLRLHPVVPTNKRKAMRDTVLPRGGGNDGLS
                     PVFVPAGTLVGYNIYAMHRRTDFYGPDAKEFRPERWEDGKLQPRWGYLPFNGGPRICL
                     GQRYALTEASYVLVRMAQEFRGLESRDPGSWEEGLVLTVCPRNGTKVGLIP"
     exon            complement(182249..182670)
                     /number=1
     exon            complement(182722..183805)
                     /number=2
     CDS             join(186320..186548,186604..186687,186747..187030)
                     /codon_start=1
                     /locus_tag="AO090010000076"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000038"
                     /protein_id="BAE65989.1"
                     /transl_table=1
                     /translation="MKISVALGLISLALAVPRPPSPALSDTGVSNYNNVNNAAPPNQR
                     PASPAQSNTQPATPNPVPANIEGLDTSYSVKCGRSTFPGADIHRAISLGVDLDRNGKQ
                     LGTFPHDYTNYENFNFLNKECNGKGGLRRREIPIVRGGYFNGKLDAKDNVFRAIYLHN
                     IWETADGQGKVPAIYCGTIYHPKGAQTFQGCDVRKVKS"
     exon            186320..186548
                     /number=1
     exon            186604..186687
                     /number=2
     exon            186747..187030
                     /number=3
     CDS             complement(join(188055..188413,188463..188625))
                     /codon_start=1
                     /locus_tag="AO090010000077"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000039"
                     /protein_id="BAE65990.1"
                     /transl_table=1
                     /translation="MKFSIAAIALFTLSAVALPATVVRRGASAATVSLIGEVEGFRAD
                     FYDMMGHKTIGYGHDCVAKQDCDSIKAPISNAQGDEILQKDLAGFEQCVCALPNAKAL
                     NANQYGALVSYAFNTGCGGLQQAWTAAMTSKNFDSICADLPHTNTLNGVLDNRRKKEA
                     ALCSTPTTQMCGC"
     exon            complement(188055..188413)
                     /number=1
     exon            complement(188463..188625)
                     /number=2
     CDS             complement(189033..190022)
                     /codon_start=1
                     /locus_tag="AO090010000078"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000040"
                     /protein_id="BAE65991.1"
                     /transl_table=1
                     /translation="MRTLCPGRGLTQILLYIHNPNMSSIKKILVLGAGELGTQVLLSL
                     AQHSRLNTIVVSVLLRPPSIASTQPQKVRELSLLREHNIQLVPGDLVADSQESLAQTF
                     RGYDTIIGCAGFVAGRGTQSKVTQAVLAAEVPRYIPWQFGVDYDIIGRGSAQDLFDEQ
                     LDVRDLLRSQTKTRWKIISTGMFISFLFEPSFGVVDMENSSICALGGWDTKVTVTAPE
                     DIGKLTAEIVLGLEPDVAFDNRPTFVAGDTISYAELLRIVEDVTGRTFTKSVRTVEAA
                     KADLAKEPDNSLYKYQVVFGEGRGVAWDLSTTWNHESGVNVLSVKEYASRYLV"
     exon            complement(189033..190022)
                     /number=1
     CDS             join(190426..190593,190648..190944)
                     /codon_start=1
                     /locus_tag="AO090010000079"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000041"
                     /protein_id="BAE65992.1"
                     /transl_table=1
                     /translation="MAEITPQPPTINGSCLCGTIKYHITGSPALKILCYCQNCRKSTG
                     SLGMANSIYHRSNLTISQGHDTLRTYKDSATDSGSPVDRSFCGNCGSNLFCENKEKGP
                     GLVIVTSGTMDLEDGQSWQPVMEFYCKDKKTWLETNLETKKFETVPAALENL"
     exon            190426..190593
                     /number=1
     exon            190648..190944
                     /number=2
     CDS             complement(join(191346..191353,191384..192443))
                     /codon_start=1
                     /locus_tag="AO090010000080"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000042"
                     /protein_id="BAE65993.1"
                     /transl_table=1
                     /translation="MGLTKDTLDMVRTHVHVIIHAASSINLAKPLAGLFDVIIQASDM
                     IGGFALSCPKLDWFVYVSTAYANGHLGPSGHTSDIEVDERIYDPGSSASVIEELSEVE
                     KHGTSKVYEAHDFPWPYAYAKNLTERLLVRRFQDHRATNKLLMVRPSIIGPSQSVPYP
                     GFCLPLSAPLLMFATGMALSTSRDMRIGTNLTDPDSQATLDGVPADVVADRLITHVAA
                     STTGCIHAVSGERARYKTRDVWEQAMQFRPIPWDLKLVWDPNGWRSPNQHFLCRRYNL
                     LGVSYAFSERRTVKLSNALSPEERKELQLFSRVKVSELLPKQVQHFRYIFDRTAPKDE
                     KAWLATTTSDHRFGDHQRVIA"
     exon            complement(191346..191353)
                     /number=1
     exon            complement(191384..192443)
                     /number=2
     CDS             complement(join(193513..193878,193923..194297,
                     194349..194490,194539..194678))
                     /codon_start=1
                     /locus_tag="AO090010000081"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000043"
                     /protein_id="BAE65994.1"
                     /transl_table=1
                     /translation="MHSLNADEAAALATFSQLCIEQGLLKRPSELSGNDVVDGINDET
                     ALLRFLQARRMKPHDALKQFQEATAFHAEKNVHAFYNVISVDDYEDTRRLYPHWTGRR
                     DKQGQPILMIDLAYLKNEAMTRWRQTRNIPCADASATSSPDMAQRVCVFHDSLTRFIL
                     PLCTAMNDRPDSSIPVTKSTYLVDGSALSLKQVWDMRDFAQEVSWILATCYPETISHI
                     ILCNAPSSFAMMWNIVKNFVDPRTAEKLVVLKSAEVYSTLEKCIDHVNIPKQFGGEFV
                     FQNGMLPDLDEGIRQTLSWINSESSLPPGPLKWIEDGEDRKAIATGCVGGIERTEEIA
                     VLRKLK"
     exon            complement(193513..193878)
                     /number=1
     exon            complement(193923..194297)
                     /number=2
     exon            complement(194349..194490)
                     /number=3
     exon            complement(194539..194678)
                     /number=4
     CDS             join(195401..195427,195474..196594,196642..196683,
                     196880..196916)
                     /codon_start=1
                     /locus_tag="AO090010000082"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000044"
                     /protein_id="BAE65995.1"
                     /transl_table=1
                     /translation="MTSDSLLQLFSNPDSIPSDPRWSHLLAPYLENGLIHAATYSLEE
                     IRKHVDFFIKHIGPHLGPGPLGKDGYQPRYPSAMTDDLTPFELSLCWKDPKQQGRPIV
                     RFVSDIIPADAERTRIASLLQSQRLIEALRNIAEDTSDLTLHMLPDIWKAVSHTLKVS
                     ETLIHSGSCSQCGSSSAFIAFDLKKSVISGKFYWRLPFCLDVPGTLNLMDHVFSACFA
                     VHEFFGSAVFSTSWHQIREHIRNHADTLLPRMISIDATAFPAPRIKVYVNCRFQGERN
                     FDSWEHHLRFNDSVASPEDFRSTCRDLWNSLTTNPPEWAQTRPDAGPKSCLLLYELTA
                     SSAKTTDEQRQKLSSKLYIMCQEIPLPDSVIATQLLRHCELAGDADTLKFFAAGRKPT
                     NFISDLFLLSGPQSSP"
     exon            195401..195427
                     /number=1
     exon            195474..196594
                     /number=2
     exon            196642..196683
                     /number=3
     exon            196880..196916
                     /number=4
     CDS             complement(197963..199795)
                     /codon_start=1
                     /locus_tag="AO090010000083"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000045"
                     /protein_id="BAE65996.1"
                     /transl_table=1
                     /translation="MQAVEGSFDSSPVEAARWYQPLASRVVQRWGAPSAAPVANNGQN
                     QNGQYTGTGAQGSWGQTSWGQRLGVAQAPGQGVAAQVPGASTALQQGSTEDNGQYTWK
                     PAGQASQLQTPQLQTPQLQTNTQSAATSTLSQWTPTSPTTSTTSQATSTTSQATTTSS
                     DTTTTHSQSTSTSTQPTTLQTRVSHKATATATDTAPMSTGTGHQAPKKLDNSAWAAVA
                     VCAVVGLIAGLVLLSLYRKRQRAKAVARAKERMRRDEEPKSAHLERNSGLNTLPHLFL
                     ASKTALFSVVSLRSTNEKDEVCSNRSPEERQIASIHPALHGKSQDVATKDDKTPAKSH
                     TDGSSISDASTVAGTPSRHPTFRQPTELNYDGCSSSDDSSDDEANDHRPGLYRRFTER
                     VASIRPTRSKQQPKRGHRHCNSAPNEIIIDGITAHHRDLKQSNDSRTHFRRSTYSEHS
                     TPCHSPGIQQSNKSNSEPRSTSDDDSDHATESPNISRSTSGDDGDHNNGFQRPPLKTR
                     GSFKDRVTGLAKLPRIGSRNSLYKGSSAEEKDKKLSTIPDDEDNRIVASYAPATFKTY
                     SVEMEHSPANDTQIKLGLGQYVTIFQVYDHGWVCDPIFSFPLVS"
     exon            complement(197963..199795)
                     /number=1
     CDS             join(206856..206917,208249..209302,209629..209640)
                     /codon_start=1
                     /locus_tag="AO090010000085"
                     /note="glycolate oxidase"
                     /old_locus_tag="AO070317000047"
                     /protein_id="BAE65997.1"
                     /transl_table=1
                     /translation="MDMSVGVAFSFRIIFEYHVRTLTSIEDVLGDTPAGTLPDLERIV
                     GLPDFEWAARRYMNASSYTYYRNGAAGEWSYRNNLEAYGRFRFKPRMLVDVTNIESTL
                     PTTILGHNFSAPFYISPCARGGLAHPEAEKNFVKAAYEEDILYIPSLYASLSVEEIAA
                     AKPSNGSQTIFQQVYLTENDTETKQLFEKVEKLGSKAIVFTVDSAADGNRHRAARYGV
                     GSADSSYTYITWDYYKKLQNMTSLPVVLKGIQSVEDVKLAVAHGAPAVILSNHGGRQL
                     DGTPSPLEIALEIHEEAPELFEQIEIYADGGIRYGADVLKLLALGVTAVGLGRPFMFA
                     NTYGVEGVKHAIQLLKHEIAIDAGNLGVGDLKKLDASYEPE"
     exon            206856..206917
                     /number=1
     exon            208249..209302
                     /number=2
     exon            209629..209640
                     /number=3
     CDS             join(210094..210689,210740..210839)
                     /codon_start=1
                     /locus_tag="AO090010000086"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000048"
                     /protein_id="BAE65998.1"
                     /transl_table=1
                     /translation="MTTSPKFRIRDAGAVEGDDQFVVAAFDAVIPYLTSIGSHEQWGT
                     IPFSHREGWVDETVQQIEDFSKSSAFQGDQNKNGVLRIFIVEKECNADGPEYFDRPLA
                     HYRVSSDRRRYLSVGFAFVRENWIPGYIESQKHLQIPEAERENNIYLEVMVTDCRVGS
                     LRRGAGSALIQGIRDYGRKKQKKAFCLDGWAGNDKKLVHYYENQGFQVVGDFSLPRAN
                     KAPWVGTLMRMDI"
     exon            210094..210689
                     /number=1
     exon            210740..210839
                     /number=2
     CDS             join(211189..211388,211442..211585,211638..211763,
                     211814..211910,211968..212201,212254..212592)
                     /codon_start=1
                     /locus_tag="AO090010000087"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000049"
                     /protein_id="BAE65999.1"
                     /transl_table=1
                     /translation="MKFALLSGVAAGLLPVVSAVSVSGAAEGFAKGVTGGGSAAAVYP
                     TTTDELVSYLGDSSPRVIVLDRTFDFTGTEGTTTATGCAPWGTAAACQLAINQNDWCT
                     NYQPDAPSVSVTYDNAGILGITVASDKTILGSGSSGVIKGKGLRIVSGASNIIIQNIA
                     ITDLNPKYVWGGDAITLNDADMVWIDHVTTARIGRQHLVLGNDADNRVTVSNSYFNGV
                     SDYSATCDGYAYWGIYFAGSSDLITFKGNYIHHFSGRSPKVQENTLLHAVNNYWYDST
                     GHAFEIGAGGYVLAEGNVFQNIDTPVQSPIEGQLFTSPDTNTNTVCATYLGRNCEVNG
                     FGSSGTFSQADTAFLVNFEGKNIASASPYADAQSSVPSSAGQGNL"
     exon            211189..211388
                     /number=1
     exon            211442..211585
                     /number=2
     exon            211638..211763
                     /number=3
     exon            211814..211910
                     /number=4
     exon            211968..212201
                     /number=5
     exon            212254..212592
                     /number=6
     CDS             join(213231..213608,213666..213737,213781..213825)
                     /codon_start=1
                     /locus_tag="AO090010000088"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000050"
                     /protein_id="BAE66000.1"
                     /transl_table=1
                     /translation="MRATNLHLPSVIRSQVDDRLPRDPTNVVKQSVSPRYYPLFKYSF
                     THSVSRIGDYNFPNLYRMLEPEFGTLSIFHVAKASKPHIKRIMHNDLGVDDSHLLRGE
                     VLTVIRIMLGQLKQKVFVSEMVAPVLLFSLNRRHPRVIEAYFDGLELLLGSRPLHNGS
                     WETL"
     exon            213231..213608
                     /number=1
     exon            213666..213737
                     /number=2
     exon            213781..213825
                     /number=3
     CDS             join(214410..214477,214632..214755,214807..214962)
                     /codon_start=1
                     /locus_tag="AO090010000089"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000051"
                     /protein_id="BAE66001.1"
                     /transl_table=1
                     /translation="MALNVALRTSLARQSTAYGFWLTVPSAPVARTILRAATASPVEA
                     FSWVLVDAEHGLITDRDYYDLTTAIAAEGASPIIRVPWQEEWMIKRALDSGAHGILTP
                     MCHSVVSHALLPE"
     exon            214410..214477
                     /number=1
     exon            214632..214755
                     /number=2
     exon            214807..214962
                     /number=3
     CDS             join(215184..215271,215360..215631)
                     /codon_start=1
                     /locus_tag="AO090010000090"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000052"
                     /protein_id="BAE66002.1"
                     /transl_table=1
                     /translation="MVMVQIESRSGLDSVEEIAKVEGLDVLLIGPFDLAKQIGVVRGG
                     DEHTAAIDRILKAAKAAGKKAAIFCTSGEQARQYAEQGFDMVSVITDQGAMGDAMVQS
                     LSAAQGRDADNKPRDGY"
     exon            215184..215271
                     /number=1
     exon            215360..215631
                     /number=2
     CDS             join(216600..216682,216737..217496)
                     /codon_start=1
                     /locus_tag="AO090010000091"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000053"
                     /protein_id="BAE66003.1"
                     /transl_table=1
                     /translation="MERYTCFDADSLRSYSSTVALDEYPPSNPPEELITSFPRPPSGA
                     RNLDNVAANSPRASIKTLRRNYMVHELPLLQEPNPWDGSDQFHPVQEAGCSYDLIVPF
                     DDSCETPLHSLERLADIMFSPEHMLSILNNPRYLARFREFLLEERPRSLELLTYYLNT
                     RKALKALEYVNALVRCAVDLPPSAITVTEQVGESCNPALQRRVHEALQALTDEELPAF
                     ITSRCIGITSRVVEERVRGTLPRKFQGTSDALAEVFCLTDPSRRDNPIIFASEGMFLI
                     EVVR"
     exon            216600..216682
                     /number=1
     exon            216737..217496
                     /number=2
     CDS             join(217764..218186,218205..218252)
                     /codon_start=1
                     /locus_tag="AO090010000092"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000054"
                     /protein_id="BAE66004.1"
                     /transl_table=1
                     /translation="MNLLQCAPLCDSQGTVRYFIGAQIDVSGLAMEGAQMDSLCALLD
                     KQKNGEAGADAEDGEMKEDVRPDEFRELSELFSPRELSVVHQVGGNLFKPIPAVFDRY
                     GKGHSRTWSTADTVEMEAIRERDIKTALFRGSLTGVYENASDSQAFLPLRPPSC"
     exon            217764..218186
                     /number=1
     exon            218205..218252
                     /number=2
     CDS             219090..221660
                     /codon_start=1
                     /locus_tag="AO090010000093"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000055"
                     /protein_id="BAE66005.1"
                     /transl_table=1
                     /translation="MFEAKAPKSAQFLRRRSARAGQSRPKATATRSRVTRSRPATQHK
                     GLSVVIPVKADLNKKKKNGEKRTDNRVSVEIANKSPWSAIDIASQVLDLEEAGEWNDL
                     DSELQDEQEDERLNEEQTPSKDVLPPDPFLPNGIRVTQARAAYDAGQYRSLKAAAAAW
                     GISQTILKHRVKGPRPSRREAAHSLQKLDATDEDSISKEALRRVEEDDRRPTNVLIWE
                     VANDLYRDKCGHLGLEFQPIGSQWPQRFLVRNPDFRKTWSQLIEARKAPPRAPRPGVS
                     SGPHPWRFAEDASSIVDDDFSKFDIPKTEAECATYFRQIRSGPAATAVRIQRFLTHLL
                     VEQAKSVDMLSRVRKALEEPEQPNETAPQVATREHQKQSGHTQGSAAAAASDSRQPPA
                     TTASTPIVGTGVGNSTAASSQPSQSTSQPPTDNIPQRQEAQVPQVPPNTSNPPPKASM
                     RSEERATMARQASSASLPLPTNPLAQPQPSQDTLNTASSTPILSNASSTYTSTPSRPS
                     ITTFQQFSRNHISQPSQPPDQQESREPQQPQGTAESTSVIGNALGNTAAPLQSSMESF
                     QSSSAQDPSLPLQALQSPHTQEAQRDEATADSNPTLDNASPAHLSEAPHSNLSSYQPS
                     TTSIPQLLHPPEPQQSHEPENSEDAANSLSLLGNSPPSHAPASLETLLSSFQTYPTTH
                     VRQSPQSRGAQGPQNPQKPQKPRKPSQPRKPQQPRARKPQQPQPQQTQQSQQPHYQQQ
                     QQQQKSQPQHQQQQSLQLPQPSEPSQPLQPPESPHRSSNHMASSMAPFTGWGSGALSM
                     TSSSPYHSGNFATNYGSSQPTRPQYYPNEYLLRTAVDQSSKRRRIDDPIHSINHPGYQ
                     "
     exon            219090..221660
                     /number=1
     CDS             225408..226193
                     /codon_start=1
                     /locus_tag="AO090010000095"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000057"
                     /protein_id="BAE66006.1"
                     /transl_table=1
                     /translation="MDSLLALTSLHIASGTASSNDNDVNNHHGSLNLALVSEYIDDAL
                     HYQNSAVPAFSSALENISPLNCDALFACSVIMMACAFAAPLIGSSRGNTRESLTSPFH
                     FVKGIHSVIDKARPWMANGPFRFAIITHSDDDWESSQQDNEVFHRLRKLCFHGDPAIR
                     NILFHSITLLRNCFAKDETMAIPWIVVVGEDFADLVQQEVPMALLVYMYWGVLLSRLK
                     EVWWATLSGRGIVNDLAKELAGIDGWTEAIQWATEEVGTNKEN"
     exon            225408..226193
                     /number=1
     CDS             complement(join(226484..227086,227165..227856,
                     227912..228002))
                     /codon_start=1
                     /locus_tag="AO090010000096"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000058"
                     /protein_id="BAE66007.1"
                     /transl_table=1
                     /translation="MWSYFWHIAFTALLTLGRLTAGIQLDINDPNSIKDAAATAAYGM
                     MTYYHGNESGQIPGKLPGTWWTGGEVFMALVQYWYWTGDTSYNDVTKQALIWQKGHND
                     YLPDNYTQDLGNDDQVFWGLAAMTAAELNFPEDEEVSWLALAQGVFNTQAEKWDPDTC
                     HGGLRWQRNSWNGGYDLKNSVSNGGFFQLAARLARYTKNETYTEWAEKAFTWATSVPL
                     IIEKGWTINDLVTVESNCQAPNQMQWSYNYGIYFNGAAYMYNLTNGDTKWKNVVEGLL
                     NTTWRNFFPQEYGGNIMVEPCEPQKQGVVPCDGNQSTFKSLVTAWLAFTTTIMPETLD
                     QILPKLQGSAEGAAKQCSGPSPDKICGQRWFLDKYDGVTGLREHMCALSVFTANMVPF
                     KTGNRDQGPLTADTGGTSKGDPSAGTGSRKPEKDKPREITTGDRVGASIATVVVVGIW
                     LGIAAFMVTGG"
     exon            complement(226484..227086)
                     /number=1
     exon            complement(227165..227856)
                     /number=2
     exon            complement(227912..228002)
                     /number=3
     CDS             complement(join(230291..230319,230375..231008,
                     231313..231381))
                     /codon_start=1
                     /locus_tag="AO090010000097"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000059"
                     /protein_id="BAE66008.1"
                     /transl_table=1
                     /translation="MPPRRSHKKSRTGCIQCKKRRVKCDERGPPCSNCTTRGIECAYS
                     STPAGALMPNTVSASPSSPQVSISPNAIPSQSPPVTTHYDLRSLELMHKFSTETYYSL
                     SSDALDHRVWQTTMPRKALEFDFLLDGILSIASLHTAATKPPLEARSYIDTALEYQNR
                     ALTPFRHALNNISPANCDAIYAYSLITIASRIAMPHLAIGDNEGPNMIENILHVFELL
                     QGTTEISKMTRAWSSQMKQKKPSAV"
     exon            complement(230291..230319)
                     /number=1
     exon            complement(230375..231008)
                     /number=2
     exon            complement(231313..231381)
                     /number=3
     CDS             complement(join(231966..232024,232094..232188,
                     232243..232622,232676..232828,232883..232969,
                     233027..233056))
                     /codon_start=1
                     /locus_tag="AO090010000098"
                     /note="short-chain alcohol dehydrogenase of unknown
                     specificity"
                     /old_locus_tag="AO070317000060"
                     /protein_id="BAE66009.1"
                     /transl_table=1
                     /translation="MSLRGKNVLLTGASMGIGQAIASALVEAGANVILFSRSENKLAH
                     LKEKLLATSDVKVTYGTVDVGDYASVEAAVSSAIEEIGDIDILINNAGLALGAPSPFP
                     ELKVSDILTMNNTNINGYMFMAHAVLNQSMLRRKAGTILNITSVTGLEVPPFPGEAVY
                     HANKACQEAFTNALRNELSGTDIRVLALRPGCVATNFHSLRVGHDKEMYDSFFEGYEP
                     LVAPDIAQAAVYMLQQPPNLSVKALDIVPSAQRSLNVFDRSWNERRKDQ"
     exon            complement(231966..232024)
                     /number=1
     exon            complement(232094..232188)
                     /number=2
     exon            complement(232243..232622)
                     /number=3
     exon            complement(232676..232828)
                     /number=4
     exon            complement(232883..232969)
                     /number=5
     exon            complement(233027..233056)
                     /number=6
     CDS             join(233273..233479,233509..233539,233643..233758,
                     233837..234268)
                     /codon_start=1
                     /locus_tag="AO090010000099"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000061"
                     /protein_id="BAE66010.1"
                     /transl_table=1
                     /translation="MSLGPIETNHGISPELLPHGHPLVLKWTMECQMKLACADKLPTP
                     DLLQTSAMDFLTASDVLGLIILRRIAWWSPNLSNGQNEAAAAPNESGSEEQKLPPLSL
                     KDFGVYNRMAAQMDGFHNHFRLSWKDLQNACETNGKRSSGLKPKQLILTGLRFCSQLD
                     FHHSIEEEHIFPVLARKMPEFRQKKTLLAQHKKIHRGLDELEQYLEKCRSGEEDLELT
                     EMKRLMDAFGEVLWTHLDEEVRTLGAENMRKYWTLEEMRTLPM"
     exon            233273..233479
                     /number=1
     exon            233509..233539
                     /number=2
     exon            233643..233758
                     /number=3
     exon            233837..234268
                     /number=4
     CDS             235487..236302
                     /codon_start=1
                     /locus_tag="AO090010000100"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000062"
                     /protein_id="BAE66011.1"
                     /transl_table=1
                     /translation="MKPTHAYLTAALISGALAAPGSTLAQRMRHRSLDHLTLPLQGEG
                     SATDSEARVAGAAVQYSNNWAGVVREQAPPEGPYTAVSATFTVPSATAVANQNGVQAG
                     SVWVGIDGDTYAGAILQAGVDFYSDPTQQNHAWFEWYPAYATNFPNIEVNAGDTIVST
                     VRSNSPSEGIAIIENKSTGQTVSQTVTAPEPTATLAGQNAEWIVEDFQSGDTMVVLAN
                     FGEVEFSGAQAEAGNAKFGLKGGEVIELKQNNKVLTQTEVTGDQDMTVKFIGA"
     exon            235487..236302
                     /number=1
     CDS             complement(join(236581..236607,236651..236744,
                     236811..236989,237067..237306,237374..237493,
                     237543..237743,237790..237896,237948..238039,
                     238084..238159,238220..238310,238359..238616))
                     /codon_start=1
                     /locus_tag="AO090010000101"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070317000063"
                     /protein_id="BAE66012.1"
                     /transl_table=1
                     /translation="MTFIPKSDETKEKVILEATAKDDIEIGQMTSLDEAELFLQEHGV
                     TDTQLQELLNDSKKSKELVRKVDLIVLPLLCGTYVLQYIDKQALAYSAVFDLFTDAHI
                     NSNQYSWLVSIFYFGYLFWEYPASHLAQRLPTGTVISSFVLSWGSMLMITAACNNFTG
                     LGITRFLLGCFEAPITPCFMMIVGMWYTRQEQPFRAGCFYCCNGVGSMLGGLITFAIG
                     QIKTFPVWRAVFLICGGVTVIWGGILMLFLPNSVLTAKRFSVEEKILLVGRGKQNQTG
                     ILNRSVKWYQIREAFIDPQVWLLFLFTLLNETINGGTANFGKLIIKGLVSSPLLTTAL
                     GIPQGAFQVLFILSGSYLSTRFKNIRTIIMILYLIPTVIGISLLWKLPRTNRYGVLFG
                     YYILGAYVSSLVLSLQMPSSNMGGYTKRVTATAFVFLAYCIGNIIGPHAFLAKEAPIY
                     QTGCKRNKRREERMRSDPGLDGQGESDVMADLTDFEKKEFWVDC"
     exon            complement(236581..236607)
                     /number=1
     exon            complement(236651..236744)
                     /number=2
     exon            complement(236811..236989)
                     /number=3
     exon            complement(237067..237306)
                     /number=4
     exon            complement(237374..237493)
                     /number=5
     exon            complement(237543..237743)
                     /number=6
     exon            complement(237790..237896)
                     /number=7
     exon            complement(237948..238039)
                     /number=8
     exon            complement(238084..238159)
                     /number=9
     exon            complement(238220..238310)
                     /number=10
     exon            complement(238359..238616)
                     /number=11
     CDS             240046..241056
                     /codon_start=1
                     /locus_tag="AO090010000102"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000064"
                     /protein_id="BAE66013.1"
                     /transl_table=1
                     /translation="MNHDLGHTLFHRAIIESGAATSRAVHSYDAHLHEDQFRQFVEEA
                     GCKDAPSHEVMDCLRGQPESAITNASFTVFDRYNPSVRWAFQPVIDGELIKQRPIDAW
                     ESGKWNKIPILTGFNTNEGTYYVPPSMSKSEEFTAFFQTLLPAYSASDIKTIDKLYPD
                     PAKDTSSPYVDTRALPVGPQYKRVEAAYGHYAYACPVRQTAKFASAGQEPPVFLYRWA
                     LNKTVQGGANHGDQMAYETFNPEVRAISENQEKIAGTLHAYFTSFIVSGDPNAVPGAY
                     ADRPSWETYDTSSSGRIMVFGEGNDERAGGSGVGIAAQVVDDDWSRKECNFWWTKSGI
                     SD"
     exon            240046..241056
                     /number=1
     CDS             241277..242407
                     /codon_start=1
                     /locus_tag="AO090010000103"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000065"
                     /protein_id="BAE66014.1"
                     /transl_table=1
                     /translation="MTTRQLPILLLDGGLGTTLGDPPHNITFTAETPLWSAHLLISSP
                     STLEEVHKAFATVGADIILTATYQTSFEGFTLTDPRYTADDAAHFMRSAIPLARRAGS
                     SSGRTVKVALSLGPYGATMSPVGAEYTGLYPEEMNSEAKLREWHARRLCVFVDETGSW
                     DNFEYIAFETVRRADEVKAIRGAMSDVLADMYQGQGPDSEKNQLAMGKKPWWICGVFP
                     DEEVDEEDVRAWVRAAVGTQEGETGVYLPRPWGIGVNCTRIGNVGRIVSIMQDELRNL
                     EDLRTKGYVDEWNSVTGKPWLVLYPDGTNGEKYDPVTKTWVATETGKETRPWHEIYWD
                     VVQGLPEGAWEGIVMGGCCRAGPEQIATLRRRIDERSNAQGV"
     exon            241277..242407
                     /number=1
     CDS             join(244815..245056,245112..245768,245817..245943)
                     /codon_start=1
                     /locus_tag="AO090010000104"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000066"
                     /protein_id="BAE66015.1"
                     /transl_table=1
                     /translation="MADLHKVRELGLDEDTTLAILERLKHISQLYRSGKPLFPRRLLE
                     DLNRQIDDGKEEVYISDFDDVPQVYSLKVPSWCTEFANTYRIRYQSIHSLGCVPPYDP
                     ERVLCKCTPVAIDYVDTSGPGESTLEAIGGAFFKQRQIWLESLGHRNLEHHLSTLRTT
                     ANIRKIVCFGLGSLGRLSGDCYTRTHTQHAAVETIAASLVRRGLSGSQEIKCYAQDPV
                     YDEVDHEFLRSIGITPLEDPKGFLEVDEHTLVFSVSPDVPVKQIVTDLHWPGAMIWDT
                     VTPSEKRKSWAKYKENDGTIFWITPFTTDPDSGRVRRMIKHYAHAQLEDSDGFFGDLT
                     IYMKCEE"
     exon            244815..245056
                     /number=1
     exon            245112..245768
                     /number=2
     exon            245817..245943
                     /number=3
     CDS             complement(join(246032..246884,246932..247149,
                     247193..247527,248120..248234))
                     /codon_start=1
                     /locus_tag="AO090010000105"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070317000067"
                     /protein_id="BAE66016.1"
                     /transl_table=1
                     /translation="MTKSEHFTVYMNGIEDRLRYDMEYGRYGPSISPYFADSVQPPMH
                     WEHHPHNPFNWPRWKKWMSMLTSCWVTFIVGLNATSITTAADAISSEFHLANGIFEYN
                     FFAVTAWNAAAAFVPLATLPLMETYGMRFGFLVSSLCSCDSALVTDSIALAQNFATLV
                     ICRAIAGAFGGTLQNCADGIASNLFLHHRERVFPLTLYTFTLLFGVTMGPVLGAIAEP
                     LGWRWIFWIELIIYGAFTPVVLFCMKETRGPLLRVKFMPDEASPRASDDSETLATFQE
                     TIARSAVLLTTEPTITSFTLWSAFAFGLVFISTQSIPLVFSDTYGWPSYTDGVVQAAI
                     GVGQVIGLLACTLQNRVYTRSASHNPDSPGIPIPEYILHLSIPSTALALAGGLFMYGW
                     GIYQSHWIVLAVALALIGYASMVIVTAVSIYITDSYAGYAASAIAAVAFGENIFAAFL
                     PLAAKPMYVRLGYQWASSLLAFVALALTLAPVVLLLKGRTIRAKSVAIKKMSHSHS"
     exon            complement(246032..246884)
                     /number=1
     exon            complement(246932..247149)
                     /number=2
     exon            complement(247193..247527)
                     /number=3
     exon            complement(248120..248234)
                     /number=4
     CDS             join(250964..251326,251373..251548,251603..258229,
                     258284..258332)
                     /codon_start=1
                     /locus_tag="AO090010000106"
                     /note="glycogen synthase"
                     /old_locus_tag="AO070317000068"
                     /protein_id="BAE66017.1"
                     /transl_table=1
                     /translation="MFLTVMQRSAILILSLLSATALSWPYTESLVDYNLNENKTAEAP
                     IDYWGEWPDHEYHPSPDNWRFPIYTIFLDRIANGDPKNDDINGTAFEHVVGSNQMRHG
                     GDLVGLIDTLDYIRGMGFKGIYFAGTYLMNLPWAYDGYSPVDTTLLDMHHGTLEDWRR
                     TITEIHKRDMYVIVDNTLATMSNLIGFKGHLNDSADFRADEYEVQWISDRQYADFKFG
                     NEYNETCNFPKFWNETGYPLTSGGVEELKGCYNSDFDQFGELEAFGNFPDWKRQLTKF
                     ASVQDRLREWHKPIRDVITKHSCIQIASLDIDGFRFDKAVQTTLEPLSEITAVYRECA
                     KKYGKHNFFLPGEITSGNTFGSLYLGRGRQPDQQPESADAGVKLKNSSDGYFLRDDGY
                     QALDSAAFHYTIYRSMTRFLGMDGNLVAGFDLPTDFIEAWNGMLVSNDFLNAYTGEVD
                     PRHMFGVSNQDNFRWPAIVNGTEKYLLGLYIVTLELPGIPLILWGEEQAMYVFESTAS
                     NYLFGRQPMTYQTAWWTHGCMTLNTSKFYDFPNEKGLHGCEDITVTYDQRNPAHPLRN
                     IMKRMFEIREQYPVANDGFYLQTLSQLTKDVYLPGSTDTPTVTGLWSVLRSYFPGVQK
                     EASKNSQNLWLVYHNANKTETYGGDCKKKDTALLSPFKSGTKLKNLFYPYDELTLEDG
                     PGEIAVHNSTESYGCIRSMKLLPWEYRAYIEAENFVEPGPTVTEFVPGHDARLLSTDD
                     SGQTVDIQLGYSKEMDCDKIADAISLNSTTVKGVTASLDTSSVSCNKISPRTSSDNFV
                     GEVPTVWTWSAKLKNVHHGIHQLTVKNVSTTSGVHTDAVDQFLFRVGSQNNPLLSPLS
                     NYSTSLVQKSDNGSFYIQHDAAGADKFRYSTDFGLNWSNWTTYTGDNTLVDFPEWTGT
                     DAQKWKGTHIRVQYFSRLTGSSDYIQEGDHGWEKGVARRFPNLFWNGPFNQYGYDAGL
                     DNKMRYDTKDHRWKYDFVYEWPAIGQMSVWGMLKDGRPDVTEVYGDVDNSSVVQKLPP
                     SYLSSNVINITKLPPFPHLGWTITLNDANLRYEMLPVGSGWAQLVLYILLWVLPILMG
                     FAGIFIFIRTFYRVKLNTDGDVAKEDKLPLLFWRRVREKFSGDDESDKSISDKDIPTD
                     IAIAGAPEQRRTVLIATMEYNIEDWKVKVKIGGLGVMAQLMSQHLKHQNLIWVVPCVG
                     DIEYPQDTPSEPFVVTILDKPYFINVQYHIVDNITYVLLDAPVFRQQTKAEPYPPRMD
                     DLDSAIYYSAWNQCIAETIKRFPSIDLYHINDFHGCLAPLYLLPTRTIPVCLSLHNAE
                     FQGLWPLRNPQEKKEVCSVFNLPIETATKYSQFGNVFNLLHTGASYVRFYQRGFGAVG
                     VSKKYGKRSWARYPIFWSLEKIGSLPNPDPSDTGDMTNNADAEVPIQSYEERINDKLQ
                     AQKWAGLNEDRDADLLVFVGRWSKQKGVDLIADVMPAILSARPHVQLICVGPIVDLYG
                     RLAATKLERIMEMFPGRVFSKPEFTVLPPYVFSGADFALIPSRDEPFGLVAVEFGRKG
                     ALGIGSRIGGLGQMPGWWYTVESDATRHLLHQLKTAIKQALDSSQDAREEMRANSVRQ
                     HFPVLEWIQKLEALQRTAIQIHHTKNKNTVTGPMPESQNYWETQSVRMSTLGLPGPTQ
                     SVTEGLDTPPGRLLTPGQSRFAELQLEGADGNRNSSLGRKLSLGRRSGPGQDRKRPGK
                     SPPRESQILGEDLEGENTDAEEEGTTTPQVNYISPEEAMAAVNNTLGTQDIGMAHTNN
                     STHSLAGPQGSTYMSVPGSPNNMSRASSPMPGTPGLPQYPFQFALGSGGNTPFTHSRN
                     VSMLSLPSVVADHNQPVFELQKVDPTFTDSTRHFTRRFEEILNNLNKKNSMTDCCIET
                     YLMKSERKFYDMYNDAQLKKQPDDRAVSDSNSDTQDNRASYATVTGGSDSNDPDEIDL
                     WLSRLGYKRPIAIQRFMRRRLGKWPVYALFLGLGQIIATNSAQMTLLVGQVGETATKL
                     YIIATIYCISSICWWLLFYRFPSVIVLTLPWFIYCMAFIIIGVSPFALTSLGRAWAQN
                     VAAGVYSAASSSGSLFFALNFGDQGAVPIKDWMFRASLIQGIQQLYTVALWYWSSKVT
                     EAEVGGVSTAALSSWRLTAVVMPIAAVCFIVGVLLALGLPKYYRQSPGRILFFYTSLF
                     RRRIVLWFFFMVIVQNWFLSAAFGRNWSFLWSSQHAKAWEVVILVIFFFVVLWVIILI
                     IFRALSKEHSWILPVFGLSLGAPRWAQTWWGTSNIGYYLPWAGSLTSGALVSRCVWLW
                     LGVLDEIQQVGLGMILLQTLTRVHVCFVLLAAQALGSIATICARGFAPNKLGPAGISP
                     NVGTSLDTVGNAWFWIALFFQLLASWGFLLFYRREQLNRP"
     exon            250964..251326
                     /number=1
     exon            251373..251548
                     /number=2
     exon            251603..258229
                     /number=3
     exon            258284..258332
                     /number=4
     CDS             complement(join(258724..258837,258884..263601,
                     263642..264105,264153..264179,264228..264331))
                     /codon_start=1
                     /locus_tag="AO090010000107"
                     /note="3-oxoacyl-(acyl-carrier-protein) synthase"
                     /old_locus_tag="AO070317000069"
                     /protein_id="BAE66018.1"
                     /transl_table=1
                     /translation="MAMHSNLTLDRSSVGHCENKDRSQLALKLLIELLAYQLASPVRW
                     IETQHQLITGCPPVCRFVEVGPRTTLATMAKKSAARHYRSYANSQWSHLQFLSYQDNK
                     DEIFYHYIDSKVCSDEKGKAGPPTSHDLSLLPLLPGSLREPQQCVPSKAPPLRASPSI
                     DVSLSCNHIALAMTAQKLRQPFDKVAMGKTVRELSGGMGKSTLQNELVGDLVAEFGRV
                     PEGVEDMTLIALGEALQGAFVGKPAKHMTTLIARLISRKMPAGFNQNSMQDYICSRWG
                     FSKAHSLIPICLAITIEPTARLANAHAAQGYIDELISRYATFQGISLVPADGLYIEQS
                     ELMPSAVSLSDRQVIQEQQRSYYRKHFDILAKYLEIDLGASGQPPLDITYQETLERWN
                     AEFDDHFSEGIKSMFDIMQARNYDSWWNWAREELIQWLHKVASDPLDVALPRKGNRLR
                     RILNRWDPSCSDIVEAMIKSPRPVGCPKQAISSCSDIRLALKEILRLGDLALASEPIY
                     IYSFPALCPKTTISSSGQLGYMETARKVSSYPDVVCQGRLCADDLETMIPFVHIKSRR
                     NEGSWKYDADATSILHAALGTGTTTGFSYASKTVLVTGAGPDSIGAQVVHGLLCGGAR
                     VVVTTSRTISESASFYQELYRRCGARGASLTVFPMNQASKRDCENLIEHIYSADSPID
                     GDLDYFIPFAAVPQAGELDKLGSRQELAHRAMLVNLLRIVGFIRQHKEKRRISCRPTT
                     IVLPMSCNEGSFGGDGLYPESKAGLKTLLNRFHSESWSSYITICGAVMGWTRGTGLMH
                     SSNIIAEEVEKLGVITFTQAEMAFNILALMTPGITTLAEQAPVYADLTGGLGLLWDIK
                     DHISGSRRRLNEESQIRKALQEEDTRHVSVLFGPQQQQPKDTGVNISRRRAHIQIPFP
                     ILQPFDDLRVSLPNLQGMIDLSRTVVVVGFSELGPWGNARTRWEMEHQGWFSLEGYIE
                     IAWIMGLIKHVDGDWKGRHYVGWVDAETQEPIHDQDIPHKYHEHIMSNTGLRLIEPEG
                     VDTYIPSQKEFLQEVAVEEDLPPFECSKLSAEAFKLRHGNNITLQPIPGSDSYRVFLK
                     KGAVLMIAKTIPFHQSVAGIVPTSWDALRYGIPEEIIQQVDTTTLYALCCVSEAFLSA
                     GINDPYDIYQHIHVSELANCLGTGGGPMKVIQNMYRDRFLDRQVRGDIILEHFLNTMG
                     AWVNMLLLSASGPLKTPVGACATALESLDIGCDAIISGNCKVAIVGGCDDYREELSFE
                     FDSIKATANCVEELARGRLPGEISRPTASSRSGFAESAGCGVQLLMNAELALKLGLPI
                     YGIVAYSQMASDQAGRSIPAPGKGILTAAREHHEAKSSPFLDFNFRRAGFDEEVADIE
                     QKSIGGSVGRMQSSGAAQAVAEQSRKLKVQDTQWRWAHNIRLQDPSISPLRAALATWG
                     LGVDDIGVVSMHGTSTKANDINEGEVINTQMDHLGRRKGNPLLCVCQKSLTGHPKAAA
                     GAWQLNGCMQILQNGIVPGNRNADNIDAQLRQFEHLVYPMESIKTRGIKATMITSFGF
                     GQKGAIAIVVTPSYLLASLPASTYEEYRVRVTQRQRAANPELVSRILNNCIVQIKSLP
                     PWENKDATEKVFLDPGSCRQDVTTEFTNEAHANSSKLVNTTTDRNSQIVENEDEGTSL
                     SCLVEKMLIDAVGRSKGTSSPSIGVDVEEIASINTENETFLQRNFTLAEREYCLKAPN
                     PQASFTGRWSAKEAVFKSLHASSSGPGAPMQDIEVLSHCGVPIITLHGEVKDIAQAKD
                     IGRVEISISHTSKAAVAIAVAVKG"
     exon            complement(258724..258837)
                     /number=1
     exon            complement(258884..263601)
                     /number=2
     exon            complement(263642..264105)
                     /number=3
     exon            complement(264153..264179)
                     /number=4
     exon            complement(264228..264331)
                     /number=5
     CDS             join(265075..270208,270260..270748,270805..270920,
                     270977..271429)
                     /codon_start=1
                     /locus_tag="AO090010000108"
                     /note="enoyl reductase domain of yeast-type FAS1"
                     /old_locus_tag="AO070317000070"
                     /protein_id="BAE66019.1"
                     /transl_table=1
                     /translation="MEPPSPCRPVPSSTSFSFNVEFQYRDIAFSLTIPDAYSTLHTLQ
                     RDVFLRSISLSGTNDIKQPVELALTYIEFLLSQKEIGAAALAVLLKAFNIQFLGRTDI
                     HSLIAELTSRSEQRRRWLRIYYHAVNRGYENRLDEHGKGVDYIRSGLFQNVEMNQFQV
                     MALFGGQGDASLTCLEELSELYNTYQSMLERFLRRMGSRLAELCRLPQCRPYYHQRYL
                     DIEAWITDATVVPDNAFVASAPVSVPVIGLLSLARYIVTCHILEISPGQMRALLCATT
                     GHSQGLLVSIIVAISDSWESLYDNSRLLVDVLFWLGWECHNCAPQIAIPAMSTRSEER
                     DVDCDTPSYMLCVRGATRCQVEDILTHMNCRFRRESQLYLALANTQDHFVVAGPYSSL
                     LHLTSYLQEICTSGPNQSHIPFSSRRPSLQHSFLPISTPFHTPYLRPAADSLKLRFSD
                     RCILPQQLAIPVYDTRTGNDLRASDGDVLHLAFDAIVHDICDWPATLACSPKMSARRP
                     PVSHIIVFDRGGLSSLVKKLKEGQGVRVIQGSDLDSRDPELGTMKDLFSPLLLHSATR
                     LQSWGQRFQPRLIPGAKIRIETRLTRLLGTPPIMVAGMTPTTMHWDFVAAIMNAGYHA
                     ELAGGGYHTADSMASAIDQLVKNIPAGQGITCNLIYANPRAIRWQITLLRRLSHAGVA
                     IDGLTFGAGVPSLDIVKEYIQTLNLRHIGFKPGSAAAIRDVVSIARAHPNFPVILQWT
                     GGRGGGHHSCEDFHAPILNMYGLLRQQPNIYMVAGSGFGSSGSIYPYLTGSWSATMGY
                     ASMPFDGVLLGSCMMVAKEAHTSKAVKDIITSTSGLDDNDWEKTYDGPAGGIVTVLSE
                     LGEPIHKIATRGVRLWAEMDKTVFSLPRQDRVAYLTKHRDMIIHRLNADFAKPWFGRN
                     SQGAVVDLKEMTYAEVMNRLVELMYIRHQRRWIDSSYVSFTFAFAVRTLERLPGELSD
                     SQHLSRVSLELDPLGFVRAFITARPAAVAEVLNPEDVSFFLMQTRKDNQKPVNFIPAL
                     GDDFEYYFKKDSLWQSEDIDAVIGQDPGRVCILQGPVAARYSCDRGESAKEILDTLLY
                     SLSDCFQRDMCVEELTIGIDSGLVTPDSWSTVSPGTKDLFMEGISTPSSTALSDSSDD
                     PCVCSFTVPYSSDRNVPVWVRAVLEDRFVLQGRLRRNNPFREYVEKYPESSIRYNPGR
                     SEVSVMAQDSPDIRSSMTITCQNGVDVIVELHPPYKADNLQLLYQFDPSRVPFRLSEI
                     MEGRNERIKSFYSELWLGERTISRMDLHSTFTGRPVKLTRQRFEKLVLTVGEAFPDHR
                     IVSSDSDILPISVGIIIAWDVISRPLVLLDIEGDLLRLVHRSNTIAYNPGAAPLRLGE
                     TVTSQSRVQSVYIEDTGKVVVIKARVIRSGEHVLTITSTFLLRGSFHNVENTFRKTEL
                     SDWRINVRSSLEETLLKSRKWFHPLAALPSLVDKSVVFNIESHVAYKKNGHTSLRVTG
                     QAHTRTGFKLEHIGDVDFICDDCIGNPVSEFLERKGIAQGGRIDFEKPGWPGRSSFEI
                     QMPASNNAYAQVSQDFNPIHVSSIFASFAQLPGTLSHGMCTSAILTAVLEHLVLENDR
                     SRLRHFSAAFLGMVMPSERLAVRLEHVGMVEGRMRFVIEACRTANGEKVMDAEAEVEQ
                     PATAYLFTGQGSQSRGMGMDLYDRSLSAKGLWDEIDAHLCDAYGWSVLDIVRNNPKTL
                     TIHFGGKQGRKIRKNYLSIIAETVLPNGDRMQKPVLAGLTPTSASYTFHDPRGLLYST
                     QFAQPTILLFEAAAFAEMRAKGYVSREAVYAGHSLGEYGALSALSEFIPTIALVELAF
                     YRGLMMQASVARDGEESDRYGMVAVNPERVGKAFDQASLSTMVCTIAAESRELLEIVN
                     FNVDGEQYVCSGTSTNLYVLGKLMDHIAQCPSGAKQVQAMRDSTDASTMELYRVIRDL
                     LHHAKTLPRPIELQRGQATIPLQGIDVPFHSSHLRSTVNVFRQCLLRPGLLVGNVDAE
                     ELEGKYIPNLMAQPFSLDEKYIRQAFDLTQSPVLGEILGVKHTFHAV"
     exon            265075..270208
                     /number=1
     exon            270260..270748
                     /number=2
     exon            270805..270920
                     /number=3
     exon            270977..271429
                     /number=4
     CDS             complement(join(271822..272642,272696..273311))
                     /codon_start=1
                     /locus_tag="AO090010000109"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000071"
                     /protein_id="BAE66020.1"
                     /transl_table=1
                     /translation="MLTSILSRLRPSWFPPFVKGHTSTPTTSRDPEISPLDIEDEPLE
                     IAIIGCGIIGAILALGLLAKNIKVTVYEQAQSPRESGAGIAFTANARRCMSMIDERIV
                     DCVAAVATTNGDPRNPNNNMQFIDGYTHDPDGLDDMSWKKLYALATGPKGFEGCHRAH
                     FLEEIRRLIPGGVVKLGKRLDRVEDYGVGKVLLRFCDGSVGRADAGPVIGCDGIKSRV
                     RELILGEGNPASYPHYTHKVAYRGLVPMQEATARLGHYRAHNQHMYGGPNAHVLHFPV
                     AKQTLMNVVAFVTDPNDWPLDRSMSQLATKDEVAGAFADWGPTVRDIIDLLPAELEKW
                     GVFDSLDCPAPTYSRGRVCIAGDAAHASSPHHGAGAGIGIEDVLALTVLLDMVQSRVK
                     TPGGRKTVALQAAFAAFSAVRRDRSQWLVRSSREACEIYEWNDLQCGSDMDKGYDEIK
                     RRSHKIWHFDIDGMLRQLEVEYRKHLGA"
     exon            complement(271822..272642)
                     /number=1
     exon            complement(272696..273311)
                     /number=2
     CDS             complement(join(274771..274965,275029..275355,
                     275443..275727))
                     /codon_start=1
                     /locus_tag="AO090010000110"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000072"
                     /protein_id="BAE66021.1"
                     /transl_table=1
                     /translation="MNTPLSVAVSRGHLLVVEALLNRLDVDTNFTNDRGRTLLHVAAL
                     NGHVSVMEMLIHWTGLEINEQDDRGQTAISLAAEHGQERAVAFLVTKADTNHVEINAL
                     DHRRSTPLCYAAYNGNPFTIELLIARNDVDLYCGTYDNRFPLSLAVESGNCTTIKLLL
                     NRMRQQNPKVTGEVDHQFSAELNRSDLWGRTPLFIATEQGREDMGTALASAAKNGREN
                     IVQLLLSRPDIDIGARDIHGRTPIQLATLEGHKSIALMLQRFHLDPDSEV"
     exon            complement(274771..274965)
                     /number=1
     exon            complement(275029..275355)
                     /number=2
     exon            complement(275443..275727)
                     /number=3
     CDS             complement(276357..278258)
                     /codon_start=1
                     /locus_tag="AO090010000111"
                     /note="alpha-N-acetylglucosaminidase"
                     /old_locus_tag="AO070317000073"
                     /protein_id="BAE66022.1"
                     /transl_table=1
                     /translation="MHHTVTFSYTTAFWTWEDWELELDWAALRGVNLILAWVGYEKVL
                     LDSLREIGMTDEEILPFFSGPAFQAWNRLGNIQGSWGGHGVSIAWIEAQFELQKKIVS
                     RIVELGMTPVLPAFPGFVPPAIKRVRPHATVVNGSQWSGFQKKFTEVSFLNPLDETFA
                     QLQKSVISRQTRAFGNVTHVYALDQFNEINPASGELGYLRNLSLHTWQSLKAVNPAAV
                     WMMQGWLFYDKKDFWDPNRISAYLSGVERNDDMLILDLYSESKPQWQRTESYFGKPWI
                     WCQLHDFGGNMGMYGQIMNITSDPIEALNKSDSLVGFGLTMEGQEGNEIVYDLLLDQA
                     WSAKPIDTRAYFQSWVRSRYSGNFSVPNELYTAWDLLRKTVYNNTNLTTYSLTKSIFE
                     ISPDIAGLVGRVGHYPTPTSINYDPMVLNEVWSLFMNATRKEPSLWHSPAYEYDMVDI
                     TRQLMGNAFVNVYSDLISSWKSETENRTTNVTSQSERLLNLLSAIDKVLSCNENFSLT
                     TWISSARDWGNTTETKDFFEYNARNQITLWGPTGEISDYASKAWAGLISSYYKPRWSI
                     FVDYLGEKNQTSYNETELKAKLHGFEMSWQEQSREPGISWANSSCRGLEVVLRNVSQS
                     WPSIFGDRA"
     exon            complement(276357..278258)
                     /number=1
     CDS             complement(279237..280601)
                     /codon_start=1
                     /locus_tag="AO090010000112"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000074"
                     /protein_id="BAE66023.1"
                     /transl_table=1
                     /translation="MAIFEHVQDVIGQLPVLKSYSHMLICFPVQDDKREVALQELERA
                     VRLVMKTFPYLSGRVINEGSGAGSSGTFKVTTYKEWESETHVFVRIQDRTSDCPGYDE
                     LCSAQGPSSMLPGHLLSSRVAFPETYQDTEDDPAPVLDFQANIVRGGLLLDLAAQHNI
                     IDGTGIFQIINLLATALRGDQFPLFQLHEGNRDRRDLIRLLGPDEPLLDHSELKPPVI
                     MKAPPPSDILAPYKWRYYRFPVDSVNKIRDLANSKPEDFDPSTESLSVNDAITAFCWQ
                     RITAIRLRKLETPAAFSKLSRAIDFRRIMRLTPAYLGHMVRVCNTRLTFEAIIESSLS
                     RLASLLRKDVQEISNEYALRSYVTFIANEPDKSDIAYGGSFNAQTDFSCSSIAHVKAP
                     DFGPLGKPGLMRRPTFQPLPCSSYIAPVLHGEGMEGLFCLHESEIEALAEDEMWKELV
                     EYIG"
     exon            complement(279237..280601)
                     /number=1
     CDS             join(283019..283217,283265..283505,283563..284091,
                     284139..284627,284768..284839)
                     /codon_start=1
                     /locus_tag="AO090010000113"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000075"
                     /protein_id="BAE66024.1"
                     /transl_table=1
                     /translation="MVTTQNISRQRPGSACEECRRRKVRCDRRRPQCQVCFETGIDCK
                     ISTTRLPRGPRKGQLRTLRTRIAALERCLADQHPGINQQMAGLFDGSGVECDSEEDPL
                     RERATLPEQVPEICSDDQQGGGSPRSPDPQTRPCGLVSDLMRADLDQLYFDRVHPSAP
                     ILQRWRYQVWAKQPRKSEAQVCLQYAMWTVAASLSAHFQSLRDTLYHETRRMLDAIDL
                     RSPISGILAVEQAQAWVLVAIYEYMQLSPQQAWMSAGRCCRLVLGMRLYEIDDPNSPV
                     TMAREHEPNLVDWTGLEEQRRTFWMAYSLDRFISFHNALPYTLNEELIATRLPTSEED
                     FQAGHPAATQFLSEVMAGYSSSDSSNVQSSFSQCVILATLCGRALSHKQKSAMEQING
                     ELGDGLWTRHQWLHEMLTYRIQVLSVLAQVDPMLIFARLVAQTLVLFLHSVLEAITWK
                     TGEHLLGMFEYERLCVMAAHEVVNLVKLQAQLGYFKELLECLQDLDHVKNPSQSPRIS
                     V"
     exon            283019..283217
                     /number=1
     exon            283265..283505
                     /number=2
     exon            283563..284091
                     /number=3
     exon            284139..284627
                     /number=4
     exon            284768..284839
                     /number=5
     CDS             join(285532..286197,286246..293322)
                     /codon_start=1
                     /locus_tag="AO090010000114"
                     /note="polyketide synthase modules and related proteins"
                     /old_locus_tag="AO080542000114"
                     /protein_id="BAE66025.1"
                     /transl_table=1
                     /translation="MSRPYRNSNMLSQLEPPPGGNTVLIFGCQCLSFNIDDFHRLRAT
                     VLETPEHRWIQDVLSELPVYYRTASTTYVQKLKNIPGTQQLRNLAEWFHTGKVPTDSF
                     PLPYIQLAPLLVITHFTEYWQYLRIRHHKGPTSVKESSAESPVVEIVGFCIGFLSAAV
                     VSAARNQEQLSKYAAVALRLATLMGALGDAQEREEEYTSLATVWKAAELENRLPLVLE
                     AFPESYVTVRFDTNRVTIMTPRRTIKQLENELQSAGFNTTQVEFNGRYHWAGHEDTLH
                     ALGRMCDSDPALQLPDTSQSVVPTRPNIPMDTPPKGPLHELVLWSILAKQCQWLDTFS
                     KVYRAHLEDTASLIIEFGPERCIPPTYMRKLQGRTVHFADLDLNTLSRTPPLYQTPRS
                     YDSDIAVVGIACRVAGADDLEEFWRLLCSGASQHQEMPLERYKDYETPWRPSAIRPWY
                     GNFVRDIDAFDHKFFKKVPREAMSQDPQQRLLLQVAYQAVQQSGYFHRPNINRNIGCY
                     IASCTVDYEHNVNCHPASAYSATGLLRSFMAGKLSHYFGWRGPAFCVDSACSGSAVAL
                     HQACQSIIRGECTAALVGGANAIMSPLAYDNLAGASFVSPTGPCKPFDASADGYCRGE
                     GFAAIFIKKMSDALADGDIVLGTIASTAVEQNNNCTPIVVPDASSLAGLFTQVTKKAH
                     LHPRDISVVEAHGTGTQAGDPAEYVSIRQTLAGPRRTSPLSLGSVKGLVGHTEGVSGL
                     IALVKILLMINEGIIPPQPNFQTLNPHINASPDDQIHIAVTLEQWRENFRAALINNYG
                     ASGSNASMVITEAPYASEHRMSSSIHTFTVALPILICASDEGRLSDFAKRLRQFLHHQ
                     AISAAPATDLGNLSFNICRQSNPTLDSQVAFTCCSKSELSSKLSSIIDGETSHIFRFI
                     KSPRSIVLCFGGQVSTFVGLDRTVYDCISLLRYWLDQCDSLAQSFGYGSLFPGIFEHN
                     PIIDQIQLHIQLFSLQYSCARCWIDSGLAVEAVVGHSFGELTALCISGALSLGDTITL
                     IARRAAIIRDGWGHDHGAMLAVEGNKDDIMRLIDEACRNTPTNVAPATIACFNGPSSF
                     TLAGTTAAIDGIQATLKTPSYISLKAKRLFVTNAFHSDLVDPLLPALEDVMCGIHPQE
                     PIIPCEKATENACTGTVTSDMVAKHLRQPVYFHHAVQRLAEKYGPCVWLEAGSNSTIT
                     YMVNRALVPSSGHHCQAVNITTERGMQSLSDATVSLWKASVSVAFWGHHSQQAQKYVP
                     MFLPPYQFEKSRHWLSNKKLPGPAHEAGATPAVSASALRFVGYQDTQQLVARFSIDTA
                     HPQYQESIAGHVVSHTSPVAPASFMLDYVVEALRSLPECKGKIPQVQNVTSDAPLCLD
                     MSRDLWIELYAQDTHKHIWDLRYLSEQLQIGRRSQVLHCSARFTMFDPDDSQIRSEFT
                     RYSRLVSHRHCKELLNDPNISDIIQGRNVYRTFAEIVDYSEPYRGVQKLVGKDNESAG
                     RVIKRYTGQTWVDTYLCDSFSQVGGFWVNCMTDRAPSDMYLASGMEMWMRSPIYADPT
                     TPRPDTWDILAKHERGDDCYTSDIFVFNPTTGQLVEVFLGMQYTRVKKATYSKIIGKF
                     MPQCAAHSSDVNKLETAVPHAAVPVPQAAKAKSDSSGPKSRINLTARIKEVVAEFCAI
                     DPSEITEDGNMADAGVDSLMAMELAREMEEAFHCTLPAADLMEADTFRDLVNCVKGAV
                     GECDSDEHENSSRSSEEISFKDRSPDGDYNTPDTEPPTSVASDTLDLELPLESVLEAF
                     GETKALTDHFLADNKCSGRIHIFAPLQNELCVTLTLEAFEQLGSHIRTASRGQRLDRI
                     PFDPQHQELTNYLYKRLEEARLVHLDGNTVIRTAISAPNKSSLSILEEIKCSYPEYAG
                     ASKLAYFTGSKLASVLCGEQDGLQLIFGTKEGQELVSWMYGDEPHNVVGYMQMLDFIK
                     RLIQKVPRTGAEAGALKILEMGAGTGGGTKWFLPVLSKLDIPVEYTFTDISPAFLAQA
                     RRRFKEYSFVQYRIHDIEKPPPDDLVSTQHIIIASNAVHATSSLQESTRNMRKALRSD
                     GVVLMLEMTRPAFAIDIVFGLFRGWWVFNDGRNHAITNEHRWETDMHTVGYGHVDWTD
                     GHSPEVSVQRVIFATATGTQSERLPLGKPLEKVHPVQKVDNASRRKVIDKYIRRSIET
                     FTLPVTSQNGFGSDGQVVLLTGATGSLGSHIVAHLAQRQSVKTIFCLNRGNPNEEPFQ
                     KQTSALKKRGIPLATHEMCKVKALTATISHHKLGLSSELYDTLKTTVTHIIHNAWPMN
                     GGLKLSGFEKQFEAMRHLVDLASDIACHLPTESKVRFQFVSSIATVGHYPIVTSQNNV
                     PEQSTNIEFVLSNGYGEAKFVCERILQETLQRYPSRFQVMVVRPGQIAGSSSSGCWNT
                     AEHFPAMVKSAQTLRALPDLQGDLSWTPVNDIAASIVELLLTDNTPYPVYHLDNPIRQ
                     PWHDMIRILASELSIPTGNIVPFSEWIQRVRSFPGSREDNPAGMMADWLEENFERMSC
                     SGVLLETTRAREHSSTLAGVGPVSEEVTRRYLHCWKQCGFLH"
     exon            285532..286197
                     /number=1
     exon            286246..293322
                     /number=2
     CDS             complement(join(293437..293514,293610..293654,
                     293702..293833,293892..294281,294343..294393))
                     /codon_start=1
                     /locus_tag="AO090010000115"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000077"
                     /protein_id="BAE66026.1"
                     /transl_table=1
                     /translation="MKSFNFLWLLAAGLITQVQADESPIEGYTIEEFSWEVETTPGGP
                     TVVLNGTIEKVLSQLREINPNYDNEFPTVVSAEQAAEEEDTSSHLVERGDVVCGKFPS
                     AYQSDIDKGIKYLRTVPGKPQRGPGPGSCGQVSCSWSSAIWWCNDNTFTKVLPSFKNI
                     ADGAQLIKNTCLHGGQTFSGQDFHNDKWNTIEWLILRLDVDSTRCNVAERPFLIRPSA
                     NGLCVKETPSQLV"
     exon            complement(293437..293514)
                     /number=1
     exon            complement(293610..293654)
                     /number=2
     exon            complement(293702..293833)
                     /number=3
     exon            complement(293892..294281)
                     /number=4
     exon            complement(294343..294393)
                     /number=5
     CDS             join(298568..298637,298687..299513)
                     /codon_start=1
                     /locus_tag="AO090010000117"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000079"
                     /protein_id="BAE66027.1"
                     /transl_table=1
                     /translation="MSLNASNLFSVHGIVAIITGGGTGLGRTIALALDTNNAEKVFII
                     GRREQPLHETAAQATNQSIIPIVADITSQESLENAYHAVAAQTSHIDLLFANSGTDGP
                     SAHLPPKPDGSPPTLAEFRDHHWGHQMTDFSETLNVNVTGTHYTILAFLPLLDEANKR
                     RPPQDSNELASPHPQVIVTSSVSAMMNRPASLAYSFSKAALLHLVEVFAAQLAPYRIR
                     VNGVAPGLFYSDLSKHLFDKSGVSGRGISEGSFTTELNPLTRAGSDEDIAGTILWMAS
                     RSGGYLNGDTIVLDGGRTAVVR"
     exon            298568..298637
                     /number=1
     exon            298687..299513
                     /number=2
     CDS             299966..301972
                     /codon_start=1
                     /locus_tag="AO090010000118"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000080"
                     /protein_id="BAE66028.1"
                     /transl_table=1
                     /translation="MSTHHSIKRKPVALPPQETGIILTTAPRPQTSHGKTPNTVTPTL
                     RPTTSNGRPPELYAPPPPYSQNSNVAPPIPQPPTQPRPPQTTLSTPPLRNHKSTPNLR
                     NPPSALPRTATDLPIPGPNAIQKAYGEVSHFLGGLIAHPTESTRHYTILRHSHGIVFY
                     RGSTTSIAISIFSDTLLPQDRKYFLQSRGWTGKTGMKAKALFRLTDDWLDVTPSFALR
                     ANQVSPGDERAWQRDITKFRKKAPSKLLNHELRETIVARIPAEAGDGYFQLNLCQSAK
                     KKVLCSSPVFRVLSTSLDPSSLRGASLSTMPLEVGAMVLSTYAQTAVQAIINPVTSTV
                     SNKLTPYKPGTVTQTAAETAYSLSGMEDRVARIRNHRGNNDSNPTDETESRARQTQEY
                     QQAGALENGPQSPFPMDFKARTQPQTQGQFSESSRYTLTKVPDTVLDKLRGRYLAWAR
                     YDLDRRPSNTPPKSPTQFPSSPYTPYNPQHAYITPSNSQGSQIQAQSQSQKSPWFPTI
                     LSISPLNPSYQNRVNLTSAMQKTTLLRFLDEIHVPASSRVQIRVMCFLRPDIPLPSPS
                     GMTEKDLLVARERAAEAEMLADACDVDCAQGILEHPAWGPEVLGASERQGGWMDRTRE
                     GMENVRTRAEKIVESVPLHWIGVRSATAEMRDRQVEINGFYIVR"
     exon            299966..301972
                     /number=1
     CDS             complement(303540..305198)
                     /codon_start=1
                     /locus_tag="AO090010000119"
                     /note="amino acid transporters"
                     /old_locus_tag="AO070317000081"
                     /protein_id="BAE66029.1"
                     /transl_table=1
                     /translation="MGSGEKPTIAPAASYSHDPESGDVKAGTMQAMVEADLLDERYMN
                     TQRGLKNRHVQLMALGGTIGTGLFVGSGQALVIGGPLSLLLGYTFISALIYAIVTGIA
                     EVGAYMPVHGGTMSYHGFRYVSRSLGFAMGYLYWYSLAILAAYEIVAASMVIDYWPNS
                     VHIAVWITIMLVVIVVLNFLPVGAYGESEFWFASIKIITLVGLLILSFILFWGGGPNR
                     QRLGFHYWKDPGVMNTYLVSGDRGRFVGLLQCIVKSAIAFLFAPELVVISGGEMESPR
                     RNIPKVARRYIYRLVIFYFLGSLAIGVICPSNAKELVHGDGHDASSSPFVVAISNAGI
                     PVLNHIVNAAILTSAWSAGNSFLYMSSRSLYGLAVSGNAPSIFKACNRWGVPYYAVGI
                     SSLFLFLAYLSVGSGSNTVFNWLINFTNTSGFISWTCCGIIYIRWNKAIQVQGIEKPY
                     YSRMQPYGMYIGMGGAIFLTLINGFTCFFPSEWSASNFFTAYIGIPAFLVLYAGHRIL
                     FWQDPWAWRPEEVDLQTGLQEILAAEKPPRPRDTWGRKLMALIE"
     exon            complement(303540..305198)
                     /number=1
     CDS             complement(join(306448..306970,307026..307666))
                     /codon_start=1
                     /locus_tag="AO090010000120"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000082"
                     /protein_id="BAE66030.1"
                     /transl_table=1
                     /translation="MGKLQPDCDPNDLPPPYEQVVSGQPSLDDSLPPLAGPSTATPPI
                     ADNEVQDNDRSEITERPSTTMSPFLSQDPTALHSLISHEARIPPRPCLSVRGAHQETH
                     PDRNDRKENRTESVVDFDFRINLTNYLVGDPDHDAGWYQLRVARDGDGQKLYRGGRCR
                     SRTWKRNARGRRVRLPTEEDGTATENVGLVEDDAGPDLMGWCERFCQDPSPVKSFTFT
                     RHIENFNSSIIHSTLTSHLRSLNYQGNIDISTSFSNRLFTVYSPHWINRARNNNFVYY
                     TCLILQLWLITWPIIWLLERRYAVVGSVWLFSREVGSQHVYARNRDEAGIAEDLAPVV
                     TQAAWERRLDGKVLTPQDMRLLRRLEREGQERGGRILVVNWDRISGWGRDQYT"
     exon            complement(306448..306970)
                     /number=1
     exon            complement(307026..307666)
                     /number=2
     CDS             join(310374..311103,311153..311281,311331..311632)
                     /codon_start=1
                     /locus_tag="AO090010000122"
                     /note="endo-beta-mannanase"
                     /old_locus_tag="AO070317000084"
                     /protein_id="BAE66031.1"
                     /transl_table=1
                     /translation="MKLNPSLLTAAGLVSAQLASALPQASSSTVSPSPSPSATPGSFV
                     TTSGLNFVIDGKTGYFAGSNSYWIGFQKNNDDVDLVFSHLQESGLKILRVWGFNDVNQ
                     KPTDGSVYYHLLADGTATVNEGEDGLQRLDYVVSSAEKHGIKLIINFVNFWDDYGGIN
                     AYVKAFGGSKEGFYTNDAMQAAYRAYIKAVISRYSDSTAIFAWELANEPRCQGCETTV
                     LYNWIESTSQYIKSLDSKHLVCIGDEGFGLDTGSDGSYPYQYSEGSDFAKNLAIPTID
                     FGTFHLYPSSWGTTNDWGNGWVTSHGAACKAAGKPCLFEEYGVTSDHCAVEKPWQNTA
                     LNTTAISGDLYWQYGDQLSGGPSPDDGNTFYYGTDDFKCLVTDHIAAINSRK"
     exon            310374..311103
                     /number=1
     exon            311153..311281
                     /number=2
     exon            311331..311632
                     /number=3
     CDS             join(316296..316372,316735..317026,317101..317269,
                     317368..317384)
                     /codon_start=1
                     /locus_tag="AO090010000123"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000085"
                     /protein_id="BAE66032.1"
                     /transl_table=1
                     /translation="MPEDSLPSMWSYTITVLVLWNPGLVAGTIEEVTNQVRSIKSNYK
                     YERRDGTNASTASLEKHYDEESLVCYPNGWGAADGNTVQEGVEYLKNDVAGKPTNGPG
                     PGNCGRVSCSYNNAIWWCNDNTESKTLDSCREIGLAAEEICNRCWMSAVASNSGFENL
                     CAGQMFMKDKWNVIVRDAKLSLQL"
     exon            316296..316372
                     /number=1
     exon            316735..317026
                     /number=2
     exon            317101..317269
                     /number=3
     exon            317368..317384
                     /number=4
     CDS             319220..320449
                     /codon_start=1
                     /locus_tag="AO090010000125"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000087"
                     /protein_id="BAE66033.1"
                     /transl_table=1
                     /translation="MSVPQYVAKEALVRDLRDFISRDADRTKRFNDAIATAVAGSAGA
                     HDEMANEGIKTLDYLRFCDDLLQWVPKVSSKGDELLQKILVFYWVFDQPALRGLQTEI
                     QPQNSNTDLSWLSYWLVTFARQQGLFLSTPQSAASVYSFYRNEKYNQEADLWVEPKSG
                     WVSFNHWFAREWKDIDSARPLAGPNDDKVIVSVADSKFNGDWDIVDGNVTISGIDAKG
                     VEWPIDKLLQTTTIDYHNGTFMHAFLGPTDYHRQHAPVSGEIIEVKNIQDQVYLQVAT
                     KNGGHLSGDRRLIRNPHMITRRRERLLSGGHGYYNLDAPDNAGYQWCQTRGLIVIQTK
                     DYGKVAVLPIGMAQVSSVVMTVKKGDHVKKGDNISYFQFGGSDVVVVFEKKVTFKSGL
                     KPGETKLNVRSELARFQ"
     exon            319220..320449
                     /number=1
     CDS             join(323586..324566,324626..325285)
                     /codon_start=1
                     /locus_tag="AO090010000126"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070317000088"
                     /protein_id="BAE66034.1"
                     /transl_table=1
                     /translation="MGVETSAEHGEMISPAGAPQYSSQESVAANKPMEIGVDTPVPRI
                     TLRAFVMGAFVSMGGLLFGYDTGQISGFQEMDNYLERYGQLNDEGKYYFSHVRSGLIV
                     SLLSIGTLIGALVAAPIADKLGRKWSITFWCIILNVGLIIQISSPAGKWVQMVMGRWV
                     TGLGVGGCSLLVPMYQGESAPRQVRGAMISCYQLFVTLGIFLSYCINLGTEHLEGTEQ
                     WRITLGLTFLFALILGGGMACFPESPRFEFRHGRVDSARNTMSKLYGVPENHRVILQE
                     IEEIQQQLDAESQEQVWHEFITAPRMLYRIALGMVLQSLQQLTGANYFFYYGTTIFQG
                     AGISNSFITQVILGAVNFGTTFGGLYIVENFGRRKSLIAGAAFMFVCFMIFASIGHFM
                     LDVQNPENTPGPGKGMVVVACFFITAYAMTWGPMIWAICAELFPSKYRAKGMALATAS
                     NWLWNFLIGFFTPFITGAIDFAYGYVFAGCLAVAALVVYFFVIEGKGRTLEELDWMYV
                     NKVAPWKSSNFEMPSLHDQQYGNQHGRKESRSYHAENA"
     exon            323586..324566
                     /number=1
     exon            324626..325285
                     /number=2
     CDS             328447..329553
                     /codon_start=1
                     /locus_tag="AO090010000127"
                     /note="3'-5' exonuclease"
                     /old_locus_tag="AO070317000089"
                     /protein_id="BAE66035.1"
                     /transl_table=1
                     /translation="MSGFKYSQTETNSYPNEKNANGTLSLTAPSDKGEWNTKDVGRQD
                     NEGVELSGKKGSCPRKCMGQIIFLYVLHNLTTDAGQSKGQRKKGKGKWQKVSLSEATK
                     PTTPNKDWSVIPDPEQAKILQDLVALCRSTNPHVARMRHWNTSNGHETSPTRRSVVAI
                     DCEMVLVGPGQNEVVQVCAVDVLSGEIVVDKGVVPTKPVTDWCTPWSGMTPQRLEDMK
                     REGKTVNGWEEARAEVLKFVDGDTILVGHALRNDVRALKMQHAKVLDTATVTKHAVTN
                     EMVGSGCKRTRKLKTLCQDFLGINIQQSRNGHDCVEDTLATREVLLWCVRNPDKLKKW
                     AVEQSAAIQAVSSSCSSGKKLEDSTPFEGVEDWL"
     exon            328447..329553
                     /number=1
     CDS             join(330876..330930,330988..331080,332523..332663,
                     332722..332976,333037..334043,334095..334619)
                     /codon_start=1
                     /locus_tag="AO090010000128"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000090"
                     /protein_id="BAE66036.1"
                     /transl_table=1
                     /translation="MSGNCRGFTNVAVRVSDMWPALSLFSMFSVFSTCMDHNLLLNSY
                     WLLLRMTEPIVVDGGLAHECLQSMPFDAQKGAKFVSELTKYIQFQSTIELLDDPPAGY
                     LSAPTDLLGGMAEVLAKAKSNQFPSHYEFENAILRVLHSANDGHLGATLCSNTIFYFN
                     NLVSLTSISSDGVQLPQLYTLDVLQKDPKIVSPVVSINGYEAVSYLNQYAESDHFQDP
                     DARYNHLFPSNARYVAQQESTGTWMFNNGLWPGYAVQNLTFSNGTSLEVPTLAQVALE
                     DFKYRNGSALWEDVCLTQSESASDDTEDSLSKRSDTAGKKAPSMYPKPIMRDEYNTIS
                     GYFLEDDEDVAALFVPSFETNKYEGDPLAFANHATDFVKKAVDAGKKKLIIDVSGNPG
                     GNTASAYDLFRLFFPQTDMYTASRIRAHESVNLIGQALSSLTKDTDYYGAEGIALYDL
                     VSPNQTYHFQSWEEYYGPQQVNGANLSQIAANFDFDVISGWETPIRGYGPVKLNDTES
                     PFAPEDILIVTDGYCTSTCTLFTELMTHLGGVKTLAFGGRPQNGPMQAMGGSKGSQVA
                     SSALIDAWVEGAKILAEKSGQDEKPLFSLEQRRALNDSAPAVEELPFNLPSLSVNWKN
                     SYLRDNHEIPAQFLYEPADCRLFYTWENYKSPATTWKDAARAWWGNGTCVPGLSAASR
                     STADGSPNN"
     exon            330876..330930
                     /number=1
     exon            330988..331080
                     /number=2
     exon            332523..332663
                     /number=3
     exon            332722..332976
                     /number=4
     exon            333037..334043
                     /number=5
     exon            334095..334619
                     /number=6
     CDS             335547..336632
                     /codon_start=1
                     /locus_tag="AO090010000129"
                     /note="coenzyme F420-dependent N5,N10-methylene
                     tetrahydromethanopterin reductase and related
                     flavin-dependent oxidoreductases"
                     /old_locus_tag="AO070317000091"
                     /protein_id="BAE66037.1"
                     /transl_table=1
                     /translation="MPVEFISLTFPNASTEIKPIPNATIDPEYLERYARNLDDYAFNY
                     TLVPYDSSYFDPWTIGATIASKTKNLKIIIALRPNTLYPTVAAKALATLDQLSSGRVV
                     VHFIAGGSDAEQAKEGDFLTKEQRYARLEEYIRILRRAWESADPFDWDGEYYQFKQFS
                     NKVRPTKETIPVSVGGSSDDAYRIGGALADIFGLWGEPLKETKEQIEKIYAAAEKAGR
                     TDRPRIWVTFRPIIAETEELAWEKAHRTLDALQANRPGGQGNAPSRPQNVGSQRLLDI
                     AARGEVQDRALWYPTVVATNARGASTALVGSYQTIVDSILDYVDLGAELISIRGYDNL
                     NDAIDYGRYILPPVRQALQERGAQSTA"
     exon            335547..336632
                     /number=1
     CDS             join(337826..337954,338001..338032,338160..338247,
                     338300..338410)
                     /codon_start=1
                     /locus_tag="AO090010000130"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000092"
                     /protein_id="BAE66038.1"
                     /transl_table=1
                     /translation="MKTTMAFLFVLFASFVGAAPPVQGQSPVSPYPNVVQKTVTYRGY
                     QDMLVRVSKMAPQERGPTPSWLVTSAPNEMIVQCDRRYECPSDGTFCFFNLITTEVGH
                     MKHVDGLAYCRGDVKEF"
     exon            337826..337954
                     /number=1
     exon            338001..338032
                     /number=2
     exon            338160..338247
                     /number=3
     exon            338300..338410
                     /number=4
     CDS             complement(join(339619..339959,340204..340250,
                     340485..340549))
                     /codon_start=1
                     /locus_tag="AO090010000131"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000093"
                     /protein_id="BAE66039.1"
                     /transl_table=1
                     /translation="MSLRLLCRLGGPTGTYCQVFKMVLSPITSSRPSGTNLVTFLQPG
                     LLTLKNHKYNMKFTAALALLPLAASAWEVTTGYWKSSETDVCAKTFLPKGFHVTINDL
                     LPGQKVFFFSDDECEDLEFSVHEVGTVKLESRVKSFTVLDFEQKQDLK"
     exon            complement(339619..339959)
                     /number=1
     exon            complement(340204..340250)
                     /number=2
     exon            complement(340485..340549)
                     /number=3
     CDS             complement(join(340983..341119,341181..341733))
                     /codon_start=1
                     /locus_tag="AO090010000132"
                     /note="serine/threonine kinase TIP30/CC3"
                     /old_locus_tag="AO070317000094"
                     /protein_id="BAE66040.1"
                     /transl_table=1
                     /translation="MTTAAVFGSTGAVGGQILATLLASDAFSSVKTVSRRLPNAQSPK
                     LQTLEEGDITKWGGLIASLSPKPSIVFNAVGTTRAAAGGIANQWKIDHDLCIENAKAA
                     KEAGVKTYVFISSGGTRGFFSRYVPYSKMKIGVEDAIKELDFEQAIILRPGLILQREK
                     PKAALLENIVQNLNKLGQGVQDMIGQDQTVIGRAAVAAARMAEEGKAPSKYWVLEQAD
                     IVRLGRDEWKQ"
     exon            complement(340983..341119)
                     /number=1
     exon            complement(341181..341733)
                     /number=2
     CDS             complement(342712..343350)
                     /codon_start=1
                     /locus_tag="AO090010000133"
                     /note="Ras-related small GTPase, Rho type"
                     /old_locus_tag="AO070317000095"
                     /protein_id="BAE66041.1"
                     /transl_table=1
                     /translation="MSNIKRKLVVVGDTSCGKTSLLHAFTQGSPASGELPTLLDLHEV
                     ASPVPGSQTQLSLWDTANHGEFSKLRNLSYLLCDVVLICFSIDSPQSLSNVLIKWAPE
                     VRHLSENKPTILVGCKKDLRCEQNPKSRNVFSQAMTKLVGRKKDLQSDQESKASDALS
                     QMPTEQVSHKEATKIFRQIGARQYLECSATTLEGVQQVFEAAARAVTHYKSG"
     exon            complement(342712..343350)
                     /number=1
     CDS             join(346290..346449,346503..347353)
                     /codon_start=1
                     /locus_tag="AO090010000134"
                     /note="kelch repeat-containing proteins"
                     /old_locus_tag="AO070317000096"
                     /protein_id="BAE66042.1"
                     /transl_table=1
                     /translation="MARAVWTNLLSDDSIQRSSQTLSVLARNAYLYGGELRPREPVDS
                     AVYRITLDNEQPSDIKLSTITSTSGSPQPRVGSASTTIDGKIYIFSGRGGTAMAPIEE
                     AGSFWIFDPNTSTWQQVKPADPQSTYPAGRSYHTLTNNGRDTIFLHAGCPEKGRLSDL
                     WAFNISTRQWRELAPAPKPERGGTSIAYAEGKLFRMNGFDGKTEQGGALDVYDPENNT
                     WSTIAYPADGVSGPGARSVSCLLSLKVAGKPSLVTAFGERDPSSLGHQGAGKMLSDVW
                     LFDIQSGKWTEVQADGGNAPEARGWFDADVIANASGDSIVVHGGLAESNERLGDIWRL
                     DF"
     exon            346290..346449
                     /number=1
     exon            346503..347353
                     /number=2
     CDS             join(348038..348403,348449..348643,348691..348714,
                     348761..348928,348994..349527,349642..349935)
                     /codon_start=1
                     /locus_tag="AO090010000135"
                     /note="iron transporter"
                     /old_locus_tag="AO070317000097"
                     /protein_id="BAE66043.1"
                     /transl_table=1
                     /translation="MAARMTRPSTPSEYSPLLSADPEAVDHGHSTFPHSQHEPPVANA
                     PPSRLARRLYISHFLSTWNSRVFEFGAVLYLASIYPGTLLPMSVYALSRGVAAILLAP
                     AVGHYIDTGNRLQVVRVSIGAVLQRIAVSASCVIFYLLAIGQPALSEIDSILLIALAL
                     LACIEKLCSIMNLVSVERDWVRIENSSETITIASRPNIATNAQMRRIDLICKLIGPLA
                     IALVDGVSTKFAILFNLGMNICSVVVEYFSIARVYYEVPELQERKTKADHDSPSRESD
                     QQSIMARLSHYWHRLTRKALGDFASYFRHPVFLPSFAGALLYLTVLSFAGQMVTWLLS
                     TGYDSTHVGIARTLAVAFEVLATWIAPWLMGRIGPTRAGLWLANWQLASLVAGISIFW
                     IFPDQPLISASGLVGGTILSRVGLRGFDLCVQILVQEGVEAENRGNFSSIETAWQNAF
                     EIGSFISTIVFSQPDQFEWPALISVIAVGLAGMLYTLFVRMQRGHLIHVPKWIATPGM
                     LQQTRERCIDRISSASDF"
     exon            348038..348403
                     /number=1
     exon            348449..348643
                     /number=2
     exon            348691..348714
                     /number=3
     exon            348761..348928
                     /number=4
     exon            348994..349527
                     /number=5
     exon            349642..349935
                     /number=6
     CDS             complement(350305..353175)
                     /codon_start=1
                     /locus_tag="AO090010000136"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000098"
                     /protein_id="BAE66044.1"
                     /transl_table=1
                     /translation="MYRISIPLVLLLVQQTVSLPAPEDYSGVTNNGAYGVSDASLNAN
                     VGGSIPQPAQNGIDPQSLVANDADLNNQVNPEPPAYGSAIDAAASQEVITSTIVVTWT
                     KPGDTNPTMAPIAAPVDKSNFIEANEDAGRPAADAWAAFDSSSSENVINTPHSSSAPL
                     IHASSHYEDVGIQNSGYPTSRSAQFIPAPEPSSQASVTPVPDPYPPSNAADDSSNTTT
                     DDDLLPPTRAPRLPTFTDVPPRFSTLSIESMASQNGLLQTAINGISTILPVINGLGLL
                     GIETEGTYFNLPGLLDAIDIPCLFRCSTPPSPARPQPGAVPQAPAAVQAPPAVAPPAV
                     APPAAGGAAMGGGAEAAAAAGAGAGLVGASPAGGAEAAGGTVAGGVPAAANVVKGGAE
                     AGAGVLGSGVEAAGGSVGSGLIRASAEAPQVEAPPAQGIAAQVPEAAGGLSNNPLLSV
                     PGRSLLKGVENGIQTGLDQSGGLPGINNPPSQSLDGQANDVLSNVGPQPGSDSTLNAP
                     VNGMDNSGVNEMIPPVAASSSTPPQPVQNGLQNDAGNLMYPPPPPMPLNPPQPSYVQD
                     GLQRGINDNTTMAGGLNNGYGNNMAPPAYSSLASPLQNGMNAGIGSNMQQAGNIGQNM
                     PPEAATMNSFASGAQGPPASGQLMQPNAAAGVAMALPVQGNSPSSNGALINAGSYGGS
                     SSMPLIPMSTMMASPSQTPSITPGPSHTPTPTPTPTPTTASSSEPPAVTTTQFNGEVV
                     SCASGKYPDDDHSATPECAGETKVVSTVESIASAYAASVSAEASAAASKSAAEESAAA
                     SKSVAEAADASWTSAAAKPSATCDILDDNGKNKVIFRVGGINGWTDGSSFSEILKTKC
                     HRFNFFKTFTIADYLFYGHEKSDFEGRQRDTEKVTFTMTGFKNGCVEDAIQEAGGPVH
                     GKGDGELTCQHKKEDSLPPKSLKDAQDAGENIENCVFIPVVH"
     exon            complement(350305..353175)
                     /number=1
     CDS             complement(join(355955..357110,357179..357252,
                     357288..357504,357596..357696))
                     /codon_start=1
                     /locus_tag="AO090010000138"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000100"
                     /protein_id="BAE66045.1"
                     /transl_table=1
                     /translation="MNIVFIPEVLIRPNQPQGVMSLLYFEKQNLWLQAQRCNMGFFSI
                     GPCLHSIILINRATLNLNQRPDIRAPVMEISLKNDSLITPGYIFMAPYQTELPGPYIY
                     DTDGLTQEPRIWYGPEPMAQQPNFSMACRGRNIILNKDYAQAATVQSGDGLTLSDMHE
                     LDIIDNTSVLIAIYQPRRYNLTAYNVSADNGWVMDGVFQEINITSGKVLFEWRSLDHV
                     GISETYTPIRLNTVVGDGLSNATAWDYFHINSVDKNDDGDYLVSARHTSCIYKISGAD
                     GSIQWRLGGTNSSIKLQDYNFSSQHDARFIQENDTVTVISLFDNASNGYRNTSSTSSG
                     IIVSIDHATNTSSLMKRYQAPGNGLLSTSQGNLQILANQNTFIGWGNNPSISEHTEDG
                     TPVFLATLEDPRAMNYRAFKFNWTGEPSDNPTLRTYAAAPGSATTFWVSWNGATEVDY
                     WNFYGTTSTSEEFTLLTKADRQGFQTTYTSTDYHPRAYAEAVSSDGSSLGNSSVVNTT
                     SSLPSQD"
     exon            complement(355955..357110)
                     /number=1
     exon            complement(357179..357252)
                     /number=2
     exon            complement(357288..357504)
                     /number=3
     exon            complement(357596..357696)
                     /number=4
     CDS             359412..359936
                     /codon_start=1
                     /locus_tag="AO090010000139"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000101"
                     /protein_id="BAE66046.1"
                     /transl_table=1
                     /translation="MRELEKEEFAQTHEICPLMELNATLRWSRLLYDWCYQHQEEPIK
                     GCDRDIQYPLVLDAQDIAHHPAVLAKYCKLIGLNPVHLKWEWNVPDQKIQKGVEDRIG
                     HKSPEAVMKFTLDNSSHVLKDKTPAIVDIGLERKGWDREFGISIGEQMEKWVREAMPD
                     YTYLRAKRLRVQDA"
     exon            359412..359936
                     /number=1
     CDS             complement(join(360665..361425,361473..361566))
                     /codon_start=1
                     /locus_tag="AO090010000140"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000102"
                     /protein_id="BAE66047.1"
                     /transl_table=1
                     /translation="MKLNLIALFLFIFSFAAASPVAEPDEVDGLEARDADIYEKGLYE
                     RDSSPEHFQHDHKCNQQESRCEPGHWNSNSCKCNGKWCDQFDPNCNNWSWNKCKCIKK
                     CDGPDRHCKPGDWDWNSCRCKGKWCGNYDSNCNNWSWNKCKCKKVCNEADRHCKPGDW
                     DWNSCRCKGKWCGNYDSNCNNWSWNKCKCKKVCNEADCHCKPSDCDWNSCRCKGRWCG
                     NYDSNCKTWNWDKCQCKKVCHQADPHCKPQDWDWNNCRCRGKWCDNFQPNCNNWNWDN
                     CRCKHHKS"
     exon            complement(360665..361425)
                     /number=1
     exon            complement(361473..361566)
                     /number=2
     CDS             join(364933..364941,365688..366353,367296..367316)
                     /codon_start=1
                     /locus_tag="AO090010000141"
                     /note="ankyrin repeat"
                     /old_locus_tag="AO070317000103"
                     /protein_id="BAE66048.1"
                     /transl_table=1
                     /translation="MPADNCGRTPLSYAAEGYEVVVRLLLDRPDIETDSKDNLGRTPL
                     SYAAEGGYEEVVSLLLDRQDVEADSKDNLGRTPLLYAAWRGHKAVVRRLLDRQDIEAD
                     SKDNDGLTPISCAAGGGHEAVVRLLLDRPDVEADSKDNLGRTPLLYAAWRGHEAVVRL
                     LLDRQDVEADSKANWGQTPLSFAAGGGYEAVVRLLLDRPDVEADSKDNSGRTPLLYAA
                     WRGHEAVISSKNL"
     exon            364933..364941
                     /number=1
     exon            365688..366353
                     /number=2
     exon            367296..367316
                     /number=3
     CDS             join(367571..367744,367809..369330,370487..370548)
                     /codon_start=1
                     /locus_tag="AO090010000142"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070317000104"
                     /protein_id="BAE66049.1"
                     /transl_table=1
                     /translation="MTDRKEVAVEQDAKSLEAGAPEVPSQTPNDQTMEQLDIFEAPKI
                     RTKLRIIAIMIALNLVLFVGALDQTIVATSIPTISAALHSAAGYTWIGGAYLLANAAT
                     APMWAKFSDIWGRKPVLLGAVIFFAIASIIAALSKNMEMLIAARALQGAAGGGLMQLV
                     FIVISDLFSIRTRALYLGMMGFTWALAGSAGPLIGGAFTELVSWRWCFWINLPLCGLS
                     FILLLLFLDVHNPRTKLREGIVAVDWLGTICILAVTLLLLLGLDFGGAIFPWSSPKII
                     CLIVFGTAMIGFFVFSEKRLAKYPLMPLSIFSNWSNNAIILVAFAHSMVAIGVEFYLP
                     LYLQSVKQASPLRSGILIIPMMITEAAVDILSGILISRTGRYREITWAGLALMTLGTG
                     LYINLGIDTPVARIIGFEIIGGIGTALLFQTPVIAIQNTVSQADTASATATMSFLRNL
                     ATSLSIVLGGVIFQNGMASRHSLLVDAGLSGSVLEALSGDHAAANVEIIKSIQEPAQR
                     RAAQGAYAWSLRNIFIMYTSVAAVGLVAGAFIKQRHMSSEHTETKTGIQQLTKRESAN
                     WTRVGEEGAEVGVCVFASR"
     exon            367571..367744
                     /number=1
     exon            367809..369330
                     /number=2
     exon            370487..370548
                     /number=3
     CDS             join(371930..371963,372046..372563)
                     /codon_start=1
                     /locus_tag="AO090010000143"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000105"
                     /protein_id="BAE66050.1"
                     /transl_table=1
                     /translation="MTILLVLALRRTRSIYVSSGPNFPLIVNLFSLYSIRSPTGRKRW
                     CGLFHNTPAFLNNFTTTRSDINTLSPRMAGNENLPSGIPAMTKTAAAPQCSKGDDTAD
                     FGDFVRNEDEELDLEEVVEPWYNYDIKETSHVFHPICLGEVLNGRYLVGNKMGSGGGS
                     TVWMAHDFQETKDVALKVMASRE"
     exon            371930..371963
                     /number=1
     exon            372046..372563
                     /number=2
     CDS             complement(join(373839..374571,374636..374712,
                     374765..374902,374969..375059,375114..375136))
                     /codon_start=1
                     /locus_tag="AO090010000144"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000106"
                     /protein_id="BAE66051.1"
                     /transl_table=1
                     /translation="MHTFTSRRNGDGSWITSPTSPTDPDALLDSRIRNSTLGKIFAIG
                     FKERTDKHDAIALAASYTGLEVDWFEGVRAANIPPKAYPAVWTEEKHRDKPAELGSWR
                     AHMNALRHIVENKISSAVLMEDDSDWDVNIKAQMVEFARGTRALQGTEGVPFSPYGDN
                     WDMLWLGHCGINLRGEPKYYVIPNDLTVTPRPHQNEFVRPPLAEDPNFESHRLIFNAD
                     NAICSWAMAFTYEGACKALTALSYVGIDEPVDLGYNFLCTNILHVPYKCLSSHPSIMG
                     TWAQRGPASRDSDITDGDDTWHEASSRSLTYSTMLNILPLANNETTISATWEDVPAPK
                     IAITTFKIPSGYLYTPDVE"
     exon            complement(373839..374571)
                     /number=1
     exon            complement(374636..374712)
                     /number=2
     exon            complement(374765..374902)
                     /number=3
     exon            complement(374969..375059)
                     /number=4
     exon            complement(375114..375136)
                     /number=5
     CDS             complement(376529..377980)
                     /codon_start=1
                     /locus_tag="AO090010000145"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000107"
                     /protein_id="BAE66052.1"
                     /transl_table=1
                     /translation="MSSLFLRRTRQRLKPVIAASVILATITVFLLSRTQPPQPHVETV
                     TFPSSSGTGVVANNDRNSSTCYVDAELLKSLGYNSSAEYRRWEIAVRRSKSHNGVSDT
                     LDVPVPKFEILDLDTDDDRIYLPETQCAPTATIEAPAAKARADASHMVFGVSTSLERL
                     SDSLGPFAHWAGGTGARIFAMVDVVPKKEKLKVLNRAQELDIKLTIIESKEEWLDRYF
                     RLTKVLWENRDAHTQWAVIIDDDTFFPSMSNLVERLATYDTTKPYYIGAPTENWGQMN
                     IFSFMAYGGAGIFLSIPLLQQMNEVYDICYAFKDHGDKRISQCIYQHTTTKLTWERGL
                     FQVDFGGDVTGFFESGRPLPLSIHHWKSWYDVDVVALGRAAAICGDDCQLQRWRISDR
                     WYFINGFSLVQYSSPMNDMIGMEQTWDPSDWARDQGYAFSLGPLRPKDEKKVSFRMKS
                     AVLEGQRLRQIYVHEPDSGSPRILEVVWTVADE"
     exon            complement(376529..377980)
                     /number=1
     tRNA            379693..379766
                     /locus_tag="AO090010t00003"
                     /note="tRNAscan-SE"
                     /product="tRNA-Asn"
     CDS             complement(384319..385461)
                     /codon_start=1
                     /locus_tag="AO090010000147"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000109"
                     /protein_id="BAE66053.1"
                     /transl_table=1
                     /translation="MGLPKVFHAVCFNQSTCTDDTSLHKVQLWQAICNIERLIGMILN
                     LPPGTARYQLTAAAPLNADGSIHLTTYLTRLLDISIKVYDLEEFSATHESSMKRQMAA
                     LEMAQALGELAGQAPDTWWAGDERDHITPEDIVQFLHCCVLMRVYLPFALKQNLRDEL
                     VYARLPCMNACEAVARRYLVLRRKLPAGLFMSRVLDLQALTAASVLLLLSHHVRSTDR
                     HSFRVDISHLHGVVSDIITLIGERARDPTNSDLAVEAYNTLRALDQLLRQDDHTGEVE
                     RLTVTVPLLGKIHVRRNARSAPQPRVANQPSSQLESNMGIQTWISASHPLEGQSSLGT
                     NIPVNEADPSPDEWRLTDLSWSVEGSLDNLLEDAFLSESIGQYVDI"
     exon            complement(384319..385461)
                     /number=1
     CDS             386874..387830
                     /codon_start=1
                     /locus_tag="AO090010000150"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000112"
                     /protein_id="BAE66054.1"
                     /transl_table=1
                     /translation="MSSSLQIRGGPYASTTAGMGGLPTIVPDIPICAVFLVLYIAFAA
                     TNMTIFQKNRRRGHKFVMSAMLFGFCMARITTLVLRIAWANRQRNVRLAIAANIFVNA
                     GVLLVYIINFILAQRILRSKQPHLGWHPILRQGSKLLYSLILGALVMVITSTVLSLYT
                     LDMHTRSQCRDVQLAAITYLLVFTCLPLAQVLIAFTLPRRPQEESFGQGGMTSKTAIV
                     VLSSCLCILIAGFKAGVNWSPPRPVTNPAWYDSKACFYVFNFVLEIMILSLLTFTRFD
                     RRFHIPDGSTRPGDYSCRALQPDKDSDQSQLRERKGSASVQT"
     exon            386874..387830
                     /number=1
     CDS             complement(388632..389039)
                     /codon_start=1
                     /locus_tag="AO090010000151"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000113"
                     /protein_id="BAE66055.1"
                     /transl_table=1
                     /translation="MGPLARYAVNVASTTDVQKVLYLTDKQNIRLAIRNTGYDFMGKS
                     PGPAAVAFWTHHLKLVQSMPGYIRYSGPTMRIGAGIQGSKAQNAAHKSGFVIVTGHYP
                     DIRIAGGYTQGGGHGPLGSRYRRQLTNSWSGRL"
     exon            complement(388632..389039)
                     /number=1
     CDS             join(390392..390891,391122..391953)
                     /codon_start=1
                     /locus_tag="AO090010000152"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000114"
                     /protein_id="BAE66056.1"
                     /transl_table=1
                     /translation="MGKVPIRSRTGCLTCRRRKKKCDERHPVCSGCDRNRLPCEWVSN
                     DLVPRTRRPRGRRQLAVTQLPHEAQAMVNVFAVPKPGMVQRLLSHFIDHSPRWLLTRT
                     GERRSDFLQYLLPAVSGNLLVHNCVLMIASADLAKYCRDDIEVQAVAVEYYGKAVSAL
                     QGSLNEDTRIVPHLNAAAALLLRRLHYTPEDLALRSFLFELFCYYFSLVAFSHGSKLS
                     LCQASAIFNSPIVTQYLQQGNVMGTSQRLFMCIFRISMLVEKVTSERQIHDSPARAEL
                     VMLEEQLIAWQAELPSRRDADVAWLNDAITSELYRLACLIYIKKVLDTCLSDHSPPIQ
                     ALVLAFVEHLGHLPPDAPSNNILCWPLVVAGLSAVVVTHQRAISTRLGQIYDIWRSDI
                     LCQSAAFLRQKWRDDRNHSAAASYGEHEKGQNDSPVAINDILKLQFPVILV"
     exon            390392..390891
                     /number=1
     exon            391122..391953
                     /number=2
     CDS             complement(392348..392989)
                     /codon_start=1
                     /locus_tag="AO090010000153"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000115"
                     /protein_id="BAE66057.1"
                     /transl_table=1
                     /translation="MPILPHLPTHSQTPPIHTARLLLRPFRAADLPALHVLRTTPDVM
                     RWTRQGRIDATTEETSKWMQRFTQDTEPGEQPNYNFAVLRKPISGAVHATESEEGDVI
                     GVMGIVSISPEDGPEVGYLFLPETWGMGYATEALRGFAEAWWRLPVPGDGVSRNGEGA
                     EEVGTLRAVTDKTNLGSARVLTKCGWTVVGEGVDGEDEKKVELLYWILRRPGI"
     exon            complement(392348..392989)
                     /number=1
     CDS             complement(join(393367..394293,394353..394820))
                     /codon_start=1
                     /locus_tag="AO090010000154"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000116"
                     /protein_id="BAE66058.1"
                     /transl_table=1
                     /translation="MDMRYGECADDPEWTFQVQGPDQPEYDTMFYPLSTKLGESIYII
                     NEDGSRTMNRDAYNRSRCYEHIAGPDCRNTQGYLGKNISAEEMTGCHTVQCILAKRED
                     WEPRPDDMEFEHKSRYHLTGVAENMPSSGYGLKFAPVRHGIDNIQAETEFLLETSQEQ
                     LDETGLPFHPACFELFIQASKQCLGEVDIDTLVRIRDRACMESQHFPIEDNEDVKEGQ
                     EQVWNHTVGHEYLVANPIFVPSLKPIIQSAISTDRGFSVNNSPFESRSPINPASTARD
                     PFRALPIEIILIIVDHLNSPDIAALRLTSRAFTHLPTSLWFRLVVTEMPWLYEAWSSD
                     PTPYHWATVIAHDVHQEKAAREEWDRDMEKQSLVIGEEMPEVQAEWLRNLPRWEWPDH
                     PDRLEVLDLSPARLHYHTTNWYRLYRDITVNWKQLKGLQNRARIWDAVLQIVGAIKDA
                     RGEYVNEGFSDGIV"
     exon            complement(393367..394293)
                     /number=1
     exon            complement(394353..394820)
                     /number=2
     CDS             complement(join(395809..396944,396994..397348))
                     /codon_start=1
                     /locus_tag="AO090010000155"
                     /note="uncharacterized protein involved in propionate
                     catabolism"
                     /old_locus_tag="AO070317000117"
                     /protein_id="BAE66059.1"
                     /transl_table=1
                     /translation="MTIPAADDNNCPSYDKVIDLIVDYAYDYEIDSPAAWTRAKAALI
                     DALGAAIESIHTSPECAAMIGPVWPQTATVPGGFRLPGTQFQVDALKGAFDLGGMIRY
                     LDHNDAFPGAEWGHPSDNLGAILSTADILSREALARGSPEEVISMKQVLTALIKAYEI
                     QGVFQIRNAFNKVGLDHVILVKVASSAMVSWLMGLSRDQARAVVSHAWADGHPLRVYR
                     QAPNAGPRKGWAAGDACMRAVHLANLVRCGQPGIRSAITTPRWGFYDVLYRGQTFELP
                     RPFTSWVMETVLFKVSTAEGHGLTAVEAALTIAEKLAQRGLRPEEDIVNIRARTQEAG
                     MIIINKKGPLHNAADRDHCLRYMVAVVLLKGSQITTADYQDSSPWARDPRVETLRSIT
                     TMEEDPSFTRDYHDPQCRSVANALEVTLRDGTKLEELVPFPLGHVRRPETLQLVREKA
                     QQNLGLKLSSERVGQILDTVDQPKFEKMAASDFVDLFIPQPASSAA"
     exon            complement(395809..396944)
                     /number=1
     exon            complement(396994..397348)
                     /number=2
     CDS             join(397833..402876,402969..403457,403509..403624,
                     403675..404106)
                     /codon_start=1
                     /locus_tag="AO090010000156"
                     /note="enoyl reductase domain of yeast-type FAS1"
                     /old_locus_tag="AO070317000118"
                     /protein_id="BAE66060.1"
                     /transl_table=1
                     /translation="MASTPSSGSYDLAIVTPTEDHSLRSFSLSQGNVQQTFLVSTQDG
                     AFLDQQKASFLQSYSKDQSILGLVFEFLQFLLDEACPPAPLGAFLGAIESQCVRDANI
                     HDLIVSEPEAKNIIRTYYRAHAVAGLNPRPAPSGLFSTVNIEAHRILMAFGGQGSTNL
                     VCVDELADLYSLYQPLLEPLIASVAPALASLSREPSTLQHYLGREIDLYSWLTIPESR
                     PDRAFTATAAVSFPIIGLLDMAHYYVLGKLLDSDSPKRLRSALQGLTGHSQGIIVAAA
                     VAQADTWASFLAQAQWAIRLLFWMGYECHTAAPASPLSSAAIRDSIEHGEGSPSWLLS
                     VRGLRSPALDALITDCNRRLPESEHLSIGLINTERNIVVAGSPRSLRGLCLRLREIEA
                     DDGQDQSRVPFRQRKPVVHHTFLPVSAPFHSSHLRAAADRVKERFPDASSPQVGDLLT
                     AVYHTRTGQDMREMFSPSNNLIHSLVEAVACETVDWPATLQVSRSKPPSHIVLLSSSR
                     LSDLVSEIVDGRGVRIIAGTVLAPTDPAVLGGKAELLTTKPSQAPTPWAELFKARLVA
                     GPDGRPILETRLSQLLQAPPIITAGMTPTTVHWDFVAAVMQAGYHVELAGGGYFDAAG
                     MTTAIEKLAAHVPPGRGITCNLIYASPHSIAFQIPLIRSMIQRGIPIDGLTIGAGVPS
                     QDVVNEWIQTLGIKHLSLKPGSIAAIYEVIEIAKKHPTFPIILQWTGGRGGGHHSCED
                     FHEPLLQTYRDIRRCSNLYLVVGSGFGQADQMHPYITGEWSLSFGRPVMPCDGILIGS
                     RMMVAREAHTSPQAKELILAAAGVADSEWEQSFKKPTGGVLTVQSEMGQPIHKLATRG
                     VRLWHEMDKTIFSLPRDKRVAALNARKAEIIRRLSADFAKPWFGYNAAGDAVDLEDMT
                     YTEVIARLIRLVYVSHQHRWIDPSYRQLVLDFTYRTLERVSNADYATDKLDLSQPEQF
                     VEQVQQLCPAATTRRLHPDDVRFFLTICKQRGRKPVNFIPALDEDFEYWFKKDSLWQS
                     EDVDSIIDQDADRVCILQGPVAVQYSRRADQSAREILDEIHHGLANHFEEGPSQSDRP
                     SLAISEMVSARVTVTESNTHRIIRPTSESLPSVEDWQAFLASQVTGSVRSAIMAEEVL
                     RGSQRQANPLRRVLEPRTGQSIQIPLDGRDLRLVEDAKNRPLVHIKPSGDQEVAVDFY
                     YYDFVETPGNLRFTYKFDSKSLSLVENLDGRDDRVKLFYAHLWLGRADLSYHRLSEVF
                     EGEEITLSSDLHRHLHNALRHTVPDATASATTNTLPLEAAIIAAWKPLMEPLFVAELQ
                     GDLLRLVHLSNSIRYTPGAAPLEVNDVVATKSQVRAVTIKETGKTISVEAQIFRSKTL
                     VATVTSEFFIKGSFSDYETTFSHQDEAAIELKVQSAIDEALLRDREWFLLDDPTQSLI
                     DKTLVFRLHTVTRWKDQSTFTSLKTTGSIYTKHWNGTEQKVGTVASEVVECHGNPVID
                     FLQRKGTVVQEKVPLKHPGLIDNGSRTIRLPLDNALYSSVSKDYNPIHTSSVFARFAD
                     LPGTITHGMYTAAVSRAVTECLAADGETGRLRSFSASFVGMVLPGDQLTVRIRHEAMC
                     HGRMVLSVAAYREGTDEKVLQGEAEVEQRTSAYLFTGQGSQAQNMGMQLYDSSAVARS
                     VWDEVDRRLLDQYGWSILNVVRANPKQITIHFRGARGRRIRDNYLAMRTETRMPDGST
                     RLEPILRDLTAKSESYTFFDSRGLLYATQFAQPAILLMEKAAFEDMKANGLIQEGAAF
                     AGHSLGEYGVLASLVDFLPFEMMMSVVFYRGLVMQFTMERDSNGHTGFSMVAVSPKRV
                     GKYFDEAMLRIVVDLIHRQSGKLLEIVNFNVEAEQYVCAGHVRNIYILSGILDLLSRS
                     ATGPQLVASLRSASDPAITDVAKEIAVYLEKAPQLNNPTELKRGRATIPLQGIDVPFH
                     SSHLRSGVSVYRRFLEERIQAENVQVDRLVGKFIPNVMGKPFAIDRSYLEEAAAVTGS
                     SVLRELALAA"
     exon            397833..402876
                     /number=1
     exon            402969..403457
                     /number=2
     exon            403509..403624
                     /number=3
     exon            403675..404106
                     /number=4
     CDS             join(408538..409728,409770..410422,410475..411075)
                     /codon_start=1
                     /locus_tag="AO090010000159"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000121"
                     /protein_id="BAE66061.1"
                     /transl_table=1
                     /translation="MTARTPNRATGAPENANPTVRDQTQQDQGERSESPAIPSLTNKK
                     RPRSQPDNTSSPACNQCRTRKIRCDRQQPKCSNCRRADVECDFATTPKRVDRTKQLLN
                     DFSGVVARLDRVDNSLAKLSEQLQQQQPCRCSHSPVPSQVDNPWGASEPAAIYTTYTP
                     KSSTSCRSPHLMEVDGSEDCDPEIPNGDLVDFDQGGQRLLDYPAALSLFKNLQRQITR
                     WLTKDVPQGSELWQVIAQQPGFKASLEYQLEQFPFGGLCHEPVIVSDHRPISTPPRYL
                     LELSLDGFLRHINIHTPIFDDSSLGKAIDTHYQSLSAGTGDAWALTFTNIIILTVALD
                     ARVARATASHLVSMNDDMLPSFLKNCDRALADLNRFTAPCLINVQVLLTLVRMVINFP
                     EAYIRALVAREFYGSVVFEKVCQAVCQVARSTGLHRAHGARSMRWEKMPERERLFWVV
                     YTMDKQRAFLTGQPCDLYLFDSDIQLRSCGERAPFPLRLNAAYVHMMTIWEQIFINLY
                     SSRAVLAGAADRSRQVQQLWGSLNEWNIKYHALLSSPILEKMADLAPMQLELKYCFMV
                     SQVLVHRCDRNARSQQRYRDPARSALKLIAQVAGDHRSITLARCAVLARMFRNYPLVA
                     VHDLFSFCLTDGEPDSTEDGQLIHETRRHLELLHYADFPQAYFARLEVGLKWCTDMLD
                     TIKDCLSRSAVAGDWGPMDGSSTGLSDRTPPSESELSSIPPDAWASLNLPMSRDEMLC
                     GLSPSVPSEGLLDPQFSAFGLTTSSTGDSTVPAFAQGGDNPAVTMHPSMWVPAEVPCN
                     SSEPLFDPEFTRSIMS"
     exon            408538..409728
                     /number=1
     exon            409770..410422
                     /number=2
     exon            410475..411075
                     /number=3
     CDS             complement(join(411810..412400,412456..412502,
                     412552..413083,413139..413486))
                     /codon_start=1
                     /locus_tag="AO090010000160"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070317000122"
                     /protein_id="BAE66062.1"
                     /transl_table=1
                     /translation="MAVAELPNIVSTDSSPSPHPGSRLSSEPTDIESQKAPSNAEPKT
                     DPNLVTWDGPDDPANPQNWSFAYRAFVTAIWVYGNLCTCIASSIFSSGSGQIAQRFHV
                     GSTVVTLGISLFLLGYTVGPPVWGPLSERFGRKWPMVIGMALFTIFCIPVAVAKNLQT
                     VLIGRFLTGVFGAAPLSLVGGSLVDMWNPAQRGVAMACCIGTIFGSPVLAPLMGNFIV
                     ESYLGWRFTQWLSCIMGGSCTVLVVFGLPETFAGSILRKKAAAIRKAGNPDVHTVYDG
                     KQKGIKDIFVIFLLRPFALLVTEPILLLVTIYQAFIYGILYLVFVSYPIAFREVRGWS
                     LGISALPYIGMMVGILIGCAIVVIQTRRNYDGNKAVVPEQRLPLMIAGGCLLPVGLFI
                     FAWTSNPNIHWAGMVIGSAPVGTGMYMVFVQCLNYLVDVYPTIANSAIGANTFVRSFF
                     GAGFPLFGPFMYHNLGVAWASSTLGFISIAMIPIPVLFYRYGARIRSWSKNSKHT"
     exon            complement(411810..412400)
                     /number=1
     exon            complement(412456..412502)
                     /number=2
     exon            complement(412552..413083)
                     /number=3
     exon            complement(413139..413486)
                     /number=4
     CDS             complement(join(414737..415948,416000..416236))
                     /codon_start=1
                     /locus_tag="AO090010000161"
                     /note="uncharacterized protein involved in propionate
                     catabolism"
                     /old_locus_tag="AO070317000123"
                     /protein_id="BAE66063.1"
                     /transl_table=1
                     /translation="MTVTDSTPEGNVTAELCNWVTELKPSDIPADVLQRAKHLLLDGI
                     ACGLVGSHVPWSEQAAKAIDDYEPEGYCSVIGYNRRYGPQAAAILNGSFIQAVELDDY
                     HSAAPLHSASVLLPALFAAAEVQSKGHRKSVVSGLDFLVALVVGFETGPRVGSAMYGA
                     DLLSRGWHSGPVFGSPAAAAASSKLLGLSPDDTESAVGIACTQAGGLMAAQYEGMVKR
                     VQHAFAARNGLFGALLARDGYVGIKKVFDRSYGGFLTMFTQGNGRTPQYKPEEVTTAL
                     GKEWQTTNIRVKLHACVGGCHGQIEALEKLQRNYPDRFAVDQLHNIRRITVSLSEPVF
                     AHDGWAPEERPLTATGGQMNAAYIGAAQLVYGQVLLDQFEPHALDSDAVWSLIDKTTC
                     VHSSEFDKPGHLCGARIVVEFNDGETVEDVVAMPKGFDPPITDDEIREKWRKLASSVI
                     DSERLQRIENSVLSLETSADVSELLALISGEL"
     exon            complement(414737..415948)
                     /number=1
     exon            complement(416000..416236)
                     /number=2
     CDS             416584..417468
                     /codon_start=1
                     /locus_tag="AO090010000162"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000124"
                     /protein_id="BAE66064.1"
                     /transl_table=1
                     /translation="MLSYTSHCLQALLGVASLPYRQYQAYSSPQAPLQVPQVPQAGPP
                     ITTLVSSCAGFSYPEVACIDRYGSLLQGEFERKVRNVLGDADTYISTNAPSEPTFSDL
                     QNADFLVWNQSAAKAILGPNPHVDFMFSIEDCSHEAPVYVPTTNELYFSRLQQGFLPQ
                     LVINLNNDPPTLEEKLAQPPIYAATGARFRDGLLYLATIGGNESLAGYTFRPGLYTLD
                     PITGKTQALLNNYYGYYFNAVDDLDIDHEGQIWFTDNGNTAFLLPTLPTPLPTPLSNS
                     PAKQPIPKTRKITAVPAK"
     exon            416584..417468
                     /number=1
     CDS             417534..417989
                     /codon_start=1
                     /locus_tag="AO090010000163"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000125"
                     /protein_id="BAE66065.1"
                     /transl_table=1
                     /translation="MVDDTLLEPNGLTFSPDNKTVYLTDTGAGSAIIDPNIYPAPHIA
                     YNSTRKGRTIYAYDVAPSRKALLNKRPVYLSMEYAPDGIKTSREGYLVSATGKGVVVL
                     TDEGEPLVRVQTNFTVINIAFAGAERDELWAIGKGGVARIRWGLKGSYA"
     exon            417534..417989
                     /number=1
     CDS             complement(419122..419556)
                     /codon_start=1
                     /locus_tag="AO090010000164"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000126"
                     /protein_id="BAE66066.1"
                     /transl_table=1
                     /translation="MELIRLEQQNKRRLFFAGDTRCPLSWAAKSHNAPLVNALLRSPQ
                     VNVNFQDPSDRTPLLYAIAVNDRPIVERLLNHRDIDLNLRDAEGRTAIFYAAQGGDLS
                     IVQLLIGTQNVDFSIRNKNGKNVKEFAKKAKLKQDIVAALSN"
     exon            complement(419122..419556)
                     /number=1
     CDS             complement(419794..421107)
                     /codon_start=1
                     /locus_tag="AO090010000165"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000127"
                     /protein_id="BAE66067.1"
                     /transl_table=1
                     /translation="MDIYEAASQGRIDAIKFAVEQGCDVDGPNEDGKTPLWFAVQSGQ
                     PEACRFLMSLGAGRGPQNPSLLEVAVGGGYADIVALLWPHCNAEREHRSLKTAISLGF
                     HEIADFLIETGAFEYQDSEVSGTESLIEDGSPERESTVFQQWERFLFVRRGQKLPLHR
                     VFFDYALLLATKAGRNAGLRLVEFLLGESMPDVNCKIMINGQFETPLTAAAEKGNLEI
                     LATLIDHPNIDLTICGKYNWPAFLHLLASPLSISTERGRVIARRLAYKAVYNRLFIDS
                     REIRLQGAFQNVLRFGDDGLVKQVIDLVRGAAGTLILPLLIRANEVDGLTWVLNCDGV
                     SSKKPPPAFWVLLCQYFKRYQDQDALGLFTSVTEFLVEKKIWNQAILKCLHACNFSFI
                     QQFFYPLSEAPPKEVTEETLVGFPAASTNHCIIQEWAGQGFARVA"
     exon            complement(419794..421107)
                     /number=1
     CDS             complement(join(421941..421994,422252..422779))
                     /codon_start=1
                     /locus_tag="AO090010000166"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000128"
                     /protein_id="BAE66068.1"
                     /transl_table=1
                     /translation="MGSLPEKDFPQVHRFITTHKEDGTPTFETKIPEPIEWERTNIGV
                     DFFLAYTLGSFPAPLSHDADLNQYKDHLVNHPPFMIPGGAVVRYVDYHPGCEPMWHRT
                     VTVDFGVVIEGELELEVEGGEKRLMKRGDVAVQRGTNHCWRNPSKTQFARALYIALDA
                     KPVIVNGQELGESLGEPPLCRPLCCPLSIASRL"
     exon            complement(421941..421994)
                     /number=1
     exon            complement(422252..422779)
                     /number=2
     CDS             complement(423684..425093)
                     /codon_start=1
                     /locus_tag="AO090010000167"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000129"
                     /protein_id="BAE66069.1"
                     /transl_table=1
                     /translation="MYLSLRLVSLALCIAPLASAGNNSTPLVQACTGYSFPRVACMYR
                     YASKMPLDFYRKASVDISNVDTYSSTEVANDDSFQQVGKATFLVWDQQRGSEILGSDP
                     AYDIVFTISTGGHEAPVYVPDTNELWFSELGKGELHQQVISLDGDSPTISEVLTDPPL
                     YAPSGARYRNGKIYFSAGGGNSTLEGGPYHPGIYSVDPKTRKSTIEVNNYFGWYFNQV
                     SMPTAHTRGGSPLSHFCTLVDPRLVAHGLTFQHRPTTWILTNTVASGLVILVSSWTRD
                     LTLVHTDAAIVLARNHGTSTVAPQVQASVYRYDPETGAVNIVDDTLHCPNGVAFSPDY
                     KTLYLTDTDAGVPMIDPRVPLSEVPSLQYNSTNRRTVYAFDVSEDGSYLKNRRPIYTA
                     KDFVPDGLKVASNGYVITGAGKGVDILDTTGTPLLSIQTNFTAVNMVFGGKNLDELWI
                     VGHGAVARARLNLTGPALE"
     exon            complement(423684..425093)
                     /number=1
     CDS             join(425899..426073,426134..426448,426499..426692,
                     426745..426928,426984..427141)
                     /codon_start=1
                     /locus_tag="AO090010000168"
                     /note="probable taurine catabolism dioxygenase"
                     /old_locus_tag="AO070317000130"
                     /protein_id="BAE66070.1"
                     /transl_table=1
                     /translation="MHSTKVTYPEPMQLSGILDQYESFQVTPCIGTEFPKANLAEWLH
                     SPNADALLRDLAITIAQRGVVFFRAQTDLDGELQKELTHRLGVQSGKPAGHRLSKHPL
                     HLIRKDDPEMGVLDPGRQQKLHGVENTQKRQRAVLEYHSDGSYEVCPPDFTMLRMTEI
                     PPTGGDTLWASGYELYDRLSTPYQKFFESLTAQHEVPSLRKLAETEPGIYDGPRGAPA
                     NTDMQFKQSHPMVRTHPVTGWKTLFAGGLHCRRVNDVTDFESEQLLSKIISLVGDNHD
                     LQVRFRWNNPGDVAIWDNRCVLHCPTQDHYGLGGRMGYRTMGIAEKPYLDPNSPSRQE
                     ALAAAAK"
     exon            425899..426073
                     /number=1
     exon            426134..426448
                     /number=2
     exon            426499..426692
                     /number=3
     exon            426745..426928
                     /number=4
     exon            426984..427141
                     /number=5
     CDS             complement(join(428183..428632,428685..429230,
                     429279..429677,429727..429774))
                     /codon_start=1
                     /locus_tag="AO090010000169"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070317000131"
                     /protein_id="BAE66071.1"
                     /transl_table=1
                     /translation="MAEEVNERTRLLSQSDDPSPSLEELEEWEEPRNWKVSYRWLCIA
                     VISVYGLISPVIAAIIVPAMPQIATDLNVTDPGMLQAFVSVYVLGWSFAPLVVGPLSE
                     VYGRISLLNTGHGLFLVFNALCAFARSDYELLILRFITGAVGSAPLSIGAGIIGDLWA
                     PEERGLSISLYTLGPLLGPAIAPITGAYIVSHTSWRAIFAWCSLYILITWVVGLCTLR
                     ETFRPVLIQRKQAAAVRKGQLPGSVQHHHKSLADVFRQDLRRPFTFLGTQPIIQVLSL
                     FMGYLFGLNHLSITTFESVWTDIYNQTPSRAALNYISIAGGFILGSQITGSLNDRIYI
                     YYTSKDPAKGTPELRTILMLPAALLVPTGLLIYGWSAQTHSHWIMPNIGIGIYALGLI
                     MSYQCIQAYVLDCYAVYAASAMGALTILRSLLGFVLPILAPLIYRTLGYGWGSSLLAL
                     WALVMGGLVPILLWRYGAVLRKRSGILEEM"
     exon            complement(428183..428632)
                     /number=1
     exon            complement(428685..429230)
                     /number=2
     exon            complement(429279..429677)
                     /number=3
     exon            complement(429727..429774)
                     /number=4
     CDS             complement(join(430358..430428,430486..430568,
                     430625..431380,431436..431869))
                     /codon_start=1
                     /locus_tag="AO090010000170"
                     /note="citrate synthase"
                     /old_locus_tag="AO070317000132"
                     /protein_id="BAE66072.1"
                     /transl_table=1
                     /translation="MTVTQEASPKRESLHIIDDRTGSYYSIPIVNNAINASDFKKVTA
                     PEDKAYPANQTENGLRVYDPGYSNTAVSHSKITYIDGLKGTIQYRGYSINDIVGRKTF
                     IDTAHLLIWGHWPSTAEAETLQQRLDQVPVPQDFVFNVIKSFPRDGSLMGMVIAGLSA
                     LQSSDMNAIPAHVGKTIYLNNPELADQQIIRVMANMSMLTAAAYCHHIGRDFTPPRAG
                     LSYIENFLLMTGHVEAATGLPNPRYVNAIERLWVLIADHEMTCSTAALLQTASALPDV
                     ISCMVSAISALYGPLHGGAIEVAYKNIESIGSISNVPAKIARVKAGKERLYGYGHRVY
                     RVTDPRFVFIREILNELSEEVEKDPLLKVAFEVDRVASEDEYFTSRNLRPNADLFAAF
                     VYKALGFPPEFILPLSILSRTQGFMAHWREAMGNPPRIWRPGQIYTGDLNKSMDE"
     exon            complement(430358..430428)
                     /number=1
     exon            complement(430486..430568)
                     /number=2
     exon            complement(430625..431380)
                     /number=3
     exon            complement(431436..431869)
                     /number=4
     CDS             join(432546..432613,432661..432687,432741..433195,
                     433248..437914,437963..438079)
                     /codon_start=1
                     /locus_tag="AO090010000171"
                     /note="3-oxoacyl-[acyl-carrier protein] reductase"
                     /old_locus_tag="AO070317000133"
                     /protein_id="BAE66073.1"
                     /transl_table=1
                     /translation="MVQRKDPPSEQLRAYTLLIELLSYQFAFPVRWIETQNDLIQRNN
                     TIQRFVEVGPSNVLANMAKKTAKGQYAEEDLVRCVDRQYLSHADDAQHIYYQYDEEAP
                     VESADNEPAQPAASSTPAAPAPVAAPPVVVQTAPQPAAQAAVAVPDVDLSAIDVVISI
                     VAQKIRKAFDEVPAAKSIRDLSAGKSTLQNELIGQLDAEFRGLPEGSEDLALEALASH
                     FTNFSGRPGKVMGGHIDRLVAARMPAGFNQAKIRDYLSSHWGLGLNRQTTVLCYAVTM
                     EPAARLADAGQATQFLDSVVSRYGGKAGIALQKRAEGGASQTSAVAQVDLASLETLKK
                     EQNEYLHKQFQLLAKHLDLDGVAQPSQTQVQGEDTDRLAEWDAEFDEEFLTGMRTIFD
                     PRKARRYDSWWNTAREDLMALLHDIRPAAEDKASQRYQSLVNRWSPELEQMLEHSAQD
                     DTTKEKAQMLLDDVRASGVANGPVFRYTQPAMAPETKVDANGRIQYSEVPRRQLHGEN
                     KASTLNYAQVVAARHRDVPYAHLRSRAGVDWKYDDQLTDMFLNILSTGASTGLSFTGR
                     RVLVTGAGVGSIGADIVAGLLAGGAHVIVTTSRQPSDVAASFRQLYAKVGAPGSELIV
                     LPFNQASKRDCEELINHIYDEQSGYGWDLDFIIPFAAISEIGRQIDKIDSKSELAHRA
                     MLVNLLRLLGFIKQQKEKRGFDCRPTGVLLPLSPNHGNFGGDGLYSESKLGLETLFNR
                     FHSEGWSDFLCIIGAVIGWTRGTGLMSANNIVAQGMEDSLDILTFSAPEMAFNILSLL
                     SGDILEVADDEPIYADLSGGLQGVSDLKDKISAIRKKIVSDSRIRQALVAENLHEQKV
                     LRGTKPAEGNVQPPLKRRSNIEPAFPPLSDYNSVTAGLQSLKGMVDLSRTVVVVGYSE
                     LGPWGSSRTRWEMEHEGRLSLEGYTELAWMMGLIKHFDGDLKGKPYTGWVDSKTKEAV
                     DEADIEEKYGQHILGHAGIRVIEPELSEGYDPSQKEIMHEVVIDEDLPPFEAPQGVAQ
                     AFKLRHGDKVILTPIEGSESVKVVVKSGAVFMVPKAMAFNRFVAGQLPSGWDPTRYGI
                     PEDIVAQVDPMTVYVLCCVSEAMYSAGLEDPFELYRHIHVSELANCVGTGAGGLLAMR
                     GVYRDRYLDRPVQSDILQESFLNAMNAWTNMLLMGAAGPIKSPSGTCATSVESMDIAC
                     EAIQTLKAKVAIVGGSDDFQEEMSYEFGNMKATANAEDELEKGYLPSEMSRPTASSRS
                     GFVESAGCGIQLVMSAELALQMGLPIYGIVAYSQMAGDKVGRSVPAPGQGVLTAARES
                     IDAAQSPLLDVQYRKARLDEAVSEIKRWRHKESQKLIASTTSKEFKDLDAHLQHINNI
                     AATRIRDAQWTWNNNIRHIDPTIAPMRAALATWGLSVDDIQVASFHGTSTKANDKNES
                     NVINQQMTHLSRTVGNPLLVICQKSLTGHPKGAAGAWMFNGCLQALQTGIVPGNRNAD
                     NVDVALQQFKHLVYPSQTIHTSGIKAFMLTSFGFGQKGGLVVGIAPRYLFSTITANKF
                     EDYRERVLQRQQKIIPVFQRRMAQGRLFQIKDQSAWTSDQEKDVFLNPQARVAQKSTG
                     EYSFPTTVAPVASSLPARTVSDDKQLFARSSDQWLRDSISKEQGNVSVGVDIESISSV
                     NIEDEIFLERNFTPGELKYCQGSPDKQASLSGRWAAKEAIFKSLQIPSEGAGAAMRDI
                     EIVSNGAQPPTVLLHNRAKSAADAQKVEEVQVSITHSPESAMAIALARRRL"
     exon            432546..432613
                     /number=1
     exon            432661..432687
                     /number=2
     exon            432741..433195
                     /number=3
     exon            433248..437914
                     /number=4
     exon            437963..438079
                     /number=5
     CDS             complement(join(438378..438633,440477..440525,
                     440579..440709,440762..441114,441180..441462,
                     441514..441762,441835..442090,442137..442188,
                     442241..442312))
                     /codon_start=1
                     /locus_tag="AO090010000172"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070317000134"
                     /protein_id="BAE66074.1"
                     /transl_table=1
                     /translation="MTVLTREKKPYFGLTGGWLTFWVTVACATDMSLFGYDQGVFSGV
                     VITRDFLEVHDLVGPEKTKTLSTVTAIYDVGCFFGAIVAFTIGEQLGRKKAILLGTTI
                     MAIGAVLQAASFSLAQMFVGRIILGIGNGINTATAPIWQTETSQLKWRGKLVIFEMMM
                     NIFGFCLVNWINYGLSFVGGSIAWRFPLAFQFFFLIILWSTTPWLPESPRWLIAHGRQ
                     EEATVVLSCLEAKPIDDPFVIAQRNEIEFSVRYERENSMRWRDLCQKKGNDSKTLRRL
                     LLGAGSQFMQQFGGINIMSYYLPTVLMDSVGLSDTMARLLAACNALSYLVFSGLAVLL
                     VERIGRRGLMLLSTFGQFLCFLIITILLRFSRISDNGEKFASASVAFFFLYYGAFGIG
                     MLGVPWLYPTEINSLPMRTKGAAVATATDWITNFVVVEITPIGIKNIDWKFWIVWTVT
                     NAAFLPILYFLYPETANRSLEDMDEYYRSNPANKPDRGRPTDYSKVIGKNHVLLTRTT
                     ARYTGGLWVGKYLKTCTYQEVTSPESSGKLGRLCGRAARPERFEAHARSGDLQANRHM
                     "
     exon            complement(438378..438633)
                     /number=1
     exon            complement(440477..440525)
                     /number=2
     exon            complement(440579..440709)
                     /number=3
     exon            complement(440762..441114)
                     /number=4
     exon            complement(441180..441462)
                     /number=5
     exon            complement(441514..441762)
                     /number=6
     exon            complement(441835..442090)
                     /number=7
     exon            complement(442137..442188)
                     /number=8
     exon            complement(442241..442312)
                     /number=9
     CDS             join(443078..443424,443482..443713)
                     /codon_start=1
                     /locus_tag="AO090010000173"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000135"
                     /protein_id="BAE66075.1"
                     /transl_table=1
                     /translation="MTAESSNLDHTLPSRPTPSKSAAVANNEESKLTALEKAELALAD
                     KYSSPDVYIDREKDTCWHPWLNNLELKPLRFESRTGTFVVVLRSLEDTWLGKHRHRGS
                     VTAVTLKGEWNYKEYDWVAKPGDYVVENPGTIHTLHMSKGAEVVFTITGSLEYFHDDD
                     TLKNTMDIFSYAHLYYEHCKKQGIKPNDGLWY"
     exon            443078..443424
                     /number=1
     exon            443482..443713
                     /number=2
     CDS             complement(join(446735..447738,447789..447825))
                     /codon_start=1
                     /locus_tag="AO090010000176"
                     /note="hydroxysteroid 17-beta dehydrogenase 11"
                     /old_locus_tag="AO070317000138"
                     /protein_id="BAE66076.1"
                     /transl_table=1
                     /translation="MAPQGKRWPSREGFTVDVVGSLIHRTLLSPWKMIPLLALAQYTV
                     KGREILESRPEVLKALKVLASLAVFSRLGAWLDRRSINNGLKDHYDWNREVVVLTGGS
                     GGIGRRVAQLFGDRGIKVAILDIAAPEDSLPSSVRYYECDITSPENIAEVASKIRASF
                     GKPTILINNAGILTGKTILGTTEAITRRLFDVNTLSHYWLAQEFLPDMIASNHGMVVT
                     VASQSGYTVTPSMVDYSASKAAAIAFHEGLAAELVTRYQAPRVRTVLVTQGFTRTTLI
                     SKLSPEDTFLAPLLDPETVAEGIVDQVLTGESGNVLLPGTSGTIAQRLRGYPLWFQHF
                     LRCRLERVMRAN"
     exon            complement(446735..447738)
                     /number=1
     exon            complement(447789..447825)
                     /number=2
     CDS             complement(join(449560..449565,449691..450494))
                     /codon_start=1
                     /locus_tag="AO090010000177"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000139"
                     /protein_id="BAE66077.1"
                     /transl_table=1
                     /translation="MSISDHALGAKFPRASSQPTVVGCPMDLVPLCIGPQSPRQIEDW
                     LYSDRPQFAIHVVLFDDATLVTVTWMHTLTDAMGLAGFFKAWTAVLNGREEDVPEFQG
                     IGETPLQQLGQHIAGETYVNYKFMLKGFGLLSFAFWYFFELFWYRREEQRIMCIPGRF
                     VEQMRTESLKELRHQNKEENAPFVSESDVLFAWWTRAQTRALNPFRSRMITLMNVFDI
                     RAAALPESASQNSALVANAVQTSLTFLRPQQILNQPLGFLASQIRHSLVQS"
     exon            complement(449560..449565)
                     /number=1
     exon            complement(449691..450494)
                     /number=2
     CDS             complement(451726..452472)
                     /codon_start=1
                     /locus_tag="AO090010000178"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000140"
                     /protein_id="BAE66078.1"
                     /transl_table=1
                     /translation="MEKIYLRNYEPVPKADHVEDSGDSDTTLTVRPRRRSVQQYLKRN
                     LATITITGLLLILLLLVIALIAAITLQPVRQALSWEHSSVYSGSHHSGQRQCLPTTPR
                     TRLSCGNSTDEAEALGCTYDPLSACWLHQECPHDYVKEFTEFNNGEPFIYYYDKEMTR
                     QMKDYDEVGRNVNGFYWTSNREHLVHCLYLLRRAHDVHMRGDRLDTMLADLEHTDHCT
                     NMLANWLRRPDPALDELGTQGQTHCFMSCS"
     exon            complement(451726..452472)
                     /number=1
     CDS             454949..456871
                     /codon_start=1
                     /locus_tag="AO090010000179"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000141"
                     /protein_id="BAE66079.1"
                     /transl_table=1
                     /translation="MPEVGFMWGRRHARAKGGSAISQQIETQTSTDPHTGNMAPPSSE
                     PASDKVQRGLTKPTKAEKGKMGHGWKESWKWEAAAATLSVIGLGLLIGFLFRINGTLY
                     ADWQHTASPNTVLSIIVTISKAALLVPVSGCLSQLKWNRYRNSVPLYDMQAIDQASRG
                     PWGALELLWIGLPQLRMDALTLAAAFMTVLAVAIDPFAQQILAFPSHTVQGFNETASI
                     QAAHKYVYQQKLYNNEVSGSLAPSMLSSILSGLAQTNSPLAPQCSSGNCRFPRFTTLG
                     ICSHCEDITSKVNQTCHKSEFIQSLGEPTIQPQEGPHTSCRYKLSNGLEISTDASGSE
                     NNKTSTQTLDQVPNLVTLNQWGTYPQNSTSMTGIEKPIFSFVAVNQSIQIWYMPENIT
                     LSPPKPSFTDCVFYYCEREYSPTHYLANDRASHSVDVSDTQPLLPSDDSTLDGSDYVY
                     ILQPPNGKAALSGASTYKVDAYTFLSIPNVMTKLFNTTTGSGAYWDDFENESTGLNLG
                     PILREADLSQLLQSVSASMTDTMRANPETINVPGQAFRVETFIHVRWPWIILLVCAVL
                     GSLALLLGTATVSKRQHAKLWKASIIPLMTSRLDLLHENEIAGLDNMEDIHRMSKKAN
                     VRMDRDGGQLVFTEKQ"
     exon            454949..456871
                     /number=1
     CDS             457580..458602
                     /codon_start=1
                     /locus_tag="AO090010000180"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000142"
                     /protein_id="BAE66080.1"
                     /transl_table=1
                     /translation="MFRRLTGREKVDGSILSKLKELTQFSQADLKIIIQGLHKTDPAQ
                     YIIDKGYGHTFEEARNEYDTRQLMWKHGVDRQDAKGALEKSNGDINKADQACKELADA
                     AMKNLQIPFVIPTRHTRSAPSVTKNTRVVAVLGADEGLNDPNAASPSLGDGWMVSNFY
                     LWLIVLDGVGKSQQWIIGMDPAYLLDKYGREDEMTMEDIEGNGTVLKPVQTKCAAGFI
                     HGDPFEERKVVLDDYLLPRIRDRVTIGPKGSALRDFFLNQLEETVKDAAQCGDKSSAN
                     DISYGDYDTDGGLLVGVSPFDNEEDIKDAVIRPQYIVSILAQHPGVKLTILYDLMLLW
                     PLGRDC"
     exon            457580..458602
                     /number=1
     CDS             complement(join(459093..459151,459213..459368,
                     459425..459669,459741..460096))
                     /codon_start=1
                     /locus_tag="AO090010000181"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000143"
                     /protein_id="BAE66081.1"
                     /transl_table=1
                     /translation="MSAYNHLPTVDLSLVSNNQHVNILKDTGVNVTNDYGTPNLLFFY
                     FIPFLPDDRKPDLEALQDEIQSWNAWELGQTEVQVRHRIADGSLPSDDATASRVKRTN
                     YRAKVVDHLREVSETTWLVKNADSHSGPFSADVKVAEVNGKIRDVLKDFYGQESLPAQ
                     FSVILNIITDLIASQPDADNRYLFTYVYYYYDVDQKVFKPDIRQLQFSVTQTAAEGEK
                     DTVKLDISNLNHVYSLLREKWRSVRHEAEEIIEAGLSLLCIVLIPISIPRPPW"
     exon            complement(459093..459151)
                     /number=1
     exon            complement(459213..459368)
                     /number=2
     exon            complement(459425..459669)
                     /number=3
     exon            complement(459741..460096)
                     /number=4
     CDS             join(462557..462740,462809..463029)
                     /codon_start=1
                     /locus_tag="AO090010000182"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000144"
                     /protein_id="BAE66082.1"
                     /transl_table=1
                     /translation="MISDMLVGLLDGITGISKTIEDVFSGLANLIFENKNQVQSRTVW
                     SLFHVFLYDKTTDDVRTYFRIINYSVTAEMVEYVSNKTTHQEIKMGFNFNMTDLSLNE
                     NQWDRVKDDVQKFIDDISANQVENPIDGEISV"
     exon            462557..462740
                     /number=1
     exon            462809..463029
                     /number=2
     CDS             join(463645..463780,463849..464108,464181..464205,
                     464255..464807,464903..465035)
                     /codon_start=1
                     /locus_tag="AO090010000183"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000145"
                     /protein_id="BAE66083.1"
                     /transl_table=1
                     /translation="MSMTRHCTPGMALYFVLVAICLFQVQAAVAEPRTDKPAFLSLSS
                     TKLHEEYKDLATGKSLASNPYEFNDEIYYDGEFKSQEVFEKEYPFDVRKDGVNDRDNE
                     YNGGHPYYSASTLPGIGSGSNKNLPYIACQSQVHVLGNNLVNYEQAKGLTSETQANVI
                     PSSTKKSLSFSPPTVMNTEKIIPPYKGIYSVHYKASNGKWAHSDIEYRQLSLEYHDDS
                     KTGSGNGPHNVHYFHLSSWQNRQAVDPEKLQFLINEVDKKFTGQTIIVNCEFGGGRTG
                     VFIEAREMYRATVKAKSTKWFFSSSDDPIQEYTKELRKKRSKMIDSFPQPGSSPAKTM
                     KICAALLPIIGIENVDGTVGWRSQTLCNEPRSVE"
     exon            463645..463780
                     /number=1
     exon            463849..464108
                     /number=2
     exon            464181..464205
                     /number=3
     exon            464255..464807
                     /number=4
     exon            464903..465035
                     /number=5
     CDS             join(470087..470227,470297..470790,470808..470811)
                     /codon_start=1
                     /locus_tag="AO090010000184"
                     /note="predicted protein"
                     /old_locus_tag="AO070317000146"
                     /protein_id="BAE66084.1"
                     /transl_table=1
                     /translation="MVIAVSDLVGSYGARVALVLALVIVLRFLQEMLKVRLLFYRLRK
                     QGLPMPKWNFAAGNLQMLPDLMKRHPKGSQQSEAFTLLSYEFASSDNCFYIDVWPFTK
                     PLLVVNSPDLAVQACQTYALPKPPVLAKFFNPFAGGPSIFTTNGPEWKRNRGLFNPAF
                     STSNILQHTPHIVEEAEEYVEILREHARKGDTFTLDKMTCDYVLDIIGRVAI"
     exon            470087..470227
                     /number=1
     exon            470297..470790
                     /number=2
     exon            470808..470811
                     /number=3
     CDS             join(475523..475708,475893..476543)
                     /codon_start=1
                     /locus_tag="AO090010000185"
                     /note="predicted protein"
                     /old_locus_tag="AO070281000001"
                     /protein_id="BAE66085.1"
                     /transl_table=1
                     /translation="MPLTDVIQSFIAHFGNHWGPPVNATCEEYFESCHAALPEPLDPV
                     YACQKNVKYGEHERHRLDFSRNNSDNLGKFFASNNMIGILGTYRLLPEARFPDGMDDV
                     TSALRWIKANIHEYGGDANGIFAIGQSAGGGHLAMALFSGRLQQQNAMPKGVMLQSAA
                     LLYDLSQEQRRTSMIAYYATHDLDRILAQSALGLFNELVTAETMMPALFVTVAEFDFQ
                     ECLQGNQKFVRAFSKRMKYLPTYQVLPGHNHVSYCLSIGLQGDEVGPRIVEWVRDCLC
                     TE"
     exon            475523..475708
                     /number=1
     exon            475893..476543
                     /number=2
     CDS             join(477329..478729,478807..479124)
                     /codon_start=1
                     /locus_tag="AO090010000186"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070281000002"
                     /protein_id="BAE66086.1"
                     /transl_table=1
                     /translation="MQAYLQYRSMRNDVCRQLDDLPDRARASLRDGMFRPEVTDGLDP
                     SSSQTSSSLYSPRQEPVSHGLSSPLPGVELLEKPDDHENHCEVFLVGWDHDEDPMNPR
                     NFTVTTRVMATLIVSALAFVVSAASSIESAVLRQNSAAYNVSEVVASLATGIFLLGFA
                     AGSLVSGPLSEILGRNIVYTGSTSLFMVFIMASGLAPNIGAQLAFRFLAGVFGCPPLT
                     CAGGTVADLWDPLEKTLIFPLYAILSFGGAVLSPVIASYLGQGTLSWRWTNWIVLIMA
                     GLVLGLVVLFQPETYSPLLLKWKAHHLRQLTGDPRYQSKLDLDRTSLLSRIVTACGRQ
                     FSLAMYEPIILLLALYMTILYIVLFTFFDGYTHIFSDVHDLSQGLTNITWVAMYVGIM
                     LAGLIVPGMYSSMKNALKEEIPSRDDNGNDNGASSNGQSPPTKSPSFNPENRLWYAMI
                     GAPEIPISLFWMGWTDYKNISVWSPIVGSSLFGFGSICMFISSYMYVIDAYEIYAASA
                     LGFMTVTRYCAAGGMTVAGVPFYNNVGVQWTLTILGIISAVMVPVPYIFWKFGKVIRG
                     WSRYAV"
     exon            477329..478729
                     /number=1
     exon            478807..479124
                     /number=2
     CDS             complement(join(479805..479943,479997..480190))
                     /codon_start=1
                     /locus_tag="AO090010000187"
                     /note="predicted protein"
                     /old_locus_tag="AO070281000003"
                     /protein_id="BAE66087.1"
                     /transl_table=1
                     /translation="MKFTAISLLLAASTALASPVNVRSESLKLTGLTAKSSKLGDSDI
                     QFSLTDPNYPEDTQTDCAVKWSTNSTPPLRMLVARTTTTTSGSWAEPKTSTSSLLRSS
                     GFLTQLRR"
     exon            complement(479805..479943)
                     /number=1
     exon            complement(479997..480190)
                     /number=2
     CDS             complement(join(480893..481264,481317..481444,
                     481492..481578,481628..481823,481879..481933,
                     481997..482261,482323..482440,482498..482615,
                     482688..482815,482871..482935,482992..483133))
                     /codon_start=1
                     /locus_tag="AO090010000188"
                     /note="predicted protein"
                     /old_locus_tag="AO070281000004"
                     /protein_id="BAE66088.1"
                     /transl_table=1
                     /translation="MSEKEWNIVIRNNSLTSASRLVFSNLGRASDGSKKLKFRRIERA
                     PYSAFVLKPRKFQPHEISDSEVKIEQQFHIPRFVVADDSYVDTFETKSSVATAMARSS
                     FSSIEAEASIEGGAFGFSAAVSAGFSSSESNALSKQSTAESSTMNITYNFPRVVLHLD
                     EYSLALSDECSQDLIRVKDVNSLIAFHHKYGHFFATRVELGGRLFSSEKFSTLGTSSE
                     SEATKQMKISASASFSSKFVSGSASYSQENGQSGQDSDARRSMQSSISWQAQGGDTLL
                     CNNPPAWCPTVAPFQNWRVIKQEDVIPLGDFIGRIPGYEDVPDRFNKLAEITRRKETV
                     SFRLGLDAWQRADKNKPEYLSLHHAWRIRQEVTQLYTNELTKDPFAAIKGLQSGQWAN
                     YQIPYAIQELYDSGHPGLAFEDNSTDTVYDIEVETLLNQAPALHYGVRYQIFNRKRGL
                     WLRAILFNQNGKEITVLAAGPKHEATLFEFRDQEREGPMRNGDKCCLLVYGPDGRQKG
                     IIALSLRGQNPGEGVDDAKSIGALPYSVPNEGRIRFTVLEMVDQADVPT"
     exon            complement(480893..481264)
                     /number=1
     exon            complement(481317..481444)
                     /number=2
     exon            complement(481492..481578)
                     /number=3
     exon            complement(481628..481823)
                     /number=4
     exon            complement(481879..481933)
                     /number=5
     exon            complement(481997..482261)
                     /number=6
     exon            complement(482323..482440)
                     /number=7
     exon            complement(482498..482615)
                     /number=8
     exon            complement(482688..482815)
                     /number=9
     exon            complement(482871..482935)
                     /number=10
     exon            complement(482992..483133)
                     /number=11
     CDS             join(484926..485319,485391..485644)
                     /codon_start=1
                     /locus_tag="AO090010000189"
                     /note="predicted protein"
                     /old_locus_tag="AO070281000005"
                     /protein_id="BAE66089.1"
                     /transl_table=1
                     /translation="MTTPSYTIRAVEHSDIPALGELLYTSKLALTINRLLFKNWPNEA
                     TQRQNYLGALEGIDVDSPKSRTVVDNDTGEVIGHLALNRRRPVEKLEQSQGETKKPYL
                     PNFFAPEVVTAVLEAVATINEEVKTFDRYEITYIVVKPEYRHRGIGKNLMDYVFNQAR
                     SAGVPVAVNAEPQIYEFFKRYDFHDTKHVDFDLAQWAPPYSGFGIFRLAGLIWHP"
     exon            484926..485319
                     /number=1
     exon            485391..485644
                     /number=2
     CDS             complement(join(488766..489154,489212..489581))
                     /codon_start=1
                     /locus_tag="AO090010000191"
                     /note="predicted protein"
                     /old_locus_tag="AO070281000007"
                     /protein_id="BAE66090.1"
                     /transl_table=1
                     /translation="MVSYDPPFGYSLRVNGSCPERTKQCRATWDGFVACCPSESTCKV
                     SDNNKNPICCPNEADCREPLFRIAHCANASWTMYEHYGLFCCKEEDQGFWTSKKKYND
                     SVGCAKQPEGASHTILNPIVQTISSTTFTYPRIATSTSTATSTSASAPHTSETSTSDY
                     VSSSDDDPRGAIAGIVVGCVAGVALIAALAWYLLRRRRQKKQFGPGSDLQPPPGYRKN
                     PESLPQGELTELPSSPPSQAVHEVHELPETTETR"
     exon            complement(488766..489154)
                     /number=1
     exon            complement(489212..489581)
                     /number=2
     CDS             complement(join(492309..492522,492622..492889,
                     493070..493316,493441..493798,494010..494197))
                     /codon_start=1
                     /locus_tag="AO090010000192"
                     /note="predicted protein"
                     /old_locus_tag="AO070281000008"
                     /protein_id="BAE66091.1"
                     /transl_table=1
                     /translation="MQALQAWDPIKRIKMRLSDRQKKKAEQNETSPTTMQTPPPSGII
                     VPLYIYPLSPTTWDPLYDSISAYPDLHFLVIVNPNSGPGASPLPDANYVREVARLNRY
                     ANVVTVGYIAINYCKKPLQEALEEVQTYATWADDYVKTGLGVGGIFLDETPNLSSPEA
                     VEYLAILQDRIKSTPGLLGNRLVIQNPGTPPDAPLANIGPDLILTCEEPYSRYRSNEV
                     QQRLRQLHYDRARCGFMIHSVPRDDLRPLVHDLRHRAAYLFVTELFATPPVFHVCPVP
                     WKRFPRNNPVRFLMDAFPIVLPTECIVFFGLSSCSVHIEPSGSLRVFLSEHLRERTIK
                     KHRRFFTLEKITTLFPSILLPPFTLGTDKFFVSPVEPQFRFLRYKRSLLRGKVDPVPS
                     FPQSRTVAMGPDAESALQIQNQTQLVLGNGKR"
     exon            complement(492309..492522)
                     /number=1
     exon            complement(492622..492889)
                     /number=2
     exon            complement(493070..493316)
                     /number=3
     exon            complement(493441..493798)
                     /number=4
     exon            complement(494010..494197)
                     /number=5
     CDS             join(496533..496571,496622..497362,497418..499294,
                     499366..501766,501817..503618,503631..504098,
                     504158..504368,504425..504928,504983..505024)
                     /codon_start=1
                     /locus_tag="AO090010000193"
                     /note="predicted protein"
                     /old_locus_tag="AO070281000009"
                     /protein_id="BAE66092.1"
                     /transl_table=1
                     /translation="MQEKTFNRSVSSSWDITVLDPTQEGVLSSLSTQRTASYTLGRLD
                     VRGLANSERASDNDEVIQALEVVSQTLRTHFKQSLDAQSPFNGVLLADFLAHFQPVVL
                     NALVKYINQLGIDVWLELSPPAYMTEQQCRDIDMLPIRGFIYRNATISPDGSSRNYFQ
                     MTEMRTAMRAIASQKSMGGTTIAMWETIDNGVELSHDVIHRTFKWCNYRSARCWIAPR
                     AALCDATVATARTITEEPLGALMWMKGNEVTEAHNVWRSNSKVCQTPCGHDSLYESLQ
                     SFIPDLPAKLSLSPPAKEASIDSQETILDELSWPSRPELTQENPFSVSPAGADYTGLG
                     CFQLGLDCTSREINDLVDAQRHVKDLNLLERIKLEELHGIAGQLRALQKVTNTTASAA
                     FNAARELLGILSSCNGSETDAVKVYVGLHSGFRTRLETQVWGMYDTDTTSGTLNLNIY
                     LSAKTEDRTSTLLHTFMSSRGYSRVECLMAEVALATQTGSLSKTWGLPPRIMHDIEQL
                     TPTEAILFLRRLTASESLEPSALSQKVRAFCEYQLIEAPSFAQLRALSSTAYLGGEIS
                     AEDLVSSRLAWYREQGCWCPEPTVAVALFKEVDARLPAILINGELQLLTQLATVAHTV
                     LQTDQIDAAADLFALSVFCAFRKLALNEVYLEVLDRNPLPNNDMLQASCFAEMYAVGA
                     RCDMYFDMAPILLGKIIASRYREYYDVHQPPRRDDMFTELPTAYASMDIDLDPKGEQE
                     RPSVFYQFTFLGIFAVPALIDIIMLTTVGRGLYLTTFMSNIDKSLATLALMIALILCG
                     GFGGWISSGGNYYLNAMAFPAMSMFVLTRFVAGLAVAFVGGIFAMIGIGVISGFEHGV
                     VFFLYFLMLSTFLMTLSALSVYQIPGFQFQEFDIQGRTVIMMCIPILFISPIITIWVH
                     HDTWVYIPFLWLFLICLLIGARMVISQWNTWYLNIPRITDSDVVNWYLKTSPRDSLPA
                     DVEDIGTTPIPRQALQASVEKERNRHFWTRSTADPLVRKLADGYSATMFLLVWYCRYS
                     RTKLPRPYSPTWNLQLKASVDTMSDMQRGVKLHNAFLHWRHTGGDVWCGILYFILALV
                     DKWTALLTGQSVVGLSNVSSMKYRLATGFGLAYYLMGAVILDAVSQPLWTLANKTTSR
                     AIASLDSLQEAKLDNIRSRRALYWKSLAKFFFLHIWGAAVSLALMWAFEATSDATIMY
                     LAYVGSYSGLLWYQYNKVFTGLLAVIPLALGTVIGFILGILLHIYVPAFAYSSVVSLA
                     SGTWTAALVSLYMTDIWMPLWKKETNAEPTSKNEPPFYTCSALDPSPDLSQTRLSQMF
                     ESISALPADVRYKLQPSQHPGVEVMQILQSQCSSKKSGRVEAAFRLAGGLVSLAADLW
                     QQGETTIELVSAGHLLQDEQKIRTISRSTASGLHIFVVIGPDLVGNEWVSDIRRNCRM
                     IAEAVVQATAECKSGISHNQSLLTELLVADDRDDEQAPVPEGVKRQLETCTGERRRAI
                     CYWQKTLLRHLLLGLECDLDWDKLPKEVRSFLLKRCCGQSCRLSSTQMDWIRSRFSTD
                     ESLGIEEFISRCNLGAELAISVTSFAETLPPNQDLQHAFPDSWSMGAQLPASPNLSDL
                     GFRETVQLALSRLHEKLKTCIKFTVISLVADPEYQRELNYIIRGQPLIFAWPATLILN
                     TVWTICKTLQRFILPLVLLHGREKVSTLYKNMKGRKTVIENNRVMTESLKGPSTGFFE
                     TMPDGTLRLYQYSGRHEERPKDNKHLTAINTYKDTLNLQKREEYSNGSLTNEFIYDYT
                     SVNDGRNAKLPSRRQCISGALSGQVVQYDKRGHIMSGSTMRNGDPVSFQFSYRKHAKF
                     DDELLRAEFVSGHNKIQVAWCMPPRARPDKLNKWIPYPRVTEATFTKESDVYNAKWTY
                     DHKFHPIISTTLNGEPSPTPPMIQDDWYNVLQKPKNCSFLDDNPLFSFSSVKAGFVSR
                     MFGFNVKRYPIPTSLAREHLWKSWKSGKEFDAATTRWMDELLLRSDRVLNPYWRNRDF
                     GRLDAAGKYLDALGDTVLARVDMDPEVSSWTWLAFKMSDLYSFGQGGDARINTRTLST
                     QLQDSDSQLHILALDTATWPNEPGGVSACRRDLVNNLKSTRWHILAEAANDFGVPRFQ
                     IERNVQSLAVVPQWGLDFLNPTHGVFQSSLDSEVAERSFDTRKSDIEQNFIPILTSLV
                     RCARTTHHTRQHIEEATKALIDLNTYFESSRNWNDVWMSDVVKDAWRNLWLADDIDGI
                     MPISQWRTAEHPTLVQLDTALDMWHRCKFLSSTSLPGYKLVDLFVFSVPVPEKIPDIF
                     QASHHFTGATYGVVCKIKRKCALHVWDHSISLREMVTFLSGAISFDSSFVNTTLIHLG
                     RLSCILAEHHADVVLPCAAFFNPGWEAELGTCEGALQHRRAFMRKIDPVVNGITDMEK
                     YKPIETIKTETPTVVMLSHIRYVKDIKTAVMATDVIVNRWGFKDYRLHIYGDMEKTPG
                     YSSECQEIIASKGLRDHVVLKGLGNPSVVLQDAWLFMNSSISEGLPLAMGEAALTGVP
                     VVCTDVGASFCVVTDSKTGKRFSEVVAPNDALSLAQAQIRILALVDEWAPFAEDEEGY
                     QPPKLSLRPSPEEVEQITKRMYAKTEQRRRLGMRGRDNVLNNFSEHRYLREHEQMLWI
                     GKYQSRSFIARERMASSNSSLGFTKERGPLSSAGSSSESV"
     exon            496533..496571
                     /number=1
     exon            496622..497362
                     /number=2
     exon            497418..499294
                     /number=3
     exon            499366..501766
                     /number=4
     exon            501817..503618
                     /number=5
     exon            503631..504098
                     /number=6
     exon            504158..504368
                     /number=7
     exon            504425..504928
                     /number=8
     exon            504983..505024
                     /number=9
     CDS             complement(join(505924..507185,507237..507735))
                     /codon_start=1
                     /locus_tag="AO090010000194"
                     /note="predicted protein"
                     /old_locus_tag="AO070281000010"
                     /protein_id="BAE66093.1"
                     /transl_table=1
                     /translation="MPSELVVLPPSSPLMISAIPPPRPVSVNSLARASVSSSIPYAKS
                     TRSTSAEFQLPDGPIAPPAVPGQLACQSPVDTDMEDVEIIVDAPHPLRPELQFQNLPV
                     EIHEAILDYLFGERAAAFTTTGPGKSPGRSWNKSLRHPRRKVLSNLALISPVWRSLVQ
                     DRIYRHIKIKGTTEELYESARWFRAHPLLASYVRHVEIWIPVWGKRATKNSSSQIPAR
                     RYNDEDMDGAAAHTTMVWDDSDTNHGNDYKYHYASHNATLEEIFYHVQSCFPEARILT
                     LEGGHCKKPPMVRHFRNDPCGFSGQRLPTLPEIRSFVMRGAWNIMRDHRHWHNLSEAL
                     PGLQEWHCAYAKPKVEGYHTIAEILRRLSPSIVHLNISLEGFYSKDSTQTSWLGDGVN
                     PPHLCRLLGDVIPHLESLAFTGKVCACLFQPTRSSLSTWPPKSSKLRSLDLVVKNCCR
                     DKRTSSGLPFLDDFSRITNLHFIRAFERLITGAVHSLNTHQVLNYMRIRFIDLDSACP
                     PLNPYFQLIDDECSGLWSERILDMLHEARPQAHFIELSEGIYPQYGPNHQIVGAVYPR
                     TRPLSIHAATYKIIADVSKS"
     exon            complement(505924..507185)
                     /number=1
     exon            complement(507237..507735)
                     /number=2
     CDS             complement(join(509602..509973,510033..510743,
                     510842..511378))
                     /codon_start=1
                     /locus_tag="AO090010000195"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070281000011"
                     /protein_id="BAE66094.1"
                     /transl_table=1
                     /translation="MGILNVVEDRPTPKSVYNWRVYLLAGIASCGSNMIGYTSAFIGT
                     TITLDSFKEEFGLDKMSSAKVDLISENIVSLFIAGAFFGALLTYPVGHFLGRKWSLVI
                     ASAIFTLGAGLQLGANHSRGLGIMYAGRVLNGLGTGVASNIVPIYLSELAPPAIRGRL
                     VGLYELGWQIGGMVGFWINYGVQKNMEPGHTQWLIPFAIQLIPAGLLFAGALWTKESP
                     RWLFLKDRRQEAMANLCWIRQLSETDIYITEEVAAIDQALEEQAATIGIGFWKPFQSV
                     GTRPKIMWRLFLGCMLFFWQNGSGINAINYYSPTIFKSIGVNSDTIGITTGLFGVVKA
                     VMTFVWLLFLVDQLGRRKLLLIGAITGSICMWIIGAYICVVQPEENPTDHLNGGGIAA
                     IFFFYLWTAIYTPTWNGTPWVINSEFFDPNIRSLAQAATTASNWLFNFLVSRFTEQMF
                     AKMGYGVYFFFAALSFLAFFFTFFLIPETSGVPLEVVDRLFEVKPVWRANETVKAQMK
                     EEEERFRFEIKEGNFDKSEEEHVEDGNETRS"
     exon            complement(509602..509973)
                     /number=1
     exon            complement(510033..510743)
                     /number=2
     exon            complement(510842..511378)
                     /number=3
     tRNA            512564..512635
                     /locus_tag="AO090010t00004"
                     /note="tRNAscan-SE"
                     /product="tRNA-Glu"
     CDS             join(515770..516482,516648..517521)
                     /codon_start=1
                     /locus_tag="AO090010000196"
                     /note="predicted protein"
                     /old_locus_tag="AO070281000012"
                     /protein_id="BAE66095.1"
                     /transl_table=1
                     /translation="MSSVDEEPILEDIFVPQSLLNAVARREDTVEGTHRVASPCYPPS
                     SQTQEIYVQKRNQRTISWATRVSDKRKAPQRASSYSSALEEGRMQLHQDQGPSVPPHV
                     RGITSSLNLNSSDSTPLRFLEHDPFADSSVREPLIERNSRSPYSIPRPGNINRKTLGD
                     SVRSVYNRANLVKIKHQRKYWIRLLIEYAAYTIGAVFIYFVLVGLPLWKGAVYWLYWV
                     MQHKFVFSGGWAIFVFLLVFPTAPNTALLIPCYKSGAIIGRTLEAALKIFPASHIYVI
                     ANGDSATPIDDTEEVCRIYSVNHIWCPVGSKIVAIFIGCHAVKSFRHVLLIVDDCILP
                     PHFPVVVSRLTHKVRCIGYTIKSVGTNSQRGSYCQQAQDLEYKLAGLQRSFAGHIGSA
                     TFPHGAISLWERAFLKDTLQHHPGFSISEDWFMGNSCRRLGGRIQMCSAVFVETTTPA
                     ALFFVDRRLRRGGFGETTVFKQRFLRWNFFVANGIWYNLLYILGSWRLGKWELGAKLF
                     VFQEVCSYLFIKQVPSGSSG"
     exon            515770..516482
                     /number=1
     exon            516648..517521
                     /number=2
     CDS             complement(join(518449..520198,520254..520405,
                     520458..520537,520594..520656,520710..520824))
                     /codon_start=1
                     /locus_tag="AO090010000198"
                     /note="predicted protein"
                     /old_locus_tag="AO070281000014"
                     /protein_id="BAE66096.1"
                     /transl_table=1
                     /translation="MPSRAFDVVCTLTATTGKSHLNWPPLMWILDSEGDLLDGKRVWL
                     RPGQKYLFGRIRQDGVRHAIQHSSISRKHMVIEVSSVKDGDGSRIYAKSEITVIDQNS
                     KCGTAVDGNQIRGESVNLTGDEHTIKLGRYQHLLRIKWQPTVLTFSFSSKELKAKDPL
                     AHVRSRLEDLDIKTIIPYVVGNTTHVVQSKRNTAKGLQALVNGKYIVANSYIDALVYA
                     ATPSDLENLESLSPLEVDFDSAWPDPTEHLPPPGKELVHRPAEAFAPILDRVNLFEGY
                     TFVFGDKAQFDMLHDPIANGHGKALLYRVENEVTTADEIAQFMRNAAGEKGLGSQRDG
                     PGGVVLVRFRAKGYEEWSIELSNQIALQTNQRVIEQSEFLDAILANDASSLCRTLPSQ
                     EPTSIQEASATPASQPASTPVKNVQIADSQAVEEHGQPTKSRSKGPRVRSFVSKMKTF
                     DDGFDINAIPAHPPDDEDVVVDSLPAMDMESSSGQRTQPHSNLQEEEDVLSQLLPGAN
                     AMKRRRAETVQRAMDDSTLRPKEEVHQPKRQKIDVLEAARQHRDAEEDAQRQRREEEE
                     AELQNSLKDIENLKGLAIVEEMEMPARKIADKDSRWDERWNGRKNFKKFRKKGDRNRS
                     RHMIQTVIVPLEEVTRKAFGIGEHYWVSSRKSADNSQTESRREPPASEQDTGESRSQS
                     LARTESEPTALRSQKRSREDRDSDSDDELRFRFRRRR"
     exon            complement(518449..520198)
                     /number=1
     exon            complement(520254..520405)
                     /number=2
     exon            complement(520458..520537)
                     /number=3
     exon            complement(520594..520656)
                     /number=4
     exon            complement(520710..520824)
                     /number=5
     CDS             join(520927..521067,521121..522794)
                     /codon_start=1
                     /locus_tag="AO090010000199"
                     /note="predicted DNA damage inducible protein"
                     /old_locus_tag="AO070281000015"
                     /protein_id="BAE66097.1"
                     /transl_table=1
                     /translation="MEPRRETPTDEVSSTSKGVTDGYATLKYQLLGPSLTKAGQDAVD
                     QQKVSEIIYNASKGSKFFNHEQNRDRILTEKIERILKEKARLENLDLSHDLRRADQLL
                     DELELSRDLSQYIVHVDCDAFFAAVEELDRPELKTVPFAVGKGVLTTCNYEARKFGCR
                     SGMASFVAMKLCPQLICLPINHQKYSAKAQEIRAIFAQYDPLFESASIDEAYLNITAY
                     CTENQIDPEDAVNRMRAEVLEQTKISVSAGIAANAKIAKIASNRNKPNGQFRVPNDRD
                     AILEFMKDLPVRKVNGVGRVFERELDAVGIKTCGDIYSQRALLAKLFGEKAFHFLAQC
                     YLGLGRTKIQPVENYERKSVGTESTFNEMGGKEALREKLWAIAQELEKDLTRTEFKGR
                     TLVLKVKLATFEVLSRQCQPPKAVFLAKDLYTFSLPMLEKLEKEIPNMRLRLLGLRCT
                     NLVSTKKGGIDFFGWATRSKPTVESTSDAVEQEISAEEAFERAARQEIQEDMNDLEKL
                     SQEVSEPNEVDQSEKDPATPSEPQPTYWDCPVCSKPQVADDRAFNEHVDYCLSKQTIK
                     EAIQGASQDAEPVPPKPRKRKSTSQEPVDPRQKRLFFT"
     exon            520927..521067
                     /number=1
     exon            521121..522794
                     /number=2
     CDS             join(523643..523670,523833..525802)
                     /codon_start=1
                     /locus_tag="AO090010000200"
                     /note="predicted protein"
                     /old_locus_tag="AO070281000016"
                     /protein_id="BAE66098.1"
                     /transl_table=1
                     /translation="MFGFSVVGFASSFVFLWLVPPCLQIFVECRNVMSRPPFRPSSPA
                     TMTSDKQTTNGPVAKPFTPSLSAAFNRSTKSPLTPKLANPGGYRTPRRLTPSEHPAST
                     PKPDSESVYLSANITPRSGTRTSRRDGPISTPNMPSNGHCSPSYISASGSTVGKRTDR
                     SPVRTGGKPDPPRTTRAKTLTTEPQRSRPNSVCGAPSNSPRFFHASDARSNPDVDSRP
                     KPAAKPSNPAFVYANGEQEGPSEELNTAPVYKRRSTGFTRSVVGSKPPSASPRLASPR
                     LNASSPRLSDGVGSQVGSQVGSQVSSQVGSQLGPQTGPQFGSQAGTRFDFAPQIVSHM
                     PSPPMSHFPPKPTTPAPRHMKSSSVDSGHGATSPREPLRPSPIIISPSDIKIDASAIA
                     SEPLPGLRPRIFSNGSAASVETHDSSLQSPAKSESGQAKDDVAINARTERKILDLEIS
                     NSSLLAINRTLEREMRKQNAELRRYRRLSRAGRLSVAPSSRSVSGASLGIMAEADESD
                     EHEHSSVQSPEELSELSDEDSVMDEGVLSPDSLAEHDARHRAQDEKKFFIDLAKHQEL
                     LADSQKMNQSLKRCLGWTEELIKEAKKALEYSVHVNDIQLGGRVLAPEEIADLRESGR
                     GLLRASDPQDLSYLPELPDSEPDSELDSEADEVTEAATETT"
     exon            523643..523670
                     /number=1
     exon            523833..525802
                     /number=2
     CDS             complement(526405..527496)
                     /codon_start=1
                     /locus_tag="AO090010000201"
                     /note="predicted protein"
                     /old_locus_tag="AO070281000017"
                     /protein_id="BAE66099.1"
                     /transl_table=1
                     /translation="MSTVSSNHTDKMINKTNPSTTSSSHTWMTARTSDRTSNTQPIIY
                     SSASKTSLPTLTDSSIDDDIEIPSSILSTTTESSLTSFFTPLNPNLISFEDELSSYVG
                     TVTDSWTEWALDPELGFDNSISDNIAPNLDLDIPQTPWEHDNEHGNLIIRGPTILLTT
                     LKQKTVPTFLKKMGYSAPIPLSKNPVVRNFDLNINESKNDSPPWSPYTLSTRLLALER
                     YIEDKPGTKLSTIYPPIETWGRRKVGYRAVWCIDRVFRFHGICIRGFGVDVACVSGLV
                     GVPVVLLQADREAPVRAWRGAVRDVGLAGLWDLGIKMGRDGEGIVEVDVDVDFGCGGL
                     DVDGLFSSSSPRGVEERVRECLVYLGGRG"
     exon            complement(526405..527496)
                     /number=1
     CDS             complement(join(527917..528760,528808..528937,
                     528985..529594))
                     /codon_start=1
                     /locus_tag="AO090010000202"
                     /note="multiple inositol polyphosphate phosphatase"
                     /old_locus_tag="AO070281000018"
                     /protein_id="BAE66100.1"
                     /transl_table=1
                     /translation="MQQLLQSTAALLAFQAVVGDAAPTSSSSAAASGPTGASYPSGFD
                     MSTSWGNLSPYKDQPGFEVPNGVPRGCELSQVHVLHRHAQRYPTSWKLDGGVIEDFAQ
                     KLKNYTKRHDNATVGKGALSFLNEWEYVLGEDLLLVSGAATEATSGANVWSKYGRALY
                     HAPVGVASYDSSLNVYPNGTERPKPIFRTTDQARILESARWWLSGFFGNTGANSSYSE
                     YDLVITHEGTGFNNTLASDGSCPGDLEEGDDSGEKFIPNLTKDALKRLSHFLPSDFNL
                     TANDVVGMFSLCPYETAALGSSSFCSLFTEQEWRDFEYFVDLQFYGNYGFGAPTGRAQ
                     GIGYVLELAARLEGKRIETSDTSINATVDSKPATFPLNQPLYMDMSHDDVIVGVLAAL
                     GLKYFNYGSKGLPDDVAHAVPRNFKLNEVTPFGAHLISEIWTCPEKTNFHELDGALYK
                     NPDLSSTSDTTDVIRFVLNGSPVSQEGLDGCETSINGFCSVEDFLKGVPKLKVKAEYQ
                     YACFGNYTAGHQVGDGRPE"
     exon            complement(527917..528760)
                     /number=1
     exon            complement(528808..528937)
                     /number=2
     exon            complement(528985..529594)
                     /number=3
     CDS             complement(join(530740..530889,530943..532003,
                     532060..532153,532222..532265,532320..532425))
                     /codon_start=1
                     /locus_tag="AO090010000203"
                     /note="molecular chaperone (DnaJ superfamily)"
                     /old_locus_tag="AO070281000019"
                     /protein_id="BAE66101.1"
                     /transl_table=1
                     /translation="MVADTTYYDALGVPPTATELEIKKAYRKLAIVTHPDKNPGDETA
                     HARFQAIGEAYQVLSDEELRKRYDKFGKEDAVPGGGFEDPSEFFSMIFGGNAFVDLIG
                     EISLMKDLTTTMDITMQEMEEEELAASAEEKLNIHEEEAKTAAGTSAEGTAAAAPAAA
                     GSATATDAPASEEKSEKPTPTPSSGTSTPRRYLGQQAIMDKSEEEARMEAAGLSAEEK
                     ELHKKSKKKGALSREQEERLAAYELERKKAREERVNTLATKLVDKISVWTETDKGADV
                     TRAFEEKIRLEVENLKMESFGLEILHAIGQTYIQKGSSFLKSQKFLGISGFFSRLKDK
                     GTLAKETWTTISTAIDAQMTMEEMAKLEERGGEDWTDEKRAEYEKKVTGKILAAAWRG
                     SKFEIQSVLRDVCDQVLGDKKIKLDKRVERAHALVIAGNIYQKAERDPEEEGDYMAFE
                     QLMADAMTKKGKDEKEKKKKEKKSKHEHVEETTA"
     exon            complement(530740..530889)
                     /number=1
     exon            complement(530943..532003)
                     /number=2
     exon            complement(532060..532153)
                     /number=3
     exon            complement(532222..532265)
                     /number=4
     exon            complement(532320..532425)
                     /number=5
     CDS             join(533253..533317,533408..534467,534525..534707,
                     534758..534862)
                     /codon_start=1
                     /locus_tag="AO090010000204"
                     /note="squalene synthetase"
                     /old_locus_tag="AO070281000020"
                     /protein_id="BAE66102.1"
                     /transl_table=1
                     /translation="MRATEVLYYMLRPSQLRSIVQWKVWHNPVHERNVNNETETQKAC
                     FKFLDLTSRSFSAVIKELHPELLLPVCVFYLVLRGLDTIEDDTSIPLKTKEPMLREFK
                     DYLEQDGWTFDGNRPEEKDRELLVQFHNVITEFKNMKPAYREIVKDITDKMGNGMADY
                     CRKAEFEDASVKTIEEYDLYCYYVAGLVGEGLTRLFVEAEFGNPALLSRPRLHKSMGL
                     FLQKTNIIRDVREDHDDDRHFWPKEIWSKYVTEFEDLFKPENRETALNCGSEMVLNAL
                     EHAEECLFYLAGLREQSVFNFCAIPQAMAIATLELCFRNPDMFDRNIKITKGEACQLM
                     MESTQNLHVLCDTFRRYARRIHKKNTPKDPNFLKISIVCGKIEKFIDTIFPQQTAAQA
                     KLKVQGEKSEAEKEKARQEAETRQDLYFMLALMGVIVLIVSIIMLTAAWLLGARFDLA
                     FQELKSGNFRPPAKQIPGEL"
     exon            533253..533317
                     /number=1
     exon            533408..534467
                     /number=2
     exon            534525..534707
                     /number=3
     exon            534758..534862
                     /number=4
     CDS             complement(join(535418..536106,536211..536274))
                     /codon_start=1
                     /locus_tag="AO090010000205"
                     /note="predicted protein"
                     /old_locus_tag="AO070281000021"
                     /protein_id="BAE66103.1"
                     /transl_table=1
                     /translation="MSTTLPTGAKIINGVKTFIPLENNPEVHTHLATTLSVQSLTFHD
                     IFTLSPPPRDLPHPINALIFLAAAPIYTRARSTLQSTLPKYTTTNETDPIWIPQTIGH
                     ACGLMAFLHCVLNLDDGRHLARGSELAKLREELVSLAPGDRARVVYEALFLEEAHMDA
                     ARGGSSGVPGPEEDNGFHFVGFVKGGDGRVWELNGGMPGPLERGVLEDGEDLVSEAGL
                     RLTVGDFMEAAKEVEGGGYGGLGISLVGLVGV"
     exon            complement(535418..536106)
                     /number=1
     exon            complement(536211..536274)
                     /number=2
     CDS             join(538655..539731,539785..540441)
                     /codon_start=1
                     /locus_tag="AO090010000206"
                     /note="predicted protein"
                     /old_locus_tag="AO070281000022"
                     /protein_id="BAE66104.1"
                     /transl_table=1
                     /translation="MAISETAFAYHEPAISTILNQTGFLLVLNLVNVCLDKLVYCGLI
                     GQLFIGILWGTPGAKWLTRDMETVIQQLGYLGLIMLVYEGGLSTSLSSLKANLLLSLA
                     VAITGICAPMGLSFILTELVSATPLQAFSAGAALSATSLGTTFTILSTTDLIKTRLGT
                     VTTGAAMLDDVVGLVLVQIITNLGGSSDSFSAVTVIRPVSVSIGFGVGVWLLCLLGLR
                     PALRVLLAHKHRFPAFTGTVQFYFLVNTCLLVGMVAGATYAGTSSLFAAYLAGVMTSW
                     MDDFFKENSGSGDAGNGNVSSESGTENTSQEENPTGQEKDSNQNDQTTRQQTTSTKRE
                     TPTGSMVYEKYYHEPVTRILVPLFFASIGFAIPITEMFDGKIVWRGVVYATLMTFGKL
                     ITGLWLVRLSSRPISSVLRILKKPFSRVVLFCASPRTGSKKQKKGTTETQQHQDPRNP
                     EDKSQDQPTPTQAHETVTSEQPTQISQPTSTLPPKPRSLYPASILGLAMVSRGEVGYL
                     IASLAESKGIFGTSSSGGSSETYLVIVWAISLCTLFGPICVGTLVKRAKTLQRMRVDR
                     GGEDPLGVWGI"
     exon            538655..539731
                     /number=1
     exon            539785..540441
                     /number=2
     CDS             complement(join(541144..541293,541386..541493,
                     541564..542574,544150..544203))
                     /codon_start=1
                     /locus_tag="AO090010000207"
                     /note="mannosyltransferase"
                     /old_locus_tag="AO070281000023"
                     /protein_id="BAE66105.1"
                     /transl_table=1
                     /translation="MGRFGPTITVKLPQYRERSIRELSVMASLFERPSLVFGAAIVLR
                     AILLVYGAWQDAHSAVKYTDIDYMVFTDAARYVSKGDSPYARDTYRYTPLLAWLLLPT
                     SWDGFFSFGKVLFALSDVVAGWLIAKALTSFYGMSPPRALKYASVWLLNPMVANISTR
                     GSSEGLLCVLVIALLWAVLNRKITLAGVLLGLSVHFKIYPFVYGPSIIWWLDEEREGL
                     KSSSQKQKPEQDDRNLLTHIFNFITPSRLLLTTTALATFSGLNISMYILYDFPFAQHT
                     YLHHLTRIDHRHNFSPYSSLLYLSAAGDIQGSFESLAFIPQLLLSVVVIPIVLAKRSL
                     PGAMLAQTFAFVTFNKVCTSQYFLWYLIFLPFYLPSSSLMKNPRLGITVTALWVIAQA
                     LWLQQGYYLEFLGLSSFVPGLFLASLGFFAVNIWILGIIINDVALEGC"
     exon            complement(541144..541293)
                     /number=1
     exon            complement(541386..541493)
                     /number=2
     exon            complement(541564..542574)
                     /number=3
     exon            complement(544150..544203)
                     /number=4
     CDS             join(548775..548908,548974..549927,549976..550657,
                     550741..551520)
                     /codon_start=1
                     /locus_tag="AO090010000208"
                     /note="beta-galactosidase/beta-glucuronidase"
                     /old_locus_tag="AO070281000024"
                     /protein_id="BAE66106.1"
                     /transl_table=1
                     /translation="MAAFSQYPLSTGWSFKDSDDQSPEAWMPVPVVPSVAHQDLQANQ
                     KLKNPYIGFNELDARWVNDKSWTYRTVFQKPAVAAGSSIILAFDGLDTFATVKLDGSV
                     ILQSDNMFLAHRVDVTKALEAEGDHVLEIDFDCAMRRARELREKDTKHNWASFNGDPA
                     RMAVRKAQYHWGWDWGPLLSTAGIWREVRLEVYSAKISDLWTEVELASDHQTARVSAF
                     AEVDAADSVDSYKASFLLSLHGKEVAREVATLKDKVANVTFDVTQPSLWWPNGYGDPA
                     LYEISVSLEKEDCEIHSVSKKIGIRTAELIQQPDRHGKSFFFRINGVDVFCGGSCWIP
                     ADNLLPSITAERYRKWIELMVAGRQVMIRVWGGGCYEDDSFYQACDELGVLVWQDFMF
                     GCGNYPTWPELLESIEKEANYNVRRLRHHPSIVVYVGNNEDYQVQESAGLVYDYEDKN
                     PENWLKTDFPARYIYEKLLPSVVEKLSPKTVYHPGSPWGDGKITSDPTVGDMHQWNGK
                     SNGVLDWVHTKPSVVWHGTQEKYQIFDTLGGRFNSEFGMEAFPHMSTIEYFVENEADK
                     YPQSHVLDFHNKADGHERRIATYLTYVYLTQVVQAETMMFGYRGWRRQWGDERHCGGA
                     LLWQLNDCWPTISWAIVDYFLRPKPAFYAVARVLKPIAVGVRREHHDWSVTHAQPPKT
                     SKYELWIASSLQKETVGTIELRFLSVNTGLDVRAPILRDNVKIVPNGTTNILEGVIDH
                     KAQPEPHVLAARLWVDGEVTARDVDWPQPFKYLDLSDRGLEVNKVSESGNEQKLLITA
                     KKPVKCLVFEERDGIRVSDSAMDIVPGDGQTVTVTGLKAGDAPLKYKYLGQ"
     exon            548775..548908
                     /number=1
     exon            548974..549927
                     /number=2
     exon            549976..550657
                     /number=3
     exon            550741..551520
                     /number=4
     CDS             join(552279..552406,552585..553185)
                     /codon_start=1
                     /locus_tag="AO090010000209"
                     /note="translin-associated protein X"
                     /old_locus_tag="AO070281000025"
                     /protein_id="BAE66107.1"
                     /transl_table=1
                     /translation="MAEQPTQIHSIFETFRNELDEHHDRRERLIKISRDITALSKKII
                     RKLNAPLPENITKETQSRFTQIQSLFTNALPDLTGPNKWRYQRQLSGAIQEYIEALSF
                     HHYLTSQTLITLPEVRTKLPAEILVTEEDYLLGLFDLTGEMMRFAVTALSAGSVASEE
                     KKMGLSREQNGIVVDLREMRSLFEGLSVSRRHNLIKDLGKKMEVMQGSVEKVERAAYG
                     ILVRGSERPAGWMPDLSGGGDEGY"
     exon            552279..552406
                     /number=1
     exon            552585..553185
                     /number=2
     CDS             complement(join(553513..553691,553799..553899,
                     553972..554117))
                     /codon_start=1
                     /locus_tag="AO090010000210"
                     /note="predicted protein"
                     /old_locus_tag="AO070281000026"
                     /protein_id="BAE66108.1"
                     /transl_table=1
                     /translation="MTMINTVDETSLAASPTERRNSLEKHLLNRPDPQDLKERHILLD
                     TNVAPSIQAARQELDRQRTTDSLKKHLEHRPDREELVERNILPHTNAAPALQAHAREL
                     EKHMLADHLDQKIQNRPQPEDLMAQGILTEDEDPRQPTI"
     exon            complement(553513..553691)
                     /number=1
     exon            complement(553799..553899)
                     /number=2
     exon            complement(553972..554117)
                     /number=3
     CDS             complement(join(555070..555218,555271..556245,
                     556344..556464))
                     /codon_start=1
                     /locus_tag="AO090010000211"
                     /note="predicted protein"
                     /old_locus_tag="AO070281000027"
                     /protein_id="BAE66109.1"
                     /transl_table=1
                     /translation="MSTGRKVFHCAVDETALTTNISEIKKWTTNGAITLVVPLYTLER
                     LHALKRAGSQVAINAREAVRFLDRVTSGKDSTPADRVALQGPMEQYENWSDAEKFFLP
                     EFEEEPEATNGTGAGETPLEKKGPTGRDNKKNGAPDDLSQMLLNKLNFKKDSDAASIN
                     SAGTHSAPASPPSSRSSRTSPECANSHVVENGNGTSNRKVKQTNGHKRSASGSTIPTV
                     PLVLRPLLSALLWRLHSGPDASNAAKSCILITNDRSTQIWAQKFGIGVKNIHQLRTSI
                     QYEEREYKNRCKYVEKTQTQTAEPKSLLSYDDESDEDELVFVPRGRGKGSSRGASRGG
                     SNRKPAASKNTAPPVESTMEIPTQPIDPNSFIRNPGLRGAWPERLGTTIVVAEELLVD
                     QLVVTAEAGGNSGFLDRTAEPR"
     exon            complement(555070..555218)
                     /number=1
     exon            complement(555271..556245)
                     /number=2
     exon            complement(556344..556464)
                     /number=3
     CDS             complement(join(557207..557261,557335..558314))
                     /codon_start=1
                     /locus_tag="AO090010000212"
                     /note="mercaptopyruvate sulfurtransferase/thiosulfate
                     sulfurtransferase"
                     /old_locus_tag="AO070281000028"
                     /protein_id="BAE66110.1"
                     /transl_table=1
                     /translation="MAFAALRHSIPSPTRLLRPTMSTPSQARLQSQCRQVSFSSYLVS
                     PKELSEALKKNPATKISTAPRVVPLCAAWFMPNDPEGRKGIDIFRKHRIPQARFFDLD
                     AIKDAESPYPHMLPTAETFADAMSELGIRRDDEVVVYDTEELGIFSAPRVGWTLRVFG
                     HPRVHLLNNYRLWVREGYPTETGEPQQVERTSYPVPNYDSKLVIPYLELKEIAKEHRK
                     EGAKEVEILDARSYGRWAGTDPEPRPGLSSGHIPGSKSLPFQELLDPETKTFRSKSEL
                     CKIFEEKEIDDSKSIISSCGTGVTATIIETALGEAEYGDPNLRRVYDGSWTEWAQRVK
                     PADGLIKKLN"
     exon            complement(557207..557261)
                     /number=1
     exon            complement(557335..558314)
                     /number=2
     CDS             complement(join(560859..560872,560948..562007))
                     /codon_start=1
                     /locus_tag="AO090010000214"
                     /note="L-asparaginase II"
                     /old_locus_tag="AO070281000030"
                     /protein_id="BAE66111.1"
                     /transl_table=1
                     /translation="MGKLKDYITTDRNGIIENRHQVHAAIVSSDGTLLYSVGDPSRVT
                     LTRSAAKPAQALAVISTGALEKFGFDEADLALMCASHNSEDRHLSRARDMLRKVSAGE
                     KDLRCGGHAALSETVNREWIKRDYTPTAITNNCSGKHAGMLGGARALGAEISDYHLPC
                     NPLQRKVRDVVEELAGLETGPEGVLWGVDGCNLPAPAFPLRNMAKIYAAFAEAADVAD
                     GARNASGKDRDMARIFSSMTRYPELVGGEGRFCTVLMRVFRGILIGKVGADGCYGIGI
                     RASEYTRRLGVDGAMGIAVKIEDGNMGVLYSAVTEVLDQLDIGSSDMRRELALFHHPE
                     IVNSAGVVTGSTAHRFHVCGLGS"
     exon            complement(560859..560872)
                     /number=1
     exon            complement(560948..562007)
                     /number=2
     CDS             join(562801..562983,563047..563116,563122..563515,
                     563554..563791,563846..563908,563961..564064,
                     564110..564290,564334..564468)
                     /codon_start=1
                     /locus_tag="AO090010000215"
                     /note="choline dehydrogenase and related flavoproteins"
                     /old_locus_tag="AO070281000031"
                     /protein_id="BAE66112.1"
                     /transl_table=1
                     /translation="MSGGGTSGIVLAARLSEDDSKSVIIREAGRNLADDFRVQTPALW
                     TTLLGSEADWQLITAPQTELRNRIIKEPQGKLLGGSSGINGLHRSLQAEIHAWSKSSA
                     IDWTWEKLSPYYKKSYTLQLPDEATREHIGLGWVDQNVNGDSGPINISFPAVLQDPLS
                     KAWVDTFKGIGYSLTADPFSGNSIAGYSNLATVDYKTKTRSYAATGYGLPAMQRPGDA
                     GVTATGVKAILQGELSTIKAKKEVILTAGALNTPKLLELSGIGNKAILDQFNIPVVVE
                     NPNVDENIQDYLMSRISSEQEVMQNAMQLYTKHKAGPITIEAKQAYLNRFIPQPEGRD
                     QVIRDIYAADNEPTCSIFVGQELLPGNFLSLGLELSLPYSRGSVHIASADPNVPPTID
                     PRYFSNPLDLDIMARNLLDFLVYGVTNLRVCDASVFALVPPANIMSTVYAVAERAADI
                     IKSDA"
     exon            562801..562983
                     /number=1
     exon            563047..563116
                     /number=2
     exon            563122..563515
                     /number=3
     exon            563554..563791
                     /number=4
     exon            563846..563908
                     /number=5
     exon            563961..564064
                     /number=6
     exon            564110..564290
                     /number=7
     exon            564334..564468
                     /number=8
     CDS             complement(join(565284..567720,567768..568864))
                     /codon_start=1
                     /locus_tag="AO090010000216"
                     /note="kinesin-like protein"
                     /old_locus_tag="AO070281000032"
                     /protein_id="BAE66113.1"
                     /transl_table=1
                     /translation="MAGPQRPSSGLPTRRTTTTRQPTRRLGSLATQRASSPAISSKIP
                     ASGGSRVIKSPSEPASVTAKRKERDLERGINEDTSIHVVVRCRGRNDREIKENSGVVV
                     KTEGVKGNTVELSMGPNAVSNKTYTFDKVFSAAADQLAVYEDVVLPIVNEMLAGYNCT
                     IFAYGQTGTGKTYTMSGDMTDTLGILSDNAGIIPRVLYSLFHKLEETESTVKCSFIEL
                     YNEELRDLLSAEETQKLKIFENESKKGQSTLVQGIEETYIDSASSGIKLLQHGSHKRQ
                     VAATKCNDLSSRSHTIFTITVHTKRTTDAGEEYVSSGKLNLVDLAGSENIQRSGAENK
                     RATEAGLINKSLLTLGRVINALVDKSPHIPYRESKLTRLLQDSLGGRTKTCIIATVSP
                     SRSNMEETISTLDYAFRAKNIRNKPQINFTSKHKLLQEFAFEIEKLKGELIATRHRNG
                     VYMTVDAYEQMTMENESRRIVNEEQRAKIESMESNLRNKVQELFTLTSNFNNLKKDNE
                     DTRAALNDTNDVLEKTEIVLKNTRSLLEEEEMLRKAHQDTESQLYDIGTGLLSTLDRT
                     VGDVHGLHAKLDRKADLDSSNMETWQMSAKEVSAVTEEVDKKVEAFQLQHSQLLESMA
                     AKINDYVSSELSHVQSNQSALSSFGAIFDKAEHDAKTQTCGAHDRMNEVLEEIKDLRE
                     EVKRKVGEGLNGLSAAAARISKEVIGEFTEFHEQLHMSYSTLGKDFKSLFEEMVRHLN
                     EQKMEINRLRLEVQEANLQTVEANRRASSNLAHAVEEEHATAESERDLLLSQFKTLME
                     ESRQRQVSRLKGRLDSVRADISSSGDLLEQATTQHDRQTDEWVFKSEQFAKDVAASRD
                     ELRTKMQNDWELFDQRNVSIQKTTESVHEETVRIVDAQISNMDKQMEALDDFVAKARS
                     QNGEYRDAHISSLDNMASSVRESYSFVHEQLEGVGTRIGQLQEDAAQQQHSLHETTSP
                     LSEEVRKPLTELRNNIHSRPLQEYIVTGATPQKRHYEYPTDLPRTEAHDALISGIRTS
                     RDLTLLPFNGEDHLPGTSPTKGFVYNDTEDEVGNQTPTARITSNTGLREVDANVAAKQ
                     LASSPGDRASVRQSNISIAGKSSEVDTVPESEDSDEPPAKRRCSNPTTTDSKLPKNML
                     TKRMAGMMEGRENVPPPGLSSARRTRTRPAP"
     exon            complement(565284..567720)
                     /number=1
     exon            complement(567768..568864)
                     /number=2
     CDS             join(569095..569149,569418..570886)
                     /codon_start=1
                     /locus_tag="AO090010000217"
                     /note="predicted protein"
                     /old_locus_tag="AO070281000033"
                     /protein_id="BAE66114.1"
                     /transl_table=1
                     /translation="MRSSSSRLISILYHFLSISLGASLHNVLSRVKAHPQTYPAIDIA
                     YSSTDPIREPVTLQLSSNGLRLRFDGPDQRLRLIEVLDFTKIPLVYKNQEVLKGGKPQ
                     ERAVSHQGPSFGHIYHRLFGLSYPGEYRPPTNQSPYGTYVLSYPGVAFSFPLQHSAWS
                     DQCDFVALLSSSAALPATSMAIFQGDSWPEAQGRLFTQEQKYPRNPALAGKNRESVPD
                     EIEEFNILGAGKLEVIRRSSPTSYITLSETTPQDLVAEFGPPDAIYRKHDRRITIHRA
                     AGGGGEDHIHLSPPPGRGINVTDTDQSSNNSGTEDSDEELHQPHNLDPSSLPTECFLN
                     YFHHGFDAFVSYPTTPGPAFPGSDLQDPSPPSPSTQLVVTKIILHGNVPGSYPFNRHR
                     RSRWKIKLDSSGDAVSSETRYDEISERLREVWKGSYTNPAEERALQRPMVLNRGWGDS
                     PESSVEFLGGWEESTGKGQRPGQDSHDGGLGNTELFGFPGLLFEVMKNSAVSCLTVY"
     exon            569095..569149
                     /number=1
     exon            569418..570886
                     /number=2
     CDS             571211..574231
                     /codon_start=1
                     /locus_tag="AO090010000218"
                     /note="Isoleucyl-tRNA synthetase"
                     /old_locus_tag="AO070281000034"
                     /protein_id="BAE66115.1"
                     /transl_table=1
                     /translation="MPELSRSLTRSWSSTLKLPKSTFPARVTPADQAKYLRRCTDELY
                     AWQRRERPADKPFVLHDGPPYANGELHIGHALNKILKDLICRVQLGLGKRVRYVPGWD
                     CHGLPIELKALEAQKGLKDAGGSVSAAVIRKEARALARRTVKEQMKGFRSFAVMGDWE
                     NHWKTMDKEFEKRQLGVFREMVDKGLIYRRFKPVYWSPSTGTALAEAELEYKDDHVST
                     AALVKFPLLSIPSHLAQNPLLQVKDLTAVIWTTTPWTLPANAVIAVHPDLEYTIVQSD
                     THGHLLVAQSRLQYLEHILKEDLSVIIPSVLGSELADRTTYRPLFKGADAEPQPIIAA
                     DFVTADSGSGLVHCAPGHGMEDYEACLSRGITAFAPVDDHGRFTDKAMPSDPTRLSGK
                     SVLDEGNATILEYLESQGHLLSKHRYEHKYPYDWRSKRPIIIRATEQWFADVGDIRES
                     AVKALEDIRFVPASGRQRLENFVKNRSEWCISRQRAWGVPIPALYHRVTGEAVLTKDS
                     VSHIMSVIDERGIDAWWTDDANDPAWIPASLQEASGPGYRRGTDTMDVWFDSGTSWAE
                     IDEPYRDGYPADVYSEGTDQHRGWFQSGLLTFTAHQLAAGQTATRAPFRNLITHGFTL
                     DEEGRKMSKSIGNVLLPQTIMDGTLLPPLKPRKGKKKQTENQGPVYDALGPDALRMWV
                     ASSDYTRDVVIGKQVLQTVNTSLHKYRVTFKLLLGALSDFRLDNQVPYNQLQQADRIA
                     LKHLSEMILSCQKACENFEFYKAVNALNRWANLEFSAFYMEAIKDRLYTYGENSASRR
                     AAQTTLFHIYRHLQEALAPITPMLVEETWEHTPEAIKSQCEHPLKRVVSTPASEWQDD
                     SLETDYQDLVAVHSVIKNAQETARGKKEMGSSLQSFVHIVLPQGVNNSVFQRSLTELP
                     DIFVVSSVTLGTSGEPIPATIAEAEWQYSEEYELPSGQKGTVYVYTPQADKCPRCWRY
                     VVPESQAEESVCDRCEDVVSELDASGAAKAADSS"
     exon            571211..574231
                     /number=1
     CDS             join(576021..576657,576716..576774,576833..578198,
                     578251..579217,579271..579925,579980..580747)
                     /codon_start=1
                     /locus_tag="AO090010000219"
                     /note="pleiotropic drug resistance proteins (PDR1-15),
                     ABC superfamily"
                     /old_locus_tag="AO070281000035"
                     /protein_id="BAE66116.1"
                     /transl_table=1
                     /translation="MASHKKSEDPLVVKDRQEQECESSDSTIASENASEHRSPMGLID
                     EDGIETLNRIASQSSRRRSSVYPPNVPTRTSTLATISENDPAVDPQGPSFDLNKWLKM
                     VLRESERQGREAHRTGIVFKNFTVSGTGAALQLQDTVSSMLSAPFRIGEMMKNRHSPP
                     KRILNEFNGLLKSGELLLVLGRPGSGCSTFLKSLCGELHGLSMSKESVIHYDGVPQQR
                     MIKEFKGEVVYNQEVDKHFPHLTVGQTLEFAALARTPAQRIRDMSREEFAKHITQVVM
                     AVFGLSHTYNTKVGNDFVRGVSGGERKRVSIAEMALAHSPLAAWDNSTRGLDSATALK
                     FVEALRLFADLSGSAHAVAIYQASQSIYDIFNKVVVLYEGRQIYYGPAKDAKSYFERQ
                     GWECPQRQTTGDFLTSVTNPSERKARPGMENQVPRTAEDFEAYWRKSPEYQKLMSEIS
                     HYEQEHPLEEEGDALATFQQKKREIQAKHTRPQSPYLLSVPMQIKLNTKRAYQRVWND
                     ISSTVSTVISQIIMALIIGSVFYGTPDATAGFTAKGATLFFAVLLNALIAMNEINSLY
                     SQRPIVEKHNSYAFYHPATEAIAGVVSDIPVKFVIAVVFNLILYFLAGLHRSAGQFFL
                     YLLVTFIVMFVMSAVFRTMAAITQTVSQAMGLAGILILALIVYTGFVLPVPSMHPWFE
                     WIHYLNPIYYAFEMLIANEFHGRDFICSQFIPAYPNLSGNSFVCSSAGAKAGQRAISG
                     DDYIQVNYQYSYGHVWRNFGILIAFLVGFMMIYFIATELNSSTSSTAEVLVFRRGHEP
                     AYLRTDSKKPDAESAVELSAMKPTTESGEGDMSIIPPQKDIFTWRDVCYDIEIKGEPR
                     RLLDHVSGWVKPGTLTALMGVSGAGKTTLLDVLAHRTSMGVITGDMFVNGRGLDQSFQ
                     RSTGYVQQQDLHLETATVRESLRFSALLRQPPNVSIQEKYDYVEDVIRMLKMEDFAEA
                     VVGVPGQGLNVEQRKLLTIGVELAAKPKLLLFLDEPTSGLDSQSSWAICAFLRRLADS
                     GQAVLCTIHQPSAILFQQFDQLLFLARGGKTVYFGPIGQNSNTLLNYFESNGARKCAD
                     DENPAEWMLEIVNAGTNSEGENWFDVWKRSSECQGVQTEIDRIHREQQSKTQASDKDN
                     ESWSKSEFAMPFWFQLYQVTYRVFQQYWRMPEYIASKWVLGILSGLFIGFSFFQAKSS
                     LQGMQTIVYSLFMLCSIFSSLVQQVMPLFVTQRSLYEVRERPSKTYSWKAFLIANIIV
                     EIPYQIMMGILTYACYYYAVVGVQDSERQGLVLLLCIQFFIYASTFAHMAIAAMPDTE
                     TASAIVVLLFAMSLTFCGVMQTPTALPGFWIFMYRVSPFTYWVSAMAATQLHDRVVQC
                     SPSEMSIFDPPSGQTCGEYMSSFMSMAGGQLSNPNATSDCNYCSVAVADDFLSSVNIY
                     WSERWRNFGLMWVYIVFNIFLATMLYYTFRVKKWNLSGLKERFSKKK"
     exon            576021..576657
                     /number=1
     exon            576716..576774
                     /number=2
     exon            576833..578198
                     /number=3
     exon            578251..579217
                     /number=4
     exon            579271..579925
                     /number=5
     exon            579980..580747
                     /number=6
     CDS             582092..582853
                     /codon_start=1
                     /locus_tag="AO090010000220"
                     /note="predicted protein"
                     /old_locus_tag="AO070281000036"
                     /protein_id="BAE66117.1"
                     /transl_table=1
                     /translation="MPDPNDSEAHRRRRFSMSDALLLNPFHSTHLSRRRARSSIRSDT
                     SDQTTPEQEPTEARPRSSSRSRSLLRLPLTILRELSNTRKRPDLLPNDQATPTNPILE
                     FRGGDTWDLLARDRKSLGLDLFWPIDFSAIDSVQTHNITKATPSKTEATEQKPKENPN
                     NDTDEKEQETETFPLSSLTPLLHFRHLRTLKLTGMMSSYQKYIWQAAWLNPHLEELEL
                     GMALAPSLRRNYVTKWPCIRGGWTLTKERFREPVY"
     exon            582092..582853
                     /number=1
     CDS             complement(join(583882..583963,584017..584151,
                     584217..584704,584753..584819,584899..585065))
                     /codon_start=1
                     /locus_tag="AO090010000221"
                     /note="predicted protein"
                     /old_locus_tag="AO070281000037"
                     /protein_id="BAE66118.1"
                     /transl_table=1
                     /translation="MIDPPAEMIDFFDTLKTKPLPVPTTTPTSVAPVPTVVPGHDLIF
                     QELSKTSQRTLWVVVVLMAISAIVFYILASRAPLTKRVIHNLIAISTTISFITYLALA
                     TGEGITYKHDILTIHNKHVPNTHRDIYRQVLWLRYLNWFLTNPLALINLALLSGLPGA
                     HLLVAIVADWIMLGTGILGTYAGHTPRRWVWFTISAIGYLTTVYHIGVNGGRSAVNKD
                     AQTKRFFGTVSGVSLLIKALFPVAIAAGALALKIGIDAETIIFAIHDIFLQGIIGYWL
                     IFAHDAAPGITLLVDGFWSHGHGNEGAIRITEEEGA"
     exon            complement(583882..583963)
                     /number=1
     exon            complement(584017..584151)
                     /number=2
     exon            complement(584217..584704)
                     /number=3
     exon            complement(584753..584819)
                     /number=4
     exon            complement(584899..585065)
                     /number=5
     CDS             complement(join(585746..587294,587360..587601))
                     /codon_start=1
                     /locus_tag="AO090010000222"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070281000038"
                     /protein_id="BAE66119.1"
                     /transl_table=1
                     /translation="MRFRLPIKPDEIPVDEKQQPNDDEANVTPQSASKEAATSRADQV
                     DDDKSDVVNPEFQHGVQSAQAMTQVWSKQHLILAYVMIWIIYFVKNFAFGIIGTLTPY
                     VTSSFKEHSLTGTTTILSTLIGGLFKLPYAKLIDIWGRPQGFALMIACMTVGLIMMAG
                     CNNVQTYCAAQVFYSVGSAGVDFTLTIFIADTSALKNRAFWLGFVGSPYIATVWAYGP
                     ATEDILSSMGWRWGFGIWAIVTPVMLTPLFFLFYYNQRKAQKAGLVPERHSQRTVMQS
                     IAYYGKEFDVIGLLLLTTGLALFLLAFNLYSKQPDEWKSPLIICFIVIGGLLLIAFPV
                     YERYIAPVTFIPWSLLLNRTVFFTYTMAASIYLAWYLWDTYFYSMLVVVFNQSVTQAT
                     YITNIYSVGSCFWAVLMGILIRYNGRLKWQALYFGVPITILGVGLMIKFREPGVNIGY
                     IVMCQIFIAFGGGTLVICEQMTVMAVSSQQHIPAVLAMESMFINIGSAVGTTIATALW
                     TGIFPQKLAEYLPADAQSNLANIYGDMTVQASYPVGSAARDAINRSYSETQRLMLIAA
                     TCLYTVTLASVMMWKDVNVKKIQQVKGRIL"
     exon            complement(585746..587294)
                     /number=1
     exon            complement(587360..587601)
                     /number=2
     CDS             complement(join(589858..590115,590173..590430,
                     590610..590873))
                     /codon_start=1
                     /locus_tag="AO090010000223"
                     /note="40S ribosomal protein S2/30S ribosomal protein S5"
                     /old_locus_tag="AO070281000039"
                     /protein_id="BAE66120.1"
                     /transl_table=1
                     /translation="MADAAPRGRGGFGSRGDRGGDRGRGRGRRGRRGGKQEEKEWQPV
                     TKLGRLVKAGKITSMEQIYLHSLPIKEYQIVDFFLPKLKDEVMKIKPVQKQTRAGQRT
                     RFKAVVIIGDSEGHIGLGIKTSKEVATAIRAAITIAKLAVLPVRRGYWGSNLGEPHSL
                     PVKQSAKCGSVSVRLIPAPRGTGLVASPAVKRLLQLAGVQDAYTSSSGSTKTLENTLK
                     ATFLAVVNTYGFLTPNLWKETKLIRSPLEEFGDVLRQGKKY"
     exon            complement(589858..590115)
                     /number=1
     exon            complement(590173..590430)
                     /number=2
     exon            complement(590610..590873)
                     /number=3
     CDS             join(591361..591371,591434..591488,591543..591648,
                     591701..592006,592065..592108)
                     /codon_start=1
                     /locus_tag="AO090010000224"
                     /note="peroxisomal membrane protein MPV17 and related
                     proteins"
                     /old_locus_tag="AO070281000040"
                     /protein_id="BAE66121.1"
                     /transl_table=1
                     /translation="MFRWYQAKLAKQPILTASVTSAVLFGSGDVLAQQVVDRKGLEKH
                     DFARTGRMALYGGAIFGPAATTWFGFLQRNVVLKNSKATIVARVAADQCLFTPTHLTC
                     FLTSMAIMEGSDPIEKWRNSFLPSYKANLTIWPLVQGVNFSIVPLEYRVLVVNLVSLG
                     WNCLLSMINSGDK"
     exon            591361..591371
                     /number=1
     exon            591434..591488
                     /number=2
     exon            591543..591648
                     /number=3
     exon            591701..592006
                     /number=4
     exon            592065..592108
                     /number=5
     CDS             join(592918..593121,593187..593258,593321..593788)
                     /codon_start=1
                     /locus_tag="AO090010000225"
                     /note="translation initiation factor 4F, cap-binding
                     subunit (eIF-4E) and related cap-binding proteins"
                     /old_locus_tag="AO070281000041"
                     /protein_id="BAE66122.1"
                     /transl_table=1
                     /translation="MAAVAENGPVPVNDENTAPTVAAPEQKEETEKTNGDNITVFHDP
                     ENFNVKHPLMHEWTLWFTKPPSGKGDNWNDLLKEVVTFNSVEEFWGIYNNITPTSELG
                     LKADYHLFKKGIRPEWEDPQNKHGGKWSYSFKDKRSVPIDDLWLHAQLAAIGETLEND
                     GDSEVMGVVVNVRKGFYRVGLWTRTVGKSIPGDKSSRTPAQGKDVLESIGRRFKEVLR
                     LNEADVVEFSGHTDSAHSGSTRAKAKYTV"
     exon            592918..593121
                     /number=1
     exon            593187..593258
                     /number=2
     exon            593321..593788
                     /number=3
     CDS             join(599569..599662,599739..599748,599830..601105)
                     /codon_start=1
                     /locus_tag="AO090010000227"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070281000043"
                     /protein_id="BAE66123.1"
                     /transl_table=1
                     /translation="MSCPEHRKRAERVIVLCFDGTSNTFQADGTESVRVIAGVGTEIS
                     PTSLSSNPLRRRSKLFSSKLVDSALAVSFDQHVLGGYRFLMRHYRAGSQIYIFGFSRG
                     AYTARFLNEMLDHAGLLSADNEEMIPFIWEAFSSYKLTVGAKNQLEQEESKKTSQFLK
                     ACRETVCREVDRVHFLGLFDTVNSTAEFQVNAEVKPDSEIIRHALSIDERRVKFYPVL
                     IEPKKEYHYRVHRRLWPWSYRGSTTCGQGGGDSGKQDIQEVWFPGGHSDVGGGWDFDK
                     EEDWRLSHGPLVWMVHEAQRAGLHFDKEKLDMLVSSERQEKVDSVDKKSEKPARDSPE
                     DLVKSLHLSSTKGVLHDSLKTGEGTRFWYLMEHIPFRRMVLQLDGSWKPTRWPLHRGR
                     SRDIPKYAQIHVSAIERMKADTTYRPMNVILEGPAVRKGEASAQFEIGEWKVCCHKGD
                     RVREAYVRE"
     exon            599569..599662
                     /number=1
     exon            599739..599748
                     /number=2
     exon            599830..601105
                     /number=3
     CDS             join(601930..602106,602223..602296,602426..602570,
                     602636..602672,602728..602795,602849..602923)
                     /codon_start=1
                     /locus_tag="AO090010000228"
                     /note="inosine triphosphate pyrophosphatase"
                     /old_locus_tag="AO070281000044"
                     /protein_id="BAE66124.1"
                     /transl_table=1
                     /translation="MTDSDNPLILVTGNKNKVLEVKAILGPTATLEVLDINLPEIQGS
                     VEEITREKCRAAAETIGGPVLVEDSALEMRALGGLPGAYVKAFVETIGNEGLNRILSA
                     FDDKSAEAVCTFGYSQGPGHEPLLFQGRLQGRIVPARGVSSFGWEPIFEVEGEGVTLA
                     EMEVGKKNGLSHRFKALVKFREWFLGARRPV"
     exon            601930..602106
                     /number=1
     exon            602223..602296
                     /number=2
     exon            602426..602570
                     /number=3
     exon            602636..602672
                     /number=4
     exon            602728..602795
                     /number=5
     exon            602849..602923
                     /number=6
     CDS             join(606036..606067,606164..606710,606765..607937)
                     /codon_start=1
                     /locus_tag="AO090010000229"
                     /note="H+/oligopeptide symporter"
                     /old_locus_tag="AO070281000045"
                     /protein_id="BAE66125.1"
                     /transl_table=1
                     /translation="MSSDRDVEVTQQQAQYNATHVIDDKDGLEANEKALGPTPDGEEP
                     TQDEIKNLRHIAENLPVSAWLVAIVELCERFTYYGMSGLYQNYANLPLDGSQGRGALG
                     LGHQGATGLTTFNQFWCYVTPIVGAIVADQYLGKYKTIVLFSIIYMIGLLILVCTSIP
                     SSLEHGAGLGGFVVAILIVGLGTGGIKSNVAPLIADQYKRKKMAIKTIAKTGERVVID
                     PALTIQRIYMIFYGCINVGSLSLLATPYMERDIGYWSGYLLCLCMFICGSCVLIVGRK
                     YYVVRPPQGSIITNAFKALWIMVINRNMDAPKPTWQAEHGSRDVPWDDHFVDELKRAL
                     VACKVFAFYPIYWVVYTQFSSNFVTQADQMEGHGVPNDLMQNFDPISIIVFIPVLELT
                     VYPLLRRCHIQFRPITRIALGFIVASLAMMYAAIVQHLIYSAGPCYEHPGCDASIVNG
                     QTTGNRVHIAIQTPAYVFIGLSEIFASVSGLEYAYTKAPPTMKSFVQSMYLLTNAFGA
                     AIAEALTPAAYDPAIMWMFVGLAVASFLAGVIFFIVYRHLNHTEDEMNALDADDDVVA
                     AAQQAEEEKRRKKEESS"
     exon            606036..606067
                     /number=1
     exon            606164..606710
                     /number=2
     exon            606765..607937
                     /number=3
     CDS             complement(join(610086..610400,610446..610648,
                     610714..611248))
                     /codon_start=1
                     /locus_tag="AO090010000230"
                     /note="flavonol reductase/cinnamoyl-CoA reductase"
                     /old_locus_tag="AO070281000046"
                     /protein_id="BAE66126.1"
                     /transl_table=1
                     /translation="MARRALLTGGNGFIGSHILAQLLDHGCTVCCAVRTQEKGDKILR
                     DFATQQSQITITIVPDIVAPGAYDTAVQGTPAFDAVYHTASPFTYANAGSNLQFLEPA
                     IKGTLNLLKAVKDNAPSVKRVIWTGSCASVIDYDNLVADPPRIYTEADWNPVTWEEAV
                     NGDPSKAYRGSKLFAEREAWQFMKEEQPHFDLVTLSPPATFGPLRHSITSIGELNESN
                     SRLWKFCFSSTKDAPVPYMPVHTYVDVRDLAYAQFRAMIVPEAGNQRFVVCARQFDFQ
                     DVCDILRSHHPELSERTPLGKPGTRSLPPGAYSIDNSKVKKFLGVEFRSLEETVLDAA
                     RCMLDIERNEKQALST"
     exon            complement(610086..610400)
                     /number=1
     exon            complement(610446..610648)
                     /number=2
     exon            complement(610714..611248)
                     /number=3
     CDS             complement(612340..613557)
                     /codon_start=1
                     /locus_tag="AO090010000231"
                     /note="tryptophan synthase beta chain"
                     /old_locus_tag="AO070281000047"
                     /protein_id="BAE66127.1"
                     /transl_table=1
                     /translation="MPDAKPYSQSYPDAEGYFGQFGGKHYPPEVQPALEELANTYQEL
                     RQSPEFQRALNKARIGLQGRPTPVHYLETISKQVGGAQIYVKREDLNHTGAHKINHCV
                     GFALLAKKLGKTKLIAETGAGQHGVALATAAAYFGLECEVHMGEIDVSKQSSNVGRMQ
                     LLGARVVSATAGQSALKEASDSAFNAYVEQHKHALYAIGSAIGPHPFPLIVRDFQSVV
                     GQEAREQFLSITNGSLPEHVVACVAGGSNAMGMYSAFLDDRGVILHAVEPLGKSDELG
                     QHAATLSYGKPGTLHGARSIVLQHDDGTPANVSSVASGLVYPGIGPEMAMLHEAGRIS
                     VATISDEEVISTFFRMAKFEGIIPALESAHAVAFAIRLASQRPSSERILVNLSGRGDK
                     DVEYVLQNYGTGQ"
     exon            complement(612340..613557)
                     /number=1
     CDS             complement(join(613962..614906,614964..615032))
                     /codon_start=1
                     /locus_tag="AO090010000232"
                     /note="predicted protein"
                     /old_locus_tag="AO070281000048"
                     /protein_id="BAE66128.1"
                     /transl_table=1
                     /translation="MPKYAKDQPIGFKNTIERVAIVGAGGTVGSHITNTLLKTGRHTV
                     TALSRKDSGNKLPEGVLVAPVDYDDEATLVAALKDQQFLIITMAPTAPRDTHSKLVQA
                     AAKAGIPYVMPNGYGGDIEDIKLGEETLLGPVAKANRDEIERLGMQWITVCCGFWYDY
                     SLAGGEARFGFDFDKRSLTIYDDGNTKNSTSTLSQVGRAVAKVLSLKELPEDENDKSL
                     TLSTFLNKGVYVKSFVVSQNDMFESVKRVTGTTDADWTITHEDTKKRYEDGLALMKLG
                     NMAGFGKMLYARAFYPDHPNDLSKKAQNDLLGLPDESLDEATKVGINMVKELQLRDER
                     MAS"
     exon            complement(613962..614906)
                     /number=1
     exon            complement(614964..615032)
                     /number=2
     CDS             complement(615857..617605)
                     /codon_start=1
                     /locus_tag="AO090010000233"
                     /note="predicted protein"
                     /old_locus_tag="AO070281000049"
                     /protein_id="BAE66129.1"
                     /transl_table=1
                     /translation="MATAIAKRKRARKACIPCHQRKRKCDTVYPCGMCSTYGYNCRYA
                     DDTADNTGGGVLIPSSAKRVSLDSESRLTSRAPTARSPRSRSHMERGSREADGSSTES
                     PTIVAGASPGIFDEQKFRYSGASAAMAFPHILGVALGSDSPPKMRSFAYNFGIRPEEA
                     SNAHGFLGNLISEKDLDFFSGVYFSILGPIGDVIDPRIYAQRCREYYHGSGRNAVAFA
                     AVAAGVAALGSFLSPNRHPRESDLVQYAKAILDDPASMRLHGIDHIVAWGMRVFYLRA
                     TTRPSNAWIASCTQMHLCEAIGLHEEENIKKMASIAGAAVHGHDADRLRRIFWISWAG
                     HIMLSYEYDRSPVHFRAVTCQSIIPVSGSVADQFIQLVQIIPSLNSPFQLEWQSPAPS
                     DELFERLKVLGGLQTTHPFLVVTKADIAFCFYRRLYQLKIRIPDEVIKLVIDSGNAAV
                     EAAEQQASQGRLFWNVIGSVFQYACILLAIDTPAASVHIGAAFKGLENLVKAVDTGLT
                     REALSMARHLLSLNMAKKRKELAQLEAVEANYQFFPAQPASETNTAVPDIDWDVDWDQ
                     FFIEPYLSMLGPDIQV"
     exon            complement(615857..617605)
                     /number=1
     CDS             join(618314..618322,618360..618589,618920..619439)
                     /codon_start=1
                     /locus_tag="AO090010000234"
                     /note="predicted protein"
                     /old_locus_tag="AO070281000050"
                     /protein_id="BAE66130.1"
                     /transl_table=1
                     /translation="MVIDKRLPRLDLIRKAHLELWSWDGSTKLDSDTWDVHITSGRGL
                     KVSFVMSTYIHLSHYRCIRCKEKQVESVKRRTYTTWLTPLSFTPEFTIPVSDICPWHN
                     NQGVVRADYGDQDYHQDHFKQLEGYNAFRAMVFLLFPGLWSKVLGQQVFIADDERDSV
                     VDDLNTATYRLGGIIKDATDRYMFEVYHDAEVAGVVLPDDVLNFLREQKEQSPENEVI
                     GMARSMKFGPTSCLADSAVQEVEDVQRDGRSGDH"
     exon            618314..618322
                     /number=1
     exon            618360..618589
                     /number=2
     exon            618920..619439
                     /number=3
     CDS             join(622744..622821,622936..623520,623572..623772)
                     /codon_start=1
                     /locus_tag="AO090010000235"
                     /note="predicted protein"
                     /old_locus_tag="AO070281000051"
                     /protein_id="BAE66131.1"
                     /transl_table=1
                     /translation="MGKTRKSLCVVLPYVFSVASLICLIFANLTGFGSTLEKKLTGLI
                     SQRSVFDDSLAAVAETTSDVSSTLQDTSNTAQNEGNDAIDGVMEAVGNAVDEAKNQAQ
                     DVSDKLAKIESNIERFYIIGLWGYCQGSFNGTGSTVRKCTPPSSSFWFNFTEVLGLES
                     SWAEKIFPSEVEKVVGVYKVASKGISATYITALTTTVLTLITGLTAIVSGWGSCLISI
                     CAMISMVSNIAGSATVTGVYVSLVGVLESVFYSAGINASLGQKMLATSWLASSFSVVA
                     CIFWLLSICCC"
     exon            622744..622821
                     /number=1
     exon            622936..623520
                     /number=2
     exon            623572..623772
                     /number=3
     CDS             join(624699..624843,624861..625434,625789..625837)
                     /codon_start=1
                     /locus_tag="AO090010000236"
                     /note="predicted protein"
                     /old_locus_tag="AO070281000052"
                     /protein_id="BAE66132.1"
                     /transl_table=1
                     /translation="MALLSKREIIEFRPIGDGLNAFRDEFVSTCRSSGLPCSVQSVHE
                     LDHDGQMTVSNRELALQSLCIWLILALQALPASRALPPVVGAHKNLFNDLSRLCSSIN
                     SDEFNLERLLPLSIAAFNREFDEVIWDKLYAAAAETTPPHPRPPPYVEQMPYSCSTSM
                     ISNSHERRDDIDPVLKKELGSIYTDVPGFEEAFFGGVKDLEKAGTAVFHRFIEGDDPL
                     YRETAGWRDWPQSAEEKQVLDCKKSFAGSRRSKRSNA"
     exon            624699..624843
                     /number=1
     exon            624861..625434
                     /number=2
     exon            625789..625837
                     /number=3
     CDS             join(626614..626769,626817..627040,627235..627334)
                     /codon_start=1
                     /locus_tag="AO090010000237"
                     /note="predicted protein"
                     /old_locus_tag="AO070281000053"
                     /protein_id="BAE66133.1"
                     /transl_table=1
                     /translation="MPVSSPLKAAAKTAAAKVRSKVSRSSHEKYAWLYAPPATKDDIN
                     PVVECWLKDQGNLDYVSGVTGGTFRDNPLENVVESFAIVWTKNSGTIERPFPGKYLLI
                     VGLEYVDQNNGLPILEETTSLDHGEMRTRNSPRAVWPTHPKFHMPQRMQFAVSSFVG"
     exon            626614..626769
                     /number=1
     exon            626817..627040
                     /number=2
     exon            627235..627334
                     /number=3
     CDS             join(635965..636535,636586..636686)
                     /codon_start=1
                     /locus_tag="AO090010000238"
                     /note="predicted protein"
                     /old_locus_tag="AO070281000054"
                     /protein_id="BAE66134.1"
                     /transl_table=1
                     /translation="MMHWYQPSHLSLQPHNSYPETLFDYGQCLENLQLYTTYISNHER
                     PQVLNPYYISDAFEMCQAAIDKASHLNREEDLNAASVLLTITGHSLWEAQQKQFPEPV
                     DIQDYNQWTTTENDSIGFWQNFNHCWLKLGGNISKTLWQTTHMDRNAKESLEEWLKQL
                     ADHVINVSDFLEGFGLVDYERGIWEDDILSCFEDCFEALEQIGTTPFNSQGSYDGAGA
                     QIIQH"
     exon            635965..636535
                     /number=1
     exon            636586..636686
                     /number=2
     CDS             join(637379..637645,637719..638096,638171..638182)
                     /codon_start=1
                     /locus_tag="AO090010000239"
                     /note="predicted protein"
                     /old_locus_tag="AO070281000055"
                     /protein_id="BAE66135.1"
                     /transl_table=1
                     /translation="MPFRGFWDFLQEDNEDNIEELEKMDNKGYYVIASKPAPNGTFVQ
                     QVKESVERNNRHGLSDPGTECFFDWRTYGVPTKKLWIQFMNFGFNLDINLVARFGRDH
                     DLMIQGPFIISHFVAGKHKREDESQLRRAHPCSDGISIWRPLGGKVGPENGMFKVYPG
                     SHNIESEQELRNSGLHADEIHLHADQILITAGGLWIEYNQSKGGILMWMGYSEDLWRA
                     "
     exon            637379..637645
                     /number=1
     exon            637719..638096
                     /number=2
     exon            638171..638182
                     /number=3
     CDS             complement(join(640101..640115,640185..640416,
                     640473..641846,641915..642027,642123..642677))
                     /codon_start=1
                     /locus_tag="AO090010000240"
                     /note="predicted protein"
                     /old_locus_tag="AO070281000056"
                     /protein_id="BAE66136.1"
                     /transl_table=1
                     /translation="MGTPAFPQPTRHMHIVPSSNFHVASHLTETDNSQWRHYPYNEGN
                     SAGKRRVCVVLPSPIPHGDPAMANCKLPLPLDDPCDRQGDSHSQRHAPMEAHQPFRGP
                     MNEKPFDPARHAALPEYQPQVYFPQEPRSNSDAPAPLRPHSKPPAPCSTLVIPTSHAL
                     ASYDSGSYQSQTYGTRQRKGARAQQACDNCRTRKAKCDEGRPSCSHCKDNRLGCVYRE
                     FLHPKYDKGTQLLLDQIQSLEKEVMSKFDHLDQWNTEYGSQFSIVQAKIQESSAPKAP
                     RTSIAPESKNDSLDMLQRLKAKDDNIATAQKQLPEWSGAATDQHIRPGKDDELSIPVE
                     HTTAAHKLLLWPSIQNLLLPRRYDDDYITKLEEQRGLICVYGRGEGDETSEDNSPSAA
                     PTNSSTGCDEDEPYYVAASPGDPWGVEAKQEQAKLANKGIDEKGILTINADDVHCYHR
                     SYMKHIHQLHPFLGHGFLENMINRFIRINCPQTCFAANSEVPNKHANKFPRGRKRKHL
                     YEDFKGTGCDVQFHAGQESYQRIEYSVHNAIVLLVLALGSICEANPVPGPVTDYTVDF
                     RQEMIPGPAGSDYGPHPQGSNYVTLPPLTGGRRTGTGKLPRPQDNQNLKNIDVIPGLA
                     FYAYATQILGSIQGSNGLLHIQAALLAGLYTGQLAHPSQSHGWFHQASRACEVQIRSK
                     RYRQMPDGPVKDLYDFAYWTCLQLGRYDGSCDLPIPFTPLYNIFHILILCLAKYQQSL
                     TFLLVVYRDYKILFLYQRLKFI"
     exon            complement(640101..640115)
                     /number=1
     exon            complement(640185..640416)
                     /number=2
     exon            complement(640473..641846)
                     /number=3
     exon            complement(641915..642027)
                     /number=4
     exon            complement(642123..642677)
                     /number=5
     CDS             join(647726..647922,647969..648161)
                     /codon_start=1
                     /locus_tag="AO090010000242"
                     /note="predicted protein"
                     /old_locus_tag="AO070281000058"
                     /protein_id="BAE66137.1"
                     /transl_table=1
                     /translation="MSQVTPGAVVLSAYWDTERELWQSEKSLVQGELVICNLEDSDSG
                     EADLSQPFDIRWQTFSPNEDIFGEEVTARVTMENGELKSQIIELHPLLKTPELLRELQ
                     DNPNIGQHKLMIKKANHDSELVTCHCL"
     exon            647726..647922
                     /number=1
     exon            647969..648161
                     /number=2
     CDS             join(650785..650920,651009..651224,651456..651466)
                     /codon_start=1
                     /locus_tag="AO090010000243"
                     /note="predicted protein"
                     /old_locus_tag="AO070281000059"
                     /protein_id="BAE66138.1"
                     /transl_table=1
                     /translation="MAARLSISLPRSILMRFAYWHNLGRNSSTDMTVAGFEWSYDQVI
                     YYDSLVVGGHFYTSAHLPSTLEGFNLLEQKQGISNESLEDSHYETLAEIFSSYDKVAT
                     PEEVKRVWVTCDLFLGLF"
     exon            650785..650920
                     /number=1
     exon            651009..651224
                     /number=2
     exon            651456..651466
                     /number=3
     CDS             complement(join(652787..652840,652894..653437,
                     653448..653601,653647..655562,655604..655822,
                     655889..655980))
                     /codon_start=1
                     /locus_tag="AO090010000244"
                     /note="predicted protein"
                     /old_locus_tag="AO070281000060"
                     /protein_id="BAE66139.1"
                     /transl_table=1
                     /translation="MSSGTPIGSGPVVSMTPPYRCWAPAPLCQTIGEIDFYTDSPKDY
                     DRLARHRKAWTWLLPHHKRVQVVSNLFTILFHGVPRDWFSKQSPENSEAGEAIIKAMT
                     PSNAVGKKWKGSLMVSLHRAEDANRLLRGLFYLRSQTLRTELFDPSGRLTQCLQCQRY
                     GHVQRGCTFSIRRLYCGEQHRKGDCPQTKVTPDRFTCATCKGPNLAYEKMCPTRLQAA
                     AEADYTRKHKPKYFPEPARPVTSLPIGPPPLTSNPSGDSEQPEEPEPEPAESSAETRK
                     KAKKVVETSLTTTPTPLPEGAQRNLRRRAITYAHEVCLVNSATSDHSESTEPESDQRE
                     PSGTISQADSSEQSEESNPSGRSDTDAPSAPKNSELDRDANLEIPDREEVQQCSALDT
                     DTRPEQQTPISPFSSPKKRRSTRLQEEPIKRRKTTGPREIPQPTPEQWRNPSRLDPQA
                     ESRTCRSYVGIGTDRQLKTTDQRKTHQTKCPQGARGGDGADRRVPSSAPAPARLRSTR
                     NATRLTGAYAPPLQGPSGLEFTAQAKAKLLSQMFFPPPPPVNLDDIRNYKYPEPLQNP
                     GITQSEMLQSINRPREDKDPCPDDITDRFLQVTADLVALILTEIYNESLRQVHCPTHF
                     RKARTVALRKPGRDGYSKPKSYRPIALLNTIAKVLEGIMALRLSYFAEEYKLLPDNHF
                     RGRKGQGTETALHSDGNHQQSMETRPNRVSTAPRQFRSLRQRLTPTAPAQPPQTTNPI
                     RNQLPEVSCPESMIDTGIPRRSPVSPILYLFYHADMINADEETKTSDTLTTLQWPGTG
                     GKLLNSTEGLSQYLRTVVTDTRLGVVLDRQFDFQTHLQQIDTKCSQGLRAITLLGRSK
                     WGPSLEDKRQVYNACVTPVALYGASVWQHPGAPKKKGMHDRQLRSLVAIQRRAGHSIS
                     GGFKVVSRDAFDAELHLLPITQRLRRNRLTALTRIAATPAYQRILRQRAFSQNQALHS
                     ALEITTAFIVPRGGNYPMWR"
     exon            complement(652787..652840)
                     /number=1
     exon            complement(652894..653437)
                     /number=2
     exon            complement(653448..653601)
                     /number=3
     exon            complement(653647..655562)
                     /number=4
     exon            complement(655604..655822)
                     /number=5
     exon            complement(655889..655980)
                     /number=6
     CDS             complement(join(660102..660105,660312..660616))
                     /codon_start=1
                     /locus_tag="AO090010000245"
                     /note="predicted protein"
                     /old_locus_tag="AO070281000061"
                     /protein_id="BAE66140.1"
                     /transl_table=1
                     /translation="MVMSIVTSDMPRLPGISVKADLGVTDSEAHWIIAFVAYDARNEL
                     DDCIYATFTEDILNWTRKHPKLILKTIEFEVIASCHSIEDVKPRLWYPGHTCCSASWA
                     "
     exon            complement(660102..660105)
                     /number=1
     exon            complement(660312..660616)
                     /number=2
     CDS             complement(join(662064..662119,662206..662506))
                     /codon_start=1
                     /locus_tag="AO090010000246"
                     /note="predicted protein"
                     /old_locus_tag="AO070281000062"
                     /protein_id="BAE66141.1"
                     /transl_table=1
                     /translation="MDFLSRQKGLCLKRLHAPKALLSNVGLCNDYLTVLRRGESLAQY
                     LGERLFINYMEERLNNLLNSPDHPISIHDSEGRTKHVRWAYLLRHLEPDQFEEEGGVP
                     RAMANIGRCAKGTGYY"
     exon            complement(662064..662119)
                     /number=1
     exon            complement(662206..662506)
                     /number=2
     CDS             complement(join(667597..668777,668829..669147))
                     /codon_start=1
                     /locus_tag="AO090010000247"
                     /note="predicted protein"
                     /old_locus_tag="AO070281000063"
                     /protein_id="BAE66142.1"
                     /transl_table=1
                     /translation="MVAKDPTTLYIRYVQAQMLKHNNKSYTLPKKYVEEGRVLDDQHE
                     KHLQSVIDAQISRILEESNDKILDASEISKEPENLKGNLQLLVDGFQYRAQEKGDEAH
                     RALEKLQECATTHDMELEYDQKITESGTEGVLPKDKPGDKPGDKPGDKPGDKPGDELE
                     DESEDESEDESGTKINYLFDNGSAKGLWRRNGYSCPKKGRFRLLWQETTARESNSKYA
                     VDGRQCNFGVEKYNEEKRVFYREIVSAAKVADLLEIWKTGNSSKKKMILTVGTQRKVY
                     STKTSGRVTVFHWCAYMEGAQRDQNKARRTPVLKCCVEFEKEDGPQIVPLSNLEKLED
                     VSTLNKIFIWTCKTDGLPLPSKWTPKEWKEKNRAYYDMGDDRERLRGAPVMWRDVKEE
                     IYEEEGIAKSVPNGRSVMGGEGEPIYNQHIMQTVVGMLDKERVRTDARFRQIEGNVQG
                     VTNTLNEHGEYLQLILGLLKGKTTTKDAGAKPKEEEEEEEEEEEEEEEE"
     exon            complement(667597..668777)
                     /number=1
     exon            complement(668829..669147)
                     /number=2
     CDS             join(671707..672329,672412..672496)
                     /codon_start=1
                     /locus_tag="AO090010000248"
                     /note="predicted protein"
                     /old_locus_tag="AO070281000064"
                     /protein_id="BAE66143.1"
                     /transl_table=1
                     /translation="MEENVILEDQETVKHLEVLSGCREVSVSPPLTSAENTIHSSLGK
                     TYSHSKCSCGECIAGFLSPRMRVFLEWHANRWWCFLRDNIEEGEAWTRLNAENLIFAS
                     RGLQQELAQRRAMREGFAGISGFIAACLSCNTIPTEENVKKAIYTEEFPQICLDYISR
                     GGTISPVASIIFKEASSENNWLDYDLFQTEYEETMMQLPACRNDGEFTFLFDIAFHNM
                     LYNVIPKPRCCSNLKHK"
     exon            671707..672329
                     /number=1
     exon            672412..672496
                     /number=2
     CDS             join(676628..677588,677714..677784)
                     /codon_start=1
                     /locus_tag="AO090010000249"
                     /note="predicted protein"
                     /old_locus_tag="AO070281000065"
                     /protein_id="BAE66144.1"
                     /transl_table=1
                     /translation="MPALTREFRTEQDPDINYNQDLPVQNSVCFGNYPLNLDMPTNRA
                     PMPSLIPEFRTEWNDGIDYNQDLPVQDNTPFGHCPLDLEVDPILEFVNLSPQPEPTMD
                     IPGHTPSAEISHSPLQDSPQRSPFKPVEQSRVTASVSTPSSPLEKAKTKVSKRYHKGL
                     EIMYEKGMEETGQTNPDKIAHSIHASYSIIRSDLEIFTENILHTWLEKGLWPQTAPSA
                     SDELWDQCTIDMMQLEIEQDPETKAIMRRVAQIRMYYWHEEEKKKIEKSPNFVKADSE
                     KSLHARASDAFFRYYTTIWDKTDDKSRKIAREKFDIEIETGKKWLKISRPGKCACFLA
                     LSSIATRGF"
     exon            676628..677588
                     /number=1
     exon            677714..677784
                     /number=2
     CDS             complement(683276..684034)
                     /codon_start=1
                     /locus_tag="AO090010000250"
                     /note="predicted protein"
                     /old_locus_tag="AO070281000066"
                     /protein_id="BAE66145.1"
                     /transl_table=1
                     /translation="MSPRIWTAPMTFHHLRQLHISCIEHEPGLCVLPALPVLETLALN
                     FCCYCLECPRQGQGPCALLQFQRLPQLRSLSIAGAQRKSISWCGRAVRLRKLEIEFSS
                     GLDLHQILASLGWDLEELHLLDCEFVAEVPRPVVAFPALRRVQLLESISGLAAFGSAE
                     VPSSAEFTLRISHNDLDGLADWSLVWRLLQRCSVLLSLPRSGIHQWPPASTSRLSQVM
                     SLPQVRVEGPPWSADITKGRQDIPSGRREIQHHG"
     exon            complement(683276..684034)
                     /number=1
     CDS             join(685373..686051,686382..687112,687211..688689,
                     688791..688802)
                     /codon_start=1
                     /locus_tag="AO090010000251"
                     /note="helicase-like transcription factor HLTF/DNA
                     helicase RAD5, DEAD-box superfamily"
                     /old_locus_tag="AO070281000067"
                     /protein_id="BAE66146.1"
                     /transl_table=1
                     /translation="MDATQTAAAAATEGRADPLSWPDSGSPTWPSIRSNITRPDTFHG
                     QQSLTLGQHLPALSLPLKRHIYETDVFAGNMAPPKRRRMEDHPSGSATDYAPTVAGAV
                     PQSVAWRPAQTPPSAMHEIQAPSLTSPSAAPWYAMAPSGTSRRNMSPPGVPNSIYSSQ
                     LTPQHPMAAASPAELTLYPHPPTPSSHALEAVPVGSVDGPVWVTTPNQAFESSECTYN
                     TTAPFGVAEPWDVVSPADADTPAANETMAALDPCEGATGALTVPLMEHQKQGVRWMTA
                     MEKSHHRGGILADDMGLGKTVQALALIAAHPAQHINRHATLVVTPASLIQQWKHEIEQ
                     FLRSSPHRQRVYVYYGDRRGKAIPVLNGYDIVLTTFGTITAELRRTGPRQHARNLAGP
                     HRSSPLFGPASGWHRVILDEAQCIKNDQSQTAAACCALDATYRWCLSGTPVMNNLREL
                     YSLLKFLRVQPYASRQSFATAFQQPLQTRGSPQRAAATARLRRLMDTIMLRRTKTSTI
                     QGQPILQLPVQTTEIVYVTFTEPERELYTALECHTRLQFNHYLSGGNPSRNVSHMLGL
                     LQRLRQACCHPFLVSDFIPDTLDASGNDGHRAANAMRFSPAVVQRLWDNERENGREFE
                     CPICYDSVDNHVIFFPCGHSVCVKCFARIFPQVPTARPRVEGNPPMCCPSCRVVIDPS
                     KATDHTAFAKQHYPTPPGDVGTETLSTVLENLRGRVEDDRDDGQDLMLGMPAGAEHAY
                     PPVQFHMNPTPTIHAPKRSFARLRQRALTSPAAKQKYHQILAETWISSSKIDRALEIV
                     RDIVARGEPGGEREKVVIFSQFTSMLDLIEVPLARHGWAFRRYDGTMKPADRHAATVH
                     FATDPDCLILLVSMKAGNSGLNLTAASQVIILDPFWNPYVEDQAVGRVHRIGQRRPVH
                     VHRILVSNTVEDRILDFQDRKRQLIEGIVDHRTHGEPSRLESTDFAYLFGLP"
     exon            685373..686051
                     /number=1
     exon            686382..687112
                     /number=2
     exon            687211..688689
                     /number=3
     exon            688791..688802
                     /number=4
     CDS             complement(join(694668..694710,694719..695453,
                     695513..695736))
                     /codon_start=1
                     /locus_tag="AO090010000280"
                     /note="predicted protein"
                     /old_locus_tag="AO070235010002"
                     /protein_id="BAE66147.1"
                     /transl_table=1
                     /translation="MKLSIPLLSLLATSQVTLAAPAATVDVAELPSDTILDIRSSNPS
                     DEALAVLEQRATRVCEILDRTVRTIGTSKFTVVYIVMGSRLARQVCEYAGGSRCEELS
                     YIISDGLLLAYTAAAHYSGSIPEGLPGKRDVDDSQDYLQMWETMLSSSDDISYESLSP
                     LSISSDTIALARRQDEPLPTHRFQITGFAVDDSPKHDIIANHYENGETVLHLPLLRGD
                     SGTTNTEGSNLQKRFDNPGFKIAFTTRERSKLTQAHQKSMALAGAATWAVYADNANHK
                     MDDFIGFAETEHAANFYYRIIPEIKGFGTNYETVDICGGMASYLFCIFVRSMSRGTH"
     exon            complement(694668..694710)
                     /number=1
     exon            complement(694719..695453)
                     /number=2
     exon            complement(695513..695736)
                     /number=3
     CDS             join(698294..698680,699087..699380)
                     /codon_start=1
                     /locus_tag="AO090010000279"
                     /note="predicted protein"
                     /old_locus_tag="AO070235010003"
                     /protein_id="BAE66148.1"
                     /transl_table=1
                     /translation="MDQQIASYKFSSNDRQYVPNYPSLPPSLSLTGPHLVIRTGLSVG
                     TRRLLSSSSPKAPCLQLEIELCPLLQYTLRRATPDDDPRPFVFVWSPLNEGYHQDGFI
                     LLRHTSDGKLERVSVPDAIQDPIDIVHTGRPGPERRALRSEYHCPRRKHSASLHVRYQ
                     GSPTDRPIIFRNHVIWDMFRSYRLEDGLWELQEGPCGCPGLFLDDPDITVNVAEDEGF
                     VTLKPGEC"
     exon            698294..698680
                     /number=1
     exon            699087..699380
                     /number=2
     CDS             complement(join(701794..701845,702033..702403))
                     /codon_start=1
                     /locus_tag="AO090010000278"
                     /note="predicted protein"
                     /old_locus_tag="AO070235010004"
                     /protein_id="BAE66149.1"
                     /transl_table=1
                     /translation="MVCGANVADTRPKFDTLARQIFSRRPLWQTILGQSWGWVTAWMA
                     DSRYDSAVLDRTVQDGFGRDRRLFDTTKPLVSGIRVALTASQVEDGSLCLFSNYRAAG
                     RPRMSSAYRALVPEQEPFLWEIGSICGKGGRRGRGHPY"
     exon            complement(701794..701845)
                     /number=1
     exon            complement(702033..702403)
                     /number=2
     CDS             complement(703133..704128)
                     /codon_start=1
                     /locus_tag="AO090010000277"
                     /note="predicted protein"
                     /old_locus_tag="AO070235010005"
                     /protein_id="BAE66150.1"
                     /transl_table=1
                     /translation="MAAWLGLEHDEGGWAITDNDAMRRVINGMDCPANQHPSIALFVG
                     HTAKAQALRSLYPHNNTGRHRKQGWAQLHLSGAATSHPVIVIESSLSRTSPPGPSQQE
                     PLRRYPIPRTRGRSYEDLQSLLYRDVLLPIVDTVCVFAADCGGIRHVQHLLASWGSLP
                     PTGLDGAAASVRPRWVIVLTDPDDDAVPAGGIETTLQATAVPHLAGSVAVVDLRPRQP
                     LSRLSRFEPLRRRLSLELDEVRTLRANAHLLFSALHLEWIFRGLLRHVAQGPASPFNC
                     IQACRPQHLDADEVAQYLGIFLQLAEKTQIADPFMATFIASAFLMDAYPPGMHSE"
     exon            complement(703133..704128)
                     /number=1
     CDS             complement(704792..705502)
                     /codon_start=1
                     /locus_tag="AO090010000276"
                     /note="predicted protein"
                     /old_locus_tag="AO070235010006"
                     /protein_id="BAE66151.1"
                     /transl_table=1
                     /translation="MLFTRSRRRGPVVRKWGSDEVKAVLPFITKLRQKNTPWKDIQRK
                     WLKKFGIPRTVNALRGQWYRAQWGWVPQVGSEKTPPADVETTAETESSDELPQATSCS
                     PQQPSRARRKSVWSVPSSPEPSPAPDSEDAQAPLAGVSTSQTLPSTTVEQKAARKSLS
                     KNQENALKMSLAFSKYWLHARTTCAGITLTQCPVCTQICQQRREKNRREKDRSHSAVL
                     PYRLNRLSGKGLGPRRRP"
     exon            complement(704792..705502)
                     /number=1
     CDS             join(706414..706663,706712..706767,706826..708268)
                     /codon_start=1
                     /locus_tag="AO090010000275"
                     /note="predicted protein"
                     /old_locus_tag="AO070235010007"
                     /protein_id="BAE66152.1"
                     /transl_table=1
                     /translation="MTDSSRIDSSGTPAKARGSWRINKRRRRRARQSQRVTESNGQEA
                     QADDAHGDDTHADALGEPDSESDNAFEKIMQRKEIREVVSYTIGSREDGGVLDGRGQP
                     EALGPNRALITLIRKGPHADIIPQSVLPWPCCDDEQPGSPAGPARLSSPSLAVPSPDA
                     PIVQPQTADGPSSATPAAPSTLTAQHQPPAVQSTQAASEWTAAAAVGGGHPLQQTAQP
                     PQSQASNPSPPAPSSGIPDHPPAGQLGVPPNTVAQPQTYSGSVTYQPPPTTGLTTAPA
                     PGPAGPAGPPARPPVPMPTASQPPQAPLWTTDAVPHITSVQPPLAPGAAPGPYPGQSV
                     SHGVAAGMPHPSQPQVNQSMHPTALAYGSLHPQVTGHLPSGQLYVGPAGQVVQAGHAF
                     QTGQAGQALQTGQTSQVVQTGQALQAGQALQAGQASQAGQTVQPVQAGPTAQTAHTVQ
                     AVQAGLGAPPQPSFPMAHGQPAAAVPNGGGLLTAPQPVQHWTPGVAGLPQAATQTAPP
                     TQPVNAALSAQPTDPCQGTLVHPGQPQASTQPSTGHPPVEPSQQTPWPPQQQNDSAMD
                     SDPYGLNLLDSWSLFK"
     exon            706414..706663
                     /number=1
     exon            706712..706767
                     /number=2
     exon            706826..708268
                     /number=3
     CDS             complement(join(713589..713865,713942..715413))
                     /codon_start=1
                     /locus_tag="AO090010000261"
                     /note="thiamine pyrophosphate-requiring enzyme"
                     /old_locus_tag="AO070235000021"
                     /protein_id="BAE66153.1"
                     /transl_table=1
                     /translation="MAHITARINVAEYVFHRLRQLGVCSIYGVPGDFNLVALDYVRPS
                     GLHWVGCSNELSAGYAADGYARVKGLAALMTTSGVGELSALNAIAGAYAEKVPLVHIV
                     GTPPTYLQDQNAILHHSLGDGNSRLYASIYRSFTCAQANLTLASHAPVLIDETLRQCL
                     LHSRPVYIEIPANMAKVIISASRLEEGIDTSLSLNEGSEVEQTVVKELLKSLYSASQP
                     LIILDGWVSRYGLEQEADDIVRLAGFPVVTTPFGKGTANETYPNFCGVYTGAAGNSDF
                     MRWVKSRDLVIRFAPMNADTNTFGFTALTSEAITIELHKFTINIRGENYLNMNTKSIL
                     RKIISELDPSRFAYDESCIEPRRLNMTGALDSPRPEASITQDIFWRYVSQFFHSDDII
                     LTETGTPYAGGCDFVLPPNAKIINSALWLSIGYTLGASCGAALAQREMVKQGLRNKGR
                     TILFEGDGSFQMTAQVLSDIIRNRLDLIIFLINNDGYTIERYIHGMEAYYNDIQPWRY
                     LESPWYFGARKDDLEYPVFTKQVRTWADLERVLQSEHIIRGRGLSMIEVILEKDDAHP
                     LLKRQMKIAKDQNGNS"
     exon            complement(713589..713865)
                     /number=1
     exon            complement(713942..715413)
                     /number=2
     CDS             719749..721770
                     /codon_start=1
                     /locus_tag="AO090010000262"
                     /note="predicted protein"
                     /old_locus_tag="AO070235000020"
                     /protein_id="BAE66154.1"
                     /transl_table=1
                     /translation="MAKNHTDRKGALFDSSGYLADLLTRCAFIEKQFYGDRDPVILNI
                     EKERSIVRVYVAILRYSAEVRRVQQSNKGKDIAESVTAITSQPLTQLKTSIKEEEAHL
                     YHWLVLDQHLHRRKEAEATLNRLDKLTVDIQEVRDAVDMLNLPFAKGAFFGSFEDQHE
                     DECLPGTRTELLQQVQGWGRFSDKHLFWLNGMAGTGKSTIARTVARAFEEDGILGASF
                     FFKRGEGDRGSTAKFFSTIVKQLAVHIPQMVPGVRKALGEDPAIPGKSLREQFNKLML
                     QPLLAVKHGEAIDTTVIVIDALDECEPQEDVEIILSLLPGVETATNLAIRFFLTSRPE
                     IPIRFGFDQIDRSKYQNTILQNLDEDVIKHDIALYLREEFSKIQQKRRHALSPGWPGE
                     ERIEALAMMACPLFIFAATVCRFVADRHFDPDERLQKFPISSTGSKMDSTYRPVLNQL
                     LVQDATDRNELIEEFQRIIGVIILLANPLSLSSLAELLLDTPEHNSSTHLERRMHLER
                     QISAHLDSFHSVLSIPSDPELPIRTLHLSFHDYLVDDRTRSEKATSQFWVDKREKHEF
                     IACQCLAVMDRYLRKNMCDLPTYGTSRTEIDLNSIARFLPPALQYACRYWVYHLTQSL
                     APATSLDQVLPFLKEHFLHWLESMSILGIISEAIIAVNSLLQLTKVSIN"
     exon            719749..721770
                     /number=1
     CDS             join(722024..722562,723127..723208)
                     /codon_start=1
                     /locus_tag="AO090010000263"
                     /note="WD40 repeat"
                     /old_locus_tag="AO070235000019"
                     /protein_id="BAE66155.1"
                     /transl_table=1
                     /translation="MQTLEGHSDLVDSVAFSGDGQLLASGSRDKTIKLWDPATGALKH
                     TLESHSGLVSSVAFLGDGQLLASGSYDKTIKLWDPATGALKHTLEGHSDLVDSVAFSG
                     DGQLLASGSYDKTIKLWDPATGALKHTLEGHSDLVDSVAFSGDGQLLASGSDDKTIKL
                     WDAATGALKHTLEGHSNSVHSSTVKDGIIALGSTSGRVAIIAFSVM"
     exon            722024..722562
                     /number=1
     exon            723127..723208
                     /number=2
     CDS             complement(join(730670..731053,731115..731569,
                     731633..732023))
                     /codon_start=1
                     /locus_tag="AO090010000265"
                     /note="NADH:flavin oxidoreductase/12-oxophytodienoate
                     reductase"
                     /old_locus_tag="AO070235000017"
                     /protein_id="BAE66156.1"
                     /transl_table=1
                     /translation="MPSSTDRESISPDLLGRRLLFSFSGKWAQNRLLKSSTAECMASF
                     SASDSGSRGIPSAELANLYRRWGEGDIGVIITGNIMIDPQHLVSAGDPIIPIDAPFEG
                     LRFERFSKIALEAKCHGSLIIAQLCHPGRSFGADFGKPREAKREDINYIVEGFAHAAA
                     YAEKAGFDGIQLQAAHGHLLSQFLSPRTNKRQDNYGGSIKNRMKLISEIRKAISERVA
                     ETFTVGIKINTVEFQESTFNLEETVQLCIEFEKMRFDFVELSGGTYEDWTIGRKQVAS
                     IPQHEGFFLEYGRIYSEKMERTKVYVTGGYRSVKGMIRAVQEVDGIGLARPLCQEPHL
                     CSHILSGSVETAPPIKIDTDNFHLTSVAALMQMQHLGKGLQPVDLGSERDTNRLYKAI
                     LDHERTRYSAAAPMNFL"
     exon            complement(730670..731053)
                     /number=1
     exon            complement(731115..731569)
                     /number=2
     exon            complement(731633..732023)
                     /number=3
     CDS             join(732845..732882,732959..733327,733650..733680)
                     /codon_start=1
                     /locus_tag="AO090010000266"
                     /note="predicted protein"
                     /old_locus_tag="AO070235000016"
                     /protein_id="BAE66157.1"
                     /transl_table=1
                     /translation="MSGITAMIKAAILMNSARVLQCLSGEKRSLGLYTLGFSYYAEMY
                     LGFEEAWGDLRDWIAKYPCSLTSLTYEKKISDLSKLLSMVDLYRTERLIEDLRRLHSS
                     YPTITNLTTNESHDMQIKDVIKRRINENPHKLLALMDDLNAVL"
     exon            732845..732882
                     /number=1
     exon            732959..733327
                     /number=2
     exon            733650..733680
                     /number=3
     CDS             join(739199..739208,739509..739732,739788..740108)
                     /codon_start=1
                     /locus_tag="AO090010000268"
                     /note="predicted protein"
                     /old_locus_tag="AO070235000014"
                     /protein_id="BAE66158.1"
                     /transl_table=1
                     /translation="MDTSSRLGFEIPPDKIRLQPRDEDPYRWHVADHLKPLFKSNLSS
                     GSVGNFQKICHALKAPDLIEAIHPEALRNDQDLETEKQSSVPSSSFAATIQRLEKEKQ
                     DVLADSQRLCEKQEQNLLGAQVEWEAERRKLQEEISRWKDAVSSYDLRVQELKRVVCP
                     ALETLNLHLPGLFVAIHAEQHLVD"
     exon            739199..739208
                     /number=1
     exon            739509..739732
                     /number=2
     exon            739788..740108
                     /number=3
     CDS             complement(join(740648..741008,741058..741554))
                     /codon_start=1
                     /locus_tag="AO090010000269"
                     /note="predicted protein"
                     /old_locus_tag="AO070235000013"
                     /protein_id="BAE66159.1"
                     /transl_table=1
                     /translation="MALFPRFHLFEIEDQSWCPEFVVKFIQTYLTALWNFRIPAVRHT
                     AAEAAANIILENLPNASLYTFVDPCAGAGGPIPAIEKALGTEYSHSVQFILADIKPRV
                     EEWKAIKKEQKNISFIQDSVDAAELGKVTSGKECRIFNISFHHFNDTSAKKVLHSAMQ
                     FTDAYIIFEFLQRDLTTFLFWCVTTISPLPFMHALLQGSLLQMCFMFVIWVALGIDGF
                     VSMLRTRTHEEIKNLTRAAEGISEGWVFKHGRSRIIGPWYIHWHLAFRTLDRKANNGE
                     EAMVLPLRA"
     exon            complement(740648..741008)
                     /number=1
     exon            complement(741058..741554)
                     /number=2
     CDS             complement(join(742748..742804,742858..743649))
                     /codon_start=1
                     /locus_tag="AO090010000270"
                     /note="ankyrin repeat"
                     /old_locus_tag="AO070235000012"
                     /protein_id="BAE66160.1"
                     /transl_table=1
                     /translation="MHLELPLKLLLLIVEYLDSKEDLNSFTRVSKYIRNKTNNILYKK
                     HGELALLWAGEKGIVETAQLALRYYNFEEADANRKKELCERALLLACDGGHIDLIKIL
                     LKEGVLATYKNYEGMSGLSLAAGKGHNDIVEMLVEAGAEPNCEDREDKSPLMLAAIGG
                     HHHTVNILLDSGAAIDSLCYHESATALMFAAYHGHENIVNILLDRGANIDKTNIFGNT
                     ALWHAIWGCQKGVFQTLVQRGANTSLRDTAGKTYLERAEFYRGIDWEEKTNVPSGYRR
                     EDIFGK"
     exon            complement(742748..742804)
                     /number=1
     exon            complement(742858..743649)
                     /number=2
     CDS             745874..748042
                     /codon_start=1
                     /locus_tag="AO090010000271"
                     /note="predicted protein"
                     /old_locus_tag="AO070235000011"
                     /protein_id="BAE66161.1"
                     /transl_table=1
                     /translation="MASGSSPDYKALYLRAEEDKRKAEEDKRKAEEERDQGRERTRPT
                     TFLELLRLCHTLFSLSLRAEAPSRSTTGKIPPPTGKYCPLRLQHWEDCAARQQEIYRS
                     VCAYLAPPGEAATQLFLSRIVLEGFGEEFNKRAISSEQDLESYERFGVENHVRDIIAQ
                     LCKIPAAREEFGLSDGVKFDNHANALDPPETDPSLPTTYRRSRPDQFCIRRIDAERNT
                     LLTTVEYKPPHKLSVENLRAGLQDMNFWEEVVRPNSIPTEESAKLAYNAAWLTGSAVT
                     QEYHVMIQEGLEYSYLTNGLALVLLRVPYDEPGTLYYHLCEPNVEIDPNDDWSFEQPL
                     TAIARVLCLCLMSFGAPVRDQAWRNQASKKLPVWKTSFDHTRSQIPERELRQNPPSSE
                     YSPSVSSGRTVSEYLPSSSPVEPTQQRRVPTRSRAQCAPNTMEREDSPDSDTDSAPGG
                     RKRGFSQVTSSPSSPSVQRSARQTGSQQNERGRYQHNAQFCTQQCLLGLQRGGTLDDH
                     CPNAELHRQGGTSNQHLIDAKGLVRQIKQQLDENLDRYCTPMGGCGASGAPFKITCTA
                     YGYTVVGKGTTSYRWNEVKREADIYRILWRAQGRAVPVFLGTIDLAMIYFLEGAGRIR
                     HMLLMAWGGEPIHKLEDVESIRHEILRSQKKIRSLGVLHQDLRLDNMLWNAELGRVLI
                     IDFHRSELDARPTKKRMKLHEQLSCGAEEHRRKRPRLGYK"
     exon            745874..748042
                     /number=1
     CDS             complement(join(755197..756639,756698..756753,
                     756802..757051))
                     /codon_start=1
                     /locus_tag="AO090010000258"
                     /note="predicted protein"
                     /old_locus_tag="AO070235000007"
                     /protein_id="BAE66162.1"
                     /transl_table=1
                     /translation="MTDSSRIDSSGTPAKARGSWRINKRRRRRARQSQRVTESNGQEA
                     QADDAHGDDTHADALGEPDSESDNAFEKIMQRKEIREVVSYTIGSREDGGVLDGRGQP
                     EALGPNRALITLIRKGPHADIIPQSVLPWPCCDDEQPGSPAGPARLSSPSLAVPSPDA
                     PIVQPQTADGPSSATPAAPSTLTAQHQPPAVQSTQAASEWTAAAAVGGGHPLQQTAQP
                     PQSQASNPSPPAPSSGIPDHPPAGQLGVPPNTVAQPQTYSGSVTYQPPPTTGLTTAPA
                     PGPAGPAGPPARPPVPMPTASQPPQAPLWTTDAVPHITSVQPPLAPGAAPGPYPGQSV
                     SHGVAAGMPHPSQPQVNQSMHPTALAYGSLHPQVTGHLPSGQLYVGPAGQVVQAGHAF
                     QTGQAGQALQTGQTSQVVQTGQALQAGQALQAGQASQAGQTVQPVQAGPTAQTAHTVQ
                     AVQAGLGAPPQPSFPMAHGQPAAAVPNGGGLLTAPQPVQHWTPGVAGLPQAATQTAPP
                     TQPVNAALSAQPTDPCQGTLVHPGQPQASTQPSTGHPPVEPSQQTPWPPQQQNDSAMD
                     SDPYGLNLLDSWSLFK"
     exon            complement(755197..756639)
                     /number=1
     exon            complement(756698..756753)
                     /number=2
     exon            complement(756802..757051)
                     /number=3
     CDS             757963..758673
                     /codon_start=1
                     /locus_tag="AO090010000257"
                     /note="predicted protein"
                     /old_locus_tag="AO070235000006"
                     /protein_id="BAE66163.1"
                     /transl_table=1
                     /translation="MLFTRSRRRGPVVRKWGSDEVKAVLPFITKLRQKNTPWKDIQRK
                     WLKKFGIPRTVNALRGQWYRAQWGWVPQVGSEKTPPADVETTAETESSDELPQATSCS
                     PQQPSRARRKSVWSVPSSPEPSPAPDSEDAQAPLAGVSTSQTLPSTTVEQKAARKSLS
                     KNQENALKMSLAFSKYWLHARTTCAGITLTQCPVCTQICQQRREKNRREKDRSHSAVL
                     PYRLNRLSGKGLGPRRRP"
     exon            757963..758673
                     /number=1
     CDS             759337..760332
                     /codon_start=1
                     /locus_tag="AO090010000256"
                     /note="predicted protein"
                     /old_locus_tag="AO070235000005"
                     /protein_id="BAE66164.1"
                     /transl_table=1
                     /translation="MAAWLGLEHDEGGWAITDNDAMRRVINGMDCPANQHPSIALFVG
                     HTAKAQALRSLYPHNNTGRHRKQGWAQLHLSGAATSHPVIVIESSLSRTSPPGPSQQE
                     PLRRYPIPRTRGRSYEDLQSLLYRDVLLPIVDTVCVFAADCGGIRHVQHLLASWGSLP
                     PTGLDGAAASVRPRWVIVLTDPDDDAVPAGGIETTLQATAVPHLAGSVAVVDLRPRQP
                     LSRLSRFEPLRRRLSLELDEVRTLRANAHLLFSALHLEWIFRGLLRHVAQGPASPFNC
                     IQACRPQHLDADEVAQYLGIFLQLAEKTQIADPFMATFIASAFLMDAYPPGMHSE"
     exon            759337..760332
                     /number=1
     CDS             join(761062..761432,761620..761671)
                     /codon_start=1
                     /locus_tag="AO090010000255"
                     /note="predicted protein"
                     /old_locus_tag="AO070235000004"
                     /protein_id="BAE66165.1"
                     /transl_table=1
                     /translation="MVCGANVADTRPKFDTLARQIFSRRPLWQTILGQSWGWVTAWMA
                     DSRYDSAVLDRTVQDGFGRDRRLFDTTKPLVSGIRVALTASQVEDGSLCLFSNYRAAG
                     RPRMSSAYRALVPEQEPFLWEIGSICGKGGRRGRGHPY"
     exon            761062..761432
                     /number=1
     exon            761620..761671
                     /number=2
     CDS             complement(join(764085..764378,764785..765171))
                     /codon_start=1
                     /locus_tag="AO090010000254"
                     /note="predicted protein"
                     /old_locus_tag="AO070235000003"
                     /protein_id="BAE66166.1"
                     /transl_table=1
                     /translation="MDQQIASYKFSSNDRQYVPNYPSLPPSLSLTGPHLVIRTGLSVG
                     TRRLLSSSSPKAPCLQLEIELCPLLQYTLRRATPDDDPRPFVFVWSPLNEGYHQDGFI
                     LLRHTSDGKLERVSVPDAIQDPIDIVHTGRPGPERRALRSEYHCPRRKHSASLHVRYQ
                     GSPTDRPIIFRNHVIWDMFRSYRLEDGLWELQEGPCGCPGLFLDDPDITVNVAEDEGF
                     VTLKPGEC"
     exon            complement(764085..764378)
                     /number=1
     exon            complement(764785..765171)
                     /number=2
     CDS             join(767729..767952,768012..768746,768755..768797)
                     /codon_start=1
                     /locus_tag="AO090010000253"
                     /note="predicted protein"
                     /old_locus_tag="AO070235000002"
                     /protein_id="BAE66167.1"
                     /transl_table=1
                     /translation="MKLSIPLLSLLATSQVTLAAPAATVDVAELPSDTILDIRSSNPS
                     DEALAVLEQRATRVCEILDRTVRTIGTSKFTVVYIVMGSRLARQVCEYAGGSRCEELS
                     YIISDGLLLAYTAAAHYSGSIPEGLPGKRDVDDSQDYLQMWETMLSSSDDISYESLSP
                     LSISSDTIALARRQDEPLPTHRFQITGFAVDDSPKHDIIANHYENGETVLHLPLLRGD
                     SGTTNTEGSNLQKRFDNPGFKIAFTTRERSKLTQAHQKSMALAGAATWAVYADNANHK
                     MDDFIGFAETEHAANFYYRIIPEIKGFGTNYETVDICGGMASYLFCIFVRSMSRGTH"
     exon            767729..767952
                     /number=1
     exon            768012..768746
                     /number=2
     exon            768755..768797
                     /number=3
     CDS             complement(777936..778346)
                     /codon_start=1
                     /locus_tag="AO090010000284"
                     /note="predicted protein"
                     /old_locus_tag="AO070184000006"
                     /protein_id="BAE66168.1"
                     /transl_table=1
                     /translation="MLRPREDQRGDLQPLSVTTGQALVLLLAAVTDRQALRVQRGSKV
                     GELRTALRLVEANISQDPPDQGPSAAPAEGWLQPLHDNRDGVRRCRHPGGKLEQTDRV
                     GLEDGVLPARRSQRPTHQAGKLQGSTSTTGTYQF"
     exon            complement(777936..778346)
                     /number=1
     CDS             join(778578..779015,779139..779195)
                     /codon_start=1
                     /locus_tag="AO090010000285"
                     /note="predicted protein"
                     /old_locus_tag="AO070184000005"
                     /protein_id="BAE66169.1"
                     /transl_table=1
                     /translation="MWDTVDLHAPSSSVRTPVGDLLLGPAHRGRLYLKGLRVPEPSRD
                     EQTFRFGYNLVHGSVDRDRKRLVDAPEAMANVHSIWEKAIARDEVKALPCYLELLRDH
                     ASCADASGAERLVSESTAKKLWAAIRREPSAGGEFYCQPSDQDETHLTHHCWTRISPS
                     SGRN"
     exon            778578..779015
                     /number=1
     exon            779139..779195
                     /number=2
     CDS             779432..780595
                     /codon_start=1
                     /locus_tag="AO090010000286"
                     /note="predicted protein"
                     /old_locus_tag="AO070184000004"
                     /protein_id="BAE66170.1"
                     /transl_table=1
                     /translation="MAYRMEANALYIHEKWLHVRGAEGPATEGAIRSERDVFLCQHLA
                     EELYRRAVTLIVHKTDGPRTSQTIQPLLQVAHWKLHEMPRRIEVYAAAADDGPRATQV
                     SFYTGHSLLFTKLCGTQVSYLVVLHGPNCVAQSVDHLLYDPSRDCCLCPRQVVPLSMR
                     RAVFEDPGHGPWVPMVVKMSVRDGLVGAMSSPGGHHWPLLPKAQDGALVAIAPPSHSP
                     SSETAAPRGTVPVDRPPTVCAALDPVLTTPTAASQENQETTAASQLAARPLELETGAQ
                     TTASDTASDTASDTAAPVPLVPVVESLAPHPDDHPESASGALPSTISRNMTSADRAWW
                     QTWPEPPRDVQTSPSAADHNIGRFQVSSPLSYHVLHHRCPSSNIILPCPFDKV"
     exon            779432..780595
                     /number=1
     CDS             781199..782287
                     /codon_start=1
                     /locus_tag="AO090010000287"
                     /note="predicted protein"
                     /old_locus_tag="AO070184000003"
                     /protein_id="BAE66171.1"
                     /transl_table=1
                     /translation="MVVSGAAGVFAHGPERQCRVSTLFSAARGLRLRSLPRRPAPVGW
                     LPEGGVLRAGRGRFCRRPPPGMEGECALSRRCPDRWAPEATVKAALTLCCQQTQHPDA
                     TVYPGCVASALATMDYDLSMQPDDRGRDVPRIVTISGEGSFAKSAAGWLDPSSSGFDG
                     INGLSGETLSPLQQCELAAQSPGLSPDFIVLTMSRSILTDQLWGSLARTMGLLLEQGY
                     AVALRPVSLPDPGQRGERSVLLLAAPGRTDPQWIDDTLSDLRMVSASDELLERAENES
                     GVSSVPAVDDVAAAESAGGGDASPPSDSTPRRGDSVRADGAQHIAATVSRIIGEFSTK
                     CALTTNLPRLVVTDNSDGAQDRAKRQRM"
     exon            781199..782287
                     /number=1
     CDS             join(785584..785835,785895..786150,786164..786270)
                     /codon_start=1
                     /locus_tag="AO090010000288"
                     /note="predicted protein"
                     /old_locus_tag="AO070184000002"
                     /protein_id="BAE66172.1"
                     /transl_table=1
                     /translation="MWMSRIEYRGTCYVAQLSSKPLESASTSEQYRIKLPDNISKIIL
                     SVDCIGIRGIQFVDHKSNPRTDGSPWYEILDAGDTGLEVYGFFMRNIQLLPRNPSTYR
                     AWSSPFPPKFHPWNFYQARCKSRLDYFKIDSHIRGVLVCCANAKTVGIHGFSDTSKAF
                     REFIDLMNRPISSGFISRSMDMNISKQLGFGSLGFVVGQPPTLF"
     exon            785584..785835
                     /number=1
     exon            785895..786150
                     /number=2
     exon            786164..786270
                     /number=3
     CDS             complement(787032..787565)
                     /codon_start=1
                     /locus_tag="AO090010000289"
                     /note="predicted protein"
                     /old_locus_tag="AO070184000001"
                     /protein_id="BAE66173.1"
                     /transl_table=1
                     /translation="MSLITDEVLKGLWDRAQAQSSDEWASAKLWSYLWNKHLFAEKEW
                     VVSSETPPEGRGRRRVDITIEYFGGDSKLAVLAFHEAKALNAGPQDVQDAEHQAFDAC
                     MRYLGEHPELQFVYAFTSFGTKGRAWRCAREDIYLSPLFGSDDLAERTQYVELHSSEA
                     LLIRQAVQMMKAVPPSE"
     exon            complement(787032..787565)
                     /number=1
     CDS             complement(788803..792570)
                     /codon_start=1
                     /locus_tag="AO090010000290"
                     /note="reverse transcriptase"
                     /old_locus_tag="AO080603000001"
                     /protein_id="BAE66174.1"
                     /transl_table=1
                     /translation="MNKTLRVIQLNVRKQGAVHESLMNDEETQNTVALAIQEPQARRI
                     QGRLLTTPMGHHKWTKMVPSTWREGRWAVRSMLWINKEVEAEQVPIESPDLTAAVIRL
                     PERLIFMASVYVEGGNASALDDACNHLLDAITKVRRDTGVVVEILIMGDFNRHDQLWG
                     GDDVSLGRQGEADPIIDLMNECALSSLLRRGTKTWHGGGHSGDCESTIDLVLASENLA
                     DSVIKCAILGTEHGSDHCAIETVFDAPWSLPKHQGRLLLKNAPWKEINTRIANTLAAT
                     PSEGTVQQKTDRLMSAVSEAVHALTPKSKPSSHAKRWWTADLTQLRQIHTYWRNHARS
                     ERRAGRKVPYLETMAQGAAKQYHDAIRQQKKKHWNQFLADNDNIWKAERYLKSGEDAA
                     FGKIPQLLRADGTTTTDHKEQAEELLAKFFPPLPDNIDDEGTRPQRAPVEMPAITMEE
                     IERQLMAAKSWKAPGEDGMPAIVWKMTWPTVKYRVLDLFQASLEGGTLPRQWRHAKII
                     PLKKPNKENYTIAKSWRPISLLATLGKVLESVVAERISHAVETHGLLPTSHFGARKQR
                     SAEQALVLLQEQIYAAWRGRRVLSLISFDVKGAYNGVCKERLLQRMKARGIPEDLLRW
                     VEAFCSERTATIQINGQLSEVHSLPQAGLPQGSPLSPILFLFFNADLVQRQIDSQGGA
                     IAFVDDFTAWVTGPTAQSNREGIEGIIKEALHWERRSGATFEAEKTAIIHFTPKTSKL
                     DREPFTIKGQAVEPKDHVKILGVLMDTSLKYKEHIARAASKGLEAVMELRRLRGLSPS
                     TARQLFTSTVTPVVDYASNVWMHAFKNKATGPINRVQRVGAQAIVGTFLTVATSVAEA
                     EAHIATAQHRFWRRAVKMWTDLHTLPDTNPLRRNTARIKKFRRFHRSPLYQVADALKN
                     IEMETLETINPFTLAPWEARMQTDGEAMPDPQAIPGGSIQIAISSSARNGFVGFGVAI
                     EKQPPQYRKLKLKTFSVTLGARSEQNPFSAELAAIAHTLNRLVGLKGFRFRLLTSNKA
                     TALTIQNPRQQSGQEFVCQMYKLINRLRRKGNHIKILWVPASEDNKLLGLAKEQARAA
                     THEDAIPQAQVSRMKSTTLNLARSQAATTKALPEDVGRHIKRVDAALPGKHTRQLYDG
                     LSWKEATVLAQLRTGMARLNGYLYRINVAQTDQCACGQARETVEHFLFRCRKWTTQRI
                     ALLQCTRTHRGNLSLCLGGKSPSNDQQWVPNLEAVRASIRFAMTTGRLDAV"
     exon            complement(788803..792570)
                     /number=1
     CDS             complement(join(794390..795118,795391..795426))
                     /codon_start=1
                     /locus_tag="AO090010000291"
                     /note="WD40 repeat"
                     /old_locus_tag="AO070162000001"
                     /protein_id="BAE66175.1"
                     /transl_table=1
                     /translation="MQMIDILKSSIRTLEGHSRSVHSVAFSPDGRTLASGSDDNTIKL
                     WDTTTGTERQTLKGHSSLVYSVAFSPDGRTLASGSDDNTIKLWDTTTDTERQTLKGHS
                     SLVYSVAFSPDGRTLASGSDDNTIKLWDTTTGTECQTLEGHSSSVESVVFSLDGRTLA
                     SGSHDNTIKLWDTTTGTERQTLKGRSDSVETVLNEPNSNLHISVSNAWISSVGENLLW
                     LPAEYRLFFSYAVKDTTIAFGYRDGRVCIIGFHIVD"
     exon            complement(794390..795118)
                     /number=1
     exon            complement(795391..795426)
                     /number=2
     CDS             800535..804302
                     /codon_start=1
                     /locus_tag="AO090010000292"
                     /note="reverse transcriptase"
                     /old_locus_tag="AO080603000001"
                     /protein_id="BAE66176.1"
                     /transl_table=1
                     /translation="MNKTLRVIQLNVRKQGAVHESLMNDEETQNTVALAIQEPQARRI
                     QGRLLTTPMGHHKWTKMVPSTWREGRWAVRSMLWINKEVEAEQVPIESPDLTAAVIRL
                     PERLIFMASVYVEGGNASALDDACNHLLDAITKVRRDTGVVVEILIMGDFNRHDQLWG
                     GDDVSLGRQGEADPIIDLMNECALSSLLRRGTKTWHGGGHSGDCESTIDLVLASENLA
                     DSVIKCAILGTEHGSDHCAIETVFDAPWSLPKHQGRLLLKNAPWKEINTRIANTLAAT
                     PSEGTVQQKTDRLMSAVSEAVHALTPKSKPSSHAKRWWTADLTQLRQIHTYWRNHARS
                     ERRAGRKVPYLETMAQGAAKQYHDAIRQQKKKHWNQFLADNDNIWKAERYLKSGEDAA
                     FGKIPQLLRADGTTTTDHKEQAEELLAKFFPPLPDNIDDEGTRPQRAPVEMPAITMEE
                     IERQLMAAKSWKAPGEDGMPAIVWKMTWPTVKYRVLDLFQASLEGGTLPRQWRHAKII
                     PLKKPNKENYTIAKSWRPISLLATLGKVLESVVAERISHAVETHGLLPTSHFGARKQR
                     SAEQALVLLQEQIYAAWRGRRVLSLISFDVKGAYNGVCKERLLQRMKARGIPEDLLRW
                     VEAFCSERTATIQINGQLSEVHSLPQAGLPQGSPLSPILFLFFNADLVQRQIDSQGGA
                     IAFVDDFTAWVTGPTAQSNREGIEGIIKEALHWERRSGATFEAEKTAIIHFTPKTSKL
                     DREPFTIKGQAVEPKDHVKILGVLMDTSLKYKEHIARAASKGLEAVMELRRLRGLSPS
                     TARQLFTSTVTPVVDYASNVWMHAFKNKATGPINRVQRVGAQAIVGTFLTVATSVAEA
                     EAHIATAQHRFWRRAVKMWTDLHTLPDTNPLRRNTARIKKFRRFHRSPLYQVADALKN
                     IEMETLETINPFTLAPWEARMQTDGEAMPDPQAIPGGSIQIAISSSARNGFVGFGVAI
                     EKQPPQYRKLKLKTFSVTLGARSEQNPFSAELAAIAHTLNRLVGLKGFRFRLLTSNKA
                     TALTIQNPRQQSGQEFVCQMYKLINRLRRKGNHIKILWVPASEDNKLLGLAKEQARAA
                     THEDAIPQAQVSRMKSTTLNLARSQAATTKALPEDVGRHIKRVDAALPGKHTRQLYDG
                     LSWKEATVLAQLRTGMARLNGYLYRINVAQTDQCACGQARETVEHFLFRCRKWTTQRI
                     ALLQCTRTHRGNLSLCLGGKSPSNDQQWVPNLEAVRASIRFAMTTGRLDAV"
     exon            800535..804302
                     /number=1
     CDS             complement(join(805758..805798,806504..807012,
                     807395..807576))
                     /codon_start=1
                     /locus_tag="AO090010000293"
                     /note="predicted protein"
                     /old_locus_tag="AO070210000007"
                     /protein_id="BAE66177.1"
                     /transl_table=1
                     /translation="MFTIRTTNSGAHLRFQNVEQLNIMVLNAYVQWLCEGQTHPLKDE
                     THHRYLVSLFLSIFSTLFFGDFLEMDFISCQDGLRLKRFSSPNLLLSSLELCNAYLTV
                     LSRGESLTYYLGEQQSSIFLEERFRTLFCTNPPLLSPWYNQRTNILAWIGLLRHLDPK
                     QLQIDTDGICRCRIQEHTIEVSESAYHMLKSGILQEFIQRWPLWGDPQKEIEITEQSI
                     AEASKWHGFALQDAVNNLPAFALPF"
     exon            complement(805758..805798)
                     /number=1
     exon            complement(806504..807012)
                     /number=2
     exon            complement(807395..807576)
                     /number=3
     CDS             join(812747..812916,812966..814425,814480..814815,
                     815355..815562,815974..816139)
                     /codon_start=1
                     /locus_tag="AO090010000294"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070210000006"
                     /protein_id="BAE66178.1"
                     /transl_table=1
                     /translation="MDLAALNETVNDAAGKAQKNEGLSTQSFLISLAVSGSIFIPVVY
                     IFTFLKDIDHKLFQPGCLADPDLSPLPKGRTLWVKQLWEFMKDDTKLTGRLSLDCRFF
                     LRLLQVAVRLFAPIAVIILPILLPVNYTANNIHVGGLDKLSISNIQKEQHIRWWITIF
                     AATLANIHIWRLLLVEFRLVVKARQNYFHEYFSAQRAATIVVTNIPPGTWNDETLRQI
                     YSAFNGGPVDVILPQQEVCDGKELELRTLLRDLDTMIRVRPHISGKRVVPSSTKLMAY
                     FREKALLECKIHNLGRDIERIKSIALLHFSDLFTAHLLLQARASSIPLALEAHDTDLK
                     TLDPILYYGKLSRTLRSISILVTLNVLAILWAIPISLTGLLSQLVYLDSIDSHLHNLS
                     DKELGAIQGLAPQMAASILMYCFPVVLQFLMKYYIAFERPAVEVLLQRHYFLFLYTQL
                     FIVVSISSGVTTMIPEIVNNVQSVPALLAKNLPKSGNYFYSYFLLQTVTQTALILFRL
                     PDSLWMCLRRDGKKHTLKEVRWSLLYPVFTNLICIGIIYSIISPLITLIGTMAFGIFL
                     ITHAYQSIYILEANEDTAGLLYWEALNQLFVGVYTMDLFLIGLFILRNVLGPMIVAII
                     LLAGSALVQNYVRTKLHPLIKFVSASQNEFGKGKTIRSYSVLAVYTCLAYFNNPIMDL
                     ASKGRILSFYRLLNMNSVPAEEYIVWPPSVSILQRVSPNQVRQPKDSRLPVAYLLRTV
                     RNNKRRTEFDLHICFWIDEESIMQFSPHLHSTYSKSPGM"
     exon            812747..812916
                     /number=1
     exon            812966..814425
                     /number=2
     exon            814480..814815
                     /number=3
     exon            815355..815562
                     /number=4
     exon            815974..816139
                     /number=5
     CDS             join(825432..825728,825783..825890,825954..826143,
                     826438..826445)
                     /codon_start=1
                     /locus_tag="AO090010000296"
                     /note="predicted protein"
                     /old_locus_tag="AO070210000004"
                     /protein_id="BAE66179.1"
                     /transl_table=1
                     /translation="MRVRPGQYINLWLPSVSLRSWMQTHPFTVTSWSRDHQDTMELLV
                     QPRHGLTADLLRYAPTVAEGSVSFLAFFTGPHGISEHVDRYESVLVIASGFGIATVRR
                     LHLVWQVELISEIIAAQDLLNNLLKDDIMDDGYILNISIYVSSGLERNKVPFGQHKRV
                     FLYQGVPDYRNVISLEASGEQIERLPNIRDEQGRTLVMGW"
     exon            825432..825728
                     /number=1
     exon            825783..825890
                     /number=2
     exon            825954..826143
                     /number=3
     exon            826438..826445
                     /number=4
     CDS             complement(827218..829809)
                     /codon_start=1
                     /locus_tag="AO090010000297"
                     /note="predicted protein"
                     /old_locus_tag="AO070210000003"
                     /protein_id="BAE66180.1"
                     /transl_table=1
                     /translation="MITYLKHIEQFWSSLVGADTAAMKKIDQDTVDNLQLLAPGKSRA
                     DKSTACGLVLSGRAFSDFSETERKSIWSRLEVFDGLVPSLYTFFEDFKYLENCAQCIK
                     RLFGPVNESIWNTMKHMFHGSPDLEDGCLIQTSECTERLQRADSAERLDLGYRQVWLF
                     AMRNYTLMPTDPKNDDDLLAKPNRAMADPRTIYDMADLARRLGFHSSEIESILQGSPD
                     RQIARDALLQARKPHRFRYDVGEFNALVDRIVECFSAAVPYEPERNPELLADSTVKAR
                     ARCGTPQKRTQRQDSLHLFIDYLHKDEIIIADTITTFFVRRCVYFAFFGKPCSHSDPH
                     TDRDGDTFFQGSPAFSPLFIRDDSAAADLEATSPARLVAEQPESEPRGAPAGRGQQNI
                     RGRQHQSGVHERLRRRTRKMRKRRRQTQLGGQIAEPSMELDSLSVGSTNDEVKDNDGS
                     DLWITDAGTPEPSPPAVAVDLMSKATTPDSEHLAHDRTERQVRSELAASLEPSDDGVF
                     EQVAAPGPVERDSDPFESTTSSIVTSGQPLEAADLEQNPSNPSPKQPRRAASGENLTP
                     TEQTPPEPYMEEYINRILQAREEQDRLEEELDQERLERELNFSSTQPKAAPESVTQDH
                     SGSPKPHAPTSPASSNYSRPEFYQPALEQDPAVSVAEDPPEPVAAVQNPDRGTAEGHT
                     SAARQERPLTELDAENLKPQVAPGTTSAPGAPEGSASPSPDASTSPAPSTVASKEEPP
                     PADIVEISFWSFERGEWRQTNLVRVDVLDPSPVERVAKKYMRKKYSLYDVNLQSLSPA
                     GCFRAAIADGINRIFVISEHEESKLVADGQLIKDRRLLYSVSKLLDQDQSGSERQTKI
                     CRPRKPE"
     exon            complement(827218..829809)
                     /number=1
     CDS             complement(830217..830663)
                     /codon_start=1
                     /locus_tag="AO090010000298"
                     /note="predicted protein"
                     /old_locus_tag="AO070210000002"
                     /protein_id="BAE66181.1"
                     /transl_table=1
                     /translation="MQRALFTEEEVRLASERHLKYQGSAKVSINDIEFDPPLPRDLDS
                     RNLDRICQIFRKNRCRRLDVENRIPVIVARNDLSTALQQAEVTAGALMTKSAKHLPSL
                     RFPSGQLRGLHGRHRAQAGSMVLAPIDRWWAVDLYFDGQAAALFQL"
     exon            complement(830217..830663)
                     /number=1
     CDS             join(830965..831555,831582..831614)
                     /codon_start=1
                     /locus_tag="AO090010000299"
                     /note="predicted protein"
                     /old_locus_tag="AO070210000001"
                     /protein_id="BAE66182.1"
                     /transl_table=1
                     /translation="MSSKKEKHLTLLDVEHLDSIKPPASLPGTNASSTVQANKVERLV
                     NKIPYSSGCLTEKTPAPLTQINESIKHDQHRDEALLHPTNSGYRSLPVLHKVCPWKSF
                     EKRFDCDLAGTVAIVTRRSDPSDIQTIRQFAAKDGKNVMQALRSFRHEKIFSATECFQ
                     FDGILYTVSEFYPLTLEHIVACKVFPNERQLAAIMEQLTHNQCGKCS"
     exon            830965..831555
                     /number=1
     exon            831582..831614
                     /number=2
     CDS             841310..845215
                     /codon_start=1
                     /locus_tag="AO090010000300"
                     /note="reverse transcriptase"
                     /old_locus_tag="AO080602000001"
                     /protein_id="BAE66183.1"
                     /transl_table=1
                     /translation="MTTNLRILQLNIMKSRPGMEALINDHQSQNLDMLLIQEPPMTAY
                     RSHVNHSAWRLYRPTYTDESVRFRSLLYVNRRISTSSHRQIHCNHPDVVAIKIWTPEL
                     QYLIFSVYIPPVALYEAPEVSSAQQILEEIQTSIRQHAEGNNRVTKLILAGDWNRHHP
                     AWSHRPVHHSFAEHAEELINFFQAHELQWCLAPGQPTFWSLKEPGKTSVLDLTLTNNT
                     ERLIKCQLYHHHYGSDHRGTYSEWSLQPKQNVKLKLKRAYDRADWTKVGQDILNLIDP
                     QPRILSSQDLDQVVENLVHTTTTVLDQHVPFLAPSPYSKRWFTPDLKVQQTEVNQIRR
                     RWQDGCAILGPSHPMTKTLFEEMRRKRRQWTRAIEKAKSGHWREFLDKAGEGHLWKAA
                     TYMRPRDADMSIPTLKVDTKEVTDNQEKAEVFLEAFFPKMADPGDEEVESPAEELRWE
                     PITEIEIHRSIRAAKGTTAPGEDGIPTLVWKQLWAYLKETITIIFTKSLDLGYYPNQW
                     KRARIVVLRKPGKPDYSAPGAYRPISLLNTLGKLLEAVMARRLSYWAEKYGLLPDTQF
                     GGRPGRNTEQALLVLANAIDRAWVRSRVVTLVAFDLKGAFNGVNKTSLDTRLRAKGIP
                     FKARQWICSFMENRQASVTFDDFETENLPLEHAGLAQGSPLSPILFCFYNSDLVDQPV
                     DSNGGASAFIDDYFRWRTSPSAEENIKKIQEEDIPRIDEWARRTGASFAAEKTELIHL
                     TRRKSEHCKGQILINGQVIKPADTAKLLGVIFDKEMRWKEHIQRAVRRATKVNIALGG
                     LRHLRPEQMRQLYQACVTPTIDYASTVWHNPLRDKTHLRLLRTVQRTALIRILSAFRT
                     VSTEALEVESHILPTHLRLKQRAQITAARLSTLPGNHPIHGVIVRAIARSSHIGSGQR
                     FPLAETMRTMDLNRLQALETIDPTPLAPWRTQPFTEIEIEPDREKAKANASARQAMTG
                     ATVFSDASGQQNQLGAAAVALDKNQQILGSRQISIGSMSYWSVYAAELMAIYYAIGLV
                     FQLAQKNQTTATTTRGPATILSDSMSALQAIANAWNKSGQRILQAIHQAAGELKARGI
                     PLRLQWVPGHCGDPGNETADRLAKEAVGLEKKHPFRHLLSREKGYIRDRISKEWEQEW
                     RTSKKGGHLRKIDRTLPSSRTRRLYGSLPRNRAYLLTQLRTGHSWLATYGKQHRFQEE
                     EKCECGAVETVVHVLIDCPRLNRLRQELRRKIGRAFNNISDMLGGAEQGKEGRLQDAP
                     QDSSVLGAVLDYAEASQRFRSRAPRGRQNRTPGIGQHRP"
     exon            841310..845215
                     /number=1
     CDS             complement(join(846719..846744,846804..847752))
                     /codon_start=1
                     /locus_tag="AO090010000301"
                     /note="WD40 repeat"
                     /old_locus_tag="AO070164000001"
                     /protein_id="BAE66184.1"
                     /transl_table=1
                     /translation="MQSTIRKMFSDSIPKQLNILPQVEDLWSAGLQTHEGHSSSVLSV
                     AFSPDGQTIASGSSDTTIKLWDAKTGMELQTFKGHSSSVLSVAFSPDGQTIASGSSDK
                     TIKLWDAKTDTELQTFKGHSDGVRSVAFSPDGQTIASGSYDRTIKLWDPKTGTELQTF
                     KGHSDGVRSVAFSPDGQTIASGSYDRTIKLWDPKTGTELQTFKGHSDGVRSVAFSPDG
                     QTIASGSYDKTIKLWDARTGTELQTLKGHSDGVRSVAFSRDGQTIASGSYDKTIKLWD
                     ARTGTELQTLKGHSVSSVMNEPNFNSHSPISLSNAWVALGGRQTCSRA"
     exon            complement(846719..846744)
                     /number=1
     exon            complement(846804..847752)
                     /number=2
     CDS             complement(join(847888..847902,847926..849854,
                     849914..850399))
                     /codon_start=1
                     /locus_tag="AO090010000302"
                     /note="predicted protein"
                     /old_locus_tag="AO070164000002"
                     /protein_id="BAE66185.1"
                     /transl_table=1
                     /translation="MGRLRHSLSHPFRRFKGAVNVQSEEDQVKNQDNTGGTLLPTSPS
                     QSTIRTVQSAETSRPLDLWKTAYGQLDEEDRRILSEVQVTASPIYQEDQPRDLIEEVI
                     HLTTEQYEQYQQEATGKLRTSSRKIINAALSFKDIIGAVATFDPTQHAASAWAIVSLG
                     LTMTKNRHDLRDALFDSSEYLADVLAQCAFIEKKFYLDSSSKTKEDLGNALIKLYRAM
                     LHYTALVQMTQNASMGKKVLNSFTIITEHPLTELKNSVEKERGDLHKLVGLVSHLHHE
                     EKAESILYKIDELADSMKLLIEQFSLVNLHVAEGAFYDSYVNEHEDFCLPGTRTELRS
                     QISEWAKSSDGKCIFWLKGMAGTGKSTISRTVAQSFKEQGLLGATFFFKRGEAERGNA
                     KYLISTIIKQLVTSHRGLVPHILNVIKNDLNISSKFLSEQFDKLLYQPLLKLHLNQLS
                     TIVIVIDALDECDREDDIGVVLRLLFKLRDIKSVHVRIFLSSRPELPIRLGFKQDNNH
                     QDLVLHELPKPVIEHDIRLFLEHKLSEIQNGRSLPPAWPGKKATEELVQISVPLFIFA
                     ATACRFIEKGTHPKKRPQKVLEFQATTAANQMDKIYLPVLNQLTGESKDDSQELLEEF
                     RHIVGVIILLATPLSIESLGRLLQIPGEDISELLDHLNSVLYIPSHTKDPVRILHLSF
                     RDYLLITESPFRINKQETHEKLVSRCLHVMENKLMHNICGMASYGTQRLDVDNEIIKR
                     HLSAELEYSCQYWVYHLQQSKGRISETKILSFLKQHFLHWLEALSLLGIISEAVVILD
                     TLKSGIWLSSG"
     exon            complement(847888..847902)
                     /number=1
     exon            complement(847926..849854)
                     /number=2
     exon            complement(849914..850399)
                     /number=3
     CDS             join(862063..862420,862511..863271)
                     /codon_start=1
                     /locus_tag="AO090010000303"
                     /note="predicted protein"
                     /old_locus_tag="AO070175000001"
                     /protein_id="BAE66186.1"
                     /transl_table=1
                     /translation="MRAKKQRQPLQKATVIKTAQVKPKDSLGSLDRGVLIKIQKCQSR
                     ARHKSTTESEAKAALFVAQKLMAQYNVSQADLVANSDDGSKAQYGGMSKVEIINVKNR
                     TRRVIKEAFVHKLAKAMSAIAFETAHNKILDWACSYKGGSATFSYRVGVADGLVSMAN
                     REKKIELEAARKKELDIIAAKEREAGMEHERKLQRLHKGPSLVLDIDGQSEDEIPGFL
                     DIDSMSDESYGSLESIGNLNLNTRAALVDFNENDENVVDLMCSVEDNIDKIIKREAHK
                     THDFNSIPSPSVKQNPSDKNFSFVKSEDMSNSPWMSETQLVRFRATSVQVADEYLKKH
                     NIKLRMGKARTVVTRDYSAYTEGWKDSEKIDFRQRRLE"
     exon            862063..862420
                     /number=1
     exon            862511..863271
                     /number=2
     CDS             complement(869249..870691)
                     /codon_start=1
                     /locus_tag="AO090010000304"
                     /note="predicted protein"
                     /old_locus_tag="AO070203000012"
                     /protein_id="BAE66187.1"
                     /transl_table=1
                     /translation="MGIAPRQVKYCWECYTFFDGESLEFERHCASHLVSMTSQHYEVM
                     VYRHTTLRAGYCIECMWDDKRAAARRMRAFERSTELRDHLEEHIEQKSWPSVCSDPLC
                     NHASTNELDYRRHLHDVHHYNKTICVRSKKVSKKRLSSVQDEESTPDRDHCMQLKRPR
                     KQCKKPSVPPSTSTKELKITFWEPPAMYLKAISSIPAQEEDEDQESLKEMAWQAVNHC
                     QSLNLPGVSQNSQTARSATFGTPDLTDGLSSCSSPSTTSSTFGAVPIDPRILETPTAL
                     LRQSVEETEQPSARSPGVYVESNYATEQLKGNTPLQELFADLAQGGVDSQGVAIPETD
                     NITIEHAPLSPISLNAKPAPSLTDYELKPIDEADYTTQSSSDMHVIKGRMEEAVELTG
                     PMTRAKAKELAAKACQRSTDLQTSSQKAKPYSQEEDKLLKTLMRKLATFEAVTPAFQK
                     RFPGRSAISLRKRWSVIRSPSRRSTRLKPL"
     exon            complement(869249..870691)
                     /number=1
     CDS             complement(join(870802..871451,871511..871865))
                     /codon_start=1
                     /locus_tag="AO090010000305"
                     /note="predicted protein"
                     /old_locus_tag="AO070203000011"
                     /protein_id="BAE66188.1"
                     /transl_table=1
                     /translation="METIRFGTAIWDCDEPIYSGGLFLLALALADNALYGYSSPEEVF
                     EQRIPEGQDELVLRWNEDAKNRCIVRKVTAAGVSEDPLTKEMYAADFRKILANACYFV
                     TATVHAMRRALGGAVKSKYSSAHVAQILTQKSKNVYGNDYLANCSGVDVFNALMGKPA
                     DNTHIDYFQGYSQFHEHGLPRRLPIEEAQKIDADPQLVTKATEIRNAESDDDIKRLKR
                     DYNILKRKIYASMYQQFQSEWVQNQRDWKILTRGRERPDFVEQTAEKQAQCKVMPELG
                     RLAAIMSSNLPLSFDEKAVVVRDLYTQCLRDFDVIYRPGEEPVEGLCPVASCSHSLEM
                     "
     exon            complement(870802..871451)
                     /number=1
     exon            complement(871511..871865)
                     /number=2
     CDS             complement(join(872062..872328,872377..872620,
                     872675..872862))
                     /codon_start=1
                     /locus_tag="AO090010000306"
                     /note="predicted protein"
                     /old_locus_tag="AO070203000010"
                     /protein_id="BAE66189.1"
                     /transl_table=1
                     /translation="MAKRSESWKASQLEKKRKARRELRQQRGYDASAYRQKDAERTRG
                     RASTKTKESYRERVRKYEEFLIEEKNMPEGYKIGEGYPAPTLQELKEFTRWLIESTKG
                     RLADDGRPTKNSIKVRAQEFVPGFFLETGNEISSQDATELYHWIENELVEEGVLSAIR
                     KPKYNFKLRDFERAIIAFWATNDPFFMSGRYRVQFHFITLQFLCTGSRVSSFTPASVD
                     KVGRGLRYKVKLMK"
     exon            complement(872062..872328)
                     /number=1
     exon            complement(872377..872620)
                     /number=2
     exon            complement(872675..872862)
                     /number=3
     CDS             join(874287..874459,874623..874894,874945..875117)
                     /codon_start=1
                     /locus_tag="AO090010000307"
                     /note="predicted protein"
                     /old_locus_tag="AO070203000009"
                     /protein_id="BAE66190.1"
                     /transl_table=1
                     /translation="MNTLANHGFLPHDGRNITRNTVIEGLSAALNFNASLASLMFDMA
                     IVVNPEPNATFFTLRTDAYFGNNHVFNETIFEETKKYWTGPTLDANMLANSKLARQIS
                     SKAYNPTYTFTSSMEQFSLGEVAAPIIAFGDIQNGKVNRTLVEYFFENERLPTELGWS
                     RREEVVSLVDIAGVTQMISNATNLITPSKESRASRRRDLHSGLGF"
     exon            874287..874459
                     /number=1
     exon            874623..874894
                     /number=2
     exon            874945..875117
                     /number=3
     CDS             876172..877749
                     /codon_start=1
                     /locus_tag="AO090010000308"
                     /note="predicted protein"
                     /old_locus_tag="AO070203000008"
                     /protein_id="BAE66191.1"
                     /transl_table=1
                     /translation="MSRIRLSEIPQEIILEIYKNLETPQDRLNLVCCSRLFYDLCLPL
                     LYQKLRTGGKDLVPIARVVRTLVEKPSLAARVRTLHIFDWTRYVGFNCPEFDQALDSF
                     REERDMKREQGAANQEEVKGGDGNEDEDAGDEHTGNDDICDDSSGDVDFGGDGDDGDN
                     ASDDDSTYLKTFDYGPLREQAMLVTRSEDASNYWMDEITIGDADGWVALLLTLVPNIQ
                     RLEIEFPCGSFWVRWVLKWAIARRLDSIPAFKSLSEVYVDWDREDVQACCRNIIPFFL
                     LPSMRRFYASKLFAELASFEDYWPNEDDLTEVARFSPVTHIEIDESDGQWGMWKVVGI
                     CKNLQSFKYNHSGCAGFDPGGFYKELFPFRETLETIWLDIKESSRENCTEDSHHCHEP
                     FPSFKDFTSLRTLHLRMKNLPGLNIQSGDDHASMSFAEALPSSLETLQIADIGSLVNL
                     QVLVQKLQDHVEYALDFTPALKDIAIEPLRDSPRMPELLVKLNRACTKVNINFHVCDI
                     HDERVNWGAEGFAPRFL"
     exon            876172..877749
                     /number=1
     CDS             complement(878027..878959)
                     /codon_start=1
                     /locus_tag="AO090010000309"
                     /note="predicted protein"
                     /old_locus_tag="AO070203000007"
                     /protein_id="BAE66192.1"
                     /transl_table=1
                     /translation="MSKLVIFGATGQQGRSILETVHHDPVLSKQYSIRAITRDATSKA
                     ATEITNQGIETVQADIDDPTTLPRALAQAHTVILITSTIYDAELKSREYRQTKNVGDA
                     AVAAGATHIVFSTAVHASKLWNGRTMDVFDSKAEAEAYLRTLQIKVSLFMPGMFMQNL
                     TTMMAPRLGLDGTYSVASVLDPDTKVPLIDAANDSGMYVAALLGGEEGVRGATLYAAT
                     RLYSFSEIVGIISAVSGKVVRYVRLPDEVYAGFMKSEQGGRVVSMMGFFEEVGYFGPG
                     TGDLVEQTRSMVKGRLTTFEEFAEKYMKDLEACA"
     exon            complement(878027..878959)
                     /number=1
     CDS             join(882176..882539,882577..882611)
                     /codon_start=1
                     /locus_tag="AO090010000310"
                     /note="predicted protein"
                     /old_locus_tag="AO070203000006"
                     /protein_id="BAE66193.1"
                     /transl_table=1
                     /translation="MKTTFAVIISVLTASISAAPLEARQSNQVTLALSNDQSGAYAGV
                     AFAADGTDKSIKALYGGTSVGASGSVLASSAQLASFPQTIHCVIKNNGAVIANLDAQH
                     TFADLDGNPASATPVNLDHEPSIFTRDYGR"
     exon            882176..882539
                     /number=1
     exon            882577..882611
                     /number=2
     CDS             join(885727..886257,886324..886603,886662..886720)
                     /codon_start=1
                     /locus_tag="AO090010000311"
                     /note="predicted protein"
                     /old_locus_tag="AO070203000005"
                     /protein_id="BAE66194.1"
                     /transl_table=1
                     /translation="MADRKAMVCHLINLLAEMNQVGGGYDNQPADPTSLLNKCREIND
                     GIADIRAKREGQLAAAQNALLDSSTGKEDQVSRQTLDYVEDEINNGFRYLRDLLKKIK
                     QTPGSGDSRVQTQVDVTSRNLRREIEQYQRAQSDFQKRLREQVRRRYEIANPDATPEE
                     LEQGVDNVLMGQEQTFQLTGSRTRQANDARQAALERSAAIRKIEQDMIELGRLYQEVA
                     ELVHQQEPAVEQINQGAEEVAGNVANANTQITHAIDSARRARKWKWYALLIIILIIAI
                     VVGVAVGVTQANK"
     exon            885727..886257
                     /number=1
     exon            886324..886603
                     /number=2
     exon            886662..886720
                     /number=3
     CDS             complement(join(887498..887672,887732..887838,
                     887912..887953))
                     /codon_start=1
                     /locus_tag="AO090010000312"
                     /note="predicted protein"
                     /old_locus_tag="AO070203000004"
                     /protein_id="BAE66195.1"
                     /transl_table=1
                     /translation="MASNTPVEDTIREKITTAFSPSNLIIRNDSHLHAHHAPMQGSTS
                     KETHFHVTITSESFKSKMQPARHRMVYALLKEEMDREGGIHALQLRTRTPEEEQREKE
                     RKAQA"
     exon            complement(887498..887672)
                     /number=1
     exon            complement(887732..887838)
                     /number=2
     exon            complement(887912..887953)
                     /number=3
     CDS             join(888314..888668,888734..889035,889090..889994,
                     890043..890275,890325..890365)
                     /codon_start=1
                     /locus_tag="AO090010000313"
                     /note="acyl-CoA synthetase"
                     /old_locus_tag="AO070203000003"
                     /protein_id="BAE66196.1"
                     /transl_table=1
                     /translation="MQGRMLISALSRGFAPFGRRAFQSFLNCNARHQLRFQPINCRSL
                     STLPNLPLFRALQDHDQSSVAVVHSASSRSFTYGNLVADVVRAKERLLECAGGQQDGL
                     AGERIAFLAENSYDYVVTLLSILAIDAIALPLSPAFPVGELKYIMDNSQAKVLVATEK
                     YAAKAHDILKAGLEREPILEVKEKIKTGANSSDQVSLQDIVQESRGGMMLYTSGTTNR
                     PKGVLIPQSALTAQAASLLEAWKYSPEDRLLHLLPLHHIHGTVNAIVTPILAGSSIEF
                     MFPFNTDAVWKRLAAPFSPTFSASKITFLTAVPTIYNRLLSSFPGLSPEVQEAAKKGI
                     APENLRLNISGSAALPTPTKQAWQDLSNGNVLLERFGMTEVGMAISCGLDFADRVDGS
                     VGWALPSVEARLVDTETNEVIQPGEEYDANGREREGEIQLRGPTIFREYWANEKATKE
                     AFVDSDDGKSKWFKTGDVATRRVVEHAGKGTSGDWAQGPMYFIQGRLSVDIIKTGGEK
                     VSALEVERELLSLPQVSEAAVVGLPSEQWGQKVAAVIVLDKEKAANTGRNGKPWGALD
                     MRRALKDRLANYKMPQEMKVLNGPIPRNAMGKVNKKTLVKEVFGI"
     exon            888314..888668
                     /number=1
     exon            888734..889035
                     /number=2
     exon            889090..889994
                     /number=3
     exon            890043..890275
                     /number=4
     exon            890325..890365
                     /number=5
     CDS             891074..892324
                     /codon_start=1
                     /locus_tag="AO090010000314"
                     /note="predicted protein"
                     /old_locus_tag="AO070203000002"
                     /protein_id="BAE66197.1"
                     /transl_table=1
                     /translation="MIWTLAPFVALLPLVTAQQVGTTADAHPRLTTYKCTSQNGCTRQ
                     NTSVVLDAATHFIHKKGTQTSCTNSNGLDTAICPDKQTCADNCVVDGITDYASYGVQT
                     KNDTLTLQQYLQTGNATKSLSPRVYLLAEDGENYSMLKLLNQEFTFDVDASTLVCGMN
                     GALYLSEMEASGGKSSLNQAGAKYGTGYCDAQCYTTPWINGEGNTESVGSCCQEMDIW
                     EANARATGLTPHPCNTTGLYECSGSGCGDSGVCDKAGCGFNPYGLGAKDYYGYGLKVN
                     TNETFTVVTQFLTNDNTTSGQLSEIRRLYIQNGQVIQNAAVTSGGKTVDSITKDFCSG
                     EGSAFNRLGGLEEMGHALGRGMVLALSIWNDAGSFMQWLDGGSAGPCNATEGNPALIE
                     KLYPDTHVKFSKIRWGDIGSTYRH"
     exon            891074..892324
                     /number=1
     CDS             complement(892505..893452)
                     /codon_start=1
                     /locus_tag="AO090010000315"
                     /note="predicted protein"
                     /old_locus_tag="AO070203000001"
                     /protein_id="BAE66198.1"
                     /transl_table=1
                     /translation="MPPKPTIAIAGGTGHLGKHITTALLSTPFINSFTSIILLTRSET
                     SPSSFNIPSNPKLQLRKYTPTNLADSLNDIDILINAIGPSGHNFKETLLRTIPKTNVK
                     MYIPSEFGVDHYIHDFPHLEWDAKKRHDELAREILDPGVKVCRVFCGLFLEDSIGPWF
                     GFDTRDGRYECVGSAGEVVSFTGLGDVGRVVAGLCGLFAEGGAGVVPDVLHVAGDTRS
                     VFDVARIMEREGGGPIEVTEVALEEYKERVTKVVGSDPAPYLRFLIGEGKINHSSAGL
                     GCDNEVVNPGERVWKWKSLEQLARETQGRPWRDLEWPSK"
     exon            complement(892505..893452)
                     /number=1
     CDS             895494..896108
                     /codon_start=1
                     /locus_tag="AO090010000316"
                     /note="predicted protein"
                     /old_locus_tag="AO080606000002"
                     /protein_id="BAE66199.1"
                     /transl_table=1
                     /translation="MKDFLYTFVDPEADRHRNVAYRLINEKQNGRNMREWCARSLEVW
                     QAFPNNSLTAQTWIQTLDQEVQREITRAARQPQTLGEAHDMAIQYWSMLHRERSLRDS
                     EGSGRKRADGGNQGPAGFNRGRKRPRENETPATRPRGSRSSPGQPPFKARRWNDGTQA
                     AHERKRDWQKKEGRCFRCNEMGHRIWECPKAADGAPGKDASREQ"
     exon            895494..896108
                     /number=1
     CDS             903013..904860
                     /codon_start=1
                     /locus_tag="AO090010000317"
                     /note="predicted phosphatase homologous to the C-terminal
                     domain of histone macroH2A1"
                     /old_locus_tag="AO070323000204"
                     /protein_id="BAE66200.1"
                     /transl_table=1
                     /translation="MKSRLIRALQHLIQEAHGHVSQPPSCHSCSHHMNPDYISQMETW
                     SQLETMRRLLCQRPPIPELPSQILDDIDTVITYRNNKTMLTSSTSIAPSLVLKPNNLK
                     TVEKSSSKAINISLWKGDITSLTDVTAIVNAANSQLLGCFRPDHRCIDNIIHSAAGPR
                     LRDACNSLMLKQCHPESVGSVKVTSGFNLPAQWVLHTVGPQVNSRKSPGTLQQQQLAS
                     CYSSCLDATESLPALPDGRKVVAFCCISTGLFAFPPDMAAKIALETVVQWCMNHPATS
                     VTDIIFDTFLERDYELYQANISELKTTVASSGNQISFSPSPLSQPKALVTPTISKARS
                     WLQEADYLIISAGAGLSAAIGLDYTSTSLFQKHFPGFLHLGLGRLYDVFGFNDWDSPN
                     QKWGYCFLHLNMVRTWPASKLYGTLCKLAARFDDRYFVRTSNADGRFVANGFPAEKVS
                     TPQGQYRFLQCFAKCRPDAVFPSDPFVDAALPFIDPETQVLTDETKIPACQYCGGELT
                     LCVRGGDYFNSGPFRAQERKWKEYMDDVARNLDGRRAVILELGVGLNTPGVLRWPNEE
                     LVEDPSNPGFRLIRAGNGASGCAPWDFEERDLAIGIEGDLNLVVEALVG"
     exon            903013..904860
                     /number=1
     CDS             join(906149..906288,906345..906461,906513..907103,
                     907194..907221)
                     /codon_start=1
                     /locus_tag="AO090010000319"
                     /note="sterol reductase/lamin B receptor"
                     /old_locus_tag="AO070323000202"
                     /protein_id="BAE66201.1"
                     /transl_table=1
                     /translation="MSFLRVSLDSYISDLWRGIELHPRFGAAWDLKIFHNGRWTMTAL
                     AIIDISFAALQWEIHGYITYTMICVMLLRNLLIVNFFGNEEWYLCSTEVCDEPFGFYF
                     AWGSGVFFPTIYTLQTQYLAMNPIELPLTHTILILSLGIAGFMVYYIATEQKKAVNDT
                     KGVHDVGDEMALFIRASYTTTDGVERESLLLCSGMLLPDHDFSHLMLMNNLGLWKYIR
                     HPNYLGLLILTYAMCGLCGTRALLPWTEALFATILLAYRCLREERNCVRKYGKDWEVY
                     CSRVRWRVNKLYLVI"
     exon            906149..906288
                     /number=1
     exon            906345..906461
                     /number=2
     exon            906513..907103
                     /number=3
     exon            907194..907221
                     /number=4
     CDS             complement(join(907501..908118,908161..908597,
                     908611..908876,908950..908969))
                     /codon_start=1
                     /locus_tag="AO090010000320"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000201"
                     /protein_id="BAE66202.1"
                     /transl_table=1
                     /translation="MSWTEPITENNSSLPGGNELGAVAGTTHGGFGGFDVSSWEVWLN
                     GDGEVNWDIVHMFGYKAINEMSQIDRDLTKSFYNMSDTKLWSYYDGCSEGGPRFKFPD
                     LDGAVIGAPGMHFSFQQIQHLWSQFVEYQLNYYPPYCELEKIVNLTTEACDPLDGRVD
                     GVVSRTDLCKLHFNLNSTIGESYSCSETAEIPNFMPYIPAQNGTVTKEGVAVAKEILN
                     GAQDNLGRRIYMSYQPTAQFQDAVVKQSAQWVGVGLNLLTNVSALSSFEGVTRDTFRD
                     WIATGFQRYYDSLETAWPDLSVWQKAGGKVLHYHGESDPQVPTAGSVRYFESARSIMY
                     PHLSYNQSVAELNNWYRLFLVPGGAHCGANTLQPNAPWPETTLATLIDWVENGIEPKT
                     LNGTIQSTGEQQQICGWPLRPYFKNNATNPECVYDQKSLDTWKYNLNAFKMPIF"
     exon            complement(907501..908118)
                     /number=1
     exon            complement(908161..908597)
                     /number=2
     exon            complement(908611..908876)
                     /number=3
     exon            complement(908950..908969)
                     /number=4
     CDS             join(910058..910317,910384..910483,910544..910930)
                     /codon_start=1
                     /locus_tag="AO090010000321"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000200"
                     /protein_id="BAE66203.1"
                     /transl_table=1
                     /translation="MRLILTGATGLVGSAALNHILSLPPGQVSHLYILSRKSVPLAEN
                     RPDVTVIEHKNFNEYSPELLEKLKGADGCIWALGISQTQVSKEEYVKITVDYPLAAAK
                     AFSGLSDSFNFVYVSGEGATQEPGRFTPYYGRIKGECEAALIELSKKYPSLKPYSVRP
                     AFVDAAYDPPTLASVMQRPDFTVGKRLLFGTFGPIIRQLYSKGVSPTKDLGRFLTDLA
                     KGNGQPLTGEGVSGNGWIISNAAFRREAGL"
     exon            910058..910317
                     /number=1
     exon            910384..910483
                     /number=2
     exon            910544..910930
                     /number=3
     CDS             complement(join(911001..911652,912149..912204))
                     /codon_start=1
                     /locus_tag="AO090010000322"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000199"
                     /protein_id="BAE66204.1"
                     /transl_table=1
                     /translation="MFRCSADPRPQYNLGAGNKTLAKECNINIVPGSIAELHTDPTTG
                     EEKLLNVTYFIDNTGEIRGRYEKRNLWIPERQFVDRGATDSGHVAFDTPLGKVGLLIC
                     WDLAFPEAFRELVMQGAKMIIVPAYWKLDDAGEVGRRWNAESERVFVDAAVVSRAFEN
                     TAAVVFCNVGGREEEGYAGASQVAVPFLGCVGRVEGSGEGMSVVEVDMGVLDEAEGVY
                     RVREDLGREDWHYGYKR"
     exon            complement(911001..911652)
                     /number=1
     exon            complement(912149..912204)
                     /number=2
     CDS             complement(join(912452..912697,912760..913957,
                     914011..914081,914135..914208,914265..914325))
                     /codon_start=1
                     /locus_tag="AO090010000323"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070323000198"
                     /protein_id="BAE66205.1"
                     /transl_table=1
                     /translation="MSHQTQTSDPSWPPGTVQLEDLPQDGQTTDIILQPTPSHDPNDP
                     LNWPTWRKHLNFGLVSYYVIMVFAIIDVATVTWGPLNAELGFSFELLNDSYAAGCGSL
                     CIGGVILIPFALKYGRRPVYVFSTIAQCAFCVWQARMQTVADLMSANILSSMVGALAE
                     VLVQMTVADVYFVHQRGLMNSIYVWFMTVGATLSPLAGGYIVISQGWRWVWWWMVILM
                     GAGLVAFVFLYEETKFSPTLEGVVPVVAAAQINASAKGRDKKSPTDPEVEANVAHKDG
                     ETQRSHATHWIDHSIPVKPYWKKLALWSTSPGSFASMARHSVEPFILLFTIPAIFFMS
                     VVYGAMTAAVTVSVTTLSSYMTLPPYNFNASQIGLMGLPPFIGTSIAVLISGRLSDSL
                     VLYLAKRNRGVFEPEMRLWIAVAFIPFVPAGLFMFGIGLNNGSPWPLVAVGLGIAIFG
                     TIPANSVALTYLTDAYTDVIADSLVGVTFIRNLISTVFVFALSPWIESVGLTGFYITF
                     GLILTVILLGNLVFIYFGKKFRVMTAKRYRYYAQRQMDLRN"
     exon            complement(912452..912697)
                     /number=1
     exon            complement(912760..913957)
                     /number=2
     exon            complement(914011..914081)
                     /number=3
     exon            complement(914135..914208)
                     /number=4
     exon            complement(914265..914325)
                     /number=5
     CDS             join(916612..916836,918677..918804,918858..919165,
                     919240..920431,920490..921009)
                     /codon_start=1
                     /locus_tag="AO090010000324"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000197"
                     /protein_id="BAE66206.1"
                     /transl_table=1
                     /translation="MTKVAFNRTTACAPCAHVLSHDIHQNIETSRFNWAMVKLATKVP
                     TFPSKVKFVAEFVPFGALTIQLPFFLGWQGAACTTCRRKKTKCDGRRPTCSPCKAFNL
                     PCAFQDVLRHSSRTSRAYVEELEKRVQDMEMQLQDRTLDSSWRGFVSENKRNSPAPSS
                     AAAGTSDGATFELNAIESQPYSTSPSRSQPEEGNAQPNVDGGASQAPYVINAEGTKMR
                     FFASGQDLNSLEGGKRSGAWMTASQKTASRWQLSSWYPRILQGDPGQRAFQTLPPKAT
                     TTQLVSEYFGSFNRAVPLFDEATFTRLVDKQFGWNPDENPSWWASLNVVLAISYRERA
                     QKLPDGSEEWQKSMGHIRNALNVIVEFFMCSADLLAVQAMLGLALLFRSTPNPQPLFM
                     FAAAAMRLSQSIGLHRNQTSGLSPSHVEERRRTFWIAFILDADISHRTGRPPVQDVND
                     FDTPLPSKFPHDGLGILDVHGAHLDYFHLLARFALIQRGLYDRLYTANVQTKATRDLI
                     QEMKTSEEDLLGWRTSFAKHYNPQIAFSNASDYHLQHVLRLDFAYHCCYAKLYQLCIL
                     ARRSMAQAAQGLEDFPALDKVINNILVRSLECARSAIQLIKHVGLFGPCFVWGVIYFP
                     AAASMTLLSNLLTDPSHQHAVSDLTMAQETINLLSKVSSEEPGTYVDYILGVCSELKT
                     AAKKAVSRADQDISQQSMRYLNNTQLSTNETGNPASGHAVPHPSLASPQSGDTDPTRS
                     CAILQSYDMPSVDPTFDLAMNFQWPVAPFWNWGEMMTSTSDGGIDNGQLL"
     exon            916612..916836
                     /number=1
     exon            918677..918804
                     /number=2
     exon            918858..919165
                     /number=3
     exon            919240..920431
                     /number=4
     exon            920490..921009
                     /number=5
     CDS             complement(921229..921948)
                     /codon_start=1
                     /locus_tag="AO090010000325"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000196"
                     /protein_id="BAE66207.1"
                     /transl_table=1
                     /translation="MARLRELIADVDVFIQGFRYGSLDRKGLGLRDMLELAASRGKGI
                     VYVDENCYGPDGPFAERPGWQQIGDAASGSSYVMGRSLGYADEKCVLPPLPVSDMTTG
                     VVGALAAMMAIRDRAVKGGSYHVLSSLVAADNLSLEEEVGLYPLDVVRETAEKFGFVP
                     STPDQYVMEILLQVIAGWKKGRPGYLDEDSPLMTTFDQGPWGRQTLLKPVVRLDEEAV
                     TPRWTTAPVPNCYHDRNINWH"
     exon            complement(921229..921948)
                     /number=1
     CDS             complement(922037..923017)
                     /codon_start=1
                     /locus_tag="AO090010000326"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000195"
                     /protein_id="BAE66208.1"
                     /transl_table=1
                     /translation="MAFSHETTPGTDVYGPGTFIDKHVLPVPEDTRRVFEYLASKTPG
                     FTQNKEVWDTVHFEGEPDPMIPGPIKSPVVAAALHAMCGVVGNELVELRDSRPAAEGS
                     VTVNTDQAAIWLGSVATTHINGSDIPAIAISGKLNTLFDRDFEQGFGKGLASRATAIY
                     QTKDPNVWYQLHGSLDANRVLKTMGIDTNVAFNTPSEYYDYIQKHVRQWSPDELEMHN
                     VRHGLCGSICYKPESWRSTEMGKQLAKHPYVNYTHEAYAAPTPQQPLPKVPGDRRPLA
                     GIKVLEMVRIIAGPTIGVTLAAFGADVIRVNCSKLPDLNVSCLTSLIEQT"
     exon            complement(922037..923017)
                     /number=1
     CDS             join(923702..923759,923815..923889,923945..924123,
                     924179..925071,925134..925273,925325..925899)
                     /codon_start=1
                     /locus_tag="AO090010000327"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000194"
                     /protein_id="BAE66209.1"
                     /transl_table=1
                     /translation="MLRDPENRPVEVANCSGYHGDPAYEMYRQATLGDVDFITGDYLA
                     EVNLAKNAEAWRAGKHPGYEETAWQGLQQTIDVIAEKGIRVVINGGALDPRALALKVQ
                     ALTAEKRLDIRVAYVSGDDLYPQVGPNMPTSKEELQHLDSGNPSIVPSRLTYAFMNTN
                     DGKPLPMTSAHAYLGARGIVEGLRRGAQIIICGRVADASPVIAAAWFWYNWSETDYDR
                     LAGALIAGHLIECSAYVTGANFAGFDKYPLEDLIAPGFPISEIEKDGTCIITKHPGTQ
                     GVVNTDTVKCQFLYELQGNVYLNSDVSAHIGNIAFEGVGKDRYLLITPRFILALTVGR
                     VRVSGVKGSPPPPTTKLAVFYPGGYEAELLLNATGYATTQKWDLLEKQIRHFLPEGAV
                     NDLETLEFQRVGVPDPNPSSQLKSTTYIRIFIAARTAQAVSTVVKALGHISLKHFSGF
                     HASSDMRTAFPRPFIAYYPAIINQSDIKERINILDGQFKTASFDIPRPCQYEPLQPRE
                     SYDPISPTVYNGPTKEIRLGDITLARSGDKGANLNFGIFVSDPAHWEWLRSFMTISRM
                     RDLLGDDWDDSFSIERVEFPHIHAVHFVIYGILGRGVSSSSRLDGYGKGFADYIRDKV
                     VSVPVQFDLKQSTRL"
     exon            923702..923759
                     /number=1
     exon            923815..923889
                     /number=2
     exon            923945..924123
                     /number=3
     exon            924179..925071
                     /number=4
     exon            925134..925273
                     /number=5
     exon            925325..925899
                     /number=6
     CDS             complement(926018..926827)
                     /codon_start=1
                     /locus_tag="AO090010000328"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000193"
                     /protein_id="BAE66210.1"
                     /transl_table=1
                     /translation="MIFGLTAQVLTFAFAAPLYCFFHLITSRTAKNPTPDTLRIPRSI
                     TNTLPLVFILGYMVPTQLLILPISEHITFDLKQIFIAIWQPWPAYISIILTLIYTITT
                     PFTSSDRTTPASERKNLSSLRWVYAFAFGNTALTHLISWIVSLASVLVPDIFNPEVVD
                     YLHPGRVFEVPIPWEEPVRTVASVGHGVHAFLRWDYIIGSLGVLVWAVSLHGAAQRGV
                     YGSVGWLWLLWKVGLLSVFVGPVGAAVELMWEREELVLAKRGLTESGKKDS"
     exon            complement(926018..926827)
                     /number=1
     CDS             complement(join(926889..927318,927424..927455))
                     /codon_start=1
                     /locus_tag="AO090010000329"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000192"
                     /protein_id="BAE66211.1"
                     /transl_table=1
                     /translation="MQAASPIYDRHINTPSNHRFNPQSPAIPNVIHSQRRTANMAIAK
                     VLLPSLSLFVFYAIFYYADINGLRALGEQYIASGTLPGTNEPIRTIYTGIEPIDHLLT
                     TLTAFFWPTTDGSHPSLLLHSIAFSGTFGSAWVLITLEAWRKGNAWTIAAL"
     exon            complement(926889..927318)
                     /number=1
     exon            complement(927424..927455)
                     /number=2
     CDS             complement(927627..928775)
                     /codon_start=1
                     /locus_tag="AO090010000330"
                     /note="beta-lactamase class C and other penicillin
                     binding proteins"
                     /old_locus_tag="AO070323000191"
                     /protein_id="BAE66212.1"
                     /transl_table=1
                     /translation="MAQVNGTCDSAFSSVRDILQQNISSDKELGASICISVKGKTVVD
                     IWGGYADAARSKPWAENTIVSVWSMTKTVMGLAMLLLIDRGLVDPDAPVAKYWPEFGV
                     NGKEGVLVRHLMSHTAGLPSFDPPIDQDTLLNVPKATENLVQQKPWWTPGTGHGYHLA
                     SQGHLIGELVHRVTGKTLGEFVHDELTVPRNADFHLPVAEEEWDRIAEMVPAPTNMDI
                     SALDPNSIMYRAVTGGPGNPNMPKEPAFRRSGLGSIGGFTNARGANDILSIVTQNGTV
                     DGKRFLSPETIDKIFEVQASGPDQVIGLGIEWGLGFGIGMLGTLDWLPSGKLAFWGGW
                     GGSFALMDLDRQVTFTYAMNKMGMSILGNERTGDYVRAAYAALEGYNA"
     exon            complement(927627..928775)
                     /number=1
     CDS             join(930280..930599,930654..931640,931690..931821,
                     931881..932118)
                     /codon_start=1
                     /locus_tag="AO090010000332"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070323000189"
                     /protein_id="BAE66213.1"
                     /transl_table=1
                     /translation="MSSASSSSSNLSEIPTAHPEHSPAFGSVRPSTLSRRSTNVELSR
                     IESLRLTHRSTVGSTAGPAPRDQWLPFGGGKDYPPLLPDPEKYVVEFTGDDPMDPHNW
                     RMSTKIRFSCILAYVTFVSSFASAIFSSTVAATSKEFHVSTEVMTLGVTLYVLGFASG
                     PTFWAPASELAGRRWPLTAGAFGASIFTIGTATAKDVQTIMLTRFFAGFFAASPLALV
                     PAVFADIYNNRHRGVAIAMFAMAVFVGPFASPFTGGFITMSYLHWRWTMYIAAIMGFF
                     GSALLLFFFRETYAPIVLVEKASILRRQTHNWGIHAKQDEVEIDFNHLITVNFSRPFR
                     MLFTEPIVFLVTLYMSFIYGLMYALLSAYPVVFQQIHGMNLGVGSLPFIGLIIGEFAG
                     GAYTLLSQSAYTKKLMANNDIPVPEWRLPPVIVGGIAFTVGLFWFGWTGWTKNIHWMA
                     PTASGLLVGFGIYCIFLQCFNYLIDSYLQFAASVFAANTILRSAVGACFPLFSRQMFN
                     NLGVQWAGTLLGCLAAIMVPIPLGFIIWGPTLRRKSKFAPTAAVFEEKSG"
     exon            930280..930599
                     /number=1
     exon            930654..931640
                     /number=2
     exon            931690..931821
                     /number=3
     exon            931881..932118
                     /number=4
     CDS             join(932779..932859,932924..933844,933904..934008,
                     934063..934671)
                     /codon_start=1
                     /locus_tag="AO090010000333"
                     /note="permeases"
                     /old_locus_tag="AO070323000188"
                     /protein_id="BAE66214.1"
                     /transl_table=1
                     /translation="MGWIHRTNLKVAQSPVGRWFRLENSGHPQERKGSFFFTEIRAGL
                     ATFFAMAYIISVNSTITSDSGGTCVCPPESWADKCNSNTEYLLCVQEVKRDLVTATAA
                     IAALGTFFMGLLANLPVALAPGMGLNAYFAYTVVGHHGFGMIPYRVAVTAVFVEGFVF
                     LALTLMGIRQWLARALPASIKLATGTGIGLYLTLIGLSYSAGIGLVTGSTDTPMELAG
                     CHSSMRDATTGMCPASDKMRNPTMWVGIFCGGILTAMLMLYRVKGAVIIGILLVSIIS
                     WPRPTPVTYFPHTELGDSNFDFFKQVVTFHPIKHTLVAQEWDLSGHGSQFGLAFITFL
                     YVDILDTTGTLYSMARFAGAIDERTQDFEGSAFAYMVDAICVSIGSLFGSPPVTAFVE
                     SGAGISEGGKTGMTSCVTGLCFFIAVFFAPIFASIPPWATGCTLVIVGALMCKAAADI
                     NWKYYGDAIPAFLTIAIMPFTYSIAYGLIAGILSYICINMMVWIVEKASFGRIVPPNK
                     DEKDPWTWKLPGGFFPPWVKRAARGKKKFWQPDEENEGVVPDGSVSSNDRGEKSGFKS
                     KSGVV"
     exon            932779..932859
                     /number=1
     exon            932924..933844
                     /number=2
     exon            933904..934008
                     /number=3
     exon            934063..934671
                     /number=4
     CDS             join(935342..935464,935514..936098,936154..936309)
                     /codon_start=1
                     /locus_tag="AO090010000334"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000187"
                     /protein_id="BAE66215.1"
                     /transl_table=1
                     /translation="MTDSKRRLAPAPPGTPGGNDAHPRRKNVGTACSACKARKLKCTG
                     TAPCANCVKSRLECTLDQTLDKRRRGALKRKIDQLEEKEDLLFRLVNVLRESGNRSTI
                     PLLNLIRSNASLPEIQYYLNHQVPESELALMPELLEVSHEFQRLQDADSRSVRRILDA
                     KRLSDQPLFQVPAKPWTSVVSDNDFVSHLISLWLTWFHPFSNWVDRDRFVYDMQTGLL
                     GAKYCSPFLVNAILAYACTYSDYPEAYAVPGDVSSKGVHFYDEAKRLLDKEEGRISLP
                     TVQGIGMLWAR"
     exon            935342..935464
                     /number=1
     exon            935514..936098
                     /number=2
     exon            936154..936309
                     /number=3
     CDS             join(936819..936931,936983..937463)
                     /codon_start=1
                     /locus_tag="AO090010000335"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000186"
                     /protein_id="BAE66216.1"
                     /transl_table=1
                     /translation="MEQKTSEFHKRLTEWADRLPQCLKTGKDPEIPHILCLQMYYHAI
                     LIAIYNPHRLSREKLMPYTNYDTINPSQALTICLSSARSIGHWMQMYRTTWGLEHMPI
                     FHIQWVQAALFILLENLQKADNCEAFIILSIAAKAFSRRFEKAKRLLRSLQETARELR
                     INLPVEVAPLFIEIDGQWLLRPVRIKEETSDTASGDV"
     exon            936819..936931
                     /number=1
     exon            936983..937463
                     /number=2
     CDS             complement(join(937808..938029,938115..938225,
                     938305..938598,938699..939061))
                     /codon_start=1
                     /locus_tag="AO090010000336"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000185"
                     /protein_id="BAE66217.1"
                     /transl_table=1
                     /translation="MIESWTVFKLKKVNTADKYYWMQPSVFVEWNIPPQQTPTDSRNP
                     DGGAQPTTNSNNAPGVQRVFFVNLPLDEQRSIQKNFPSRYLRYYNPYIWHAVFAREVA
                     MLYDKCFWSLRHLVRDIEKKRNTSTLAELQATNFPNLHDIARHIFHSTEILEVAEHTI
                     NSVVTEQSRWREEFTDIASKARGAHLQTGQKLAFAAKEMHSLKIRSKSLTDRLDNEIN
                     LAFNLVNQGFGRNAQSDSAMMKTIGVVSLVYLPGTFVSGIFGTNFFDYQSGEAESWEM
                     AKNFWLYWAVTLPLTLATVVVWALWHYRLTLKKGYWKGKSKVKGKNEDPMEKV"
     exon            complement(937808..938029)
                     /number=1
     exon            complement(938115..938225)
                     /number=2
     exon            complement(938305..938598)
                     /number=3
     exon            complement(938699..939061)
                     /number=4
     CDS             complement(join(939856..940259,940307..940542,
                     940595..940978,941033..941998,942047..942246))
                     /codon_start=1
                     /locus_tag="AO090010000338"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000183"
                     /protein_id="BAE66218.1"
                     /transl_table=1
                     /translation="MQSRRSAIRKSSGSCRRKSSFCCEPCRERKSRCDGRKPICSPCT
                     QRSHAADRCVYRRNIVRLLDTDEYLQVLYRHIRELEEMCHEAGIPVPTFNPDVSSIDS
                     DGETAHIGLGIQFDTQTALPDHGNSRAFPPPIKPETFPSLLTNPQEGDLNLLKASNVS
                     SGNEGFPKQLNKFFGSPPTACLIRLLTQGSLLRDIPYGPTHAHLDGSLLPPRDLADHL
                     LGCFWDRVYCLYPFFDRSSVQDAYEGLWVSDTKDNKPSELNIGLGGRSDSGRQSPVFI
                     CALNIMFALGCHFADLSVPDRNAIAHTFFLRAKQNIGLDLLEIRTFGAVQTLLLASLY
                     LQSIPDSHKSCDLVGVACRIAQGLGFHETQPDSFKDPLEMEVQRRTWHGCVMMNTITN
                     MACGRPSSMSSLPTIPLPGAVGLTPTNAKDPYVAAFYPSSLELCSILDTALSAVHKAQ
                     CNRSSTPASSKIAQQDWLDVVIKLEEKLSKYESSLPAVLSWNRPFNPATDVTQLLTLR
                     RQRNVLHARFLYLRLRLNRTAFSQLCSEMLAQEDSETDQHDPVLRALFSSVLSKCAAA
                     CVKAAIDLVSLVYDNYQTSATDTWWYNGFYTSIAGMVIVMSYTCLPALSDIEKTTVHE
                     AWRKCEQILQFMIPYNFSSRNTLLFLRAARDRILSYLEDTSETGATDMGPDSSHVDGM
                     ENPFADDTDGLFNGANWLGSAVAMVGLGFLCPADFKWFQDWLAEELP"
     exon            complement(939856..940259)
                     /number=1
     exon            complement(940307..940542)
                     /number=2
     exon            complement(940595..940978)
                     /number=3
     exon            complement(941033..941998)
                     /number=4
     exon            complement(942047..942246)
                     /number=5
     CDS             944262..945029
                     /codon_start=1
                     /locus_tag="AO090010000339"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000182"
                     /protein_id="BAE66219.1"
                     /transl_table=1
                     /translation="MPGATGTGMVYEPLATALSSHFQVALYDRRGFGNSLLVTPGELD
                     TTTHVRTQADDVAQLIQHLSPGKPATVFAASGSAVMAIDLLQSRPDLVQHLILHEPLI
                     LDHLPTQFRSYIKDGMVDGILKYGGSGNRIIRRELLAYVQGRRDQQRLRRDPHYARLM
                     SQPVDEAMLFFKFELPIVLNYHLDLENLRLYRDRLVLMKGLDISPELASNPVITLSDV
                     LETAVVFAPGGHNGFITDAEEFAKKMISALNSKKAKL"
     exon            944262..945029
                     /number=1
     CDS             join(946146..946267,946329..946359,946414..946551,
                     946606..946909,946960..947960)
                     /codon_start=1
                     /locus_tag="AO090010000340"
                     /note="amine oxidase"
                     /old_locus_tag="AO070323000181"
                     /protein_id="BAE66220.1"
                     /transl_table=1
                     /translation="MFLGHLSLIAFGAWAVHPVVGYVSQPRDQEGTCQKTTVAILGAG
                     ISGISAAQTLSKASVDDFLILEYRDRIGGRAWHENFGQDKDGNPYVVEMGANWVQGLG
                     NPGGPENPIWTLAKEFGLQTTYSNYSNVSTYNQDGYKDYSHLLDECDEAYDIANQAAG
                     KILVENLQDQTAKAGLALAGWKPKSHDMEAQAVDWWTWDFEASFTPLESSLVFGMASD
                     NLTSNQFSDHDNFVTDQRGFNTIIKGMASKFLTEDDPRLLLNTKVTNITYGPEGVTVY
                     SSDGNCVQAAYAICTFSLGVLQNDVVTFTPELPEWKKTAIQMFTMGTYTKIFLQFNET
                     FWPTDTQYFLYADPATRGYYPLFQSLSMDGFHPGSNIIFVTVTDELAQRAERQSDEET
                     KQEIMEVLRKMFPDVDVPEPTAFLYPRWNTEPWSYGSYSNWPMGTTLEMHENLRANTD
                     RLWFSGEATSPSYFGFLHGAWFEGRDAGRRIAGLLNGCKEGNSTTCVPRKHYEVLHGT
                     SPLADYSSVNGWEVSSFYDSNDD"
     exon            946146..946267
                     /number=1
     exon            946329..946359
                     /number=2
     exon            946414..946551
                     /number=3
     exon            946606..946909
                     /number=4
     exon            946960..947960
                     /number=5
     CDS             948392..949855
                     /codon_start=1
                     /locus_tag="AO090010000341"
                     /note="glutamate decarboxylase and related PLP-dependent
                     proteins"
                     /old_locus_tag="AO070323000180"
                     /protein_id="BAE66221.1"
                     /transl_table=1
                     /translation="MPQQDSVERINIHDSTEINQVADAFRNSLERIGCHNPFPEAVRI
                     ANYPSEDWLSEVQRRTPSSTGRPLEDVLREADEIFSYRISTKHPRFFAFIPSPVSPMS
                     WLGDSLSSAHNTYAGSSESGSGVCAVEKSLIAWIAERFGLPSSAGGQFVSGASMATLT
                     AVAVARDQRLEAELRHRATVYISDESHFCITKALRVVGILDSQIRTIRCDSKYRMDSD
                     HLRRAISEDLADGFRPFLVVATCGTTSTGGIDPLNEIADIADEHGLWMHVDAAYGGSV
                     AFSSTHRPLVDGLGRADSIAWDPHKWLFQTYGCGTILFREKSHPLKSFASTAHFCRDF
                     EDEKEPQNPWNYGIELTRPARHMRLWFSLQVLGMDTIDKMIGRGFELSVLAEGEIKRL
                     ADWVILAPTSLAIVNFRFAPHGVDEKLLDQINTHVSKELAAENIACILTTLLDGVVGL
                     RMCTINPRTTDDDIRRVVRALGSSAQGAYRELFKARD"
     exon            948392..949855
                     /number=1
     CDS             950238..951155
                     /codon_start=1
                     /locus_tag="AO090010000342"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000179"
                     /protein_id="BAE66222.1"
                     /transl_table=1
                     /translation="MKIALAGVGDVGNYFMEEFSRSTHEVVLLTSKHKSHLDRLPIDQ
                     QITDYSVENLTLHLQDCDAVVSTFCGPEDKYISAHLAIPEACTRSPKCKRFLPSSWTT
                     NIEDFGDQPIMIAHSRDTIWKALRAQHEVKWTMICNGWFMDYVVPASQRYLRDVGVGW
                     VMDHQNKVFELYADGQQKVTLTSVRDVARAALSILEHDEIEWNEFTHFGGQTLTYLEL
                     YKLIKRRDPEWTLKKLPFAEVIERITSGKLVGEDVDLEYFRIMGFTNCNKAPEDRALT
                     WGTGLLEGLRARGVEELLDEAAKDEKVVP"
     exon            950238..951155
                     /number=1
     CDS             join(955322..955477,955538..956455)
                     /codon_start=1
                     /locus_tag="AO090010000344"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000177"
                     /protein_id="BAE66223.1"
                     /transl_table=1
                     /translation="MSAVGKVLIRRGHELTSARLEYRQQPQNPIHGWLGFSIVVLTAL
                     AFGFAIFWVDYTCNHVIATLAAVEDSNPTTYVRLDCEDSNDPCNPNYPEVAAPSTTKP
                     ITSGLRSAIKHLRARGGFWSCFRGFRMYLAYTGFDLGAGYLLPAVVPIPTHSLLSLFL
                     GKFIASMLLATWQMAWVHLVIADQSPRSRYRRMLGLQHWPRIAPAAALYNVLMSATLS
                     LPIAAARLSGGTVDGIVANPKKKELLNFLAMGILPAILFLLVSIPARGVFTRVAASML
                     PEEDDPIVPFDRRFGGKVKSAMVGGSGELSLLDAWTSFDWAARIRYVKIILKALVIEV
                     ALGVVGGLLVMGELELVTPSRHT"
     exon            955322..955477
                     /number=1
     exon            955538..956455
                     /number=2
     CDS             complement(join(957152..957280,957371..957732,
                     957813..958638,958733..958999))
                     /codon_start=1
                     /locus_tag="AO090010000345"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000176"
                     /protein_id="BAE66224.1"
                     /transl_table=1
                     /translation="MEIEREQKSLWHVGIESHDGSLESPTERTNTAVDPGDEGEKRMR
                     HIQEGNGLLRSLRNFETWIDRKLGVEAMGVERVPEDKRRPPQKLNMMFFWFSVLISPT
                     LIPIGSLGPIFGLSVHSSVILTIFAALLGTIAPAFTATLSPPSGLRQVAVARYAFGIW
                     GAKFCGLLNIIVNGGYAVIAAVVGGQLLVAVSGDSVPLAAGIVIIVAIGFLVSFCGFT
                     LIHHYERYAWIVALVLICVTWGQSARYFSPTPGLSQLSGIDYSGACLSYFAVVFGVAC
                     SWCPIAGDYYIHYPADTSKWLVFSLTYFGQVLPTIFVGTLGNHFGGIITSNDEMSAIY
                     NTKGTGALILATLRPAGWAKFACTIFALTFLANVIANIYSSALCIQLWGKHFLAIPRF
                     IWCALTSAIVLALAWGGRNKLEAIIDNFLAILGYWTLAFALILAIEHFWFRPRLGGYD
                     LSAWQDPKRMPVGIAGTAALLIGIGFSFLGMCQTWYVSPVARRIGKSGGDVGDYLVFA
                     SVGVFYPVLRTLEIRLVGR"
     exon            complement(957152..957280)
                     /number=1
     exon            complement(957371..957732)
                     /number=2
     exon            complement(957813..958638)
                     /number=3
     exon            complement(958733..958999)
                     /number=4
     CDS             join(959725..959977,960111..960218,960326..960363)
                     /codon_start=1
                     /locus_tag="AO090010000346"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000175"
                     /protein_id="BAE66225.1"
                     /transl_table=1
                     /translation="MAFLHSLSAVELGRCDRIVQHARRPPGGIMDLVCGHQCRGYLAI
                     VSGTLRLVARSDIRSQYLQGYAPGWIERSDGGGLYHAIDLCMQGLTEEDIQDRVYGSK
                     ITFVLEQSMVLVQWGCKACQEQRWLYQSRS"
     exon            959725..959977
                     /number=1
     exon            960111..960218
                     /number=2
     exon            960326..960363
                     /number=3
     CDS             964274..964984
                     /codon_start=1
                     /locus_tag="AO090010000348"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000173"
                     /protein_id="BAE66226.1"
                     /transl_table=1
                     /translation="MHHFIIIITLYLSALVAGGGIVSKPQPPPDGGIPMTDMKPGSSP
                     ETNIHKGGALQSECRFLKVHITSPSTTSKTPAQDPKKQGKGPTTITTPYRQVLLTADC
                     RRPKSDPTKGILDDDWRETKLDLDKCVGWDAQTQKLTPESDGKGLMKGDCWSCDYFSE
                     VMGAANKGEFECYCDNVEKKSKHKIPHSKDKSLKVKFDLGMSSSVGLGLGWVANVVID
                     SVLWSKDGRLNCHKHIGS"
     exon            964274..964984
                     /number=1
     CDS             complement(join(965488..965880,965934..968122,
                     968173..968440,968477..968791))
                     /codon_start=1
                     /locus_tag="AO090010000349"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000172"
                     /protein_id="BAE66227.1"
                     /transl_table=1
                     /translation="MEQPQTPVNAGQRLLTNVVDEIAQSNPQKRLGVIPSALEASEGF
                     RDVSFGDLAHAVNALSWWIEKQIGKAENNETVAYMGRNDILYLIFILACNKTGYKVKL
                     LKIPLLPSSRLSIEAYQHILGVTECHRFFYSHDKERQVSEMKNFLKDIDFYEVPATAD
                     ILNCSHVPEPYPFTKTFAEAEDDVAFIIHSSGTTGVTTGMPKPVPLTHGFVATLDSVG
                     YLPIPAGRRVAAPNDPSSSNLVLVTTPFFHLMGLYGLTCAIFHNTPFVNLPDRPVSVD
                     LVLDTIRATNPTITLLAPAILEDISQTQAGLDCLGTLNAVIYAGAPLAADIGNRIVPY
                     TKVVTLLGSSEMGIISSLVPEGDGNWGYFEWNPAYGVEMQHRGEGLYEFVIPRRENSR
                     AIHGIFHTFPDKTEYGSNDLFVQHPSNPTLWKYHGRFDDVIVLSNGEKLNPVTLEKMV
                     ECHPKIGRAVLIGQGRFQTSLLVEPHWDEQEKAIDEAAFIDEIWPVVERANETVPNYG
                     RITKTMIKLSSPEKPFKTTPKGTTQRRAVNRDYKEEIDAIYASADQQLNGSLPDIITL
                     NNITQYVNETICSLLEREAIDNDEDLYSAGLDSLQTIQLATILCNGVFCQVPAGDRPR
                     ITAQHIYAHSTVNQLAEFLLKVIAGDSVASIPRHDRIQNMVAKYTEDIPARPYSQAQL
                     PPTSTVILTGSTGSLGAYLLHILLTNKNVSKVYCFNRSDAQSRQIQSFKEKGLDAAPL
                     SDPSRVEFLKVSFGELHFGIDDTKYASLLSTVDLIIHNAWKVNFNHPLESFEDPHIKG
                     VREFISFSLESKYKAHLSFVSSVATVGAWTSEMGAVVPELPLEDDTAVLKQGYGESKH
                     VSERMCVIASKKAQVPTTIFRVGQIAGPTTKSGLWNPDEWLPTIVATSKALGKVPSDL
                     GSMPIDWVPVDKLAQITVEALQTRRRSLTETPNAFFHLMNPNHAAWSSLIPAIESKYN
                     TQTVPFGEWISDLESIKNPSDQDVREKPALKLLDFYRGLSSAGGMLSADISVERTKEA
                     SETMRGLGPISAELMENWMEQWGF"
     exon            complement(965488..965880)
                     /number=1
     exon            complement(965934..968122)
                     /number=2
     exon            complement(968173..968440)
                     /number=3
     exon            complement(968477..968791)
                     /number=4
     CDS             complement(join(970235..970658,972649..974231))
                     /codon_start=1
                     /locus_tag="AO090010000350"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070323000171"
                     /protein_id="BAE66228.1"
                     /transl_table=1
                     /translation="MDPENQSEWTKPACERHIPFWRQVIDQGAITQDVLHHNYPGSGT
                     ETEPFLVSWLPDDPRNPMLFTTFKKVGITVVVSTATLAVALASSAYSGSTKQVMEGLD
                     VGTEVATLGLSLFVIGFALGPLFWAPLSEFIGRQYPFIVSFGAMTVFLAGCAGAQNIQ
                     TLLVLRFLAGTAGSSPLTNAGGVISDMFRAEQRGLALCLFAAAPFMGPVIGPVIGGFL
                     GMNAGWKWVEGFLAALSGVLWLMMACFVPETYAPVLLRQRAKRLSQKTGMVYRSKLDV
                     ENEGSVSLKRMFATSLLRPWVLLFREPIVFMLSIYIAIIYGALFMMFAAFPIVYQRGR
                     GWNQGVGGLAFMGIAVGMIVGTIYTIPDNRRYTRTVKRHGGFAPPESRLPPVMLSAVC
                     IPVGLFWFAWTNSPSVHWMASIAAGVPFGCGIVLLYLGIMGYLIDSYTIFAASVLAAN
                     AVLRSLFGGIFPLFTAYMYEGLGIHWASSIPAFLTVACMPFPFIFYRYGEAIRKRCPY
                     SAQSEVYVRKLQVAAQQSENVSVADADTDAVHAAIDGRVWFFPESDVANGWDTPAGNG
                     SELWYQISFESSTKTASAEIAFFANSTQGFDAPEKYSIQVNVSGEWAEVSNANYSSPV
                     ANGITRATWDGVDADKIRLVFAPQEEKKVRLVEFKVFGEVVAEN"
     exon            complement(970235..970658)
                     /number=1
     exon            complement(972649..974231)
                     /number=2
     CDS             complement(join(974887..975702,975759..975906,
                     975962..976205,976279..976303))
                     /codon_start=1
                     /locus_tag="AO090010000351"
                     /note="amino acid transporters"
                     /old_locus_tag="AO070323000170"
                     /protein_id="BAE66229.1"
                     /transl_table=1
                     /translation="MKIFSYITGWLTVIGWQATYATVCYMGGNYIETLVTLTNPSYQP
                     KIWRQVLISYAIALFGFIINIAGGKVMPRFEGAILILHILGFFAILIPMVYMANHNTA
                     EQVFTQFLNEGQWPSQGLSFFVGLIGPVFAFAGGDAALSEEITHATVAVPLSLMLTVL
                     INGTLGFSMLIALLFCVEDIKGALEARVPFLTIFHQATGSVAGTAAAGSIIVVMGSCS
                     SAGMLASTSRQFWSFARDRGIPGWRLWTKVTTHTAIPAYAVTITTIIACLLSLIGIGS
                     DLAFNDLMSLSTSGLFSSYLVVAGLLLWRRCTGGISGSKSKHTLINTAGAQLVWGPFH
                     VPGVWGILINAFAVAFMTIAVFFSFWPPMNNVSAESMNYSVVGMGGVILLSLLYYLVR
                     ARKVYKGPVVELQVGYRA"
     exon            complement(974887..975702)
                     /number=1
     exon            complement(975759..975906)
                     /number=2
     exon            complement(975962..976205)
                     /number=3
     exon            complement(976279..976303)
                     /number=4
     CDS             complement(join(979277..979318,979415..979461,
                     979517..979582,979634..979793))
                     /codon_start=1
                     /locus_tag="AO090010000352"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000169"
                     /protein_id="BAE66230.1"
                     /transl_table=1
                     /translation="MQFLIVAASFVAVATAIPASNGISATNIQSAADINNIASAWTKA
                     KEDDGCSWLACISSVVGQSATCAAAAAELALNPIADVACVAGLGTMTCFGNRNQRLGK
                     GL"
     exon            complement(979277..979318)
                     /number=1
     exon            complement(979415..979461)
                     /number=2
     exon            complement(979517..979582)
                     /number=3
     exon            complement(979634..979793)
                     /number=4
     CDS             join(982114..982381,982432..982531,982609..982774)
                     /codon_start=1
                     /locus_tag="AO090010000353"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000168"
                     /protein_id="BAE66231.1"
                     /transl_table=1
                     /translation="MHLLTTPLLYRILSFQTSPERTRIVGIILSLLFTVVMVVHMVMD
                     EFLLHAVTFGTAVYLIATRTLKIIPRLIPDPVTRKNIQSVALFGCASFIFGYLVWLID
                     EWACRVLTKTRQAVGLPLAFLWHVFTAIGGYIAVAIIDLLTSGEVRNDSTEHLAWPIP
                     VIARLTARGNGLARKDK"
     exon            982114..982381
                     /number=1
     exon            982432..982531
                     /number=2
     exon            982609..982774
                     /number=3
     CDS             complement(join(989486..989877,989940..990257,
                     990318..990501))
                     /codon_start=1
                     /locus_tag="AO090010000354"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000167"
                     /protein_id="BAE66232.1"
                     /transl_table=1
                     /translation="MSGMLHKVKEAVTGHHDSTSDTTHTNTTNNANYAENPKSSNHGP
                     HGSAIANKLDPRVDSDRDNRAGHHTTTTTGPGGTTTTHSSTHGPQQAPVGAAGGVDAP
                     FGTTGHAGSHSTNAGPHSSNVANKVDPRVDSDRDNRARHEALGGAHGPHSSNLANKAD
                     PRVDSDRDNRAAGIGATGAIGTPGAYSSGASHGYGTGTGTGAGVGTGTGLGHGHGTTT
                     STAGPHSSNLANKADPRVDSDLDNRARHQGLASSSYNTSGGSTTAGPHSSNIANKLDP
                     RVDSDLDNRHNVGNVGTQRHI"
     exon            complement(989486..989877)
                     /number=1
     exon            complement(989940..990257)
                     /number=2
     exon            complement(990318..990501)
                     /number=3
     tRNA            992384..992474
                     /locus_tag="AO090010t00005"
                     /note="tRNAscan-SE"
                     /product="tRNA-Tyr"
     CDS             join(993430..993808,993860..993925,993981..995014)
                     /codon_start=1
                     /locus_tag="AO090010000355"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000166"
                     /protein_id="BAE66233.1"
                     /transl_table=1
                     /translation="MHGPRQAAPYIFRDDGELVWSGYGYYSIWATNFQKARWKGKDIL
                     FSFEGDHNAGYGHGHGHTTILDQHYETIRELRAGNHKLTDKHEFHIINEETALIQIYQ
                     PIPKDLTRWGASPEQQWIVNAIFQELDIETGELLFEWSSLDHVLPDEAILPINPGQAG
                     SGYNSSDAWDYFHINSVDKDSEGNYLISARDACAVHKINGSTGEIIWRLGGVKSDFDL
                     GPNVKFCFQHHARFVSRDGDKEVISLYDNSAHGTENGRGSEVHTHPFSQGKIIEINTA
                     TWKASIVQAFQPPDGLLSKSQGSTQLLPNRNVLVNWGSEGALTEFRPDGTPIFHTYMD
                     SGFLGLGVENYRGFRYNWTGLPNETPAIVSLENDQGTTVYVSWNGDTETKVWRFYQVT
                     DEYGSRQYLGETKRTGFETAFSLKSGNVHTVSAEAIGANGRVLTSTGIVKTQVEILPP
                     PKGVEASSSVSLQDKMQPQIYLGQKSRWEEHMILKVDRFHLD"
     exon            993430..993808
                     /number=1
     exon            993860..993925
                     /number=2
     exon            993981..995014
                     /number=3
     CDS             complement(995479..996249)
                     /codon_start=1
                     /locus_tag="AO090010000356"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000165"
                     /protein_id="BAE66234.1"
                     /transl_table=1
                     /translation="MPSKRISRRPFLSSEEVTVGSLINNINEPVKGAYGCPWPLGQIE
                     DFAVRSVPDMCAATQPTKDTGLSASFTRLFKTPGRGCADSDDMRPRGGKLYTLKNPRE
                     LFRNLSTNKGVKKWLQQQIGEKSDVYLVEGLATLEGNSTSSCMDSEDSYPAQGELICA
                     MRVLKLVFKPFRTKTLESGRLEKNSSWEVFSDCKLLHSQAAEWVEVSDGEESSLGDRD
                     RRAMGDNGHGGMFAFDEDLREQPRNRREEVSRFSDDSR"
     exon            complement(995479..996249)
                     /number=1
     tRNA            complement(996885..996956)
                     /locus_tag="AO090010t00006"
                     /note="tRNAscan-SE"
                     /product="tRNA-Ala"
     tRNA            complement(997682..997755)
                     /locus_tag="AO090010t00007"
                     /note="tRNAscan-SE"
                     /product="tRNA-Ile"
     tRNA            complement(998230..998301)
                     /locus_tag="AO090010t00008"
                     /note="tRNAscan-SE"
                     /product="tRNA-Ala"
     CDS             complement(join(998363..998493,998541..998747,
                     998802..999218,999264..999764,999980..1000004))
                     /codon_start=1
                     /locus_tag="AO090010000357"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000164"
                     /protein_id="BAE66235.1"
                     /transl_table=1
                     /translation="MPRPFLTNSDGLRPVCLRCQQASRNCQWSNRSPREQQSRSPTTP
                     DQSLTTRPRSAEYVSTKDPEAALRNPHIATIFRYYIEHLAGWYDLNDVKRHFGDIVPS
                     CARRNSLLLSAILAFAAASQSSSFLKKDLWDLAESYHLESVQALLQLTENPDEFRTGE
                     TLAAICLLRSYEIISQNVSCQNHLQGSYSLLASRPAGLEAGLLSAGFWNYLREDITVA
                     LIEKRSLMIELSQEHLPPTVEGEDDLANRITYLLGKVINRCLNQDASPLEQHEWHSLG
                     DELDTWRASLPASFEPIGTPGLYGQSNFPCLWTVSGWHASSLQYYHTALAILSIAEPM
                     QTGMNTLQQIQLINNFEKKLNHHAVQVSALAIFSNSAPVWVNSFGPISFCGPWLRDSQ
                     RVHELIEETRKWGSKTGWPVASIVESLSRSGTRG"
     exon            complement(998363..998493)
                     /number=1
     exon            complement(998541..998747)
                     /number=2
     exon            complement(998802..999218)
                     /number=3
     exon            complement(999264..999764)
                     /number=4
     exon            complement(999980..1000004)
                     /number=5
     CDS             join(1000429..1000783,1000839..1001279,1001330..1001511)
                     /codon_start=1
                     /locus_tag="AO090010000358"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000163"
                     /protein_id="BAE66236.1"
                     /transl_table=1
                     /translation="MQRITHITRLCKPTRSCTQSRSMSSFPTSISPSQSEIQSRQLSP
                     QNLEIAIRSLHHDGLVVVENVVPHDALDRLNHKMVKDAWTLRNRKENSPYNYNPGNIQ
                     QDPPPVRKYFDPEIFFNPIATQITTTALGPRPKWTFCSGNSAMPPTAENPPMSQPVHS
                     DADFAHPTHPFAYVVNVPLITMTPENGSTEVWLGTHTDSGLHVQEGMHGERASGRIQL
                     SALEKQRMIRPPCQPVVPKGALVLRDLRLWHAGIGNQTDDVRVMLAMIHFAPWYRNPM
                     RLEFAEDLKPLVEKETGLEIPVDWVTEAEAMSRYLNRGFGNSYDFSQRP"
     exon            1000429..1000783
                     /number=1
     exon            1000839..1001279
                     /number=2
     exon            1001330..1001511
                     /number=3
     CDS             complement(1002101..1002880)
                     /codon_start=1
                     /locus_tag="AO090010000359"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000162"
                     /protein_id="BAE66237.1"
                     /transl_table=1
                     /translation="MAAYTQKPLFNRCFQNAISSEAVIAEKLWAIEYLNDWFTNNSSA
                     SIPGPQADPNILQWETIYHLCINGSKEAVIRLLQLGLTFSVPWDPRTLFHAAVRRYDN
                     DKDILYHLLGNLPLNQFFLVFQPDETGETPLQCALNQPYFGEKEAMLLRWALHARRLG
                     WEIHYNRTLAVAARNGHIDAVKMLLGALHDARHDMNTDPLISAIRYMAKETNNDENLA
                     IGCDIVTQLAQYGHEMGWGNGVGYFVQELVGLFKYRVYGTT"
     exon            complement(1002101..1002880)
                     /number=1
     CDS             complement(join(1003656..1004109,1004211..1004218))
                     /codon_start=1
                     /locus_tag="AO090010000360"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000161"
                     /protein_id="BAE66238.1"
                     /transl_table=1
                     /translation="MEIKHPISEIPDHNETPSKPTSQNTYQERMGWNLDYSAITPGPG
                     GTVMLGEKGGAEAVARRAKERRARERELALQEGRLADDAVSETTLVPQSTQSGSIGGG
                     DVKPGSSFQGKALNCRKIAKAVSEGDGAPEVSGKKSGFRARWREFRERNLP"
     exon            complement(1003656..1004109)
                     /number=1
     exon            complement(1004211..1004218)
                     /number=2
     CDS             complement(1004512..1005768)
                     /codon_start=1
                     /locus_tag="AO090010000361"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000160"
                     /protein_id="BAE66239.1"
                     /transl_table=1
                     /translation="MDYQFGLGRLRPPTCHRCPFVVFKHLRLAISRRSSSLETIDLSS
                     LRLLYPRICTLTPNSNVSVTMVGINEVRKSNVALHAREGDFVAVFVGGTSGIGEATAK
                     ELAKTIKKPTIHLVGRNQAAGSKILEELKSANPDGTFHFIQSDVSLLRNVDEACSEIK
                     QKEKAIDLLFLSTGHLAASKQSKENHTYPSFEYVAANCKVDTSEGLENNHALRYYSRM
                     RFVHNLLPLLSASKAPARVVSVLAAGQEGKIEEDNLDLQKSWSIMKAGMYAATLNSLA
                     AEHLATLYPSISFVHVFPGIVRTPLMNKTMGSIAGSIVSFLSRPMSISSQESGERHVF
                     ISTSAAYPPAAPEDPTNAGVPLVEGVKTSVASTGKIGGGSYILNYDGANAANEKLMSG
                     YRAEDFPKKIWAHTLETFKKVFDPSQ"
     exon            complement(1004512..1005768)
                     /number=1
     CDS             complement(1006423..1007298)
                     /codon_start=1
                     /locus_tag="AO090010000363"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000158"
                     /protein_id="BAE66240.1"
                     /transl_table=1
                     /translation="MNPGGSGAFYKPPASDRIRVSPSTRYANRSYLGNLPRDIERPLN
                     GSATFTYSYNESTFARRLHRYCIEYAYQLFTDPRTDPQDIYRVFRLVSCVRQEDKLAR
                     CLSSLLSAGPKESLERPNVPFYCIGGAGTHYPHMQPDGKPLYPENMRLPGRVLGSIPG
                     SAQEMDNKSSSEKRQELLKLYGLDGTWLDCRDVQGYLEEKGFCLDGAPCIFATPTLEN
                     QENSPKAALDQSKDIPMNLDDSHKLTSLPLRTVDGTDERNSEKAANAAEQAAWVLNIE
                     EFVQSKYFVIYHHAL"
     exon            complement(1006423..1007298)
                     /number=1
     CDS             join(1010572..1010677,1010787..1010812,1010866..1011087,
                     1011204..1011227)
                     /codon_start=1
                     /locus_tag="AO090010000364"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000157"
                     /protein_id="BAE66241.1"
                     /transl_table=1
                     /translation="MQSRGGVPQTIEFEYGAKGHWIGNKNARNVLIWYHVSFNVRPLR
                     YPTQLIQSVEGLRYILTETNRTPANILLGGDSAGGNLAVGVLSHLSSPHEAIAKLDVQ
                     EPLAGTVLIAPWTSLEYCSFKLV"
     exon            1010572..1010677
                     /number=1
     exon            1010787..1010812
                     /number=2
     exon            1010866..1011087
                     /number=3
     exon            1011204..1011227
                     /number=4
     CDS             join(1014181..1014413,1014461..1014519,1014744..1014794,
                     1014868..1014899,1014997..1015008)
                     /codon_start=1
                     /locus_tag="AO090010000365"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000156"
                     /protein_id="BAE66242.1"
                     /transl_table=1
                     /translation="MKSPIYLLTALLPLTLPLVNATPTAEPDDLEVEGSVLEDRDNCR
                     VERPFVYRKYPCDSSDITGRANRGDNVNFQCRYRNWYKTPKGWVKQDDKPRRCLILIF
                     NGFVDLFIYDIFKLLPESTENHSILD"
     exon            1014181..1014413
                     /number=1
     exon            1014461..1014519
                     /number=2
     exon            1014744..1014794
                     /number=3
     exon            1014868..1014899
                     /number=4
     exon            1014997..1015008
                     /number=5
     CDS             complement(1015612..1016244)
                     /codon_start=1
                     /locus_tag="AO090010000366"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000155"
                     /protein_id="BAE66243.1"
                     /transl_table=1
                     /translation="MFYGQSSIDMQVLLIAEITKRRAELRDVAESVLTINDLARFQLT
                     KGQLLDSNAASMCNLLGERGIAVHKRLTIDEEHSILGDMPYLSMMKALYQAGFRDKSS
                     LAPPQPVYPVANLQRAMWLMDMDLSLKVSKDGFSTVLELCSSITYSFSSMVRQPGPWT
                     SLTCKHACQVVTGLFQALNKEERQFWLGCLASKETTAAHVPALQGKDDVR"
     exon            complement(1015612..1016244)
                     /number=1
     CDS             complement(join(1017647..1017746,1018203..1018884,
                     1018932..1019165,1019219..1020236,1020287..1020415))
                     /codon_start=1
                     /locus_tag="AO090010000367"
                     /note="2-polyprenyl-6-methoxyphenol hydroxylase and
                     related FAD-dependent oxidoreductases"
                     /old_locus_tag="AO070323000154"
                     /protein_id="BAE66244.1"
                     /transl_table=1
                     /translation="MSELKEDYVDVLIVGAGPAGLMLANWLSRFDIKTRIVDKRGTKI
                     FNGQADGLQCRTLEIFDSFDFAHRVWRESNHMLEIWFWNPDKDGILRRSDRIADTIPG
                     ISRFQQVVLHQGRIERFFLDSIKEHSDITVERGVLPTTFEFDEAKAADFEDYPITVTL
                     RTLSEEEATPAQRQQHHRRADGTQSVINDGLFRSNLAADDTDDLIRVAKANNNASSVE
                     TVKAKFMVGCDGAHSWVRRQLGFKLEGDSTDYIWGVLDIVPITDFPDIRHRCAIHSAN
                     AGSVMVIPRENKLVRLYIQLQVTEHAQSGGKADRSWITPEVILQSAQRIMHPYKINYT
                     YCDWWTAYQIGQRVGDHFSLRERVFLAGDAVHTHSPKAGQGMNVSMQDTYNLGRKIAH
                     VVKGYSEGSILKTYQSERRRVAQDLIDFDHRLSRLFSGRPAKDGANEGVSMEEFKNAM
                     EKGNEFASGIVVNYGSSIIVAKEGDSVEQGDGTEVAANLQRRVVSKTHLATKIDIGKR
                     MPSFKVLNQSDARPWHLQELLKSNGRWRIIVFPGQLTQPQNMQRIQKLGDQLGSQDSF
                     IRQYTPSDQLIDSLIEVLTVHAGPRTGVELLDLPEAFHPFDEEMGWDYWKVFVDDQSY
                     HEGHGQAYFNYGIDPIHGAAVIVRPDQYVSWVGEVDDYEDMARFFSGFMRVQDSSKPK
                     SRVVKLWSVLLKPALITSRRQLSGVGATPTPPVQHDRL"
     exon            complement(1017647..1017746)
                     /number=1
     exon            complement(1018203..1018884)
                     /number=2
     exon            complement(1018932..1019165)
                     /number=3
     exon            complement(1019219..1020236)
                     /number=4
     exon            complement(1020287..1020415)
                     /number=5
     CDS             join(1021411..1021482,1021549..1022499)
                     /codon_start=1
                     /locus_tag="AO090010000368"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000153"
                     /protein_id="BAE66245.1"
                     /transl_table=1
                     /translation="MATKYAKSQGPDFRNEIQRVAIIGAGGTVGKPIAQELIKTGKHT
                     VTALTRAGSQSTLPEGIQTVPVDYDDKASLLRALEGQDALIITLPVTAAPDTQSKIIQ
                     AAAKAGVKYVMPNVWGCDVANDNLVNSGLGWERLRGAFDEIEKTGVSSWVSLICGFWY
                     EHSVSLGPATFGFNFAEKKMVLFDDGETKINVSTPAQCGRAVAKLLSLKVLPEDENDR
                     SVTLSRWLNKPVYISSFRITQKQMFQSWKRVTGEKNEDWTVAYESSRERYEKGLEGMQ
                     NGDHGAFVQAMYSRVLFPNGDGDYESKHALANETLGLPQEDLDELTRNAKVMIDRGYD
                     YMTKRD"
     exon            1021411..1021482
                     /number=1
     exon            1021549..1022499
                     /number=2
     CDS             complement(join(1022658..1022691,1022741..1022844,
                     1022916..1023097,1023148..1023377,1023426..1023716,
                     1023768..1023869,1023939..1023973,1024024..1024120,
                     1024174..1024282,1024342..1024516,1026523..1026600))
                     /codon_start=1
                     /locus_tag="AO090010000369"
                     /note="proteins containing the FAD binding domain"
                     /old_locus_tag="AO070323000152"
                     /protein_id="BAE66246.1"
                     /transl_table=1
                     /translation="MQPALYLARSSMFEPAIGRAKVFAITETLGEDSVSWDEEEIAIH
                     GYSELSTSNCEARPIAVVRPKTTEDVAFIAKICTAFKIPMIPFAGGSSVEGNFVAPYS
                     GLTIDFSDMKRIVSFHPDDMDVVVQPGVNWVDLNKLLKNSGLFLPLDPSPTALIGGMV
                     ATNCSGTNAVRYGTMKDWVVNVTVVLADGNVIKTRHRPRKTSAGYNLTSLFTGSEGTL
                     GMITEITLKLATIPEKQSVAVATFPSIREAAATASKIMRTGIQIAALEMMDETQMMVI
                     NKNGGTGGRLWEEKPTLLFKFSGTQRAIEEDVERVRTISSQHSGENFEFAKSEEEMNS
                     LWAARKESLWAMLAARPEGTQIWSTDVAVPLSRMAEIIDLSKKESGQLGLFSSVLGHV
                     GDGNFHQAVMYNPNDPEQKQSVRDCVLAMVHRAVEMEGTVSGEHGIGLGKKECLLEEL
                     GPETVGVMRTLKRSLDPHCLLNPGKIFD"
     exon            complement(1022658..1022691)
                     /number=1
     exon            complement(1022741..1022844)
                     /number=2
     exon            complement(1022916..1023097)
                     /number=3
     exon            complement(1023148..1023377)
                     /number=4
     exon            complement(1023426..1023716)
                     /number=5
     exon            complement(1023768..1023869)
                     /number=6
     exon            complement(1023939..1023973)
                     /number=7
     exon            complement(1024024..1024120)
                     /number=8
     exon            complement(1024174..1024282)
                     /number=9
     exon            complement(1024342..1024516)
                     /number=10
     exon            complement(1026523..1026600)
                     /number=11
     CDS             join(1040783..1040795,1040834..1041348)
                     /codon_start=1
                     /locus_tag="AO090010000372"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000148"
                     /protein_id="BAE66247.1"
                     /transl_table=1
                     /translation="MVDRLVGSIDTLQVNAARALRVAEIINDYRTLLVHIARHNVQIP
                     TEDYHEEAYKEIRDGLAAAQALMSANYNPIVASAQSNTETEKAELKRYGDPLYQLARR
                     ILIICRTILDASARRFQAHRIYLRVAVARRWVIARQDILRGARPGIQHTASLIAVGNT
                     FRQVNRALYFQICKH"
     exon            1040783..1040795
                     /number=1
     exon            1040834..1041348
                     /number=2
     CDS             complement(join(1044290..1044308,1044779..1045284))
                     /codon_start=1
                     /locus_tag="AO090010000374"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000146"
                     /protein_id="BAE66248.1"
                     /transl_table=1
                     /translation="MNQVLTILFLYLSALAVGLGLPMPGSKSPSPPPDQNRSPSPIQI
                     DPAAAAAAIVSNLHRSCGNFAIVASSEDVPGSPSSAGTPSSAGSPGSPGSPNSLGSPG
                     SPGSSGPWSPASPRSPAQRMRRADDSPPAFLVADCTNHLGQRHKVNLNLNRCFGWDTD
                     NVRFTVQQKKGSLV"
     exon            complement(1044290..1044308)
                     /number=1
     exon            complement(1044779..1045284)
                     /number=2
     CDS             1046627..1048111
                     /codon_start=1
                     /locus_tag="AO090010000375"
                     /note="beta-lactamase class C and other penicillin
                     binding proteins"
                     /old_locus_tag="AO070323000145"
                     /protein_id="BAE66249.1"
                     /transl_table=1
                     /translation="MQNLVPMTTSTLMPICSITKQMVCMILKDLERNPTPEMVKRGNV
                     SRQFSDALHQMLHPDLTTNTALELEHLCHNQSGIRDYWAMSMFWGAHPDGVFRLEEDA
                     KKALERTKSLHFEPGTQYSYCNLNFYILARLIENVSGQTLSALLTERLFLPAQMKTAR
                     LCADNANLPPPCVGYEGTESSGFIPAINRMQWSGDAGVVASLKDMIAYEHYLLTCWDE
                     EKSVYRAIAQQQSFKDGTVAQYGYGLKHVTIRGMATIGHGGALRGFRLHRIQAPSEKV
                     AVVVMLNHQADAEEAAQDIMKSVLDIFPSHVPQSDPVNPSPDWFGTFYDPDAQLVVEI
                     RHGGQGHVIVSYAGSDETLICVGENEAGSNNTVGIIDGGIPKLRRLVDNRVLDVKRVA
                     TGYPPHKDDYLGEYYCAEIDSTFRCSGAGGMLYGHFEGYLGQGPPHLMRYIGEDIWML
                     SCPRGLDAPAPGNWTVVFQRADHGDITSVTIGCWLARKVVFVKR"
     exon            1046627..1048111
                     /number=1
     CDS             1052475..1053983
                     /codon_start=1
                     /locus_tag="AO090010000377"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000143"
                     /protein_id="BAE66250.1"
                     /transl_table=1
                     /translation="MQFFRQLLAIGLVVTAAQAYATSRSSMLRTVVTTDMEQDDLASL
                     IRYLLYTNELDTQGIIYSSSRFHWSGDGNGTKFFLPDREYTTPQWTWRWTGTRTIQVN
                     VLQAYAEVFPNLLSHDPFYPTPDELLSKVKIGNIDFEGEMDHDTDGSNLIRSLLLDQD
                     PRPLYLQAWGGTNTIARALKSIEEQYSGSQQWTQTKDTVSSKAVILASGFQDEAYANY
                     ISVNWPQIRVENLQTGYSTWGYNCDKGQGNTRGLPDDGVYFTGDWIKANIQTGPYGKL
                     YRSWLDGQSMPGDAQDIFGNRSTALSSFCKPLDPYDFLSEGDNVVFNPLITTGIQDPA
                     NPNLGGWGGRSTQNTTSPNLWEMVTSEKNGTGVEVDNYTTDRWAAAVQNDFAARMQWT
                     LTPSYEDANHPPSVEILNRTTVEAHPGATVTLAGAVSDPDNNTVTTSWWQFFEEGTYP
                     GSVTVTESDGHRADVTIPSDAKTNQTISIILQGTDDGQFPLTRYGRVFIQVI"
     exon            1052475..1053983
                     /number=1
     CDS             complement(join(1054778..1055293,1055350..1055411,
                     1055620..1056025))
                     /codon_start=1
                     /locus_tag="AO090010000379"
                     /note="predicted dehydrogenases and related proteins"
                     /old_locus_tag="AO070323000141"
                     /protein_id="BAE66251.1"
                     /transl_table=1
                     /translation="MTVSPGNRRIKFALFGLGRLGVIRARILAFQQPRIELVAVCDTK
                     PGTDKWAAENLPPSVKHFSEPQECLKNSGAEAVLICTATATHAPLILQALDLGLHVMC
                     EKPVSVDIATTQAVVEKAASRPDLKFLVPFTRRSFFVSFSEQSGGIFLDFGIHTVDAG
                     RYLLDVKAGLSNPKKQVNRVIAFGQVAVYGDLAKYGDADNAWGLVEFANGKIFKTYLG
                     RTLTSGFEDTTRLCGTKGHSIISANSNVEIRDHLGIRTQSVPDAFTLFDATFLADLSE
                     FADAVLDNKPMTCQPEDAFEAGKICAALQYSFRKGVPVYFDDDGLPIMESK"
     exon            complement(1054778..1055293)
                     /number=1
     exon            complement(1055350..1055411)
                     /number=2
     exon            complement(1055620..1056025)
                     /number=3
     CDS             join(1056659..1056899,1056962..1057370,1057425..1058646)
                     /codon_start=1
                     /locus_tag="AO090010000380"
                     /note="predicted flavoprotein involved in K+ transport"
                     /old_locus_tag="AO070323000140"
                     /protein_id="BAE66252.1"
                     /transl_table=1
                     /translation="MANIESKSAALNHDRVQKPVADDFMYDFKYNHHLPTTDILGVDI
                     PADCDAKKEAEGIVARLAKTMSEGDAQAFAGLFLDYGVWRDKLSFTWDFRTFNFRDAI
                     LKAATDLFPQTKARSFQFLEPVPTVARPYTDYSYLQFVVSFETELVVASAVINAVLTQ
                     DGWRIYTMHTVAEGLKQFPEQPAPDGHMTGITSWASQRSEAINNVDPEILIIGGGQNG
                     LAMAARCKVLGMENLIIERSDEVGDIWKKRYEYLSLHFPHWPDALPYFKYPQHWPTYT
                     PAQKQALYMQWYASALELNVWTKSSVVKAEQDAEGKWTITINKEGKETRTLHPKQVIM
                     ATSLCGVPYTPTVPGMDEFRGVIRHSSAHDSAREFVGKKVCVVGTSSSGFDTAFECAR
                     LGIDVTLLQRSPTYVMSLTHSVPRMLGSYAPDEHGNLPDLEEQDRLFFSTPVGPGEEL
                     SRRTAKVLEDLDRPLLEALNARGLRTWRGQRDTGNSTLGQTRNGGFYFDAGACEEIIN
                     GNIKVEPGYCEKFTADKVILNGGREKEFDLVVFATGFSNTIDSIRATLGEKIASQCGP
                     IWGIDEEGEYKTAYRETGVPNLWIMVGFLPMTRYASKLLALRLKALQEGISPPPYKV"
     exon            1056659..1056899
                     /number=1
     exon            1056962..1057370
                     /number=2
     exon            1057425..1058646
                     /number=3
     CDS             complement(join(1059171..1059448,1059516..1059813,
                     1059874..1059903,1059959..1060079,1060233..1060317,
                     1060381..1060441))
                     /codon_start=1
                     /locus_tag="AO090010000381"
                     /note="aldo/keto reductase family proteins"
                     /old_locus_tag="AO070323000139"
                     /protein_id="BAE66253.1"
                     /transl_table=1
                     /translation="MSPPSHFKLNTGAQIPAVGLGTWRSEPGQVRQAVSYALKNGYTH
                     IDAAFGVPREKIFITSKLWNTHQPNVAEGLQKTLNALGTDYLDLYLIHWPVRLVPNES
                     SELLPVNPDGTRSVDRSWDQSETWRQMEEVYKSGKVKAIGVANWSIPYLEELKKKWTV
                     VPAVNQVELHPFLPQHALKEWCDKHGILLEAYSPLGSEGAPLMSDPVIQEIAKKNGVS
                     AATILISYHVNRGVVVLPKSVKESRISSNSQVIPLSQEDMNVLNGLAAQGKAKRINTP
                     LFGWDLGFDDWYSQ"
     exon            complement(1059171..1059448)
                     /number=1
     exon            complement(1059516..1059813)
                     /number=2
     exon            complement(1059874..1059903)
                     /number=3
     exon            complement(1059959..1060079)
                     /number=4
     exon            complement(1060233..1060317)
                     /number=5
     exon            complement(1060381..1060441)
                     /number=6
     CDS             complement(join(1061230..1061353,1061437..1061865,
                     1062130..1062205,1062277..1062379))
                     /codon_start=1
                     /locus_tag="AO090010000382"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000138"
                     /protein_id="BAE66254.1"
                     /transl_table=1
                     /translation="MASVLRFRTAWGIDPGTSYENWAKWFPTLKAQGYVDITDLNDLP
                     SIRRIADDAGLEVNVLEGWTVDEAVEFYSGTFAIDAELGLTGKVSHETHRNTALFNPY
                     STAAVLRRVPNLRITADFSHWVVVCERLLDTHEEDKQILSAVIPHVTHIHARMGTTQS
                     SQCPDPTHEVFKEERRFFETVWKQIIDATATASEPITFVPEYGPYPYHPFGSQKTFSE
                     VADSEGARLHPSFETYAKAAIASRS"
     exon            complement(1061230..1061353)
                     /number=1
     exon            complement(1061437..1061865)
                     /number=2
     exon            complement(1062130..1062205)
                     /number=3
     exon            complement(1062277..1062379)
                     /number=4
     CDS             complement(join(1063355..1063526,1063572..1063893,
                     1063931..1064354))
                     /codon_start=1
                     /locus_tag="AO090010000383"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000137"
                     /protein_id="BAE66255.1"
                     /transl_table=1
                     /translation="MTNSLFCEPHPDFVAHNAASALLVTSPALNDWVGYTAKETYPAS
                     VKLVEATERYGSSQLTNHAEYNLAFDTDEPMFVHLQRFPERERRLANIMVEMTSTEGY
                     GVHHPVEGYPWEEVKGKVVDVSCSPSPPQLSWSLSFSYLCHASIAISRKSPAAQLVLQ
                     DAQGVVEQGRAALAPALTERITFQTHDFFTAQLVSADVRFILHDHPDAEAVKILQNFL
                     PAMKKGSRIILNVGVLPEPLTLGRSEERIARIMDMEMITTFNARESPLEDWKKPCGDA
                     HPALELRRIFKPTGSIMSIMEFVLEEYLS"
     exon            complement(1063355..1063526)
                     /number=1
     exon            complement(1063572..1063893)
                     /number=2
     exon            complement(1063931..1064354)
                     /number=3
     CDS             complement(join(1064413..1064508,1064564..1064812))
                     /codon_start=1
                     /locus_tag="AO090010000384"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000136"
                     /protein_id="BAE66256.1"
                     /transl_table=1
                     /translation="MSAPSSPSLVDSAAHIGQATEQVNAFLVANGQPQPSFDRDAPPV
                     FPEAPADIQAARQQILDACQTIYDALVGPAEYLRWLACRDRKAPRHVQPPVALSFQHR
                     GPHPVGPSRSVQ"
     exon            complement(1064413..1064508)
                     /number=1
     exon            complement(1064564..1064812)
                     /number=2
     CDS             complement(join(1066404..1067337,1067370..1067551,
                     1067606..1067782,1067830..1067919))
                     /codon_start=1
                     /locus_tag="AO090010000385"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000135"
                     /protein_id="BAE66257.1"
                     /transl_table=1
                     /translation="MAAKELVNDMKLNAEIHPDGTTHILSNLTTKEKLLGEGTYGKVW
                     LERCSSREGPARLRAVKMIIKPTNSAHRAYCDQELEAIAKFSQQKYTGLFVKSSGWFE
                     NEESIFIAMEHIELGDLDIHLKGPLPEIEARQISYQILQGLQHLHDNGYTIIGKVRPL
                     KAPVDERSLNVFIMSTSPHWWVKIGDFGFSKRHTEGVALQSMVGTLLFLAPEVLKLYP
                     PGLGRKRIRSDYTHTADIWSLGVMTFYMLCHDYPFPDYHSLWSYVQSSDLPSATKLKS
                     VSESARELTNSLLVVDATVQLSAKEALQSRWLKQDSFDPVSGMASLAISEESMPRKSA
                     SPLARNINATVSDASKGWDEVEKSSVIVDEEPIRIALETEIKQACSHSRTPMEHDPLA
                     EQRSTLSATLLDLQAMRENGVSLIDLEIFSEAETICRQAWEGYKQALGEKHINTLASQ
                     FNLGTAVLAC"
     exon            complement(1066404..1067337)
                     /number=1
     exon            complement(1067370..1067551)
                     /number=2
     exon            complement(1067606..1067782)
                     /number=3
     exon            complement(1067830..1067919)
                     /number=4
     CDS             join(1068459..1068831,1068890..1069956)
                     /codon_start=1
                     /locus_tag="AO090010000386"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000134"
                     /protein_id="BAE66258.1"
                     /transl_table=1
                     /translation="MTLAAHSENQHLLPLFSLGVDVWYIVLDLLREEVDPDDYEDDEE
                     EEDPDSAWKPKNVARRQPYLPDLISLSSTCTWFRVVLAPIIFANLELNNTAKSARSIT
                     AIGKGRHAACVKTLRYIGICETDQQTSPLEEVYPPEVDQVLSNLHMFGSLDKLTIEFP
                     FDYESDLLFEYLQSDIFYPENAPLEESENTWRGFMAATFRAIVSNYSHASSNRRLPLN
                     IEFRDLNIFMVSVYATEPFQSFLSQLKSFDLSLRRWDNGVGWTMITQRIFREFTHYLG
                     PFFFDHLATVEEFSFDPRETGTLGNGGQPYCEDIGLRNTTLPRLRKLTLNNIIICLEL
                     RDFLVRHKATLESITLQDCFACDEQAWVYGEQIDWRELFTTLAQESFPRLTEFEAVWS
                     DSTLQLLGVDDTWADHRVVQRVREKLDREPDAKVFAYCEVDDKYGVRYCDGIVNQAAF
                     LNGADNLGYLDLMAIVHRNSEQGSLVVTD"
     exon            1068459..1068831
                     /number=1
     exon            1068890..1069956
                     /number=2
     CDS             complement(join(1070423..1070463,1070527..1070931,
                     1071008..1071167))
                     /codon_start=1
                     /locus_tag="AO090010000387"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000133"
                     /protein_id="BAE66259.1"
                     /transl_table=1
                     /translation="MHFKAYILAAIATASTALAHMEMIRPFPLKSQFDPNNDWSNIDY
                     DNTSPLEPSGSNFPCRGHHKTTSWRTVANYTAGQADYMKLAPGNNHHGGSCQISLSYD
                     NGETFRVIESYMGGCPLKLEWDFEIPSFAPSGKALFAWSWFNIEGNREMYMNCAQVEI
                     EGGSDSAQFDQLPEIFTANVGNGCRTVEGDAPFPKCGGNAE"
     exon            complement(1070423..1070463)
                     /number=1
     exon            complement(1070527..1070931)
                     /number=2
     exon            complement(1071008..1071167)
                     /number=3
     CDS             complement(join(1072528..1072732,1072820..1073193))
                     /codon_start=1
                     /locus_tag="AO090010000388"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000132"
                     /protein_id="BAE66260.1"
                     /transl_table=1
                     /translation="MIDDPSVASINLSNEVADVLLGWIRTTPPGAKFENGLELIGLNV
                     SNDQTMVNNWNHSRSKAANVSVVMDLVEFLINPNVLSNVTCSIITTYSEQKKCYIAKM
                     PELSVKLNIVFEGIVDVVTGDRIRANVAITRARACLIVVANGRILDNDRLILVHWQYL
                     LNNDLIVDCPGELPTVDSNVEKEKKSAGPTNL"
     exon            complement(1072528..1072732)
                     /number=1
     exon            complement(1072820..1073193)
                     /number=2
     CDS             complement(join(1075473..1076329,1076381..1076495))
                     /codon_start=1
                     /locus_tag="AO090010000390"
                     /note="dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /old_locus_tag="AO070323000130"
                     /protein_id="BAE66261.1"
                     /transl_table=1
                     /translation="MAAFIGANLNPCNYIGGVSFNPERDIPDLSGKVALVTGGNAGLG
                     KETILQLAKHRPQRIYLAARSETKAQAAISSLKGSLSNNVEITWLPLDLMSIKSIQTA
                     AQTFNAESSRLDILILNAGVMSLPPGETEMGHEIQLGTNHTGHFLLTKLLLPTLLKTA
                     EEPNSDVRVVSLSSIGHNLAPSFETILDQDRLKKVNTNTRYGASKAANILFAAELARR
                     YPSITSVSVHPGIILTDLYSSVSDRSALAALGSKTLGLFGTQVPQGAYNELWAAAGAK
                     KHDLVNGSYYIPVGHLKPYNQYARSEDMGRRLWDWTESELRKFNALP"
     exon            complement(1075473..1076329)
                     /number=1
     exon            complement(1076381..1076495)
                     /number=2
     CDS             1077733..1079646
                     /codon_start=1
                     /locus_tag="AO090010000391"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000129"
                     /protein_id="BAE66262.1"
                     /transl_table=1
                     /translation="MKRKHPEYEQRRTNKRSLREPLASKQGGEGSRSQRHDVYLSSES
                     SPDSQEGFHPQNSGDECELEVDGGFWNTPLPHEQHALFHRHDGESSTIRTSGPATAEG
                     NRDQVVTGPSTQGPSLNGSDCMGRMVQDAIELERSLLLGTSFLKATYELDDQLQSAII
                     TQPTAFDSTLAGCAYNQGSPGLSPTNDQGDWLPSPTQITQGCDLFFKHVSHFLPFLHQ
                     PTFDATRVPLHLLLSILSLGYQHGEDPECGDQTGSGASLSTRCFHQARALTVAEENKT
                     DQPRQNTTLIQSYLLLQICAMMYLCGEDSARGLKMHSNMISLARAGALMKPMPTESST
                     TEDLEALWREFIKSESHKRTSFAVHQIDALWYQFLSIPRSISHLEVKHDLPCPEAQWT
                     APSAAEWAHRHLVARNPGPAVPYPDAVRRFLSSDASPDTIPTFDPYGAINIAQFLISS
                     AREVSGWSTMTGMLSMDRLDALRSSLIALGPFIRPQPETPRAMHATATWETAMIELHL
                     WSPAHTGGIVASSLNAVVTQSTSLAPSYEFLWEADTAKAIQPHVDWFLRYLDTTLEPD
                     MEAPWVAVYAYKAFLIAWQLVRGGIPNAMLVAGIADGDVEGALGWARKVFRRRQRWQL
                     GRLILTCLDGLGD"
     exon            1077733..1079646
                     /number=1
     CDS             complement(join(1079821..1081107,1081159..1081347))
                     /codon_start=1
                     /locus_tag="AO090010000392"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070323000128"
                     /protein_id="BAE66263.1"
                     /transl_table=1
                     /translation="MATAMDTKKGPLSVHSDDNISAAEGQVDIPDAAYRRMPESLRNL
                     SEDELNTLNKKIVRKVDFLNLAAAKLQGIMEDLNMTTQQFATAVSILFVGYLPFQIPS
                     NLIITKISRPGMYICVAVVIWGCISAATAAVKTYGQLLAVRAILGVAEAVFFPGAIYY
                     LSAWYTKKELGKRIAGLYIAQQVGNAFGGLFAAAILQLDGAHNIAGWEWLFIIEGSAT
                     VGIGVVCACIMPEFPHNSRILSQIERDLAVWRIESEAGAAEGTENESVLRGFTKALSD
                     PKLLLLIFANMLSQTQGSIANYFPTLVASLNFNNTVSLLLTAPPYILAGAVYYVLMYY
                     SDRKNTVYPIIQLCVAIAIVMYIIPMATLNVGARYFSMVILPFASVGPQLLLYKTINL
                     HLARPVSKRAAASALVNAIGGTSNIWASYLYYEPPHFYAAFGTLMASAVLLAVTMTVY
                     RWLVLRENKRLDSGDPEEIAKVVRGGVTEEMVQLNWRYEMY"
     exon            complement(1079821..1081107)
                     /number=1
     exon            complement(1081159..1081347)
                     /number=2
     CDS             1082040..1082744
                     /codon_start=1
                     /locus_tag="AO090010000393"
                     /note="2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase"
                     /old_locus_tag="AO070323000127"
                     /protein_id="BAE66264.1"
                     /transl_table=1
                     /translation="MAIPSVRMAQIVALTGVDGIIIDCEHGHISDDSMHNSVSAISAL
                     GVSPIIRIRGPAHDIIKRALDTGAHGIMVPQINNAEEAQQIVASSKFPPQGVRGQGSA
                     FPAIGHGLTTPEYMISANETILTMIQIETREGVENVDAICAVPGVDLVFIGPNDLAQS
                     LLGYVPARGDEPEFVAAVDKIIAAARKHGKWAGRMVNNGTMAKEARERYDTVAITGDT
                     KAIQNWYIAEFEVARS"
     exon            1082040..1082744
                     /number=1
     CDS             join(1084455..1084746,1084807..1084889)
                     /codon_start=1
                     /locus_tag="AO090010000397"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000123"
                     /protein_id="BAE66265.1"
                     /transl_table=1
                     /translation="MAPAAPFNPPSADLPGKPFVPEWVPPPVTKEKHNFAELKSIDLS
                     LLDSEDPAVVDDLVQQVKVAIRDDGFLFLENYGVSLEQVSNASYEENSNSIDCPRRTK
                     SAFFSTPIAESGLVTSIRMDLR"
     exon            1084455..1084746
                     /number=1
     exon            1084807..1084889
                     /number=2
     CDS             join(1085051..1085543,1085602..1085840,1085922..1085975)
                     /codon_start=1
                     /locus_tag="AO090010000398"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000122"
                     /protein_id="BAE66266.1"
                     /transl_table=1
                     /translation="MDEIEAFSNYLTKSVNRRLLTVLSRVLELPDDYLWDNVQSHGSP
                     TGEGYFRHALFRPVQKQTQEASKGLRMHGHTDFGLTTLLFSVPISCLQIWGRDEQWYY
                     VPYKPGALVINIGDTLEIVSGGHFKATRHRVFRPPADQLHEERLSLVLFNSSIGDLRM
                     APAHDSKLIQREGCVEEQGVYKEFKKLTSQGKLVPTNRQWREIQIATCTDPTDTVNNR
                     VGAHQVLIDGKVMHQREYMGVKVVLPVIFDFQLLVFILSLLDS"
     exon            1085051..1085543
                     /number=1
     exon            1085602..1085840
                     /number=2
     exon            1085922..1085975
                     /number=3
     CDS             join(1086944..1086949,1087090..1087350,1087405..1087531,
                     1087609..1087679)
                     /codon_start=1
                     /locus_tag="AO090010000399"
                     /note="translation initiation factor 5A (eIF-5A)"
                     /old_locus_tag="AO070323000121"
                     /protein_id="BAE66267.1"
                     /transl_table=1
                     /translation="MSDDEQHDQTFEQHQQHASPTYAALVSTLTKGAHVIIRGRPCKI
                     LEISKIGTNIHLVARDIFTDRILSDDIESTQSVEIPHVYRNEYMLVNIDEGFLNLTNQ
                     DGTMKDNVKVPGGGLGQQIEQDFEAGTDLLIAVISAMGEEHAVSVREAPKGS"
     exon            1086944..1086949
                     /number=1
     exon            1087090..1087350
                     /number=2
     exon            1087405..1087531
                     /number=3
     exon            1087609..1087679
                     /number=4
     CDS             join(1088504..1088777,1088829..1090000)
                     /codon_start=1
                     /locus_tag="AO090010000400"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000120"
                     /protein_id="BAE66268.1"
                     /transl_table=1
                     /translation="MAKSKAAKRKRNAQVELPQKVPKAAPTLTPPPDGEPKHLKTVVP
                     DEDLEITIDTLTTLAQYPALTKSKACKDLRAAVYDFRQACTTGVNAAEGANLTARITG
                     ALADEKYIDAKILLAEMRIRGEQPKIGALCRWVRDLDVVSGLSTQPDAIDRVPLERSA
                     KELELLRVLDAILRVSTPIDTNPDAVDSTSPIAFQSIWDLRPSSAPLPVYASVLDKSI
                     LADAPKSPSALRVIETTPGPLRKPPNHHPAILYTSAPNAVPLAPVGPTITYHPHPAVP
                     GLGLALNVLSPAECKAIIAAGESVNFLPDAPLREDGDMSILAHNFYWVVDTTFHDMLW
                     ARISSYVPQSINGRLARGINRRFRVYRYVPGAEYRCHIDGAWPPSGILPDDTYVYDAS
                     PEDKRQSSMYTFLLYLNDEFEGGETTFFMPAAREGTLNAYPVRPVMGAVAIFPHGEAN
                     GALLHEGTGVRKGAKYIIRTDVEYDVKPCEE"
     exon            1088504..1088777
                     /number=1
     exon            1088829..1090000
                     /number=2
     CDS             join(1090976..1091392,1091485..1091847)
                     /codon_start=1
                     /locus_tag="AO090010000401"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000119"
                     /protein_id="BAE66269.1"
                     /transl_table=1
                     /translation="MSQSKPSIIIVPGSFSLPEFYDAVTDRVASKGYEIKAIRLRSTE
                     KLQQPATMYDDAAAIANEVAALVDQGKEVILVAHSYGGVPASESIKGLAKTEDSGKAG
                     GIVNLAYLTAVVPELGASSADVLADIPTENRVELQLEDDGYLVMANPTASASLCFSDL
                     PVEEGEAWMKRFARHSAASFTNPLTYAGYKDLPVSYLLCADDKVIPAREQQKGIDMIE
                     RETGREVDVTVIQTGHFPIPSAPEKVVDWITSLASRYEKGK"
     exon            1090976..1091392
                     /number=1
     exon            1091485..1091847
                     /number=2
     CDS             complement(join(1091898..1097101,1097151..1098039,
                     1098090..1098202,1098255..1098378,1098439..1098949,
                     1098996..1099537))
                     /codon_start=1
                     /locus_tag="AO090010000402"
                     /note="polyketide synthase modules and related proteins"
                     /old_locus_tag="AO080521000091"
                     /protein_id="BAE66270.1"
                     /transl_table=1
                     /translation="MPSIVTVPHCPTERPCAMPIAICGMGMRLPGGIRDSEALYDFLL
                     NKRDARRTVPPTRFNVDGFYDPEGKPGSLSSKQGYWLEDVELSNFDSSLFSMGRKEIE
                     NLDPHQRLLLEVVREAFESAAETGWRGKNIGCYAASFGEEWSNLHAKDAQNRGFNVIT
                     GYMDLMQANRISYEFDLRGPSMTLRVGCSGSGLGIHLACQSIQLGECSSAIVAGANII
                     LSPETTMLMADGGAISPDASSKTFDATANGYVRADGVNCLYIKRLDEAIRDGNPIRAV
                     IRGTSTNAGGKSSALTAPNINAEETLIKAAYRNAGVDPARTAMVECHGTGTAMGDAIE
                     AAAVARVFGDKGIYIGAVKPNLGHSEGASAISSILKAIVELENRTILPNIKFNTPSPR
                     IQWDEARLTVPIEPMHWPEDREERISINSYGIGGTNVHIILDSPASFGLSNTESPAEQ
                     APDFKLLLLSAGHSDSLTKMQNNYQDYVTKHPDRLTDLEYTLAERREHLPVRGFFISN
                     GNHDEAFVSPSFTSHLQKKVAFVFTGQGAQWAGMGRELLKTYPEFVHDIRQMDKLLQK
                     QKDPPEWRIEEQLLTPPETSLLSKAEVAQPVCTALQIALCNHLARWEIFPSAVVGHSS
                     GEIAAAYAAGSVSMHDAVLLAYYRGAASKEQTREGAMAAVGLGYDDVVHWLRPGVVIA
                     CENSPSSVTLSGDADVIESVLSAIRNDRPDAFQRFLKVNKAYHSHHMQDVGHLYDSLM
                     ANQPAIKRPNVPFHSTVLSRQLHEPEDFGSSYWRLNMESPVWFYQGFNSLLQSEVGAN
                     GLYLEIGPHSALAGPIKQIYRAQNVSNPYLSVLSRGSNAVVTFLSCVGELWSRGVNIK
                     YPLPATIPKALHDLPLYPWHYAERWWSESRSMKSSRFQRFPHHELLGARTIESSDLEP
                     VWRNILRLGDVSWLRDHCVGSDIVFPAAAYIAMAGHAVWQITNLKDFTVRDISFKTAM
                     VLDDKVPTEIITRLQPHHLTDSLNSRFFEFSILSHTGSVWTQHCMGLVAGGEISPGGI
                     PTVTSFSRIVDPKRWYRAMSRAGLKYGPHFAGLQQITASVSESTASAIIQDSRAPGSS
                     YTLHPTTTDLILQSAFVAIYQGQPRLLEKSRLPTFIEEMYIRGGVGEHDIHLNTTARK
                     QTIQSHGVVKDTLIFFVKGLELSAPETDGNEQEQQSESAQLVWKPDIHFVDSTSLVQP
                     AQQAELLSANPLIERIFLLCAIDLMDDIDGIPTTQPHLELYRTWMSEQPSKAQKEGSP
                     LVPDAKDLFNLSASDRKELIHSLVASHTDGTMIPGSRILFLCYRHMLDIFRGRTNPLE
                     LMRRDGLLARYYDCLQDKHDYKGFLQLLGHLRPRMTVLEIGAGTGGLTAKILELLRSE
                     AGEDTYQEYMYTDISSGFFVDAQERFHDRPRIRYDVLDISRDPIEQGFPEAHYDLIIA
                     SNILHATPKLTETLKHTRKLLKQDGRLLLQELCPVSKWTNFIFGLFPGWWLGKDDGRP
                     SEPYISPTEWNCRLRAAGFTGIDSSALDAERPYQLNTMLVATPAPLSYVKRVTVLYTG
                     TSHPVVHDLRQRLISDGYKVDLVSWGDDLPADQDIVFLLDLEAPFFDSITEENLDTFL
                     QIFNHHSSSRLLWITHAAQILPQDPRFSQVLGMARTLRSELGVSFSTLELESFGPGSM
                     EAISLLLQHIQQRTAENTEESEFDPDQEYAWVNGTIHVGRMHWLSVSEALAQSSGGGE
                     KAILEIGRPGLLNTLRWVSQPLKLVGANEVRIKTMSISMNFKELLLAMGVVPIDCGQE
                     LVGTDSTGIVTAVGSNVKNVSVGDRVMALTVESTSYTTVLQLPSHLCIRIPDDCSFEE
                     ASTLPTVYLTVLRTLREKANLRRDQSILIHSAAGGVGIAAIHYAKWIGAKVYATVSSP
                     NKIKFLVNEMGVEREDIFYSRDTTFLDGVMRATCGRGVDVVLNSLSGEQLHASWKCVA
                     EGGSMIEIGKRDLLGRGKLAMSPFLANRSYIGADIATLSVLEPEWVQEQLATIVNLYK
                     QGAIHPIRPVKTFPVSEVEDAFRYLQTGQHIGKLILQFSDSPDLPMATRVPVLDLRGD
                     RAYLLVGGMRGIGASLARWMVYHGAKNLVFLSRSAGERDEDKTLIHELCDMGCQVFPF
                     AGDVTDLATVKRVIESVTTPIAGVIQLAMVLADTGVMDMNLETWNTALKPKVDGTWNL
                     HKALPTNMDFFVMASSLSGTFGNYGQSNYAAANTFLDAFAQFRQSQGLAASVVDLGVV
                     DEIGFVSRNASLHRSIVQQMGAPISENSLLSCFHLAIIRSHPRHEYSSVFNPLDGFRS
                     PYQLLHGLQSKVGIAKNQFMWQRDPRTAFNRTHMQKDASTHDGSEREDGGLRSFLAAI
                     HDNPGILQEQSSVERAATEIARQASAYTTRRADEATNLGLSLHDFGVDSLVSIELRNW
                     WKQSFGVDVTVLQLMNGGSFMDLGQKAVDQLKQRHLKV"
     exon            complement(1091898..1097101)
                     /number=1
     exon            complement(1097151..1098039)
                     /number=2
     exon            complement(1098090..1098202)
                     /number=3
     exon            complement(1098255..1098378)
                     /number=4
     exon            complement(1098439..1098949)
                     /number=5
     exon            complement(1098996..1099537)
                     /number=6
     CDS             complement(1100344..1101135)
                     /codon_start=1
                     /locus_tag="AO090010000403"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000117"
                     /protein_id="BAE66271.1"
                     /transl_table=1
                     /translation="MSASPLPTQFNTLDPASSCPRILCLHGGGSNSQIFRIGCRVLEA
                     QLSNDARLVYADGPFFAPPGPLITGVFTEWGPFRSWLPPDLGVGPGKGQGVKLIYEDP
                     TDADMVIEQIHHSLQKAMEDDDRNGATGPWVGLLGFSQGAKIAASLLFRQQTDPERFT
                     SLPFFQFGTLAAGPAPLVWLGSRESHQVGGKSSLDPLLRIPTLHIYGTRDHLVRSSAD
                     WLYQCCSPDSARLFVWEGEHVMPTRTRDVSAIAEMIIEVLRGLAN"
     exon            complement(1100344..1101135)
                     /number=1
     CDS             complement(1101452..1108213)
                     /codon_start=1
                     /locus_tag="AO090010000404"
                     /note="polyketide synthase modules and related proteins"
                     /old_locus_tag="AO070323000116"
                     /protein_id="BAE66272.1"
                     /transl_table=1
                     /translation="MQGTSFLFGTLTPEHNWNSIRDLKCYFDQNLGAEWILAAVSGLP
                     DYWDLLVKKLPSIDGSFPGRQVLEDFHRWLRQGFNADETSSQLGNTVLLPIVVIIGLI
                     EYWRFVEAKNPGCEDPLQEFSSKLQEGEMCNSEAIGLCAGQLTAYAVASSRTRSEFER
                     YGSVSIRLAMMIGAATDALDARHGKAKSYVAAWRNPEQCEQMKRAISLVHPQAYISVW
                     LDERRVTITTTAQWIRSSLLRQFQGAGLTVAESTIQGPIHSPSSENKSLAQGIREICQ
                     VTPALQLGDISNLALRTYTNDGHGTPVDRGSLHDLAVQSTLVAECNWYGTFASLPLSH
                     RNSTQGVVAFGPDRCVPQSLTTSLGGRFIHVSRLGHSDALPNGIDTSTFSATPTTTAA
                     TPAAMTPALTTPVSPSLVPPASHIPTQQTEYVQNTPVKQLRAVDMANPDNEIRAKQHQ
                     QAEPSLSTESTVAIVGMSIKTAGADDVDEFSRMIQTGTSQHELVGPDRVKFHTLWREG
                     DWDPSYKWYANWMRNIESFDHQFFKKSPREAANMDPAQRLSLQAAYQAVESSGYYCSD
                     RNPTTGMDRDETDANHTGVYLGITLDDYQNHVRSHRANAFSITGTMRSLIAGKIAHHF
                     GWTGPAMTLDTACSSSGVAIHTACRAILAGDCNAALAGGVNVITDPLAFQDLAAAGFL
                     SPSRQCKPFDNSADGYCRGEAVGFVFLKRLSDALADGNQIFGCIAKSSVYQNENHTPI
                     FVPNSPSLYNLFSSVIKKSQVDLSDISVVECHGTGTPVGDPAEWESVRQALEGPERPE
                     PVYIGSAKGHIGHTEGASGLVALIKVLATIQSGYIPPQASHSTLNHLIQPTDTMQIAK
                     ALQPWRATRKAALINNYGASGCNVAMVVTESPVSQPSHDQCISEELMNVPICISGRTI
                     NTVKANCARLLKYLDIHTGISLVDLSFNINRQCSRLLPYRFSFTCGSLDELKMSLSQI
                     VALSPGPEADTMVTPCQPERQIILCFGGQISRAIGLDRSLYDRTKVLQYHLNECDRAV
                     QSLGAESIFPDIFSHEPVEDQQHLQTMLFAMQYSCAMSWLQSGLSKRVATLVGHSFGE
                     ITAMCISGVLSLQDTLKLVVGRAQLVRDSWGSDPGAMLAVEADEIAVQTLLSQANRVY
                     TGSHPASIACYNGPRSFTLAGSEEAIGIVTDILSETSPPIRSKTLRVTNAFHSSLVDT
                     IASRLKAVGGSITFKKPKIPLERTTEARSSAGLLGPQYVAEQMRQPVFFHHAVQRIAK
                     GHPNCVWLEAGSSSTITVMAQRALDSTQRTSCHFQPVNIDDSDAFSNLAEATASLWKE
                     GLSLSFWPHNAIQTAEYATIVLPPYQFEREKHWVELRSPVELIEQIKDRVRAESTIPA
                     SESTADPNQKWLFTGYKDSHVKGKRQPCFNIITASKEYQSLISSHIVAQKAGICSGML
                     QADLAIGALFSLHPDWITKGITATVHDAINHAPICLDSSRVLSIEFEDQENGFWDWKI
                     VGSSMVAPRVVHTTGRLQMRDPKDVSYQAEFRRLSRMVDHERCLAVLNARPRDNDVEI
                     LQGRSIYRAFSDVVDFGQQYRSLRWLVGRGNESAGRFSKTPQNDAWFDQLRGEHISQV
                     GGIWVNCMSNHSRDDIFLGAEIETYMVSPDWVNRPLPDQCDVLARHLKHRNTGDYTSD
                     SFVFDPDSGDLVQVLLGVRFTRTPRASFVRALQHMTPGLETGHPESMLGTTLQPIPMT
                     AATPVAVAEAPKTVSPKANIHETPTRNLLTEMTELIANIVGVDIAEIGPDANLVDFGV
                     DSLLALELQGEIKTAFSCAPDVVAILEATTIRDLVACLPIPRDMLQHETINNAESTDD
                     LFHEVSSLSQASDPYLSTPCESSTSGSFIPLDLLWRASDILESFSAIKGRGDQMILEH
                     GLGNFESNIVPDTNRLCTALVVECFEELGCPLQSANPGDVLSRISFKPQHTIFVNYIY
                     HFLEKTAQLVSLDQTGRLIRTETPTPTMSSKDMLPELLKKYPDHGDFTQLTYHAGIQL
                     ASALSGLTDGNRVLMSNPEGRKLCESVYHNYPLNRIGFETIRDVIIQALKHIHIDKTP
                     LKILELGAGTGSLTSVLLPLLGSLDIPVEYTFTDLSSSLVAQARRTLGRQYKFMKFAV
                     QDIEKPPSKEIAGQQHIIVASNAVHATRSLEDSTRNIRQALRPDGFLMVLEMREAWPA
                     LDLTFGLYEGWWLFEDGRTHVYTSPEVWKRSLTAAGYEAVDWTDGKLPEHKYYMVVIA
                     LASAL"
     exon            complement(1101452..1108213)
                     /number=1
     CDS             join(1108936..1109113,1109166..1110093,1110147..1110459)
                     /codon_start=1
                     /locus_tag="AO090010000405"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000115"
                     /protein_id="BAE66273.1"
                     /transl_table=1
                     /translation="MPIAVTTGTGADGIAAPGSSGIKVLVIGCGFGGIAAAIECYHKG
                     HEVVVFEKNSEIGGLGDTLGISQNGTLPIYKWDNGMVQQKAAEICCNYATHKIHTSKG
                     ELLLSHPMKGYSAGSGYTGRRGDLLLCMFEYFQKLEIELHLNANVKEFFETDDSAGVI
                     VNSQRWEADAVICADGVHSAGRHYVLGKEDLPRPSGYAIYRAWFVPEPSLRENPATSW
                     IPLPGGEDTVMNFIGPNVHTLIATVKRNTGITWVLTHPDEYDIEESWTHPAKLEDALK
                     VVEGWDPRIAEVYKITPPDQLFDHKIIYRDPLPTWVSSKGRIILIGDAAHSYVPTSAQ
                     GATQAVEDAATIAIMLELAGKSQVPLALRTMEKMRYERCKIGQLMGLETRDIWVKTDW
                     EAVRKDPQLLAQPRPNWLLNHDPQAYAYEEFETAANSVLTGCAYTPRNIPYEGSNHRA
                     TDFEDEKWGNRHKESADVGVKV"
     exon            1108936..1109113
                     /number=1
     exon            1109166..1110093
                     /number=2
     exon            1110147..1110459
                     /number=3
     CDS             complement(join(1110543..1111397,1111453..1111611))
                     /codon_start=1
                     /locus_tag="AO090010000406"
                     /note="mitochondrial solute carrier protein"
                     /old_locus_tag="AO070323000114"
                     /protein_id="BAE66274.1"
                     /transl_table=1
                     /translation="MGGTSPSGSLVEDSSNVTRNSHRDNHGLESDNASRNQGFDWRNG
                     VAGGVAGCAAKTIVAPMERIKILFQTSNPHFLPYSTRWNGFIEAISHIRTSHGVPALF
                     KGHAASLIRVFPYAGINFLAYEQLQRVIIISPKRDTPFHRFFCGSTAGAISTAFTYPL
                     ELIRIRLAFEAEQHRHSSWFGISRRIYFESGGKGSLLNLYQGIGPTMLGILPYAGTSF
                     VTHDLMREQLRSPLFAPYALEKGSSTRLTAVAQLCCGAIAGIVAQTVAYPIDILRRRM
                     QVGSVVGSRSGILETARRVFMERGVKGFYVGLTIGYMKMAPMVATSFYVYDRMKRLLG
                     LIE"
     exon            complement(1110543..1111397)
                     /number=1
     exon            complement(1111453..1111611)
                     /number=2
     CDS             join(1112599..1112799,1112870..1112981,1113034..1113270,
                     1113326..1114117,1114176..1114483)
                     /codon_start=1
                     /locus_tag="AO090010000407"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070323000113"
                     /protein_id="BAE66275.1"
                     /transl_table=1
                     /translation="MIVDASADHAPEQHSLHEKKSPGLQDTNLDQQSPISPSDEGEYP
                     TGLRLTFVVVALILAIFLTSLDFTIIATAIPRITDDFHSLGDVAWYGSAFFLVTAGFQ
                     TAWGKAYLFFSLKITFLLAIFLFEVGSLICGVAPSSVALIVGRAIAGLGAAGVNTGSF
                     TLAAFCAPPQKRPIFTGLIGLSYGIASVVGPLLGGVFTEKATWRWCFYINLPVGAVSA
                     IFIIIFFQSPQASKSTDTSSLWSKVMQMDPIGTFLMMASVTCYILAMQYGGLTHPWNS
                     SVVIGLIVGFVVILAVLCGWEVYMGEMAMSCPRLVKKHAIPSAVGFFFFGSYIVVIYY
                     LPIYFQSIDGTSAIGSGVHNLPFILAVSIFTVLSGILISMTGYPAPFVISGAAVGTIG
                     CGLLYTFNIGTSTGKWIGYQILAGVGNGFGVQVPMIMAQGSTEPKDMAATTAILMCFQ
                     TVGGAFMQSGAQAAFANRLLIELPRTAPEVDPSAVVAAGATELKSFGSSLQGIRLAYM
                     DGIKVTFAFACASMGVAFILAFFARRARIGGEAVKNAMAAA"
     exon            1112599..1112799
                     /number=1
     exon            1112870..1112981
                     /number=2
     exon            1113034..1113270
                     /number=3
     exon            1113326..1114117
                     /number=4
     exon            1114176..1114483
                     /number=5
     CDS             join(1116255..1116503,1116572..1117132)
                     /codon_start=1
                     /locus_tag="AO090010000408"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000112"
                     /protein_id="BAE66276.1"
                     /transl_table=1
                     /translation="MASPNRLTVLSNVIAEKTKVISDFLASKGVEPPSFDVDGQADYA
                     ISADDKEAYEARLELIAASKELYALSHGPKDHIRNICWDAMDPLSLHAIWTFRVPQAV
                     PLNSKISYEDLAEKCHQLSGIFVPLFTFRRIIRHAITNRFFCEPELGFVAHNRASRVL
                     LEEETLDAWVGLFCNDMWPGFVYTVEAMKRWPGSGEPNETGINVAYGHNLNWFDHTSR
                     NDVVADRYSKSMKAHGGGVGFDVSHTVTGYPWADIGEGTVVDVSTILLMAM"
     exon            1116255..1116503
                     /number=1
     exon            1116572..1117132
                     /number=2
     CDS             complement(join(1119705..1119740,1119818..1120054,
                     1120133..1120495))
                     /codon_start=1
                     /locus_tag="AO090010000410"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000110"
                     /protein_id="BAE66277.1"
                     /transl_table=1
                     /translation="MAPNDTESLISMTHPPATGPVTFVDTPTVSSSTPSLNFPKDLMS
                     SIPSNLEEMSQGDSGANLALRCLTPPLDNHTSTASSSQVVKSLEWKGSFAISEQQWHQ
                     LASEQQWHHLASTLNIVRPVENLNDLKIPSRLTLERLLRAFAECFLIYIPCIHMPTWK
                     AELAPPCMIFAMASIGASYYDDDATATSLHCIAQMCIKNHTSRYGCCSVCC"
     exon            complement(1119705..1119740)
                     /number=1
     exon            complement(1119818..1120054)
                     /number=2
     exon            complement(1120133..1120495)
                     /number=3
     CDS             complement(1122606..1123001)
                     /codon_start=1
                     /locus_tag="AO090010000412"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000108"
                     /protein_id="BAE66278.1"
                     /transl_table=1
                     /translation="MLRGSKHLVANTLVHWGTWIGCVLGVAVVAYIIASAIPNFDSLI
                     SFIGALLGTLQSFQPSGCMWLYDNWSRGREQRSHKWALGVCWNIFVVVCGTFLMVAGT
                     YGSVVGIIDSFRTNGGSGVWSCADNSNSV"
     exon            complement(1122606..1123001)
                     /number=1
     CDS             complement(join(1123051..1123062,1123090..1123478,
                     1123535..1123726,1123783..1124014))
                     /codon_start=1
                     /locus_tag="AO090010000413"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000107"
                     /protein_id="BAE66279.1"
                     /transl_table=1
                     /translation="MKTQIGLGVLSIPSAFDTLGLMPGVLCLVAIAIINCWCSYMVGS
                     FKLNHREVYGIDDAAGLMFGPVGREVLGAGFILYLTFVAASGILGISIALNAISTHGA
                     CTAIFVAVAAIGVFCLAIIRTLSRVTVIAWGGLACILIAILIVTIGVGVEDRPYAAPP
                     GPWVSDYQIVNNPSFADGISAICTLIFAYGGVPFFFPIIAEMRDPRHYTKSLVACQTV
                     VTVIYVTIGIVVYYYCGSYVASPALGSAGRLIKQIAYGISLPGLLASATICTHSLK"
     exon            complement(1123051..1123062)
                     /number=1
     exon            complement(1123090..1123478)
                     /number=2
     exon            complement(1123535..1123726)
                     /number=3
     exon            complement(1123783..1124014)
                     /number=4
     CDS             complement(join(1125613..1125625,1125804..1125941,
                     1126082..1126206,1126297..1126368,1127039..1127683,
                     1127744..1127992))
                     /codon_start=1
                     /locus_tag="AO090010000414"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000106"
                     /protein_id="BAE66280.1"
                     /transl_table=1
                     /translation="MPQLLHLPGELLARVISHIDQSALKQLRQTCRTLAQFVSRELFR
                     TVHLFPDEESYERVRNISNNTILRSLVRKIYINTCYKDSEWGDPDCTLTEPFKDAILQ
                     LKRFPNVQSTVLRFDKNCCVDDDGVEMWRSEWPQPPTYREEVLHVFFSWLTSLDVPTK
                     ELGICNLQDLTIKDTDTRAMMAKVLCGLQSLRLNIATEHHEASPEEDLEFPEPHEFFA
                     EMPFAWLKPTMGSLEHLTIYCDNYWGFFPKLDLKGIHFPRLKTLALGNFGFAQDAHVE
                     WIVSHEATLAELYLDDCTILYDILHSKHDAPPPRLHPATKLTKRSSRLNSQSPSLRNQ
                     LLVYCDIFPYPEALIPPKGDSAAEAFPMECIICHLDGFLLCLEAIQPQRRAKDLLLTR
                     QHGGYHSRNDCGREKFSRNLV"
     exon            complement(1125613..1125625)
                     /number=1
     exon            complement(1125804..1125941)
                     /number=2
     exon            complement(1126082..1126206)
                     /number=3
     exon            complement(1126297..1126368)
                     /number=4
     exon            complement(1127039..1127683)
                     /number=5
     exon            complement(1127744..1127992)
                     /number=6
     CDS             join(1130998..1131238,1131301..1131590)
                     /codon_start=1
                     /locus_tag="AO090010000417"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000103"
                     /protein_id="BAE66281.1"
                     /transl_table=1
                     /translation="MIYWTTLVLGLLLQLLSVSAGTTLATTTTSSSKYEPTQPGIPSN
                     CDKFHLVAAGDQCGTIEAKYGITDAQFKAWNPTINSGCTNLWLDYYVCVHVPDDTTTT
                     TTSKTPGPTDTAPEPRMPGIVSNCKKYYLVKKGDDCYSIDTAAGITLAQFRSWNTMID
                     AACTNLWVDYYVCIGV"
     exon            1130998..1131238
                     /number=1
     exon            1131301..1131590
                     /number=2
     tRNA            complement(1134139..1134210)
                     /locus_tag="AO090010t00009"
                     /note="tRNAscan-SE"
                     /product="tRNA-Met"
     CDS             complement(join(1135219..1135754,1135828..1136119))
                     /codon_start=1
                     /locus_tag="AO090010000418"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000102"
                     /protein_id="BAE66282.1"
                     /transl_table=1
                     /translation="MRSSLVLGVSRLILLVPLLSSTASAADNRTCYMVDEKTVAVDDV
                     PCSTKETTHCCNKNDICMSNGLCWVQSTGDMVLSRGSCTDINWGGDCVAARPCARANP
                     TSGYPVVNADIANHQFCCGSVVSSSSSDGIKCSGDGPFPVPTGTVIPGVAALASVAST
                     SSPSSSATHPAGNSNDTSSGNDTSSEKPEKSDDQSTKLAIGLGLGLPLGIIAGSALMW
                     GAWERKKSVSARREMDQLKATMSYQYAPVPQMQAAPPVEMGHNEYRVAELPPGGYNK"
     exon            complement(1135219..1135754)
                     /number=1
     exon            complement(1135828..1136119)
                     /number=2
     CDS             join(1141376..1141566,1141612..1141807)
                     /codon_start=1
                     /locus_tag="AO090010000422"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000098"
                     /protein_id="BAE66283.1"
                     /transl_table=1
                     /translation="MLSLALNPQNLLPTFFHYRFFVSPPLTSSHVHPHHQTTLSPKLS
                     LSPSSSSNPQQWPVSSKSATNPKFGPVPISADTLGEFYLNELTAIEEQYHKLPEVVIL
                     DAKFKTSSGDVRVELPMAFRGPMLFN"
     exon            1141376..1141566
                     /number=1
     exon            1141612..1141807
                     /number=2
     CDS             complement(join(1144381..1144518,1144623..1145054))
                     /codon_start=1
                     /locus_tag="AO090010000423"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000097"
                     /protein_id="BAE66284.1"
                     /transl_table=1
                     /translation="MGCQLGPLRDSINDSLSSKESFPNKYFSNGRLPVFTALPPQREA
                     VEVLNTFFTYTTDIFPLFHPNTFTELLNNSYERRRPRDPSWWAGLNITLAIGYRYRSM
                     HQPSQSGARTKSNVYYKNAMAAVPELLLRKPDLMAVQALMGINLLTIAMRSCAQFGIH
                     GTCAIPRSTCREQDQPTFILSLGYMMEEL"
     exon            complement(1144381..1144518)
                     /number=1
     exon            complement(1144623..1145054)
                     /number=2
     CDS             complement(join(1146258..1147046,1147117..1147356))
                     /codon_start=1
                     /locus_tag="AO090010000424"
                     /note="flavonol reductase/cinnamoyl-CoA reductase"
                     /old_locus_tag="AO070323000096"
                     /protein_id="BAE66285.1"
                     /transl_table=1
                     /translation="MTITHSKTILVTGASGFLATHIVKAFLQQGYYVRGTVRSDQAAA
                     NVRKGFSQYSDRLSFAVVEDISQPGAFNEAVEGVDGIIHTASPFQTSVRDNKRDLLWP
                     AINGTTSILQAAQEYAPRVSRVVITSSMAAVIDVGKGPQPGYPYTEEDWNPMTFEQAE
                     NAHGIVAYAASKALAEKAAWRYMETNTPDFSLTTICPPMIYGPVEHHVSTMERLNTSA
                     GDIYRLFNGSSIEIPSAILPVFADVRDVAQAHLSAFESEKGAGERFIVSSGGYTYQEV
                     CDILRSVVPEVRDKVPIGQPGKHESAVIKVSNNKVKTLLGITVHTLQETVKDTAYSLL
                     ALEKAFKA"
     exon            complement(1146258..1147046)
                     /number=1
     exon            complement(1147117..1147356)
                     /number=2
     CDS             join(1148297..1148581,1148641..1148902,1148960..1151151,
                     1151218..1151610)
                     /codon_start=1
                     /locus_tag="AO090010000426"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000094"
                     /protein_id="BAE66286.1"
                     /transl_table=1
                     /translation="MGSTNFDQRLMCRVVDELAESKPEQLFCVQPISSDLSQGWRNVS
                     MRDLAGAVDYTARWIEMAMGKGFDFQPLAYIGANDIRYVVFYLACMKTGYAALLPSTR
                     NSIVATSHVLGATECSKVVYSAERHKIAEEIGDSVQNVRLYEIPSLWEVFGAPAEPYA
                     FDANFYDLQNKPCIIIHSSGTTGLPKPVYLTNGFFSVIDNFPRTPTPPGRLNKSITSV
                     AQGRRLFSMAPMFHLMGLVILSGAIFHNTPVVLSPERPMTPGLLSQILETARPEVAML
                     TPSVIQELSAFQEGLEGLQKFKAIVFGGAPLSPEVGNKLNEKVALHSIIGSSEAGFMG
                     ALICTHSEDWEYFEWNPYSGIHMESVDDGVFEAVIRKDEHHEFLCIFHTYPDITAYRT
                     KDLFTPHPTRPGLWKYHGRLDDVIVLSNGEKFNPTDMENIVESHPLVSKAIIIGQGRF
                     QASLLIQPNWGQWSEDQDKADFIDRIWPTVERANGIAPGHARVLRTKVALAKQDTPFA
                     LTPKGSVQRRQISEDYETEINALYAGEDEECTDDLPQSTDLEDIKQYIHTVVSQLLSV
                     ERISDTSDIFSLGMDSLQTLQLSKILQTAVRHLSADKNSEPITSQKLYAYPTLDQLSQ
                     YVYRLLKGETMEEKAEDEEATRPGRIEGLINKYTNDLSQRAITSFNRSTKNAVILTGS
                     TGSLGNYILNELLSDREIPMIYCLNRAEDARQKQIASFKEKGFTIPHDFDERVEFIHA
                     QFGALNLGLSIDKYNELTKSVDLIIHNAWKVNFNHKVEAFEDPHIRGIRSLVDFSLRS
                     AHSAHIHFISSISTVSAWGPQHGPSVPEISLDDPDVALRQGYGESKFVGERICAIASS
                     IAGVPSSIHRVGQIAGPTTEKGLWNRQEWLPSLVATSKTLGKLPNTLGTMPVDWIPID
                     IMAKIVVDITNSRRATEDLTRTAAFHLVNPRSSSWESLIPAIKKHYKAEVVDMHDWMA
                     TLEAFRNPTDGDLQDKPALKIIDFYKGLASNHGTFTSVMETVKTQEASQAMCDLGPID
                     GAIMENWIKQWQF"
     exon            1148297..1148581
                     /number=1
     exon            1148641..1148902
                     /number=2
     exon            1148960..1151151
                     /number=3
     exon            1151218..1151610
                     /number=4
     CDS             join(1152167..1152557,1152612..1152748,1152811..1153102,
                     1153157..1153569)
                     /codon_start=1
                     /locus_tag="AO090010000427"
                     /note="beta-lactamase class C and other penicillin
                     binding proteins"
                     /old_locus_tag="AO070323000093"
                     /protein_id="BAE66287.1"
                     /transl_table=1
                     /translation="MSELNPTNIEALKRRMQSVCSDPDKGLPGVSVAVVGRDGKQLFS
                     HAAGKRGHGSSELMSVDSVFWIASCTKMITGIACMQLVEQGRLSLDDAGQIHRICPEF
                     DDLRVLQEDGTLVEKNKGITLRMLLTHTSGFGYTFYNEKLRDYARPAGFDEFSGYAEE
                     FNQPLVHQPGEAWEYGIGIDWAGVVLERVTGQSLNDYFHQHIFEPIGLKHISMLPTEE
                     MKANLAYMHQRAADGQISVRDHLLRRALTVKSESDIKSYFNSGGAGCFSTAQDYSQIL
                     AILLNGTSPTTGKQLLKKETVDEMFRNQIENLPPLAEKYFPDAKAEFVQSGLGLHPTV
                     EGDRQGWGLTFLLSGGSTGRSIGTAQWSGVANLRWWCDREKGVAGFICSQVLPYGDEQ
                     LFQLSQDVETEVYKGLAL"
     exon            1152167..1152557
                     /number=1
     exon            1152612..1152748
                     /number=2
     exon            1152811..1153102
                     /number=3
     exon            1153157..1153569
                     /number=4
     CDS             join(1157844..1157899,1157969..1158399,1158468..1158739)
                     /codon_start=1
                     /locus_tag="AO090010000429"
                     /note="dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /old_locus_tag="AO070323000091"
                     /protein_id="BAE66288.1"
                     /transl_table=1
                     /translation="MALNEIRGRLALITGASGGIGAACSHQLAQRGVHLALTYSTNST
                     SINELVKELQSKYAENKLRISTHKVDVGSADQIESLFHEIDTQHGRRPDILISNAGYG
                     KRITNIWDIPHEEFDYMIKVNLRASFVLVKGVVEHMKAQRWGRIVFMSSIAAYGGGIN
                     GCHYAASKGGLTGMMKNLSTRLAEYNISVNDVAPAMIGDTGMVPNASAIQDTVATIPL
                     GRLGTPEETANVVTMLVTTGYMTGQSLLLSGGLK"
     exon            1157844..1157899
                     /number=1
     exon            1157969..1158399
                     /number=2
     exon            1158468..1158739
                     /number=3
     CDS             complement(1159183..1159995)
                     /codon_start=1
                     /locus_tag="AO090010000430"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000090"
                     /protein_id="BAE66289.1"
                     /transl_table=1
                     /translation="MRLQLIAATLLLSTTAQATQSFTNTGTTSGWSWKNIEHNGTVEQ
                     VTDIVYKGSTALKMTQIYDQKYTNRYRNNDDADDDLVKPGRYHSEVIKNDVYKLGDEG
                     YYGFMFRLQDTWQFSPVQSYNIAQFMGEFPDRGCEQFHWIPSNMVYLYGDQLYLHQRT
                     GKVCAPKETIYSNLATVSAGEWHKVVIHSEWRADGTGSYGLWFDGVKVLEEYDIDTTI
                     DDGDTAFQFRVGIYANGWHDNGGMKGTQGTRQVWYDQIAIGTTFADADPDQW"
     exon            complement(1159183..1159995)
                     /number=1
     CDS             complement(join(1160600..1160664,1160828..1161806))
                     /codon_start=1
                     /locus_tag="AO090010000431"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000089"
                     /protein_id="BAE66290.1"
                     /transl_table=1
                     /translation="MRPKPNNVHSLLLSGQSPRANSFPEACTAIGFSELCLLDLELMH
                     HFTTNTCMMGPHVLDPSVFRDESPRLGLRYPYLLHQLLALSAFHCAYLRTELREKYLF
                     HGSKHQAHAIAGMRLALTGKMTEETSFALFMTSALLMTSSFASHLKYPHNEAKPPLAG
                     MLEIMALVRGLSAIKTTTHAELQFNVLDKLKHHSGSPPCWKALDLFKTQLTILQSRIS
                     NLTNIDNAILALLNKGAQSMLDCAAMPATTMTGELHVVFTWLSILPGDFFNLMQAQHP
                     GAMVVLLYYVVALQEVETQCWVLEGWSAQLTSNIVDILFPPWTGLAQWAMSMNLDCQS
                     TESRQLSYADAPS"
     exon            complement(1160600..1160664)
                     /number=1
     exon            complement(1160828..1161806)
                     /number=2
     CDS             join(1162686..1162778,1162830..1162872,1162936..1163187,
                     1163264..1163778)
                     /codon_start=1
                     /locus_tag="AO090010000432"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000088"
                     /protein_id="BAE66291.1"
                     /transl_table=1
                     /translation="MAPPLCDPENYKDATFAFYRFAPSVEANIIFTKIWYLWPLVVGG
                     ACEAVGYIGRVLNALEDEGCWNIGPYVIQNTLILLGPAFMAASIYMILGRIILLTAGE
                     HHALVKRKRLTKTFVWGDVVSLCTQSTSGSIMAAPDLWQIGEKVIIAGLFVQLFIFSC
                     FLVIAINYHYRLAKSPTPESNNPSIRWKWYLFTLYLTGGLVLVRSVFRVVEFIEGNHG
                     PIMRSEAYVFIFDGFLMVLVLLWMNWFHPGEIGLLLRNEVPITNGLQLMKIRQGRKRC
                     NTMESLNSKLPLIGRSNGVGHKAV"
     exon            1162686..1162778
                     /number=1
     exon            1162830..1162872
                     /number=2
     exon            1162936..1163187
                     /number=3
     exon            1163264..1163778
                     /number=4
     CDS             join(1166083..1166171,1166181..1166481)
                     /codon_start=1
                     /locus_tag="AO090010000434"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000086"
                     /protein_id="BAE66292.1"
                     /transl_table=1
                     /translation="MPAHDSKIKRGRNGWEYKVTLNANFDANSIIQPYRVQKFIAGGD
                     KAHGSDITTGNVIFSWMGANGGVASHTDKVDAVRSTYQLPYPIPRDHRGHTFKVHSIR
                     FHDIHVEADDCVWKGREDDVEWTCYFG"
     exon            1166083..1166171
                     /number=1
     exon            1166181..1166481
                     /number=2
     CDS             1170307..1171323
                     /codon_start=1
                     /locus_tag="AO090010000435"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000085"
                     /protein_id="BAE66293.1"
                     /transl_table=1
                     /translation="MPAAAMDALGAFSHLTDNLPTWINRMSDLATHTAAKHAEYAEAY
                     KKLAVTPGKPRRRKNSSVCSIRTDELRNAVTQSPPPAEAPTQRDPETPQPASQDLSTP
                     NPNPRKRGTDEAPSLASEENPFVSTRYNLVIHYDGETQKSLEEMVRIIGTARNNIRRG
                     KMSQMGAMRSSALNKPTRMNSPPLPPPGVAADAQLLSQIRSTRNRGPPPQARVMAKNS
                     PFEMADRQLELAHSMCETAAYQFLRTGDCSEELQGVLDKFKALLELATGEVRRLTEEQ
                     ERERAAKEKEAPQVESVQLTVSPASNKGPSSDVGAIEVDDGTESEESIDLSAFRARRM
                     MMRA"
     exon            1170307..1171323
                     /number=1
     CDS             1174594..1175265
                     /codon_start=1
                     /locus_tag="AO090010000437"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000083"
                     /protein_id="BAE66294.1"
                     /transl_table=1
                     /translation="MTASHIFPYKHGQATMDAIFGRVRPAELFSSRNGLMLNSIIEKH
                     FDSGVMVIVPSLPERPTDTMLSKWVGQEVREYKLRIIDNTWQHLDRVINKDGLTWRKL
                     DNRVLQFRGNYRPAARYSYFHYCVQVLRRAWKLGPGQKTVFHLTDEFGKPFWGTPGRY
                     IAKNMLRALIEELGHEYDNLLEGATLLSRGDDDLLLNTAVAQIAPIEEADVEDTDEED
                     FDDYD"
     exon            1174594..1175265
                     /number=1
     CDS             complement(join(1175549..1175647,1175656..1175694,
                     1176059..1176322))
                     /codon_start=1
                     /locus_tag="AO090010000438"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000082"
                     /protein_id="BAE66295.1"
                     /transl_table=1
                     /translation="MKLTRYLSLLTLVLTANAADCTAPNQQWFSDAAVQMMWSIRAWL
                     CPNAWSQSITAGPDGGWCDAGGGVISAYWGSWTISGMQSEQQCWQGADMIGGFNMEYF
                     IVLHGFVLLEPLKAPIIHLLCLIGGVSNTNS"
     exon            complement(1175549..1175647)
                     /number=1
     exon            complement(1175656..1175694)
                     /number=2
     exon            complement(1176059..1176322)
                     /number=3
     CDS             complement(join(1177303..1177449,1177508..1178497,
                     1178558..1178693,1178746..1180385))
                     /codon_start=1
                     /locus_tag="AO090010000439"
                     /note="DNA replication licensing factor, MCM6 component"
                     /old_locus_tag="AO070323000081"
                     /protein_id="BAE66296.1"
                     /transl_table=1
                     /translation="MSTLFDAVLQSELDSNAGSRDHRLHSDQLPSSRPHPPSESNGPM
                     SDMHAFPDDQVVESNSTVTRRRNPYVKAPPPLVDVAGEKVQQAFEELLETYREEPTWS
                     APPPSSEILSDKYYIAQIHGMNKHSLSTLYVDFTHLTSLDSPILADAIVNQFYRFHPF
                     LTKALHNLIAKYEPDFYTHHRKVDKVNSDAGTSMMGGNSSVSISDKHEMGEHVQERTR
                     HQQTDKLFSLAFYNLPLVSRLRQLRTSQIGKLLSISGTVTRTSEIRPELSLGTFICEN
                     CKTVCPDVEQTFKYTEPSECPNQSCGNRSGWRLDIGKSTFVDWQKVKLQESSHEIPTG
                     SMPRTMDVILRGEMVDRAKAGERCIFTGTLIVVPDVSQLGLPGVRPEAVRDDSAFRSG
                     DVGGGGLTGLKALGARDLTYRLAFLACMVTPDTTTPGQQTNQQLNGQSNNILASLNQL
                     TEPEDNEDKAQEAFLHTLTPYEVEDLKGLVHSDYIYSRLVDSIAPMIYGHRQIKKGLL
                     LQLIGGVSKNTAQENMQLRGDINVCIVGDPSTSKSQFLKYICSLHPRAVYTSGKASSA
                     AGLTASVVKDAETGEFTIEAGALMLANGGGICAIDEFDKMDISDQVAIHEAMEQQTIS
                     IAKAGIHTTLNARASILAAANPIGGRYNPKATLRANLNFSAPIMSRFDLFFVIRDEPN
                     ETVDRNLADHIVNVHMNRDEAVQPELSTEQLQRYIRFARTFRPVFTDEAKALLVEKYK
                     ELRSNDSQGGNGRSSYRITVRQLESLVRLSEAVAKANCVEEIVPRFVQEAYDLLRQSI
                     VTVEKDDVEVDDDEELANAAGHDEDHEMGDGERDREGDSPMREDVEEQPAPSRTRTKI
                     TFDKYMKILNLVVRRVNEDESTSGEGVEEEDLIVWYLEQIESELDNEEDLQRERSLAV
                     KVLKRMVKDNILMPIRGEGLVDAADGDQETSHRTVYVLHPNCAVDDIVIPDPNSRR"
     exon            complement(1177303..1177449)
                     /number=1
     exon            complement(1177508..1178497)
                     /number=2
     exon            complement(1178558..1178693)
                     /number=3
     exon            complement(1178746..1180385)
                     /number=4
     CDS             join(1181778..1182822,1182899..1183044)
                     /codon_start=1
                     /locus_tag="AO090010000440"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000080"
                     /protein_id="BAE66297.1"
                     /transl_table=1
                     /translation="MPVEPNSSAPASYSVSPVTLLDASGKDPFDSLPVTCTREDFILM
                     DCWTNRLTYWSGEPRLIKDQVFRAVLNHPLPFQSIVLAYCSRWRAHAYGLKWNPEVEQ
                     HVGRATKGLEQVMKGGMKIDTDSLAMALTGMAIQEERFGSKQQARGYVDQAVQILRSR
                     SGSNRVAEALLHYVQFMLMPLHPAVPEDGQQWLVTFLRGAEELMLEHSSDAYLSSVPQ
                     RRSTFQMDSPLFPLLSSGPRPSHVPLQSRIYIITKTAPTQELTRTAALIYITAALWDF
                     QGSPSKTGRFLDHLRAIVKNHELDRFPACESFVWLLLLEGYEADLQEPERSWSTSELL
                     KLYKQLQPELQFLFTLCQRSRKNLKLHPTRVTIFFMYIYSLDLLSGRHNTSTVCGQPF
                     AHLI"
     exon            1181778..1182822
                     /number=1
     exon            1182899..1183044
                     /number=2
     CDS             join(1186118..1186168,1186236..1186701,1186767..1187375,
                     1187451..1187777,1187833..1188231,1188293..1189128)
                     /codon_start=1
                     /locus_tag="AO090010000441"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070323000079"
                     /protein_id="BAE66298.1"
                     /transl_table=1
                     /translation="MAFSDVGLRGLHHLVRRDSDNPADTPPTASALVTTLVPALVSAG
                     AMVLIFLILRRSQRRTYMPRTYLGVLKPWERTPPVSTTPWGWIIDMYKLPDEYVLQHH
                     SMDAYLLIRFLKLVSMICFVGACMTFPILFPINATGGNGNIQLNILSMSNVEESKYER
                     YFAHAFIAWLFIGFVMYTVTRESIFYINLRHAYALSPAYASRLSSRTVLFTAVTQDYL
                     NRDKLRKMFGTDKVKNVWITTDTSELDDKVKERDDAAMKLEAAETKLITLANKARLKA
                     MKKQGYVEEGPPTPSEEPSDESGSVAARWVKPSERPTHRLKLLIGKKVDTINWARSEI
                     ERLNPEIEELQAKHRAGDAKLVSSVFVEFYHQADAQSAYQSVAHNLPLHMAPRYIGLE
                     PTQVIWSNLRIRWWERVIRYFATIGFVVALIVFWAIPTAVVGSISNITFLTEKVPFLR
                     FINDVPSWIRGVITGLLPTILQSVLMALLPIILRLMAKLGGAPTAAAVELTTQNFYFT
                     FQVIQTFLVVTVTSSASSVVSDIINNPSSAASLLAKKIPQASNFYISYIILQGLSFSA
                     GALLQISGLILGKVLGALLDNTPRKMFTRWSSLSGLGWGTVYPAFTFLVVVAITYSCI
                     APLVLGFATIGLYLFYFAYRYNMLYVSNADIDTQGKAYTRALQHITVGCYLLNVCLIG
                     LFAIASGARRIALGPLILMIISLVVMVIYHVSLNSALDPLINYIPKNLESEEEALLIQ
                     EKGELAPSGGEHSDDAGASGPGKEGIDNGVTNADSAEKGLTGPAPEPKVNFLTKWLRP
                     DKYDGYTQLRRFVPNASAITTYAPEVERDAYFHPSITSQPPLLWIPRDEIGVSKQEIK
                     HTSRVIAITDEDAWLDEKNKIHWDMDKGVPPIYEEKIYY"
     exon            1186118..1186168
                     /number=1
     exon            1186236..1186701
                     /number=2
     exon            1186767..1187375
                     /number=3
     exon            1187451..1187777
                     /number=4
     exon            1187833..1188231
                     /number=5
     exon            1188293..1189128
                     /number=6
     CDS             complement(join(1190220..1191510,1191668..1191675))
                     /codon_start=1
                     /locus_tag="AO090010000442"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000078"
                     /protein_id="BAE66299.1"
                     /transl_table=1
                     /translation="MSSNMRYNSRLKVRCSGEKTGCQRCANLGSECIFSISRIGKVPG
                     KRSKANRAAAAAAAAAAVTAPPSSISLTSPSRLESANGTITAFQPFSNAIKDEGGSGV
                     TPSARHVPSNFAVDPMITPLMVHDYSSSIPFYSGASYAPDGLSLADTAPTSTHNISHP
                     LGPNIDLSLQEPGNFCWASDLEPLSANSLPTPGLEMSASRDSLSLDRRLSHDWEMETN
                     VANGSCDPSRSCTTSIRQPATPPEYLADEGIYPVSALENMGPEASYTVYLQLLHNIEQ
                     TLLMGRHRTKENHTLDAVLAANQQYLTTLLQLSESLSFEQMYDGHLLFTVALSKIITL
                     FSFGYRDFTLRSEAHQSMGCAERLIRFGVFEIDFVEQKAICEGIFLRELKRAGVCLAR
                     LMDALRREKFPYAHGRHERLCEEMKQHIDQLTRALEASEA"
     exon            complement(1190220..1191510)
                     /number=1
     exon            complement(1191668..1191675)
                     /number=2
     CDS             join(1194442..1194713,1194803..1194941)
                     /codon_start=1
                     /locus_tag="AO090010000443"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000077"
                     /protein_id="BAE66300.1"
                     /transl_table=1
                     /translation="MSFTKNLTRALNTTPLRQQRSTTTFPYATHEPLEYQLSRLSLSK
                     IKQESARPEPDLRHVVGYASVNRAAGDKMYQNLVRGVELLRTERRAKGTSERRGSGGD
                     EVFWGGRVGGKGTAEEEELEEVEGGAGLVALRMG"
     exon            1194442..1194713
                     /number=1
     exon            1194803..1194941
                     /number=2
     CDS             complement(join(1195242..1196363,1196425..1196883,
                     1196957..1197703))
                     /codon_start=1
                     /locus_tag="AO090010000444"
                     /note="pyrophosphate-dependent phosphofructo-1-kinase"
                     /old_locus_tag="AO070323000076"
                     /protein_id="BAE66301.1"
                     /transl_table=1
                     /translation="MTNTILDTYSSRRKPRRIGILTSGGDAPGMNGAIRAVVRTAIQN
                     GCEAWAIHEGYEGLIQGGAMMHPLYWEDVRGFLSRGGTLIGSVRCDRFREREGRLQAA
                     RNMVLFGIDALVVCGGDGSLTGADLFRSEWPELLNELVSTGVLTVAQVAPHQNLNIVG
                     LLGSIDNDFSGTDATIGCYSALTRICEAVDAVFDTASSHRRGFVVEVMGRHCGWLALM
                     AAIATGADWLFIPERPPRDGWEDDMCSIITKNRNRGKRRTIVILAEGAQDSNLDRISS
                     SAVKDVLSKRLGLDTRVTVLGHIQRGGSPCAYDRWLSTLQGIHAVKAVLSMTPESPSP
                     VVIIQENRIRTSSLAETVALTKEANASMHAKEFEKAATLRDPEFMEYHSAYRHLNTSD
                     HPKMVLPEDKRMRVAIIHVGAPAAGMNPATRAVVAYCLTRGHTPIAIHNGFPGLCRHH
                     DDTPGSVREMHWLESGDWINDGGSDIGTNAGLPLDDIETTAQCFERYKFDALFVIGGF
                     EAFTAVSQLRKARKQYLAFRIPLVLLPASMSNNVPGTEYSLGSDTSLNTLVYFCDVVR
                     QSASSSGHSVFVVEAQGAEYQATAAALAAGAMTVYTPERGITLQSLSNDIEYLRQQFS
                     KDHGANRSGKLIIRNDQTSTIYSTTEIANIIKHEAKNRFDAQGVVPGHFQQGGKVSPI
                     DRIRAFRLAVKCMEHLETFAGQSPEEIMNDENSATVISIKQSRILLLPMGGPTGVEAT
                     DTDWKRQRPKTQNWLEIQEAVDSLSGRSSLYAIPN"
     exon            complement(1195242..1196363)
                     /number=1
     exon            complement(1196425..1196883)
                     /number=2
     exon            complement(1196957..1197703)
                     /number=3
     CDS             complement(join(1198743..1199642,1199701..1199766))
                     /codon_start=1
                     /locus_tag="AO090010000445"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000075"
                     /protein_id="BAE66302.1"
                     /transl_table=1
                     /translation="MCIAFFSTAHPQYRLIICNNRDEFLHRPTSRADWWPSPHSHVLS
                     ARDLVRPIHPTWLGITKQGRIAVLTNYHEDTCAKAVGKYSRGEVVNSWLALSPDSAQT
                     TQEFVNQWTTNGELANIGGFNLVCGNVMEPLAILASRASETEPILWIADKPGQTVGLS
                     NTDYDDRSWPKVEKGEDAIVDAIAGHVQNQESEDNLIERLLGVLSVDTLPRLSNDAGV
                     QEYIPHLPQSVFIPPIGRDKQARDEAESANQDKREQSPVLPSTPEGTPNRAYLEGLYA
                     TQKQTVILVGFDGRVRYFERTLYDDDAQPVSTEARDRSFEFRIEK"
     exon            complement(1198743..1199642)
                     /number=1
     exon            complement(1199701..1199766)
                     /number=2
     CDS             complement(join(1200604..1200686,1200749..1200772,
                     1200816..1201120,1201173..1201270))
                     /codon_start=1
                     /locus_tag="AO090010000447"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000073"
                     /protein_id="BAE66303.1"
                     /transl_table=1
                     /translation="MNVFPEKRGTISLFASKGQREGAIVAVILEELKLPYHLYLDKKL
                     EDIGAQSFPVLRNTQSDGESVNLSGFHDVVSYLITRYDTAHDVSYKKGSKEDEEVNRL
                     VASLTEPNAAHPEERRFDLDAKDDIPFARKAIITTWWARNALLRTSSTSPTWLPQAQL
                     VSTWRGSRS"
     exon            complement(1200604..1200686)
                     /number=1
     exon            complement(1200749..1200772)
                     /number=2
     exon            complement(1200816..1201120)
                     /number=3
     exon            complement(1201173..1201270)
                     /number=4
     CDS             1202892..1203527
                     /codon_start=1
                     /locus_tag="AO090010000448"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000072"
                     /protein_id="BAE66304.1"
                     /transl_table=1
                     /translation="MQPNSQDILDSPGYLPQWSPSSADLLPWEAYENWTSPRHSFAAP
                     NQFEDAPVLPPLKQDLVQNTSKLSSKTRTSPPQSHCSASSSTIASLSPPPSSPSGSPS
                     STPHEGSAHPSSRRSAHNRIEKRYRENLSKNFAALESSLQGYYTRGVGSGRPRFYCQR
                     KHASKKMAVLTDAVNYIGELEAETVMLKKKLETLRQALLPNGIWRYTLTDD"
     exon            1202892..1203527
                     /number=1
     CDS             join(1204265..1205236,1205294..1205677)
                     /codon_start=1
                     /locus_tag="AO090010000449"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000071"
                     /protein_id="BAE66305.1"
                     /transl_table=1
                     /translation="MPRDILVVGAGIAGLASAIALSNELAPVVPELKITVYDGASELT
                     TSGGAISLTPVAQRYLDELGVLSELNQMDDQAGIEVDAIDLFSVRAGRRLGPLRFTDE
                     NGHGYGGYKGRRVLRSALSEAMLAVARRLPNVSVHYDKKLIGGSTTAENVTLHFEDGS
                     TATGDLVLGCDGVHSATRTKIVDPGNRSEYTGVSFIQSMADARNFTATMPFTQTAVHL
                     ARHSSLLTSYCDPKHEKLFVAAIVRVSEHLIEKYQAMSGTDLAAQKNMRMSMRYLVRA
                     QFGMSSLPYIREIIDRTEDWMLYPVYQVRQRGKWHTDRILLLGDAAHAMPPRDESAAY
                     AVEDAIIFSKLLAQNPDCELLRLFEEYEELRRGLVNKAFDASRRLWQSDLDKGLFPGQ
                     TRDLMSPVHLPPDSCVGKRATQPINKRNLPAPTHESFSDLSVYSLTSDLGRTVDATNA
                     D"
     exon            1204265..1205236
                     /number=1
     exon            1205294..1205677
                     /number=2
     CDS             join(1206668..1207194,1207244..1207655)
                     /codon_start=1
                     /locus_tag="AO090010000450"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000070"
                     /protein_id="BAE66306.1"
                     /transl_table=1
                     /translation="MDPPQELDISASLSETVETRREQAGAKGALARGLLALQNRSSQL
                     PSSSEPSHMSETTMAPESRGAEAALGATDTSAKPQNNPQAGHTFTVVVPDLSFYELDD
                     DLNPPMDIAQALSGFIQNEASDHQLPVNDLAVASSLSIQIEDAEPGPSTRPADPESLE
                     WPDEMLDSVNDNDTSEFDVIKSWFKGLVNPTMEDAVKYKAAKLQEKARETRVSNREAL
                     QLQDDEYDEFVGDEENPGLFVTPEPAQESSSHVQLPEQNESKLAAEPTEEPKKTTRKK
                     RQNKISAEEKRRSMQFGLDVVLGKVDKKKVRKEAQG"
     exon            1206668..1207194
                     /number=1
     exon            1207244..1207655
                     /number=2
     CDS             join(1208279..1208397,1208449..1208606,1208661..1208848,
                     1208903..1209098,1209148..1210346)
                     /codon_start=1
                     /locus_tag="AO090010000452"
                     /note="helicase-like transcription factor HLTF/DNA
                     helicase RAD5, DEAD-box superfamily"
                     /old_locus_tag="AO070323000068"
                     /protein_id="BAE66307.1"
                     /transl_table=1
                     /translation="MQQLEKHCEIDAIGEVLVYRANARYLTLDVPKSIQKHNIVITTY
                     DEVRRSYPQCNVPSQIADKDKLIEWWKETYENDVGPLHQIKFRRIILDEAHVIKNHLS
                     QISIAVRALTGHYKWVLSGTPVHNCVEEFYPLFDFLGVPRTGTYENFWKLYCKDNEAN
                     KCLVNLLRSFMFRRTHSSRLFSLPIIKLPDIDERVVQTEFCKAERVMYDAIIDAFFEI
                     INGFAHVENPRVKQYRCFLTMILKLRMFSSHMLTAQDIIKKLLSKGLIRELIDILKVE
                     RSPESPSYNIIQWIRTMRKDTELPATPQTQGFTGLCVEELHGDKEELAKQFKAFMTTL
                     HENEQWLERFERGKCASCGFMPMNPLVTSCMHLYCEECYYLLMKEGETRICSSCNTCI
                     EAAAMCPIADDGEIREPPSALIVEKTKKQKKPSKKNKKKTQRGFMGGFPAVASHGRDE
                     SEDEEVDEDEEVDWISVSGGEMTSAKLVKIQEIVKGWIDENPDVKIVIFTQFLDFLRL
                     VGLMCNKEKWVATSVSSNLRHNLPLIHGGSAANRTQLHGKLSLQAREQSMDKFRDEKE
                     VRILIASLKAGGIGLDMSMANKCILVDLWWNEAIQQQVLHTHTFDFIHFYISE"
     exon            1208279..1208397
                     /number=1
     exon            1208449..1208606
                     /number=2
     exon            1208661..1208848
                     /number=3
     exon            1208903..1209098
                     /number=4
     exon            1209148..1210346
                     /number=5
     CDS             complement(join(1211233..1212195,1212300..1212347))
                     /codon_start=1
                     /locus_tag="AO090010000454"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000066"
                     /protein_id="BAE66308.1"
                     /transl_table=1
                     /translation="MMDEVDFELCLDIDQYVAASRRESKRLSTQSTTGSIKHDNVRTV
                     TIPNPKVRKHGELDSTSDIDEKHTLEPVHHARPCKKLKVANQAESDLEDDHDRTYLDI
                     AIKRITTHHDQEILSDADDTDPETRSSTNASTTAVNEDTMDLDSDTDAEVHANSTSGS
                     ITTSPSHSYIARPSHLFQIFEDPDDSHLENHPGLVSSFTTYSSLDEDKENIRDDDAYE
                     QREHTHGMGVNSQMWTRQSNNRFSHAASSRYQGVDGGVDTDEADTDVEEFLTEGGEGA
                     REVEMEDVRVSFHSLGAGEASLLPLAFPLPLRIPSPGVGQGGRASGRRRCFGPRPVVH
                     FE"
     exon            complement(1211233..1212195)
                     /number=1
     exon            complement(1212300..1212347)
                     /number=2
     CDS             complement(join(1213261..1213416,1213458..1214903))
                     /codon_start=1
                     /locus_tag="AO090010000455"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000065"
                     /protein_id="BAE66309.1"
                     /transl_table=1
                     /translation="MKAGSSQAPVEEKKETPVDSTPAHAQKPEPRPTDGEIFSSSGTP
                     FQSDTAMERFFGLLGDSKSPQEIATSSPLEAPVVSQATPKKENIPGKPFKSSRFAGLF
                     SPPPGSPAKETDSQLGNKSPTVQPSTTDADQEGFQRILQMLGGSKSRNATPHNDTAQA
                     NRPPSLPQADSVQSAISSPSREQIKRPDPMLMQESSMRSAPPAMDPQAREREHLLRLM
                     QQVRVTPVTNQAPGNHGQPQSAGAVSGMMNMPEMLPPPPGLASAPKAPNFIDDPAIAN
                     MQRAEPDQLRRRPANGPPMGYFEDMPFPQGGQVPITPGGSRAPQGQGLPGMGVQRPPG
                     FEHLPPPGWAGHQLPPQQGGGPGPLAPPPGIPTPTRGVNPNFMSNMMPMHGNVPPLGE
                     RQPFPRGAGGNGSAGFPPPPGMMPPPGYMNGPPPSGFPPMPPNAEALMGLGHGGQGPF
                     DGNPGPQGPPHSSRHLLDMFGQVGAGDARGGMARSLLDAKLTWHMAGLLPGVSGRFFA
                     KFDMYSKSMCCFVWCPPSVRSKDWL"
     exon            complement(1213261..1213416)
                     /number=1
     exon            complement(1213458..1214903)
                     /number=2
     CDS             complement(join(1216863..1217180,1217231..1217557,
                     1217618..1218379,1218459..1220256,1220305..1220456))
                     /codon_start=1
                     /locus_tag="AO090010000456"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070323000064"
                     /protein_id="BAE66310.1"
                     /transl_table=1
                     /translation="MSPHDDQLHRNKRRKVDSAQGNDASTDITSHGQLRNLLTFQQNI
                     NEVKQGQVTLGIKKFKDFLLATGQTENEGEKAKKFRILKAYCDSQISHEEEPSCFPDL
                     IQTWNFADSNNNESLLTVVPSVLALFIKTVSTNLDFRDFGLALCKFLLKKEQLRFFNR
                     GLTATKSKEHLISPCLRLLTEIVSFDGGAVARHVYAVRYITFKRIEVFLTPNKSQLEE
                     ASDDIQKSTLRRNAQRYVLANLRFQHASAKSDIIEQHKVIRAFLEYVRKDPRDTVLDI
                     IKAIERDIVQDTSLSRNAKTKFFNRGNLEKLVTLYGYDRESEEPNPTGVSIASEIHKI
                     LMNVCTNSSNGVLLSETSWYPNGSDPESLPGEEDTSIDLGLDSAVYVDKYRESVPVRN
                     GILSYLAQTLRPDADSLQIELLVAIFKEAPELVADFFTKKTMFVSDPKPTSSWMAESA
                     LLFSTVSLPVPTNFGWKDKLPSMPPPVSVVIENILPRPLTQKTLTRCLNLNAEIITLF
                     AVRILTISFNKLRKVLRIFNSDHGVSQSFWTQAKGKLIAEFCRRCPAMKDVVSLYKKT
                     AKEDLQQQEAVAELLSCFYEIVPDVAFEEIFDVSLVLVDILKRLDESSPSEEDSESLL
                     AQLGSILKIAQQSASMRWWQQPGKYTVVVGASSPDSLRNIEVLLKTVLTENSILHGSS
                     SFQSLLSSFGTSDSGNLRHQLSFFDNCVCRVAKKPVHYQDLLGSLCEDVSKPVSPIVA
                     AITEQWPFVVKSGGDAESAVGAWIAKTLGKLKGSGEDPKALKAARDTLVAATENKRTK
                     STLKKALKDTEEETSQDSNRRESSTTQPTTLRSSNEKSTVDLEEIFGTLPTEGTTHNA
                     LHRWEKEDIEISVEQGRVADLMLCLCSEHEEVRRQAFANITRFMSKIRESKYVEWRSV
                     FLLTGELLETVKQIGLESPVPWIVGECASNCLAVLVNPMHKLYGKVNKFLQKAPSWEP
                     EKIPSYWIDKILLHEPELDDGYFEETNWLLDLLIKGLRTETDMGIYRRANVFERALSF
                     YESPGPSLPSKRKILHLLYRSTQVQGSTTLITRAGIVSWIQSQIPALGGKEVPTFTAM
                     AFSLYESSEQDRVMKWSGGSVAQAVENIAV"
     exon            complement(1216863..1217180)
                     /number=1
     exon            complement(1217231..1217557)
                     /number=2
     exon            complement(1217618..1218379)
                     /number=3
     exon            complement(1218459..1220256)
                     /number=4
     exon            complement(1220305..1220456)
                     /number=5
     CDS             complement(1224599..1228288)
                     /codon_start=1
                     /locus_tag="AO090010000458"
                     /note="DEAH-box RNA helicase"
                     /old_locus_tag="AO070323000062"
                     /protein_id="BAE66311.1"
                     /transl_table=1
                     /translation="MDDLQSLELFSLVSRITSELQNHLGINDKTLAEFVIDQHLKCGS
                     FSKFKETLDEMGAEFPQSLMESIDRLVLTMHPKYKTKKTDDADKAEGGDDMDVLDALE
                     KKARVFKGLAVPDKAPQWDEDDYTDRKNSDEGDAKADAMDDTFAMLEGLAGKAREEKG
                     HTTGEDRSSRKRSRSPGYDDYDRGRRRKDKYRSQSRSHSPRYRKRDDDVDEFGRTRSK
                     YSSRDEHRDGRSERRQRRHDRSQDDHFRKPPPVELDDAPILYKVYDGRVTGVKDFGAF
                     VNLSGVKGKVDGLVHVSAMQEGARVNHPSDLVSRGQPVKVKVISIQGSRIGLSMKEVD
                     QVTGLDLIPQRRLASGANMERLDGTSANDRYGNLSSDVPVIEDSNGRPMKNRKRLTSP
                     ERWEIRQLIASGVASAADYPDLDEEYHATLTGEGTFEEEEDIDIEVRDEEPPFLAGQT
                     KMSLELSPIRVVKAPDGSMNRAAMAGTNLAKERRDLRQQEAQDKAAEQAAGVDLNAQW
                     QDPMAAPEDRKFAADLRTAQQPKPDDAVPEWKRVTMGKNQSLGKRTSMSIKQQRESLP
                     VFKFRKQLLDAVRDNQLLIVVGDTGSGKTTQLTQYLAEAGYGNNGIIGCTQPRRVAAM
                     SVAKRVAEEVGCKLGAEVGYTIRFEDCTSPETRIKYMTDGMLQREVLLDPDLKRYSVI
                     MLDEAHERTIATDVLFGLLKKTIKRRPDLRLIVTSATLDAEKFSEYFNGCPIFSIPGR
                     TFPVEIMYSKEPESDYLDAALITVMQIHLTEPSGDILVFLTGQEEIDTSCEILYERMK
                     ALGSSVPELVILPVYSALPSEMQSRIFEPAPPGGRKVIIATNIAETSITIDNIYYVID
                     PGFVKQNAYDPKLGMDSLVVTPISQAQAKQRAGRAGRTGPGKCFRLYTEAAYQSEMLP
                     TTIPEIQRQNLSHTILMLKAMGINDLLHFDFMDPPPTNTMLTALEELYALSALDDEGL
                     LTRLGRKMADFPMEPALAKVLIASVDMGCSEEVLTIVAMLSIQSVFYRPKEKQQQADQ
                     KKAKFHDPQGDHLTLLNVYNGWKNSKFNNAWCFENFIQARQIRRAQDVRQQLLGIMDR
                     YHHRIVSCGRNTTKVRQALCTGFFRNAARKDPQEGYKTLVEGTPVYMHPSSALFGKPA
                     EHVIYHTLVLTTKEYMHCTTAIEPKWLVEAAPTFFKVAPTDRLSKRKKAERIQPLHNR
                     FAGEDDWRLSAQRRQGRGGGGGTWG"
     exon            complement(1224599..1228288)
                     /number=1
     CDS             complement(join(1229140..1230100,1230157..1231103))
                     /codon_start=1
                     /locus_tag="AO090010000459"
                     /note="mitochondrial RNA helicase SUV3, DEAD-box
                     superfamily"
                     /old_locus_tag="AO070323000061"
                     /protein_id="BAE66312.1"
                     /transl_table=1
                     /translation="MNACKLEDRATSGGFGTLRQVKTTLQKTYIQSGVRGLKNELEYL
                     LYAEDVTSKYSTPNIEQQKKVADMRFPAEWYPQARSIQRTIHLHVGPTNSGKTYQALK
                     KLEASKSGFYAGPLRLLAQEVYHRFQANGTTCSLVTGDDVKIPEGQAPTIVSNTVEMV
                     NLGQPYDVGVIDEIQMIGDPKRGWAWTRAVLGARAKELHLCGEPRVVPLIRELAALTG
                     DKLEIHRYERLNPLKVMDRSLRGDLKNLQKGDCLVAFSRVGIHALKADIEKVTGKRAA
                     IVYGSLPAEIRTQQASLFNDPNNEYDYLVASDAIGMGLNLSCKRIIFETLVKRVPGGL
                     VRLSVPEIKQIAGRAGRYRSAAQQQKKGKAAEYDGTNVGYVTSLEEVDLPYIHQAMGI
                     EPPPITAAGVFPPEPIFQRFAAYFPQSVPLEYIIKRLIDVSQVHPLFFMCDPRGQLDN
                     AEVIDTVSGLRFEDQMTFMAAPMHTRDISSRDVACAFAQCVAEHTGGRLLDIPDLNLE
                     ILEEPVSGNKEYLHDLEILHKSVILYSWLSFRFGGVFTDRTLAAHVKELVEERMVRAL
                     TEFSANKKLRKDASLRRQIALQKQIQDHKRLLAEADLDAFEEEGEETVPIDLSAENDS
                     LERVSPEAQAA"
     exon            complement(1229140..1230100)
                     /number=1
     exon            complement(1230157..1231103)
                     /number=2
     CDS             join(1232314..1232461,1232520..1232663,1232719..1232921,
                     1232983..1233449,1233515..1234619)
                     /codon_start=1
                     /locus_tag="AO090010000460"
                     /note="vesicle trafficking protein Sec1"
                     /old_locus_tag="AO070323000060"
                     /protein_id="BAE66313.1"
                     /transl_table=1
                     /translation="MRCAKTPPPYGRGTNGGDVQWKVLVVDETSRKLIDNAVSEDDIL
                     NLNVTNVEQIEEKRKTNPMDALYILSPQSHIVDCLMADFERKRYKKAWLVWTSYLDPQ
                     QRTRLERSQMAQEQIAGFRVMSVDYFPRESRLVTFRDPWSFPVLFHPGCNHLIRGHLE
                     GLAQKIVSLCVSLGEYPVIRYYKPRAPTHEASVMCSHLARFIQNELDQFAHFQKDFPP
                     PSQRPRGVLMVVDRSMDVVAPLIHEFTYQSMVHDLLPIKDGDKVTYKTIINEGSHNEE
                     LKEMEISENDNVWVDYRHLHMKDVLGKLGEDFAKFRAANPQFAEENDKANVNTIKDML
                     AGLTEFQQGRDAYTLHLNMAQECMKHFQEHKLLEVSSVEQCLSTGLDENYKKAKNLAS
                     QLVQLLDDDAVDHQDRLRLLILYIMYRGGILGGDIRKLMAHAQLPPQDGDVISNLDLL
                     GSRVEKQLKDEKPPVQPLFHRKPPSPAESDETSLSRYELNLKLMLEELVRGTLDPTAF
                     PPTRPNTEAEGMGGPQDTLSQASLRSAKPTWARTRSATEQPRQRIIVFMAGGATYGEA
                     RSCYEVSQAFNKDVFLATSHMLSPGLFLKQLGDLSADRRRLDIPAERPKPTAPAHLFE
                     KDPPPQPQPVPKKAPAPKLNPPAPPSAAMGAMSLGSNGAAPAPSSAKPHKEKKEKKHH
                     HFFRRS"
     exon            1232314..1232461
                     /number=1
     exon            1232520..1232663
                     /number=2
     exon            1232719..1232921
                     /number=3
     exon            1232983..1233449
                     /number=4
     exon            1233515..1234619
                     /number=5
     CDS             complement(1234972..1235748)
                     /codon_start=1
                     /locus_tag="AO090010000461"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000059"
                     /protein_id="BAE66314.1"
                     /transl_table=1
                     /translation="MTSNEATDEDYFLPVESQRPFGAGIRRKRVQFVRSSEHELNTTS
                     APAAQPASSGTSIANKYLSIVMPKEKQVSEPGTPAERVSGDVGSRDAEVQSAPASPSA
                     IPRCDVCSLPIDGDELGHGAMMTGDRPHEASLAHQVCLSHSHPPSHLDRTRHGLRYLA
                     AYGWDPDSRLGLGVSGREGIREPLKGRLKVDTVGLGAQGDDEAKEGGKGKIRVVERPA
                     KVQKLNAKEVRKSYLDARKRGEKLREQFFQSDDVLKYLGQ"
     exon            complement(1234972..1235748)
                     /number=1
     CDS             join(1236018..1236194,1236264..1237373)
                     /codon_start=1
                     /locus_tag="AO090010000462"
                     /note="dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /old_locus_tag="AO070323000058"
                     /protein_id="BAE66315.1"
                     /transl_table=1
                     /translation="MPIPLLAQGFQEGISSIPYAWTVLKIVPFVLLVAALKYYFGGAR
                     NGSERLMHSKVVMVTGGTSGIGASVVHELASRGAQVILLTKHAPSDVFLVDYIEDIRK
                     STKNQLIYAEQVDLSSLHSIRTFATKWIDNVPPRRLDMVILCGNTAAPSSASRKLTAD
                     GLDEEWQVNYLANFHLLSILSPALRAQPPHRDVRVIFTTCSSYIGAKIDPKQIEAACT
                     PDAPAPRGTKNGKNVKKVGAGSKKSKPSLFGASKLALMSFSQSFQKHLNAFERPDKMP
                     PCTRVIVVDPGFSRTPGTRRWLTGGSLWGLLLYLITWPLWWLVLKSPQQGAQSILYAA
                     MEARFGRGTGGWMIKECQEVDFARKDIKDEEAGKLLWQFSEAQIEQKEKESAVKRALA
                     KKEQQEKEKQKNNGASSSKPAAKEQTPGSRRSRKAK"
     exon            1236018..1236194
                     /number=1
     exon            1236264..1237373
                     /number=2
     CDS             complement(join(1237678..1238072,1238139..1238595,
                     1238656..1238890,1238963..1238991))
                     /codon_start=1
                     /locus_tag="AO090010000463"
                     /note="UDP-glucose 4-epimerase/UDP-sulfoquinovose
                     synthase"
                     /old_locus_tag="AO070323000057"
                     /protein_id="BAE66316.1"
                     /transl_table=1
                     /translation="MPSGSVLVTGGTGYIGSFTALALLEAGYKVVVADNLYNSSAEAL
                     RRIELISGKKAEFAQVDVTDEAAFDKVFEAHPDIDSVIHFAALKAVGESGEKPLDYYY
                     VNVYGTLNLLRSMVRHNVYNIVFSSSATVYGDATRFPNMIPIPEECPLGPTNPYGNTK
                     FAVETAITDVINAQRNNAAKAGNEEESKKWNGALLRYFNPAGAHPSGIMGEDPQGVPY
                     NLLPLLAQVATGKREKLLVFGDDYKSHDGTAIRDYIHILDLADGHLKALNYLRANNPG
                     VRAWNLGTGRGSTVYEMVRAFSASVGRELPYEVAPRRAGDVLNLTANPTRANTELGWK
                     AERTLEQACDDLWRWTKNNPQGYRQEPPAELLEQLKK"
     exon            complement(1237678..1238072)
                     /number=1
     exon            complement(1238139..1238595)
                     /number=2
     exon            complement(1238656..1238890)
                     /number=3
     exon            complement(1238963..1238991)
                     /number=4
     CDS             complement(join(1240879..1241002,1241095..1243329,
                     1243422..1243570))
                     /codon_start=1
                     /locus_tag="AO090010000464"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070323000056"
                     /protein_id="BAE66317.1"
                     /transl_table=1
                     /translation="MSFFGFDTTLPRDRAPGGGQKGIFDTPDPFAEVARARLAGHFRD
                     NDDDDVIDFEDTYDGLGDQLDDDQDAFNDDTFGGNMGTGAVGKDFDFFGKTAQVADVI
                     GEEQVRYSLQKPQAPAAAPATEVPVATSTVAQQPKRTGYEKYSDPDYIPDLQAKSSVW
                     NLQKQPEPAPAPAVQPVAQPAVQARKMLSLEEVEAQLRHQGPGPAPGLPPVSLPHSMA
                     EALHHLQRPQQIPGFPDGFPQLPPEILQAQFARGVPPAQMLHHPQMAPEPYPPPNLPL
                     HLLQNANLPQHLVQSQHQAPPRGQRTQQQQQQQQQAPPPMPQNVPQGPKGTNGTLPLI
                     TNPQQLMQLTEEQRVAYLMEDAKRAKRNHKIFLLSKGNGLMTPQDKNFITRIQLQQLV
                     AAAGNVADADLEAVLAEDFYYQVYSQIRGAPRQHPHQPLGHFAQTYLLQTGNRLGGHG
                     SRRQAQSADNHMQRMQQQVQRAVEAAKAKPKNKQLIIEGSLGKISFSNAKTPKTMLNI
                     KRPETSEGIKAAKKPHTDLSLSDRKSILTNIENVYGTLMELEDMERTMPPPPNEGDAE
                     AIQEHMEWRQKVRSLNQKLWQALKVMEPIVPNTNTPHPFIAFLSYPKGKKAIPRIFRH
                     IDQEQRVTILTMIVVHLDSLDVVRNGQPAPGEPQPSLPVREAIDLFSQAVMPSLLGYV
                     NEAPFNIIIGLLGLVIAQTHVHMVAKTRIGLGILTMLLSRAEIVKEAGQAAERDWQQW
                     VEKFNILFDTLEPTFAEIFPGSINAGDDMYVWQFLAAVGIGASPEQQQRLVIAVKDRV
                     METVAYSKTLPADMASQRLGNVNLFMRAIGLDVELLG"
     exon            complement(1240879..1241002)
                     /number=1
     exon            complement(1241095..1243329)
                     /number=2
     exon            complement(1243422..1243570)
                     /number=3
     CDS             join(1244647..1244697,1244758..1245561,1245617..1245905,
                     1245962..1246026)
                     /codon_start=1
                     /locus_tag="AO090010000465"
                     /note="glycolipid 2-alpha-mannosyltransferase (alpha-1,
                     2-mannosyltransferase)"
                     /old_locus_tag="AO070323000055"
                     /protein_id="BAE66318.1"
                     /transl_table=1
                     /translation="MSSGPVKYVRYLLFAAAGLAVFFFLSRSAIPIPDSIGSKLNPAS
                     YKDNSASSPSSHDNAATPKEHTNDASGSVGTPQGGRVNATFVTLARNSDVWDIAKSIR
                     SVEDRFNRNYHYDWVFLNDKEFDDEFKKITTALVSGTTHYGVIPKEHWSYPEWIDQEK
                     AKKVREDMGQRKIIYGDSESYRHMCRYESGFFFRHPLMLNYEYYWRVEPSIELFCDIS
                     FDPFRFMKENNKKYSFVLSLYEYFDTIPTLWDSVTKFMNNHPEHIAEANSMDFLSDDG
                     GKTYNKCHFWSNFEIGHLEWLRSKPYMDYFESLDRDGGFFYERWGDAPVHSIAAGLLL
                     EKEQIHFFNEIAYYHIPFTHCPTGEQLRLDLKCHCNPSDNFDWKGYSCTSRYFHVNNM
                     KKPAGYENES"
     exon            1244647..1244697
                     /number=1
     exon            1244758..1245561
                     /number=2
     exon            1245617..1245905
                     /number=3
     exon            1245962..1246026
                     /number=4
     CDS             complement(join(1246603..1246668,1246734..1246834,
                     1246895..1247306))
                     /codon_start=1
                     /locus_tag="AO090010000466"
                     /note="mitochondrial/chloroplast ribosomal protein S12"
                     /old_locus_tag="AO070323000054"
                     /protein_id="BAE66319.1"
                     /transl_table=1
                     /translation="MPPFVSSLTLRTLRTIIQRPAFSAIAAPKPSYSIPRFQPVLRTP
                     TAVAAATTPSLAIRQFSTSPFRQATYNQVRRGCRVAQRARRARSPALKDRPEMKGVCL
                     KTGITKPKKPNSGERKTARVRLSSGKVVTAYIPGEGHNVQQHSVVLVRGGRAQDCPGV
                     KYHLVRGAMDLGGVANRLTSRSKYGTKKPKRD"
     exon            complement(1246603..1246668)
                     /number=1
     exon            complement(1246734..1246834)
                     /number=2
     exon            complement(1246895..1247306)
                     /number=3
     CDS             complement(1249732..1250127)
                     /codon_start=1
                     /locus_tag="AO090010000468"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000052"
                     /protein_id="BAE66320.1"
                     /transl_table=1
                     /translation="MSDAQPLAGGESAPPPQSPSDASTLPTLNAPAAESGVSAPEAPP
                     VEQPSQESEAKEEDQGPSLMITLLLTSGSRHPFKIDGKYLQKRSVNVENNDPFAMSVY
                     TLKELIWREWRQGMYGRRQLSKTGPREIN"
     exon            complement(1249732..1250127)
                     /number=1
     CDS             join(1255640..1256173,1256227..1256466)
                     /codon_start=1
                     /locus_tag="AO090010000469"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000051"
                     /protein_id="BAE66321.1"
                     /transl_table=1
                     /translation="MPIAAIHCPAEDFVEDAEPVYIARAWKRLLRCDILMSRRGAPLC
                     HNLPVTVSFTELANARFHGLQIYISENVQFLRKDGVVSYLGPFKRRLLYEAAEDFVPT
                     LPPYRLGEYDDHLSEKSGFGVQESVVLSECEDKPVTSEGMTLNIDLALPTCQDHSEDN
                     WMHFSTEYKSARVSHWLDFVFSMSRHGAPPVVQKIARVPLSLRSCYAQHANASLPAYS
                     QTCEIKPFNAVPAEGCFDQESVDQGQHWWSENDQRYSVS"
     exon            1255640..1256173
                     /number=1
     exon            1256227..1256466
                     /number=2
     CDS             join(1257086..1257182,1257235..1257342,1257407..1257947,
                     1257989..1258856)
                     /codon_start=1
                     /locus_tag="AO090010000470"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070323000050"
                     /protein_id="BAE66322.1"
                     /transl_table=1
                     /translation="MAPPTYAGMSGRKLSLTVSTIATMGFLLFGYDQGVMSGIISDPA
                     FNDMFTATKDDNTMQATVTAVYEVGCLFGAIIALLIGDRTGRRWMVIAGAAIMIIGVV
                     IQVSAMPGSLPLLQFIFGRVITGIGNGMNTSTIPPYQAECSKTSNRGLLICIEGGIIA
                     IGTAIAYWIDYGAHYGPQDLVWRFPIAFQVFFGVIIIVGMFYLPESPRFLIAHDKVAE
                     GERVLAALAGTEIEDRHTQTEKNLILDSVRALPRDSSGATKAKFSDLLTGGPSQHLRR
                     MLVGSSSQMFQQISGCNAVIYYLPVLLEQSIGQSHNFALLIGGINMICYAIFATFSWF
                     FIEKIGRRKLFLGGSYGQCAAMVIVFACLIPGDKQSAKGAVFGFFLYMCFFGATWLPL
                     PWLYPAELSPIRTRAKANAISTCNNWLFNFTVVMITPVMVEHIGWGTYLFFAAWNAVF
                     IPVIWFFYPETAGRSLEEIDLIFAKGYVEKMSYVRAAKELPKLSDDEIEAKAAEYGIL
                     DNNEKVEERIAEHAPQDSQEYSSYLPSQL"
     exon            1257086..1257182
                     /number=1
     exon            1257235..1257342
                     /number=2
     exon            1257407..1257947
                     /number=3
     exon            1257989..1258856
                     /number=4
     CDS             complement(join(1260354..1261452,1261502..1261854))
                     /codon_start=1
                     /locus_tag="AO090010000471"
                     /note="phosphomevalonate kinase"
                     /old_locus_tag="AO070323000049"
                     /protein_id="BAE66323.1"
                     /transl_table=1
                     /translation="MSYPPSGSTALSAPGKVLLTGGYLVLDRNYTGTVIALDARIHVI
                     VQQLKRGHRRGASFSSVKGGPDTETVEDGSAVDDKEKEDVVVVRSPQFVNAIWEYGIQ
                     RCENGGGIKVIQRNDGRSNPFVETSLNYALTYISYVADSKDFGSLSVTILADTDYYSE
                     TAFSRVSESPGRFVNFGVPLHEAHKTGLGSSAALVTALVSSLVIHRTLQPDDLGASRD
                     KLHNLAQAAHCAAQGKVGSGFDVAAAIYGSCLYRRFSPSILESVGDAGSPGFEERLFA
                     VVEDADPKHPWDTECLDFGMRLPRGMQMVLCDVECGSNSPSMVKKVLEWRKQNQQEAD
                     LLWAALQSNNERLCLQLKQLAQSPDQESPEDFNDVRNLIQRSRNHLRSMTRKAGVPIE
                     PRVQTELLDAVSAVDGVIGGVVPGAGGYDAIAVLIRDDQEVLKKLTELFKNWESKVED
                     DFGGKIGTVRLLGVRHGSDGVKNEVLDQYAGWL"
     exon            complement(1260354..1261452)
                     /number=1
     exon            complement(1261502..1261854)
                     /number=2
     CDS             join(1264002..1265984,1266252..1267817)
                     /codon_start=1
                     /locus_tag="AO090010000472"
                     /note="PPR repeat"
                     /old_locus_tag="AO070323000048"
                     /protein_id="BAE66324.1"
                     /transl_table=1
                     /translation="MVFKPFTHLARQSFTKAFTHGYAQSVVAASQSSYASSATFNQLA
                     NQPAKVSRSALQNVFQPSSSSGAGAKASQGGSGSGDLGLAAYYAAWQHAQQTGDDSDW
                     KQFQVKRKLGWKPSTPEEAAKSKEDSVNSTNPHNFDSPHITKASANADVSAQVEEAVA
                     REIQIQEEQAQAEEASEGKDDSATEAFPDLPADVAAIADVSTEQARIASDQIVQLALT
                     KKYAEIPSAFEALLRDGLTPTVGAYNALLESAVRLHGDTAQAIQKALDVYSDMLRRRV
                     IPDEQTYRTLVQLFVERAHDALKSQKSLEQDRIRYGGMEEPGKFMLHSSELERAILDE
                     DHSLGIAIKLFNTATTRHPDLIFPLDTYSRLIIACAREGQVENMIRIYAHMETHKVTP
                     HASIFPSMIDAFASTGDLKSAVECYNEYKALAISDDNGTFSIVQRLDGQVYAALVKAY
                     LSCGKEKEALRFLERIRASFDEVTENKETRKDAVETVIVRDGLVSHSLKSGEHDKALS
                     QAKTRLRDGALDHAMAEICIAAADAGNLKTASEAYDCLPTDTAKRHGPAISMLALYVR
                     QGNVSAARPLWVMLSTVGQTTPDMVQPTAMYSVALLKSGQIEEALVEARNMFGRVRNA
                     SIDNPYLLNAVREQINESLHLIGRVLIQTAAVLSPQTAVGKLFNSRPDMVRRWHDHLG
                     LTSSPSSFLSDRHTPVSEMSTMTSAPSEDSFDPYAYATDFKGSAMIAEQLESTSGRPD
                     SHLNDALTRLRNMRRSGRHPRYITYAKLITAAAKCHRNDLVHEILSMARRDVPLLHQY
                     HAVKYGWVSILDAMVASCLTLNDRSLASKYHQELSELGSAPSANTFGLYITTLKESTK
                     TFDEATEALKIFHRAVAEGVEPTSFLYNALIGKLGKARRIDDCLLYFAEMRAQGVRPT
                     SVTYGTIVNALCRVSDERFAEEMFEEMESMPNYKPRPAPYNSMIQYFLNTKRDRSKVL
                     AYYKRMLSRNIQPTMHTYKLLIDAHASLEPVDMKAAEKVLETIKAAGQQPEAVHYASL
                     IHAHGCVMHDMKAAQDVFNSVVSNSKVRLQPCLYQALLEAMVANHQVAQTEDIVKDMV
                     QRRVDMTAYIANTLIQGWATEGNVSKAKAIYDSIGVDKREPSTYEAMTRAFLMANERE
                     NASRIVQEMLSRGYPTAVASKIVDLVGGGAAVAAAL"
     exon            1264002..1265984
                     /number=1
     exon            1266252..1267817
                     /number=2
     CDS             join(1268556..1268634,1268716..1269722)
                     /codon_start=1
                     /locus_tag="AO090010000473"
                     /note="pyridoxamine-phosphate oxidase"
                     /old_locus_tag="AO070323000047"
                     /protein_id="BAE66325.1"
                     /transl_table=1
                     /translation="MSSENPTADHLASPGDDHAKHPRKLIFAPGDIQVPTPNDQTTPP
                     HKPDAATPANISRLVAEALRSETSTPNSVTENQIVSHPARAHQFVTNPPLTVSQMHPT
                     NPLHQFHTWFRDPRLSASSAPETCTLATASLPSGRVSARVVYLKELDERGWVVYSNWG
                     SRQGKGAQVFGTQADGDSVLGAMPEPGVDDDGMPQGNKWAALTFSWGTTERQVRIEGL
                     IEPLSREESELYWRTRERGSQIGGWASWQSKVLWSAEPDSLIERRRKSLAQDVFPQAI
                     PGDVDETDIDDGRALLEKRVREMEEKFANTEQIPLPPFWGGVRLVPESVEFWQGRRSR
                     LHDRFRYVRVHDPQSDSYKWRIERLSP"
     exon            1268556..1268634
                     /number=1
     exon            1268716..1269722
                     /number=2
     CDS             join(1274849..1274936,1274996..1275333)
                     /codon_start=1
                     /locus_tag="AO090010000474"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000045"
                     /protein_id="BAE66326.1"
                     /transl_table=1
                     /translation="MFIQYLTEQGHNVVKSERKPRKLIQYKDLATAVSRIDNLEFLSD
                     VIPKTTTYKQFKEKKAKEAIREAEIEKGQRTLNGTVPHANGESEHQEELQAIEEKPSK
                     SPRTPVVMHATGAVSTLVVDRTVDNQSRGDDGDVEMVDQ"
     exon            1274849..1274936
                     /number=1
     exon            1274996..1275333
                     /number=2
     CDS             join(1275897..1276188,1276336..1276424,1276493..1276643,
                     1276710..1276891)
                     /codon_start=1
                     /locus_tag="AO090010000475"
                     /note="ubiquinol cytochrome c reductase, subunit RIP1"
                     /old_locus_tag="AO070323000044"
                     /protein_id="BAE66327.1"
                     /transl_table=1
                     /translation="MSLSSASSTLLRACARQQLPTSRAAIASCQQRRGVADASKSSFE
                     SPFTSAKESSTYKIPDFSKYASKKPPRSNQVFSYFMAGSLGLASAVGAKATVQDFLVN
                     MSASADVLAQAKVEIGLASIPEGKNVIIKWRGKPVFIRHRTQDEINEANSIEWQTLRD
                     PQADEDRVQKPEWLVMLGVCTHLGCVPIGESGDFGGWFCPCHGSHYDISGRIRKGPAP
                     LNLEVPQYSFPDESTLVIG"
     exon            1275897..1276188
                     /number=1
     exon            1276336..1276424
                     /number=2
     exon            1276493..1276643
                     /number=3
     exon            1276710..1276891
                     /number=4
     CDS             complement(join(1277827..1278710,1278789..1278891))
                     /codon_start=1
                     /locus_tag="AO090010000476"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000043"
                     /protein_id="BAE66328.1"
                     /transl_table=1
                     /translation="MDNLQSNIFVAGQRLNDLTGYSSIEALKKDIHTQEERLRAARLR
                     VREAKDAYAAAINNRSTSQREVNELLQRKHAWSASDLERFTHLYRNDHTNEVAENEAQ
                     EALSAAERESEEAAAQLNKSILSRYHEEQVWSDKIRRMSTWGTWGLMGVNVLLFLIFQ
                     IAVEPWRRKRLVKGFEEKVIEAIEKEKAMHHVEILAPVNAAQEIPAAPSADSSAPVVA
                     AVPSPAAEETASNAISTEVLDVPDSATPAPDTTTTPNSQNSLNDLLESAKLQLSRFPP
                     PTSVESWRQYISDLFSDRNLVITQRDLSSLALQSAAAGAAIMGLVIALIRPR"
     exon            complement(1277827..1278710)
                     /number=1
     exon            complement(1278789..1278891)
                     /number=2
     CDS             complement(join(1279945..1280363,1280445..1280502))
                     /codon_start=1
                     /locus_tag="AO090010000477"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000042"
                     /protein_id="BAE66329.1"
                     /transl_table=1
                     /translation="MCGSDIFLAILAIFFPPVSVWIKVGICTADSIINLALCCLGYVP
                     GLLHAWYIILKYPEQDPDDPYYEPVPGNAHRRDVENGHVTYYYVSHQQIQHPSQRGYG
                     TVAPTTATPPLQQQSQSTPKPQNEPAAGSSGDQTQGDSRPPPTYAEAVKGDHKVQD"
     exon            complement(1279945..1280363)
                     /number=1
     exon            complement(1280445..1280502)
                     /number=2
     CDS             join(1283879..1283970,1284033..1284116,1284178..1284340,
                     1284392..1285621)
                     /codon_start=1
                     /locus_tag="AO090010000479"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000040"
                     /protein_id="BAE66330.1"
                     /transl_table=1
                     /translation="MATCISLKGSTQCPAWNGSSISTSSSLYTDFPFMQNVTSIKQFD
                     QELSDYVKGSYVTQKYADYLGCQGANLTDTDDFYARYTTSSICSGLVQSSKTDCDLSD
                     NESRPLCADTCALMATSEATILLNPDLCPKRAGNYMSQVRSDFTVCALPADSLTVTCI
                     SGADNESDECGYGSNLVGLCGFCGASSPNSTDSCCINSNAATRCKDVTIPTSTTIPPI
                     FTSTSSPTAGSSSGHLSGGQIAGAVIGAIAGVALLAALAALALICWRRKRRARNDNVL
                     NQPNPQRKGFSPMQPTPGQQGFAPIPGGRVARMSALREAPSYSPGRSRNSAALFGVGK
                     HSESSDSDYYGASPGAMSKKIPPTAGKRTASLSSNSALAGAGSDGSPRSGIGGQYSSP
                     DGMASGQSEQLSSFHDYYSQDDIRPGDKVAVLWAYQPRAGDEFALDRGEMLKIVGIWD
                     DGWATGIRVPESAEDYDARHREQRDSGVSNGSHRPIASPSPNGEIKAFPLVCVCLPQH
                     WRKIIDGGQADDTL"
     exon            1283879..1283970
                     /number=1
     exon            1284033..1284116
                     /number=2
     exon            1284178..1284340
                     /number=3
     exon            1284392..1285621
                     /number=4
     CDS             join(1285646..1285665,1287333..1287584,1287647..1287695,
                     1287756..1287896)
                     /codon_start=1
                     /locus_tag="AO090010000480"
                     /note="actin depolymerizing factor"
                     /old_locus_tag="AO070323000039"
                     /protein_id="BAE66331.1"
                     /transl_table=1
                     /translation="MSQKVRGVSITDECINTFNDLRMKKGDKLKFIIFKIADNKKEVV
                     VDEASTDQDYDNFRKKLEDAKDSNGKPAPRYAVYDVEYELGGNEGKRSKIVFISWVPD
                     GAPTLWSMIYASTRENLKNALNISNSIHADDKSEIEWKTILNEASGGKAGK"
     exon            1285646..1285665
                     /number=1
     exon            1287333..1287584
                     /number=2
     exon            1287647..1287695
                     /number=3
     exon            1287756..1287896
                     /number=4
     CDS             join(1288769..1289078,1289161..1289354,1289446..1289535)
                     /codon_start=1
                     /locus_tag="AO090010000481"
                     /note="cytochrome c oxidase, subunit IV/COX5b"
                     /old_locus_tag="AO070323000038"
                     /protein_id="BAE66332.1"
                     /transl_table=1
                     /translation="MFLQSVSRAAARSSAMPTTAIRSYRTVSGPMACLNARPQPVKKS
                     IAPQQTRASSEHAISNPTLAGIEKRWEAMPPQEQADLWMQLRDRMKVDWHQMTLQEKK
                     AAYWIAFGPHGPRAQAPKGEGLRIAVKVAQLTAVSVALFYVIHLFAKPQPKTMSKEWQ
                     EASNEYAKAEKINPIYGISAEGYEGKGFVQSPPAEKS"
     exon            1288769..1289078
                     /number=1
     exon            1289161..1289354
                     /number=2
     exon            1289446..1289535
                     /number=3
     CDS             join(1290821..1290831,1290915..1291078,1291215..1291300,
                     1291356..1291398,1291522..1291838,1291897..1292746,
                     1292802..1292884)
                     /codon_start=1
                     /locus_tag="AO090010000482"
                     /note="F0F1-type ATP synthase, beta subunit"
                     /old_locus_tag="AO070323000037"
                     /protein_id="BAE66333.1"
                     /transl_table=1
                     /translation="MFKSGLARTFGRAAFARPTPVARRVPSKINAFPSLARLASTEAG
                     ATGKVHQVIGAVVDVKFEGEKLPAILNAIETENNGQKLVLEVSQHLGENVVRTIAMEG
                     TEGLTRGAAARDTGAPITIPVGPGTLGRILNVTGDPVDERGPVKATKYAPIHAEAPEF
                     VEQSTEGEILVTGIKVVDLLAPYARGGKIGLFGGAGVGKTVFIQELINNIAKAHGGYS
                     VFTGVGERTREGNDLYHEMQETGVIQLEGESKVALVFGQMNEPPGARARVALTGLTIA
                     EYFRDEEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLAVDMGGMQERITT
                     TTKGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRGISELGIYPAVDPLDSKSR
                     MLDPRIVGQDHYDTATRVQQMLQEYKSLQDIIAILGMDELSEADKLTVERARKLQRFL
                     SQPFTVAQVFTGIEGKLVDLKDTIRSFKAIINGEADDLPEAAFYMVGDLESARAKGEK
                     LLAELENKA"
     exon            1290821..1290831
                     /number=1
     exon            1290915..1291078
                     /number=2
     exon            1291215..1291300
                     /number=3
     exon            1291356..1291398
                     /number=4
     exon            1291522..1291838
                     /number=5
     exon            1291897..1292746
                     /number=6
     exon            1292802..1292884
                     /number=7
     CDS             complement(join(1294609..1294635,1294710..1295340,
                     1295401..1295736,1295787..1296478,1296543..1296655,
                     1296711..1296810,1296908..1297032,1297089..1297134))
                     /codon_start=1
                     /locus_tag="AO090010000483"
                     /note="1,4-alpha-glucan branching enzyme/starch branching
                     enzyme II"
                     /old_locus_tag="AO070323000036"
                     /protein_id="BAE66334.1"
                     /transl_table=1
                     /translation="MGTSQAVDSSPPDGTGVIQLDPWLEPFRDALKQRFSFIEGWVKA
                     INETEGGLETFSKGYERFGLNVQSNGDIIYREWAPNAVQAQLVGEFNNWDVTAHPMTK
                     NGFGVWEVTVPAVNGAPAIPHDSKIKISMVIPSGERIYRIPAWIKRVVQDLSVSPTYE
                     AVFWNPPTEKQYKFQYSRPKRPESLRIYEAHVGISSPETKVATYKEFTSNMLPRIKYL
                     GYNAIQLMAIMEHAYYASFGYQVNNFFAASSRYGTPEDLKELVDKAHSMGLVVLLDVV
                     HSHASKNVLDGLNMFDGTDHLYFHGGGKGRHELWDSRLFNYGHHEVLRFLLSNLRFWM
                     EEYGFDGFRFDGVTSMLYTHHGIGTGFSGGYHEYFGSSVDEEGVMYLTLANEMLHNLY
                     PNCITVAEDVSGMPALCLPHSLGGVGFDYRLAMAVPDMYIKLLKEKKDDEWDIGNLSF
                     TLTNRRHGEKTIAYAESHDQALVGDKTLMMWLCDKEMYTHMSVLTEFTPIIERGMALH
                     KLIRLVTHGLGGEGYLNFEGNEFGHPEWLDFPRDGNNNSFWYARRQLNLTEDHLLRYK
                     FLNDFDRAMQLTEEKYGWLHSPQAYVSLKNETDKVLVFERAGLLWIFNFHPTNSFTDY
                     RVGVEQSGTYRIVLDTDDPAFGGLNRNLKETRFFTTDLSWNGRSNFLQVYIPTRTALV
                     LALEETL"
     exon            complement(1294609..1294635)
                     /number=1
     exon            complement(1294710..1295340)
                     /number=2
     exon            complement(1295401..1295736)
                     /number=3
     exon            complement(1295787..1296478)
                     /number=4
     exon            complement(1296543..1296655)
                     /number=5
     exon            complement(1296711..1296810)
                     /number=6
     exon            complement(1296908..1297032)
                     /number=7
     exon            complement(1297089..1297134)
                     /number=8
     CDS             complement(join(1297657..1298378,1298455..1298656,
                     1298714..1298752,1298813..1299448))
                     /codon_start=1
                     /locus_tag="AO090010000484"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000035"
                     /protein_id="BAE66335.1"
                     /transl_table=1
                     /translation="MRINTLSLFSLVSLVPTLALASLSGSVGPLTSASTKAATKTCNV
                     LDYGAKADKTTDLGPPLASAFADCKSGGLVYVPSGDYALSTWAKLSGGKAWALQIDGT
                     IYRTGTDGGNMIFIEHSSDFELFSSTSSGAMQGLGYEYHKDNKWSGPRLLRLYDVTDF
                     SVHDFILVDAPAFHFSLDTCTNGEVYNMAIRGGNHGGLDGVDVWSTNVWIHDIEVTNK
                     DECVTVKSPSKNILVENIYCNWSGGCGMGSLGKDTDISDITYRNIYTWNSNNMMFIKS
                     NGGSGSATNLLFENFIGHGNAYSFDIDSYWASMSSQGGNGVELSNITLRNWKGTEENG
                     ASRGPIKIVCPDGAPCYDITIEDFAMWTEDSSRQRQWYSCRNAYGTGFCLKSGSNHVA
                     YEATTTTVSSAPSGYSAATMAADLKTDFGITASIPIPTIPTSFYPGATPYSALMANKG
                     STAKVRAVVAPSKPTTVAAATSTPAEQQTSTSTPAPAVEQPSQQSPGQSAGEVGGCPF
                     GNGRSVPTGPPRAGHRHHQRHGHH"
     exon            complement(1297657..1298378)
                     /number=1
     exon            complement(1298455..1298656)
                     /number=2
     exon            complement(1298714..1298752)
                     /number=3
     exon            complement(1298813..1299448)
                     /number=4
     CDS             complement(1300627..1301514)
                     /codon_start=1
                     /locus_tag="AO090010000485"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000034"
                     /protein_id="BAE66336.1"
                     /transl_table=1
                     /translation="MKASLITVIAALASSAMAAPAGGLSDVSILKEATSTTNAIPATS
                     PVPSSGASGHIVQDAGHGVNQVLTVTGPNAKKLLIELSPSVAGLLSGLHLPSVGVPVG
                     EVVKTAASVGDLVEDLGPRVDGLLTVVSEDGDVLLIKLSTEVAGLLSGVSLPGVGIPV
                     GSIVATLGENLKRSADGQLVQDVAPKVQDVLEVTGADSKRLLIQLSPSVASLLADLGL
                     PGVGTPVGQIIKTSGNLGDLLEDLGEPVKDLLVVTAQDGSFLLIKLSPDVAGLLTGLS
                     LPALGTSVGSIVATLGANL"
     exon            complement(1300627..1301514)
                     /number=1
     CDS             complement(join(1303895..1304351,1304433..1305199,
                     1305267..1305700,1305755..1306296,1306359..1306444))
                     /codon_start=1
                     /locus_tag="AO090010000486"
                     /note="putative alpha-1,2-mannosidase"
                     /old_locus_tag="AO070323000033"
                     /protein_id="BAE66337.1"
                     /transl_table=1
                     /translation="MVLLGAFLVLALLQPMALSADLTSHVNLFLGTENGGNNFPGAAR
                     PFGMVKLGPDLFISGTDAYSGYLPNGNFSGFSMMHEQGTGGAPKYGTVSQLPLIGNIS
                     NPLSNKTVARTGTDQASVGYYKAQTSEGTIVELSASAHAGMYQYTFPKGSTGNVLVDV
                     SHVLPSFRGQGLGQGYKGGNITIFPDGHYEGQGVYDNGWNRSPDWSIYFCGYFDAAPV
                     RNSTYTGSDAEGSVEQISGFASSSSSTTRIGGLFTFQQTVVTSRVGISWLSTEKACQN
                     VDEEIPEGTELTSVVHDAQTEWSSKVLSKVTTTSTNETSLTLLYTSLYFMHLIPTNQT
                     GENPGWASSEPYYQDIFTYWDLFRCSTALMQVLQPAAYEEQIRSLIDIWRFEGYLPDA
                     RSSNYNGRTQGGSNADNILADAYVKGVRGAVNWEDGYRAMVKDAEVAPPNDPVDPMAP
                     DSSTKEGRGALPDWLSLGFITPKYSRAVTRAVEYSCNDFGLYQVASGLGKDEDADKYL
                     NRSRNWRNHWNSNQTSLGFAGFVVPRDTTGFIETDPLKDSGYWGDPYYEASSWAYSWA
                     SVHDMEGMIEMMGGAQTVLKRLDTMFTEGASGSSGIIFDPTNEPMFNIPYLYHYINRQ
                     DLSVSRSRNIAKTYYHTGAKGLPGNSDAGAMQTWLLWNMIGLYPITGQTTFLVHSPWF
                     ESMAIELGDGKKLSITATGGDGNGDSQIYVQKLRLNGKDWKKNWLTWDDLFAQGGTLE
                     FELGEAASDWFTGELPPSPAS"
     exon            complement(1303895..1304351)
                     /number=1
     exon            complement(1304433..1305199)
                     /number=2
     exon            complement(1305267..1305700)
                     /number=3
     exon            complement(1305755..1306296)
                     /number=4
     exon            complement(1306359..1306444)
                     /number=5
     CDS             complement(join(1307684..1307827,1307884..1308941,
                     1309002..1309104,1309161..1309220))
                     /codon_start=1
                     /locus_tag="AO090010000487"
                     /note="hydroxymethylglutaryl-CoA synthase"
                     /old_locus_tag="AO070323000032"
                     /protein_id="BAE66338.1"
                     /transl_table=1
                     /translation="MPLTPKDIGIKAIEVYFPSRYVPQSELETFLGASAGKFTIGLGQ
                     QNMSFCDDREDIYSLALTTVSSLLRKYSIDPKTIGRLEVGTETLLDKSKSCKSVLMQL
                     FGDNADIEGVDTCNACYGGTNALFNAVNWVESSAWDGRNAIVVAGDIALYDTPAARPT
                     GGVGCVAMLIGPNAALVLEPLRASYMKHVYDFYKADLKSEYPLVDGHFSNICYLQALD
                     NCYQRYRSKKLAKTSGELNGVSTSNKSSFLDTFDYMVFHAPNCKLVAKGYGRMLFNDF
                     RLEPDRFDPVPSEIRDVEYTASLTDKNIEKLCMGLTKDKFSERVQPSLTAPAHCGNMY
                     TASIYSGLVSLLSNVPSEKLQNKRVGMFSYGGGLASTMFSLQVKGDITEMAQKIRLRD
                     RLDARTAVSPEFYDQMCQLREKAYQQKNYTPKGSVETLAPGTYYLVHVDDIFRRKYEL
                     KPYA"
     exon            complement(1307684..1307827)
                     /number=1
     exon            complement(1307884..1308941)
                     /number=2
     exon            complement(1309002..1309104)
                     /number=3
     exon            complement(1309161..1309220)
                     /number=4
     CDS             join(1311409..1311478,1311538..1312673,1312745..1313065)
                     /codon_start=1
                     /locus_tag="AO090010000488"
                     /note="permeases of the major facilitator superfamily"
                     /old_locus_tag="AO070323000031"
                     /protein_id="BAE66339.1"
                     /transl_table=1
                     /translation="MGIFKNHRVYILTAVAYSGSLLFGFDTGVMGSVLALDSFKNDFG
                     LSGSDGFADAANAQVSSNVVSLLTAGCFFGAIGASFLNDFLGRRYSLMILTVVFLIGA
                     AIQVGASHQIGMIYGGRVVAGLGIGGMSSITPVFVGESAPPEIRGRIAGMFQEFLVIG
                     STFAYWLDYGVSLHIAPSTKQWRTPVAIQIIPGGLMLIGLFFLKESPRWLTSKGRHEE
                     ALQSLAYIRNEPASSEVVQTEMAEIRASIEEEQAATEGLTYKEFLQPSNRNRFMFAAV
                     LMLCQQFSGTNSIGYYAPQIFQTIGLSATSSSLFATGVYGTVKVVATAIFLFIGIDRW
                     GRKKSLIGGSIWMASMMFIIGAVLATHPPDTSASGVSQASIAMVAMIYLYVIGYSASW
                     GPTPWVYLSEIFPTRLRAYGVGLGASSQWLFNFCVTEFTPHAVHNLGWRTFLMFGIFC
                     VAMGVFIVFFAKETKGRSLEEMDILFGAVDENERRAAVEHTLNKGVVSHIEQAEDNKV
                     "
     exon            1311409..1311478
                     /number=1
     exon            1311538..1312673
                     /number=2
     exon            1312745..1313065
                     /number=3
     CDS             join(1314823..1314914,1315228..1315289,1316353..1316566,
                     1316627..1317650)
                     /codon_start=1
                     /locus_tag="AO090010000489"
                     /note="molybdopterin synthase sulfurylase"
                     /old_locus_tag="AO070323000030"
                     /protein_id="BAE66340.1"
                     /transl_table=1
                     /translation="MARTVRDAAWVLGAIAGRDGRDNYTLASPHPISENTHRVTHERI
                     IPDVTRSSQLKLRSAKVLIVGAGGLGCPAAQYLAGAGVGTLGLVDGDTVESSNLHRQV
                     LHRSKNVGKLKVDSAIESLRDLNPHPTYIAHRAHLAPQDAADIFKNYDLILDCTDNPA
                     TRYLISDTAVLLGKPLVSASALRTEGQLMVLNNPPRSVGDKTGGPCYRCVFPRPPPAN
                     SIMSCADGGILGPVVGTMGVLQALEAIKVITATDEEVKPPSLHIFSAYSSPLFRTIKL
                     RSRRPNCAVCSGEASVTLETVKSGSTDYVFFCGSVGPEKLLLPEERISPREYRTKYPV
                     TASSEAIGTVTKEPTIIDVREKVQFDICSLENSINIPISSILSSATKTAQNNEVANGS
                     NPLPPWLPADIASSDSIDPIYVVCRLGNDSQIAVKRLKELGLDRGGERVVADIRGGLR
                     AWREQVDPEWPEY"
     exon            1314823..1314914
                     /number=1
     exon            1315228..1315289
                     /number=2
     exon            1316353..1316566
                     /number=3
     exon            1316627..1317650
                     /number=4
     CDS             complement(join(1317777..1317904,1317997..1318241,
                     1318296..1318672))
                     /codon_start=1
                     /locus_tag="AO090010000490"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000029"
                     /protein_id="BAE66341.1"
                     /transl_table=1
                     /translation="MKQKQSIPSPPPQPLPIYNSTYPPPTPDVENIEPLKMSTPDPQT
                     HPPTDIPKRKPVPPPPPPPAPAAFPAIDEDKLEPHPQTAKWPPAKWTQLPRKKNRLIL
                     TSIAIAICLLALIIGLAVGLTRHSNRNLPLPTTSGGPYTGDLTYYDPALGSCGITSSN
                     SDLVCAVSHILFDAASTGSNPNANPLCGMKVRVKRGEASVDVTVVDRCTGCAVKDLDV
                     SRGVFKKLADLDLGRVSVDWAWLEEAPVSVR"
     exon            complement(1317777..1317904)
                     /number=1
     exon            complement(1317997..1318241)
                     /number=2
     exon            complement(1318296..1318672)
                     /number=3
     CDS             join(1319681..1319838,1319975..1321331,1321388..1322517,
                     1322570..1322926,1322977..1323103)
                     /codon_start=1
                     /locus_tag="AO090010000491"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000028"
                     /protein_id="BAE66342.1"
                     /transl_table=1
                     /translation="MSSHRSSEDSQWPLPDEPEVKPDSKQKKGLMAKLKSGWDSLGLD
                     TPTILLMMNFQADAVASKFTTVGYLMAIISVLGFSIQPRAKFIQMMVLDVLAVCVASA
                     VTLLMMYSCIKARQHTEVVSSVGTSIVNTPYNPSASAVSGVWLFFQIYVVHSFRAKFQ
                     QFQFPVIIYSIVANVTFSYAPRMTTMAAAISMVTKLLEACLVGLALATGVCLFIYPVT
                     SRTVVFKQMAGYVGCLRGALQAHTVYFESLEESDMFGRAETYDSKVEKITKDGKVYSP
                     EAQAIRTAVQKITEIHGKLHGDLTFAKREVAFGNLGPDDLQAIFRNLRQVMIPVVGLS
                     FTVDLFQRLSEYNKWNTPIDPTATDIPDLVRHRVVQEWNDIMRAVHDPFKSMIQAIDE
                     GLQHISFVLKLAKPPKKTATAANGETSSSGVEDVEASAVPSPGDKNFAAHLEQRLRDF
                     KVAKRIALRTWSEEKGIKLPKDFFDRPTDDMEDISYGDPFIGRERSQRQLYLFLYMEQ
                     LLSSTGQMVLEFVKFADDKRESGKLSRRHIIIPGWKRLRKWATSLLKAEDTHEDDNIG
                     DINAQNNILQLGEAYKHRKDPEHLRPETTFQKIGDKVRLIPAMFRTQESAYGFRVACA
                     TMTIAIVGLLHDTQSFFIKQRFIWAMIMVNLSMTPTSGQSIFGFVLRILGTVLAMVLS
                     FLSWYIPGKQTPGIIVFFFIFLTCVFYVPIKLFRFRAIGIITIITTSMIIGYELQVRK
                     VGEQVATSNGQSYYPIYLLAPYRLATVTGGIAVAFFWTFFPYPISEHSVLRQSLGASL
                     YLLANYYSLIHETVSARVRGEAGDMALKTSAGRRLLKSRNQVFSKQMLMLNNLRTYSE
                     FLKWEVPIGGRFPKKQYDSIIACIENIVSYLSLLGYASDTLLQIGDDEESNSAWLHDF
                     KRLVASAGVTTHEITSVLCLLSASITDRRPLPPYLKTPRPYSFTKRLEAMDKDILSLK
                     HIAEPGFATFAVLQISTRCIGGDVERLMKDVKKLVGELDFSFHAVSTVQSAKSSAEVS
                     RYSRATERNKLE"
     exon            1319681..1319838
                     /number=1
     exon            1319975..1321331
                     /number=2
     exon            1321388..1322517
                     /number=3
     exon            1322570..1322926
                     /number=4
     exon            1322977..1323103
                     /number=5
     CDS             complement(join(1323381..1323443,1323484..1323879))
                     /codon_start=1
                     /locus_tag="AO090010000492"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000027"
                     /protein_id="BAE66343.1"
                     /transl_table=1
                     /translation="MMGAAVALQVLLAPQLVSIDQASSQQTAVSVKASIQNPSNEPVT
                     MLKWGTPFDPKAGILGVFQVQDETDGQAVPLDTIKFSRKLPPAADDLLEIAPESTVDT
                     VVTLPPMPLQSGHDFSIRAQGRWHAVWETPTQTGAISSRTPFSSKSNKQC"
     exon            complement(1323381..1323443)
                     /number=1
     exon            complement(1323484..1323879)
                     /number=2
     CDS             join(1324976..1325204,1325266..1326075,1326131..1326150)
                     /codon_start=1
                     /locus_tag="AO090010000493"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000026"
                     /protein_id="BAE66344.1"
                     /transl_table=1
                     /translation="MRVTTLSTALFALASTAVSAPTAGSSSPGLEVKLTQIDNTRVKA
                     VVKNTGSEEVSFVHLNFFKDAGPVKKVSIYRGQDEVQFEGIKRRLRSSGITKEAVTSL
                     GAGETLEDEFDIASTSDLASGGPVSIRSHGFVPIVVDGKITGYIPYKSNDLTVNVDGG
                     KAAKVTKALSQLTRRTEVTDCKGDAESSLTTALSNAAKLANQAAEAAESGDESKFEEY
                     FKTTDQQTRTTVAERLRAVAKEAGSTSGGSTTYHCNDPYGYCEPNVLAYTLPSKNEIA
                     NCDIYYSELPPLAQKCHAQDQATTTLHEFTHAPGVYQPGTEDLGYGYDAATQLSAQDA
                     LNNADSYALYANAIELKC"
     exon            1324976..1325204
                     /number=1
     exon            1325266..1326075
                     /number=2
     exon            1326131..1326150
                     /number=3
     CDS             complement(1327576..1328343)
                     /codon_start=1
                     /locus_tag="AO090010000494"
                     /note="beta-xylosidase"
                     /old_locus_tag="AO070323000025"
                     /protein_id="BAE66345.1"
                     /transl_table=1
                     /translation="MTPLPKVSTLLALILPITAIKNPILPGWNPDPSILHLNNEYYLT
                     TSSFEYFPGLPIYKSTDLTNWTLHSHALTRPSQLALYGTPTGGGKTTPHPSPTHNTNP
                     DPKNKGTWAPTLSYINNTFYIATMTRWTYDPVAKVWPRITWISSPDLETWSDPIWAEP
                     WGIDPSLFQDPVSGDVYLNLMAPDSKETGIWGIYQCQVDLGTGKCIDEYRSLWNGTML
                     HDVSARPEGPKMFVRGEWYYLLIAEGILPFPISLKYV"
     exon            complement(1327576..1328343)
                     /number=1
     CDS             join(1331286..1331859,1331924..1332177)
                     /codon_start=1
                     /locus_tag="AO090010000495"
                     /note="predicted protein"
                     /old_locus_tag="AO070323000024"
                     /protein_id="BAE66346.1"
                     /transl_table=1
                     /translation="MPNGPLYINKLIHKKAQPYSHPTPTTSPQLKPPKPIPKMSNPPT
                     ITILPASPEDAPTLTRIHGDAFQNSTLLDLMFGPPTDENLKGFTAQLAELIANDKTAR
                     FTKAVDNDTNKIVGWSWWNIFPDHKSRLEGSEAFAKDHTDPPESAISPEAYREYFRGV
                     EERREKWVGGRAVICEFLSDVFPLDCPCLLKFLRVLVVLPEYQRKGVGAKLMTKGLEE
                     ATALNLPVWLESSEEGYALYKKLGFKDLNDSIVMDLTKYGESGIATTACMLLENGNP"
     exon            1331286..1331859
                     /number=1
     exon            1331924..1332177
                     /number=2
     CDS             complement(join(1332525..1335585,1335665..1336008))
                     /codon_start=1
                     /locus_tag="AO090010000496"
                     /note="HAMP domain"
                     /old_locus_tag="AO070323000023"
                     /protein_id="BAE66347.1"
                     /transl_table=1
                     /translation="MAAVETAFRTAAAGLESAISTRIHDTHPFQPLGSPAEEVYSLLF
                     RLPGEPSDAKAAFEKQLQAFIGHIQFLQNGALEGDISPPHSDNGYLPHSTLCGQHTEM
                     ILSPKPRKRKFACHQVDHTPEYGFANDDHYSLVKRALDEQKDEIKLPREVVSSLFREL
                     LRHRAANKHPDHEVDLRKHQQMNKAFQTALQEIAKVITKVANGDLSTKVPIHPLEMDS
                     DIITFKVTMNAMLDQLRVFASEVSRVAWEVGTEGILGGQAQVSGMHGVWREVTDNVNT
                     MALNLTNQVREIAVVTTAVAHGDLSQKIERPAKGEIFLLQNTFNTMVDQLRTFATEVI
                     RVARDVGIEGVLGGQARVYGTQGMWNELTTNVNAMANNLTMQVRDIATVTTAVANGDL
                     TQKVRADCKGEILALKNIINSMVDQLRQFAQEVTKIAREVGTDGVLGGQATVHGVEGV
                     WKDLTESVNRMAMNLTNQVREIADVTTAVARGDLSKRITANVNGEILNLKDTINGMVG
                     QLNQFASEVCKVAREVGVDGTLGGQAVVANVEGEWKALTDNVNMMADNLTSQVRAFGQ
                     ITNAATDGDFSKLITVSASGEMDELKQKINKMISNLRDSIQRNTAAREAAELANQSKS
                     EFLANMSHEIRTPMNGIIGMTQLALDTDDLPPPTREMLNVVHNLGNSLLVIIDDILDI
                     SKIEANHMKIESVPFSLGQTVFKALKILAVEASERSLHLTYHINNSVRDCVIGDAFRL
                     RQIILNLIGNAIKFTETGQIQLTIKEAVPRCHPDKYLLEFSVSDTGIGIDKSKLDLIF
                     DKFQQADGSMTRKFGGTGLGLSISKKLVNLMGGDIWVTSAVGVGSTFHFTCAFTSLDP
                     PVKDITKYVIPYKGCRVLFVEKISGHCNEDGKGIQQTLQQMGLHVDVVRLEDGAAPTE
                     TAAQHGKDLRRQYDVLIAPTMDSVSQLRNFDRFKTLPAVLVCPVVSVAMKSALDLGIT
                     SYVTTPCRPIELVNGILPALEGRPSRRSAEETRPLAILLAEDNEVNQKVALKVMQRYH
                     HNVTVVSNGQEALDEFRHKQYDVILMDVQMPVMGGFESTLRIRDYERLHSLPHTPIIA
                     LTAHAMFGDREKCISAGMDDYLPKPLNQTQMMEMIHKHATLRDVLC"
     exon            complement(1332525..1335585)
                     /number=1
     exon            complement(1335665..1336008)
                     /