LOCUS       AP007174             1282697 bp    DNA     linear   PLN 16-DEC-2016
DEFINITION  Aspergillus oryzae RIB40 DNA, SC103.
ACCESSION   AP007174
VERSION     AP007174.1
DBLINK      BioProject:PRJNA20809
            BioSample:SAMD00067075
KEYWORDS    .
SOURCE      Aspergillus oryzae RIB40
  ORGANISM  Aspergillus oryzae RIB40
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Eurotiomycetes; Eurotiomycetidae; Eurotiales; Aspergillaceae;
            Aspergillus.
REFERENCE   1  (bases 1 to 1282697)
  AUTHORS   Sawano,T., Tanaka,T., Machida,M. and Yamada,O.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-JUN-2004) to the DDBJ/EMBL/GenBank databases.
            Contact:Toshihiko Sawano
            National Institute of Technology and Evaluation, Genome Analysis
            Center, Department Of Biotechnology; 2-49-10 Nishihara,
            Shibuya-ku, Tokyo 151-0066, Japan
REFERENCE   2
  AUTHORS   Machida,M., Asai,K., Sano,M., Tanaka,T., Kumagai,T., Terai,G.,
            Kusumoto,K., Arima,T., Akita,O., Kashiwagi,Y., Abe,K., Gomi,K.,
            Horiuchi,H., Kitamoto,K., Kobayashi,T., Takeuchi,M., Denning,D.W.,
            Galagan,J.E., Nierman,W.C., Yu,J., Archer,D.B., Bennett,J.W.,
            Bhatnagar,D., Cleveland,T.E., Fedorova,N.D., Gotoh,O.,
            Horikawa,H., Hosoyama,A., Ichinomiya,M., Igarashi,R., Iwashita,K.,
            Juvvadi,P.R., Kato,M., Kato,Y., Kin,T., Kokubun,A., Maeda,H.,
            Maeyama,N., Maruyama,J., Nagasaki,H., Nakajima,T., Oda,K.,
            Okada,K., Paulsen,I., Sakamoto,K., Sawano,T., Takahashi,M.,
            Takase,K., Terabayashi,Y., Wortman,J., Yamada,O., Yamagata,Y.,
            Anazawa,H., Hata,Y., Koide,Y., Komori,T., Koyama,Y., Minetoki,T.,
            Suharnan,S., Tanaka,A., Isono,K., Kuhara,S., Ogasawara,N. and
            Kikuchi,H.
  TITLE     Genome sequencing and analysis of Aspergillus oryzae
  JOURNAL   Nature 438, 1157-1161 (2005)
COMMENT     URL:http://www.bio.nite.go.jp/dogan/Top
FEATURES             Location/Qualifiers
     source          1..1282697
                     /db_xref="taxon:510516"
                     /mol_type="genomic DNA"
                     /note="SC103"
                     /note="phrap>=30:101-1282697"
                     /organism="Aspergillus oryzae RIB40"
                     /strain="RIB 40"
     CDS             join(5922..5928,6097..6246,6858..6916,7411..7446,
                     7513..9921,9997..10155)
                     /codon_start=1
                     /locus_tag="AO090103000001"
                     /note="Alanyl-tRNA synthetase"
                     /old_locus_tag="AO070242000001"
                     /protein_id="BAE65489.1"
                     /transl_table=1
                     /translation="MKEDQLIAYWLCFCDDESRDCSQVLPDPRQKRDRITGKLSFCYL
                     TFKVMNVNRQTPEHSTIFTLPLPLPHFEDLDDVGKDSYHHTFFEMLGNWSFGDYFKKE
                     AINYSWELMTKIYGLDPQRLYVTYFEGSKEGGLSPDLEAKELWKAVGVPEDHILPGNM
                     KDNFWEMGDQGPCGPCSEIHYDRIGGRNASNLVNQDDPNVLEIWNNVFIQYNRESDRS
                     LKPLPNKHVDTGMGFERLVSVLQNKSSNYDTDVFSPLFQTIKDITGARPYQGRFGVED
                     ADGIDTAYRVVADHVRTLTFAISDGVAPNNEGRGYVIRRVLRRGARYARKYFRVEIGN
                     FFSKIVPTLVDQMGDMFPEVKRKQQDVMEILDEEEISFAKTLDRGERQFEHYAQQAKA
                     KGDDKLHGADVWRLYDTFGFPVDLTRIMAEERGLRIDDTEFEEARSRAKEASKGQKKA
                     AADTVKLDVHDLGKLEKMNDVPKTNDSAKFDRGNITAQVKAIYHGKSFHLSTEQIPEG
                     DQLGLILDRTNFYAEQGGQENDTGRIVIDGQAELEVGDVQLYAGYVLHTGFMKYGSLS
                     VGDEVICEYDELRRWPIRNNHTGTHILNFALKEVLGDGVEQKGSLVAAEKLRFDFSHK
                     SPVTDKDLERIEDISTEYIRQNCAVYSQEVPLATARQISGVRAVFGETYPDPVRVVSV
                     GVELEEILKNVKDPRWEKVSIEFCGGTHVQKTGDIKELVILEESGIAKGIRRIIAVTG
                     EDAHEVQRVALGFEKRLDRLEAMALGPEKEQDAKQIQVDLSQLLISAVQKSRFRERFA
                     HINKQIIDSQKAQQKLESKKALEAITSYFENPENKDKSWLVARLPISANAKAVSESLN
                     HVKSKLQDKTVYVLAADSNQGRVVHGCYMSKGASASDWAAIVSTAVGGKAGGKGPTSI
                     GNGTNPDKTDEAIALASDYLSKFKL"
     exon            5922..5928
                     /number=1
     exon            6097..6246
                     /number=2
     exon            6858..6916
                     /number=3
     exon            7411..7446
                     /number=4
     exon            7513..9921
                     /number=5
     exon            9997..10155
                     /number=6
     CDS             complement(join(10377..10568,10619..10756,10816..10961,
                     11142..11211))
                     /codon_start=1
                     /locus_tag="AO090103000002"
                     /note="U-snRNP-associated cyclophilin type
                     peptidyl-prolyl cis-trans isomerase"
                     /old_locus_tag="AO070242000002"
                     /protein_id="BAE65490.1"
                     /transl_table=1
                     /translation="MDSQVTSSAKTPNPVVFFDITLGGESLGRIKMELFTSITPRTAE
                     NFRQFCTGESKSPQGRPQGYKNSKFHRVIKDFMIQGGDFVNGDGTGSRTIYGTPRFQD
                     ENFILKHDQPGLLSMANSGPNTNGCQFFITTTATPFLNNKHVVFGQVVEGMDVVRMIE
                     NTRTTRDKPNQDVTIIQCGEM"
     exon            complement(10377..10568)
                     /number=1
     exon            complement(10619..10756)
                     /number=2
     exon            complement(10816..10961)
                     /number=3
     exon            complement(11142..11211)
                     /number=4
     CDS             12376..13551
                     /codon_start=1
                     /locus_tag="AO090103000003"
                     /note="predicted protein"
                     /old_locus_tag="AO070242000003"
                     /protein_id="BAE65491.1"
                     /transl_table=1
                     /translation="MFRIIVGVKYCFRYNQRNRQLRNEETGEPIDLVTMPRTHRRRRE
                     KKLMSMDEVNERFPLVKYKVWRSSRANEGLPTAGGISAPNSRPQSLKGEHNVLSTTVG
                     APSYTTNSAIKGHRRCDSTTSQLSIPAEHAQTALVQPQEKENAGQAFAVLADGTHGPD
                     AKQLQNCNSLEDEDVNNPIRTAVPAELLPNPGDSCAICLDTIEDDDDIRGLTCGHAFH
                     ASCVDPWLTSRRACCPLCKADYYVPKPRSDPGGLTTNPERSGRRNTTRLAVPTQPQSV
                     FIGGRVNPFRNPLAISDRQDPSRNGTQSSRLTAPRFWRIQAHHSQPANNPSSSAPEPS
                     DRRDWRTRFTPTRSLNLSFLSFSARNHYSRESMPHPTDTARSAADRTPSQLEAQSGA"
     exon            12376..13551
                     /number=1
     CDS             complement(join(14185..14775,14828..14971,15031..15209,
                     15263..15587))
                     /codon_start=1
                     /locus_tag="AO090103000004"
                     /note="predicted protein"
                     /old_locus_tag="AO070242000004"
                     /protein_id="BAE65492.1"
                     /transl_table=1
                     /translation="MHRLTSLLSLSLAIASGTKALDASIFTFGPSPPWQNMKTPVVTD
                     DVARHILELRMNVPTVSALGKWDQDIVELLDRYGGARHSLFGGDIDYKDVTRSLVILE
                     GIGAGLGSAIQQEYQGDLMIGSPSANYLIDGFLDSTSEANSDGYVTATKNYCKSDSGG
                     GISFDVLQTIENCIPKGSAFEAVAHVFGKELLGIVKVAETWVDEQSLTAVLKISFQVP
                     DEYVGSGSVVDSLTSVLHGLRALSSEVSQVTAVLLPTINQGKGLKRKVDPREAVKEEA
                     SVRSSSAAVMTTLQRQTHPVCFTSNSSCNLATDSCSGHGFCYKKSGSANDEAASDCYA
                     CKCKSTIVTKEDGTVQKIRWGGPACEKRDISSPFFLIAGISVLVVMAAGTAVGMLFHI
                     GQNELPGVISAGVGPAKAQK"
     exon            complement(14185..14775)
                     /number=1
     exon            complement(14828..14971)
                     /number=2
     exon            complement(15031..15209)
                     /number=3
     exon            complement(15263..15587)
                     /number=4
     CDS             join(18183..18261,18322..18341,18401..18802,18860..18907,
                     18970..19047)
                     /codon_start=1
                     /locus_tag="AO090103000005"
                     /note="predicted protein"
                     /old_locus_tag="AO070242000005"
                     /protein_id="BAE65493.1"
                     /transl_table=1
                     /translation="MALPPKFAGHRLRAGTDQLPQHTLELYLDYACPFSAKMFDTFYS
                     SVRPTLASQYRGQLQVIFRQHIQPWHPSSTLMHEAGAAVLRVAPEKFWEFSAALFKQQ
                     KDFFDVSVVNETRNRTYERLAKVAGHIGVEEREVLKLLTVSDKASDNGELNTGNFVTD
                     DIKKMVKADRAVGVHVSPTVYFNGIEEPGISSSFTATQWGQWLAKNVI"
     exon            18183..18261
                     /number=1
     exon            18322..18341
                     /number=2
     exon            18401..18802
                     /number=3
     exon            18860..18907
                     /number=4
     exon            18970..19047
                     /number=5
     CDS             complement(join(19176..19218,19424..19506,19550..19694,
                     19751..19854))
                     /codon_start=1
                     /locus_tag="AO090103000006"
                     /note="cyclin-dependent protein kinase CDC28, regulatory
                     subunit CKS1, and related proteins"
                     /old_locus_tag="AO070242000006"
                     /protein_id="BAE65494.1"
                     /transl_table=1
                     /translation="MDIDMSRRNKKPRLLLESERERLDEFIDSIHYSARYSDDQFEYR
                     HVQLPKNMLKKIPADYFDSSKGTLKLLWEEEWRALGITQSSNFTDGQSLGWEHYEVHE
                     PEPHILLFKQSGASCMKFRQGI"
     exon            complement(19176..19218)
                     /number=1
     exon            complement(19424..19506)
                     /number=2
     exon            complement(19550..19694)
                     /number=3
     exon            complement(19751..19854)
                     /number=4
     CDS             join(21617..21659,21766..21816,21877..22003,22058..22223,
                     22278..22985,23067..23547,23606..23874)
                     /codon_start=1
                     /locus_tag="AO090103000007"
                     /note="molecular chaperones HSP70/HSC70, HSP70
                     superfamily"
                     /old_locus_tag="AO070242000007"
                     /protein_id="BAE65495.1"
                     /transl_table=1
                     /translation="MSDEVYEGAIGIDLGTTYSCVANYEGTNVEIIANEQGSYTTPSF
                     VSFTEKERLIGEAAKNQAAMNPKNTIFDIKRLIGRRYDDPIVKKDVESWPFKVVDQGG
                     SPAVEVEYLGETKTFTPQEISSMVLMKMKEVAETKLGKKVEKAVITVPAYFNDNQRQA
                     TKDAGAISGLNVLRIINEPTAAAIAYGLGSGKSDKERNVLIYDLGGGTFDVSLLNIQG
                     GVFTVKATAGDTHLGGQDFDTNLLEHFKKEFQRKTGKDLSGDARALRRLRTACERAKR
                     TLSNATQTTVEIDSLFDGEDFNSSITRARFEDLNAKSFSGTLEPVQQVLKDSGIEKSK
                     VDEIVLVGGSTRIPRIQKLLSDFFDGKKLEKSINPDEAVAYGAAVQAGILSGKATSAE
                     TQDLLLLDVVPLSLGVAMEGNIFAPVVPRGQTVPTIKKRTFTTVVDNQTTVQFPVYQG
                     ERTNCADNTSLGEFTLAPIPPMRAGEAALECVFEVDVNGILKVTATEKSSGRSANITI
                     SNAVGKLSTTEIEQMIDDAAKFKSSDEAFTKKFESRQQLESYISRVEEIISDPTMSMK
                     LKRGNKEKIESALSDAMAQLEIEDSTPEDLKKKELALKRLITKAMATR"
     exon            21617..21659
                     /number=1
     exon            21766..21816
                     /number=2
     exon            21877..22003
                     /number=3
     exon            22058..22223
                     /number=4
     exon            22278..22985
                     /number=5
     exon            23067..23547
                     /number=6
     exon            23606..23874
                     /number=7
     CDS             complement(join(25264..25406,25669..26520,26579..26699))
                     /codon_start=1
                     /locus_tag="AO090103000008"
                     /note="predicted protein"
                     /old_locus_tag="AO070242000008"
                     /protein_id="BAE65496.1"
                     /transl_table=1
                     /translation="MFQLRTKLIRHERVRLVEGCLYPIRQFSSIQGRAKDASQSGNDA
                     PKARSLPSGASSSRAPSRKSNLPPANLNSRKTDSDKPRPRRVFDARSLAAPSANGQST
                     NILRSTSLRSPRKGPSIRARRPRPPAKSSAPKLRKGGRPQRSKNTDMEESDSSQIENV
                     YRELAEKSRPTPSRYEPQAPDFSNLKETWPSFPTGTTANTAEVVEKLSFLSDRFPNGY
                     VTPYELGMRLFRGQFVQFLDEEEKAQAIAEAKKLSQQRADNYSQRKGDLVEPEDVGFI
                     PLSVEDRKSLVQSFIQGAYPKLSTEKAASPILSEVKKNLRNNESYQAAGYALSIAFFA
                     ASKRSLTSLCPFSVTFSICSCAFRTSSGLAIFFFCIS"
     exon            complement(25264..25406)
                     /number=1
     exon            complement(25669..26520)
                     /number=2
     exon            complement(26579..26699)
                     /number=3
     CDS             complement(join(27900..28212,28276..28739,28791..29344,
                     29390..29671,29763..30104,30159..30677,30736..30780,
                     30864..30918))
                     /codon_start=1
                     /locus_tag="AO090103000009"
                     /note="predicted protein"
                     /old_locus_tag="AO070242000009"
                     /protein_id="BAE65497.1"
                     /transl_table=1
                     /translation="MQGYSFTPPTGPPREGHKNYVFVDEHNRHKRLKVMRACNGCRKR
                     KIKCDAATTNTWPCSACTRLKLVCVPPTVGQDSEFPTGQGVEANPTNAIGASNTTESF
                     SSFSMPQGYRDSGQATVGGIPPYSDGMGMFPQFTHSASHQTGMYEVGSPALAVSHQTY
                     QQQQIFPSQTESLGTIESGVYGDHEQSTAEDLSEVLGELKIDETGIAPYIRQQKKEKG
                     EPEIPIQDEVEEPLPPLSTGAGSTIRIPPELMPSDEEVTNYFKIYFDDIHPYVPVVHR
                     SHLYYQWQYDRSSISPLLLEALFACAGRQSDDPAQGAQWLALANRHESSFMDVPRLST
                     IQAMLLLLKARESVPKKGYYYRSWQTVKTIVSMAKDLEIDEHYNTHAEHRLCDLNPIE
                     CLVQTRVWQALLVVEVMIGAPQGRSDYGVTPDTVCMDPALDIKDLDQFEIDRSRQYAY
                     FVQNAHHIRIITDTYHKIKRQKDWGANPKFVEKNPLFTDWLQGLPSDLQITYPPDGSP
                     PWIPSHFVANMHSHCHLGIILLHRPQLLASKSFAAGGGWKMHMALCYSSAKYLCRLQE
                     AILQRFGLPGLLSMQRGINFAIYCIMTCTMLHLVAITSPDPNFHTDARDYFARHMRIL
                     ERCSSAWPMPEMQAQIDSLRLAFSADVNRPFELKPTFPYGSPSEPYHPSPPPLDSQYQ
                     PHVSQVSGGVRGRVGYNPYPITPPISASTEDSKSDCSQLHSLGMMPPQPVSSQSLNAP
                     LVDENSWDPTRIITQWDMAFSMAPSTVNTNSPPMAMDHSVQAPLAGQYTVQYGQTTKV
                     TPVTPPQAISPPQFNGQQVLFTARDWQQSVASVYDPNGLKRRWNYSVDIGTEHTQKRA
                     R"
     exon            complement(27900..28212)
                     /number=1
     exon            complement(28276..28739)
                     /number=2
     exon            complement(28791..29344)
                     /number=3
     exon            complement(29390..29671)
                     /number=4
     exon            complement(29763..30104)
                     /number=5
     exon            complement(30159..30677)
                     /number=6
     exon            complement(30736..30780)
                     /number=7
     exon            complement(30864..30918)
                     /number=8
     CDS             join(33542..33779,33837..34210)
                     /codon_start=1
                     /locus_tag="AO090103000010"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070242000010"
                     /protein_id="BAE65498.1"
                     /transl_table=1
                     /translation="MASEMQNSNPTILNAADLPKRLRPAPSRKPGIFGNGLFASALPF
                     VYASKLPPEGFTSSSESESDDDDLLEEPIDEQEIYDLVSTISDPEHPISLGALAVVSL
                     PDISITPTLPYVPASPLRTVTVLITPTITHCSLATVIGLGVRVRLEQSLPPRFRVDVR
                     IKEGTHSTADEVNKQLADKERVAAALENGTLMGVIAKMLETCQ"
     exon            33542..33779
                     /number=1
     exon            33837..34210
                     /number=2
     CDS             complement(join(34374..34936,35041..37269,37326..37471,
                     37529..37548))
                     /codon_start=1
                     /locus_tag="AO090103000011"
                     /note="U5 snRNP-specific protein"
                     /old_locus_tag="AO070242000011"
                     /protein_id="BAE65499.1"
                     /transl_table=1
                     /translation="MDDLYDEFGNYIGEAADSDEDGQHDEVKPRAFAFNEAFGEEEDE
                     ELYGQQSMEVDEAPSNAVILHEDKQYYPSAQQVYGTEVETLVQEEDAQPLSEPIVAPV
                     QQKKFAIEETELPRVHFSREFMTDLLNFPEQIRNIALVGHLHHGKTAFMDMLVMQTHD
                     LTERLEKRAGKRKEVQLRYTDIHFLERERGLSIKSAPMSLVLQGTKGKSHLFNILDTP
                     GHVNFVDEVAASSRLVDGVVIVVDIVEGVQSNTEQIIKHAVLEGLPLTMVVNKMDRLI
                     LELKIPPNDAYFKLKHVIEEVNTVIESVLPGQGEKWRLSPEKGNVAFACASMGWCFTL
                     QSFAGMYAETYPQIETSDFALRLWGDIFFNPTSRKFTRKGVEENSKRTFVKFVLEPIY
                     KLYSHAISESSEDLKRTLASVGIHLKPSQLKSDAKELLNLVCGQFFGPATGFVDMIVQ
                     HVPSPVEGAQMKLDRYYTGPLDSKVAAAMTTCDADGPLVVHITKLFTSTDASSFNAFG
                     RIMSGTAQPGQQVRVLGEGYTPEDEEDMVTATISDTWIAETGYNIMTSGVPAGNLVLL
                     GGVDNSIVKTATIVPLKLEDDEDAYIFKPIRHMTESVFKVAVEPVNPSELPKMLDGLR
                     KVNKSYPLISTKVEESGEHVILGTGELYMDCVLHDLRRLFSEMEIKVSDPVTRFCETA
                     VETSAIMCYSITPNKKNKITMIAEPLDDGIAEDIESGKVSIKDPIRKVARFFEDKYDW
                     DKLAARSIWAFGPDELGPNILQDDTLPSQVDKKLLGSVRDSITQGFSWGTREGPLCEE
                     PIRNTKFRLTDVSLADQVIYRGGGQIIPTARRAIYSSFLMASPRLMEPIYSCTMTGPA
                     DAVASVYTVLARRRGHVLSDGPIAGTPLYSVRGLIPVIDSFGFETDLRIHTQGQAAVS
                     LVFDKWSVVPGDPLDRDVKIKPLEMAPAMATARDFVLKTRRRKGLAEDVTVSKFLEPE
                     LWRGLKESGVLDS"
     exon            complement(34374..34936)
                     /number=1
     exon            complement(35041..37269)
                     /number=2
     exon            complement(37326..37471)
                     /number=3
     exon            complement(37529..37548)
                     /number=4
     CDS             join(37968..38032,38100..38149,38207..38282,38356..38845,
                     38914..39432)
                     /codon_start=1
                     /locus_tag="AO090103000012"
                     /note="acetyl-CoA acetyltransferase"
                     /old_locus_tag="AO070242000012"
                     /protein_id="BAE65500.1"
                     /transl_table=1
                     /translation="MSSLPPVYIVSSARTPVGSFLGSLSSLTAPQLGSHAIKAALSKA
                     DGIKPSDIQEVFFGNVISANVGQNPARQCALGAGLNESTVCTTVNKVCASGLKAVILG
                     AQTIMTGNADIVVAGGAESMSNAPHYLPNLRVGAKYGNQSLVDGIMKDGLTDAGKQEL
                     MGLQAEECAQDHGFSREQQDDYAIRTYEKAQAAQKAGLFDEEIAPIELPGFRGKPGVT
                     VSQDEEPKNLNPDKLRAIKPAFIPGSGTVTAPNSSPLNDGAAAVILVSEAKLKELNLK
                     PVAKILGWGDAAQQPSKFTTAPALAIPKALSHAGVAQDAVDAFEINEAFSVVALANMK
                     LLGLAEDKVNIHGGAVAIGHPIGASGARILTTLLGVLKARKGKIGCAGICNGGGGASA
                     IVVESLV"
     exon            37968..38032
                     /number=1
     exon            38100..38149
                     /number=2
     exon            38207..38282
                     /number=3
     exon            38356..38845
                     /number=4
     exon            38914..39432
                     /number=5
     CDS             complement(join(40270..41420,41478..41666,41772..41817))
                     /codon_start=1
                     /locus_tag="AO090103000013"
                     /note="Fe2+/Zn2+ regulated transporter"
                     /old_locus_tag="AO070242000013"
                     /protein_id="BAE65501.1"
                     /transl_table=1
                     /translation="MDELTRWQRNDLEKFNIESAVELSAYIPEAVLRAELHRRSGIRD
                     SDNDKPSCGSKDRGVYNTPVHVMALFLILLLSTLACSFPVLARRFPRLPIPRRFLFLS
                     RHFGTGVLIATAFVHLLPTAFVSLTDPCLPRFWSESYRAMAGFVAMVSVFVVVVVEMF
                     FAMKGAGHVHGSEYDHLIGDVGGDTASVYRNEGPEYLQESTENIHLEGMPDGSCTSSL
                     PQSSGHLLSDFTDDGSQSQSANLVAHKEDVEVDLEGPDSYDGSRTNAHRNPYSQSELA
                     RPSPAISCEHPDTMLTIQNPQRQLLQCLLLEAGILFHSIFIGMALSVATGTSFIVLLV
                     AICFHQTFEGFALGSRIASLIPDLFAPSSMKPWLMSLAYGTTTPIGQAIGLILHNLYD
                     PTSTAGLLMVGITNAISSGLLLFAGLVELLAEDFLSESSYATLHGRKRVEACIAVACG
                     ALLMALVGAFA"
     exon            complement(40270..41420)
                     /number=1
     exon            complement(41478..41666)
                     /number=2
     exon            complement(41772..41817)
                     /number=3
     CDS             complement(join(42360..43303,43340..43997))
                     /codon_start=1
                     /locus_tag="AO090103000014"
                     /note="predicted protein"
                     /old_locus_tag="AO070242000014"
                     /protein_id="BAE65502.1"
                     /transl_table=1
                     /translation="MSCHVCSRAPTSRLKYLCPSCARNQLYQLRIENARILLENESLG
                     QQINETVSSTSILEALSERPDSGHLSLKNEGHIAWPIQIIANEKTRSSLRIKLLKSRT
                     ENLRLEIKNKKRNISEHKLTLAQRRSDAGSAKYQLAEREAAILSGIHNNAKRTDHLWH
                     SLHSKTAEARIFLCREAAYLYNLQQKVKKRDGEVKEAYTIGGIPIIDLRDMNGKLRSL
                     FRATPSQISTSFSYIAQLLVLVSHYLSLRLPAEITLPHRNYPAPTIYAPSGSYLLREM
                     LPASSTLQPSPSSLTPSRTADPRSCFPRPRPLSIDRSLPKLAREDPGTYALFIEGATL
                     LAWNISWLCRTQGLHITSDSWEEICSIGKHMWQLLVAPPAQTSTLVRAFAGRDVQSKV
                     KITRDPPKTIIQRTKSFPMLGHYSHGTVHSFLAASEGTEYTRTWRLPTPTKVADKLKS
                     SLLGEMASAEWEVLEKKEWDNIPEAPLQSVHESSANREDEKDELNISNIEPSENNCAE
                     PESPKEPVKSNRLKGTSGWTKLRNR"
     exon            complement(42360..43303)
                     /number=1
     exon            complement(43340..43997)
                     /number=2
     CDS             complement(join(45379..45572,45636..46643,46732..47281))
                     /codon_start=1
                     /locus_tag="AO090103000016"
                     /note="predicted protein"
                     /old_locus_tag="AO070242000016"
                     /protein_id="BAE65503.1"
                     /transl_table=1
                     /translation="MALLQTSLIWAVYAIVVAILAAVASVFIYTYQTPRDRCPSVILT
                     CIVAVTTLLATVLLVPVDVALVSSTINPALGRRQDWATQSEVDRILLCLKIVYYFLYS
                     LDALLCLIVIPFIYFLYEEYDEVASETEQQSFGQRFWAAFKYTVSFLAIVVVLFLVGF
                     FVPVAKDGDGGGLDYFKHLLTENRGERALTFALGLLITIGLCLYVLYTSTGLALFPIT
                     LIKEGPSVISPTLKATTAVQLCSNRERQRQLEGRCRGNPGLLSSKDRRELDTLVREER
                     TLIRRQRLADEAHGKHQNWLMQLWLKFGAIFRPFQLLSGVIFSLLALIIWISMLLTTI
                     DKAKNSFCKQRCGYILGHINVFNPINWVFVQSAKIFPVDYVIFTLLVLFLFSSSIVGI
                     SAVGIRFLWIRIFQIRKGHTSPQALLLATAMLMLIILALNYSTSMILAPQYATYGPQT
                     FCDRELSFSEKQPDCSRDKHLIRPCSEVADSLAAKQVCTPSVVSTFLNRVTMNFPFFG
                     AIFFWAQFAFLGIYLLVMVTALLHSPKLDERQLDEDAEEAEEESLLANTRGRAETTWE
                     DITSRLRRQNEVDRAGA"
     exon            complement(45379..45572)
                     /number=1
     exon            complement(45636..46643)
                     /number=2
     exon            complement(46732..47281)
                     /number=3
     CDS             join(47795..49760,49812..50125,50211..50378,50446..50875,
                     50907..51062,51111..51186,51269..51710,51778..51925,
                     51980..52461)
                     /codon_start=1
                     /locus_tag="AO090103000017"
                     /note="mRNA cleavage and polyadenylation factor II
                     complex, subunit CFT1 (CPSF subunit)"
                     /old_locus_tag="AO070242000017"
                     /protein_id="BAE65504.1"
                     /transl_table=1
                     /translation="MQCYTELLPPTGVTHSLALPFISESANNLVVARTSRLQIFSLLD
                     VGPRPGGIEEQGVPKLVLEREYALPGTVTDLCRVKLLNTKSGGEAILLAFRNAKLALI
                     EWDPGRYGICTISIHYYERDDSTSSPWVPDLSSCGSILSVDPSSRCAVFNFGIRNLAI
                     LPFHQPGDDLVMDDYGELDDERLGSHGLESGTDCDMTKESIAHRAPYSSSFVLPLAAL
                     DPSILHPISLAFLYEYREPTFGILYSQVATSNALLHERKDVVFYTVFTLDLEQRASTT
                     LLSVSRLPSDLFKVVALPPPVGGALLIGSNELVHVDQAGKTNAVGVNEFSRQVSSFSM
                     TDQSDLALRLEGCIVERLSETNGDLLLVPTTGEIVLVKFRLDGRSVSGISVHPIPPHA
                     GGDIVKSAASSSAFLGDKRVFLGSEDADSILLGWSVPSSGTKKPRPQARHTEEDSGGF
                     SDEDQSEDDVYEDDLYATVPEVVVDGRRPSAESFGSSLYNFREYDRLLNIGPLKDIAF
                     GRSFTSLGGEENAGNDSGLELVASQGWDRSGGLAVMKRGLELQVLNSMRTDLASCVWT
                     ASVAHMEEAVSKTTTQAENRECHQYVVVSKATSAEREQSEVFRVEGQELRPFRAPEFN
                     PNEDVTIDIGTLIGKNRVVQILRSEVRSYDGDLGLAQIYPVWDEDTSEERMAISSSLV
                     DPYVAILRDDSTLLLLQADDSGDLDEVELNEQIANSKWTSCCLYFDKTGIFSSISATS
                     DELAQNSMTLFLMTQDCRLFIYRLPDQKLLAIIEGVDCLPPVLSSEPPKRSTTREVLT
                     EIVVADLGDSWSSFPYLIIRSRHDDLAVYRPFISITKSVGEPHADLNFLKETNLVLPR
                     ITSGVEDQSSTEEVIKSVPLRIVSNISGFSAIFRPGVSPGFIVRTSTSSPHFLGLKGG
                     YAQSLSKFQTSECGEGFILLDSKVLCFILLCLTYCILSFHTGCHSYYPWTIQQIPIGE
                     QVDHLAYSSSSGMYVIGTSHRTEFKLPEDDELHPEWRNEMTSFFPEVQRSSLKVVSPK
                     TWTVIDSPAEHVMAVKNMSLEISENTHERKDMIVVGTAFARGEDIASRGCVYVFEVIK
                     VVPDPKRPEMDRKLRLVGKEPVKGAVTALSEIGGQGFLIVAQGQKCIVRGLKEDGSLL
                     PVAFMDVQCHVSVVKELKGTGMCIIADAVKGLWFAGYSEEPYKMSLFAKDLDYLEVLA
                     ADFLPDGNKLFILVADSDCNLHVLQYDPEDPKSSNGDRLLSRSKFHTGNFISTLTLLP
                     RTSVSSEQMISDVDAMDVDIKIPRHQMLITSQNGSVGLVTCVSEESYRRLSALQSQLT
                     NTIEHPCGLNPRAFRAVESDGTAGRGMLDGKLLFQWLDMSKQRKVEIASRVGANEWEI
                     KADFEAISGEGLGYL"
     exon            47795..49760
                     /number=1
     exon            49812..50125
                     /number=2
     exon            50211..50378
                     /number=3
     exon            50446..50875
                     /number=4
     exon            50907..51062
                     /number=5
     exon            51111..51186
                     /number=6
     exon            51269..51710
                     /number=7
     exon            51778..51925
                     /number=8
     exon            51980..52461
                     /number=9
     CDS             complement(join(53433..55062,55132..55277))
                     /codon_start=1
                     /locus_tag="AO090103000018"
                     /note="predicted protein"
                     /old_locus_tag="AO070242000018"
                     /protein_id="BAE65505.1"
                     /transl_table=1
                     /translation="MEGFDTMAMPYLASPLSLSNIQGADYLNSMPGMDLPDQRSNFES
                     ETFVSGDDIAFPQTGLSAPLKRFHSGYDDPFSDMVAPFDPAPAEQQHSDSSIDHNNKL
                     LSFSMPVYNFTLLDYSLRRTSLSLSAQLHGMFFLAESPWTTSPAENAPPQQGAELTCY
                     RRNLFQITGSVTLPRSLRYIMTEQGDRIPILAQELTVSATESVEGNSVKIISVPWKTP
                     AANANPSTEDSGHPTATNNPNNPKVEKEPPAIPLDIMAGQDLDTDYATFPIAWKRLQF
                     RVATANNGRRKELQQHFVVRLKVVATLSTGTKIPICEVHSGPVIVRGRSPRNFQSRKD
                     LPLSGSAAASRKNAQASHSASINRTPTSETAPRSGQPPSKFKTTGKSSSPETSASQTG
                     VTAQRASPDWTQIPQSTGGALPSAALPRSSIYSQSSPEYSRTAETQQRRASAIAAPIN
                     LSLLDDDGGGDPSRLNDSARPTSSYASETPQKIINTEGSAPPAKMRKLSHGIPQPPAR
                     STSSSLPLLNTTNMQQPFASTLPFPNESADLLYEYFPLGLDDWQAPVDAVYRPHVVHH
                     TNMPEMKFVATRGRSKRYFAAEDVF"
     exon            complement(53433..55062)
                     /number=1
     exon            complement(55132..55277)
                     /number=2
     CDS             complement(join(61519..61635,61694..64206,64307..64425,
                     64741..64823,65486..65539))
                     /codon_start=1
                     /locus_tag="AO090103000019"
                     /note="beta-glucosidase-related glycosidases"
                     /old_locus_tag="AO070242000019"
                     /protein_id="BAE65506.1"
                     /transl_table=1
                     /translation="MQPSLICCGVVSIDGTLWILSWHSLFRALMAPREDMLPPGWDDL
                     DRQMGQLFMMGFDGTSVDPQIRSLIENYHLGSILLTAKNLKSAEDATRLVLELQTIAR
                     DAGHPVPLLIALDQENGGVNSLYDEIYIRQFPSAMGIAATGSKALAHDVAVATAQELK
                     AVGINWILGPVLDVLTNVRSQPLGVRTTGDDPQEVSQYGVEFMKGYKEAGLVTCGKHF
                     PSYGNLEFLGSQSDVPIITESLEQLSLSALVPFRNAILHGIDSMMVGGVSMSSAGFHV
                     MHACLSEQVVDDLLRKKMKFDGVVVSECLEMEALTHNIGVGGGTVMAKKAGCDIILLC
                     RSFPVQQEAITGLKLGVENGIIGRARIEQSLRRVLSLKAKCTSWEQALNPPGLSSLTQ
                     MQPSHTTLSTRAYNSSITVVRDKKTLLPLSNIIEPSEELLLLTPLVKPLPASAVSRSV
                     TEHPNLSIEPMTWDRTSSVLSGESVFRELGRSLSRQRNGRVLHTSYTANGVRPIHENL
                     IDRASAVIVVTADANRNQYQYGFTKHVSMICRSQFTPSGESREKPVVVIAASSPYDFA
                     MDPSIGTYICTYDFTETALEALVKILYGEIIPMGSLPGSINRSQKLHQARQHWLVENW
                     NEERDSHALDSLLDAVREDCTQTQRSELLGVTSCSFLLRREEIDEAHFVVRNSSTQAL
                     YGFCSTYFFRSTGTGVIGALIVDPARRKLSIGASLHNRAIRTLVQRKGVKRFQLGSRL
                     PGIYLGIPSANPVERKRLRQWFANLGWNTALSRPVCSVVLRSLSSWKPPNGLIQGLQN
                     ADVVYDLVYGWDYADTILDHIKTNSRQGVIDIYKVALGGAPNCGIIRATRPGDGAILG
                     SVVTYNGRATLAEHMPALKAMHSSTGGISSPVISPSVGEYATVMQGLIFMGIKQHRKQ
                     GADSVIMDCVDGDSNFDSLSGIMGFSTLHSFEEVNCDAATWTMMTAS"
     exon            complement(61519..61635)
                     /number=1
     exon            complement(61694..64206)
                     /number=2
     exon            complement(64307..64425)
                     /number=3
     exon            complement(64741..64823)
                     /number=4
     exon            complement(65486..65539)
                     /number=5
     CDS             join(66425..66426,66503..66564,66622..66770,66843..67706)
                     /codon_start=1
                     /locus_tag="AO090103000020"
                     /note="glucosamine-6-phosphate isomerase"
                     /old_locus_tag="AO070242000020"
                     /protein_id="BAE65507.1"
                     /transl_table=1
                     /translation="MRVIIRETALEASEYIADYIISRIKAFKPTEDQPFVLGLPTGSS
                     PEVIYKTLVQRHRAGEISFRNVVTFNMDEYVGLPRDHPQSYHSFMYKHFFSHIDISPQ
                     NINILDGNASDLAAECASFEAKIARCGGIELFLGGVGPDGHIAFNEPGSSLSSRTRVK
                     TLAYDTILANSRFFGGDVDKVPRMSLTVGIQTIMEAREVVIVATGAHKALAVEKGLEG
                     GVNHMWTLSALQLHQHPLIVCDRDATLELKVKTVRYFEAIEQSGTDARTQGPPLVYRP
                     RTYVPAPMGASKTNQQPTPASTPPRVPKDLRINTQLNQTLDDEELTPDSMSSRMVDSA
                     ISGLDSTLKGDLMFDRMGTRVISH"
     exon            66425..66426
                     /number=1
     exon            66503..66564
                     /number=2
     exon            66622..66770
                     /number=3
     exon            66843..67706
                     /number=4
     CDS             complement(join(68218..69232,69308..69792))
                     /codon_start=1
                     /locus_tag="AO090103000021"
                     /note="NAD-dependent aldehyde dehydrogenases"
                     /old_locus_tag="AO070242000021"
                     /protein_id="BAE65508.1"
                     /transl_table=1
                     /translation="MSYLPLPPRQLFYDGKVQSASSGKTFQSVNPSDATPLAEIQVAS
                     HSDIDAAIAAADRVFPSWSQTPPIARARILQKASLILRERNDEIARVESLDSGKAFTE
                     TSTVDVVTGADVLEYYANLVGGGGLNGETTQLREDAWVFTKKAPLGVCAGIGAWNYPI
                     QIALWKSAPCIAAGNTMVYKPSEFTPLHAQTLAEIYKEAGLPDGVFNIVYGAGDVGAY
                     LTSHPTIAKVSFTGQVATGMKVAGSAAGNMKYVTMELGGKSPLVILPDAELENAVDGA
                     MMANFYSTGQVCTNGTRVFVPSSMKAAFENRLLEKMQYIRPGPLFDEATNFGPLSSAI
                     HLEKVISYIRHGIETDKATLLYGGLGKPQVSKELENGFWVRPTIFTDCKDDMLIVKEE
                     IFGPVMSILYYETIEEAVRRANTTELGLAAGVFTKDVNLAHRIIDQLQAGITWVNTWG
                     ESPAEMAVGGWKKSGLGVENGRRGIEAWVKNKSTLVDMNGAVATVFAKL"
     exon            complement(68218..69232)
                     /number=1
     exon            complement(69308..69792)
                     /number=2
     CDS             join(70983..71229,71359..72740)
                     /codon_start=1
                     /locus_tag="AO090103000022"
                     /note="choline dehydrogenase and related flavoproteins"
                     /old_locus_tag="AO070242000022"
                     /protein_id="BAE65509.1"
                     /transl_table=1
                     /translation="MATTNDFPASDVNSYDYIIVGGGTAGCVIASRLAQYLPNKRVLV
                     IEGGPSDFNDDRVLNLREWLNLLGGELDYDYPTTEQPMGNSHIRHSRAKVLGGCSSHN
                     TLISFRPFEYDCQRWEQQGCKGWSFETFTRVLDNLRNTVQPVHARHRNQLCKDWVEAC
                     STAMNIPIIPDFNKEIRQNGKLTEGVGFFNVSYNPDDGRRSSASVAYIHPILRGEEKR
                     PNLTILTNAWVSRVNVEGDAVTGVNLTLQSGVKHTLRAKKETILCAGAVDTPRLMLLS
                     GLGPQNQLSSLGIEVVKDIPGVGENLLDHPESIIMWELNRPVPPNQTTMDSDAGIFLR
                     REIPNAAGSDGRSADIMMHCYQIPFDLNTSRLGYDAPINAFCMTPNIPRPRSRGRIYL
                     TSADPNVKPALDFRYFTDPEGYDAATIVAGLKAAREIAQQAPFKDWIKREVAPGPKIQ
                     TDEELSEYGRRVAHTVYHPAGTTKMGDVYRDPLAVVDPQLKVRGLKNVRIADAGVFPE
                     MPSINPMLTVLAIGERAAELIAEEAGWKREQPRL"
     exon            70983..71229
                     /number=1
     exon            71359..72740
                     /number=2
     CDS             complement(join(73509..74429,74534..74905))
                     /codon_start=1
                     /locus_tag="AO090103000023"
                     /note="N-acetyl-glucosamine-6-phosphate deacetylase"
                     /old_locus_tag="AO070242000023"
                     /protein_id="BAE65510.1"
                     /transl_table=1
                     /translation="MPGKTATPPRITKFTNCRIIRGNQLVEQDVWIDSLSGKILRDQE
                     AFYELHMSPDEVLDLGGRILAPGLIDVQLNGAQGFDFSVPKSSKEEYDEGLRMVNKGL
                     AKTGVTSYLPTVVSSTPEVYWKVLPSLGPSGAKHRAEDGAESLGAHVEGPFISPGRNG
                     IHKTDVLRAAKSFEDVVGCYGKENMFGPSKTVRMITAAPEVGSMVNNIPNLTAQDIIY
                     SIGHSDATYEQAMSATKQGATMITHLFNAMRPFYHRNPGVFGLLGQNEHRRPFYGVIA
                     DGIHLHPTSIRIAYNAHPNGLILVTDAMKLCGLPDGVYDWTNGERIVKTGARLTLEGS
                     DKIAGSSATLIECVNNFRRWSGASTAEALNAATATPARLLGLEGVKGTLDCDADADLV
                     VLTDAPDPYSGPTLTIDQVWKRGVKIYDAEKEATNSRV"
     exon            complement(73509..74429)
                     /number=1
     exon            complement(74534..74905)
                     /number=2
     CDS             join(77895..78482,78561..79168,79267..79362,79433..79664)
                     /codon_start=1
                     /locus_tag="AO090103000025"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070242000025"
                     /protein_id="BAE65511.1"
                     /transl_table=1
                     /translation="MGNSTVGDDNPAEKEFAAATSDPEAGQDSVTGKPWMYKPWKIGP
                     LTLPWFAHPMTQLVLVSFVCFLCPGMFNAVSGLGGGGQVDATDVNKANTALYSTFAVV
                     GFFAGSIANRIGLRLTLSLGGFGYFLYVASLLSYNHNSNAGFLVFSGALLGVCAGLLW
                     CAQGAVMMSYPREHEKGKYICIFWVIFNLGGVIGSLVPLGQNLHSTAGRVNDGTYIAF
                     MVLMAVGFVLAWGLSDSKYIMRSDRSRVIVMKNPSWKSEFKGLLDTLRSDYYIVLMFP
                     LFLSSNWFYGYHFNSVNGAYFNVRTRSLNSCLYWLMQMVGAFVFGFTLDMKFFSRSMR
                     AKINFVLLFLLTLGVWGGGYAFQRQYTRADAPLDTDWSDSGYVGPMFLYMFYGFYDAA
                     FQTCAYWFMGSLTNNARKLANFAGFYKGIQSAGAAGMWALDLDKAPFMTELASCWGLL
                     LGSLLVASPIIFFKIKDHVDIEEDLKFSDETAHDVMGNIPMEEQTSGKKEEKRESVA"
     exon            77895..78482
                     /number=1
     exon            78561..79168
                     /number=2
     exon            79267..79362
                     /number=3
     exon            79433..79664
                     /number=4
     CDS             complement(join(80156..80731,80821..80879,80952..81105,
                     81164..81214,81277..81393,81445..81460,81535..81658,
                     81709..81825,81888..81992,82052..82400))
                     /codon_start=1
                     /locus_tag="AO090103000026"
                     /note="carboxypeptidase C (cathepsin A)"
                     /old_locus_tag="AO070242000026"
                     /protein_id="BAE65512.1"
                     /transl_table=1
                     /translation="MRGYEFLSVLPLVAASWALPGSTPASVGRRQLPKNPTGVKTLTT
                     ANNVTIRYKEPGAEGVCETTPGVKSYSGYVDTSPESHTFFWFFEARHNPETAPITLWL
                     NGGPGSDSLIGLFEELGPCHVNSTFDDYINPHSWNEVSNLLFLSQPLGVGFSYSDTVD
                     GSINPVTGVVENSSFAGVQGRYPTIDATLIDTTNLAAEAAWEILQGFLSGLPSLDSRV
                     QSKDFSLWTESYGGHYGPAFFNHFYEQNERIANGSVNGVQLNFNSLGIINGIIDEAIQ
                     APYYPEFAVNNTYGIKAVNETVYNYMKFANQMPNGCQDLISTCKQTNRTALADYALCA
                     EATNMCRDNVEGPYYAFAGRGVYDIRHPYDDPTPPSYYNKFLAKDSVMDAIGVNINYT
                     QSNNDVYYAFQQTGDFVWPNFIEDLEEILALPVRVSLIYGDADYICNWFGGQAVSLAA
                     NYSQAAQFRSAGYTPLKVNGVEYGETREYGNFSFTRVYEAGHEVPYYQPIASLQLFNR
                     TIFGWDIAEGQKKIWPSYKTNGTATATHTQSSVPLPTATSMSSVGMA"
     exon            complement(80156..80731)
                     /number=1
     exon            complement(80821..80879)
                     /number=2
     exon            complement(80952..81105)
                     /number=3
     exon            complement(81164..81214)
                     /number=4
     exon            complement(81277..81393)
                     /number=5
     exon            complement(81445..81460)
                     /number=6
     exon            complement(81535..81658)
                     /number=7
     exon            complement(81709..81825)
                     /number=8
     exon            complement(81888..81992)
                     /number=9
     exon            complement(82052..82400)
                     /number=10
     CDS             complement(join(84021..86212,86298..86482,86572..86816))
                     /codon_start=1
                     /locus_tag="AO090103000027"
                     /note="predicted protein"
                     /old_locus_tag="AO070242000027"
                     /protein_id="BAE65513.1"
                     /transl_table=1
                     /translation="MTNLTASPSSSNMAENEAKGKRKASTAGLPANARPVKRRASKAC
                     CCCRARKVRCDVVENGSPCTNCRLDQVDCIVTESKRRKKSRVEVDNPNHQLSQSPAEA
                     PEDGSLLRRLSECHGLSDVAPASPSQRSVDLDQGQHMPHLLYQSQVSRIGAGPERYRR
                     RMAPNPAVPATMPLHHVTSQIQQLLDPSFANARSGGIILPDYIRGLPPRLQKEDIDYL
                     AMKGALTVPDVGLRNELLKAYIHYVHTYMPLLDLEDFLQTIAQNDGIRRMSLLLFQAV
                     MFAGTAFVDLKHLQAAGYSSRKAARKSFFQRARLLYDFDYEVDRISLVQSLLLMTYWY
                     ETPDDQKDTWHWMGVSLSLAHTIGLHRDPGNSRMDVRRQRMWKRIWWSTYTRDRLIAL
                     GMRRPMRVKDDDCDVPMLTLDDFEFHPFSPEIVSMVGNSEVLQNVSHQKELALMFIEK
                     AKLCLCVSHVLSAQYSVLSHKFGGTMETTMMLVPKKSAAETFEVRRCDQELEDWLAHL
                     PSEIQYAPMAPAKLTEAQEVLHSHRALLKMVYLTTSSALHRPQVLPAMPFPSTDAELQ
                     DISRNKVRFAAVEITNIAQDLHALDLTRYFPTTGVTVLLPAVIIHLLDIKSSDPNVRM
                     VSLQRFYQCMRILQRLREIYASADFATSFLEAAIRKAGIQLTVAPQDVQSRNNCTFDS
                     VRLNTLTPPPDSLAQKIPDLTYPKTSGTRLAGEAAEASGFASTPPPSDGSENGSTNNI
                     NPHYHQDAFAIPNLDSDLSISELMDLANDAEVTQNDFDALINFDDTGAELFAADDGLD
                     LNGNPKGQGYGFNIGTMDNVPDLFGTESKGVGLTGLGNGQLHEDRTSTTLGANEAPRA
                     TELDGIADLEAELGLNL"
     exon            complement(84021..86212)
                     /number=1
     exon            complement(86298..86482)
                     /number=2
     exon            complement(86572..86816)
                     /number=3
     CDS             complement(join(92613..92668,93616..95869))
                     /codon_start=1
                     /locus_tag="AO090103000029"
                     /note="predicted protein"
                     /old_locus_tag="AO070232000020"
                     /protein_id="BAE65514.1"
                     /transl_table=1
                     /translation="MSTPLSPLTSSRQNSQPFSPGISGLVAQEDVVDHIVAPKDSLEN
                     GFSSPRKLVDDLSADTERRQSYTATQQPNEQDLDYDNTDPILPPSSPFQYEARDDTVD
                     FQMLRSQQLSATPRKRSYEHVPEDDAFDDRYRKGTARRDMPDISVYADEDVSINNEQS
                     SRESAGQEIGNSLMEEKHNEGMSTVIHENNSNDTSNDKEDTSLHEEDDDMIDDTNDSM
                     DETCLSTFSAVTNVDMTTFAHLRGDSPFKAGQPSKLHGDLDGKDEPGTPTTTRKSPRI
                     SGLVDFGSPTPRKRDARVSINPSETPNLLDLSDQPSFFPRKRYSMQNERYSPSRRSPL
                     RTVREPTRSPAKVSLLDFDLPAAPTPRSIPSVTPRELESLKSGFLSEISSLKATLSGK
                     EAEVASLKQAVADAERRVGETSEELRNEAARRETLEIEQAEWQRRGQEMEDVLQSVKA
                     EMMEGEREREKLMRRAEEMEKSKEKLESRVVELETQLSSARKPASNDMGSSKSAQYGK
                     TAEETAKEVQDAVEKVARELHTLYKSKHETKVAALKKSYEARWDKRLREAENKLKAAY
                     KDNERLKAERDAALSEVSQPDISMITREKDEHEAEKRVLEAQIKGLQQELGALKDDSE
                     RLHHELKIERAEKGELVAAVDEWLAIQQNQPSIQDGPQSPRPQEDNSPEPTPIEVAPE
                     DFRQSISRSSSSSIRPPSTGSSNGEKKIPRIPAPGSRQARGNSGGKSGIAVFTPGRSG
                     IMGSIERMGRGECWDEGLKGAPARTCAKN"
     exon            complement(92613..92668)
                     /number=1
     exon            complement(93616..95869)
                     /number=2
     CDS             complement(join(97220..98322,98544..98909,99007..99079))
                     /codon_start=1
                     /locus_tag="AO090103000030"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070232000019"
                     /protein_id="BAE65515.1"
                     /transl_table=1
                     /translation="MVLTQQRRQPASDDQFPTTQLFLLAICRVAEPIALTSIFPYSWV
                     MVKDFNVANGSDASFFAGILVSAFSLAEALTGMFWGSLSDRVGRKPVLLSGCVGTMAS
                     LLIVGFATNFWVALFGRALGGILNGNIGVIQTMVGELVKRPEHERFPSLFYREGLFGR
                     FPYLLPNLVCSVLLLLSIFFSWLFLQETHPDMQPCTATENLDGRSAERPLLATAGATA
                     NAGADLRAESYGTFNQVHLYDEEDWLVRADGSRPEKIPQRQTIFTKRVTMLIVALAIF
                     TYHSMTYDHLLPIFLQDKTLRDVPTVGNSILKFPGGVGLSTRTVGLIMSTDGIIALFI
                     QSVIFPALAHYLGVWRLFVIVTILHPVAYFMVPFLIFLPRSLLFFGIYGCLVVRNILA
                     IIDYPVLLILIKQASPSDSVLGKINGLAASAGAASRTIAPPIAGYLYSTGAELDCTAL
                     AWWGSTLAAIVGAVQLWFMERKKHSSATIQPAAPCHYLPNEAHPRRDAVHIIVTGTDV
                     GTPDA"
     exon            complement(97220..98322)
                     /number=1
     exon            complement(98544..98909)
                     /number=2
     exon            complement(99007..99079)
                     /number=3
     CDS             complement(101797..103422)
                     /codon_start=1
                     /locus_tag="AO090103000032"
                     /note="predicted protein"
                     /old_locus_tag="AO070232000017"
                     /protein_id="BAE65516.1"
                     /transl_table=1
                     /translation="MTTDPSANKRLHITPFTAELLPSVLPSSVRPLATEISFHSIPTF
                     PENNYGYVTLPAMEADKIKKKLNGSILKGRKFKVDVARPQKRQRDENEDESDKAVFNK
                     VSPSSKKTKKQKDIGNVLEGYELQTDRQVKRGWTESTSSLKERRKEEKRNKKKDDRTG
                     KSQAKSKYTEKAECLFRTKIPPNRASSAEVEQDKQSKKKKKKSLQESVVHEFSKTVTQ
                     PSFLRTDSDGAAPTFTFEEGKGWIDGSGNIKEQASDRIRSDQYTPGKIAGAKERPKSK
                     SSLKAKASSQSLDDACAVRGGVDLKESDESDESEDWTSSSGATSSDDSATDSESEASV
                     TSGSSDTSDISNDQHEQGAQSTPQGVEKVPGPEAKADQDVAQAEKSDEPHSQEVHPLE
                     ALFKKPTPGTTDVKPDPDASAQFSFLGQGDMESEEEPQEVTEPQTPFTKKDIQSRELR
                     SAAPTPDTALAGRNKKWNSLEQHDSMDVDDEPYINTPVPKFGSALKDESEFTKWFWEH
                     RGDNNRAWKKRRRDAAKEQRQRENRRKGMKGKS"
     exon            complement(101797..103422)
                     /number=1
     CDS             join(104782..105156,105214..107298)
                     /codon_start=1
                     /locus_tag="AO090103000033"
                     /note="putative Zn-finger protein"
                     /old_locus_tag="AO070232000016"
                     /protein_id="BAE65517.1"
                     /transl_table=1
                     /translation="MGNSQTKEARPPFTPNRRSHGGGHGRSPYGDRHHSEGSRSTRGS
                     RPDLSILGIGGSSERDVATLEHRRETKQEREARRLERERVARIKERERSMREEHVDGG
                     YLVTQGVYTGTEDFNKAVVRQLMIERRLAPFWRGLNDFSDSWTEHQLMAAARGLPIPP
                     PDEIPSELEYKNPPKITEGAKESTDTKGIQHLTVPITSRSQSYGSDASQSSTPAHSLP
                     SPTSPLASGTSSSPLFRTRAKTLASLTTSKHGTQADPAPREIQLPRDPFVNGQPIEAY
                     LYKDAAECPICFLYYPPYLNRTRCCDQPICSECFVQIKRPDPHPPEHGDSDPNAPAAA
                     AEGDAADNQDSQLVSEPAACPFCVQPEFGVTYAPPPFRRGLTYASDPSARPNFTSPVS
                     STSSLSSGNVTAVTGRRRAASLSANDPTVITTDKVRPDWAQKLANARAHAARRSAAAT
                     ALHTAAYLMNSNGNGGDSRTFNIGRRGVMRRAGGSDPHSSSSRTGSPALQALAFLTDR
                     RSATNDMDSAEEGSGNIAPPRNTSRRNRIDDLEEMMMMEAIRLSLASEEERRKREEKE
                     AKKEAKKREKEAKKAEKTARKTGLYSTNASGSALDVPTGLGRVASSSSSVIGEESTPA
                     GKGKEVDRASPEAPIDATSTCSVTAPASMNAVYPPMNSADQHQSMQSSVPQTSPRELS
                     KPSHLRHVSSASSSFSSLVESMSGDHTGTTEGNGSSTEPLFNFRSLAAVIGDEDKREE
                     SAEHVENTLSNPQAEGSASRSVLPVDHAHTDDSVFNADAATPAGSDFALQESQGYMIP
                     KELETRSVEITDSTGNPQATS"
     exon            104782..105156
                     /number=1
     exon            105214..107298
                     /number=2
     tRNA            complement(107944..108015)
                     /locus_tag="AO090103t00001"
                     /note="tRNAscan-SE"
                     /product="tRNA-Glu"
     CDS             109177..110001
                     /codon_start=1
                     /locus_tag="AO090103000034"
                     /note="predicted protein"
                     /old_locus_tag="AO070232000015"
                     /protein_id="BAE65518.1"
                     /transl_table=1
                     /translation="MAILDKESRSRGLRMPSLSAIKSRKKNAESPPRRDSSSDEVVIP
                     ARMDSAPGRFLHSQEKDLPPNPLPSPPPFPSAPADSLSNQSPYHHINPTPKYEDRPLP
                     KFPRVPVPKREEPPAPVPALVPAPAPVQQVTPPSSEDHYPIHYQEHIQPIEDPLESFI
                     PEPEPEPGVDGTSASVEPVSSEESNGPWTPPDYEPIAAPLNQLHYACYQEHRSMPTAN
                     NLWHPLPCMTCQKYDREVRHRCVFCCLRICASCYQTLQKCPNRSLAQLMKTIPSHE"
     exon            109177..110001
                     /number=1
     CDS             complement(join(110371..111324,111425..111553))
                     /codon_start=1
                     /locus_tag="AO090103000035"
                     /note="predicted protein"
                     /old_locus_tag="AO070232000014"
                     /protein_id="BAE65519.1"
                     /transl_table=1
                     /translation="MAPHQNPAPDVGDEEEDDYMSMVIEEPQQKETFTQKKRRQQREA
                     EARAKVPSKAERAAQEAERRDAALATSTLNPSNKGFQMMAKLGFKPGQALGKSQGERV
                     SNQKSDSKIGGRAEPLNLVFKEDRGGIGLDTEKKRKFREEAEEAVKKVKQEEGDYRDR
                     VRIERETRRTEAQFHAAQKVAERLDAEAETGDGKTVQTKRGKTPTEHEEEESEDTTSG
                     SNNPQPKVKVKPTSQVNILYRGLVREREEKERSIQARHLLQTSLPSSFFPNPRLPGYD
                     DDPTLEREDKVALDNKPDISTILEQELDEEDPELDEFNALEPSERLARIVQYLRETHH
                     YCFWCKFRYETGEMEGCPGVTEEDHD"
     exon            complement(110371..111324)
                     /number=1
     exon            complement(111425..111553)
                     /number=2
     CDS             join(112370..112594,112651..113001,113055..114089)
                     /codon_start=1
                     /locus_tag="AO090103000036"
                     /note="acetylcholinesterase/Butyrylcholinesterase"
                     /old_locus_tag="AO070232000013"
                     /protein_id="BAE65520.1"
                     /transl_table=1
                     /translation="MARYITFAQFFLLFCLAAAQEVVVDLEYARYRGKALSNGLVQWL
                     GIRYAAPPTGPLRFSAPQNPSVVAGIQNAFEHGPTCIPTSEYPIPEDTSEDCLFLDVY
                     SPYRAGNHSKLLPVFVWIQGGGFNQNSNPNYNGTGLIQASGMGIVVVTFNYRVGPYGF
                     LSGREILQDGSVNNGLKDQIKVLEWVQKHIHKFGGNPKHVVVGGASAGGASITLLLSA
                     YGGRDDGLFHAAAAESQSFATMLSLKQSQFAYNNLVIRTGCASDADTLECLRGLDAEI
                     LQRENINTPLPHAQQAPLYLYGPVVDGDLVSDYTYRLFHQGRFIKVPVIFGDDTNEGT
                     IFVPKNVSNVGEADTFIQNQFPTIKLEQFAAINAWYLHENQTRQFPDAGPYWRPASNA
                     YGEMRYICPGIDLSSIYARAGINSWNYHYAVQDPDLKESGLGVDHTVEINAIWGPNYV
                     TGEPPSSYFTTNAPIIPVMQGYWTSFIKTFDPNPHRYPGSPQWSTWGNEGYQRIFIRT
                     NETRMEEVPVDQRERCEYLISIGPELQQ"
     exon            112370..112594
                     /number=1
     exon            112651..113001
                     /number=2
     exon            113055..114089
                     /number=3
     CDS             complement(join(114324..116774,116833..117123))
                     /codon_start=1
                     /locus_tag="AO090103000037"
                     /note="nucleolar protein involved in 40S ribosome
                     biogenesis"
                     /old_locus_tag="AO070232000012"
                     /protein_id="BAE65521.1"
                     /transl_table=1
                     /translation="MPPSQLKQLKASLRESGVLGPQQSKKQKRQNAKSGAAAQNRVQR
                     NAALQSIRDRFNPFEIKAGGTRTKFDVTTRDGNSGTAASRARPGVTKSLGEEKRRQTL
                     LREMEKRNKVGGILDRRFGEDDPTMTPEERAAERYARASQRKMRKESMFNLEGDDEEE
                     EFQLTHKGQSLNDIDQDDFQEGDLGGLEDDASDTEAARKRKRVFFDDGEMDGPEDLED
                     GEEHPERKKSKHEVMKEVIAKSKLHKYERQKAKEDDDDLREELDKGLPDLFEMLRGVK
                     PPPKPEPPKSDLASMNPDRAALMEGIAKGDTEKEYDQRLKQLTFDKRSKPTDRTKTEE
                     EKAAEEAERLKALEEERVRRMRGEEVGESEEEDEEEEVEEEGSEMSEDESIPDDAKAF
                     GLQQSSGQISTRPELSVEDEDDFIIDDDLVETRSDVSLSIGDSDEEVLSAEESEEEME
                     EDEEDELINGFTLPTDNTGEAPAAADAPEANEGLAYTYPCPKNHEEFLQVIQDVPMAD
                     LPVVVQRIRALHHHRLHPDNKKKLGQFSRILIQHVAYMAEQPEHPPFAILENIFRHVH
                     SLAKSHPESVSQEFRARLREIAADRPLSLRPSDLVILTGIATTFPTSDHFHAVATPAH
                     LCLSRYLGQGAVNILADFATGAYAASLVLQYQLVSKRYMPELINYVLNALCNLAPEEP
                     KSSLGLFPSRSPEESLRLKISKSLKSRKLQFWDITGPDSPKAQEELKLSLINTFISLL
                     STASDMWSDISAFLEIFDQAQKVLRFLNRSCKGKIPSVVQDTLQSTLDKLDGHTSKAR
                     LTRRPLLLHDHRPLAIKTAIPKFEDTFNPDKHYDPNRERAEANRLKAEYKRERKGAMR
                     ELRKDANFIAREKLREKKERDAEYEKKYKRLVAEVQNQEGREANAYERERRLRQGKR"
     exon            complement(114324..116774)
                     /number=1
     exon            complement(116833..117123)
                     /number=2
     CDS             join(117318..117360,117414..117533,117586..117646,
                     117702..117867)
                     /codon_start=1
                     /locus_tag="AO090103000038"
                     /note="predicted protein"
                     /old_locus_tag="AO070232000011"
                     /protein_id="BAE65522.1"
                     /transl_table=1
                     /translation="MPSHMNDRLLWLCLGVSLFFAVRGIVTDLRRVRDLTEIKHVEKE
                     DKMISEGTEDALKLDTLLKLSESTSYDLRAAALRIIAERSTKGETRDLLLRDLASTDT
                     ERRSKALSAMYFLVSNRSRTDLAYSAS"
     exon            117318..117360
                     /number=1
     exon            117414..117533
                     /number=2
     exon            117586..117646
                     /number=3
     exon            117702..117867
                     /number=4
     CDS             complement(join(118702..119680,119727..119848,
                     119898..120171,120217..120356,120410..120644,
                     120701..120774,120838..121047,121104..121157))
                     /codon_start=1
                     /locus_tag="AO090103000039"
                     /note="origin recognition complex, subunit 3"
                     /old_locus_tag="AO070232000010"
                     /protein_id="BAE65523.1"
                     /transl_table=1
                     /translation="MDLDTETQGVAKDGSNTQGVYIYRPVTSAKAHGERPSKRRKVQP
                     EIKEQKSESHPFVPLLDGEENESSVELRYNAYRLLWSTQETKIQEILDDVDSEVLENV
                     LSFVRSTSHLTYDGCIPTALITVGSNVSSLGRLLSKLNDQLAASEEGGVVILESGDAP
                     NLKATLKNIIRAAVTNTEGNNGYQNFLTDREGPRLLGYDLDLLGDYVKRKGIKKLVVA
                     FRDSEAFDPNILTDLLSLLSSWLDRIPFTLLFGISTSVELFEGRLPRSSVALLRGRYF
                     EIHGASNCVDRMYERLQADQNGRFWLGRNITGVLFEKSNDYFQTPEAFSRTVKYAYMT
                     HFFANPLAMLLSEEISVNRQQGKVCEAIRNLPSFRRFCEHLLDDDSTEQVRSLLENDE
                     FLFQQSLKYIEIGQQRMRSIFHVVKTVYLCLKSMDIRKKLTIPDLSIRALSGDLQDST
                     YMDDLLKGLKTLDSSKLKEVLAFMPQDLTDCPDFQEIKKDFEALVQTYQGTEPLRSEY
                     DSHNSIVAATVVQQRVKLSKSKARLPQQNIEYTKVIDRVYALSEKYFVETLVIPQDLF
                     LHEAFLLDMKNPLKEIFSPRPRFAIERALANPFDYLMSMSDRTEARISARQPATAILY
                     QLYLESGALVNVYDLWQAFYAVFESEQGDACDERMTMTLFYRAVSELKALGMLKSSRK
                     KVDHASKSAWIGL"
     exon            complement(118702..119680)
                     /number=1
     exon            complement(119727..119848)
                     /number=2
     exon            complement(119898..120171)
                     /number=3
     exon            complement(120217..120356)
                     /number=4
     exon            complement(120410..120644)
                     /number=5
     exon            complement(120701..120774)
                     /number=6
     exon            complement(120838..121047)
                     /number=7
     exon            complement(121104..121157)
                     /number=8
     CDS             121395..123974
                     /codon_start=1
                     /locus_tag="AO090103000040"
                     /note="predicted protein"
                     /old_locus_tag="AO070232000009"
                     /protein_id="BAE65524.1"
                     /transl_table=1
                     /translation="MLRQAVRGARWYQHVALRTPSAPSLPLLRTFSVVALRSFQYGGP
                     NDKVRFYEQDTRGSKKRRQVNPEAEENADREEVEGELARLEKELQDLKEGPYGPNSQF
                     IRELPEKERAIALEALRKYEAEHGKDEPEIGLEQVFDNELDEMLKEEFEGLAKEEENW
                     HSTGQDNSPKKPVRRPYEVAVTTLEHHSYIEKFNQCLTRIASDGSNERLGAELWRWYR
                     RCKQMIPEFLESIPEEALTLLWHAQVGDYTRSSRTSHIQILAEDAISVGKSLSTPHLL
                     SYIESLRKTGKTKEALDQWEAHQTGLSQNKQDLEAYWKLGVRLFAAENDPQRAQDIAL
                     AFLANDKSREPRILLPVITAWGRQPGKEAEVKAWALYLQLKSFLENTLTMDDYDNISI
                     GLLKAGRPNLAIAVFKDMMVTGQDPANDSTSLYKAAVGLVGHLQASSISEQDVNKVSL
                     STLTVLPRRFQNRFFYASWMKKLIGMGEVDSAALVIELMYERGVKPDSKHLNGLIAAW
                     LRDGNPDAREKAERLGWSMVQQRIDSIWARTNSTGSSPKLTVSPDPDSPRIPKWMQRE
                     IPSANIETFSILLLHYTRRSDDGMIKYLVKCLGDAQIKPNSYFMNHILYAELRKQDIG
                     SLWDKFRTMSASIQPDLETFACLWDCGKLQYDRGRTTFVADFPSARSLYAEMMQWHSH
                     LPTRGRAAAQEEFSKELYNQIIRCFCLSKDLPGTLIALYSLRSIFGFSPDDVTARLII
                     LQVARMAGVPPGTPKRRLRRLSTTPKSKENISHVNRLVEILSERKVSALQARGLTLET
                     LEPQEREQYQLDIMTDLLRIIMGRAATESSRVEDQIASAAEEMNVLGVDLGSSLEDND
                     LLL"
     exon            121395..123974
                     /number=1
     CDS             complement(124473..124937)
                     /codon_start=1
                     /locus_tag="AO090103000041"
                     /note="predicted protein"
                     /old_locus_tag="AO070232000008"
                     /protein_id="BAE65525.1"
                     /transl_table=1
                     /translation="MSTTEKPTPTTATTELPVQTLESLHGPELDSKDVCSYYIRDQPN
                     EPEDLDTLRTCCKPNVIHRYNEHQYWCEVPERYFPPTLYLNVSNRTIEQWVDGNMTQC
                     IRDAHPSHYAGSSTCHFARYNVRNEAASLIAASAPLYLLLLGGLWSFRLLLR"
     exon            complement(124473..124937)
                     /number=1
     CDS             join(125917..126273,126330..126400,126456..126603)
                     /codon_start=1
                     /locus_tag="AO090103000042"
                     /note="predicted protein"
                     /old_locus_tag="AO070232000007"
                     /protein_id="BAE65526.1"
                     /transl_table=1
                     /translation="MNDTTGANNPLEERQLMGHQFMCCMGDCSYELVGDGNPHTDYLH
                     RQMTSTGECRDGPGAKGCGVGFSTSHTFGYTVSAGANIGWFAPGFSVTESWTVGETKT
                     CSADINATVCLWYDMAYTAYTVQVVNRRLYSSVCSNQPTGPLIMKAPNVNNAGGGHWY
                     CAYGDECRGEGEEYWCLTEDCPPKGKPKPQD"
     exon            125917..126273
                     /number=1
     exon            126330..126400
                     /number=2
     exon            126456..126603
                     /number=3
     CDS             complement(join(127322..127442,127500..127782,
                     127793..128810,128904..128946,129005..129023,
                     129097..129146,129283..130230,130299..130585,
                     130644..130696,130752..130984,131042..131215,
                     131286..131320))
                     /codon_start=1
                     /locus_tag="AO090103000043"
                     /note="predicted protein"
                     /old_locus_tag="AO070232000006"
                     /protein_id="BAE65527.1"
                     /transl_table=1
                     /translation="MDFIAACPRRKCFYWKAYIAVPAALGSYHQRRLLGCSIPNRPEI
                     LVVVWFWIMCIILNFGFHDIFIPNVTMPTISRQAWKYVAQRTSMFAYACLPWVWLFAG
                     RNNIFIWATGWSFSTFNVFHRHLSRLTAIFAFVHAISYTVLDTIYGPYYEEGLHVLWF
                     KFGIIGATMMGLLCGLSIPYIRTKCYELFLVGHILFAVILLVALFQCVLLCSLPVYDF
                     GRCETGLQDKTDILPFSELNITPTSGQWLPYGAVIGSCASYASEEADVVRLDVQADGS
                     IRPLPGHYFHLYQLFSWRGWENHPFTVGAYTAPNPTSPLTSSSNAQQGPHYMTGALNE
                     KNPFTSTPTEVFTQGSQSSTTDPALGNLVFWIRPYNGWTKRLKDQCLRSSSSDDSAVN
                     GYYQTSIPISLEGPYGHTLPLHHYGTVVMIVGGTGIATAVPYIHDHVSRLSKAGSRVS
                     DDTKTQTSNLTLVWACRGHVFMQQLCGRELAGALEIEGFTGRFHCTKGCNSHCAADNK
                     NGELRIERGRPNIENIIHGAATEAQIARHKMAVLTCGSPHMSDEVRRSVHRILKKGYE
                     GIEYFEEAYSWLSWPSHSFVAKLHLCYGLKITIPKLTLSFGWYAPLFRGIDVTAFRDP
                     YVFQNKDLDDTVGSSSGTWYAAISGGVHDVGPGVFLYRNQGSGYEDWEYLGKWWSEPV
                     NSTCGNGDWAKAWGYNFEVGNVFSLDKEGYNVNGETFITLGVEGSYGPITESVTSMHG
                     MLWASGNILKPDGGNVTFEPTMAGVLDWGISSYAAAGKVLPATSQASEKSGAPDRFIS
                     YVWLTGDVFGGVAGYPSEQQGWQNTLLLPRKLHKQTISNVVDNDLASETGSWCVKDSE
                     NSCLKLETMGIKIARETYKAMTNKTSFTEPKRTFCEDGAVPFKQSPTTKFFVLNAQLS
                     FPKSARDPGVQAGFKILSSELESTTIYYQFSNESIVIGRTQPSRPPLKLNTTTESGRL
                     RLFDINKNCNKSDDDDKQEERKKKDAYREHGRNRHNVKLAAEDESHIETLDLTIVVDN
                     AVLEVYANSRFALSTWARTWYANSTEISFFHNGEGEVTFSDISVSDGLYDAYPDRAR"
     exon            complement(127322..127442)
                     /number=1
     exon            complement(127500..127782)
                     /number=2
     exon            complement(127793..128810)
                     /number=3
     exon            complement(128904..128946)
                     /number=4
     exon            complement(129005..129023)
                     /number=5
     exon            complement(129097..129146)
                     /number=6
     exon            complement(129283..130230)
                     /number=7
     exon            complement(130299..130585)
                     /number=8
     exon            complement(130644..130696)
                     /number=9
     exon            complement(130752..130984)
                     /number=10
     exon            complement(131042..131215)
                     /number=11
     exon            complement(131286..131320)
                     /number=12
     tRNA            133492..133596
                     /locus_tag="AO090103t00002"
                     /note="tRNAscan-SE"
                     /product="tRNA-Met"
     tRNA            complement(134157..134261)
                     /locus_tag="AO090103t00003"
                     /note="tRNAscan-SE"
                     /product="tRNA-Met"
     tRNA            complement(135878..135977)
                     /locus_tag="AO090103t00004"
                     /note="tRNAscan-SE"
                     /product="tRNA-Arg"
     CDS             complement(join(136397..136798,136872..137182,
                     137256..137355))
                     /codon_start=1
                     /locus_tag="AO090103000044"
                     /note="preprotein translocase subunit Sec66"
                     /old_locus_tag="AO070232000005"
                     /protein_id="BAE65528.1"
                     /transl_table=1
                     /translation="MVNWLSLAVPFAYLGVLIGSLATFSSLYRKRKAQKAYSLEPWFP
                     AHLQRDIYFSLLHIDPPATSSKEKKAPAVPESVLKAALLRRAEEDIKRVLALRSQKQA
                     LGVLLQRGSVGDDLWQRFQRAEKEMEDEVRDVVSEANAYVPGWGQTIFQSANEMMNNT
                     LYRERIAEQQAKLDEERQWWEKRRASIKEGFMKELDAEDSTSTAPPQKTEAPADTTPT
                     TTSSSTPAIKTPESSGAPSSVTGSDDDAVLVEADEQPGSPASPSKKKKKGKK"
     exon            complement(136397..136798)
                     /number=1
     exon            complement(136872..137182)
                     /number=2
     exon            complement(137256..137355)
                     /number=3
     CDS             complement(join(138213..138709,139100..141142,
                     141200..141738,141997..142643))
                     /codon_start=1
                     /locus_tag="AO090103000045"
                     /note="AAA+-type ATPase containing the bromodomain"
                     /old_locus_tag="AO070232000004"
                     /protein_id="BAE65529.1"
                     /transl_table=1
                     /translation="MEEDEETQEKQEEYIEETTTEVKGSQVEIMESAQASFEEGPISA
                     GDDQQGAAEADEGFVPESENEDAEHEEDEDEDEGPVTRRRTRPNRSQQIEEPEQPDEE
                     EPSGPRRSSRKKPKSSQRKRLNDEESDFEPEEEDSNDDDEVSQTGKSNASPRKASQAR
                     DDEEDSAAGRRPGLRKRASRSRGQSEAAADIAEELAEELEDLRGGRPRRRLQTDIVDD
                     EGLHHPRGSVAGVGSALGPHGAGLLPGQTQTHDAAQGLSGTPANLGKVKDKQALADAD
                     PLGVDMSVNFDSVGGLQGHIDQLKEMVSLPLLYPEIFQRFHIVPPRGVLFHGPPGTGK
                     TLLARALANSVSSEGRKVTFYMRKGADALSKWVGEAERQLRLLFEEARKTQPSIIFFD
                     EIDGLAPVRSSKQEQIHASIVSTLLALMDGMDGRGQVIVIGATNRPDSIDPALRRPGR
                     FDREFYFPLPNAEGRRAILDIHTKGWDPPLPGHIKDELAEITKGYGGADLRALCTEAA
                     LNAVQRRYPQIYKSDKKLLIDPKNIDVTPKDFMLAIKKMVPSSERSTSSGASPLPKEV
                     EPLLRHPLADIRALLSEILPQRKRLTALEEAQFEEPEGAGSFQREQMQQEFDRSRVFR
                     PRMLLRGLMGMGQQYLAAAILHYFEGLHVQSFDLPTLLSDSTRSPEAAVIQLFAEVKR
                     HRPSVIYIPNIESWSETVGQAVLSTFLGLLRSIPPTDPVLLLGVQEITGEEIDTGLLR
                     QMFGFSKRNFYDLKAPGNEARYEYFSKVVEYIKTSPAHFPDPENRKKRELETLEIAPP
                     PPPKPTTPLTKEQLKAQKKKDHQTLNLLKIRIQPIMDQIKKYKRFRTGVIDESQIRYL
                     WEEDDPNIVTSDLPIEQRTTFRPFEKAYDKHGVPGLWETVSGKFFYNMEIVTIEKRLS
                     NGYYKRPSDFLADIKRLAKDARQTGDQERILRANELLSNVEVDISTIEQAEPQLVAEC
                     ENVYIRELAREKAAAEKAKRVEEAEKGGFLGHTANHNVPHGNTESGPSSGPVVLGETF
                     PDLAPKEQARPVTPTRQSTASFLTNGYHQSGGSDLNDLSARGPTSNEHLPDTQQCDSS
                     QPSPRPRESLPGNADSQPEHHVNGSQSQPKTQPPVPLFDESTKPSSHPPVNLHSILND
                     EDHSPKLIVDSEYVQNLHEQLTQRTSGCSVEQLEQINTSLMDYLWRTRGEWNRSKVAA
                     GIRDSFNEILEDMQAMQEIGPISQRTKEQLGSSFEHL"
     exon            complement(138213..138709)
                     /number=1
     exon            complement(139100..141142)
                     /number=2
     exon            complement(141200..141738)
                     /number=3
     exon            complement(141997..142643)
                     /number=4
     CDS             complement(join(146321..146864,147088..148175,
                     148273..148278))
                     /codon_start=1
                     /locus_tag="AO090103000046"
                     /note="predicted protein"
                     /old_locus_tag="AO070232000003"
                     /protein_id="BAE65530.1"
                     /transl_table=1
                     /translation="MSEPNPKRLAWDNSGDILQGMLDRQVAPTSPQLEFSSDGFLTSE
                     YALSDPASFLGLQFGPDSAVIPHSHLSMLNQWPPHHQQASSPPPQPSLDVSQYHHPRL
                     TSNQDAWNPLQVTGVPVSTSTWGFPNANKLQQTPKGGRKNSTGQHSAISESDSHYNGF
                     HPSDSGYCSRSCTTRSVTTSSYAVDSVSSPFLAPHEHEQEDRASMLDLGPSHCGDTVV
                     DALEIVESPSLMCHDVITCDYPNCPWTGKCPSDKRYVYSFQHVLKNSLCRRIIKLTGS
                     RKHEARHRKLFKCDEPGCTRKEGFGTINDLARHKKCVHKQEPERGPKVLYMCFGRNCP
                     RRGKEWPRLDNFRQHLSRMHNDEDTSELLKRPSNQSGLQPVEDPQTQRRYSTLDSTPS
                     IPARDTTQRLDLPALTTLNLGSTTDLDPSSTSSRLGHAQPDRMENMVSEMATNMVNAM
                     ARMMNSSSNDNGNSQRRHSHHMGDKVETLGGNDGLSDQKREIMQKILSAALDQVSGNP
                     EPSQADSQTVPDSKSDKKGWIQCEFCTKRTRLRCEMK"
     exon            complement(146321..146864)
                     /number=1
     exon            complement(147088..148175)
                     /number=2
     exon            complement(148273..148278)
                     /number=3
     CDS             complement(151634..155260)
                     /codon_start=1
                     /locus_tag="AO090103000047"
                     /note="predicted protein"
                     /old_locus_tag="AO070232000002"
                     /protein_id="BAE65531.1"
                     /transl_table=1
                     /translation="MSTLSPQFVPNDSPNPAKLNDASFPDPYLSAQLDPEVASFRSSA
                     IRLTPVSGEDHGSRDASSSPIGSHVHSDSPRDEAHPASYSEYLSPTDDLSSEMSVHTS
                     PTADYLSAAFSTDLSPDSNSWQYDGGLHPGMRSTALDPNELNSAQMIMDPSQLLTPNL
                     TNKSSLSSETTSIKNQTGPVALQNQPQALTLITGPPDECLDVPGDLGSPRARSPIVKI
                     ESFSRGDSPVRDMRRPSHSSTHLSPGGPSSESDEEAGVDNSKYLGSVQSVSRGHDGSW
                     IPNAATGHAGVDPTSRKNVYVPSPNELELRRQLDEKNEDIRSWSASVSVANSENGDDP
                     TPHRGRKHTGNRRRAKSAGDPSLQQDYFNLKVALIPGPGVLVTENSEEEYSDHESEIE
                     GTGSETPAASVNEARWVLGEEEIQLSPEGEEPSPHQFLGRPPWRDLAPVPSPDMARTQ
                     PASSTAAMVEYERRVRDLDNVSRAATWGTRDVDINSLLGGGGSFENLAISNDKSRKHE
                     RRSSLRKLLHRKSSNNLKPPNNLKRHLSDLSISLPGSDDHSKGDENKSSHQRKNSFPH
                     RKLSLGLSPRSPRSSRSPSLSTGGAVIAIAGQMAAIGGKDTLRVASPSSTSNPWPSLK
                     VRGRSRSEIPRPSTPGLIDLMTSHGGPPVANIAYSHLQPEPRSAPPNQSRLGHGTSDG
                     DENDDNVPDERGLVMDLSVQSRLPVPTLEGFRTQIAQLNPRLQPALLDRFANEQVRRY
                     KKLVENKFTHTCAVSEKGCASGKFCFAQGGEALLLTPRAGPQDSETPHTQFQIPGHGE
                     AGDDSPALGESAVTAAQFPPGVPLPPVKRLPAEFECPICFQVKKFQKPSDWTKHVHED
                     VQPFTCTFAHCSEPKSFKRKADWVRHESERHRQLEWWTCSEPDCNHTCFRKDNFVQHL
                     VREHKMPEPKVKKTKAKGLSKHPVDPNSPEVLAEIQREREIEQLWNLVEQCRHDNPKG
                     PKDEPCRFCGNVCSSWKKLTVHLAKHMEQIAMPVLALVNERDLSSNLGPGSTGKGDLG
                     PEPESISRETTNFAPNLNGVQARADMSIGYTQATYPGHDVGQSDGLGVPFSSTGVPHF
                     TTMSGAFISAEPEPMDAYDEYSVQVGLQPGGPMDQSRLMPMHQNSVTYPPPFNAGPRP
                     RVSNQDMSVLQESYNFSMSPTEMQPTYDPQYMSSTGENSYVCQGTVAPTMPFTAPGAY
                     PNQL"
     exon            complement(151634..155260)
                     /number=1
     CDS             complement(join(158221..159121,159173..159207,
                     159249..159297,159383..162522))
                     /codon_start=1
                     /locus_tag="AO090103000048"
                     /note="predicted protein"
                     /old_locus_tag="AO070232000001"
                     /protein_id="BAE65532.1"
                     /transl_table=1
                     /translation="MAGAKKGKGKSGSKKNNKKSKAQEESEIQTPPPAAPDVTIPEPQ
                     SEEQQQQEQQPVEQQPVEQQSQEPQLAESQLQEQQQPEQPSDQAVEQITDQQLDQPTE
                     QTSEQQPEQPIDQLSEQTTDQPLDQPPAEQADQQLPDQQAEPLQDPSSEPLQEQPLEQ
                     ELQDQPPLDQQLQDQPPLDQQLQDQQPDLQLQEEQPEQQLQEQEQQLQLQPEEAIEAE
                     PQQPEAPVEAPVEALVENPVENPVEVESPSAPEVAPEVAAEVVPEIATESIPETELAP
                     AQEVEQEQLQPTTEEVSTAPTPEQQPQPPTNPEEDGSAQVTAPDLSSSQQLDASDVQR
                     DPEVPQELHQEELGAAEHPVEKATETTPENIDVSREQVVEPPEPTPVTAPQTPLFSTD
                     PTTASVETPSATETQFVEFASPTKTDAPEIESHTATVSDPSFEAVEAAPTSPTRQTTP
                     PVSKPASPVPKNASPTPRAVSPAPRDAAPTPKAASPAPKPASPVPQAAPPMAETVSSM
                     QEAELPAEVIPPAPTPPPVASVYQEPPSTLQHPSPVQKMASPVSKAASPFQKVASPVQ
                     KSASPKVTSPLARHAYMSPMISPHATPHATPPVQPAMAPMHHMPPPSTAPSVASYATA
                     YSPVMTTAGFMPQYAFYPPGMQPTPRGSMEPSTATAYQHLRDLTYANGNGFFAPQNGH
                     HNGHNGHHKGMMSPPEHPVEEPIELLQRIQDAIPDINRLLGSYRNTKSKLQAREAEFQ
                     QMKTQHEQDLMHKDFYIEALQTQMRKTANEAAEESTKLKNTINELRMELGNLDEKRKD
                     LEEKLEESERSNEELTRNKHDLEEEVRTLNTSMKEAQEAHEKECERREQEKVDALATQ
                     KREMTESFEEIKAEDEKAAAEALAAREKELLDQQEAMKNDYEDQKRQMQEAHDTLQSN
                     FDDKVNELDSTKTDLENKHKELEETRVQHANEVELLNNTHADHVADMERRWADERGEL
                     EQRITDKCDELAHCEREKQKVEEDNVVKEQQLQAASDGMRLTIDNLGKDCDRLRKTLH
                     SLGEATDLKSTKGDPFLLSSVMPFLPFWPELCHNYDHDGDEDYEILDCFGQLSRLIVS
                     LSKEHFAYLPIDPPKDVLSKIPQELPSFLDNTPASRELRSAYVQHIITKTLTYRIFHP
                     FLFTLGKRYGKADTFFQMLSMDIRRKSVRREAFWRQQTLKAAYTTSDAKQSINVVAAV
                     IVDEIIDHLKHFADPKHMDTLHTSVRKIVKLAAETWRLARVERELIMASFPAPDSEGT
                     SNETWEEYGTPKEGCVGSKEDPTRHVILRTFPRIIREAAHEDFAEDEEKALSCTYTQG
                     SVLYSDSPVVMARRQELARRSMDSLVGGEERPRSESRGSTPNSPRRGKASFDTL"
     exon            complement(158221..159121)
                     /number=1
     exon            complement(159173..159207)
                     /number=2
     exon            complement(159249..159297)
                     /number=3
     exon            complement(159383..162522)
                     /number=4
     CDS             complement(join(164964..165614,165688..165999,
                     166161..166319))
                     /codon_start=1
                     /locus_tag="AO090103000050"
                     /note="predicted methyltransferase"
                     /old_locus_tag="AO070302000002"
                     /protein_id="BAE65533.1"
                     /transl_table=1
                     /translation="MASAFSFGFAGDDIDIDDSELNTVDEGYTSVTQDSSSTLPELVA
                     AQRHELSDLLSSLPSQVSFNKLNINTTQDDQTSVKTLTLARREVFDIRTQLMAEDTAD
                     YANEELISGLEKGDITPNIYEGGFKTWECSVDLAKLVANENILSNADAGDRHIIELGA
                     GTAVPSLALFAQSLSNPKGSSQNIRFTFADYNSVVLRLVTLPNLLLTWSYIVMRQKSV
                     SVAGAEDQVEEELELDITPELLEAFKKDIAERGISIEFISGAWSPAFVDLVFTSGEKA
                     KHGTLVLASETIYSPASLRAFSETLLALIRRPIRAGGRSRALLAAKKVYFGVGGGVDE
                     FLEVFNTVGGDELDVKERMDVKSEGVGRIVLEIAPKGLQ"
     exon            complement(164964..165614)
                     /number=1
     exon            complement(165688..165999)
                     /number=2
     exon            complement(166161..166319)
                     /number=3
     CDS             complement(join(166835..167410,167483..167927,
                     167991..168076,168144..168251))
                     /codon_start=1
                     /locus_tag="AO090103000051"
                     /note="cystathionine beta-lyases/cystathionine
                     gamma-synthases"
                     /old_locus_tag="AO070302000003"
                     /protein_id="BAE65534.1"
                     /transl_table=1
                     /translation="MTNSTNGAPAQDKRFGTLAVHSGAHHDPTTGAVIAPISLSTTFA
                     QTSVGSPVGLYEYTRSSNPNRDNFEEAIAALEHAKYALAFSSGSATTAVILQSLAAGS
                     HVVSISDVYGGTHRYFTKVANAHGVDVTFTPTIESDVEKLIRPETKLVWIETPSNPTL
                     GLVDIEKVAAIAHRHGILVVVDNTFMSPYVQNPLDHGADIVVHSVTKYINGHSDVLMG
                     VAAFSSDSLKERLGFLQNAIGAVPSPFDCWLAHRGLKTLHLRAREATTNATAIAKALE
                     ASPHVISVNYPGIDSHPQRAIAVKQHRQGMGGGMLSFRIQGGEKAAHLFCKYTKVFTL
                     AESLGGVESLCEVPASMTHAGIPKDQREAAGVFDDLVRMSCGIEDVEDLLADVLQALK
                     KAVASSEQNGSA"
     exon            complement(166835..167410)
                     /number=1
     exon            complement(167483..167927)
                     /number=2
     exon            complement(167991..168076)
                     /number=3
     exon            complement(168144..168251)
                     /number=4
     CDS             complement(join(169186..169230,169280..169457,
                     169513..169576,169628..169714,169770..169866,
                     169937..170035,170114..170125))
                     /codon_start=1
                     /locus_tag="AO090103000052"
                     /note="DNA-directed RNA polymerase subunit E'"
                     /old_locus_tag="AO070302000004"
                     /protein_id="BAE65535.1"
                     /transl_table=1
                     /translation="MFILTTLSDLIQISPEDFSKYSSVAIEDNINEKYANKVIQKVGL
                     CIGFYDLLESSDGLIGHGTGLVNVNVKFRLIVFRPFKGEIMLGKISSATEHGIKIGVE
                     FFNDILVPPNLLLDGARFDYADQVWIWENEDGSTFYFDIGEVVRFRVEIEEWHDQIPN
                     APDLGDAAAIERKPPYSIIGSMQMAGLGPISWW"
     exon            complement(169186..169230)
                     /number=1
     exon            complement(169280..169457)
                     /number=2
     exon            complement(169513..169576)
                     /number=3
     exon            complement(169628..169714)
                     /number=4
     exon            complement(169770..169866)
                     /number=5
     exon            complement(169937..170035)
                     /number=6
     exon            complement(170114..170125)
                     /number=7
     CDS             join(170795..172426,172504..172737)
                     /codon_start=1
                     /locus_tag="AO090103000053"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000005"
                     /protein_id="BAE65536.1"
                     /transl_table=1
                     /translation="MGYAPMNYPGYAGQPMANPQQSIPTPQFPPSRTTNYQVPQSTTS
                     FPSSRPFPQSTPTHGPPYQHQPGYSAYGPSTAQQAPTYHSVTPSHQNAPPSVQPSMMG
                     PPMHWGYNNSASGGGYTGPPHGNQRGPRPYNAYGNQASRGGGAMPHMKRDHTSAFGKP
                     QNITPRVPAPPPVPSFGNPLPSKPPPPADATRKPKKKKRKHNQLGLTPKTEEHESSEE
                     EDDVDEESRLAQGGASAAAAVQITFKGRTTTLQSPADIAAWIEERKKRFPTKEKVEEK
                     KKAMEEAKKAKEEAQRQKESRKQEMKKAQKDHQQAPADPIDAAEKAKRKADKLRRKLM
                     KEQKKVEKAEADAERARMRVEELQRGSTDVNRDVTSASTQEAQAEPGTEDRSNTAPDQ
                     ETRSIETQGVPLASGHIPGEVSQPNNDVGPSSASESKSNGEGVIEDVRADAAVSSDIS
                     DSSDWTSSSGSDLSSSDSEDSDSDSAPEEATSRREGPERVAPPPREAKKKLCRHFART
                     GRCQRGDKCKFLHETPDRGAKTKPVEKKGRKGLLQALLARQKGEDDRKVMEAIVWLGE
                     NGFLDETKSYEEPLEGANENSATDEVKLSQGLPEDPPLSEGIVSVQTGDSAPTTA"
     exon            170795..172426
                     /number=1
     exon            172504..172737
                     /number=2
     CDS             complement(173526..174758)
                     /codon_start=1
                     /locus_tag="AO090103000054"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000006"
                     /protein_id="BAE65537.1"
                     /transl_table=1
                     /translation="MQSGILLYVHFAVLILKLIPAVTRCIRRCTKRARSTTKIQFGQH
                     HFSVLKSMLVEFQEAQCFFMLSFQCAALIALAAGPQVFEATSLLQLQSNISMAKAVAF
                     MGILPITYGLWILHRIGLHSWYISVWSAITIVTSSVTLHLCKVEPRADNLQEIATADR
                     LDKCGFHPPPLIYCRSDSELGSSYSLVNNLTFGLSDNTANFVCIAIYGLLLLKRLAPY
                     PKRWLGQKPWFQATYHRVHPWLVSRGIRILSRAVNVIIETLLLVTNFFYSFMVIARSL
                     PTISLDSWSFGQIIAVTIWSPIVSKYLYWLLCTYLAFLSTPVPFFCFILITEIVGTDS
                     YSAIRFPSPYKIIRVKTINEEENPDDEDRLFIHLPSTSDLNINPNSKKFIVTDVELTP
                     VNDSKTSSVSTRHSQFPI"
     exon            complement(173526..174758)
                     /number=1
     CDS             join(177081..177297,177366..177891,178318..178441)
                     /codon_start=1
                     /locus_tag="AO090103000056"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000008"
                     /protein_id="BAE65538.1"
                     /transl_table=1
                     /translation="MRSIFYLTLSAMASLAAAATNSANPFNIPSEGYSFEAGEPTTLS
                     WKPTTSGTVSLKLQWGAVMTSNTGTTIAQNIPNSGSYTWTPPANLAAQPDYTIEIFND
                     DDTSEVNYLPRFTVAGATAAASTTASATTTAETTSATESSTTETTTNTKSATETHTTL
                     TKATASTASSTSATASGTSTESTSASASATGTSTGTSTGSASTSTEASSTTSASASAS
                     TTSVVNVNGGMVNRVSGGMLAIVLGAIAVLSEPNFGDNHGAIMGVSIKLGTGLVPTSS
                     QVPGRQWDPSVG"
     exon            177081..177297
                     /number=1
     exon            177366..177891
                     /number=2
     exon            178318..178441
                     /number=3
     CDS             complement(join(180402..180955,181069..181504))
                     /codon_start=1
                     /locus_tag="AO090103000057"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000009"
                     /protein_id="BAE65539.1"
                     /transl_table=1
                     /translation="MQNSVKPPEVLLIIAPWDLSVSFLERLPTISPGIRVITFKCNMQ
                     DMERPRAISQETWNSVTIRLTRNYLPGKEQIPNLRYIQFHTAGCNHIADTSLFEDSDV
                     SFGTANGVHPQVVAWVLSGRKLTTRSSQIAEWVVTTLLGFQHHYEDTEDAVGLRMCVH
                     HPSVGMKDRVLLSCIGCTGRQCARLANALGMDVHAFTLHERPTPESKGDHSYVEAGMD
                     DPNGDIPSRWYHGCDQLNEFLAGLDLLAITLPLTSLTWSMIAREQFQTLGKRNAFVSN
                     VGQGPIVNNDDLVDALNNGKIRGAAVDVTDPEPLPAGHPLWKAKNVITTMSEF"
     exon            complement(180402..180955)
                     /number=1
     exon            complement(181069..181504)
                     /number=2
     CDS             join(183014..183368,183518..183945)
                     /codon_start=1
                     /locus_tag="AO090103000059"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000011"
                     /protein_id="BAE65540.1"
                     /transl_table=1
                     /translation="MVVMDDKYNGWRYLILSFALSDKMVMDAVLAVSTFHLSHKSGGT
                     LPVRPDKLYAKAILGLQNRSSLDEYDMLTRQSIFVAIITLLVGVMVNGSSDFPILFHM
                     LQSALDAVGGEGGLGNAHAQESFDCLHYNGNLHPDHALTFYLNAYLRQQAYDIYLERA
                     TMGPHGTLDPNKIEQFKETLVMFPEGSLGEHSLVWPTFIAASESLKDEHRLYFKQFLE
                     KQYHRNGFLNLQQALKLLDKIWARSSYTNWPALLPEPRVFIM"
     exon            183014..183368
                     /number=1
     exon            183518..183945
                     /number=2
     CDS             join(185435..185763,185889..185943)
                     /codon_start=1
                     /locus_tag="AO090103000061"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000013"
                     /protein_id="BAE65541.1"
                     /transl_table=1
                     /translation="MQGRYIEHQALKAFGGRERISMVTSLRLKSPFIRDETIIRPLLP
                     TTPKSTLYYQYAEYRLENLEERVRHQLKVMRQHKKANRDFDVASTRKFLLGEREFIDA
                     MLEELEDPPAECTSSKVTIQSSVPL"
     exon            185435..185763
                     /number=1
     exon            185889..185943
                     /number=2
     CDS             complement(187242..187679)
                     /codon_start=1
                     /locus_tag="AO090103000062"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000014"
                     /protein_id="BAE65542.1"
                     /transl_table=1
                     /translation="MDGWILRDNTGLKGSAADFARQQLEEDKLPQSEAGRFITKVDCG
                     GGQEAAQYERHLPSCTHLVQAVGFTRDPLPELSVNGRLLDPEFDSVSGGFHDATGRVV
                     PGLHGAGIAFPERVVDPYGNVEHAVGFWKFMKFIKRVSPQWTA"
     exon            complement(187242..187679)
                     /number=1
     CDS             complement(join(187868..188015,188129..188266,
                     188420..188580))
                     /codon_start=1
                     /locus_tag="AO090103000063"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000015"
                     /protein_id="BAE65543.1"
                     /transl_table=1
                     /translation="MNSQRCAAVVVGAGPAGLAVIGNLLEKQLGGKIAWIDPYFQAGR
                     VNRKYREVPSTRIPSPFSTMAKLDQEKTCHLHHAADMVRALTEGITKMDQVYACRGLR
                     LGPFGSNVRTTSTKLRSLPLDSSCVRDRRRQRCRSRCVDSTSRGWI"
     exon            complement(187868..188015)
                     /number=1
     exon            complement(188129..188266)
                     /number=2
     exon            complement(188420..188580)
                     /number=3
     CDS             complement(join(189771..190292,190367..190714))
                     /codon_start=1
                     /locus_tag="AO090103000064"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000016"
                     /protein_id="BAE65544.1"
                     /transl_table=1
                     /translation="MLPFRFRGLRRRQSNSSNDEPEPPSNMGNQNSTADDSHGPTDSE
                     IFYPEFYDVLKVRYLLRWKIIPEGLPVEIVDLIVDAAEYWPSIEATLDQKRIIHQDRD
                     QVLVRTAPLCYDEKTLGSDSPKVLPHRTVHPCRKIVFSIASHDQGFANSGRGTFDGSY
                     TWFDTEVVPFEKLPTPGDSSVPEQDANGVRFGPDHPLLLPSSHKLQANRTAVRGTQHY
                     HITWHHLDNISADSPEAEEIQHNQGRGRATLDGSQVRNLQIGDTIAVWGRARFGAWSN
                     HVERLSVRVFWAV"
     exon            complement(189771..190292)
                     /number=1
     exon            complement(190367..190714)
                     /number=2
     CDS             complement(join(191542..192922,193855..194002,
                     194754..194910))
                     /codon_start=1
                     /locus_tag="AO090103000065"
                     /note="RRM domain"
                     /old_locus_tag="AO070302000017"
                     /protein_id="BAE65545.1"
                     /transl_table=1
                     /translation="MSLLNLILFGESSMRSVSASESFSVIAFSGLGDSRSNTIFSETS
                     SISLRLLDRYDLLQDRRKQALGGGRAKDDEEEGGGGRLHEAGNTTVKRCGRMNGIEES
                     EDVSEPEDEDQVMQEASEASSDAGGEPAQAASEPPSRKRKRAAGEDLEESYMRRIAKE
                     EQKEEQKRRAEKAKRQKGEGEEEDEATSTDKSDDENEDESSDEDEEVAIPKHETVTGD
                     AQSSDIDKSNRTVFLSNVSNEAIKSKSAKKTLLKHFESFLSTLPESTGPHKVESIRFR
                     STAFASGGKIPKRAAFAKREVLDETTPSTNAYIVYSTVQAARKAPVALNGTVVLDRHV
                     RVDSVAHPAPVDNKRCVFVGNLNFVDQEGNADDEEKPKKKKAPADVEEGLWRTFNAHT
                     SKPKDQATRRGNVESVRVVRDSVTRVSKGFAYVQFYDQNCVEEALLLNGKQFPPLLPR
                     KLRVMRAKKQLKKREAGGSTQGKPLREADKTLQGRAGKLFGRAGAAKVRADATKIISN
                     NSLVFEGHRATDNGSSRIRVKTKSRGSKGKPKNRSSKRAAAYKAAGGKKRKTE"
     exon            complement(191542..192922)
                     /number=1
     exon            complement(193855..194002)
                     /number=2
     exon            complement(194754..194910)
                     /number=3
     CDS             complement(join(194968..195170,195180..195647,
                     195701..195785))
                     /codon_start=1
                     /locus_tag="AO090103000066"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000018"
                     /protein_id="BAE65546.1"
                     /transl_table=1
                     /translation="MCRIRAVQHFEFAIKFRDSFIIDPVGLVRRRTPALKLPAIPSQI
                     PVSLLRSNISTKKKRHGWRGHSNLHSSSSLAAASPSSASSRSAASSSPSASSPPPSAP
                     VSRAMSASSSTSLAFRPFRLPFLLFLPLAGAAGKSDSGISSTGVSSSLGLEGSSMGSS
                     SMGSGVSTISSAGGSLSSLLREPRRGSSSSSSSVPISSAELSRLRFFPMPSESADSSS
                     PGVSSPRLGTWLFFERGLLGESSGTCSSSSTSS"
     exon            complement(194968..195170)
                     /number=1
     exon            complement(195180..195647)
                     /number=2
     exon            complement(195701..195785)
                     /number=3
     CDS             complement(join(197830..197981,198038..198108,
                     198165..198997,199052..199400,199455..199699,
                     199744..200151,200218..200541))
                     /codon_start=1
                     /locus_tag="AO090103000067"
                     /note="mRNA cleavage and polyadenylation factor II
                     complex, subunit PTA1"
                     /old_locus_tag="AO070302000019"
                     /protein_id="BAE65547.1"
                     /transl_table=1
                     /translation="MAQSTGSLVDQIAQLNAARTLVLGDAAFYPQIVNGVLPIIGARS
                     RLELRRWGAEFLAETFSSPALAPAQKEQLAAIALQTLRETLELPEKDTVTLKHIVEAA
                     ASLYPLKCAGNQFKPAHWGIVGTDTLDNCSINHPEDSKVWENMTAIKDDILRRWDTSP
                     FSVKVCCIKFVQRVVQVQTHGLTDPRVRTGKKEMPAVPKGKTVDDSQRPEQNETSLAI
                     VPRNHSILSLPYLEAEASGLLDRLLSSIVPCPTNGPVIVSDPLLVNATLNSLAILIRT
                     RQSIGNKIINAILSFVPARQARTPVTPAVRVGVKSMERTARALMINIMKRNPSHPLAS
                     KMQQHIERLMQSRIETVDDSSKKRGLPTEPTDGLDNSKRAKLDAESPPLIKVSPLPPG
                     PVSYSQLYTLTEDAGLSSFDVKQLPVELLVKIVVPVLARVDQSALQQAVDGVRMRYQT
                     LQKQQAAQPPPPATGEEEDDDYEPEYQPMDVPEQAAEQEDALSAEPADLQPDLVSLGP
                     FVLPQPPPLSENEAAEIGRSAVGRVFDMLASSGVAPNTGKGKSQQHLGFSRLAGSTFD
                     RDAWVTLLTRLATRAPAGLEVDHKKNDQDPSSKRPTISDSIRETLYRYILEDFRGRVN
                     VGIMWLNEEWYNDRIQMKFTASQRGEEDEESSVPLHYDQWSLRLLDGFLPYLDSRDTK
                     IFIRFLSEIPEVTIPITKRVASLAKDPERVNLCIQSLLYLIMFRPPAREMCLNAVEDV
                     YQTYEESRPAAGKVLARWRPQSTAVQQAQPEQQSTLVNRTVESENNTPVANGA"
     exon            complement(197830..197981)
                     /number=1
     exon            complement(198038..198108)
                     /number=2
     exon            complement(198165..198997)
                     /number=3
     exon            complement(199052..199400)
                     /number=4
     exon            complement(199455..199699)
                     /number=5
     exon            complement(199744..200151)
                     /number=6
     exon            complement(200218..200541)
                     /number=7
     CDS             complement(join(203547..203817,203880..205008,
                     205059..205652,205747..205827,205954..205977,
                     206050..206179))
                     /codon_start=1
                     /locus_tag="AO090103000069"
                     /note="oligosaccharyltransferase, STT3 subunit"
                     /old_locus_tag="AO070302000021"
                     /protein_id="BAE65548.1"
                     /transl_table=1
                     /translation="MAETPVDALLKGNTGRNTRGLLRIIILVTIAAAAVSSRLFSVIR
                     FESIIHEFDPWFNFRATKYLVQHGFESFWDWFDDRTWHPLGRVTGGTLYPGLMVTSGV
                     IYHILRFLTIPVDIRNICVLLAPAFSGLTAFAMYLLTCEMSISPSAGLLAAAFMGITP
                     GYISRSVAGSYDNEAIAIFLLVFTFFLWIKAVKNGSIMWGALTALFYGYMVSAWGGYV
                     FITNLIPLHVFVLLCMGRYSSRLYISYTTWYALGTLASMQIPFVGFLPIRNSDHMSAL
                     GVFGLIQLVAFADFVRGFIPGKQFQRLLTAMVIIVFGVAFAGLVLLTVSGVIAPWSGR
                     FYSLWDTGYAKIHIPIIASVSEHQPTAWPAFFFDLNLLIWLFPAGVYMCFRDLKDEHV
                     FVIIYAVLASYFAGVMVRLMLTLTPIVCVAAALALSTIIDTYVFASRGPSPQSKAQDE
                     TSAEGLRSTRNPVVGISSYISKAVVTSSVVIYLLLFVAHCTWVTSNAYSSPSVVLASR
                     MPDGSQFIIDDYREAYYWLRQNTPDNAKIMSWWDYGYQIGGMADRPTLVDNNTWNNTH
                     IATVGKAMSSREEVSYPILRQHDVDYVLVVFGGLLGYSGDDINKFLWMVRIAEGIWPD
                     EVKERDYFTARGEYRVDDEATPAMRNSLMYKMSYYNYNALFQQGQAMDRVRGSRLPAE
                     GPQLSTLEEAFTSENWIIRIYKVKDLDNLGRDHNSATAFERGHKRKRATKRKGPRVLR
                     TE"
     exon            complement(203547..203817)
                     /number=1
     exon            complement(203880..205008)
                     /number=2
     exon            complement(205059..205652)
                     /number=3
     exon            complement(205747..205827)
                     /number=4
     exon            complement(205954..205977)
                     /number=5
     exon            complement(206050..206179)
                     /number=6
     CDS             join(206539..206735,206815..206996,207055..207284,
                     207359..207448)
                     /codon_start=1
                     /locus_tag="AO090103000070"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000022"
                     /protein_id="BAE65549.1"
                     /transl_table=1
                     /translation="MDLPPLSKEQLSVVLKSSRSPTELYNILVEYEGEAYLMSTSDSN
                     VSELLSLFYSTFFFAHLLTDQIYEARAMTQRMPQELSQNDPSLQNCLTLLRAVWQRNY
                     ESIYKILRELPWPDFLRPAVESYETYFQEKTLKEVSHAYEAIRPATAANYLGLDTAAA
                     EQGDPAVIQKFTAVGWVWDESTRLLHPKPIPTAPEKDTRLYDEKPGRSDWLNEELRWL
                     RNNRPPGPLNGGNV"
     exon            206539..206735
                     /number=1
     exon            206815..206996
                     /number=2
     exon            207055..207284
                     /number=3
     exon            207359..207448
                     /number=4
     CDS             join(208586..208720,208796..209593,209654..210778)
                     /codon_start=1
                     /locus_tag="AO090103000072"
                     /note="cytoplasmic dynein intermediate chain"
                     /old_locus_tag="AO070302000024"
                     /protein_id="BAE65550.1"
                     /transl_table=1
                     /translation="MSSAMQQRKAEILAKRAKLAELKRQRELRQQEFSQSRANSGDAS
                     EVVSPVPSRADSRAELDDLISRLVDRPGSASISHADGPSRKGSRPNSVISASQVSGDH
                     AEAFIPAARPVSHSIAVQTVGAEPYPTAPAPEPKPEIVTYSKGVQTDDSKQPQGTLSV
                     ESDDEDGQDPTGTGKRLSKKERERDEEIRKKLRAEIEEELLATQQKAEHDAEDDSSKL
                     RYPLRTLDDDELKAVTSSEDFLDFVERSAKVIERALDEEYDVLADYELGGLDGDVEED
                     DEHGKKRRGIREVCQFWDERWSKKRMISDVSFSPKFPELVLAAYTKNPSAPHEPDGLV
                     QIWNQHLQSRPEYVFHSTSDILAAKFSPFHPNLIVGGSYSGQVLLWDTRSSRAGGGAP
                     VQKTPLTGSGHTHPVYSISIIGTQNAHNILTASTDGVVCGWTVDMLSQPQEYLELSTP
                     PPSKTEDLAPTTMSFPQSDPTFFIVGTEEGGIYPCHRYDRAGAKAGTDHRLAYRGHAA
                     PIMSTAFHPARGPVDLGDLMLSSSLDWSVKLWRVRPPATTAPATSAIAATQVVSPILD
                     INREDVVYDARWSPHRPGVFSLVDGAGNLEIWDLYTDTEVPVVRTTPSKGRGGILTSS
                     LNKVAWEEREGRRIATGGLDGVVTVFEVGKGLSGTPEDVPAEEWAGVKRLVGGLEQKD
                     RIN"
     exon            208586..208720
                     /number=1
     exon            208796..209593
                     /number=2
     exon            209654..210778
                     /number=3
     CDS             join(212418..212732,212803..213478,213512..213999)
                     /codon_start=1
                     /locus_tag="AO090103000073"
                     /note="phospholipase C"
                     /old_locus_tag="AO070302000025"
                     /protein_id="BAE65551.1"
                     /transl_table=1
                     /translation="MQWQPPSAPRGPSKPELQPILRPDRVIQEDGLAHIKAGTWSPET
                     PRRPWLRTTLITVLLFIMSIISLLAFFSLALGINGLPHARSSSPSYGKPVNPIKDTPI
                     KNVVVLVEENLSFDVFAGGLTYNAKIDGLVNREYCNPSNASDPFSEKVCAKPIAKNVA
                     PDDPDHSITGGNQQVYSTYHPNAKNDMPGMQGFVTEQIVSYGLGSDLSRAAEVINYYT
                     PDHVPVFNAMAENFVLFDRWFAAVPGPTNPNRAYLTSGTSHGHGQNDHDFDISNLPQV
                     SIFEQLSAAGISWINYSNTTGFLPDSLFYQWTAKSGKGTTNVKSIDQFFNDAKAECCS
                     YMSFHPPSPINMGEGFIKSIYEALRSSPQWNETLFILTFDEHGGFADHVSPPENVPAG
                     DNLTYTETAKDGQEATFHFDRLGIRVPTVLMSPWVGKGVVQNSPADQPNEFTHTSILK
                     YVAELWNLDILTPRVDWSPSFRGLITNTFRETPEKLPEPADF"
     exon            212418..212732
                     /number=1
     exon            212803..213478
                     /number=2
     exon            213512..213999
                     /number=3
     CDS             215166..216932
                     /codon_start=1
                     /locus_tag="AO090103000074"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000026"
                     /protein_id="BAE65552.1"
                     /transl_table=1
                     /translation="MRQHSRMAVAALAAGANAASFTDVCTVSNVKAALPANGTLLGIS
                     MLPSAVTANPLYNQSAGMGSTTTYDYCNVTVAYTHTGKGDKVVIKYAFPKPSDYENRF
                     YVAGGGGFSLSSDATGGLAYGAVGGATDAGYDAFDNSYDEVVLYGNGTINWDATYMFA
                     YQALGEMTRIGKYITKGFYGQSSDSKVYTYYEGCSDGGREGMSQVQRWGEEYDGAITG
                     APAFRFAQQQVHHVFSSEVEQTLDYYPPPCELKKIVNATIAACDPLDGRTDGVVSRTD
                     LCKLNFNLTSIIGEPYYCAAGTSTSLGFGFSNGKRSNVKRQAEGSTTSYQPAQNGTVT
                     ARGVAVAQAIYDGLHNSKGERAYLSWQIASELSDAETEYNSDTGKWELNIPSTGGEYV
                     TKFIQLLNLDNLSDLNNVTYDTLVDWMNTGMVRYMDSLQTTLPDLTPFQSSGGKLLHY
                     HGESDPSIPAASSVHYWQAVRSVMYGDKTEEEALEALEDWYQFYLIPGAAHCGTNSLQ
                     PGPYPENNMEIMIDWVENGNKPSRLNATVSSGTYAGETQMLCQWPKRPLWRGNSSFDC
                     VNDEKSIDSWTYEFPAFKVPVY"
     exon            215166..216932
                     /number=1
     CDS             complement(join(217328..218544,218601..219213))
                     /codon_start=1
                     /locus_tag="AO090103000075"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070302000027"
                     /protein_id="BAE65553.1"
                     /transl_table=1
                     /translation="MASEDCIHEAPQPQGIPYWRLLTDQGVVTSEIIDYPYKGSGTDD
                     DPYIVEWIPNDPRNPMLLNKSLKWAYTITVAFATFGVSLSSSAYAGGIQEVIKHFGIG
                     EEVATLGVSLFVLGFAVGPLVWAPLSELIGRQIVFFVSYGALAFFCAGAAGAQNSWTL
                     IILRFFAGSFGSSPLTNAGGVIADIFPAEERGLATSLFAGAPFLGPTLGPVIGGFLGE
                     NAGWRWVQGFLATFTGLIWIVESLLVPETYAPLLLRKRAARLTTLTGKVHRSKLELER
                     GKVTMTSAFGAALLRPWILLFAEPIVLLLSTYMAIIYGTLYMLFDAFPIVFQQLRGWS
                     EGVGSLPFLGVMIGMMLAVALNMYDNKRYVAIHKAHHGFAPPEARLPPTMLGSIAIPI
                     GLFWFAWTNAPPVHWIVSIIAAAPFGFGMVLVFLNIMSYLIDAYTIYAASVLAANSII
                     RSCFGAGFPLFTTYMYRNLGVHWASCIPAFLALACVPFPFVFYKYGAVIRRKCKYAAE
                     ADDFMRRLAEKTVSLGEEEKAVDEEVRVQAEGRGSADGGQDLGRLESGGRSSLSTMRD
                     GNAGYEANPYDIDRVNTRNSAISRRSRSRSRSAKGRKRGFLGL"
     exon            complement(217328..218544)
                     /number=1
     exon            complement(218601..219213)
                     /number=2
     tRNA            complement(220018..220091)
                     /locus_tag="AO090103t00005"
                     /note="tRNAscan-SE"
                     /product="tRNA-Ile"
     CDS             complement(join(221056..221085,221214..221318,
                     221449..221556,221677..221805))
                     /codon_start=1
                     /locus_tag="AO090103000076"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000028"
                     /protein_id="BAE65554.1"
                     /transl_table=1
                     /translation="MLRVSAIFMACLLLATAAPTAPEKSNACLSMCLQERPACASDEG
                     CWGCCQKIEAVAAPVQRASCLSMCQQEKPNCASDEGCWGCCQKIEPVVPVKKEMCLSM
                     CLQEKPTCASDEGCWGCCQKN"
     exon            complement(221056..221085)
                     /number=1
     exon            complement(221214..221318)
                     /number=2
     exon            complement(221449..221556)
                     /number=3
     exon            complement(221677..221805)
                     /number=4
     CDS             225674..229069
                     /codon_start=1
                     /locus_tag="AO090103000078"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000030"
                     /protein_id="BAE65555.1"
                     /transl_table=1
                     /translation="MSTFRSTLDEADPTSWLKDLETKLIPREKRTGWMKTFQARIRAP
                     PCGTVHVTAGDLFDFIRAQANAGDEMMSRYEQTGRMGDLEEAIKAFRWAVYITPENHP
                     YRAAMLYNYGNMLERRYEKIPDEECLKEAICVSYQVVQLVPKSHPFRLAIMDTYGKKL
                     RLRYKRTQQIEDLEEVIWVSCQAIQAPPTGHPRRARWLNIIGRMLKDRYEHIGQIEDL
                     GLMIKALRSAAQVTYDTCPDLVTYLSDLGYGLTIRYERTGEMKDLAEVLEVFRKVVQA
                     TPDTCPDLANYLTKLGVELTRRYERIGRTEDLAEAIQVFRRAVQTTADTSSDLARYLT
                     NVGSGLTRQYEREGRREDLEEAIELSRRAIRAMPMDSPDLATHLTNLGYRLVLRHERT
                     NKMDDLQEAITLSRQAEEASYNNDSDSTASVGNLGGVLLYGYKRTKQMDHLEEAYQIC
                     RKAVQITPVDDPYYGKWLCNLAHVLTERYEHTRQRKDLEVAIWWSRKSIQASFDGDID
                     LRAQYNNLGTMRVTRYEQTWQFGDLEEAIRISRRAIKATPDDHPYLAGQLKNLGAMLK
                     SQYERTGCLKDLEEAIHVSRKAARITSALPLERISAASLAIRLMLKQEDYNNSYALCV
                     EALDLLQLVCSRHLTLEDQQYVVSHFSGLATLACSLALQVRQPPFRALQLLEAGRSVI
                     FGLIMNDRSNTSKLKAADPTLCALYEELRLGINDPAESSQPQYVDEAVPTRRLQALKK
                     LEKCLHDIRQLPAFDSFQQDLNEEQMKDASLNGSIIVVNITRLRSDAIVVSQAGFSLV
                     PLPGLGAVQAQRWIDQEMTSASSSQRGEMNKRYREFLGWLWYECAEPILTKLGYNVQS
                     SPENLPRTWWIGTGLASSFPFHAARGLRADENDSTSSRVLSSYTTTIKALLHARERVS
                     ASFSPNEQLLNLLMVTMAHTPGEDDLPGVECERSIVLDLLGSSVHVNKLDQPDSASVM
                     RQIGDCHIAHFACHGMSDLADPFQSGLLLQTKTTIPEKEILSVRKLCKQNLPHGEIAY
                     LSACSTAENRAKQLLDEVVHVVNGFQVAGFRHVIGALWPSDDRVCVKVAKLFYTEICR
                     NGVLEYTDRDVALALHKAVSVISTSDDYRKRPLHWAQYVHYGA"
     exon            225674..229069
                     /number=1
     CDS             join(231106..231298,231353..231450,231505..231765,
                     231838..232626)
                     /codon_start=1
                     /locus_tag="AO090103000081"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000033"
                     /protein_id="BAE65556.1"
                     /transl_table=1
                     /translation="MEGKDTEKTPQALCKEQSIPSPTESSQTLDLECEYHDPKLPPVD
                     GGIHAWLFLAACFVVEGTVWGFAACFGVFQNYYRNDPTFQGSHAIAAIGTCAMGMAYL
                     LSPIVMAILIALPRMQRWASSIAFVVLSLSLALSSFSTSVTHLILSQGIAYGTAGCFA
                     YAPSILFMPDWFVKKKSLAFGIVWSGSGLTGIIFPLILQSLLDTYGWQTTLRICSVAI
                     FLLAAPFMLFHKPRIPRKTTNLHQLDLSFHRNRTYLIYQAGNIIQSLGFFLPQIFLPS
                     YAELLGAKGLHASSTITVFNISNMFGCIFIGWLADRYHVTKCILISTVGAIFSTFLLW
                     GMSVHLAPLYLFSIVYGCTGGSFSSSWAATSSEVGKSHPSADVSMVFAFMETGRGIGN
                     VISGPLSEALLKTRLWEGQAWGAYGTEYGILVVLTGVTGLLGGVSVVARALRWI"
     exon            231106..231298
                     /number=1
     exon            231353..231450
                     /number=2
     exon            231505..231765
                     /number=3
     exon            231838..232626
                     /number=4
     CDS             complement(join(233080..234419,234475..234600,
                     234653..234881))
                     /codon_start=1
                     /locus_tag="AO090103000082"
                     /note="amino acid transporters"
                     /old_locus_tag="AO070302000034"
                     /protein_id="BAE65557.1"
                     /transl_table=1
                     /translation="MAIDEVTPAPQVTETAAGNDGDKITIKTGANPLKKFGKKKDGNG
                     NEDVEKDGIGGDTPPQELQRRLKSRHLQMIAIGGTIGTGLFISSGTAIAHSGPAGALI
                     AYIFVGTIVFSVMSSLGEVATYLPISGSFTSYTARLVDPSLGCAMGWIYWFNWASTYA
                     VELTATGLIVQYWDDKLSVAIFIAIFWVVITLLNFLPVGFYGEIEFWFSMIKVLTVLG
                     FMIFAICIDAGVGKQGYLGFHTWKEPGAFAPYLIDASNPVSKFVGFWAVLVQAGFSYQ
                     GTELVGVAAGETENPEKTVPSAIRKTFIRILIFFVLTIFFMGLLVPYDNPNLITDSSD
                     ASASPMVIAAKLAGVKVLPSLINAVLLTVVLSAANSNVYSGSRVLLGLAQEKFAPPIF
                     GWVTHRGVPYISVAFTAAFGLLGFMNVSESGGKVFNWLVNISSVAGFICWTSISLSHL
                     AFMRALKARDISRDTLPYKAALQPYLTWYGLFFSVLIILTQGFTAWIPTFNVSDFFVA
                     YICVIIFVVLYLGHKILYRTHFVHPLEADLQSGRLQNYSWETARPKTWQERLRESL"
     exon            complement(233080..234419)
                     /number=1
     exon            complement(234475..234600)
                     /number=2
     exon            complement(234653..234881)
                     /number=3
     CDS             complement(join(236173..236529,236601..236759))
                     /codon_start=1
                     /locus_tag="AO090103000083"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000035"
                     /protein_id="BAE65558.1"
                     /transl_table=1
                     /translation="MNQFNRTIHRKLIIGVLLCGGVFVMIATLLRCILSLQSINSINT
                     STIWAIRETFVGIIAVNAPCIKPLFSTSTWLGSSEDPYSSSRKKGSYSLSVFGKSKPS
                     HLESTKSTKMGGRSSDEFILHGGGTRTFVNDGQTGRSSSLSDEEAGRHPMGGIQVTTM
                     YEIRRDGSRHG"
     exon            complement(236173..236529)
                     /number=1
     exon            complement(236601..236759)
                     /number=2
     CDS             complement(join(237197..237372,237426..237453,
                     237507..237665))
                     /codon_start=1
                     /locus_tag="AO090103000084"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000036"
                     /protein_id="BAE65559.1"
                     /transl_table=1
                     /translation="MAHATPFQKEAWTEYGIGVIILLLRIVARVRVVGFKNWQGDDYF
                     VFVVLAFWTAELTMLELIGQYGTNIGLDDAQRASLTPEQTEILVRGSKCLLAGWTCYV
                     TLIWSLKACMLFFYNRLT"
     exon            complement(237197..237372)
                     /number=1
     exon            complement(237426..237453)
                     /number=2
     exon            complement(237507..237665)
                     /number=3
     CDS             join(239520..239563,239634..239753,239804..240069,
                     240106..240620,240670..241273,241322..241548)
                     /codon_start=1
                     /locus_tag="AO090103000085"
                     /note="choline dehydrogenase and related flavoproteins"
                     /old_locus_tag="AO070302000037"
                     /protein_id="BAE65560.1"
                     /transl_table=1
                     /translation="MGSTSEDVYDYIICGGGTAGCVVAGRLAENPDVKVLVLEAGQHN
                     KDLENVHMTGGWSNNFDSETDWNIVTTPMKGVDNRQVKLSRGRFLGGCSGCNGTLCVR
                     GSKQDYDDWELEGWSGEEFFAAMRKVYSSQSIRNLIPYLVDNWFQADPQSHGYNGPLH
                     TEPHDLAPISNLLIDSLVSQGMPLHHDMFSTGDVAHGCGHAPRTVHKGIRATAADFIT
                     KDYNRSNVTIQTDTTVDRIVLEEGAAGLRATGVLTRLADGTTRTFHARKEVVVSSGAY
                     CSPAVLMRSGIGAREELDKFDIPCKVDLPGVGKNLMDHLIVFMFYETEKEGLTTDWHV
                     YHDDNMEKTYAQWKEHKTGFLSTFPFGAFAFARLDERLKDEPLWRDAPREPGRDPMGL
                     TPQQPNIEFFTTECYGGPKQYDQFPVDHKHAFSMIAELFAPKSRGTVTLKSKDPLENP
                     IVDCNYLADPMDLLVLTEACRFGNEVVMKGTGTKDIVKGSWPPNLTHHTYTTREEWIP
                     YVKEHATTCYHASGTCAMGKDDNPLAVLDNKLRVKGVAGLRVADCSVMPTLHGGHTQM
                     PAYGIGERCADFIKETWSGQSIARL"
     exon            239520..239563
                     /number=1
     exon            239634..239753
                     /number=2
     exon            239804..240069
                     /number=3
     exon            240106..240620
                     /number=4
     exon            240670..241273
                     /number=5
     exon            241322..241548
                     /number=6
     CDS             complement(243008..243994)
                     /codon_start=1
                     /locus_tag="AO090103000087"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000039"
                     /protein_id="BAE65561.1"
                     /transl_table=1
                     /translation="MKLNLASLSFLASIAPLVSGHYVFSKLIVDGQTTKDFEYIRENS
                     NGYQPTLASEIVNNDFRCNKGSMDSAAKTKVYTVAPGAEIGFQLAYGASMKHPGPLQI
                     YMSKAPGDVKTYDGSGDWFKVYQEGVCEDISDGLKDTDWCTWGKDTASFKIPKDTPPG
                     QYLVRVEHIGLHRGFSGNSEFYFTCAQIEVTGSGSGVPGPLVKIPGMYKPEDPNIHFD
                     IYYPVPTSYDLPGPSVWSGGASSGSSSSISAPPVNNAAAASSVTPTTLVTLSKTSSTP
                     AATSTAAPTLPAPSNGTIKKYYQCGGQGWTGSGSCEAGTTCRDWNPWYSQCV"
     exon            complement(243008..243994)
                     /number=1
     CDS             complement(join(246235..246908,247043..247283))
                     /codon_start=1
                     /locus_tag="AO090103000088"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000040"
                     /protein_id="BAE65562.1"
                     /transl_table=1
                     /translation="MLSLRLSVISVCLAAVNVLSASIRKDSVTKASLPKSFEWSSSGP
                     LISPKNDNYDLAGIKDPSIVEVGGVYHVFASTAKEAAVVWCLVYQNGNAAYSTNSDIS
                     NPDGWSAPKNFFDTMPSIISENIANRNWVDMWTIRDSSDCYLFPSDDNGLLSRSQTSL
                     GSFPNAMGNTVIALQGTNAYALFEVSNVYSTGDGEYLLLVEAIGRDSARYFRSWTSTS
                     LSGTWTSLADTEANPFAQSNNAKFSAPAWTKSISHGEMVRTNVDKTMTISPCNLCYLY
                     QGVDPNASGDYNAMPWKLGLLTQANSAC"
     exon            complement(246235..246908)
                     /number=1
     exon            complement(247043..247283)
                     /number=2
     CDS             complement(248265..248834)
                     /codon_start=1
                     /locus_tag="AO090103000089"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000041"
                     /protein_id="BAE65563.1"
                     /transl_table=1
                     /translation="MSNANNTPSSQPTHAGLSTEEAPSYQTFTDATDKLYKKLVHEES
                     HEWWQYRFVSTFFNLLAIVQVMVGATITALGPFGGQHLIAITVLGAINTVIAGFIALL
                     KGRGLPQRPRKNMLELRRVREYIEQKRTMLQYRNRRFSRDEVDSLLEDVMRRYDLAGE
                     IIERNQPDTYTNAGLTGRERQPDEERGPK"
     exon            complement(248265..248834)
                     /number=1
     CDS             complement(join(250514..250557,250815..251047,
                     251143..251172,251398..251462))
                     /codon_start=1
                     /locus_tag="AO090103000090"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000042"
                     /protein_id="BAE65564.1"
                     /transl_table=1
                     /translation="MKIPAGGSAGNKSSYLGIRTHIGVRGPCGFKYDDNNAFILWQTL
                     FRPIMGANDRGKTYITVSAVLVALSTIVVGFRIVARWMRTTLGMDDYVICVSIILAYS
                     MLGEAVVSFAISESRASSPAV"
     exon            complement(250514..250557)
                     /number=1
     exon            complement(250815..251047)
                     /number=2
     exon            complement(251143..251172)
                     /number=3
     exon            complement(251398..251462)
                     /number=4
     CDS             complement(join(252121..252459,252512..252901))
                     /codon_start=1
                     /locus_tag="AO090103000091"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000043"
                     /protein_id="BAE65565.1"
                     /transl_table=1
                     /translation="MTVTTTTRPTILVIHGAWHHPEFYAPFCRAFEDLGYEAVCPRLL
                     TCNNDVPPTKTLADDVALIRQTAQSLIDDGKSVVAVMHSYGGIVGTDALDGLAIKRLI
                     YMTAFIPPSGNSLAGMFGGQLPPFITIDDEKGMLTVPDPATFFFNDLPAEEAAAWAKK
                     LVVHPKSAQFDPISNEAYRSIPATYIVCEQDAALIPMVQEMMIGNVRKVGVDIDVERL
                     PASHSPFLSMPEETAKLVLKIASQ"
     exon            complement(252121..252459)
                     /number=1
     exon            complement(252512..252901)
                     /number=2
     CDS             complement(join(254216..254269,254333..254563,
                     254617..254745))
                     /codon_start=1
                     /locus_tag="AO090103000092"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000044"
                     /protein_id="BAE65566.1"
                     /transl_table=1
                     /translation="MKAPYFIAFLAAAVSAQNAFIGLPKKDQEITAGENLVVQVQRPN
                     SLTGSEEMGVAIGVASCPERPCMAPKDTLGTLLYNGPFKPEYHDSSPPYQNFTVTIPD
                     SIAKGDAQINVAHVAIVGASAWPYLDLLNQTVVVA"
     exon            complement(254216..254269)
                     /number=1
     exon            complement(254333..254563)
                     /number=2
     exon            complement(254617..254745)
                     /number=3
     CDS             join(259332..259446,259500..259550,259605..259903)
                     /codon_start=1
                     /locus_tag="AO090103000093"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000045"
                     /protein_id="BAE65567.1"
                     /transl_table=1
                     /translation="MKFTLAAASTFITAALAATLPKSFTLVADGGNTVLTDNTNAIVD
                     ASQANTLEILRLKSEDGKTITFTQQQAVNPNSWQNLYAIAGKSKPLGLTIPHSGATPD
                     GAVLNGWGITDDGYLTFNGENNFGLSEDKHQIYFLGEDATVPKVTLWVKELK"
     exon            259332..259446
                     /number=1
     exon            259500..259550
                     /number=2
     exon            259605..259903
                     /number=3
     CDS             complement(join(260443..262003,262010..262542))
                     /codon_start=1
                     /locus_tag="AO090103000094"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000046"
                     /protein_id="BAE65568.1"
                     /transl_table=1
                     /translation="MEKPDLIKELQSDLARKYKLHGPKIEGIWHSLGKAQREKVMRAG
                     AAEGQMLKSPTDRSLGDVYKFIPDWNLRDIADPDSDYLLDCLKHRATKSLPEQYIESA
                     NGGPGDAAVILRSIQVHGLKHVEPFRYSFTLFMDEERYGQSFTVSDREKYKETMAMMK
                     VGVDAGLIVPQSTGELILQSILLTSMNIVIQDILEAGSTVETKARSKKSEKAAREAMS
                     KLIIDQKPEKLSLEDLAALSLDQKSALEDYVLLCRTEPEFLAHAVNAWFFSRPELVAD
                     EKGRRLPLITDKYINIAFFEMIHNAVVGAAVWGYIHQLLQALMTGPNDRTYKSSFLQE
                     LANVCHFEYQRVQRLFKRFVQMGSGDKHFKRVSGVYDNGTARVTMKTKPDTLTRTDPQ
                     LNYILRLCQPDTNASRVVEWVRKLDDLHQTHPAEQDKMVESEFDAFGDLAVTTNFVQC
                     LSTSLPMPPINPKKCQTYVSRIKDVGSELDPLKSEVDLSAFAVPIDNLMEPGMAQGAL
                     TTLDEFISSRIGADIGFLYQDLNEECLSDLQNQAQQQKEKSEQIARAELASSTPEAPN
                     REIQIEQRKEKIKTRPPHSSVYSIAPTAAPATEPEPAAPSQAFKVKPSSLEVFSTLFS
                     NPRPRSSITWAAFQAAMAHMKFSVVPKTGSIYTFSPPEGFNVQRSITLHRPHQSRIEG
                     WRLLYFASRLKRKYG"
     exon            complement(260443..262003)
                     /number=1
     exon            complement(262010..262542)
                     /number=2
     CDS             complement(join(262835..263783,263846..264459))
                     /codon_start=1
                     /locus_tag="AO090103000095"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070302000047"
                     /protein_id="BAE65569.1"
                     /transl_table=1
                     /translation="MDPKPQGTHHEDPVKPANMDHINVVRVPLTEEDSKRIRNKTDRT
                     ILVILMWGYFLQILDKTVLGYGATFGLKEDTHLSGNEYSLVGSIAPIAQLAWQPFSSF
                     LIVKVPHRILLPVLVAGWGVAQAAMAACHNFGGLMATRFFLGLFEAGCLPLFSIITAQ
                     WYRRAEQPLRVAAWYSTNGLATIIAAALSYGLGHIQSGVLKEWQIIFLFVGLITIVSS
                     PFLYWRLDNDIASARFLNDQEKLQAMERLRANQTGAGSREFKVRHVVEAGLEPKTYIW
                     IGMAFLLNVGASVTNVFGPLILSGLGFDKFKTTLLNMPFGALQFIIILLASYLAQKAR
                     LKAVVLASFMLPVVAGLAILYALPRDDSVQGALMAGYYLLSFLFGGNPLIVSWIVANT
                     AGQTKKSIVMSLYNAASSAGNIVGPLLFNENDAPAYQPGLRACLGIFIAMAAIVLIQW
                     ANLFVLNKMQERRRVANGKPAKIVDRSMENNYQVSEEDAEVEAAETDNQVGNNAFLDL
                     TDRENDEFVYIY"
     exon            complement(262835..263783)
                     /number=1
     exon            complement(263846..264459)
                     /number=2
     CDS             join(266674..266750,266842..267034,267111..267413)
                     /codon_start=1
                     /locus_tag="AO090103000096"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000048"
                     /protein_id="BAE65570.1"
                     /transl_table=1
                     /translation="MSRQIDRLAQPANKKKMKVVIASCSRSGTLGLLAAMRILGFSPY
                     HMTEACFSGPVHMKILEEAVIAQHNRFSGIKRYERVDFDKWLSDYDCFIELPSYLGSQ
                     ALEVYAEDPDVKFILTHRDPDKWVTSMDNTIANVVRMATSFPMNILKHFDIILKGFFR
                     LNQVMFWAMSDGTNPGDPNNEAALRRNYVE"
     exon            266674..266750
                     /number=1
     exon            266842..267034
                     /number=2
     exon            267111..267413
                     /number=3
     CDS             complement(join(267802..269287,269340..270171,
                     270224..271214))
                     /codon_start=1
                     /locus_tag="AO090103000097"
                     /note="ankyrin repeat"
                     /old_locus_tag="AO070302000049"
                     /protein_id="BAE65571.1"
                     /transl_table=1
                     /translation="MVDPNEYTVGWICAITTEYVAAQAFLDEKHESSAYLSPQNKNDY
                     TLGRLANHNVVIAVLPIGEYGTSSAARVAETMLHSFPNVRIGLMVGIGGGAPSADHDI
                     RLGDIVVSTPSNNHGGVFQYDYGKTIQGQRFFPTGYLDQPPAVLRAAVNGLQARYEIE
                     GHHLAGDIDQALERNPRLRKKYGRPDPASDRLYQSHIVHPPHDKSNCTISCGDDPSTL
                     VLRNPRTEDEDSPIVHYGLVASANQLMKDACMRDKLTMEKDVLCFEMEAAGLMNHFPC
                     LVIRGICDYSDSHKNKAWQGYAAMAAAAYTKDVLRRISPQHVQAEKKIMEILSTVKTI
                     HETTQDIDRGVKRLRQLGDDQEYQAVINWLTPVNYALQQNDFIARRQEGTGEWFLNST
                     EFKQWLSQSKQTLFCPGMPGAGKTMITATVIDHLYRTYQNKPKTSITYIYCNFRQQHQ
                     QRYTDLLLSLLKQLVQGQPFIPNAVRVLYDECKGRGSRPSHEGILSTLYSVAASYSRL
                     FILIDALDECQVSNEDRERFLRIVFGVQERTKANILVTSRFVHEIEKRFGESIRLEIR
                     ASDMDVQRYIEQRLQSFPSFVLHNPALQAEIKTNLARAVEGMFLLAKLYLDSLVYKTT
                     PKAIRCVLADLEVTSAERSDNGQKSKVLDHAYNQAMERIRGQAPEHQKLANRVLSWIA
                     CATRNLTLSELRHGLAVEFNTPELDEDNMPDIEQAVSVCAGLVIVDEKSNAVRLVHYT
                     TQEYFERTYNEWFFQGHINITKACLTYLSFKDFDGDHFLTPMKMAMRTWSNPLYYYAA
                     LNWGYHARKAYMEEDKLVLDFIHNTSKLLVCGHFIRQGQLGRGLGSVDMESMHLTACL
                     GLSKSMSILLEGSHDVDPRDSLYMTPLLWAAMQGHEAAVKLLLENGADVNSADAWGMT
                     SLSWAAKRGHEAVVKLLLEWSADTEEKTRKGDTPLIMAAEEGHEAVVRALLGGNAIIE
                     ARNKSGYTALLLAVQNGHEAVVSLLLEKGANTEIKGYLDRTPLLIAVENRDDAMVRLL
                     LNKNPNIEARDSKGLTPLSLAAWGGDETVVRRLLERNANINSKCGRGFTAFYLAAKGG
                     HKAVADLLKEARAL"
     exon            complement(267802..269287)
                     /number=1
     exon            complement(269340..270171)
                     /number=2
     exon            complement(270224..271214)
                     /number=3
     CDS             join(271748..271826,271953..272539)
                     /codon_start=1
                     /locus_tag="AO090103000098"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000050"
                     /protein_id="BAE65572.1"
                     /transl_table=1
                     /translation="MDESEAHLLRGICINVSVRHLHTIPDNIKIMSVNSVSLSGSHSV
                     SKTAVPSITLIPNHGVKGDAHAGPTVQHRPLRNARPSDVNLRQVHLMQAEILQQVSKD
                     PATGTKDIVLKPGQLGENITTQGIDLLSLPKDTRLLFVDGKASSQDAPTLRLTGLRNP
                     GPQLDAMKKGLKDRFLVKDSRGVVIGYMAGVMSVVEKGGEIRPGMEIVVQKPATNLAL
                     NCI"
     exon            271748..271826
                     /number=1
     exon            271953..272539
                     /number=2
     CDS             join(273110..273361,273413..273510,273561..273908,
                     273970..274098,274155..274989)
                     /codon_start=1
                     /locus_tag="AO090103000099"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070302000051"
                     /protein_id="BAE65573.1"
                     /transl_table=1
                     /translation="MSLIQALHCEIQPEKRVSAPALASPPSSYSEGPGQQAESRQITL
                     NGNQPPETGQPVFERVPSHGTTQARRLTVTVLLILANLVQMTVNFAGIAGGSTLTSAM
                     GVEGTYASWIGASYALTQGTFVLMSGRLGDVFGHRKLLLIGGAWLSLCVLVGAFCNNF
                     FAFVTMRALAGVGGAFIMPNAVAMISSTNPPGRLRNLSLGFFAASAPLGGYCGAILLG
                     AFLENTDWKWFFVFIAVTFVALWALAPYEPPVDRSGKIDWIGSALGTSSLILFNFVWN
                     QAPSVGWSTPYEIALLPISLILFVSFLVWEKRFAAQPIMPLEIFKAPSFLTLLLVILL
                     NYMAVGTLIWYQVLWLQEVWHWSPLHFAVGWTPFVVCATAAASLAAWLIPRLAAQWIL
                     AIGTVTILVSNALMATVPLQQSYWAQIFPSVVLFSFCPDFVYTAGQIIASNSVRRHQQ
                     GIAGSIIGTLNLYGNSLGLGFASTIEVQVARRFHNQITGYRAALYFGVTISAVALILD
                     VCFVRLVKDEREGWEEEDLLAINEIELQGRAEATGAQLPAAPLRS"
     exon            273110..273361
                     /number=1
     exon            273413..273510
                     /number=2
     exon            273561..273908
                     /number=3
     exon            273970..274098
                     /number=4
     exon            274155..274989
                     /number=5
     CDS             276664..277602
                     /codon_start=1
                     /locus_tag="AO090103000101"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000053"
                     /protein_id="BAE65574.1"
                     /transl_table=1
                     /translation="MADCPSGSCRVRVLTREQKRQEFAYDPAGPQETWQDFKWRILNF
                     TQEYIEHNWDLPFVEEGLHDLWDELIHVAKRHPADSAEHDRLITLILEVREWGTVTRK
                     KKGASADEEPEQVILPNGQRLWVDIPYLVQEFQDAWMKESMGYTAAQREGLAALTARL
                     CAVGVYPSELSCCALWLFKETFETERPLIRVEGEGNATNACVPVVELLPACHAWLKYN
                     SFKLAMFTATNHDYPPPSTGDSVQASTAPGDLVPKSEFPCSGFSIPRWVFWRRRYKHF
                     HHCGNEQIAKLARACFEEAMFRGTRIGIELPGEKYF"
     exon            276664..277602
                     /number=1
     CDS             complement(join(281421..281551,281619..282226,
                     282320..282339))
                     /codon_start=1
                     /locus_tag="AO090103000104"
                     /note="acyl-CoA dehydrogenases"
                     /old_locus_tag="AO070302000056"
                     /protein_id="BAE65575.1"
                     /transl_table=1
                     /translation="MGRRSGMITNGIWSDYTTMAVRTGGPGASGLSVMVVPLKGYPGV
                     TMRRIHVSGTKTAGTTYIELDDVKVPVGNLIGREGDGMRTIMTNFNHERLTIAVQCTR
                     QARVALSSAFGYCLKREAFGKTLMDQPVVRHRLAKAGAELETVSAWIEQILYQLCKLE
                     KVEADRLLGGVTALAKAKAAMVLNECAQCAVLLFGGAGLTQSGQGEIVEAIMRDVPVS
                     RIPGGSEDVLLDLLVRQLVKIYQTQEKKLGQAKI"
     exon            complement(281421..281551)
                     /number=1
     exon            complement(281619..282226)
                     /number=2
     exon            complement(282320..282339)
                     /number=3
     CDS             join(283954..284081,284133..284911,284960..285011,
                     285061..285105,285153..285210)
                     /codon_start=1
                     /locus_tag="AO090103000105"
                     /note="threonine dehydrogenase and related Zn-dependent
                     dehydrogenases"
                     /old_locus_tag="AO070302000057"
                     /protein_id="BAE65576.1"
                     /transl_table=1
                     /translation="MSTMQAVVFQGPLKVTLEQRPVPQIEEPTDVIVKVRYTALCGSE
                     LHVFRGHQPSGTGFIMGHEFTGEIVEVGSAVRGFKVGDLVVSPFTVNCGECFYCARKC
                     SSRCAKGKLYGSVMLDGGQADYARVPSADATLVAAPAAVDEKKLVLMADILPTGFFAA
                     RNAFKGMDRATIEESTVLLFGCGPVGLCALISALDYRPKHLIAVDSVPSRLELAKSLG
                     AEPWNFQTDAEGLKQRVKDLTEGRGADVAIEVVGHSDALRMAFDNLRPWGRISSIGVH
                     NGEIPWTGNEAYGKNLQIQMGRCPVRSIFEDALEFLIRKQDSLGFMVGDIRPLSQAIQ
                     AYDDFNQMKSQKIIFEAGK"
     exon            283954..284081
                     /number=1
     exon            284133..284911
                     /number=2
     exon            284960..285011
                     /number=3
     exon            285061..285105
                     /number=4
     exon            285153..285210
                     /number=5
     CDS             join(285650..285672,285820..286273)
                     /codon_start=1
                     /locus_tag="AO090103000106"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000058"
                     /protein_id="BAE65577.1"
                     /transl_table=1
                     /translation="MIKILHKHPYRIQPNQQPTKQLFKMIDFELSDTQTRVREHAHSF
                     ATKHLETAHTVYTNLLTPQARFSAIRPLYEDLIKAGLIQAQVPAEYNGLGYGLVDMAL
                     LTEELYSADANVALTILATGLGLSPLLIGGTDAQTKRYLSPFTDGKGGTVGKLGTF"
     exon            285650..285672
                     /number=1
     exon            285820..286273
                     /number=2
     CDS             join(287604..287710,287763..287910,287962..288215,
                     288277..288634)
                     /codon_start=1
                     /locus_tag="AO090103000107"
                     /note="Zn-dependent hydrolases, including glyoxylases"
                     /old_locus_tag="AO070302000059"
                     /protein_id="BAE65578.1"
                     /transl_table=1
                     /translation="MNSRQLAKAAIPAYTCPEGTKMHLLDLGSLSCEEGWLFTAGGSA
                     TASNPQRPRKWRDLMVLAGLIDHPEMGLILFETGCAEDIEIKWNPANADVFPRTRYEP
                     EHRLPAAIKAAGYDIKDVKAVIMGHLHLDHAGGLEHFLNTDVPIYVHEEEFKHACWGA
                     GTKAEEGSYLPDYLPLDGSLNWQTFNDSQLDLCTGITLHLCPGHTPGLCIMQVNLPQD
                     GTFIWTTDQFHVRENYEKNHAQGWLLRDHKSWMDSTNFIRRLQRLYSATLIFGHDLEV
                     GTALIQQKPFYQ"
     exon            287604..287710
                     /number=1
     exon            287763..287910
                     /number=2
     exon            287962..288215
                     /number=3
     exon            288277..288634
                     /number=4
     CDS             join(290667..290747,290809..291417)
                     /codon_start=1
                     /locus_tag="AO090103000108"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000060"
                     /protein_id="BAE65579.1"
                     /transl_table=1
                     /translation="MHASLALLLLPLGALSLPFEDSVQTVEASLGRRCGRSPCKGVPS
                     TNTPDALCNNKFLGPKVLTAADDPEWSEMFKGYSPLGSYCPKDFLLEFAPSGKQYDYP
                     EQDGALLDSVGVPVTTEYTLEEGMELDRFGTQYGGYLAPRGTPFAWRSIPPSNLNKYP
                     NSPEYNYWVWRVVESFNVTGGPIAPFFGQPGYGLQFYYEGGLKLLEDQGVIELVDKKQ
                     CSCEVPRDDLK"
     exon            290667..290747
                     /number=1
     exon            290809..291417
                     /number=2
     CDS             join(296567..296663,296733..296977,297028..297477,
                     297566..298144)
                     /codon_start=1
                     /locus_tag="AO090103000109"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000061"
                     /protein_id="BAE65580.1"
                     /transl_table=1
                     /translation="MRMPRGGLLGAIVCLAGIGRVVEALSIDINDADSIKSAASQTAY
                     GSMLWYSGNETGQIPGAFPDKWWEGSALFLSLLYYWHYTGDTTYNAEVSQGMEWQAGN
                     GDYMPANYSSYLGNDDQGFWGIAAMTAAEIGFPDVDDGYSWLSLAQGVFNTQVARWDS
                     SNCGGGLRWQIFPYQAGYAMKNSISNGLLFQLAARLARYTNNQTYTEWAEKVWDWSAS
                     SPLLNNQTWNVADSTDIEGGCKSQGNNQWSYNYGTYLIGAAYMYNMTEKETWKTAVDG
                     LLGVTLNTFFPQDFNYIMSEVLCEPNEVCNDNEILFKGLVSGWLAFVALLVPSTYDEI
                     LPKLQASAQGAAASCSGMSNNTCGVRWHESKWDGWVGMEEQISATDVLSSVLVTEKKG
                     SGPLTSTTGGNSTSNPNAGSGDDSSSDKSQLKSITTGDKAGASIVTIAFVGIWGGLIA
                     FMVLGT"
     exon            296567..296663
                     /number=1
     exon            296733..296977
                     /number=2
     exon            297028..297477
                     /number=3
     exon            297566..298144
                     /number=4
     CDS             join(299072..299114,299171..299884,299927..299934)
                     /codon_start=1
                     /locus_tag="AO090103000110"
                     /note="choline dehydrogenase and related flavoproteins"
                     /old_locus_tag="AO070302000062"
                     /protein_id="BAE65581.1"
                     /transl_table=1
                     /translation="MANNTKEFDFIIVGGGPAGCTIASRLASCSEKPRVLLLEAGKHN
                     DSEDLMVDGQRWTTLQQPGMNWGYTTVSQEYCNGRQLDYSRGRGLGGSTAISFGFWTV
                     GCRGDYDRWADLVDDPRFDWVHMQARFKALESFQTEDAEASYGDYVSPRRDDHGQHGP
                     LKVGYAKLWERDIVPMLDIFRDAGFPITRDLNSGNPLGIGPVINSCYQGRRTTAITLL
                     QNSSNNLTTITECSVERLVLEGKRVIGVEAAGARLD"
     exon            299072..299114
                     /number=1
     exon            299171..299884
                     /number=2
     exon            299927..299934
                     /number=3
     CDS             300439..300903
                     /codon_start=1
                     /locus_tag="AO090103000111"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000063"
                     /protein_id="BAE65582.1"
                     /transl_table=1
                     /translation="MNPQSRGEVTLQSADPTVPLLFNPRFLSHPYDRRVAIESYRDLL
                     KLSAHPSFSKDTIGDLIRPQGDSDEAILEFWRQFVSSTWHMTGTVKMERPDDPDAAVD
                     RSFRVRNLEGLRVADMSVVPVLPNSHTQVTAYLVGATCADVLIEEYDLSYQV"
     exon            300439..300903
                     /number=1
     CDS             complement(join(301172..301534,301585..301782))
                     /codon_start=1
                     /locus_tag="AO090103000112"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000064"
                     /protein_id="BAE65583.1"
                     /transl_table=1
                     /translation="MVDRCNAQDKTIIEHVQIIDLENDAHLPKGRCIEGMLAGNDNWR
                     SPEAHFKGELNKPTDMFSFAIVCIYAILGPVIFGPDDDFRKHEAQGVLPALICLQRQV
                     SYFGDQEGLKGLMKHTDDDEVSCQVLQMLWEERHEEHIPYKLFSEWPDVFDPVFKDFI
                     LGLTSLDPHKRLTARQALDHPWLANF"
     exon            complement(301172..301534)
                     /number=1
     exon            complement(301585..301782)
                     /number=2
     CDS             complement(join(302869..303038,303110..303484,
                     303542..303874,303925..304165))
                     /codon_start=1
                     /locus_tag="AO090103000113"
                     /note="probable taurine catabolism dioxygenase"
                     /old_locus_tag="AO070302000065"
                     /protein_id="BAE65584.1"
                     /transl_table=1
                     /translation="MAPSVADSTTTPVVPIVEGDVSAAKTRTLQREPLKLSGALDSFD
                     SFDVTPVIGREFPSANLAEWLRAPNSDELLRDLAITISQRGVVFFRKQDGLDDDLQKE
                     LIQRLGLLAGKPSTSGLHVHPIHNAGREHNVKDNEISVITSKNHDQLYKGRLHPKKQS
                     ARREWHSDITFEPIPSDYTVLRLTELPKTGGDTLWASGYELYDRISKPYQQFLEGLTA
                     TYAQPGFNRVAKENDFEIFTGPRGAPENVGDKLEAIHPVIRTNPVTGWKSVFAVGVHV
                     AKVNDLSEEESDHLLRWFVSLIVENHDLQVRLRWENPNDLAIWDNRSVYHAATYDYKE
                     KGFGPRTGHRVVGLGERPYFDPKSTSRREALEAEAELS"
     exon            complement(302869..303038)
                     /number=1
     exon            complement(303110..303484)
                     /number=2
     exon            complement(303542..303874)
                     /number=3
     exon            complement(303925..304165)
                     /number=4
     CDS             complement(join(305087..305301,305351..305464,
                     305550..305986,306052..306158,306211..306384,
                     306434..306651,306705..307134))
                     /codon_start=1
                     /locus_tag="AO090103000114"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070302000066"
                     /protein_id="BAE65585.1"
                     /transl_table=1
                     /translation="MPVVHLPTSTTKTPSETVSALKNETDSSSSREIAPLGEPFSGRR
                     LWFQKGQKYDPDAIATQPSVYNNPDIAQEYQPSEDWENLHRFDPSARWTWREEKRVIR
                     KIDARIMIWTAIMFMALELDRANLTQALTDNFLKDLHLTTNDYNLRNTVFKLSFLCAE
                     LPSQLVSKWIGPDRWIPTQMTLWSAVGMTQYGLQGRSSFLACRALLGLLQGGFIPDVI
                     LYLSYFYKSHELSVRLSFFWTAYNLADILASFLAFGLLRLRGVQGQAGWRWLFLIEGL
                     ITLLVGLIAFVLMPPGPCETANWARGKKGWFTPREETIMVNRIIRDDPSKGTMHNREA
                     ITPKLLWKSLCDYDLWPIYAIGLTWLTPMTPPGQYLTLTLRGMGFNTFVTNLLTIPYT
                     FAQIPTMLILTYLSERFGQLTWAAMFTQIWALPFIIYLYVVDINSINKWVAWIILTIF
                     LSIPSVAWNSRNSNTVRSRTVSAAVYNMCVQASGIIASNIYRQDDAPRYKRGNKVLVA
                     LVVTNIFIYLFTKAYYVWRNASRDKKWNAMSEEEKRVYLATTKDEGNKRLDFRFAH"
     exon            complement(305087..305301)
                     /number=1
     exon            complement(305351..305464)
                     /number=2
     exon            complement(305550..305986)
                     /number=3
     exon            complement(306052..306158)
                     /number=4
     exon            complement(306211..306384)
                     /number=5
     exon            complement(306434..306651)
                     /number=6
     exon            complement(306705..307134)
                     /number=7
     CDS             complement(join(307865..308036,308093..308397,
                     308429..308519,308601..308647,308873..309122,
                     309192..309283,309334..309492))
                     /codon_start=1
                     /locus_tag="AO090103000115"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000067"
                     /protein_id="BAE65586.1"
                     /transl_table=1
                     /translation="MSQEKVKVIIAGAGIAGLSVAVALRRLPYIDVELFEQATELREI
                     GASIAISPNGLRSLEKLGVLNALDEDVAFRGPSGIPMIYRHWKTNKVIHQDYFVDVTV
                     RHHETARFHRGHLHAALLEHVPSERIHLGKTVVSADAPNDKVTLHFADGTSAHGDILV
                     GADGIHSVETVGTKGELFRVSTCFDLPVETDGRIRNVKWDDEENVEVLRQRYKIAADE
                     PFLATQDWNPVVKALVNSTPYTRIYPNYAGEPLPTWVFDSRVTLVGDAAHTHGGAFAA
                     GGSLAIDDAYALFLAFRHALGSSRAQKPKAYEVRAALALCWGPGNEHRLRRGVSRKSS
                     EQAKHNMAFRARCGESISKRLTKEICNRRKLGRAGYK"
     exon            complement(307865..308036)
                     /number=1
     exon            complement(308093..308397)
                     /number=2
     exon            complement(308429..308519)
                     /number=3
     exon            complement(308601..308647)
                     /number=4
     exon            complement(308873..309122)
                     /number=5
     exon            complement(309192..309283)
                     /number=6
     exon            complement(309334..309492)
                     /number=7
     CDS             join(310123..310347,310405..310577,310633..310895,
                     310951..311116,311188..311398,311467..311736,
                     311800..311835,311888..312090,314074..314089)
                     /codon_start=1
                     /locus_tag="AO090103000116"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070302000068"
                     /protein_id="BAE65587.1"
                     /transl_table=1
                     /translation="MSKATVTDSVSTVNDVAQLPKLSQRYADESYKLFSKVSVADPTP
                     EEAIKIRNKCLWRVLPFLCIGYHIMYVDKQTLGSSAILGIMDDAHLNSTQYNWLSSIF
                     YFGYLLAEWPQNWALQRFPVAKWLAINLVVWGGITLLHIPCNSFATLFVVRFLLGVAE
                     ASIVPAFLLILSMFFTYQEQAVLMPIMWSIGNASPITSGLLSYGVLWIKTGTFAPWKW
                     FMVITGGVTVMFGLAVWLFFPDNPLRASFLTPEERAQAILRIKDNHSGIEQKHFKKYQ
                     FIEAVKDPKSWLFFLHAWSQEMANGMTNQYSLIINSFGFTVLQTTLLGCVTGIVSFFS
                     LASAAVVLAKTTNCRAWISLIAYIPGAISSILLLSLPWSNRWGLITGIWIRSTVGIPY
                     AVVMIWAANASAGHTKKTTVIAMYHIGYGLGNILSPQLFQPRWKPRYRPTWIILLVVA
                     CILPSLVIVYLRWYLSKENKRRDLLQSETLVTDTGVVEEVDNDGTKHARLVDKNQLDL
                     TDRENLSFLDPV"
     exon            310123..310347
                     /number=1
     exon            310405..310577
                     /number=2
     exon            310633..310895
                     /number=3
     exon            310951..311116
                     /number=4
     exon            311188..311398
                     /number=5
     exon            311467..311736
                     /number=6
     exon            311800..311835
                     /number=7
     exon            311888..312090
                     /number=8
     exon            314074..314089
                     /number=9
     CDS             join(317390..317440,317707..318400,318455..318948)
                     /codon_start=1
                     /locus_tag="AO090103000117"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000069"
                     /protein_id="BAE65588.1"
                     /transl_table=1
                     /translation="MAQHTADKKEHMEAGGKGQGPRSEQDSESNAEHVTHRKNKSKSG
                     GSPPMKPSQIMEEHPEHNPADLGDSEVVHSSTKIEPAQNPRTRDGKVKQMESHIVALA
                     RGITELDNDRKRLQAQVRSARSGSWVTKSSRQIREELSSLEAAMRQWAENYSVAEIRA
                     LDSLSIEEKDAILERLDGYCAQVDWTTLIEKSPTMADKIPALLMQALLAKDIFGSIFA
                     NPFFAFGESKEPSTAHSSQTLSYLYASMLEVNKEEAHIWRSQTLRLLATPPPNSVHNA
                     PLRAKVEAITSELAIEFLAGPVRLLFRHRNDSWAIQRNQELYQLYHTAGELAISLWTQ
                     RSFMRCYCMDELPVFRAEHPVMSAHALHRQHGNDAKLDGKNALIIVHPAIVAFGNEYA
                     EHYDLCKVWAKGIIIVDEHA"
     exon            317390..317440
                     /number=1
     exon            317707..318400
                     /number=2
     exon            318455..318948
                     /number=3
     CDS             join(320434..320781,320845..321166,321229..321992)
                     /codon_start=1
                     /locus_tag="AO090103000118"
                     /note="amine oxidase"
                     /old_locus_tag="AO070302000070"
                     /protein_id="BAE65589.1"
                     /transl_table=1
                     /translation="MASQSNIGSSKTVDVVVIGAGLSGLRAALGVQAAGLSYAVVEAI
                     DRVGGKTLTVPSKKSGPGVNDVGAAWINDTTQSEIYKLVQKYGLQVETQEIPGHDIFQ
                     SPEGCVLFKHGELPVSEEDKAALAQVLAHFNDLVSDVNLEDPGSGPNAKELDSVSLQE
                     YCIQTFQSELIAGLFDTIIQSLIGVEAKDVSLLAFLISLKAGTGFEAVTSDGKNGGQQ
                     LRVRQGNQTISQNMAKELKPGSIHLSSPVTEIKQDPATGACTVHTSNNTTFHAKKVIL
                     SVATPLYKKITFDPPLPEYKQLLVKENKLGYYSKIIFVFDRPFWRAAGLTGAIQSQTG
                     PFTFTMDNSFPDDEQWSIACFTVGRRGREWSQLSQEERRQTAWEQLRSALENTDLPSG
                     EKIKVPEPINVLEYEWTKQDFFLGGPEPGSPPGVISRVGKDAVRKPFGSVHFVGTETA
                     LHWKGYMEGAVRSGDRGAKEVVEALTK"
     exon            320434..320781
                     /number=1
     exon            320845..321166
                     /number=2
     exon            321229..321992
                     /number=3
     CDS             complement(join(323049..323255,323312..324063,
                     324151..324640,324732..324836))
                     /codon_start=1
                     /locus_tag="AO090103000119"
                     /note="cyclopropane fatty acid synthase and related
                     methyltransferases"
                     /old_locus_tag="AO070302000071"
                     /protein_id="BAE65590.1"
                     /transl_table=1
                     /translation="MLQKHPESPPFFDFIVTPETTQTPPKEDCGVRTTTSPAIKNAPL
                     PADGAGNDSWSNLLLFSLLIGVPWFISYQLGGGLYFGIFIAVCTAIPILMAFWTIFSS
                     MSPRMNEKAKLPGRPVEYYLNFHKESDRARYNGKKKIPIEVFYEKYFRGEVEFKNGDC
                     LENLEYRHDWASFSFSWGVFKHFLFGFVPELIVHSRSQDEEQVSGNYDRGDDFYAWFL
                     GPRMIYTSGLIGDINKEESLEQLQDNKLTTVCEKIDLQPGDTMLDIGCGWGTLATFAS
                     VHYKAHVTGITLGRNQTKWGNTTLRNAGIPESQSMIHRLDYRDSPRVPGGYKKITSLE
                     MSEHVGVRHFRGFLKQVHDMLDDDGVFYLQYSGLRKYWQYEDLIWGLFMNKYVFPGAD
                     ASTPLGWVIDQLEGTGFEIKGVDTVGVHYSATLWRWYRNWVANREHVEAKYGPKWYRT
                     WEWFLSWATIVSRQGGATCYQIVLVKNINSTHRVDGIPSQFGISGAIRSAIEKLGKMP
                     SAFIPQATV"
     exon            complement(323049..323255)
                     /number=1
     exon            complement(323312..324063)
                     /number=2
     exon            complement(324151..324640)
                     /number=3
     exon            complement(324732..324836)
                     /number=4
     CDS             join(328114..328237,330056..332325)
                     /codon_start=1
                     /locus_tag="AO090103000120"
                     /note="beta-glucosidase-related glycosidases"
                     /old_locus_tag="AO070302000072"
                     /protein_id="BAE65591.1"
                     /transl_table=1
                     /translation="MPLICIVYFLQYLDKIAISYASVTGLRESANLHGNQFNWVSTST
                     ESIFPDCSTGPLSKNNVCDTSLDPVSRAKSLVAAMTLEEKINNTKYDSSGAPRLGLPA
                     YNWWNEALHGVAEGHGVSFSDSGNFSYATSFPMPILLGAAFDDDLVKQVATVISTEAR
                     AFANGGHAGLDYWTPNINPFRDPRWGRGQETPGEDPLHLSRYVYHLVDGLQDGIGPER
                     PKVVATCKHFAAYDLENWEGIERYAFDAVVSPQDLSEYYLPSFKTCTRDAKVDAVMCS
                     YNSLNGIPTCADRWLLQTLLREHWGWEQTGHWVTGDCGAIDNIYADHHYVADGAHAAA
                     AALNAGTDLDCGSVFPEYLGSALQQGLYNNQTLNNALIRLYSSLVKLGYFDPADDQPY
                     RSIGWNEVFTPAAEELAHKATVEGIVMLKNDGTLPLKSNGTVAIIGPFANATTQLQGN
                     YEGPPKYIRTLIWAAVHNGYKVKFSQGTDINSNSSAGFAEAISAAKEADTVIYAGGID
                     NTIEKESQDRTTIVWPGNQLDLIEQLSDLEKPLIVVQFGGGQVDDSSLLANAGVGALL
                     WAGYPSQAGGAAVFDILTGKSAPAGRLPVTQYPASYVDEVPMTDMTLRPGSNNPGRTY
                     RWYDKAVLPFGFGLHYTTFNVSWNHAEYGPYNTDSVASGTTNAPVDTELFDTFSITVT
                     NTGNVASDYIALLFLTADGVGPEPYPIKTLVGYSRAKGIEPGQSQQVKLDVSVGSVAR
                     TAENGDLVLYPGSYKLEVDVGQDFPTATFTVSGKEKVLDEFPEPQQNATSAVTRRGR"
     exon            328114..328237
                     /number=1
     exon            330056..332325
                     /number=2
     CDS             join(336209..337678,337737..339109,339170..339496,
                     339566..339962)
                     /codon_start=1
                     /locus_tag="AO090103000121"
                     /note="RNA-directed RNA polymerase QDE-1 required for
                     posttranscriptional gene silencing and RNA interference"
                     /old_locus_tag="AO070302000073"
                     /protein_id="BAE65592.1"
                     /transl_table=1
                     /translation="MEVFLHHVPADLNRHGFKRELQPFMKTLRIQDFICEKPRKKRFG
                     TITFLHVDDAERFLQAHGEKPNPLGGFKSNLKLMGVSVCCKSSRYPPKPFALRTLEHE
                     AQERAKGHRERPEESVVFGMQQYSCGRCDFVGEQLTYNPELQWSARGTIKFKTRSMIV
                     HVIPDCRIRIPLSTIVSLIYSTDGTLTVTLSDVPFFFKVIGTSYNSLGIESSRVRLSN
                     LGNGHDQIVGQCLVYQFKVSVVHFRANIEKLKDWEITIYRYNLTTARPLLCSQAVSVE
                     FHKLLSELAECTRNRSVPFGILFQLQALAQNAYLHPTTSRKLAEGLRKRFAEDEAAGR
                     DPITVDGMRKLFNMIGWPFPGDDPRVYEVDFLVATLEANHREIQDGFAYREGLHENTV
                     NMTKVHRVNVTPTRITLHGPEMEPQNRILRKFPNHHEYFIRVQFCDENGEDLLFNANV
                     DYKDIFGRFIDIMTRGIQIAGRTYNFLGFSHSSLRSRAVWFSSPFVDDNGHMQTYFSI
                     VSAIGKFSHITSPARCAARIGQAFTETPFMVPLEKHGVLVSTIPDLTSPDGSRVFSDG
                     VGAISREVVASIWADIPLKRGNPTCFQIRLGGAKGMLAADSRLRTAVIQIRPSMIKFD
                     SEDMKNLEICNMASRPYPMVLNRQVIKILEDMGASKDWFFQMQNEELTRLQSITVSTD
                     KTARFLKDKSVAECIGLYRLYRQCYWTRLNYKKDGFLRAIVEAVVLRELRLLKHKARI
                     PVKKGMTLYGVIDETGFLQEGEVYVTFDRMEGRYAAPPGPGHILVTRSPALHCGDIQR
                     AQNVIPPEDHPLRYHRNCIVFSQKGSRDLPSKLSGGDLDGDLYHVIWDPELESVETFA
                     PADYPRPTSIDIGRDVRVDDMAAFFVEFMRSDILGMIAIRHMVMADQAASGTRDTSCR
                     LLAGLHSKAVDFSKTGIPVNMEDMPRVNRYRPDFLAPGPQTRLYNKSKIGLEQHVSHA
                     NYDDDDDDADVEEPYRYYKSEKILGKLYRAIDEQSIWRKHVLSESETDEEFFWNSVID
                     DCLRRCKSLPRTPKEEHLDEAKRIRAAYDDAIISAMDTYSDHPTKPISELEVVIGSII
                     NRRGVQTRRQRDRSNKLHEEFDRIATWITSIMRRQEIEDPDPNGLELSLACLYHGIQG
                     SDSGHRKEVYGELKSFRVVAACALLAELDHRDKADPKNCFTM"
     exon            336209..337678
                     /number=1
     exon            337737..339109
                     /number=2
     exon            339170..339496
                     /number=3
     exon            339566..339962
                     /number=4
     CDS             complement(340408..341019)
                     /codon_start=1
                     /locus_tag="AO090103000122"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000074"
                     /protein_id="BAE65593.1"
                     /transl_table=1
                     /translation="MSTVQSVSDSRVQEETMKVAGEKLLDRIGPAIVITHSQGGLYGW
                     SWADSRPDLIKALIQIEPKGPPFREAIFSKEFSRPWGLTSIPLSYEPPPSNVSSPLTM
                     KNVPAHSPGLLPCIIQHEPARKLLNLARVPILISTGEASYHAQYDHCFIKFLYQAGVP
                     AEHLELGHAGLHGNGHLQFMEMNSDDIAQVLHDWMLIKVNGTF"
     exon            complement(340408..341019)
                     /number=1
     CDS             join(343113..343168,343219..343615)
                     /codon_start=1
                     /locus_tag="AO090103000123"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000075"
                     /protein_id="BAE65594.1"
                     /transl_table=1
                     /translation="MLMLLPMPWLLRVKTSWTRRLQLVGLFAIGLLLIAIAIVRLPSF
                     DDNTSQLNRNTWGSVEEFLAAFVANVPTLYTLRRRADKSYPTYYSHGASEGRMGGSRH
                     PPHNEGILVTNSVQLEYMVDGRHKSQGSDHNVVRQDSNEQLVGDERWR"
     exon            343113..343168
                     /number=1
     exon            343219..343615
                     /number=2
     CDS             join(346265..346269,347318..347468,347534..347893,
                     347968..348474)
                     /codon_start=1
                     /locus_tag="AO090103000125"
                     /note="voltage-gated shaker-like K+ channel, subunit
                     beta/KCNAB"
                     /old_locus_tag="AO070302000077"
                     /protein_id="BAE65595.1"
                     /transl_table=1
                     /translation="MQLGKSGLKVSKIILGCMSYGSSEWQSWVLNEKDALPLLKHAYD
                     KGINTWDTADIYSHGRSEEIIGKFLRQEQIPRDRVVIMTKFYFGVDDQGRQPPNRATI
                     HNDGQEWVNRVGLSRKHIFDAVEASVRRLGTYIDVLQIHRLDRDTPRKEIMKALNDVV
                     ESGKVRYIGASSMAAWEFQSLQNIALQNGWHQFISMQNLHNLIHREEEREMIPYCLDT
                     GVGLIPWSPLARGVLARPWDSRSTIRETTDTSLKSIIRDRESLADKSIIDRVEEVARR
                     RGITMSQVAIAWSLSHRTENPILGLNSKDRIDEAVAAIGVRLTEDEKRYLEELYIPKS
                     IHPSER"
     exon            346265..346269
                     /number=1
     exon            347318..347468
                     /number=2
     exon            347534..347893
                     /number=3
     exon            347968..348474
                     /number=4
     CDS             348635..349186
                     /codon_start=1
                     /locus_tag="AO090103000126"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000078"
                     /protein_id="BAE65596.1"
                     /transl_table=1
                     /translation="MISHIAFFFASVLAASLGISVNVNSSNLREVYQFPHGTWVENIA
                     VRSNGNLLVTLVNVPEVWEVFPSAQAGASGARLVHHFTNEGMSTSITEHSPDMLALIT
                     PNTVWKMDLNAGREASPVRVATLPGGNLNGMATLDQELGRVAISDSEFGLVWVVIHIL
                     ERSRSSSGTKPHGEYEGRPISSI"
     exon            348635..349186
                     /number=1
     CDS             join(350340..350701,350758..350983,351047..351209,
                     351287..352926)
                     /codon_start=1
                     /locus_tag="AO090103000127"
                     /note="beta-glucosidase-related glycosidases"
                     /old_locus_tag="AO070302000079"
                     /protein_id="BAE65597.1"
                     /transl_table=1
                     /translation="MVQLKSFLLLLNVAIARSALVWDDTYFYGQSPPVYPTPNMSGAG
                     SWGHALSKAQHLVSQMSLEEKVSLTGGSKDSRNGCGGNIPAIDRLGFPGMCLQDGPNG
                     IKGVELVNGYPSGIHVGASWNKSLAYKQAKAIGGEFRRKGATIALGPPVVGPLGRIAL
                     GGRIWEGYTNDPYLSGILAAEAVRGVQDNGVISCAKHFVGNEQELHRNPRPGGPGNRT
                     VEASSSNMDDKTMHELYMWPFADVVHAGVASVMCAYQRLNNSYSCHNSKALNGLLKTE
                     LDFQGFVMSDWGAQHTGIASALAGLDMVMPSGNKYWGAKLIEAVRNGSVPESQITNMA
                     TRIMAAWYLSNQDDPSLPPVGAGIPADFERQHPVIDARDPHDESLLLEGAIQGHVLLK
                     NVDNALPLTNPRILSIYGYDAKAPDSNFAQAGLNDWTLGLESHDSRTVVCGFASIGGD
                     CPDFPPIAINGTIISGGGSAAVTPVYISSPFQALEARARQDKTQLFWDFKGTEAVNSE
                     ADACLVFINAASSEGVDRPALRDDYSDGLVLGIASRCNNTIVVIHNAGVRLIDQWIEH
                     PNVTAVIFAHLPGQDSGEAITQILYGDVSPSGKLPYSLPRNESDYGSLLTPVTFTDWD
                     QLFPQDDFAEGVFIDYRAFDMKGIAPRFEFGYGMTYTTFKYSNLTIRWTVDPSDLSEY
                     PEGPVIPGGNADLWENIAAVTAGITNTGQMEAAEIAQLYVQIPGEGQPLLELRGFDKV
                     AVPPGETRTVDFNIRRRDLSTWDVAAQKWKLSVGAQYPVFVGSSSRKLLLNGTLYL"
     exon            350340..350701
                     /number=1
     exon            350758..350983
                     /number=2
     exon            351047..351209
                     /number=3
     exon            351287..352926
                     /number=4
     CDS             complement(join(353342..353891,353930..354296,
                     354477..355194,355256..355462))
                     /codon_start=1
                     /locus_tag="AO090103000128"
                     /note="choline dehydrogenase and related flavoproteins"
                     /old_locus_tag="AO070302000080"
                     /protein_id="BAE65598.1"
                     /transl_table=1
                     /translation="MDTAYDFVVIGGGTAGLVLASRLSEDPSISVLVLEAGADLTADP
                     RVNIPIFYAALLGSDADWKFQSSPQPGLNGRVLGLNQGKALGGSSSLNAHVFVPPFKG
                     AVDAWEELGNPGWNWSKLKDYFSKVYSSPTVAQDAKENLAIEDWPGLNEAKGPIQTSF
                     GNKTHPIRRAWAELFRSSEQHNAGDPFIHSSVGSFSCLASIDSEGKRSNSASAYYKPA
                     ESRQNLHVLTNSFVERVLFDESKPPRAIGVQYNLDGVSKAVQAKSEVILAAGAFQSPK
                     ILQLSGVGRAELLEQHGIDIVMDLPGVGQNLQEPEAISQAMQEYAATQSGPLASLGVH
                     TYAYLPLPEPDRSALQTLFTNDAPESSQHRATQAYYDIAKTTVLDPRQPSAAYLSALG
                     QTNYPKDLKDGTIPAASLGKFVTLGVMLSQPLSRGSVHIDCEVFFTPDSSHFTCYLPI
                     PPEPSKNRKSIKSDEKNSSTCNNPEKPPIIDSGYLSNPLDLEVMARHMLRIKELAESP
                     QLGELLEQPLKFRDPDADFQGDLDAARKYARDNLVSMWHFAGTCSMLPREKDGVVDSH
                     LKVYGIEGLRVVDASAIPLISTANLQATVYAFAERAADLIKQEWKSK"
     exon            complement(353342..353891)
                     /number=1
     exon            complement(353930..354296)
                     /number=2
     exon            complement(354477..355194)
                     /number=3
     exon            complement(355256..355462)
                     /number=4
     CDS             complement(join(357466..358727,358784..359204,
                     359256..359327))
                     /codon_start=1
                     /locus_tag="AO090103000129"
                     /note="alpha-amylase"
                     /old_locus_tag="AO070302000081"
                     /protein_id="BAE65599.1"
                     /transl_table=1
                     /translation="MSPHAVHTVPSGENNWWKEATVYQVYPASFKDSNGDGWGDIPGL
                     ISKVPYLHSLGVDVVWLSPMYDSPMHDMGYDVSDYENVLPAYGTVEDVERLIDACHER
                     GMKLILDLVINHTSDQHKWFQESRSSKDNDKRDWYFWRPPRYDEQGNRLPPTNYRGYF
                     AGSTWTWDEHTQEYYLHLYAKEQPDLNWDNEATRKAIYDSAVRFWLDKGVDGFRVDTV
                     NKYSKHTDFPDAPVTDPKSYIQPAIQMWCNGPRIHEFLREMYDDALQPYGDVVTIGEL
                     ANTPDPEHVLKYVGASAKQLSMVFHLDIGHIGMGKSLEDKYIFNPWQLTEMKSIVTKW
                     QSFIEGTDGWTTAFCENHDNGRSVSRFASDAPEHRERSAKMLALMMMAMTGTLFLYQG
                     QEIGMINAPRDWSVEEYKDIEGRGYYQEAERQVAAGVDPTRKDRIMDGLRILARDHAR
                     LPMQWDDSSHAGFTTGTPWMRAHDLYPEINVQKQADDPESVLSFWRSVLRLRKEYREL
                     FIHGAFEVVDFDNQQTFCFFKSRDEKKALVALNFTAENQPFTQATTTEGMKLLVSNYA
                     ELLPETLRPFEGRIYISQ"
     exon            complement(357466..358727)
                     /number=1
     exon            complement(358784..359204)
                     /number=2
     exon            complement(359256..359327)
                     /number=3
     CDS             359695..361290
                     /codon_start=1
                     /locus_tag="AO090103000130"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070302000082"
                     /protein_id="BAE65600.1"
                     /transl_table=1
                     /translation="MTTPDAIEANDGAQRKSSLVQGKRAAQQEQSMTLWQAIRLYPKA
                     VGWSVLLSSTLIMEGYDLALLSSMYASPAFNQKFGRQASDGKWTVPASWQSALSNGAR
                     VGEVIGLLINGLVSERLGYRWTMVSALTAMIGVIFLFFFAVNVQMLLAAEILAGIPWG
                     VFQTLPAAYASEVCPVVLRPYLTTFINMCWVFGQFVAVGVNRGSIQRDDQWAWRIPFA
                     VQWAWPLPILIGCLFAPESPWWHVRRGNLSGAKRALLRLTSSDPAFDPDATIAMIQHT
                     NELEMSATKGTRYRDCFQGVNLRRTEVVCGVWLVQTLCGQNLMGYFAYFCVQAGLPTV
                     RSFDLSLVQYALGVIGTLGSWYLMTIAGRRTLHLAGLTSLFTLLIITGSLSFAPDSNS
                     GAKWAIGVMLIIFTFCYDFTIGPVTYCLVSELSSTRLKAKTIVLARAGYNISNIVVNV
                     LTNYQLNDTAWNWSSRSAYFWAGTCLVCLVWSFFRMPEPKGRTYEELDVLFEQRVSAR
                     KFADTVVDPYADAVEVRVDSAKE"
     exon            359695..361290
                     /number=1
     CDS             join(361694..362442,362502..363321)
                     /codon_start=1
                     /locus_tag="AO090103000131"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000083"
                     /protein_id="BAE65601.1"
                     /transl_table=1
                     /translation="MPRETIPQACDACRRRKVKCTSHRPCSPCRSMALVCRSTGSRRK
                     KGRQGRSANVLYELKTNTNSDAIDENQLSGVTPVESPNDIPPTGYVKRSGLLNDGLVQ
                     SCAAYFYSRMLGTVPILHPDKFQEQVERMDECPHAYCLVVAFCAFVLTQTGYLSCHQG
                     TGPDMGRALLDEAMAARRHLDPFSAPIRLGITIAFLLYGCHIGCGNQRQAYYFLREAT
                     TFYTADMLDQSADEDEPCFSGKLFWLLLISERAHAIRRRRPVTLQITSTSPALDTSPI
                     DPFSLGFSHLVDLYRPFDESFLAIWNASQPICTRESLVHLEEHLQRSVPADLDLPDIV
                     LADLRVSQQWLRTMIWQLATTAGFLSSTPTHPSLDFRYPLQIARDLSLATWKLSRESM
                     ETHGVGLIEKIFEVACTLTDVMACLSSTGLRSSGFEMGPQDYLKHLCSLVHSLHGGRK
                     RFLPLLMAKVGHTLPAMVMPISRHLGLEDLGSFDEGEKKGFDAVGDVERDLNWAEMSR
                     IGDMTPDIDDTSLL"
     exon            361694..362442
                     /number=1
     exon            362502..363321
                     /number=2
     CDS             join(365151..365429,365477..366718)
                     /codon_start=1
                     /locus_tag="AO090103000132"
                     /note="cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies"
                     /old_locus_tag="AO070302000084"
                     /protein_id="BAE65602.1"
                     /transl_table=1
                     /translation="MIDAASVVILIIGLIVARLVTNRFRLSGIPGPSLAAYTRLWKLY
                     NAWKGDHHHTEIALHRKYGSLVRIGPRHISVSDPKAIPIIYGVNKGFTKTAFYPIQSI
                     SWDKKPQMNLFSTRDELFHRDRKRPIASAYSMTSILEMEPAVDSYTELFLSQIRKMVE
                     EKAPIDLGMWLQYYAFDVVGELSFAQKLGFLEKGEDVDNMIEAIRGMLTYAMICGQIP
                     EAHKVLLGNPLFPILLPQMETWDQVVVFTLKAINRRASLQRDGDLGKDEIDEAIGGKD
                     MMSRWLAIHNADPTRLSTRDLMVHLSANVFAGSDTTAIALRSILYHLICHPDKMAKVR
                     AEIDTADQEGKLSNPISYQESNTHLPYFGAVMKEAMRLHPSVGGNLERHVPPQGVTIC
                     GHYIPGGTNVGINPWVVHRDPIVFPQPDSFIPERWLDSTPEQLKEMEKAFLNFGAGSR
                     SCIGKAISLMEMRKILPQLLREFDIHLHQNKSWKTRNVWFVQQEEFICDLTPRVRS"
     exon            365151..365429
                     /number=1
     exon            365477..366718
                     /number=2
     CDS             join(367306..367831,367896..368134)
                     /codon_start=1
                     /locus_tag="AO090103000133"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000085"
                     /protein_id="BAE65603.1"
                     /transl_table=1
                     /translation="MSSNPEIEYGFTPVISSARALLSAAKPSTPAPFISVADNPIPKT
                     ALAQRIDLYARSQLPEPTYNHSLRVYHYGLAIKRHVFPSWSFTDETYFLCCLLHDIGS
                     TEENLNKTKLSFEFYGGLLALGVLQDGTGPFGNAVAPRDQAESVAEAIIRHQDLCEEG
                     KITAVGQLLQLATIFDNTGAYADLVHPSTIDEVSRRYPRKQWSTCFAATIRRENELKP
                     WAHATTLGEEAFPSKVLGNSLMEPYEQSDNLEPYIY"
     exon            367306..367831
                     /number=1
     exon            367896..368134
                     /number=2
     CDS             join(368560..369120,369214..369411)
                     /codon_start=1
                     /locus_tag="AO090103000134"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000086"
                     /protein_id="BAE65604.1"
                     /transl_table=1
                     /translation="MSQRSNGPYRLIYWPTIPGRGEFIRLALEEAGADYTDTAHEENG
                     VKTVLSLIDQNFVGDQSGLPPFAPPILEHGDLRISQTPNILLYLAPRLGLAPDGDAIY
                     HVNSLALTALDGLSNEPHDTHHPIAVELYYEDQLEESKRRSESYRKNRLPKFLSYFER
                     VLKPQAAQGRPWLYGETLTYADLVLFQGIDGLKFAFPRALSRLEKSGEYSNVFKLYET
                     VKNRPRIKAYLASDRRLEYSQGIYRHYPELDDAE"
     exon            368560..369120
                     /number=1
     exon            369214..369411
                     /number=2
     CDS             join(372465..372592,372642..372709,372765..372825,
                     372969..373010,373074..373122)
                     /codon_start=1
                     /locus_tag="AO090103000136"
                     /note="FKBP-type peptidyl-prolyl cis-trans isomerase"
                     /old_locus_tag="AO070302000088"
                     /protein_id="BAE65605.1"
                     /transl_table=1
                     /translation="MGVTKTLIAAGDGVNFPKKNETVAMHYRGYLYDPSQPDNKGKQF
                     DNSYDRGQPLKVAIGTGRVIKGWDEGVPQMSLGEKALLTITPGFPNLIPANSTLLFEV
                     QLVAINNKEMPKP"
     exon            372465..372592
                     /number=1
     exon            372642..372709
                     /number=2
     exon            372765..372825
                     /number=3
     exon            372969..373010
                     /number=4
     exon            373074..373122
                     /number=5
     CDS             join(374092..374235,375567..375736,375805..377242)
                     /codon_start=1
                     /locus_tag="AO090103000137"
                     /note="delta 6-fatty acid desaturase/delta-8 sphingolipid
                     desaturase"
                     /old_locus_tag="AO070302000089"
                     /protein_id="BAE65606.1"
                     /transl_table=1
                     /translation="MVDKCGQSMLMSIMPMGSSPPNRCTATRHGVRRDFVVLKQNPIP
                     STASDVILSRRQIEALIAEGQSIIIVNQKVLRVDAWIPYHPGGQKVIQHVVGKDATDE
                     FTIFHCEETRQMSERYQIGRIEGRWANFVPPIQGGVFRSEDEEDDESTILVKEQQDSS
                     STGLEVAAVDSGIHKRGSQPEPREDMATQDEMAFLDTETKEEIKLTLSKYPALDDATQ
                     DEIIAKYRLLHKQIHAEGLYTCNYTAYAWEFARCSLLFSIMLFFLHIGWYNTSALFLA
                     WFWSQMVFAAHDAGHIGITQNFTIDSLIGMTIAAPIGGLSLGWWKRSHNVHHIVTNAP
                     EHDPDNQHLPFLAVNHRFLGNIFSTYHERLLAYDKFAKALVPYQAYLYYIILLFGRFN
                     LYVQSWLFLAKGQGPRKGPAKWHRWYEICGNVIFWLWFGYGILYKSIPTPLSRISFVL
                     ISHMATMPLHVQFTVSHFAMSTTDLGPNESFAQKMLRTTMDVDCPPWLDWVHGGLQFQ
                     AIHHLYPRVPRHNLRRAQALVMEFCRDVGIPYALYGFVGGNRKVLGGLAEVARQAAIL
                     EKCRRTVVERGEFVWGL"
     exon            374092..374235
                     /number=1
     exon            375567..375736
                     /number=2
     exon            375805..377242
                     /number=3
     CDS             join(377941..378155,378223..378728,378802..378998)
                     /codon_start=1
                     /locus_tag="AO090103000138"
                     /note="sterol C5 desaturase"
                     /old_locus_tag="AO070302000090"
                     /protein_id="BAE65607.1"
                     /transl_table=1
                     /translation="MDVLLDILDTYVFDRFYAAILPATNPVTASAGTYNKHIGLYYPL
                     PPSPYADSSTWKRDDIVRQTMSLFLIGWIFATALYLIGSTIIYHTLFDKRVMRHPHFL
                     PNQIRQEIRQGITSIPVIAVLTAPFFLAEVRGWTKLYDFADEAPFRAYNWLQYPLFVC
                     FTDCGIYWIHRGLHYPPVYRWLHKPHHKWIMPSPFASYAFHPVDGWSQSIPYHVYPLL
                     FPLQKSAYLGLFVFVTMWTVFIHDAEYLSQSVVVNGAACHTMHHLYFNYNYGQFLTFW
                     DRLNGTYRTPKEDGFIQNENRKAQALKQA"
     exon            377941..378155
                     /number=1
     exon            378223..378728
                     /number=2
     exon            378802..378998
                     /number=3
     CDS             complement(join(379054..379355,379412..380838,
                     380894..380948,381002..381071))
                     /codon_start=1
                     /locus_tag="AO090103000139"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000091"
                     /protein_id="BAE65608.1"
                     /transl_table=1
                     /translation="MFRCSQCDKSYQRKAHLLRHELTHSGQAASVCPFCKKSFLKPEV
                     ARRHSKACAIKYNQQPAPAAKPGRKRQSCDQCFATKRACDKGSPCSRCQSLGQQCTFE
                     SQQESSIGSPCPTDVSLSPSVQSPTPSKEESQFSFLRHFTDPCVERDRLAIGTTAECS
                     VRRNLESLYSHLEDALVPPDPMAANFGDIPGAEMFFRPPLITDEYFPTDLLSYGPTKL
                     SEQLHELMMELIETSKSMRPDDTEDPQLQLDIAQLAPLFTVSNVAIFISVFFHSLYWH
                     LPVVHFPTFDPGNVSNPLLLSIFLTGATYSSSLDEAALLPRVLDVAEEHVFRKITTLS
                     TQVAPPTHDLTRQIPTIQLLQAALIIEMLQFGQERVETRRRIRIIRHPSLVSLMRCLG
                     IFQLKRSAPPTVCTGDDSTWRALVTEEVCIRLASWVFLADGFLTVCFKNRPTISIFEM
                     ECPFPWRTELWEAENASAFSRIAATDEAKLPMPSVREAIRLLLDNSEPGPLPSSLPLS
                     AEHLLIMIYALNSLAFLARTDFFGSVPLKKIKSAANKWKQIWNSVYQDSNNDQMLLLG
                     YPKHAEELWLLLTTMLDIATENSTKLPYLDNAATDDLGKLNEFIQWCCRDT"
     exon            complement(379054..379355)
                     /number=1
     exon            complement(379412..380838)
                     /number=2
     exon            complement(380894..380948)
                     /number=3
     exon            complement(381002..381071)
                     /number=4
     CDS             join(382600..382946,383012..383411)
                     /codon_start=1
                     /locus_tag="AO090103000141"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000093"
                     /protein_id="BAE65609.1"
                     /transl_table=1
                     /translation="MVSASQLLFCLPVLGALATPTDSTTAQAVARSPEFLEHMGALIA
                     NATGEATLERRDATFKTSKDGVDAAGFYYSLYNANGAGAEYSESENSGQFKLSWNTNS
                     EFLGGKGFKGGSPRSLSWDGQFQAEGDFTLAVYGWTTDPVTEWYVVEAHGTGTPGNGH
                     ILGQVEDDGGIYDVYMLPYRNVPEIYGVTNFNQLWSVRREARHTGTVDVAAHFKRWQE
                     LGLKPGNPVFQMVTAEGFKGSGNLDFTLQK"
     exon            382600..382946
                     /number=1
     exon            383012..383411
                     /number=2
     CDS             complement(384722..385966)
                     /codon_start=1
                     /locus_tag="AO090103000142"
                     /note="WD40 repeat"
                     /old_locus_tag="AO070302000094"
                     /protein_id="BAE65610.1"
                     /transl_table=1
                     /translation="MTMSMNGRKFVQNFTYNLERDFASPAGEPAAWAPGHPKRWGQER
                     AKIGLGGIASTPTLSPDDKLVAVGVNEKILVFDVATQASLEVLTDEKRVESVQFAPGV
                     VDSRDGKHARYLLASQGGSDENPQVIIWELDEKGKLVTTTEPRLVFEGELGSFSPDGK
                     TLVFFSQNETTQEESREAAALPCINLWNIETQSFRHHLLGHTDRIMWAAMSPDNKLVA
                     SVAWDGIARVWDAWSGSCLHVLGPMGGQLWSGAFSPDQEFLAFSQGDPRTYIHVYDIA
                     TGKQVSRFDKLHMATRSLSWRHDGTMLACGADDGTLCIWDPYTGEERMRWCLAFDDFL
                     MCRFANTRAVQFVDGGKKLVFQIREGTVEVYDFERNLKQQFTRGVDDKIDRCPVSEMV
                     CSRDSKFVVVPDMDGSLRVWDL"
     exon            complement(384722..385966)
                     /number=1
     CDS             388191..388898
                     /codon_start=1
                     /locus_tag="AO090103000144"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000096"
                     /protein_id="BAE65611.1"
                     /transl_table=1
                     /translation="MSAFERAKWKTTDGEKFTDTVNRLQNATNLLRGTLRMTREVQLH
                     RMAETNPKMAKEEARETTAETMKANAKPDTCRNGAGCRVIECKYSHPDAEPCRYGAGC
                     TNSNCRFRHPKSRLCRNGAGCRKLGCTFAHPEAPDCRYGVGCTNTLCSFKHPSVPACR
                     DGANCMVDKCKFFHPEVKPCRFGTRCTNKNCTFRHPPPPYTKEPTASAKSMDDKESKE
                     PKSSEKEVRRKLKESPK"
     exon            388191..388898
                     /number=1
     CDS             join(389452..389537,389581..391225)
                     /codon_start=1
                     /locus_tag="AO090103000145"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000097"
                     /protein_id="BAE65612.1"
                     /transl_table=1
                     /translation="MADPIGVAGLALSGISLFFQVYAGTVQGRVHTGIQLMLVARDVP
                     DKYQQLRLRLEIEQGRLLSWGHSFGLLQEESEKEDTSRISIPEQVRYMVQGYIEPLWQ
                     KVLHFTAETPGFVPRDKREETPSVHHGGMARRFRLDRMYAKARQGTIKFKDRVNWAYW
                     QMDKLEDLVECMRHVNGSVIALAEVKTQQEIQETVKATLMGLLSLQDTVNGLKELIVA
                     VEEKRLDNRSSQMPLGEPNDLLLGLANLKKMRLQIGHDKNDGSLQSDLKIQPERVWPM
                     NKMKYPSPQRQDATLDGKKGFWVEYKDYSSSDQIAGPTKDEIERHIVRELAALLISKL
                     PSSFRVAQCVGYYEEAGSFGLVFEKHAAHADQTIIPLSHCLSLETQMPSLGERIALAQ
                     GIVQTLFQLHVVGWLHKGLRPANILLFEDHNGGIAYDKSYISGFEDARPVAQPNLTEE
                     AHSRLLNDDWYRHPDIQTVKPAHREFQYCMRYDLYSLGILLVEIALWKPVLDIQSNVG
                     PGDIKSFILSHNTQCLQRIQFAFGRKYAEIVMNCLNPGEEMDDHTQMDSYIYYFEKLV
                     VKPMKQMSVD"
     exon            389452..389537
                     /number=1
     exon            389581..391225
                     /number=2
     CDS             join(391564..392755,392805..392995,393126..393238,
                     393262..393322)
                     /codon_start=1
                     /locus_tag="AO090103000146"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000098"
                     /protein_id="BAE65613.1"
                     /transl_table=1
                     /translation="MATEWGGQGIGEDPNRPPSYPGQKLCERLSGRQGHWSGKEQVNV
                     EFRPNDVVPLKDDTQVEYKGTYGRVCRSILTVGEETIVVARKEMRLSEVSEEKVNREV
                     KILQSLRHRHLVTFIGSFTARGFASILVYPFATCDLEKLLEELDYAQYHEQKDTVSTL
                     LAELGWIPTTTKAAQWKPGDIFPNLRRICGCVCSALLYLHQHRIRHKDIKPSNVLVGK
                     DGVYITDFNISKAFENDRSSRTMGPYAGTRVYSAPECVYDARSYPSDVYSLGLIFMEI
                     YTYILGRPRSEMGEYTRSNLSLSKDSQIRHAALRVLWVRVIFDGAGRGDFGMSSGMQE
                     LILRMISENQDARPDAFEVLSGLWVYSPSGDFFCNECRKHRGWVGYKGLEKRYQDSLK
                     EKASLEKRSEQAREEVKGGQSGSSPLPQSSERSPSQISVLRSPRTGPTVARNKSGQRL
                     DLDSLSYARHVRRSLRHCGISHARKLLATLEMVASTRNVYMAICAHRVHFGEDMHISD
                     TVPVLSDLLD"
     exon            391564..392755
                     /number=1
     exon            392805..392995
                     /number=2
     exon            393126..393238
                     /number=3
     exon            393262..393322
                     /number=4
     CDS             complement(join(394203..394523,394566..395314,
                     395375..396722,398430..398798))
                     /codon_start=1
                     /locus_tag="AO090103000147"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000099"
                     /protein_id="BAE65614.1"
                     /transl_table=1
                     /translation="MIIETNCSIIAACLPCYGALLRGGQSLASIVRSFLVIHGRASSR
                     SGSSFSSLHSGKHYPIHGVRDLDTDTGSQVELTGPADRWSRTTTQVTIKVSGNAHQHD
                     ECRSPGIVVHTELDISTKGADPRVAPTNDEARVPPFLLFVVSRILHLQSIQQQHKHSV
                     PLPLLQSKLAGRLSLLFLTCTTHPHFHTHILPPFFLLLPDFLPHSPPVTSFSMPLFKK
                     KPKTPPTTNSAAFRSVEHLPSSVAFPGDLDRRFSVSTNEPVPPLPPQHPAHSNVVHRS
                     QSHRRPNTLNNYSVVPPAVAAPPRIVDADPSDQSWQHPPPAERPEEHENPRRSRRNLF
                     SLHSHSSSSQAPRESTGFLERRRSVRKTSPAPQQQEQRPLSVDTAADPHSPSKSREYV
                     VDTTQDPSKSPVLQDQGIPHEPRPPRSPQNPSITRSNTDSTLLEHIYRPSPVEPKHPD
                     ELDPGPVQQQQPQQNQLGLPRPSSRQSLEPPSPLPQPPAYSDHSASQAAMSDRPPSGQ
                     RAPTATPPPGGHSSYPQGNNNQDVTPRNNAAQQPEPGRSTPSSTRMRDEGEIDVRTLV
                     QKHDELQAKYSKVKRYYFEKEAQVQQLQNTVAHQRMAVSRTVLDDNEYANRFGRLDGA
                     IKDLAFAFRKDWKSLPKWLMGYVNDDAHITGTKEMTAIGRAVISRWLVDELFERFFHP
                     ALDPTFSRQLKSIEMNLRRQQANTLTDEDKENAIARISNWRRTTLDGLTDALHGPAAE
                     EHRCQLIDHLVDSLVANLVSYLGDPPPPGLDNGARMIVENAVGIADKVPLESRDVCIE
                     YIHPGTLLHEPNMKVEAGLPPLTNEQLEGPPDEADRESSGSTSQEGAPGGPHPGREPR
                     MRSVISKVMGRRPNQGAAPNPGGNGDMRPPTAMEERNSMGAGRIRFASFITAEVRGRG
                     PMNVLVKAPVYLMD"
     exon            complement(394203..394523)
                     /number=1
     exon            complement(394566..395314)
                     /number=2
     exon            complement(395375..396722)
                     /number=3
     exon            complement(398430..398798)
                     /number=4
     CDS             join(401565..401607,401667..401689,401775..401886,
                     401963..402146,402247..402649)
                     /codon_start=1
                     /locus_tag="AO090103000149"
                     /note="glutathione S-transferase"
                     /old_locus_tag="AO070302000101"
                     /protein_id="BAE65615.1"
                     /transl_table=1
                     /translation="MTKLNTKPITVWLTPSGPNPWKVVLILEELQVPYVIESFRFNDV
                     KLKPYTDICPNGRVPAIVDPNTNLTLWESGAIIQYLEEVYDTDKKLTYESLNKRQLLN
                     QYLHFQMSGQGPYFGQAGWFNVLHHERIPSAIERYNDQVKRFLEVLNTCLEGKAWLVG
                     DKCTFADLSFVPWNCRLDMLLQTPPGEDPLAKYPNVQAWHHRMVDRPSWKRCMEVRDK
                     LMDDQGLMPNGMPKGINNIQEYEAEIAREAAEKGKE"
     exon            401565..401607
                     /number=1
     exon            401667..401689
                     /number=2
     exon            401775..401886
                     /number=3
     exon            401963..402146
                     /number=4
     exon            402247..402649
                     /number=5
     CDS             404629..405615
                     /codon_start=1
                     /locus_tag="AO090103000150"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000102"
                     /protein_id="BAE65616.1"
                     /transl_table=1
                     /translation="MSAIIDRLPLELLELVCDELDTRDLASLVGTCRDTYHRTINRLA
                     QRYTEIHLDFSQDSFNHIHAIANNKVMRQQVHRLVVMTPEPYLGRDLQWQRSAAGHIH
                     NPLQIPAIQRFRDDLVERLTNCRSFVISPVRTKFVPEEEDVNDSEHFNPDDAAGILLE
                     IIADASLPMKLFWYGTGVNYTSNIMDIRRLPKNLFTNPTFKSGWAQLENLHLDHKLTP
                     YNYSFILNMILHAPNLRKIYLSLAPRDMAIEFFSHLSQSPSLPSSLERIALCFTSVRA
                     VDLITILSHSRQTLKRLILDDIGGLSSDGSKLHNQLQGCFPRLETIEFNKCQ"
     exon            404629..405615
                     /number=1
     CDS             join(406123..406390,406451..407184)
                     /codon_start=1
                     /locus_tag="AO090103000151"
                     /note="porphobilinogen deaminase"
                     /old_locus_tag="AO070302000103"
                     /protein_id="BAE65617.1"
                     /transl_table=1
                     /translation="MAESSSVAQPPLRIGTRRSKLAIVQAEGIRDSLQKTAPNRSYEI
                     ETLHTLGDKDKSTALYNFGAKSLWTSELEEKLTSGQLDVIVHCLKDMPTTLPESCDLA
                     AITLRDDPRDALVIKAGLPYTSLQTLPEGAVVGTSSVRRSAQLLRLYPHLRFANLRGN
                     VETRLAKVDNPESEYTCMIMSAAGLERIGLKHRINQYIGSKDGGILHAVGQGALGLET
                     RKGDSSTQELLNKLVDEKSTLACLAERALLRTLEGGCSVPIGVETEWVDQSEYFLRMR
                     AIVVSLDGTQSVQDTIDATVRTKDEATVFGKELATRLVTAGADAILKDINTNRPLKD"
     exon            406123..406390
                     /number=1
     exon            406451..407184
                     /number=2
     CDS             408520..410397
                     /codon_start=1
                     /locus_tag="AO090103000152"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000104"
                     /protein_id="BAE65618.1"
                     /transl_table=1
                     /translation="MISLLQSPVRRYGLLAVTAIILLGTLYRLYFHSNPLPQVIRPSG
                     SSPDNSNPKGKEKETGRYGHDDPEAVPHPIDGLIRNAEQEWDRLLTKKVYNLTDAAAQ
                     YRQRRGRHPPPGFDKWVDLAQQKDAILIEDLFDQLYDDLSPYWALEPKVMRTQASGWE
                     PRIMVRNHTLSSAGHTGVNWLEVWMDLVSTIADFLPDMDIPLNGMDEPRIIIPWETLS
                     EYREKDRASQKLLDPATAVDQYMALPAYDEAHPNEPFKPPFDGPDRPFWEIMRDACPP
                     ESPGRNSNIPHMDFANPPPEFFNYRNFSKTGYIEDFERSKDPCWRAELQALHGSFIEP
                     TSTSTTHELVPLFGGSKLTVNNEILIPPAVYWDDDPRYSGGWKNQGGSWSDKKDIVYW
                     RGIASGGRNRVDTWTGYQRHRLVSMLNGTEVSLTNGSKSAGINFRQPDYQYYNIWAGL
                     DGTLPDYLNEHCDLGFLDLCCFPREDGKHCSYTDPHYKIVEGMPMKKMYQFKYLPDID
                     GNSFSGRYRAFLLSTSLPIKATVYKEWHDSRLIPWAHFVPMDSLYMDIYGIIQYFIGY
                     KGRNGHDGQAEKIALNGKSWAEKVLRQEDMQLYVYRLLLEYARLCDDRRDSLAFVGDL
                     L"
     exon            408520..410397
                     /number=1
     CDS             join(413141..413244,414761..414860,414908..415416,
                     415472..415523,415576..415980,416027..416168,
                     416225..416347,416397..416561,416610..416893)
                     /codon_start=1
                     /locus_tag="AO090103000153"
                     /note="carboxypeptidase C (cathepsin A)"
                     /old_locus_tag="AO070302000105"
                     /protein_id="BAE65619.1"
                     /transl_table=1
                     /translation="MLAEYFKSYILGGFPRRLPPNTCSLADMRQLNWISAVTLASSPF
                     PPEPQGLRTLPSSHVDGASISYKKTQICSTPHLDTYSGYVHLPPRADDAHPHPSNLFF
                     YYAKSAEKRTTPLTIYLGGGPGASSMSSMATEVGPCSVNSDSNSTSPNPWSWTRESDI
                     LFIDQPVQTGFSYDVLTNATIDYSTSTITPTDFDDGVPVANHTFGVGVFGSQDLNGTA
                     NSTTNGARVLWDFMQVWINEFPEYESPDKKIHIWSESFGGRYGPTYAAYFLDQNEKIR
                     NNEVTEISSPSPITIDTLSIHNGCSDITTQGAFYPEYAYNNTYGVQAITETQYEEAKY
                     NWTKPGGCLDMAVQCQELVQKLDPYNFGNNAEVNDVCFAADEYCYENVLAVYALSGRD
                     IHDLAEVPTTTVPLPYSDGFFNRAWVQNALGVPVNYTMNSYTIYNAFWSTGNALITRG
                     NAMDHFSSIMERGVKVNLIYGDRDYLCNWMGGENVSLSIKHDQSAEFSSSGYADLITN
                     KTYVGGVVRQHGNLSFTRVFDAGHTVPAFQPETMFRVFSRIMNSKDIATGNVTLTEKR
                     RETYRTQGPHSTFDRKNKLPSPATPLCYTLDMPTTCTDNQQAALLNGTAIVEDFVVKW
                     PVS"
     exon            413141..413244
                     /number=1
     exon            414761..414860
                     /number=2
     exon            414908..415416
                     /number=3
     exon            415472..415523
                     /number=4
     exon            415576..415980
                     /number=5
     exon            416027..416168
                     /number=6
     exon            416225..416347
                     /number=7
     exon            416397..416561
                     /number=8
     exon            416610..416893
                     /number=9
     CDS             complement(join(416994..417285,417343..417496,
                     417560..418292))
                     /codon_start=1
                     /locus_tag="AO090103000154"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000106"
                     /protein_id="BAE65620.1"
                     /transl_table=1
                     /translation="MVVYRAPESRSPFLTSDEERQSFDFFLHQTRYRFPIDFTDPVLR
                     AAHSDEGLARAIISFGALQQIYECGDDPSLLSPQGQFAMRQYGRALEKVRVWLGNGAK
                     DLSLVCCLLFACFECIRGCRRAAVVHIKSGLDILLQCGEELAWDVVSRDTMISMFIRL
                     DNQLVGLLGTSLSRTLKRDGERGSSILERVALGPNGEYVVQSLHGVLNSIFHDRLDMA
                     LIMEGHSPSVRPVDRRRTSRYLKEWHGGQDPDIMRIWYIIGKMYVAVPPDGSEDAWDQ
                     FRPGFETIVSLVESYLLRTRQLSQKRAFSFDLGIVSPLYIVGVRCRDMSIRRRAIWLL
                     ESCERREILWDSTLAAMAARRVMEFEGSRDIWPKSLGRRVRNVTAVLDDDNGVSIEFE
                     "
     exon            complement(416994..417285)
                     /number=1
     exon            complement(417343..417496)
                     /number=2
     exon            complement(417560..418292)
                     /number=3
     CDS             complement(join(418838..419229,419282..419346,
                     419414..419625))
                     /codon_start=1
                     /locus_tag="AO090103000156"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000108"
                     /protein_id="BAE65621.1"
                     /transl_table=1
                     /translation="MGALCRPLNAFWDRTVKGECFNSTALTYFVNSSNMVTDLVLFAL
                     PIPVIVRVRTTRKKKIALITIFSIGFITCGISAARLAYVVAQGSADITWEGVPLGILS
                     AFESLGGVLCANLPIIYRLFKTAAQKISSSVSGQKSKGSNLQYAYDSRAYGSKSHGRQ
                     NRRSTDSERWIQMPNESDSTEMQTHVQGMSPEMKADGFEMGPIPRDGIAVQREFHTTV
                     EERV"
     exon            complement(418838..419229)
                     /number=1
     exon            complement(419282..419346)
                     /number=2
     exon            complement(419414..419625)
                     /number=3
     CDS             complement(join(419676..419908,419969..420008,
                     420072..420230))
                     /codon_start=1
                     /locus_tag="AO090103000157"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000109"
                     /protein_id="BAE65622.1"
                     /transl_table=1
                     /translation="MATWDGTPSRETLVIVGYTVPTVLLVASTVLRLFAKMSNEGLHL
                     DDHLIILASALEVAYSVTILACGVGHGFGRHTATIDLKDLEIFLKVKAPDDPPDLSLA
                     DNRRRESTSPVTFTTSSLPQPNSASSSYTTAFSLSPGSARQ"
     exon            complement(419676..419908)
                     /number=1
     exon            complement(419969..420008)
                     /number=2
     exon            complement(420072..420230)
                     /number=3
     CDS             join(421628..421683,421724..421963,422098..423106)
                     /codon_start=1
                     /locus_tag="AO090103000158"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000110"
                     /protein_id="BAE65623.1"
                     /transl_table=1
                     /translation="MEKGDDYFASGTPFTMEYRSVMCAVGVTVDDERFNPLRSTVMRL
                     VFRTETAYYAVLMASAHYLRSVESRFELMEIQIRSEVLRGLRRALMKDNLDWEDFCDG
                     SWVKHLACFQLIVKEMAYGHRKAPPVPQFFISYFSAHLVLAKSVFSIDDVLPVGKIPT
                     NSTNHSSLVNSTNTEKVSWTSTKDLAKVMPADTLHEIDMWNGHSGHMLLIINEILSLK
                     HDAQALRHQSSDLSTPQLAVQEKHAAIADKITTLEASLATTTQIIPVSLYKDRTSAES
                     RHGFRLLKSTSEAYRLAAYLLLSEAVSPRFLGYTPASTQSIEQLRDSAQRAQYVDRIF
                     HLASYVVSSVDHLPISWPLWPLFIASCCCSRDEETRTRALEIFGSAREKAPYENIPRA
                     QTLVELLWKRRDMQTESDNSVRIGRFEWESAMESLGWQTSFA"
     exon            421628..421683
                     /number=1
     exon            421724..421963
                     /number=2
     exon            422098..423106
                     /number=3
     CDS             complement(join(423256..423477,423564..423971,
                     424029..424292,424358..424616,424667..424791,
                     424853..424946,425023..425141))
                     /codon_start=1
                     /locus_tag="AO090103000159"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070302000111"
                     /protein_id="BAE65624.1"
                     /transl_table=1
                     /translation="MSDYSSSPGSEPKAPSETVAEHQPLTAMEEKAILRRIDLCLLPL
                     MFVSYLLQYLDKTAMSYTSILGLLPGTHMNTDQYSWASSAFYFGYMVASYPVSIGFVK
                     FPIGKYLSIMMIIWAIILTCHAAASSFAGITTLRVLLGVFESAISPGFTIVIGMWYTP
                     SEHALRSCIWFAGNGVASIFGGVLSYAIGHVHNRLGPWQWVFIIFGIITLVWSIFQFF
                     VLPDSPLNAKFLSPSQRGPAYRRAQACQKTYQSREWKKDQFIEALIDPKTWFLFTYNF
                     LVSLPNGGITNFSSLVIASFGFDTFNTLLYTIPMAAVALIFLLLSAVTCNRFRGLRCY
                     WMIITLLVSLIGILLMRQLPVEKKWSRLVGVWLVTVFGAGFPLSLSLVSSNFAGFTKK
                     STVTAILFIGYCVGNIAGPQLFKKNQAPHYYSAFAAILACFCIAVLDVVLLRVYMVWE
                     NKRRDRKQGRVIEPETKEVEDSGDSTAGKEVGDVSDWQNPNFRFCL"
     exon            complement(423256..423477)
                     /number=1
     exon            complement(423564..423971)
                     /number=2
     exon            complement(424029..424292)
                     /number=3
     exon            complement(424358..424616)
                     /number=4
     exon            complement(424667..424791)
                     /number=5
     exon            complement(424853..424946)
                     /number=6
     exon            complement(425023..425141)
                     /number=7
     CDS             join(425771..426804,427233..427254)
                     /codon_start=1
                     /locus_tag="AO090103000160"
                     /note="imidazolonepropionase and related amidohydrolases"
                     /old_locus_tag="AO070302000112"
                     /protein_id="BAE65625.1"
                     /transl_table=1
                     /translation="MHRMLTDDRLYRVDADLLIPGKGDPIPHGAVVWQCKTIRYAGPR
                     SGVPTEFQGATTTHVPVVMPGMWDCHIHFLGATAATMNAIVDTPQALAGARSVPDLHA
                     TVMAGFTSVREVGGYGCDLAKAVGEGRIPGPNIYSSHSAISMTAGHGDVHGVHRDSLL
                     DLCAHGLPLTIADGVPECLLAVRKQLRRGAKVIKVCASGGVVSAIDDPQHQEFSFEEL
                     KAIVDEAARARRVVAAHCHGKAGIMNALRAGCRTIEHGSFLDEEAVGLMKEKGAILVA
                     TRSVIESGLAMKDLFTPSSYQKLLAVADAHRKAYQLAISRGVTIALGTDQFISSDNPM
                     IGYGRNGHEVSLGSGAR"
     exon            425771..426804
                     /number=1
     exon            427233..427254
                     /number=2
     CDS             join(428195..428445,428499..428746,428882..429186,
                     429241..429555)
                     /codon_start=1
                     /locus_tag="AO090103000161"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000113"
                     /protein_id="BAE65626.1"
                     /transl_table=1
                     /translation="MLSWLLRSLPRFPLGRTWRPLNFSNPNFGRISANQIVEEETLPD
                     YIASRYYPTRIGEIIKDRYQVVGKLGYGTTSTVWLAWDINCRSYVTLKIFIKAASMGK
                     QLDDELKMYQRIDRASKHPGRNAIRSLLDSFHIDGPEDKHHCLVHPPLFESVWEFLHR
                     NPVQRLHIKANNIMFELADNSVFTKFEEDELQNPSPRKELDGRSIYLSRELEMIPGKL
                     GAPVLCDFGSAMLGDVEHLEDVQPDIYRAPEVILEVPWWYSIDIWNVGCMIWNIFEGG
                     SLFTGHDPEFQTYQSRAHLAGIINLLGPPPPSLLARAKQSQKFFSNSGEFREAALLQD
                     LTPLDQRETTLEGEDKESFLRMMRAYDAKDVAVGAGEA"
     exon            428195..428445
                     /number=1
     exon            428499..428746
                     /number=2
     exon            428882..429186
                     /number=3
     exon            429241..429555
                     /number=4
     CDS             complement(join(430498..430750,430808..431325))
                     /codon_start=1
                     /locus_tag="AO090103000162"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000114"
                     /protein_id="BAE65627.1"
                     /transl_table=1
                     /translation="MFRSLSRLTGSLAHLRQRDDREAQRGKAFGVLCDTFTRLKDMSS
                     VYVQPNDFESLPVKIDIKVLPINDVTIEETPRATAHNDSNFFLPLSRESISSKYKMNL
                     ESPEIRKRFSEVNQLTDGNCPALVKIGCWNEEEHLDSIVYQLMWEADVVPRMGTDGNS
                     RPLRVVTGWKSPGFAFEARFEPCLHPYSPPYSEPAYCWVKGGLPHIKIAVYNTSNGDP
                     ILLLRSEVVTIIAAIATRPMDGGLEKHLVIPVRESLLN"
     exon            complement(430498..430750)
                     /number=1
     exon            complement(430808..431325)
                     /number=2
     CDS             complement(join(435610..436538,436588..436930,
                     436983..437253,437309..437553))
                     /codon_start=1
                     /locus_tag="AO090103000165"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070302000117"
                     /protein_id="BAE65628.1"
                     /transl_table=1
                     /translation="MLSSWQKKFLEKSDGPTEANPNPPEYGTNEDIHPGSKRPEEVVN
                     DDVSREDVPDDTAQDGVAQAEAITLTWNKWSLGSAYILMWLLYFVNAFQSSITGNLSA
                     YVTSGFESHSLIPTISVVSSVMSAATYMPLAKILNLWDRSIGFLVMVLFSILGLVLSA
                     TCSNIATYCAAQVFYSIGFAGLIFSIDVITADTSSLRHRGLAYAFTSSPYIITAYAGS
                     AASEHFYESNWRWAYGCFAIVLPVVAFPMFCLLRYNRHLAKKNGLLKPREKSGRTLMQ
                     SIIHYIIEFDLLGTFLLAAGLVLFLLPFTIAGSAEDDWASAHIIVMLVVGFVVLIAFG
                     LSERYLAPVPFLPYEILLSRTVLGACLIDVTYQVAYYCWFDYFTSYLQVVYGTSIATA
                     GYISSIFDVVSGVWLFVVGFLIMKTGRFRWLIQGAVPLYLLGVGLMIYFRNPSWSVGY
                     TIMCQVFLAFAGGTMIICQQVAVQAAADHNHVSSALAFLNCFGNIGGAIGGSISGAIW
                     THTLPDALKRLLPDSIKSDWESIYDDLDVQLSYERGTPERQAIALAYASSQKNMLIAG
                     TAIMALSLIWMFVLRDIKLTKQQSKGILF"
     exon            complement(435610..436538)
                     /number=1
     exon            complement(436588..436930)
                     /number=2
     exon            complement(436983..437253)
                     /number=3
     exon            complement(437309..437553)
                     /number=4
     CDS             438552..442535
                     /codon_start=1
                     /locus_tag="AO090103000166"
                     /note="multidrug/pheromone exporter, ABC superfamily"
                     /old_locus_tag="AO070302000118"
                     /protein_id="BAE65629.1"
                     /transl_table=1
                     /translation="MKLGKKLAGYPSLLLAGNPSKVDIGRLLLGMVASAASGVPFPLI
                     AILFGQLLDDFNAVTCDETESTGSDADYQHDINGKILIIVYLAIAQFVAIYIHLSCWS
                     LNGARLAQRLRETYLQNLLRQEPSFFDDLPPGELASRLNGDIQAIRSGTSEKVGICLS
                     TLSFFITAYVVAFIKDYRLAAMLISLVPAYFLMSFVGSHYIEKYSGRMSDYSATAASI
                     ASEALSNTVVVQAFGASYRLEDKFSKALKASEQEGLKKAAAVGIQSGFLYFIAYSANG
                     LAFWQGSRRVADAVGSDTAGATVGATFTVIFVLVEATLLLSQVAPFLHLFTAAVASYQ
                     KLRADIDRQPQIDATTESGIRLSQAEGGFEFKNVSFTYPSRPEITVLDQISLSIPANK
                     HTALVGLSGSGKSTIAGLVTRLYDPTEGQVLFDGHDLREVNTRDLRSFLSLVQQEPSL
                     LDRSLLENIAHGLINSSNPSHAHLRTTLLSTGLTDLAAEVREGVDLMAAAEKRGSEVV
                     EIVNLVRKAATLADADGFISALQYGYGTLVGSSGRLISGGQKQRVSLARALIKDPAVL
                     ILDEATASLDSRSEQRIQRAISNIATGRTMITIAHRLSTITNADNIIVMHKGHIVEQG
                     DHATLMAKNGAYADLVNLQTLGSAPGKKEKTASADNVSKSDQASLSDAGVEESSVSKD
                     GLETAEKKEVLASAAPVTEPAEPAEEEEEPETPKKSMWALLRGYAPTLRPHLLFIFLA
                     LLGSSIVGGAFSGEAVIFGNTVGSLNPCHSESYIRSAGNFFGLMFFVLAIIEFFANLV
                     SWTGFGWVSEKIVFTVRVLSFRSLFEQDLQWHQSNGRSPALLLSYITRDGNALAGLSG
                     SVIGTLFSITVNLIAAIILTHIIAWRIALVCLALVPLLLGAGLMELHVLGKFEERHEN
                     AYTKSVDIGVEAVTSIKTIASLSLEEDTLRTYRRSLKGPRKETFQVTLHASLWQAMTY
                     FLGNCVNALAYWWGSKQIINGNYTQTQFLIVVFSLLVSALLWSQMFALAPELSAARAA
                     MARILGLIEIGSDKMQGRVPSRSPTISSSEEKDVETAETKSVYVSGNNRASSVQLRNI
                     HFAYPARPDIKVLKGLDVDIHPGQFCALVGPSGAGKSTIISLVERLYTPETGSIVIDG
                     VDVTRHRGVDFRDSIALVPQESVLFEGSIEFNIGLGARPGHEATIEEIKEACKLANIH
                     DVIEALPEGYKTLCGPNGSQFSGGQKQRLSIARALVRKPKLLILDESTSALDAESEKL
                     LQDGLEKAAKGITVIAIAHRLHTIRAADVIFLIEGGKCIDRGSHEELLERSDSYRANV
                     MHQTVAT"
     exon            438552..442535
                     /number=1
     CDS             complement(443363..449134)
                     /codon_start=1
                     /locus_tag="AO090103000167"
                     /note="non-ribosomal peptide synthetase modules and
                     related proteins"
                     /old_locus_tag="AO070302000119"
                     /protein_id="BAE65630.1"
                     /transl_table=1
                     /translation="MLEFTVTQHIKSLVDTVKMCLSNPDASIEACLRPTASDLDAIWK
                     WNHELPPSYNFCMHDVISEQSNRFPDKVAISSWDGELTYGQIEQYSTFVAGSLKKMGV
                     DVHDFIPVCFEKSRWTIVAVLAVMKAGGTLVMMDPTLPLARLQNMAKQVGAKAMVSSR
                     NQHELATTIMSDGKHIVVEADAFAHLSNSEPLPLLPAVPSSALMYIIFTSGSTGTPKG
                     VKISHETYTSSAFPRAKAVGYTEESRVLDFASYAFDVSIDSMLLTLANGGCLCIPSDE
                     DRLNDINEVIRRMKINYAGITPSVARILEPDVIASLSALGLGGEAAAATDVTRWGHDT
                     RIVIGYGPCECTIGCTVNSDTATGRDYISIGTGNGAAIWIADPNDHNVLMPVGAVGEL
                     LVEGPIVGQGYLNDPDKTAAAFIHDPAWLVSGHNGYAGRSGRLYKTGDLGKYDPDGSG
                     GIVFAGRKDTQVKLRGQRVELGEIESQLNARLTAEITVIVEVIKPQSSGGQPTLVAFL
                     ASQSTKKNGDTEIKSAELSDDLRKTLSKADAEIAKVLPRYMVPNAYISVNYIPVLISG
                     KTDRKRLREFGATVDLQQLDQGTNNGPARELTDLEQRLRHGWGQVLKLDPEGIRPNDN
                     FFALGGDSLAAMRLVSVCRAEGLDLSVTGTFGHPTLSAMASVVSIVDSKAKTETPPFS
                     MISQAVESACLEASEACGSDPASVEDIYPCTPTQESLFTFSLKSVKPYIAQRVARIPS
                     HISSDAWKKAWGEVVAASPILRTRVAQLQERGLQQVVLKETISWRSSSDLVQYLETDR
                     RERMSLGESLARYAIVSDPQTETRYMVWTIHHVVYDGWSEPVILKNVSDSLQGQSIET
                     QAQIRDFVKWVRDTDEVAMQEFWRRELKGAVGPQFPRLPTRDYLPVPNAMVERQIPLE
                     TGSGWPFTLATLIRGAWALVASQYTGSDDVVFGETLTGRDISLPGVESIVGPLIATVP
                     IRVRIPRTSSVESYLRDVQQSVVARTPYQHMGMQNIRKVSQDAQHACEAGTGLVIQPE
                     PEYVGSELGFELGDVVREALHFNPYPLMLGCGIRKGGFRICANFDSSLVEIPQMERIL
                     AQLEMACLQLTKGLSRRVDEISCLPEAELDLIWQWNQIAPLSLDESSGRLRANTNIKQ
                     GSVYPPTVVSWVCDPRNPSLLSPIGCVGELWLEGAFLSGDAIESPSWLVAGSSNFRGR
                     TGRVQPTGDMVNLQEDRSLVFVGRKENVVPVHGHAVDIADVESHFSKYLPPNVRAAAA
                     VFQPSSDDTHSVTEQELAVFIEQEPFEQDSVELLSAQYDITCEGSDTQNLSTSVRATI
                     SVSLLVALKRLSKFMQDSLPSYMVPSAYVVLDKLPTDVGEVNHSLLKQLASNIPKHVL
                     TQLREAFQQAWTKNLGQTNMSLPESILRSAWAKILGISPEKIDVDDNFFRLGGDSVLA
                     MKLVSSLRAQGHSLSVADIFQHMRLGDAAKVLKLGQVSQQKVQPYKAFSTLGHLDVEQ
                     FLSEIVRPKLADVTWSIQDVCPVTDSQALDVRATIQGPRTSIQYTMLYLDKSIDREQL
                     FRACNDLVKTHDILRTVFIEHESTFYQVVLNELEVPVAMHQADKDLGPYIKDLCTSHT
                     ESFHLGSSFFKLLHVEGNDGQECLILGLSHAQYDGMSLPRLLQDLETLYTGGKIVDFE
                     PFSAYIARISDEGVQTKAINYWRNLLNGSSLSVLEGTSVQPTDKAIFHTKPVDVSQPL
                     DLDEVTTANLLTAAWALVLACRLQKPDVTFGGVTSGRNIDLANVENVMGPCYQLTPIR
                     VAFQSQWTAMDLLRFVQRQSAESAAHDFLGFNKISKKCTQWSSEATCFDSLVHHQDWD
                     DFDTMPFAGGTCKVDILNPDGDAPYPLKVVSFVRGGQLNVGVAGSERDAAFVDAALDE
                     LAATVKELATRPSEHVLIDGHMF"
     exon            complement(443363..449134)
                     /number=1
     CDS             complement(join(451088..451674,451744..451972))
                     /codon_start=1
                     /locus_tag="AO090103000168"
                     /note="enoyl-CoA hydratase/carnithine racemase"
                     /old_locus_tag="AO070302000120"
                     /protein_id="BAE65631.1"
                     /transl_table=1
                     /translation="MSIEMQHPPVQGCLVSFPAPNILLLTLNRPKQRNSIPLATSAEI
                     QRLWDWFDQESTLQVAIITGTGESFCAGADLKEWNELNARGETNEMTAPGLAGLPRRR
                     GGKPIIAAVNGYCLGGGFEMIVNCDIVVASERASFGLPEVQRGIAAVAGSLPRLVRVL
                     GKQRAAEIALSGLTFPASQLERWGLVNRVVEHGQLVATAVEIASAIAKNSPDSIRVTM
                     EGLHYAWEIASVEEGSTALVDRWYPKLMAGENFHEGVRAFVEKRKPKWRASNL"
     exon            complement(451088..451674)
                     /number=1
     exon            complement(451744..451972)
                     /number=2
     CDS             join(452340..453323,453393..453764)
                     /codon_start=1
                     /locus_tag="AO090103000169"
                     /note="acetyltransferases, including N-acetylases of
                     ribosomal proteins"
                     /old_locus_tag="AO070302000121"
                     /protein_id="BAE65632.1"
                     /transl_table=1
                     /translation="MSLSLAESTPKSKPSYPWVKLPHPYLTSYKIHIVSESTARVLQL
                     QLHDSSLGKPLPEPLHNNSLTYTDVSWDESAKEIPDNDNSPWARTRRAPGISFHWTSP
                     EAPTLGQIWNVIHATFLTHPQYEILRLDLIGSGSEIIRDECIRTGLTVPFPSRRVPFG
                     NENKSSDVNTLVLLRSAFWQGAASPLGPRPIWAVDQDIHGLLRKSVSQYPALAQNYEF
                     SMKFPEERIYARHPIRPTKPTPGSLVYSRYIPHLDKHFSLMAVDWQDEEHLRLFNKWQ
                     NDPRVAKGWNETGTLDEHREYLRRLHEDKHVLCLFGRFDDFKFAYFEVYWAKEDHYGA
                     HYDAADYDRGRHSLVGESSVRGAYRVYAWWGSVIHYIFLDEPRTQAVVGEPKATNTTV
                     LSYENAQGLTIQKYVDLGHKRSVHVHCSREKWFQLCPLFWDGRERPLESSDRMAFDAK
                     L"
     exon            452340..453323
                     /number=1
     exon            453393..453764
                     /number=2
     CDS             join(456577..456630,456691..457698)
                     /codon_start=1
                     /locus_tag="AO090103000170"
                     /note="predicted hydrolases or acyltransferases
                     (alpha/beta hydrolase superfamily)"
                     /old_locus_tag="AO070302000122"
                     /protein_id="BAE65633.1"
                     /transl_table=1
                     /translation="MYSKFWPKGGLPGILHHYTETLVTFEYTTSTVRKPHSLLFVGGL
                     GDGLATTSYMADLAHALQPTEWSLFTLNLTSSYQSWGLGHLDRDTNEIAQCLNYIKEY
                     KTEKFGNGKIVLMGHSTGSQCVVHYLSRPNPHTTTPSFDPTLEHIKRMVLDGAIMQAP
                     VSDREAIKWVLKWGIGGKSPSEVREIYDKVVALAREGVAKDKDSGFDTLLPINLTGTM
                     GYPPNTPISCRRLLSLVSPDSPDSPGEDDMFSSDLSEEQLAKTFGKIKQGGLLKHKLM
                     VLFSGADQSVPDWVDKEQLLEKWRKVTDRDGEAPIWDQEHSAVIPNASHALSNDDQAE
                     PRKFLVEKVMGYLRGAEKA"
     exon            456577..456630
                     /number=1
     exon            456691..457698
                     /number=2
     CDS             complement(459948..461291)
                     /codon_start=1
                     /locus_tag="AO090103000172"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000124"
                     /protein_id="BAE65634.1"
                     /transl_table=1
                     /translation="MFGLGSLLSFFFVFATCLAHPGSLANRAMVTPPSADPFYKPPSG
                     YENTEPGTILRHRRVTNPIALIDPIKLKLAAAYQILYRSTDNWANATATVTTVLVPEN
                     ANTSRLLSYQIPEDSSSVDCAPSYILQTGIDDSDILSKTGIQSHTVLFRAALEKGWIV
                     SLPDHEGPKAAFLANRRAGHAVLDGIRAVLGSSGFTTVSPNASVAMWGYSGGSLATGF
                     AAELQTTYAPDLDMIVGAALGGLIGDIEVVTYTVNKGPFVGLNFGGINGIAHEYPDIA
                     ALFEEQLVESKKAKFYDANHNCFLANIIKYPFQDLFSYFKDPSILSYPQMQQALKDNN
                     LGQNPPKMPIFVYKGALDEISPVSSTEVVVSQYCAGGTVVNYKNVLTHEHILLQLDGF
                     LEAFTWLEKRMDGEAMETDCSRTDELLPISEPGSLGVVVPTVEGVVSDVVGTVLG"
     exon            complement(459948..461291)
                     /number=1
     CDS             join(463173..463400,463438..463474,463535..463626,
                     463676..463760,463812..464204,464233..464503,
                     464527..464857,464933..464998)
                     /codon_start=1
                     /locus_tag="AO090103000173"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000125"
                     /protein_id="BAE65635.1"
                     /transl_table=1
                     /translation="MEVQYILGILHNLDLAIWAVLIFIAFVLVTQAHYKAQLAKLPTF
                     ETDKGNEKWRRTYSDSARMLYQEGHKKVGSYLFKDQAWIMPTSDGRKNVVVPGRLLSE
                     LSKLPETVLSFPTAINKVLEVKYTKVAPDEPFAPYCIKADLNPALSRLNPIIYREVEN
                     ALEDEIPQCEDWTPVFIYRKLLNTVAKVSGRIFVGAELSHNKDYLDTAINYTIELGNA
                     VQAVKQMKPWLRPFLAWKLPEVQQLNKREEMAIRFLEPIIQARREASKDPDTKSPMTC
                     CSGSLLRRIVKMQLLVIFAGIHNTTVTATNVLYNLAVSPEYMQPLREEICKAISDNDG
                     TLTSRALQQVEKLDSFMKETIRFYPQNSLPSRAKRGQYIPPGTSIEAPLQAIYQDDSN
                     YPDSDTFAGFRFYKIRQGGGATVHARNQFVTSNEQNLVFGYGKHACPGRFLAAAEIKM
                     IVSKILLTYGFKNADNWTERYSNYEVGRLNMPERAIPLLFRKTTAQDSSL"
     exon            463173..463400
                     /number=1
     exon            463438..463474
                     /number=2
     exon            463535..463626
                     /number=3
     exon            463676..463760
                     /number=4
     exon            463812..464204
                     /number=5
     exon            464233..464503
                     /number=6
     exon            464527..464857
                     /number=7
     exon            464933..464998
                     /number=8
     CDS             complement(466192..466905)
                     /codon_start=1
                     /locus_tag="AO090103000174"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000126"
                     /protein_id="BAE65636.1"
                     /transl_table=1
                     /translation="METLIRNLILGFKVRTAGFKPDQPLIRVKPNNNDLELTNEFEQA
                     LTDVSNFSMQANFIAQYPDLAPYIRADIRSFAPTLPPSVSLPRPTPSLPVGTQALEPD
                     TLWPQPRLFSQSTMQHPPNPLYSSPYLYPTEGYRKEQTMVCPGSTVPIMGGNRDNQPL
                     FTHSSLDSFSNTGNAETLDLSGLQSGDYFDPNLPRSLPSFNPPVVDNPRDPCTAGSLD
                     LDSWDMFGGGDILQIPPSQ"
     exon            complement(466192..466905)
                     /number=1
     CDS             complement(467028..467603)
                     /codon_start=1
                     /locus_tag="AO090103000175"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000127"
                     /protein_id="BAE65637.1"
                     /transl_table=1
                     /translation="MSINRFTEAIMAWKYSMGLNNGLQLLVEHFKAQGYAAHGKNLNR
                     VPNWLLYFVSDKSNLDVLHERLLSSDFNERLLGLLVGDSDTGASLPCEKQTLLPLSPL
                     DVVRRKTAYLAYRIVAPWQDCCRSHAEMIAIFWTQFRHLLVRFPSPFSRIKAYRNFRS
                     FLSSHLPKTSLDAPAGIDRHPHGFSTTIPDV"
     exon            complement(467028..467603)
                     /number=1
     CDS             complement(467661..468176)
                     /codon_start=1
                     /locus_tag="AO090103000176"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000128"
                     /protein_id="BAE65638.1"
                     /transl_table=1
                     /translation="MPPKRRSANAGRATCPSEEDNPASSTTTSNQSWKLKFNDRQLER
                     KRQADRITQRRMREPSKQTAAAFKEKLELLMDGNHKALVERTLAENEDLVAKVKTFQA
                     KFEQIYLASKECLGLDEGPGRVDTLVSGVTGLPGVPDPCLTSSGLEAPSGSNQDVPVV
                     EQRSNLCRTFA"
     exon            complement(467661..468176)
                     /number=1
     CDS             join(469042..469188,469363..470530,470569..470627)
                     /codon_start=1
                     /locus_tag="AO090103000177"
                     /note="tandem pore domain K+ channel"
                     /old_locus_tag="AO070302000129"
                     /protein_id="BAE65639.1"
                     /transl_table=1
                     /translation="MSNCKKSVQTWGESRNVFELPDPSHSVPSRWWRSASPFPVMAVI
                     AILIAGITIRVSSRMVALKAISLALAALSYITLILTMMCKRNPQQGFIVTISGWLIAG
                     ALLFSLIGVNARRHPIMQSRQPWKYTQSYFYGIMAAGLYTLIAILLAVYTATARSVPL
                     SRHDRRIVEYTSIILRTITFIAFLTGGAGVYSAVEGWSFMDAVYFTDYTVLTIGIGNI
                     VPKTHLGRSLLFPYATAGIITLGLVISSIQSFGNSIRHMKLKFEIQEARNKLLEQKRP
                     THYEHNDSRTLCSIPSTTTFPQTSDVVELQRIRYDFNQRVRWMALIFFVVAWFVLWLL
                     SAAVFRRSERGQNWTYFTALYFTYTSLTTIGYGDFYPTSNFGKVFFVFWSLLAIPVLT
                     NLVTAMGEIGVRTLVYFAGYVLRLGKMRRKSGHGVKNCSDTEPLGNFEEAITGHKYTR
                     DKEHFDD"
     exon            469042..469188
                     /number=1
     exon            469363..470530
                     /number=2
     exon            470569..470627
                     /number=3
     CDS             complement(471277..471984)
                     /codon_start=1
                     /locus_tag="AO090103000178"
                     /note="predicted O-methyltransferase"
                     /old_locus_tag="AO070302000130"
                     /protein_id="BAE65640.1"
                     /transl_table=1
                     /translation="MSTNTTLPTAKEVDSYVVSHLVSTDQALTDTISSCAKSGIPPIA
                     ISPAQGKFLSLLTKMSGAHNVLEIGTLGGYSSIWFARALNANGKKGKVTSIEILEDRR
                     ELAMQNLRNAGVKVPDEAEVLLGPGLEVLPRLEEEIQQGKRPKFDFVFIDADWDNQWQ
                     YFDYGVKLAKGPGAVILIDNVVQAMLGDGIVGPEKRKQGAISVVEKVGQDRRVEAALV
                     QTLGTKSHDGFLMALVV"
     exon            complement(471277..471984)
                     /number=1
     CDS             join(472702..472718,472782..473226,473280..474534,
                     474576..474886,474951..475031,475104..475190)
                     /codon_start=1
                     /locus_tag="AO090103000179"
                     /note="predicted protein"
                     /old_locus_tag="AO070302000131"
                     /protein_id="BAE65641.1"
                     /transl_table=1
                     /translation="MSDPTAKLACDREYPSCTRCRKTGNSDSCSYDDSPAPSRNKQQR
                     SDVLGQNRPVLTAAPAPENAASSAFLESYRDNHNNRPIVSDLTEHAGTWQLIGGDVDG
                     ATTIKERPAIKADVTELTYPPEPKPTEAVVFRGENYKTQYYGSTNPTSLIGHFPELRS
                     YMKETIKHHASLPGVQKELKALDTKWKYEKPHNLPVKTADLLLLLPDQAEMDAAIRLY
                     FDTLETMYRILHRPTFMEEYEQLQQDRTAAKPGFIVLVLLIMATVSCTTATDRTYVGS
                     SSIGRERGSLWIETAEAWLGKQSKKNIYLVIWQIRCLLVLAKQMCRYKKKRMWSVAGD
                     LVREGMAAGFHRDPSRLGGKISFFDQEIRRRLWATMAELELQASVERGMPSALAAIRM
                     DCAPPVDIDDEDLRPECDSTQIQESPSHNTSTSFLHLCRHSLDLRVSLNSRMNDLTSD
                     LPYEDILRYEDMIMSELRKLPSPTESNEDTTDRKLSQMARVVLDLQLRQFLVLLHAPF
                     ARKTEINSRYAVSRMVCFNAAASLIDQHWRLVQSGNPMLLLLRHDYFRGALSLTHYAY
                     VSSGIQAFRWLINMSADLCFPVDHNALLQYIQNALTMLEDSITYLGTGFTYHWYISAA
                     ISFLRSQSQPAKPSALKQEAINQVVRQYYRVLASQEQFPRAKERIYSSRFRQGNPSEA
                     ERHFDVLDPGEMSLDDVGFPQFDPTVPSMDQYFFGDPAAWTFDNLWEVA"
     exon            472702..472718
                     /number=1
     exon            472782..473226
                     /number=2
     exon            473280..474534
                     /number=3
     exon            474576..474886
                     /number=4
     exon            474951..475031
                     /number=5
     exon            475104..475190
                     /number=6
     CDS             complement(join(475360..475573,475659..476213,
                     476275..476395,476451..476625,476693..477805,
                     477885..478391,478442..479512,479569..479805))
                     /codon_start=1
                     /locus_tag="AO090103000180"
                     /note="chitinase"
                     /old_locus_tag="AO070302000132"
                     /protein_id="BAE65642.1"
                     /transl_table=1
                     /translation="MLPIKSLFLVTHFLSFATTTPSPTRFRDYDPKDPCPRQCGLVGT
                     DPQDWAVYYSPDALDGCNRPLLLDFKLDSELDNPNTSVPGLNSSAQNVTLQRIEYDGA
                     SGDSLVAAGAVFHIQRYLEQNVEQDNNVIMFSTSGNATVGFFGGALMDTQRMATSLLP
                     ELIRHITHDGFSNGVLEQICGTRRNAHEVWGIMVSFSASMSTVQETVRTWSQGKCVTP
                     ISPMAGVTSFHSAMIPTTAFNRRPRVLNARTPTLQRRAECSTIKVLEGDSCGTLANRC
                     GVSGADFEKYNTQSNLCSSLQPGQHVCCSAGTLPDFRPKPNPDGSCATYTVLVDESCK
                     SIATANSITLGDLEEFNKKTWGKFSLLLKQCPVQRSCGLVGWNGCGTLWQGAKICISS
                     GDPPMPNSVANAICGPQVPGTEAPTDGQDLASLNPCPLNACCDIWGQCGTTAEFCTYS
                     SSESGAPGTAAPGENGCISNCNANVVSSGPPEEYLRIGYFEGYNLGRACLNMDAGQID
                     TEKYTHIHFGFGTLTEDFNVKVGDALSQFEFEQFKQLTGVKRILSIGGWDFSTSPDTY
                     TTFREGVKSANRMTMAENIANFVEEHDLDGVDIDWEYPGAPDIPGIPPGSADEGVEYA
                     IFLILLKGLLRDKSLSIAAPASYWYLRPYQIAALADVLDYLVFMTYDLHGQWDHSNHW
                     AAPGCEEGNCLRSHVNLTETYSALSMVTKAGMPSNKVITGIASFGRAFKMTTPGCTGP
                     DCHFTGATSGARAGRCTATQGYLSVAEIDEILSTNPSADTWTDDSLSNVLVYNETEWV
                     AYMDDANKADRDILYKGLNFGGTVEWATSMHSFHEVPSDALVPGGSLSDIIKEWPVFV
                     ETVINGKSPFIHGDRNGHWADGSITCTDDAVVGVLDIPPKKRWEDLDCSTAWQDALDK
                     YRQFDLPRNWDFTKSISDTFHGRENMNCGILSAQADCSMSFQCEQSKGEGSGPAGYEV
                     MNSLMFESLYKGIVGAAGVVASKNLEFVNKFAPIPDYTMTFNLFMDTLGLVVPAGMAP
                     VFNNVLSRTAYFSANPAMLDNAKDVVYTMVGSWVNIAKDSNPADYGWDEEDQWEFMGF
                     MTDVWHTWQNETENTSRYLFSGTEDAIRDLSKIIRDGQLIQGSFEGATPPTEMSATEI
                     QALIERAFYGYLIPRIWQSSGTKAFVIDTNHACDGSNPIPDYLDDTNAETTAVCFEDK
                     LYYLAYPDGNAGDTCQLPGSTPVCVPLKFKVPPGLDELTGAVKDYGGMKPVDIVASTV
                     RSYQANGNKNGWTLKSMGDVQSVDDLNLDALITYQIGAAGFSTLPLCSAEEAHLNWGI
                     GKDTDNYPCN"
     exon            complement(475360..475573)
                     /number=1
     exon            complement(475659..476213)
                     /number=2
     exon            complement(476275..476395)
                     /number=3
     exon            complement(476451..476625)
                     /number=4
     exon            complement(476693..477805)
                     /number=5
     exon            complement(477885..478391)
                     /number=6
     exon            complement(478442..479512)
                     /number=7
     exon            complement(479569..479805)
                     /number=8
     CDS             complement(484884..485471)
                     /codon_start=1
                     /locus_tag="AO090103000181"
                     /note="predicted protein"
                     /old_locus_tag="AO070251000032"
                     /protein_id="BAE65643.1"
                     /transl_table=1
                     /translation="MYTIISYATLFLFTFQVYGSNSATDSSNPVPWDSLDLGSIFEDI
                     FGSLIPDGTTNSTSENVGNAIDGIIGLFSTTLVKDVVSSITHMADLFDNQTSFQTKSL
                     IQIGTNELTNETINEVTSLLDSANVLLTADNVESINNLLEEASPLLTEDFLNEINNLL
                     NNTSTLLNFPLSTKPNHSSLRSTRCYPIYPPILPL"
     exon            complement(484884..485471)
                     /number=1
     CDS             complement(join(486301..487246,487294..487499))
                     /codon_start=1
                     /locus_tag="AO090103000182"
                     /note="predicted protein"
                     /old_locus_tag="AO070251000031"
                     /protein_id="BAE65644.1"
                     /transl_table=1
                     /translation="MSDCSSAARVDLAQYEALIIEKHLSFTGANYRAQLLETGADLRR
                     AMNGLTSAIEYFCSQGRAERIPLSVLAYTAVPLVLTAIDVKLSPTPAEMTIRKRRLER
                     LGEIVRHSRMLYDVADYVAAGTNHILQLAYITTQEAFLRCSTNAIGSSQMEIESSSGG
                     MSLDASVFNAKRVTNWYDAFLSSPRAYLRISVSLDYSLATGRLPYDNALPLLVRQTPW
                     AKKQQRLPWTIGLDTDDSAVYPDAPRNGRVTEDISSISQISTIPEEQPVDIPEDDDTE
                     SQGDARFPFIAAIGESIREETLNLAGSSSPEEGSTGDDAINLNFFEFGSQQLDDILEM
                     ETEHTLDADQSQHLGMGASRSGKERADDVGFGHGGFQSIYTSLLRDTVA"
     exon            complement(486301..487246)
                     /number=1
     exon            complement(487294..487499)
                     /number=2
     CDS             complement(join(488026..488137,488190..488467))
                     /codon_start=1
                     /locus_tag="AO090103000183"
                     /note="predicted protein"
                     /old_locus_tag="AO070251000030"
                     /protein_id="BAE65645.1"
                     /transl_table=1
                     /translation="MNSRGSIFSKFIHVFLFWMKQGFGVSLPTPLHIQYHYLFCKLFS
                     FRAALYVYTLSFWSFIPTNTISTSPWKRSTNADSVIDEKLEQHSTIVPSYSSISKQKM
                     THSPKHKAPFSSPTTPPLTILKLAVYG"
     exon            complement(488026..488137)
                     /number=1
     exon            complement(488190..488467)
                     /number=2
     CDS             complement(489388..490248)
                     /codon_start=1
                     /locus_tag="AO090103000184"
                     /note="uncharacterized protein conserved in bacteria"
                     /old_locus_tag="AO070251000029"
                     /protein_id="BAE65646.1"
                     /transl_table=1
                     /translation="MDEKQDITTQNEKANGADEKLLTELENPQKIQKIVREGILLAGG
                     GAAILLQVAMPGVGKGVDEHSNFSYRPLDRLRTTMTYVYCMAFGTPEEKKIIIEMVHK
                     AHSVVRGPDYSADDPHLQVWVAATLYAVGIDLYEQVFGRMDEATAEAIYREYAVLAVS
                     LRVQPEMWPPTREAFWIYWDEQINKLQHQITPQAKNVCKDLLFNKQVPFVIRISMPLV
                     RLMTADLLPDRFREEYGLKTSRSRRGMQKVVRGLTKVVYPATPSFIRTYPMRYYMKDM
                     RKRMKKAQHK"
     exon            complement(489388..490248)
                     /number=1
     CDS             join(491308..491479,491530..491675)
                     /codon_start=1
                     /locus_tag="AO090103000185"
                     /note="predicted protein"
                     /old_locus_tag="AO070251000028"
                     /protein_id="BAE65647.1"
                     /transl_table=1
                     /translation="MSISSNNTAVLNREQFVEALTKAVYSKQFKLSAKGSTTGHLGAL
                     KAPVTLDKDVELAGLDKLSGFSIDTASLILPAEEDGTNLRGTATLPNHSVVTFALVSQ
                     FID"
     exon            491308..491479
                     /number=1
     exon            491530..491675
                     /number=2
     CDS             join(492284..492437,492487..492638)
                     /codon_start=1
                     /locus_tag="AO090103000186"
                     /note="predicted protein"
                     /old_locus_tag="AO070251000027"
                     /protein_id="BAE65648.1"
                     /transl_table=1
                     /translation="MAQISDSINTIQRFTPEDVSKHNTPDNLWTIIGNEIYDLTDFQK
                     EHPGGAKILQAVAGKDGTKKFRKYHREALLVKYKTLLAGELVVQPKGRKWLFFKTSK"
     exon            492284..492437
                     /number=1
     exon            492487..492638
                     /number=2
     CDS             complement(join(493054..493238,493288..493822,
                     493895..494021,494090..494232))
                     /codon_start=1
                     /locus_tag="AO090103000187"
                     /note="alcohol dehydrogenase, class V"
                     /old_locus_tag="AO070251000026"
                     /protein_id="BAE65649.1"
                     /transl_table=1
                     /translation="MDSIPSSQRAVVVQSPGNNYEMIILDDIPVRTPGADEILVKLSC
                     TGLCHSEIRAVLAWGAYNPIIGHEGVGTVIQTGPNVSPSLLHQRVGQKNTSRHVPGTL
                     QQYVIADARFITRIPETVSDEVAAPLLCAGLTMAGAVGRLDDYRLSSGDWVVISGSGG
                     GLGHLGVQIAARIKGFRVIAVDSGEVKRKVSLESGAEVFIDYRTEDVAARVREVTGGE
                     GAHATIVVPGTREAFAMAPQVVRNMGLIVGVGLPPNEMDWPISATVSAARGLCIVGSS
                     VGTEDQMSELLEQAGRGEITPAIEVFEFEETPRLVDRLRNDAIAGRAVVRIPQ"
     exon            complement(493054..493238)
                     /number=1
     exon            complement(493288..493822)
                     /number=2
     exon            complement(493895..494021)
                     /number=3
     exon            complement(494090..494232)
                     /number=4
     CDS             complement(join(496856..496881,496907..497753))
                     /codon_start=1
                     /locus_tag="AO090103000189"
                     /note="predicted protein"
                     /old_locus_tag="AO070251000024"
                     /protein_id="BAE65650.1"
                     /transl_table=1
                     /translation="MATSALSAETLFDSLGQQYEDAYMNNPTLKETVTDAISLLPPQS
                     HVLDVGCGTGKPVASNVALAGHNVHGIDISTAMIKIASSNIKGKFEKADMLTFQPTMK
                     YDAIFSIFSMFQLTHSQTYTKMLNYCDWLKQDGVLVLGTIPATSLVHDETLYDSTGKL
                     VRHADLIFMNHRFTGTLYTTAGWHDLVQKCGFEIVSEKFASFSSPPPYEKEIQDHYFI
                     IAKKVVQHALMAPYPLPTKYRGPHPLSEGAWAPFSERLVRDEFDAVLDILKGNRRVLD
                     VGSGHGIPSPDSTA"
     exon            complement(496856..496881)
                     /number=1
     exon            complement(496907..497753)
                     /number=2
     CDS             join(500506..500746,500791..500894)
                     /codon_start=1
                     /locus_tag="AO090103000191"
                     /note="predicted protein"
                     /old_locus_tag="AO070251000022"
                     /protein_id="BAE65651.1"
                     /transl_table=1
                     /translation="MRSTVQERDQIQVVINACQELTALLTEPYEWIANAAWGYVDSVA
                     LSLVLSLKVHRHVPKNGGTISLVDLAAKTGSSVVLITRQDNATMRGSASSKMNAPTML
                     PSQRAVTVPSAR"
     exon            500506..500746
                     /number=1
     exon            500791..500894
                     /number=2
     CDS             501207..501632
                     /codon_start=1
                     /locus_tag="AO090103000192"
                     /note="predicted protein"
                     /old_locus_tag="AO070251000021"
                     /protein_id="BAE65652.1"
                     /transl_table=1
                     /translation="MAGHYNTPLDDPIESIYPFNVLRDNALVVDIGGGKGHHSIRLAE
                     KYEMMSFIVQDQTSVVETVQTENLPQSVAGRIEWQAHDLHSPQPVQGADVYILSHIMM
                     DNQPGCVKKIDPRYLGAIINACFLLAVPAQIYSDMPQTQ"
     exon            501207..501632
                     /number=1
     CDS             complement(join(502145..502536,502575..502962))
                     /codon_start=1
                     /locus_tag="AO090103000193"
                     /note="2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase"
                     /old_locus_tag="AO070251000020"
                     /protein_id="BAE65653.1"
                     /transl_table=1
                     /translation="MQAANLLQKSLKKGEPSFGGGQMLPGTNLTRTICRSARNLEWLL
                     IDLEHGNISDDSMHEIVAATAACGVSPIVRVAEGQPWMIKRALDSGAHGILVPVTDTA
                     EDARNVVRYSKFPLLEIGVLRVFSRWRKITGMEYLQQANDSLVIAVQIETKAALENVR
                     EIAAVPSVDVLFIGPFDLSVNIGHPITNPEKMDPELVKAIQSIHDAARAAGKASGIYC
                     DTGEQAREYSNKGFQMMSVMTDMVGMRKVFKQAFDAAKGDL"
     exon            complement(502145..502536)
                     /number=1
     exon            complement(502575..502962)
                     /number=2
     CDS             complement(join(504277..504613,504729..504907))
                     /codon_start=1
                     /locus_tag="AO090103000194"
                     /note="predicted protein"
                     /old_locus_tag="AO070251000019"
                     /protein_id="BAE65654.1"
                     /transl_table=1
                     /translation="MAEYLHTGDLGRFEGVLAALWTASFTIMGPEFINLIAAEAKRPR
                     VHIKNAFKVIYWLPSVCGTSASHQRPPHHHDLLGWKYIHVLCEPKSIWPVLGQPCTKN
                     GVPIYCVIVVMCFPLLSLLSLGNGSSQALTWLSNRITAGAIIDYIVVCVTYIFFYRAC
                     QAQSVDRKTFT"
     exon            complement(504277..504613)
                     /number=1
     exon            complement(504729..504907)
                     /number=2
     CDS             complement(505144..505632)
                     /codon_start=1
                     /locus_tag="AO090103000195"
                     /note="amino acid transporters"
                     /old_locus_tag="AO070251000018"
                     /protein_id="BAE65655.1"
                     /transl_table=1
                     /translation="MSDGIEDVSHGTDDYDAQDIEKPGEVVAGTGQLQRRPENRQIQI
                     MGVGGAIGTALFISIGGALPKGGPLSLLLGYAIYCLRLACVNNCLAEMTVLYPVPGGF
                     IRLAGKWVDDAFGFMAGWNFFLFEALSIPFEITAINMVLSFWRDDIPTGAVCGACIAA
                     YA"
     exon            complement(505144..505632)
                     /number=1
     CDS             join(506445..506812,506868..507183,507252..507596)
                     /codon_start=1
                     /locus_tag="AO090103000196"
                     /note="predicted protein"
                     /old_locus_tag="AO070251000017"
                     /protein_id="BAE65656.1"
                     /transl_table=1
                     /translation="MSTTTVRPPTISHTVVGPVRLTGARPTNELPQWLIDEAKIEEKQ
                     SFDPKMHMNYHPPSKIYTMKEIGLEGQGISPNAVTAPFQLFNEEAIKQMRAEIFSRPV
                     LDECQYTSSFVKNTIRGMGPARAPFIYDVWRSPEVLAKISEVAGIDLIPAMNYEIAAI
                     NISVNDQTTTVLNNTKSEDEDLSAFAWHWDSYPFVCVTMLSDYTGMVGGETALKTASD
                     EIMKVRGPAMGTAVVMQGRYIEHQALKAFGGKERISMITSFRAKSPLVKDDCVLTGVR
                     SISNVLELYREWSEYRLKVLEERIRAELENERQKQLGQRPFSISDMKTFLIHQREYLD
                     ATIAELME"
     exon            506445..506812
                     /number=1
     exon            506868..507183
                     /number=2
     exon            507252..507596
                     /number=3
     CDS             join(509756..509887,509950..510130,510186..510712)
                     /codon_start=1
                     /locus_tag="AO090103000197"
                     /note="predicted protein"
                     /old_locus_tag="AO070251000016"
                     /protein_id="BAE65657.1"
                     /transl_table=1
                     /translation="MTRSILHTLADHAQEVEKIIHVRFSNFVDTMPKGTRHVTLLYHQ
                     CVIVATRPLLLSPLIERLENLDHEREYWQSFLALTKTLISIGIKSAVKMLQILSKEDY
                     LLEIFLLYGLEFTYAAALHLVMTNALFPQALDGQAYLEEAHWILDEMISNGNKVAEVR
                     KAELVHLQMLFEELTARVKSQGLQPLTLTSPTGAEAVPQTQIVEEDGEGETVTDIGVW
                     DLPIPGDSLTSHPADMQMSSVELLNNIGISSSDFLYIVDQIGNPDVSYSISDLGRAGG
                     EME"
     exon            509756..509887
                     /number=1
     exon            509950..510130
                     /number=2
     exon            510186..510712
                     /number=3
     CDS             complement(join(511086..511414,511496..511796))
                     /codon_start=1
                     /locus_tag="AO090103000198"
                     /note="predicted protein"
                     /old_locus_tag="AO070251000015"
                     /protein_id="BAE65658.1"
                     /transl_table=1
                     /translation="MAIFLYLWCTTIALLLLFGIHLLRRLGILITARPLPPSRGLTAS
                     HKANTKAGKAARTMTPVEGECYYMVNTIKEYSNKKTIIIAVLKEEQSFTYLKRKYRPK
                     KVIPSIDKDVQSAMREACELAGRRKNIKVIMSSYLPYMAYFQPSTIPSTAIVMMPKSY
                     RGEKASSQREAVARARFHSPKKVEPEVSSKGKPGIAYDTFIEVFECCYL"
     exon            complement(511086..511414)
                     /number=1
     exon            complement(511496..511796)
                     /number=2
     CDS             complement(join(512383..512833,513913..513980))
                     /codon_start=1
                     /locus_tag="AO090103000199"
                     /note="NADH-ubiquinone oxidoreductase, NUFS7/PSST/20 kDa
                     subunit"
                     /old_locus_tag="AO070251000014"
                     /protein_id="BAE65659.1"
                     /transl_table=1
                     /translation="MFTAHIPSCKASFTELASEIFSRTTIDQLVNWARQSSLWPLSFG
                     LACCAVEMMQVSMPRYDQDRLGIIFRASPRQSDVMVVAGTVTNKMGPALRQCYDQMPD
                     PKWVISMGSCANGGGYYHYSYSVVRGVDRIVPVDVYIPGCPPTPEAFLCGIFQLQKKM
                     RHTKVTRMWYRR"
     exon            complement(512383..512833)
                     /number=1
     exon            complement(513913..513980)
                     /number=2
     CDS             join(514409..514685,514707..515106,515160..515446,
                     515507..515814)
                     /codon_start=1
                     /locus_tag="AO090103000200"
                     /note="predicted protein"
                     /old_locus_tag="AO070251000013"
                     /protein_id="BAE65660.1"
                     /transl_table=1
                     /translation="MDSSTEQWMGLFHLFIDTAALDNPDQDKSLMYGLADTQELSNTV
                     SRILGLMKDMFESRFSNKGHHTMEGAESFFSPTNITLFVSAFFEHSYKASFNAHTIST
                     QLLLAITLMGATCVSPQDASSAEGYSDVAEYLIFDGPEFGKVFNIDNPSLARENMEIL
                     QAAMVISVIQWSKGDVTIKRRIRTQRFPALVCAARALRLTQVTNQAVSDTESLDLDRY
                     FYRESLVRAMAWLYLMDSHLTVYYRNPPQFKIAEACFGLPQHEELYDTMEPSALVNAS
                     QNATNAGLTLTLKSVIQRLMEKDSERFEELITQPFTLFGLFLVIASLHCILFDFQALD
                     TCVALSGPFGSLDTALDRWKKMWDLTYTTIMPSDIRKSGYMVHALELWWLAKKLTQKP
                     TGIYLESGFALDSTATFHEMVRELKGFQPVQ"
     exon            514409..514685
                     /number=1
     exon            514707..515106
                     /number=2
     exon            515160..515446
                     /number=3
     exon            515507..515814
                     /number=4
     CDS             join(515931..516020,516042..516986)
                     /codon_start=1
                     /locus_tag="AO090103000201"
                     /note="predicted protein"
                     /old_locus_tag="AO070251000012"
                     /protein_id="BAE65661.1"
                     /transl_table=1
                     /translation="MVYPSRVNVGVRRFFEPIVYLKPPRHWGLCLSTLLTESVIQTFP
                     KRTLRLNLGSSSPFSQIFLKQRSSTMSSPQNGIDYSTDSSVTTEFRRQDNTHQHALEA
                     YKLRDLTSCLERLTRAQLIEVLQAAGNDYVEVRKLVQSKVSEQMDDKTRIYRCEMSDV
                     MSFRGCREAARKAMEEAESRVRFLRLWNSLPDSGNDDFTNMVQLIADHCGAFAHPQTR
                     LNGLTVLCEMCYIFMDVARDDFWEQDQSKYGWDVSIENAMLEIATAMTPAERQAVVDD
                     DDLWSALVYVYQESDEKIFRAFKDVIDEFPKVDTGAEDDGGENDELRSLFEESDQDGE
                     QNEVDMSEAE"
     exon            515931..516020
                     /number=1
     exon            516042..516986
                     /number=2
     CDS             join(517829..518708,518771..518809,518984..519101,
                     519197..519238,519281..520247)
                     /codon_start=1
                     /locus_tag="AO090103000202"
                     /note="predicted protein"
                     /old_locus_tag="AO070251000011"
                     /protein_id="BAE65662.1"
                     /transl_table=1
                     /translation="MSSPRPTKRARANLTGDAHVTHLTEASTAQPGNGTINSEEVLRL
                     VDQLSHDKLCDIVIKAAEAHSDVATHIHNTIEEMREKERNRVINFDSLSKSVWYSINV
                     AHRKLKGSRQYDVAGDVWYEVVDTIKSIAQQCGPLTSLQTRLNGLSVLRKIGKTICLS
                     DNDVVGHEVQKQFQSDHCLEEAMIEILSTMSEDERRTIREEESSEEGLWLKLLELDDL
                     AYDLCLFERLNEVLDLINPPRECDDAFDGEDSEDEEGSEYFGEEGEDEEEENSDEYDV
                     QDYDNPVHQPWITDSSNANLRINEFNFIIARKYVVKLPLIKGGYPTQPHEAVMVLHLK
                     GFPRISSLSVPDIDATANDRDIAELQSQFGVGIICALPLEATAVSALFDTEWDSHLYG
                     KAVGDTNAYSTGSIGRHNVVLVHMAGMGKIAAATAAANLRASFEGVQLAIVMGVCGAI
                     PLRKQPDAEIHLGDVIISEGLVQYDFGRRYPSNQFARKDTPRDNLPRPSPEIRAVLAK
                     LQVEQGRRALHERTIGHLLDLREKLYDVATYPGATEDKLFEPTYRHKHHVDWTCAACL
                     KNDDVCDSAIKLTCDHLQCHEGNLVPRQRLSEPFNPVIHFGLVASGDTVMKSGVDRDS
                     IAARDQVTAFEMEGAGVWELFRGVLVIKAACDYADSHKSKNWQGYAAATAAAATKDS"
     exon            517829..518708
                     /number=1
     exon            518771..518809
                     /number=2
     exon            518984..519101
                     /number=3
     exon            519197..519238
                     /number=4
     exon            519281..520247
                     /number=5
     CDS             join(521932..522759,524147..524233)
                     /codon_start=1
                     /locus_tag="AO090103000203"
                     /note="ankyrin repeat"
                     /old_locus_tag="AO070251000010"
                     /protein_id="BAE65663.1"
                     /transl_table=1
                     /translation="MVASYFGLDSVVKELLDDYKGDLDFVDSKHERSALSWAAERGSV
                     GVVKLLLKGRRRSFIGIHVPSGKGAEINSIDIYMRTPLTYAAWNGHLEVVSLLLRKGA
                     AINTIDEFGATPLLYATYNANKPVVDLLLAQGAKTRSGENIIMAFCSAAGKGQEPVMR
                     LLLENGTDPDARRSDGCNLISWAASHGYKAALTLLIESGGDINRGNYENGQTAIHHAV
                     KYGQKGAVRLLVEYGADLKLGDKNGQTPLHFASSIGDRDIVQILLSKDSRPQLELRDK
                     VHNIYKAAQDGEPHNCQYHTLNIAVHDV"
     exon            521932..522759
                     /number=1
     exon            524147..524233
                     /number=2
     CDS             524668..525411
                     /codon_start=1
                     /locus_tag="AO090103000204"
                     /note="hydroxyindole-O-methyltransferase and related
                     SAM-dependent methyltransferases"
                     /old_locus_tag="AO070251000009"
                     /protein_id="BAE65664.1"
                     /transl_table=1
                     /translation="MSTDPVKLLQSNNDGLPATRPDSQIDQAVAVKYWSDKPATVNGM
                     LGGYAQVSRTDLRGSRNFLAKARRLVPGCPVTGKLKRGVDCGAGIGRVINDFLGQECE
                     IVDAVEPVEKFSRVLSERRLTRNCALGEVLTIGIEDWVPGVKVYDLIWAQWSVPYLTD
                     AQLVEYLVRCRGALTDVGLMVIKENISEEPEGDIYDESESSVTRTDEKLRRLFKEAGM
                     QLILSEVQSGFPRQLRLLPVISYALRPRI"
     exon            524668..525411
                     /number=1
     CDS             complement(join(525812..526133,526192..526214))
                     /codon_start=1
                     /locus_tag="AO090103000205"
                     /note="predicted protein"
                     /old_locus_tag="AO070251000008"
                     /protein_id="BAE65665.1"
                     /transl_table=1
                     /translation="MGSVKVTDLDTYHNVVSGANYAVFNFRDSRRRSSDTDLAYDDLA
                     SYAYSDTVAFYEVDVGDQKHISDFAKVERPTLILYKDGKEVERYSKPLPRQLEYLVSR
                     ALCGLTEIGGRF"
     exon            complement(525812..526133)
                     /number=1
     exon            complement(526192..526214)
                     /number=2
     CDS             complement(join(528517..528764,528818..529201,
                     529271..529520))
                     /codon_start=1
                     /locus_tag="AO090103000206"
                     /note="reductases with broad range of substrate
                     specificities"
                     /old_locus_tag="AO070251000007"
                     /protein_id="BAE65666.1"
                     /transl_table=1
                     /translation="MPEGPVVNGLFRHNNTTPPAQESVMALFSLKGKTAVVTGAASGI
                     GLSVAHALAEAGANVAIWYNRNSKAVEEAANIESKYGVKCRAYQINIRESEKVEELLN
                     TCVRELNGRLDIFIANSGIPWTQGPMIDAPLDHYRDVTQTDLDGTFYCARAAGAHWRR
                     QKTEGTDIFGNPLQGFTYGSFVATASMSGHIVNIPQLQAAYNAAKAGVIHLCKSLAVE
                     WVQFARANTVSPGYIITDISTFVPDETKDIWKGKIPMGREALPHELKGAYLYLASDAS
                     SYTTGADLVVDGGYTLP"
     exon            complement(528517..528764)
                     /number=1
     exon            complement(528818..529201)
                     /number=2
     exon            complement(529271..529520)
                     /number=3
     CDS             complement(join(529675..529757,529906..529981,
                     530195..530395))
                     /codon_start=1
                     /locus_tag="AO090103000207"
                     /note="predicted protein"
                     /old_locus_tag="AO070251000006"
                     /protein_id="BAE65667.1"
                     /transl_table=1
                     /translation="MIGIYVYNSCYFKDYVEATNIGGYLDRKTYGIWRSTSKTVVWVR
                     PTVRFPVSILPPAEEIGNVFHGLHTETSFRRKCTTFGTGPYGGVESTILVDNMFMEHF
                     RRNLSSSAISTTTSMNV"
     exon            complement(529675..529757)
                     /number=1
     exon            complement(529906..529981)
                     /number=2
     exon            complement(530195..530395)
                     /number=3
     CDS             join(531539..531558,531661..531682,531726..531868,
                     531922..532244,532337..532428)
                     /codon_start=1
                     /locus_tag="AO090103000208"
                     /note="serine/threonine protein kinase"
                     /old_locus_tag="AO070251000005"
                     /protein_id="BAE65668.1"
                     /transl_table=1
                     /translation="MSQKRYKRAPLAPHILEERFEDLRKGQYYPVNIGDIFRSKYQVV
                     GKLGFGISSTVWLARDLEGHQYVTLKLYTRSESDLAEFQIYNLLNKGSSSHPGYAHVR
                     RALDVFTIPRPGGDHCCLVQKPMWESFRGLLYRNPTHRFTEELLKAGLMQVFLALDYL
                     HNECKLVHTDIKGDNILQEIEDESILEKFTEAEMEDPSP"
     exon            531539..531558
                     /number=1
     exon            531661..531682
                     /number=2
     exon            531726..531868
                     /number=3
     exon            531922..532244
                     /number=4
     exon            532337..532428
                     /number=5
     CDS             join(532585..532638,532703..533116)
                     /codon_start=1
                     /locus_tag="AO090103000209"
                     /note="predicted protein"
                     /old_locus_tag="AO070251000004"
                     /protein_id="BAE65669.1"
                     /transl_table=1
                     /translation="MFKTEWSYPVDIWNVGTMIWDLFEGKHMFYGNDPDGKGYSTRAH
                     LAEVIGLLGPPPLDMLKRGIRINEFFTEDGIYYVVLGSTKRQQAAYQYSIGQWKQDIE
                     IPDQSLEMSEKFLNGRNKEMFLTFMRVTSQWKPEDGKTARELLEDPWLNDRLD"
     exon            532585..532638
                     /number=1
     exon            532703..533116
                     /number=2
     CDS             join(535145..535384,535535..535592,535646..535782,
                     535837..536045,536094..536862)
                     /codon_start=1
                     /locus_tag="AO090103000211"
                     /note="predicted protein"
                     /old_locus_tag="AO070251000002"
                     /protein_id="BAE65670.1"
                     /transl_table=1
                     /translation="MGETFLDATPSPSSASTHNHCTKDDAVLIHLILFLRMEIPVSSE
                     RLINRLNRCKNHVVRHGPIPIKCKKWLARVHSGSGSRWVLITGITIVPLHPSGRDGYL
                     KRWATLQISNRFTLALLRYVSRFLQLGTPKNFQMEDLLMIVNVILYVLLTVYLIEVEK
                     YGTNGIPLDKVDQIKPSAIPDLIKGSKLVIVVEQLWLGVIWGCKACLLLLYSTMTSGL
                     SQHRIVKLIGAFCALSFVLVEILFFAAWCHPFSAYWSVPPKNIQCSVYRNHLILVLAL
                     NIATDLMIMCIPLPLLIKAKLSLTKKITLCAVFSLGIFVILCSILSKYYSISNPYGDR
                     WVDWYVREAATAIVVANIPQTWTLFRRMFNWKSFLAHSSYNRSHSRSKYTNRLDSSTI
                     HLSRFKGGDKSHTRSVDITASGEHINPDQPLEIWEHRQFQVTNEPGGSSDSGSQSSVS
                     LEYDTTGLNPQGKTTVTTRS"
     exon            535145..535384
                     /number=1
     exon            535535..535592
                     /number=2
     exon            535646..535782
                     /number=3
     exon            535837..536045
                     /number=4
     exon            536094..536862
                     /number=5
     CDS             join(538266..538338,538388..539238)
                     /codon_start=1
                     /locus_tag="AO090103000212"
                     /note="dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /old_locus_tag="AO070251000001"
                     /protein_id="BAE65671.1"
                     /transl_table=1
                     /translation="MPGLAFNPDNDIPDLSGKVIFITGGTAGLGAQSVAQMAKHSPAR
                     IYISGRNATSAEKIIKEIAETGSNTPVSFVECDLTSLDSVKRAADEIIAKESRLDVLM
                     CNAGIMALPPGLTKDGYEVQFGTNHLGHALLIQKLLPLLQRTAERGADVRVIILTSKG
                     YQLHPYGGIIFDDLKTTQDYGFLGSWRRYGQSKLANILYTRELARRYPAITVVSVHPG
                     VITTGLVENLGWAHRWFIYATTYNQMVTLEEGAYNQLWAATTSKDGLETGQYYIPVGV
                     ASNDKLTKTGRDDVLAGQLWEWTDKALEDYL"
     exon            538266..538338
                     /number=1
     exon            538388..539238
                     /number=2
     CDS             550240..551301
                     /codon_start=1
                     /locus_tag="AO090103000213"
                     /note="predicted protein"
                     /old_locus_tag="AO070238000015"
                     /protein_id="BAE65672.1"
                     /transl_table=1
                     /translation="MQIISLSKLAILGLAGLAIAHPGAHEPSSMSHSAKRSFLNNAKR
                     SLSQCSSHLERRGINDRIQARRAAAYEMYRKRSIDARDYNPSVNTSHHSTLDVTSQTT
                     EEELFAKNPVCILSPEGEIGPFWVKGELVRSDVRDGEAGIPIIMDGQFIDIETCEPIK
                     DLYWDVWNCNSTGVYSGVQDSSNGNGDDDSNLDKTFLRGIQKTDAEGVAQFKSMFPGH
                     YGGRTTHVHVVAHVGATQLQNNTITGGHVAHIGQLFFDQDLIYKVEATYPYNTNKVSI
                     TTNADDHVVQDETEDSASDPFFEYAFLGDALEDGIYAWITLGVNVSASYDTSYASLLT
                     SSGGVSNSNSGGPGSTVNL"
     exon            550240..551301
                     /number=1
     CDS             join(553202..553544,553607..554821,554890..555104)
                     /codon_start=1
                     /locus_tag="AO090103000214"
                     /note="choline dehydrogenase and related flavoproteins"
                     /old_locus_tag="AO070238000014"
                     /protein_id="BAE65673.1"
                     /transl_table=1
                     /translation="MLFPSFVLATLSLGAAVRSHAGSPSHYDFVIVGGGTSGLVVANR
                     LSEMNNVTVAVIEAGESALNNFNVSNVMGYSTAFGTQVDWAYKTENQTYAGGLQQTIR
                     AGKALGGTSTINGMSYTRAEDVQIDNWEVVGNKGWNWKNLFQYYKKSEGFQVPTKDQI
                     AHGASYNASYHGRNGPLKVGWPTSMTNSSVFPVLQQTFEKLGVQYNPDSEGGKMVGFT
                     VHPDTLDREMNVREDAARAYYWPYEARSNLKIISNTRADKVIWANATQGEAVAVGVEV
                     TNAYGTETIYADKEIILSAGALRSPALLELSGVGNPAVLNKYNIPVKVNITTVGENLQ
                     DQTNNALTWEGVETLTGLATFSVLPSVNQLYGDNVTALASYVKFQLVTYAKVVASASN
                     SAVKEANLVEAFERQYDLIFNSQVPYAEVVFAPSGQSFSVEYWPLLPFSRGSVHIQSA
                     NASDLPAINPNYFMFGQDAEAQITVAQYIRKALGTAPLSGLVGDEVSPGLDVLPASAS
                     SSTWTKWVEANYRTNYHPVGTNSMLPREKGGVVSPELKVYGTKNLRVVDASILPFQLC
                     GHLTSTLYAVAERASDLIKENYRA"
     exon            553202..553544
                     /number=1
     exon            553607..554821
                     /number=2
     exon            554890..555104
                     /number=3
     CDS             join(556904..557047,557112..557433,557519..557553)
                     /codon_start=1
                     /locus_tag="AO090103000215"
                     /note="predicted protein"
                     /old_locus_tag="AO070238000013"
                     /protein_id="BAE65674.1"
                     /transl_table=1
                     /translation="MNLFDPRWKLPLHCFQLFLMVIVIGLSAPRLFMKNQPRTRASTI
                     GLGMAAKSLVIILYQLLTEHVTVLRKWASLKAYTILNALEIVFWAAVAVLTIQANVQM
                     CVAPGCILGWGVAITGINLRYGINLRLGEWCGYCMANAFENSALAIYSTIICYLCDSR
                     VSLGCL"
     exon            556904..557047
                     /number=1
     exon            557112..557433
                     /number=2
     exon            557519..557553
                     /number=3
     CDS             complement(join(557775..557779,558451..558606,
                     558682..558866,558933..559216,559359..559559))
                     /codon_start=1
                     /locus_tag="AO090103000216"
                     /note="predicted protein"
                     /old_locus_tag="AO070238000012"
                     /protein_id="BAE65675.1"
                     /transl_table=1
                     /translation="MLTVCILLQALLCKSVIAWTNGASATGPTDPSVVDHCEYWVNNI
                     GLSDSCELIEDYFGITRRQFRLWNPSLSPSCVMTRGWSYCVAAPSSATTSTTSTTSIT
                     ATRPSDPPGTITYSGTAAPTQSGVSSSCAKYHLVHPGDTCYTIQDEYGDFTLEQFYSW
                     NPSIGKGCIGIQPGYYVCVGTESKSTSISMTPTTGSSTAIPSKTSEGSSASDPQPHQT
                     GIPANCNKWHYVVDGDECETIATKYGITLQQFYTWNPAIGSTCRFLWKDNYVCVGITG
                     "
     exon            complement(557775..557779)
                     /number=1
     exon            complement(558451..558606)
                     /number=2
     exon            complement(558682..558866)
                     /number=3
     exon            complement(558933..559216)
                     /number=4
     exon            complement(559359..559559)
                     /number=5
     CDS             complement(join(560187..560301,560485..561248))
                     /codon_start=1
                     /locus_tag="AO090103000217"
                     /note="predicted protein"
                     /old_locus_tag="AO070238000011"
                     /protein_id="BAE65676.1"
                     /transl_table=1
                     /translation="MYFTGLPTETLCLIASYLPCQQDVYALARTNRRIYHALHDFLYE
                     YNSRYYHGSALAFVAKHGNIGRIAQLLRGLKTAQTRSRTPPGPRWRSEVPSEQRWEED
                     SDEVEWDSDDEDMYSLTRDISSHPLKSARYSVADIVQIQKALLAAIEINNEEIVTLLI
                     EWGAQANFYRGNLRDDNPGRIRRRHSRAKDPPPLYLAVRCGHAGLVKYLLEKGADPDR
                     YRPSPLYRAVEDGQYNIIAMLLNHGAPLSYARVLKLAEDGDGMDGTIAYDHESSYCTI
                     EEEASEGRGEEYGSGS"
     exon            complement(560187..560301)
                     /number=1
     exon            complement(560485..561248)
                     /number=2
     CDS             join(564784..564852,564876..565167,565247..565351,
                     565406..565922,565984..567949)
                     /codon_start=1
                     /locus_tag="AO090103000218"
                     /note="chitinase"
                     /old_locus_tag="AO070238000010"
                     /protein_id="BAE65677.1"
                     /transl_table=1
                     /translation="MDCRSFLPYCCIWTSTVLIESNQHLYYSFAGISIIDFSITTTNP
                     RDEDFWARFTSLKKKKPSLKTYISVGGWDVGGTPFSIMVRFPGTRKHFIKSALNMMRK
                     YGFDGIDIDWEYPAAEDRGGAHSDTANLVNFLKELRAALGSEYGLTVTLPTSYWYLKG
                     FDIANMVQYVDFFNFMAYDIHGTWDGRTSKWTKSVVNPHTNLTGTYDALVFNHYWHDY
                     SKSQTNRSILEIAAGLDLLWRNKIDPSKVVLGLGFYGRSFQLANPSCSTPGCAFYTGH
                     GSSGGALAGECSGTSGILSNYEISRIIKSYDPTIEYDEAAAVNWMTWSSDQWVSFDNG
                     RTLKQKAKFANNKCLGGLLSWAVDLGGPGSLKNPNLFTDSDLSMDGADPGGGSDGTGN
                     LYVGAEVLNPDSNSVTAIAPVNIVFPISTLPSPTTIAPSGYPTSLEVAWPTTKTVTSG
                     NIITVTSTITRYIQTTTIAVPSLTVREHGFYNWNITDKDTTHLVRALIPSIRLPPIVI
                     TDDPNPLKETSVSHTPAVTRTIHLPPWPWTTDGAKYPRITFTQGGPPGPTCTAGCGTL
                     CTQFCDGPCLNNCGDAFSRDFISPLDDDPPTVAPCAGKDCKNGKCQGEICIEKGCTGA
                     DCQNRVCVGDDCKPTGCTGPDCDKGHCSGKNCQDHGCVGKDCDKQSGGCFGPLCLSWG
                     CLGPQCSSTDFVCTGLHCRVVSCSGPSCKNGNCTGPGCMTEDGDCEAKEAESCTEWIS
                     STMMTPASTYSTQTVTTACKTISACNAKGTTVTKTIDEDGLVEGTVTYIENDVPTDAA
                     DDAIASSLASYYSSYWSTVDATSTSSTVSSTTTTTSSSGGGQTHDPIPNSLIILKEHV
                     EDEHFDSSVSHYYKWYSVYYSYRHQVTEKGICALSGKVDGPVKSDEGEEYPTSLGPFA
                     LGQYTGCLYSGSKHRPGSVKCDNSELAFTCLGYKYNAHAADWNCGKTYTKDGTTHYSN
                     YYKAVECLIF"
     exon            564784..564852
                     /number=1
     exon            564876..565167
                     /number=2
     exon            565247..565351
                     /number=3
     exon            565406..565922
                     /number=4
     exon            565984..567949
                     /number=5
     CDS             complement(568553..570142)
                     /codon_start=1
                     /locus_tag="AO090103000219"
                     /note="predicted protein"
                     /old_locus_tag="AO070238000009"
                     /protein_id="BAE65678.1"
                     /transl_table=1
                     /translation="MSYVEFRRVQPWGYDVAIIDTDGSELHEDEFGSLLAKIIESNDV
                     PMLNQYKEKHPRGITCSSEAREMDPFFVACRHGSTDVLRVLLEHYHANLGQTASLEER
                     EIVLLNVTSEYGQLETALFLLDSQPPLVSVGANMPGYETALLSAAQSIWNLSDELQYH
                     ENEALDWVDKRLTRSEQLIDILLDRGASVHDVTMCPDEDIAEVKQQPLHTVLGLAVSR
                     AGYKLLKRLIDEGANVHTRQECLGIGGPTFKEKHASFRDTTALHYGSMFWNVEGVQAL
                     FDLRGTDVDIADMVSVRDSLGRLPLHWAAAGAGDSDKAIIPDGAIVQRVLDTFELLLV
                     GNPTAINVQDNQGKTPLHYAVATHASGDRNHLYSIVKFLCESGANASLQDCKGQTVLH
                     ILAFWSVYGEPMDLNVIDLLIAHGANINHADRNGITALHIMTRNLRQVKAAQFLIHRG
                     ADVNAKTLKGDTPLCEAAGRGALLKRGVWTQGNEYVTLDDRIKAQDTMMGVLQDAGGS
                     LDQPNAAGKTPRQLLEQKRAS"
     exon            complement(568553..570142)
                     /number=1
     CDS             complement(join(570383..571271,573023..573141))
                     /codon_start=1
                     /locus_tag="AO090103000220"
                     /note="predicted protein"
                     /old_locus_tag="AO070238000008"
                     /protein_id="BAE65679.1"
                     /transl_table=1
                     /translation="MHNLSTQRYWIPILAQAIIASRMVAGMRALWKNPFLFQISWEMF
                     QIEYPAILGYTFGGTVVSMGPNVDSVKVGDRVAVACWGRAAVDRRFGAYQKYPLALEE
                     NLVKLDSQTSLEGGSGVMANLATVVAALSVCMKLDYPPINERAPKNGKKILIYGGSSS
                     VGGLAVQYATDAGYEVVTTSSPANWDLVQRRGPSSIVDHTLPREQLLESIKASGPYDG
                     IFDAIGSAEVTELMGKLLAEDGGLFWSTSPTPADSRLPKNVKKEWGGYSDILVSRDEN
                     KDAKVWYLQEYLPKGLSNGRIFSNPSYIFPGGLESVQDALDTFMAGKVSGKKVFVNPQ
                     H"
     exon            complement(570383..571271)
                     /number=1
     exon            complement(573023..573141)
                     /number=2
     CDS             573494..574345
                     /codon_start=1
                     /locus_tag="AO090103000221"
                     /note="predicted protein"
                     /old_locus_tag="AO070238000007"
                     /protein_id="BAE65680.1"
                     /transl_table=1
                     /translation="MDRYHRIPLFGAHMDPPGEEYWPSQTFSDLLEGYTKRAFSHESD
                     ILRAISGILNSFYESHHYFGLPFSVFDNAILWNAADTTYSTRNPTSGDVFPSWSWVSV
                     KGGITTYNLPLQTLAVWAVASTDSDFLPQPLKVIAPWERPLANERQYYKLMPNHSALL
                     ILAWKEGCFSGKLPEELKPAANWSKIERLAQKRWGANGQHRMIQDALGLGQNLDYNDK
                     FSPEHISLSCSSPGGIMMYTQSVRVRVVPPQNLSGRFDEHIKLYAEAGEVVACVSDGS
                     VSFQVQW"
     exon            573494..574345
                     /number=1
     CDS             complement(join(575098..575430,575485..575960,
                     576008..576233))
                     /codon_start=1
                     /locus_tag="AO090103000222"
                     /note="isopenicillin N synthase and related dioxygenases"
                     /old_locus_tag="AO070238000006"
                     /protein_id="BAE65681.1"
                     /transl_table=1
                     /translation="MPATRGLPILDFSAFYGENPKAKAQLVEQVRESCLHNGFFQITG
                     HRIPLELQHRAMNCSKRFFRLPLEEKLKIDKKKNTFNRGYELLQSQMNEAGASPDLKE
                     GLYIGREIPTDHPYFLEGLLNSGPNQWPDTIPDREEFQKSTMEYYHAVFDLAKDIMAV
                     LALTLNHDEAYFDPLTDGAVATLRYLHYPPPPKQMGERLRGIGAHTDFSCITLLLQDE
                     VSGLQVLDVPTNEWIDVQPIPGAYVVNLGNLFSRMTNDTYKSNLHRVINDSGNDRYSI
                     PFFLTGNPKYVCKCLPGFQKDGEPGKYLPATVQEVVSSSYKETFARAERYKAEIQTKI
                     QNNVTKEVAA"
     exon            complement(575098..575430)
                     /number=1
     exon            complement(575485..575960)
                     /number=2
     exon            complement(576008..576233)
                     /number=3
     CDS             join(576787..576923,576978..577332,577427..580897)
                     /codon_start=1
                     /locus_tag="AO090103000223"
                     /note="non-ribosomal peptide synthetase modules and
                     related proteins"
                     /old_locus_tag="AO070238000005"
                     /protein_id="BAE65682.1"
                     /transl_table=1
                     /translation="MGRAGNLAQPCFFPPLIAQFGRQSGGSEVVERRESVTVPLKELD
                     IQTAWAVVLRTYTAGDHIGFGLVDLENQKISASDWSDLREQIAVYESTINSLTVIREL
                     LHDGKQSSKSEGSESSDTANNTLHTSSWPFNSIVCIDRNDARKGNQFVRMSLSDMCRE
                     ALNEFQIIVRIHRDELTGLLTTIIDYTTTVLSYEQARAVAGTLNKTISEVVQHTNQTV
                     ATLDICTDFDIQQMIEWNTPPLSMPRLEQCAFQLISQRCVEQPDATAVSAWDGEMTYG
                     ELHRRSAALAVQLAEVGVGSGVFVPLFFEKSKWAVVALLGVIKAGGAFILIDISYPLK
                     RIRTICQSVSAEVAVASPQHQLLGREIVGLVVAIGDDCPETPSLPASPKLSLIHSGTP
                     ESPLYVVFTSGSTGDPKGVIIDNVSFCSIYETVSRAFSFSPSTRLLQFASHAFTLCSR
                     EILLILMAGGCLCIPSEVDRVNDLAGFLCRHRVNFATLTPSVAGTISPSSVPSLQTLL
                     LGGEAVKPAHIATWAGKVHLMIGYGASEIAGTAIVGSNLQLDNDPRNVGFACGAGLWV
                     VDADSPDKLAPVGAVGELILQSHGLASGYLNGNEQVNQPFFHEAKWQKRLPMEARIAR
                     LYRTGDMFRYNMDGSLYYVERKDNQVKVNGQRIELGDIESHITASCTMVHSSVVLLLQ
                     PDQQATRSFLVAFLCPKEPPRWGTTTNSPLAIVETPSSQFYLDIERLSRELQESLPSY
                     MIPSIFVPLSSIPLTLTGKANRRLLLETVARWPEDRFGTYRCGSQSSPTYKAPVNQRD
                     DQIRRLVATALKKKPEAISMGSSFLALGGDSISAMRLVTLAKQEGLYLTVGDIFNHPI
                     LSDLARVAREGAIEELQPRKVKFKGLNSYDGLLRRLAPDIADNIHEIIPTTAYQRMTL
                     AELRPRYLRIALPSNVDRDRLLSACQQLLERHAILRTIFEIDNETNASQGEVVQVILR
                     PYKLKFVEYHGIDDLDQHCLNESLMSPSSTGGGLQFQAQLLTMRDSRLFLVLRFIHAQ
                     YDGISLPIMSQDISAAYNRVSPDPTAPFSDHIHAVWANHNDEGLEAWRSILKGSEMTA
                     LKPKQMATTHVEKPVHEARPVKVIKRTRLISPPENITMASLVKAAWALAFAKFVSARD
                     PITFCAEAVAKDIVFGQVVHGRGLGITHENRILGPCVNTVPVRVGLSKYTNNHDLLHH
                     VQQQHLATMPFENIGLDDIIRNCTDWKPGTKFGSVLRFQNFDANLSCVFDGVAHDASV
                     YHLPNRPSEKIHVIIMPSESDMRIIMNGYDHVVGQKEAADLVDSFCAAIEDLAKTPTK
                     "
     exon            576787..576923
                     /number=1
     exon            576978..577332
                     /number=2
     exon            577427..580897
                     /number=3
     CDS             complement(join(581629..586873,586932..593329))
                     /codon_start=1
                     /locus_tag="AO090103000224"
                     /note="polyketide synthase modules and related proteins"
                     /old_locus_tag="AO080541000227"
                     /protein_id="BAE65683.1"
                     /transl_table=1
                     /translation="MAKAEPIAIVGRSCRFPGGSSTTAQLWKLLLEPQDLSSGPPSGR
                     FNADAFYHNDPRRPGTTNAVKSYFLEEPIDRFDAPFFNISRTEAESIDPQQRLLLETV
                     YEGLEAAGCRLEDLSGSSTGVFCGVMCDDYRSMVFRDLDTLPQYAATGTSQAIVANRI
                     SYFFNLRGPSITVDTACSSSLVAVHLAARALADGDCHLAVAAGTNLILAPNVFLSESS
                     LNMLSPTGHSRMWDANADGYARGEGVAAVVMKRLSDAIRDGDHIECVVRATNVNQDGR
                     TPGITMPSPEAQKDLIMKTYSDAGLDPQNRPEDRCQYFEAHGTGTRAGDPQEARAIHG
                     AFFGPSATASNDSSALLVGSVKTIIGHTEGAAGLAGLLKASLCIENATISPNMHFENL
                     NPDIAPYAGSLRVPTEVLPWPTLSPGTPRRASVNSFGFGGTNAHIILESYDVGSESHS
                     LKGPPAILPFVFSASSEWALGQLLHRYCTFLDENPDTDLTNLAWSLFARRSLLSHRVW
                     FCASSGSELRDAIKEEICSRQSGTLETILGAPPCGPKRILGIFTGQGAQWAKMGIELI
                     RACPEAGNWMAEMQKSLDELPDQYRDTGFSLMHELSLSPDTSRINQATVSQPLCTAIQ
                     IVLIKILSTLGIKLSAVIGHSSGEIAAAHAAGFITASDAIRIAYFRGVFSRLARSRGG
                     QAGAMAAAGLSHEEAESLCRESKWAGRVTIAAYNSPNSVTLSGDADGIHELCSVMQDE
                     GKFCRALKVDTAYHSNHMLACSAKYKKALEDCRITPTQNSAAAKWFSSVLEGRIMSQD
                     DRKLLSAEYWNENLVSPVRFNQAVVAVTRDTSFDLAIEIGPHSALKGPFQQSLSGPEI
                     PYTSMLKRGSNDMLSVASMIGTCWAHLGPDSIHLAEHIKLCDSTREPQLLKHLPSYPF
                     DHREEYWGVSRLTDVALNRKDAPDELLGILCPDSGEGEWRWRNHLRHEDIPWIHGHRV
                     QSQIIFPISAYLAMLWKGARIITNAQPFRFVEISDVELLHTVVLDGHMEQSIETLFKV
                     DVLTEDKNVVYLDFACYIEIEGSMRRCASGKSSLHKGEQSSMLLPTQPFDDCSLTLTD
                     SAPFYSTLAKLGYEVSEELKVISKLHHHVPHTRGFLRNLEQTCPKTQVYYGAALDASI
                     QTLLAAADAQSPRLLSVPFVPSKIRRIVLNPMSLHSHLLKNAVVFDSILSNATSYKIE
                     GDVDLFADGGQGIMQLEGVTLVPSREPDAGSHTLFSEVAWGRLVPHVTADNADLPIGV
                     EDTDLEALERISLCYLAHAARLVPQHERIHTSGQTAALLDWIDNVLEQTSAGSHPTCR
                     KEWMFDTIERVEALAPEGSSCRTYGILHTAGRNLLNSVRQQGEVEASCDLLDQWQKNS
                     VHLHKLRCRMRDVLEQICFRYPHLNILEVGGAGYAEANDALVGMGLAFKSHVRTQPPS
                     YCATAQSDVDNQHEQQIIHLDLSMNPVNQGYTEHSYDVVLIPSVLYNHTAREQALLNL
                     RRLLKPGGYLLAIQETNPSVLHTVVLAASVGLKGEEIWTPDMWHSTLQDSGFSGVDTI
                     TPAVGASLQPYSLIVSQAVDDTVNTLRDPLMSARTAADERDLYIIGGNTPETVNLLQG
                     LEAILTPRFRSLVKVPELKAFRVVGQTQINVLYLDGIGTAYSEDLDEDRYNAIENMVN
                     MSDNILWVKRGTRSSIWNQGNVTAVLRSLSSQKQNLRLQCLVLSHGTQPTACSLATAL
                     LRVTDSSVSNDHQLPTHVWSNEPHLLLEDGVVYIPRMRYSELMNQRATAYQQTTYQDV
                     QLSKSGVRLVSSSGHHHLAIQPVVLEEPEKIRIQVTLSSQSAIKIGDAYLYLVVGKVL
                     NGQSSVISLSDECASVVSVPSCWVWPFERIAQDGPKALMAVILALTAVAAVTLAGPNT
                     TLVVHEPCNPLRALLVACAHIQNVSLLFTTGSSESATSDRFIHPLSPNRVLVKLLPDN
                     VSMILRCAEETGGIFSRSDLPLAPGVTVAGIEDLFSSEPCIRGHKASSSTIANFLHIA
                     LGLTEGGDYARDPGCSVIDVQQLAGLKYDTGLPAVVDWSKHSFVRTIVQKASSELLFS
                     AELAYLVINMDGATAMLVAELLIHKGARKVVLIESSSAVDRDWIHEMAQLGAQVNFMS
                     MNITDQESVVAVKSTIIQDIGQIGGVISGVIRTFDPDITPDTASITVQSTSLPKIHGA
                     RILSDVFNGSEMNFFILSAPNMWPAGFPSQYETSLNGAVLFDTAYERKRKGLVASIIH
                     SKSLAKMGLSKEDIGEVFAEAIIGGRVSSQGALNVIPAAAIDQGMKNSDVAFSQNPIL
                     WSMIGPEATPSTPVEGQSRGQDLTLKEELIRSGREIDNLQKIIQRRFTAKLQKTLRLR
                     KEDPILANTALFELGVDSLVATSLRSWFVNEMGIDMPIMNLLNNASIGSLVQYSAKEW
                     LTQTAKQDEQGSSVSWAQGSSESSGSASPTTRSSGAASNLGDMPLCKGEYARVEHLSY
                     AQSRYWFLQQYYEDRAAFNVTLLFTMDGQPSEADLQSAIQIVSQRHQSLRTCYLSEGA
                     EMKSACQAILPISPVTLEVCDIEDESGLFDEYARICDHPYDTEKGECIRFRLVKTPAA
                     DSTFLIIGYPHMCMDGASCFILLEELDQAYRKLSLPPVSRQYPDFAAAQRISYEQGML
                     QRELDYWKKELNPLPEPVGLLPMTKVRSRPPLKEYDTHELQFCISNTIMDRIRSQCRR
                     HRVTPFHFSLAVLRILLARLTKTQDCCIGVADSNRLDPSNESTVGFLLNLLPLRFRTL
                     PDNFTDVLAGTRDACYGALTHSAMPFDKLLDELAVPRSNTHSPLFQVLMDWQPRLGGE
                     VKLGDITSSCTKMTVGRTIYDLTLLVTESARGDATIHFRTQKALYSKEGSEVLARSYI
                     NLLEAFTGDLDLQVHAPCIWHPSDLERAVEVGQGPTYKSQWPSTVSRRIEEVSVAQPS
                     NTIAVMDTKGRSFTYRGMMDRVRTLAFALRDVGVGPGSFVCIFQHPTAEWVCCMLAIW
                     RLNAVYVPLDLRNPPSRLMTVIQDCQPTAIFCNDETDPNVRDLGCPGIALLNTSEICA
                     YGGLPLTVHDLSSPDAPAAVLYTSGSTGKPKGILLRHSSIRNQVEGYTRRWELGPEVV
                     LQQGAMTFNHSLDQILTGLCTAGRVVVATRDIRGDPVSLTKLIGDEQITYTKATPAEY
                     SMWLRYGSASLRTATNWKHAFGGGEHLTTTLSQGFQALELPNLSLYNSYGPGEITISS
                     HKMKIDYKEPSVTPDDIFPVGFSLPNYTTYVVDEDMQLVPPGVSGEILIGGAGPCLGY
                     LHREALTAEKFIESHFASSEYTQSGWTRAYRTFDRGRLLSDGSLVIEGRLDGDTQVKI
                     RGIRIELEDIENSIIQASDGKVLNAVVSIHGEDSQLLTAHVVLAPSTQGGAPSDLDGF
                     LQQLRANLPLPQYMCPSVFIPVHDFPLTIHGKVDRKAIRAMPLPQAPTSNRPVEELSG
                     TEAMLREIWAQVLESTSLDATGVGREDDFFMVGGNSVLLVKLQALIRQTLRVSVPLVE
                     LFSASTLGAMAGVVQNAIPTIELNWMEETSLPDLAINHEPPRPVTDQGIVIVLTGATG
                     FLGHVILQRLLAEPTVSHIYAVGVRTEGRGIGRPLPSASPKFTALNGDLGQLMFGLDE
                     STFATLAASAHVIIHSGANRSFWDAYPIIRGANVLGTKNVVALASHRKIPIHFLSSGA
                     VEKVVESNAAPPTDGRNGYLASKWASEKILTTAAEKMNTQVTIHRLTQAPNVQPPPQD
                     IIAAFSAIAEQMNCIPTAQGWGRLISLLPLGELATSIVRCALISVGQQVSAKVTIENH
                     MISTTFELSDAAEAVDRTVVGADQMDSLHMLYWLGRAKRESKFPWFVAAQDVIVNSEC
                     QTVRVELD"
     exon            complement(581629..586873)
                     /number=1
     exon            complement(586932..593329)
                     /number=2
     CDS             join(594689..594994,595050..595118,595188..595931)
                     /codon_start=1
                     /locus_tag="AO090103000225"
                     /note="isopenicillin N synthase and related dioxygenases"
                     /old_locus_tag="AO070238000003"
                     /protein_id="BAE65684.1"
                     /transl_table=1
                     /translation="MAVNFTQIPTIDLAHAQSPVTKASFLSDLRDAIVKVGFFYVKNH
                     GVPNNVERNFVEQSVKFFDLPLEDRLEVEMLHSKHFLGYVREQNEKTAQRTDFRETFN
                     LGMDLAAPGEEEPAYRNMSGPNLWPNETAIPGFRAAMEDYVKHIQTLGDDFKVLVAEA
                     LDLEPTAFLRFFDEQPQDRLKLAKYPVPSSIADSEPSGSFQGIGPHKDSSFLTFLLQG
                     TPHRGLEVQNKSGEWIPAPPIPGTLVVNIGRMFEALTGGVVTATTHRVSLEEKNFVDR
                     DGRPLGPRFSFPMFQLLALDLRRDQMTLDMPPHIVKLAKEIKVMSDAEKFFEEMFRDC
                     AGSGLFMARVIKHEDVARKWYPDVLDNVLKAQKAELGH"
     exon            594689..594994
                     /number=1
     exon            595050..595118
                     /number=2
     exon            595188..595931
                     /number=3
     CDS             complement(join(596318..597667,597728..600256,
                     600311..600535))
                     /codon_start=1
                     /locus_tag="AO090103000226"
                     /note="multidrug resistance-associated
                     protein/mitoxantrone resistance protein, ABC superfamily"
                     /old_locus_tag="AO070238000002"
                     /protein_id="BAE65685.1"
                     /transl_table=1
                     /translation="MTLDTGQGPAIESIEKDQHEQPQQEKQSSYFQWFKLNPLRSSKT
                     PPVPQERQVSREYGANLASLITFQWVNPIVKLGYKREMEIQDIWTVNPTRSVSILSKK
                     LDEAFAGRLERGGKRPLVWALYDTLKIELCIGILCQILSMCLLVLAPFVVRRLIEFAM
                     DAYTSQHNNLPGPNLGKGMGLVIGLVTMQLVQSISSNQAFYQSLIAGGQLKAVLTPKL
                     FSKAMRLSGHARAGNGTGYSDGRITTLMAVDLSRLEKGCASLHILCATPIALIIALVT
                     LLVNIGYSALAGYAFLVAITCLLTFAVRSIIVRRRAINTITDKRVSLTQEILQNVRFI
                     KFFAWENSFLERLRMTRKLEIDSLRRFLATRHSNTVSFTSMANFASLLSFMTYVLSGH
                     TLSSDRIFASLAVFNAIRLPLSMMNVVVTSTTDAVTSLNRLQEFLLAEEREDSITWDR
                     NMENAFEFKKASFTWESVPDIEAETPGVESIPVSASASPVSSWDDATKPASKSKDNRP
                     FRLMDIDFQAAPGELIAVIGTIGSGKSSLLGALAGEMRLTAGSVRMRTAPAFCPQYAW
                     IQNTTIRNNILFGQEYDDARYDQVIDACALRADLATFADGDQTEIGERGITLSGGQRQ
                     RLNIARAIYSNCDIILLDDPLSAVDANVGLHIMKQAICGLLKDRCRILATHQLHILAH
                     CDRIIVMEAGRVVDIGTFDHLVQRNEVLQSLVSVNHQEKEETPSSPSIADAVQVEKAC
                     PESKLKNRNAAPLMKDEERARHARRRDIWRAYAVSSGSMANIFIVFALAVLSAGGAIL
                     GGLWLSFWASNRFPQLSLGQYLGIYAGITAGQAAILYLFSVCVTAFAANASKVMLEDA
                     MYRLLRAPTSFFDTTPLGRIINRFSKDVQVLDSELGEALRLFLYLFLMVVAIMILVIV
                     YFHYFAIAVGPLLAIVILITIYHRASAQSLKRHEAVLRSVVFARFNEAITGIACIRAY
                     NMEVYFRQNIGRAIDSSNAAYFLIFANQRWLSVRLDLVCNTLLLVTGVLVVTSRFNVS
                     PSISGLILSYMLSISQTLQFSIRQYTELEQHINSAERLHHYGTSLEEEEKTAPLHRVE
                     VSSTWPAQGQITFQNVQMRYREGLPLVLKGLTMSIQSGERIGVVGRTGAGKSSIVSAL
                     FRLTELSGGNIRIDGVNIASIALHDLRSRLAIIPQDPTLFRGTIRSNLDPFNEYTDLE
                     LWSALRKAHLVDPPPESPPDGDKDARQVVNEQAAGPSQLHLDTRVDEAGLNLSLGQRQ
                     LMALARAIVRDSKIIICDEATSSLDYQTDQKVQETIAGMHGKTLFCIAHRLRTIIHYD
                     RICVMDKGCIAELDTPVRLWEQQGIFWEMCNQSGITREELERGPVGL"
     exon            complement(596318..597667)
                     /number=1
     exon            complement(597728..600256)
                     /number=2
     exon            complement(600311..600535)
                     /number=3
     CDS             complement(601503..602198)
                     /codon_start=1
                     /locus_tag="AO090103000227"
                     /note="predicted protein"
                     /old_locus_tag="AO070238000001"
                     /protein_id="BAE65686.1"
                     /transl_table=1
                     /translation="MGPTEPDILELPFTDAARGLRYRLSTSDDQASMRTIDSSFVTDR
                     VFQLQSRISNLELGDIGFGLDIKAVQLDTPLHKSFPDDEDSDGDDESPDCFTVVVEDI
                     NALSTMDSPTIDPNTTGNNNKIVAFISAKFSSWNARLIITDIEISPLYRRQGIGRNLI
                     RFAEALGSARWPVRHVWLEVSNVNYPAIQSYLKMGFKIAGLDVSLYVGTQAEGEFAIF
                     MWKDVSGSAEAVS"
     exon            complement(601503..602198)
                     /number=1
     CDS             join(605052..605488,605827..605899)
                     /codon_start=1
                     /locus_tag="AO090103000228"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000001"
                     /protein_id="BAE65687.1"
                     /transl_table=1
                     /translation="MTATGRYGSDPNNHPDQKELSNIMRNLKSSSDGTAAFVMGTDGV
                     LRTLTIDYDVIDAIGLPPRLIKAFLDRDVFNQNIEDMFRGADGTKVTQEQWWRPDPSL
                     LPPPLTAEQKAWIKKTNEENKEIIQENIRKMESGELKPCGVVIRRTCFNCMLTTALSG
                     VLHMNRFRF"
     exon            605052..605488
                     /number=1
     exon            605827..605899
                     /number=2
     CDS             610679..611119
                     /codon_start=1
                     /locus_tag="AO090103000230"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000003"
                     /protein_id="BAE65688.1"
                     /transl_table=1
                     /translation="MKVSRSYNVQGKCSSHSQIFYIYVLLYKIQISLAKISVCLFLLR
                     IFQSTAFRYTAYTIIGLNAAIAVTWVLVDGLRCTPVHLAWTGWAKEEQGKCIDFIAAT
                     FANSFVNIAVDAVMVAMPVYEVMKLNLSARKKLGVGVMFAMGLV"
     exon            610679..611119
                     /number=1
     CDS             join(611976..612008,612045..612178,612215..612227,
                     612267..612347,612362..612440,612507..612772)
                     /codon_start=1
                     /locus_tag="AO090103000231"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000004"
                     /protein_id="BAE65689.1"
                     /transl_table=1
                     /translation="MADSIFDHVSNGNTPQYPAGKARIENIGNIYFSFIVMAVSLILI
                     AFSCQELTQGGYIAFGKKYSQVCILWEDHRNDLFISGFGILTPIHWWIDPMGLLWLCT
                     SIEECKLLIGVTVLIFRWNHAGRRLIVEVDVVMDSQNNFETLPNVDRAFVHIDYESTH
                     RPEHAKKIYNNLAAERTDPVYQGHCMRQTLNSSQEATVLRR"
     exon            611976..612008
                     /number=1
     exon            612045..612178
                     /number=2
     exon            612215..612227
                     /number=3
     exon            612267..612347
                     /number=4
     exon            612362..612440
                     /number=5
     exon            612507..612772
                     /number=6
     CDS             613789..614619
                     /codon_start=1
                     /locus_tag="AO090103000232"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000005"
                     /protein_id="BAE65690.1"
                     /transl_table=1
                     /translation="MVLSLLIPTSTITASVHGTRELSPWKRRLWEWHVGWLGLCLSLA
                     GAFFVVLGLKDIVGKPRPDFLARCDPDLSNISAHLAGGLGLRREGAAVLVRASICQNT
                     DAAVIKDGFAAFPSGHSSFAWAGLLYLSLWLCAKFAIIPPSHRTGHSALTRNGPPAYP
                     LTSRPAAPPLYLLLIATIPVGLALCICATRYSDYMHAGWDIMSATIIGIFFACLSFRW
                     YHTFPSTRLISPTEDGGGWAFPPRSRPHALWVAYGSRGYAENDNISGYEDLELRPVGH
                     "
     exon            613789..614619
                     /number=1
     CDS             join(617373..617524,617551..617982,618139..618514)
                     /codon_start=1
                     /locus_tag="AO090103000234"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000007"
                     /protein_id="BAE65691.1"
                     /transl_table=1
                     /translation="MGIRSSLTSMNSHVIQPCGAQLTIRVYRICPFHRVPPYSDGCLY
                     SCNYPLISLFFSDHKLPHISPTRWLINPPAVLLAGCTSSNGMNNIYLVSLKYRNASTS
                     TPNDPSFINPSIAEKVYNLSQPRNTTIQEVRAGYMGLCLTRSDGAQFCSSNAAALASM
                     VKDQGLQGSNDTADPLNLIWIAKNFKETIVFDGLIFIAVAVAFICLLALATFPGWHEE
                     VDEDGSEREVKPFPSRRVSQAALGMSTLGFIFALISILWQHINSSAAGTMSESLTYGA
                     IESHVGTAAMVLGWAAVVCLGVVALALLVMIMSISLLRQLTEE"
     exon            617373..617524
                     /number=1
     exon            617551..617982
                     /number=2
     exon            618139..618514
                     /number=3
     CDS             complement(join(618631..620357,620414..621437))
                     /codon_start=1
                     /locus_tag="AO090103000235"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000008"
                     /protein_id="BAE65692.1"
                     /transl_table=1
                     /translation="MAQQQPSRRVLDWIKQQHAEAGDASRRTRKLKARPRNSLEDILQ
                     NDPAASGRTPQQIPLPGSRDGSATASDQRERGRNAAKSSLELIEHEDTFILPSSIPLP
                     PSLPPSPKLPPVLEQATENPPKKRQTYAEILDRAGGVFDHIKNGNVRKVPRVERTSIT
                     LYEYYSDNTASSVEIEDPEFISNYSDAPQGLSGRVFIVEDLSERTIHALGEAFGVTPE
                     FFEEHLLNSGYGGAQYDDPPARSWKTAGLNKSYVSIQWVRPMYRRQPLFSSRDREDLL
                     DLDHDGLDYISGNSIFSLKAETNIFRPEWDLRVDPRRTAKETREFGLVERASIWKKKA
                     KNRDYEIVIVLLDPLPAISYSHDQTQVIPKIDMNSDSDHDYRDASDSDGAGTRPILII
                     EGDDGVEALAIPIENPRRERTGRRVFDWLLRRKRPEVHRTKVNLERTIQVLVKQMASR
                     KPVTIDLEEAIVTGDLLATLQDELNETRSTQQEIHHMVEKKTAPVSLLDTLFEIIRQD
                     TLTLLRVLNEILSDMEVDILDDTKMEDRLTLWRQLLTKAERELLDLIASIKEFLAFFG
                     ITHPANTSPAASDESSDILRSVSDLFDQINQMLARLRRASSSLTSNMGLLDSRRSIDE
                     AHAVTRLTELAFIFIPLSFSASVFGMQIEPFEDSAPVWKFFVVASTVTTFAYLMRLTM
                     RSQWLASLKQNVKQDVRRYAEQHSIPVQVRSLSMLLLLRWFGSVLNRSGKATWSWINK
                     TSRKAGTELWQVIGFPVGLILITGIVAVAPIAVLWTRNMDQGVQGTVTAAIMLAILGL
                     VGIPYWRNSDPDFRYALPRVILRLFERIPPTTRLILIWALGIMAFVAIPLALIWTRPL
                     ASGIKAGLTAAIVVILVTGVGFLVMQLLYSRALNISRGTTISSSEGTSVSAEPVVQDL
                     RI"
     exon            complement(618631..620357)
                     /number=1
     exon            complement(620414..621437)
                     /number=2
     CDS             623811..625247
                     /codon_start=1
                     /locus_tag="AO090103000238"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000011"
                     /protein_id="BAE65693.1"
                     /transl_table=1
                     /translation="MGFSSIIARLLLGTVAILSFVGAINEQDFAPDDIVIRDICILGG
                     GSTGTYAAISLKDKAKSVVVVERHKILGGHTETLYLGNNQYIDYGVEGVFNDELSRKY
                     LKRLAVDYKPLLPSAQTTEYVNFRTGKKVPPPSGIPSVVEAAKVYRAAIEKFSYLKDG
                     LYNLPDPVPDELLQPFGDFVKKAGIEGSLQVVKIFAHGAGNILQAPLLRVLQLCGLPQ
                     VDSLLQGGYITPKNGMYEVYNRASEILGSDIFYETSVIETERSESGINIFVQSANGIR
                     KLIKAKQLLVTFVPIIESLNGFDLVRPESSLFQKWNWVNYYVAVVKITGMPNATTLVN
                     ADPDNTPGNLPLPPFQLELQYPGVDGYLVSKIIGNSTFTAQQAKDLILSDLRRMGTEG
                     TFPGGDPEIVVFGDHTPTTVSVSNIDVRDGFYRKLSALQGTKNTFYTGLAFCSDYSSL
                     LWAYTETVIGEMVASSASTCSLCVQGYD"
     exon            623811..625247
                     /number=1
     CDS             complement(join(625865..625946,626054..626173,
                     626276..626607))
                     /codon_start=1
                     /locus_tag="AO090103000239"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000012"
                     /protein_id="BAE65694.1"
                     /transl_table=1
                     /translation="MHFFTILATLSGTAIAFPTWGRFVNGTANGEADIHKTTVGDNNI
                     DKSRNSAAVSYDDHSPSMDLKDSNNEDNSKRPSLGSLLEKANVTVGPLTGDSPLVSGP
                     LISLPSPLLWFMGGLGLFDMAAKHILSTVITQVPDAMFNSSMTRNISLRMAKDNVYAR
                     GTLGKINHSEGCSSFHA"
     exon            complement(625865..625946)
                     /number=1
     exon            complement(626054..626173)
                     /number=2
     exon            complement(626276..626607)
                     /number=3
     CDS             complement(join(627719..628045,628096..628180,
                     628243..628412,628460..628966,629020..629101,
                     629157..629247,629290..629449))
                     /codon_start=1
                     /locus_tag="AO090103000240"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070333000013"
                     /protein_id="BAE65695.1"
                     /transl_table=1
                     /translation="MVLTAAQDTSNSPEAAPAYDTAAEKALVWKQDLRIVPLSAFIYL
                     LCYLDRSNIALLTPGNAKVLNKDTGNDLLSETNMSNYQYTIALMVFLVAYALFEVPSN
                     YLLKKLRPSRWIAFLMFAWGGITMGLGGSRNFADVTGIRFLLGVIEAGLFPGLVYYLT
                     FWYCVSERSIRVALILASATLAGAFGGAIAYGVGYLNRSHGLSAWRWLFIIEGAPSCA
                     SAILVWFLLPDYPETAGWLNAAELNLAKHRLRLEGSKSSAKTMSWSDAKTVLTDWRLY
                     GHYAIYFGISTPFSSLSLFTPSITAGLGYENLEAQLMTVPPYAVAYVVTVAVSWSADH
                     FNARGIHAAIFSCIGAVGFLASAVLPADAYQHRYGCLIVAASGAFSCIPPLLGWLSSN
                     LHSTAGAGLAIALNISFGAPGQIVGVWIYKANEATRGYPTGHWTNAALLFFVSVSCVA
                     LHIYYVVLNRKLRRSGQPKAYVY"
     exon            complement(627719..628045)
                     /number=1
     exon            complement(628096..628180)
                     /number=2
     exon            complement(628243..628412)
                     /number=3
     exon            complement(628460..628966)
                     /number=4
     exon            complement(629020..629101)
                     /number=5
     exon            complement(629157..629247)
                     /number=6
     exon            complement(629290..629449)
                     /number=7
     CDS             complement(join(630499..630548,632380..632943,
                     632995..633606,633664..634294))
                     /codon_start=1
                     /locus_tag="AO090103000241"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000014"
                     /protein_id="BAE65696.1"
                     /transl_table=1
                     /translation="MLNTRPIRIGNVSGATGDHPQAMLRMAQHGNVDVIVGDWLSEMN
                     IAWNAITKSQDPDLGYEPGFLAQLSDCLDIVVAKDIKVVANAGALNTSSLMQKVCALC
                     KERGHSKVIVASVLGDDISEPIQKKEPGFQDLHHLDHDEWKLKDWPLKPHCAVAYIGA
                     WGIVEALNAGADIVICGRVTDASPVISAAAWWYRWQRDAWDELAGALVAGHLIECGPY
                     VTGANFSGFKPLLPNLVDLSFPIAEISPDGSCIITKCEAYGGAVTKFNTIAQLLYELQ
                     GELYLNPDVATDLRNVSVDEIGPGRVRVYGAIGQPPPPTTKAMIAAPGGYQAEAIFYI
                     NGLDVNEKAEMLRNQLDHALRGNGFCKLSIELYGSPAINPSSQQAGTVFLRIFTQARN
                     IEDISAERFKTLIYALRMQSYPGYHMNLDFRMMDAKPFMEVFPAVIPLDLLYHRIILS
                     NGIQQGAPSAPVTRIYPIQRPSYETKIPIPLSQFGAKEAAPLGSIVHARSGDKGDNFN
                     LGFFVRNSDEYPWLQSFLTVDRFKELLGDDWPKRENEPRAERCEFPKLLAVHFRVLDF
                     LDGGIASSSRIDGLGKGIGEYLRSRVVDIPKKFLERGNAGASEEAVVRGETG"
     exon            complement(630499..630548)
                     /number=1
     exon            complement(632380..632943)
                     /number=2
     exon            complement(632995..633606)
                     /number=3
     exon            complement(633664..634294)
                     /number=4
     CDS             join(634844..635183,635235..635812,635852..636478)
                     /codon_start=1
                     /locus_tag="AO090103000242"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000015"
                     /protein_id="BAE65697.1"
                     /transl_table=1
                     /translation="MRVLSITYVFAVLQVVKGIPLGRQEKVGCASLAGAQIDNAAHIH
                     HAQNVPIGGLTLSSNGSPVRNELPLCHVQGTINYMAGGDATPDPRGNNTLTWELFLPD
                     QYHYNGRFLAVGNGGFAGDIDNATMLTNLNSGFAVAGCDSGHPLLESEASGPNDSVPF
                     LDDIAKVKAWIHNSIAMTTNVTRSITANYYAEQPAYSYFWGCSTGGAQGYALAQYHPT
                     LFDGIYAGSPGNWYSHLILSFLWNGLHATGEGFMSQDALNLITKRTVAACDELDGVKD
                     GLIENPLRCDFDIRTLECQPGQTAISNNKTIYAGPKDQRTGKQIYPGFDLGSENGWLA
                     QETYLYSSYAAPILRQLVFKDRTYNVTSFNWGSDVDHLDYTASPAIDEISPDLSAFSQ
                     RGGKLITLQGWADQYNAATWPIEHLKQIQSTMKGQDVPDFIRLFMVPGGGHCGANSAY
                     THVPATYHALDALLPWVEDGIQPGEVMSSAPPDGSNTTRKLCVWPKEPRFLNGSPGDW
                     QSYTCV"
     exon            634844..635183
                     /number=1
     exon            635235..635812
                     /number=2
     exon            635852..636478
                     /number=3
     CDS             join(638764..639150,639209..639372,639440..640237,
                     640308..641079)
                     /codon_start=1
                     /locus_tag="AO090103000243"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000016"
                     /protein_id="BAE65698.1"
                     /transl_table=1
                     /translation="MSQKTFDRAETVELLSIPRDEEPLGPNSSSEDGTDLSDRTGVQS
                     TRKHRKKRKTENWKRSLYLGSLSSIIVLLFNVSFVAWAVSHHDLTEDRGVLYTGDCTK
                     TKRMSTGIHLVINILSTALLCASSYTMQCLCAPTRAEIDRAHQKNQWLDIGVPSMRNL
                     FRISKMKLILWLILALSSLPLHLFYNSTIFSTITNLEYEIFAGNKPFSDFNANNVRPP
                     HDFIDKNNTMYTNPYFSFSRMLDKGLHNELYRLENADCMSAYATNFQSEYGSVLLLTD
                     DFHPNDTDFDFLSIQGASTPVKGNNPYAWMCCNQTVYACDMQTLCRDQLPEIRTHVDN
                     WIVGGYRVNYCLAEKVPGNCKLEYSLPLAIIVIVFNTVKAIIICAVALTMTDLPILTT
                     GDALASFLKTPEIRDRDHCLMTKALAKNPPSKPLPYKAKPQRWATAVSTVRWIICIIC
                     YTIAIAICIGLLCFGLSQITNKGNLWSGLGITNTETLISGNTWPPSLLTNTIIANTPQ
                     IIFSVLYFTSNSVLTTMTLAAEWSNYALHRKGLRVSSTPQGSQRTTYFLSLPYTYAIP
                     LLIFSTVLHWLISQSLFLVNVETYDMQLERFRLFDFATCGYSPVAIVCAIVVGGVMVF
                     GLVGLGFRRFGSGMPVAGSCSLAIAAACYPGVSSVDGCGDAVETMPLRWGVVYQGTGD
                     GVEVGCCGFSGGEVGMPVDGMVYR"
     exon            638764..639150
                     /number=1
     exon            639209..639372
                     /number=2
     exon            639440..640237
                     /number=3
     exon            640308..641079
                     /number=4
     CDS             complement(join(641653..642508,642560..642643,
                     642696..642821,642888..643504))
                     /codon_start=1
                     /locus_tag="AO090103000244"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000017"
                     /protein_id="BAE65699.1"
                     /transl_table=1
                     /translation="MGSELGITPETKPQAVYTPVSIWWACWAGVWTTAVALGMIYLIA
                     NRNMPTLRIRGIGMSLSAIVLLHLYWASVQFGVMIGPIMPGDAQYWIMGTYLGCGIAL
                     FHASNTRFLHVAKHQRKFAHHNSRISESVPDEKPKGGLFARFRRLEYTKRILILVAIA
                     MSFQIFLTILLWVISRKWHSSWGIPGTEVTGTPSEQAAKQGTGWEWWPTAFFQFFWAW
                     IVAPFVLWKARHIHDTQGWRVQTIGCAIANLHATPMWLIALYVPAMQVVNQYWIPPQW
                     ICLSIWIMEIFTVFLPCWEVMRHHALRQETFNAIEQWESKMKKSGSEARSLNSIPTLV
                     DSMMSGWKSHNGSVDTTGSRDSILTMGALEHVLERNPAPLQKFSALNDFSGENVAFLT
                     SVAEWKNSLPKALRENTDPMDNNMKELLHERFNRALHIYVKFISVSQAEFPVNISSQD
                     LRKLENIFEGPARSLYGEKRAAVDPVTPFDTPSFPMKSLSSPSFGNGSQVELHPVSSD
                     DRVQFWGEVPEAFGPTVFNDAEKSIKYLVLTNTWPKFVKSRRSSDPIKEEAV"
     exon            complement(641653..642508)
                     /number=1
     exon            complement(642560..642643)
                     /number=2
     exon            complement(642696..642821)
                     /number=3
     exon            complement(642888..643504)
                     /number=4
     tRNA            648452..648523
                     /locus_tag="AO090103t00006"
                     /note="tRNAscan-SE"
                     /product="tRNA-Gln"
     CDS             complement(join(649143..649328,649392..649850))
                     /codon_start=1
                     /locus_tag="AO090103000246"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000019"
                     /protein_id="BAE65700.1"
                     /transl_table=1
                     /translation="MPFIRTYFMNQRILCYISQVLSKKSVRVCELVKESCQGKSCPPC
                     LPQYNPNALEELTIYDRPEAQFIQLTKATDLVPESTVENVYNQLKPVPPSFLIGKWNG
                     GDIDTGHIGHKLLKEMKWAGKDFRSVDDGDPIMVHDAEGNRVWKEDWGHCSLREVVYR
                     GVTSTAMIYDQKPIFDHFRYVSDDMVAGAMDTPKLFGAKGTYYFYLTRRSSSSL"
     exon            complement(649143..649328)
                     /number=1
     exon            complement(649392..649850)
                     /number=2
     CDS             join(651974..652224,652275..652359)
                     /codon_start=1
                     /locus_tag="AO090103000247"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000020"
                     /protein_id="BAE65701.1"
                     /transl_table=1
                     /translation="MLLSGGLIEVVKVPEGGGNETVQVIHQSVTEFLRARGLAYLATL
                     AETDKKAICVMPDTEPPGNDDIHNCPAPFDGSCLNHLVTEVPDESSFRLGIPGKQLCS
                     HSIDNSVMS"
     exon            651974..652224
                     /number=1
     exon            652275..652359
                     /number=2
     CDS             join(653441..653953,654006..654416)
                     /codon_start=1
                     /locus_tag="AO090103000248"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000021"
                     /protein_id="BAE65702.1"
                     /transl_table=1
                     /translation="MLEHAGVPKSDVAKWVGFTTTITATCAGLMGVIWGMASDSMGRK
                     RVILLELNLMLVFVFLFGFSQHLALLVLFRALIGLVSGSVGIMRTMIAELVPEKLLQP
                     YAFSILPTVETIGSGFGPAIGGLLARPAEHYPGIFGRIGLFKMFPFALSSVASSCVVA
                     FAITMASSSLRETQPGRKDSPDDGLMIAKILSSVWALRTRKADIRPEVVDETTALLGD
                     TIEDVEEVLEQRAAELVGRWKSVISPQPILLVLISGVMSMHTVAFDSLFPVLLHLPKQ
                     HLKGNPDVHLPFKFSSGLGLGKLPSALLPFY"
     exon            653441..653953
                     /number=1
     exon            654006..654416
                     /number=2
     CDS             654484..655014
                     /codon_start=1
                     /locus_tag="AO090103000249"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000022"
                     /protein_id="BAE65703.1"
                     /transl_table=1
                     /translation="MVVQLVIFPWAARKHGILQCLKLACTVFPILYLVVPFVPLLPQP
                     LSSVAVVALLVLKMAGAAFVFPCCTILISEVAGAIGMLATVNGIATSIIAFGQALGPG
                     VMGPTFSFGVKLGYTILPWWLLAGFAFLSSLPVAWIKEVDIKLPEEGLLPNEEEQQVG
                     DGENDMEARGRQPTLI"
     exon            654484..655014
                     /number=1
     CDS             complement(join(657620..657780,657830..658259))
                     /codon_start=1
                     /locus_tag="AO090103000252"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000025"
                     /protein_id="BAE65704.1"
                     /transl_table=1
                     /translation="MTAYWTLVILTQQPFTTQNRFGINLHSKVKHEAMDKCIEAAFNI
                     RALAEAYQRAFTLRRAQFGIPYAMHSAVLILLQSDSQGRDDYTEACRFFWSALLKYQK
                     GCGSGLKKPLALLKSLMLRVAKLAPCITVNTSDAVSWSSLHAANIGTDLVPGTITLGE
                     DGVEDVCQFNVHDGAKHTFLDDDTIFGFFTDGAALS"
     exon            complement(657620..657780)
                     /number=1
     exon            complement(657830..658259)
                     /number=2
     CDS             join(665756..666028,667244..667348)
                     /codon_start=1
                     /locus_tag="AO090103000254"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000027"
                     /protein_id="BAE65705.1"
                     /transl_table=1
                     /translation="MAMPAYAEGGLYPSVEFLRGYMYPEWLHAVHDYAESTGESPCPS
                     VASTTTSLLPYSRSGLLELALYNATVTNSNECSSMCYRRGVPPHNKTFQAMHAQRQHQ
                     IEPSMGGNNSVANFKRGERLILP"
     exon            665756..666028
                     /number=1
     exon            667244..667348
                     /number=2
     CDS             join(673027..673537,673567..673580)
                     /codon_start=1
                     /locus_tag="AO090103000255"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000028"
                     /protein_id="BAE65706.1"
                     /transl_table=1
                     /translation="MSLTIMTPFLAGKIRSFLRLFRRKSKPIPPPPQQELQDILIPPP
                     PQQELQDIYIPSPPQQELQDIFIPPLLNLPLDILFEIFPLLPLPSQVCLALSCKPLYR
                     LFSSTLQDEKLAWPSLLACKTFRLPDTLSSNEAPLSSPRTQLLLQLEDDWWLYCAACL
                     KIQPRALFRQEMHI"
     exon            673027..673537
                     /number=1
     exon            673567..673580
                     /number=2
     CDS             join(674177..674202,674245..674268,674333..674402,
                     674424..674507,674560..674709,674777..674860,
                     674931..675075,675157..675204,675247..675739,
                     675758..676019)
                     /codon_start=1
                     /locus_tag="AO090103000256"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000029"
                     /protein_id="BAE65707.1"
                     /transl_table=1
                     /translation="MAIAHFAGRCLAIPSSWYGREPFASALCQIPSINIWDDHDPTSL
                     MSNIEHFKIIDGFGSYANETMECSVFRAIGALAHKYYMLFQHHLSPGNVDDSMQDTYI
                     ADTIPEPQYVLGPRPGPYIRAQSHNIFTRLGARIAFLGVDARTERNREQTNYRETYDC
                     LFARVNAELDAAAWCGRPIKHLILLFGIPLAYPARSAGRSFQRLSDKLGIDAVFPIGK
                     NAMNPFDNAIELLDDLNDHYTSNAHRNERRYLIERIQCVCAAHSVRATILSGDVHLAA
                     VGRFFTTHKGDILPIEEDFRFINNVISSAIVNQPPPETMAKLIAHGDKIRHLNAETEE
                     CLFKLFRSNSTTSAKKPEGTTVAMPRRNFSIITENSPNNEGKLSWRQFFAKHGNRPLH
                     FGEANAGTRHIAASNQHGKGNDGSLDVCFCVEADHQRHDGQTVGYGFTIPALEYRGPA
                     LSEPVWSETTS"
     exon            674177..674202
                     /number=1
     exon            674245..674268
                     /number=2
     exon            674333..674402
                     /number=3
     exon            674424..674507
                     /number=4
     exon            674560..674709
                     /number=5
     exon            674777..674860
                     /number=6
     exon            674931..675075
                     /number=7
     exon            675157..675204
                     /number=8
     exon            675247..675739
                     /number=9
     exon            675758..676019
                     /number=10
     CDS             complement(679352..681304)
                     /codon_start=1
                     /locus_tag="AO090103000259"
                     /note="ankyrin"
                     /old_locus_tag="AO070333000032"
                     /protein_id="BAE65708.1"
                     /transl_table=1
                     /translation="MQIEISRYCYFDDEMIPLLTPVQIAAKVNNPGLVHMLLQHGASA
                     MACPVSAHPDFKLYFSRRAEEDWNVTQRYKPRYDSRQKVYTALQYGALNQNMEIIALL
                     MCTGVAPDSRVAPYVNDTPLQMSTRLGNVEMFRLLWSWGADLDAPPAARNGRTAVQGA
                     AESGNLMILLMLRRAGAQINEPAGAEQGMTALQAACLNGNSLIAGVLLAHGADLNLGP
                     SSVEGLTAIQAAAAHGDIRLVRDLVTLGAEVNAPASEGGMTALLAAIKHESLPLLELL
                     VQHGADVNATGAYGFLSPLTEAASRNWLGGVQFLLEHGANVNDTPFDLAMSDESEEYA
                     PRELLSPLGWGIKSLSLKMVDILLQHDADVLVAVIYNQSVSRSALMHAIHEGSSHEVI
                     DLLLTKVPGLQNHPGWEDAFKVALVDSFEVDTIYCQRILAKVNSLPPLLRHRAIQKAW
                     DALSSYDDDLNDADETLVETIELLIESGVSLDSRAEDGCTLLLRAAYYGYDKSCTSLI
                     AHGAAVNIYPTNDWGTPLQEAINSSHVNIANVLLEHGADINAPPAENRGVTALQAASI
                     NGMFELAVRLLDRGADVSAPAAPRNGRTAIDGAAERGHFDMVQLLLNAYGKDADLEPV
                     RRQAANYAEKEGHLEISQWLRGFSAG"
     exon            complement(679352..681304)
                     /number=1
     CDS             complement(681368..682138)
                     /codon_start=1
                     /locus_tag="AO090103000260"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000033"
                     /protein_id="BAE65709.1"
                     /transl_table=1
                     /translation="MRELTPQSDSDLPQLHVGPDSRLGTKNDLNIYLPPEDLEIGNSS
                     TTNLRALQGKSPFSILKVFLQRFAFLSANNRLDQWQFNEVFSWIVEKGGANILLFLCW
                     LKSPLMKVFARKVFCSAVMFGDISLGRKVLQCGVRLKTDDPTQRSRLTDYLSTAIHGR
                     HEAMVELLCKAGIHPEVNNRWSWRDDWDLQLPILHTLLAFGADPERFFIEEGTGFPLI
                     NAALNGSLKAVQLLLDRGARVNLYLARYYGTALQAAAS"
     exon            complement(681368..682138)
                     /number=1
     CDS             complement(join(687546..687579,687616..688069,
                     688100..688349))
                     /codon_start=1
                     /locus_tag="AO090103000262"
                     /note="1-aminocyclopropane-1-carboxylate synthase, and
                     related proteins"
                     /old_locus_tag="AO070333000035"
                     /protein_id="BAE65710.1"
                     /transl_table=1
                     /translation="MQDVILDYIRTRAASGLDRTSLTYHEGPFGSRRLREAMAKLITT
                     YFYPASPITSDNILFTSSVTSLNAVCALCLTDPNDGILLDLSVPSGCQLIYTSFQGDD
                     PSGPSAVIQYEEAFLKARDDDGVSVRALLICNPHNPLGRCYPRETLEALLQFCQKYQI
                     HIISDEVYALSVYEENTSTDGFISLLSIEPANNGVNPALIHVLYGMSKDFAAAGLRLG
                     CLISQNQNFLQAALSISNYLTSARQCG"
     exon            complement(687546..687579)
                     /number=1
     exon            complement(687616..688069)
                     /number=2
     exon            complement(688100..688349)
                     /number=3
     CDS             complement(join(689076..689588,689650..689841,
                     689913..690322,690383..690472,690524..690917))
                     /codon_start=1
                     /locus_tag="AO090103000263"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070333000036"
                     /protein_id="BAE65711.1"
                     /transl_table=1
                     /translation="MGYATFYRVLSPRQLNVMIQAFSLVCIFFEGYDQGVMGGVNSSP
                     RYVTEVGIGEPDGTVTNTTHQGGIVSIYYLGCIFGCFGGGWLADRLGRINGLLIGAFF
                     ALVGGALQAAAQSSDFMLVARVVTGVGTGALTGIAPVLVSETSTADHRGAFLGYVFIA
                     NYLGISVAYWLAFGLAFINRGYSDIRWRFLLAFQCVPALILLLFIKMLPDSPRFLASV
                     GRYSEAQEVLNRIRCHKASQSEIDLEYKNIIATVEEGKSSSPVQFAKILIGRGGKPGA
                     NLGRRAWLCVWLQIMASWTGITAVTAYSPVLLRQAGYSELTQNGLAGGLNTIGILGTI
                     ISAQIVDRIGRRKCLILGSVMLFIVELVAGSVYEASLHRPDKADQLAPAAVAMLFLFN
                     LAYAATWGTVAFLIPTEIFPSNLRAQGNGFGITGWAIGVGMTTLVNPIMFGSIGSRSY
                     FLLAGLNLLWVPVIYLFYPETRNRTLESIEYLFSTSRPFHWDMERAYRLCKERKDQEH
                     IDEQAIKASSQDEVQQEFYESIPQ"
     exon            complement(689076..689588)
                     /number=1
     exon            complement(689650..689841)
                     /number=2
     exon            complement(689913..690322)
                     /number=3
     exon            complement(690383..690472)
                     /number=4
     exon            complement(690524..690917)
                     /number=5
     CDS             join(691517..691588,691659..691733,691797..692966)
                     /codon_start=1
                     /locus_tag="AO090103000264"
                     /note="predicted molecular chaperone distantly related to
                     HSP70-fold metalloproteases"
                     /old_locus_tag="AO070333000037"
                     /protein_id="BAE65712.1"
                     /transl_table=1
                     /translation="MDPNPSMSRSLDLTVLGLNSGTSMDGIDCALCHFQQETPESPMR
                     FELLKYGEIPLEQTIKQRVMNMILHNKTSPSELSEVNVILGETFAAAVKEFCAQYNVD
                     ISSIDVIGSHGQTIWLLSMPEEGEVRSALTMAEGSFIASRTGITTVTDFRVSDQAAGR
                     QGAPLIAFFDALILHHPTKLRACQNIGGIANVCFIPPDSLGGVNACYDFDTGPGNVFI
                     DAVVRHYTNGEREYDKNGEMGARGTVDQDLVDEFLQTHPYFRLDPPKTTGREVFRDTL
                     ALDLIHKAESKGLGPDDVVATVTRITAQSIVDHYRRYAPKDLPIDEIFMCGGGSYNPN
                     ITQYIQSQYPDTKILALDQAGIPASAKEAITFAWQGMEAIVGRSIPVPTRVETRQPYV
                     LGKVSPGKNYRRVMRQGMRFGGDRDELSPVKEVVNYVDGKEWNNKW"
     exon            691517..691588
                     /number=1
     exon            691659..691733
                     /number=2
     exon            691797..692966
                     /number=3
     CDS             complement(696010..697131)
                     /codon_start=1
                     /locus_tag="AO090103000265"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000038"
                     /protein_id="BAE65713.1"
                     /transl_table=1
                     /translation="MASSTQVLPVPAPFSNSSYELSFWGPSYKCQRLGEALMEIDGVT
                     QKLWDSEFPDPQFQTTRIYMGTAPSDLNNTIFISAAGSNPLWNDNATQPTELVCQLWN
                     TSYVVDMHFTNGIPTLTPISVDHVAYANWSEGAASSSAAPSYSGLDPTVNAGFYIMHM
                     ILSGLLQGELVQSKRAGVWENKTVASTTTYTDTSFAYTGLFSCPELWNTSSYYYSHGN
                     DSTGLCRNGTLAQAIEDLSHNFTYSLLSLNGGNTTVKVVDLTYRNYYIYGPTSLLAAY
                     MSALAVTIACVVVGFCSLRRNGVPQNNSFSSFLMTTRNPELDRLAIGHCLGSEPLKGN
                     IDKVRLQFGEVEGANLQHRHAAFGSKGSVTTLSKGEDYY"
     exon            complement(696010..697131)
                     /number=1
     CDS             complement(697350..697862)
                     /codon_start=1
                     /locus_tag="AO090103000266"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000039"
                     /protein_id="BAE65714.1"
                     /transl_table=1
                     /translation="MSPITYNHLADCDPVPDKRPHSPAPATVSESESVQETQTPAAWG
                     IGWRCPALMVGLVISGAMLSVGHHYYYKSFDGGRVASREEQTWAIRIGTGFAFLIKSC
                     LVSAVGLAAVQETWATLRRKSVRLSGIDSMFAIRDSPLAFLTLDLWIYAKTLTVLGIV
                     SWYVHLHGYS"
     exon            complement(697350..697862)
                     /number=1
     CDS             complement(join(699253..699616,699677..700305,
                     700375..700977))
                     /codon_start=1
                     /locus_tag="AO090103000267"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070333000040"
                     /protein_id="BAE65715.1"
                     /transl_table=1
                     /translation="MALRFRPPKPSQKILPVKPTKGHFLFAHQEFKRVPWWKRKNMRT
                     LYIYIVILIMTNTANGFDGSMMNGLQTLSYWQEYFNYPHGSLLGLFNASMSLGSLLGL
                     FVVPYMIDAWGRRLGCFVGCLIMLLAVGLQSGATGFGMFIAARLLIGFGDCLVLGSAP
                     LLIAEIAHPQDRAVLVTLSGASYHSGAFIASWVTLGTLKIQSDWSWRLPSLLQAICTI
                     VIVCGIWLMPESPRWLMSKGRHDEAMRNLVKYHGEGDPDDAFVHLEYAEIKAAIDLDK
                     EIDQTRWVDFLKTKGNRKRIGLITALGLFSQWSGNGLISYYLKQVMDSVGITKASTQL
                     GINAGIKTEALVTNFTLAFFIDRLGRRPVYMVSTVGTCVVFNAWTIVSARYAITANQA
                     LGYTFVVLTVLYGVFYDIKSGLMATYTTEILPYGLRAKGFTWLNFCVTAALFFNQYIN
                     AIALDAIGWKYYIVYCVFLGMEVFVIYTFLIETRYTPMEEIAKYFDGDDAVDVGEIAV
                     ADMKEQARESEGKAAAVHVEVKE"
     exon            complement(699253..699616)
                     /number=1
     exon            complement(699677..700305)
                     /number=2
     exon            complement(700375..700977)
                     /number=3
     CDS             703020..704102
                     /codon_start=1
                     /locus_tag="AO090103000268"
                     /note="beta-xylosidase"
                     /old_locus_tag="AO070333000041"
                     /protein_id="BAE65716.1"
                     /transl_table=1
                     /translation="MQGSGGIGPGTTINLFEINLKTGARLSEEKIIWRGTGDIYPEGP
                     HLYKHKGWYYLLIAEGGTHGGHMVTMARSQNVFGPYDSCPNNPVLTARDTQEYIQYTG
                     HCELFKDEKAQWWGVCLGGRLDTQGRCPMGRETFLTRVDWDGEWPVFDQVELNPRGLL
                     ATRSSPRLTAEGGLDYLYIRDAIMSNYRLENDHSSLTLTASSVDLSHPADSPTFIGKR
                     QRKLAGTSSVVLKGIEDSWSSAKIKAGLACYKEEHRFSRIYYDADQQAVVLELVNAAK
                     KIVRTEKHTLGEAPCSLLFRIEYTEKQYSLLYSFEPHVGNDWTCLGTVDTLDITDPDF
                     TGPIIGVYAVGQMEGVQVQFDGLSVE"
     exon            703020..704102
                     /number=1
     CDS             709278..710936
                     /codon_start=1
                     /locus_tag="AO090103000269"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000042"
                     /protein_id="BAE65717.1"
                     /transl_table=1
                     /translation="MTASKTGVDLSNPGDLTLKKQLDLLEASGAIKRFDSHPFVKNII
                     DSRSLPTRKDIEVGPNDPTTTSQLRRAAAKNNTLVVGGAVVKNLSLLLAKDQDTVAEV
                     PLRAFPAVTKPTPKANSLLIAPVNADHLTLLLSPPSPTSYFQFTSHVAPDPVRASSFA
                     DEATDADKSMPADIINGYSLSGDLENFWGIKGLTGKLYVYNGDTVREKVRFSDFAFDA
                     GKNKPLSKLEHSPLAKFFPHIDMEPIKQLPINNVEFTYTEADNDFLYKKGLRLEGDVL
                     CTGHLQPVADMLRRIYGDKDAPSKLHVSAHLSDERDWTKAPKITKLILSATLVDGKLK
                     VWDFLAFDSVDVQILALQKDKQEKVKDDKDKDESNDAATEAKDEKQATEPESKAGKVA
                     DKATEKVSKATGIASKASDYKAQKKAEATSSQEVSKKATKESTEKGKEDAKDDKQGEG
                     EAQEDDTAAIDEKADQKAPAKPEKTWEFGLCILGTGSLINLPKATKPLWVKYRMERDP
                     QETTKALYKVHITAEDWKNAFGVKNLNVRLCPLLYIYSKCYSEC"
     exon            709278..710936
                     /number=1
     CDS             complement(join(711394..712079,712253..712352))
                     /codon_start=1
                     /locus_tag="AO090103000270"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000043"
                     /protein_id="BAE65718.1"
                     /transl_table=1
                     /translation="MKILSVAPSVNLGSVATSIPAVNFSRPNLGCSFAIGIGGSIIAH
                     SEIPTREAVNRLVDVHQDVVKYGIQRRTILDSIALHIDLAVVYITLGRSHQSHILKGK
                     VKIGVLNVMEEFRQVESINNAIHKPFSLLGLSLASVEQAYPEITSGVVDVTSHRELAL
                     AVAEILVNDLFLLFDLVVFCAGVNRIGRLCFRVSSLFLGSIFDGLGFFLFLFLIFFLL
                     TLIGLVDLWRLGPNFNIQSCLLHGNFRAFNLEVSNITVYGQPS"
     exon            complement(711394..712079)
                     /number=1
     exon            complement(712253..712352)
                     /number=2
     CDS             712702..713832
                     /codon_start=1
                     /locus_tag="AO090103000271"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000044"
                     /protein_id="BAE65719.1"
                     /transl_table=1
                     /translation="MKVSETDGEMLSVSVDKFNVCKIIRYAGQLTEIKELQKIGNGED
                     VFIINQGSLYISSGVGIGGKSYPRGISASASVTIFDQTGQFDARVDDSGFTGKGSIDR
                     FKLGALEVSAASDVTKPATFDIAMTQDEQKIKVDGMIHYHDIKLLALVDADLQKLPPM
                     FNAHLLLEFTGQYKIDFFFNASLGSVKSLSEVNLDFSALIEGDLFDLICDGVNSFLDR
                     TQKLVDQGFDSAKQKLENELSEKNKELKSLQEDLERRDQGMKEHEKKRQHDLEEAKRK
                     VKENNDKLAALEKDVKDAKKNKEDAEKRYRNELKKQQEERNEIVARKRREYEEKLRKL
                     ENDERDYRTKKENLEATHRTNYGEKETALAWFKQHKEDTWSE"
     exon            712702..713832
                     /number=1
     CDS             join(713892..713983,714319..714817)
                     /codon_start=1
                     /locus_tag="AO090103000272"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000045"
                     /protein_id="BAE65720.1"
                     /transl_table=1
                     /translation="MISKKLKKQCMTGMTDGTMPHGWIKALMSICNSKEQKAIRDAEG
                     KLDANKSNILEIIQENDNKIRELEENNERKVLQQEYDNKRAECTKLENAVHTVEHVLN
                     SLQADFDNGIIAIKGEVTAWRDFLPRITRIEAKASSNALKSNEPIFVIVTAVYKGITK
                     TFGVQWTPNSKSKPYDLYKAIGDSAKGSFPVPAGSS"
     exon            713892..713983
                     /number=1
     exon            714319..714817
                     /number=2
     CDS             716414..717271
                     /codon_start=1
                     /locus_tag="AO090103000273"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000046"
                     /protein_id="BAE65721.1"
                     /transl_table=1
                     /translation="MSLQTPSPLLRLPSELRLEIYRHLFGIAPHTRLRVGEACLDSDL
                     PHSTERSWRLSKAFEVYMHRPSPPNASEYAEMDYKHCSATEQSRRNIYREHRHLFLAI
                     LATCKTIYEEAMPFFYSSTFFAVSGNIAKASNWLYAMSHERRKYIRRLTFHFWSKALS
                     ECFSNQGNMEHLAKQLTYMDQIDVVELLITDTRTEDELLDFADAESQGIPQYAVSRRP
                     CEPLVLFGVEQLEAVPNLGCLRIVGRIDRLLVYTEDKEYLKAFAEGRKRAGLGKENGH
                     RPVVELVQL"
     exon            716414..717271
                     /number=1
     CDS             join(718717..720306,720372..720815)
                     /codon_start=1
                     /locus_tag="AO090103000274"
                     /note="sodium-neurotransmitter symporter"
                     /old_locus_tag="AO070333000047"
                     /protein_id="BAE65722.1"
                     /transl_table=1
                     /translation="MVLVPYLKKIARWLAPPPPKSEDGRDQWPSRAAFLLAAMGGCAG
                     QGNLLRYPSVVYNNYGLQWFIPYLLAVFLIAIPALILEISIGQAYRGGSVIAFNNINR
                     RLKGVGLGPILVSFIVTQYFTVNLAWIMNYFRNSFYSPLPWEGRIEEFYMGDVIHNVD
                     PVQGSLSEGNKDVVAFTKYPGLAVIGETVGWSAFIWFLIWVSIFRGVGLTGRVVYWTM
                     GLPIVTTIIFVGRSLSLENASEGVRLLWATWRSSELASGTVWQTAVGQVFFSTGIGFG
                     YFTSYASYNAKHSNAVMDAILICGSNVLFENFAAFAVFGVVGYLRRWPQEGERLGAFV
                     VGFLTLPEAVLHMPGSNFWAILLFFTLVVLGFSSAFVMLDAVTTLAVDSGLKVSRPII
                     VTALTLISFLLCLPYCTEFGFYLLDGIDRWINNIALIFVVWSELVGATTVYRWTDVVG
                     QTGLPAFVVYNFGYFGGQIVGISVGHGTENPSVGAGAGFGLYIVSVAVAVCIATTPEA
                     EAARFWNRNAVLRRFWFLVFYSGNQLRRDLNQIIGGGRNWKIPVFWPVLLRYISAPVL
                     AIIFSFAYPEFHTLRYDPMMIAGFILAHLCLLAMLLGLVLPRYYDCFIPPSRYGESTQ
                     GTIPNEPRPQDLGQPAMTSFHGTEIEAVPAVSALGDIQSLEFKSHSGHVGMKL"
     exon            718717..720306
                     /number=1
     exon            720372..720815
                     /number=2
     CDS             721634..723247
                     /codon_start=1
                     /locus_tag="AO090103000275"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000048"
                     /protein_id="BAE65723.1"
                     /transl_table=1
                     /translation="MFQAESHSHDKIAEKVLECKQLARDVKKKRPSRGCLPANLYRSF
                     PDRRVMDELIEIYFATFESCYRILYAPSFREDYRSYINHPESARGPLLLQLALLMALT
                     GTLHRDVNIRSEMMSKASTWIHIAQTWLSAPLEKDRLTLEGIQLHCLLLLARQVSRIG
                     ADLVWISAGSLVRIAMQMGLHQDPDCLEEMSITQKKIRRRLWYTILEINVQSALDSGM
                     VPMITDIDYNTQPPSIAINGEAQDNTQVNTSNGMSFQHLLAKSLPLRLRATRVINNLQ
                     DEPSYDEVLALGDELALECGKAAMAIEHDVSDTDTRSVSFASSFCNHLLRRFPLCLHY
                     RYAVKAKKNPIYCYSQKACLSGAQSLLLLLEDDMYHRLLLTGGGMFRDLITWGAMFIF
                     LELCPEPDADMSMFARKTNRARNQPLLQDARRVVQYARDRMWNGETNVKVYVCLSMMM
                     AQAEARLGGLPVKDAITKALHESLGECHSLLKAMAADSSVSTTDPVLDSWASSGLMMP
                     LFADLDADFDFLGDGNVDMSFLDTCFDLQ"
     exon            721634..723247
                     /number=1
     CDS             complement(723476..724762)
                     /codon_start=1
                     /locus_tag="AO090103000276"
                     /note="2-polyprenyl-6-methoxyphenol hydroxylase and
                     related FAD-dependent oxidoreductases"
                     /old_locus_tag="AO070333000049"
                     /protein_id="BAE65724.1"
                     /transl_table=1
                     /translation="MPQLKVLICGAGIAGNALAFWLSKLGHETTVIERFPKIRASGLQ
                     VDLRGPGIEVMRRMGLEEAFRARSVPEQGLQLVDDKDKSWGYFPANRSGRGLQSFTTD
                     FEIMRGDLCQLLYDVTKDRVEYRFGFCVKKLAQTEDYVDVLFSDEGRERFDLVVGADG
                     SGSHTRKMILDAGAKDPVHPLGVYAGYFTIQKSLQPGEGYNATAFIAPGNKGIMTRRA
                     DPHKYQAYLFCNPNSSHRLNSATKGDIEDEKKGLAEAFCGAGWKTSEILKGLVDADDF
                     YCERMGVVTMDYWSQGRIVLVGDAAYCPTAMTGMGTTCGMAGAYVLAGEIGKHCGKGF
                     KGGIPVPKNSITVALAEYEGRLRPFINTVQKGLTDNKNYMAKFPSSPLGVQMVYVLFW
                     VASLLRLDFLAKWVLREDTKGWKLPEYKLMTDCACN"
     exon            complement(723476..724762)
                     /number=1
     CDS             complement(726486..727253)
                     /codon_start=1
                     /locus_tag="AO090103000278"
                     /note="dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /old_locus_tag="AO070333000051"
                     /protein_id="BAE65725.1"
                     /transl_table=1
                     /translation="MHTGRAYIVTGGSSGMGQAVVKKLLSLSATVHTIDKAGQMPIVS
                     LPDSDRLHFHPNIDISSHEKVTQTFESIIQQSPVISGLVNCAGIILPSNILEPVENFN
                     KVMAVNVGGTWNMGTTYLRYVLERHADTMRDKKEGSVPEGIGSMVNIGSTASLFGSPG
                     IASYCASKHAVLGLTRTWAKDFGDKGVRVNCVAPGATDTPLLGGVPPAFVDYYVKNVP
                     LRRLARPEELANTVAFLLSDDASYINGQVIPVEGGFH"
     exon            complement(726486..727253)
                     /number=1
     CDS             complement(join(729338..729404,729483..729748))
                     /codon_start=1
                     /locus_tag="AO090103000279"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000052"
                     /protein_id="BAE65726.1"
                     /transl_table=1
                     /translation="MQAIHLLCLSSPRRPRRLHQRDGFVPLNPARRNGFVEHPHRTGS
                     WYQKSGRNPHIADLGAVVAVGQASAEVGMNVRGVCSTLQSSRHTYLLNLHAMLLLQAG
                     IPADHVSG"
     exon            complement(729338..729404)
                     /number=1
     exon            complement(729483..729748)
                     /number=2
     CDS             join(730269..730697,730758..730796)
                     /codon_start=1
                     /locus_tag="AO090103000280"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000053"
                     /protein_id="BAE65727.1"
                     /transl_table=1
                     /translation="MFMREDTIPLSITGASASQTHQLDGNAFVAMYFVALRNQQTPSG
                     TIISELVSCINCYASQEVLAMVVNTPDDTDFNLGAYFGGEPPVRFQFVFTITLRGKES
                     MGVIRKAQIDFEEKIESLDLPATWIGFGERAVVLDQTENVKFDARRQPFKRST"
     exon            730269..730697
                     /number=1
     exon            730758..730796
                     /number=2
     CDS             join(734171..734320,734379..734435,734501..734566,
                     734629..734784,734965..735077,735130..735251,
                     735567..735619)
                     /codon_start=1
                     /locus_tag="AO090103000281"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000054"
                     /protein_id="BAE65728.1"
                     /transl_table=1
                     /translation="MQFKLFVAPLLFALAMAAPSFEDGHLAKRTCGTLTGEKLKICQE
                     ACKAICSAGTAGIASGLCEKACDLGPLKREAAPEPEPSFGQKACDVACDVACNSTVLA
                     LEQRKCLEKCVSVIHQYSFPGFHSADWIPCYRRPSATTRFRGLHVIPSLCDSESEEDE
                     LISLSLSEINLENVYVRGNDQRKCRYSGHAAYSNRSDYIVYKPVHLDLIYTRSRVSLL
                     YITNEDMMLLGNIHWIAMKL"
     exon            734171..734320
                     /number=1
     exon            734379..734435
                     /number=2
     exon            734501..734566
                     /number=3
     exon            734629..734784
                     /number=4
     exon            734965..735077
                     /number=5
     exon            735130..735251
                     /number=6
     exon            735567..735619
                     /number=7
     CDS             join(736105..736221,737522..738670)
                     /codon_start=1
                     /locus_tag="AO090103000282"
                     /note="hydroxymethylglutaryl-CoA reductase"
                     /old_locus_tag="AO070333000055"
                     /protein_id="BAE65729.1"
                     /transl_table=1
                     /translation="MRDMSSTFESLLYHTSAPLTSLGRVFPYMLPAYYFVRLRYFMNM
                     TRIPQAITSKFQTSRASDGETSSVKIENCVGFTRVPLGVAGPLQVQGSDGTTGSFYGP
                     LATCEATLIASCSRGCKALNMCQGVRFKILHDSMSRAPAFWFANTEDAVAFFDLVPSL
                     QPKFKKDAESTSKHIRLRTVIPHIVGSSVHVRFEYLCGDAAGQNMVTIATQRVCDRFS
                     ASAEAHALRLQRITTDNQMSSDKKLAWGNIIRTRGVRVLVWGSVSNDVSKRVLGCSTE
                     LLYQSILNSKEGAAMNGQLGYSVNPSNVIAAMFIACGQDAASVAEAAWSQLTAEYDAD
                     TKLLRLISYFPSLPVGVVGGGTAYPTQRESLEILGCNVPGTKHRLAGLIASFSLALDI
                     STLAALATQTFSRSHEKLARGRWSPETKL"
     exon            736105..736221
                     /number=1
     exon            737522..738670
                     /number=2
     CDS             join(738862..739012,739070..739395,739429..739996,
                     740046..740068,740112..740170,740222..740268,
                     740319..740369,740493..740700,740757..740925)
                     /codon_start=1
                     /locus_tag="AO090103000283"
                     /note="fatty acid desaturase"
                     /old_locus_tag="AO070333000056"
                     /protein_id="BAE65730.1"
                     /transl_table=1
                     /translation="MKNEPLPFNWVTIVVSPITGFLAAVYTPLKRETECFAVIYYFVS
                     GIAITAGYHRLWSHKSYGATLPLKWFLAIFGAACCQWSIRTWAECHRSHHRYTDTDKD
                     PYSVRHGLVHAHIEWVLQPEIRAGPTDLSDLDADPVVRLQHRYYLTFAIIMSCIFPSG
                     GFIYAGVIGLFFCYQAIFSIHSIAHWVGDQPYDDRHTPRNHTLVTLLCFGEGYHNYHH
                     EFPADYHNVVEWYQCDVTKWCIWVWKQLGLAYGLKKAPDNVVGKGTYQQARKKLERKA
                     NKLDWGLPLSQLPGITWDGFQEAVKDGRQLIILSGMVYDIATFIPFRPGGVKILVSHI
                     EKDATKAFNGEIYSHFHCRTKLKLSHVPIPAVIQDSKGKRLYTFEIHEVLVLRYSRPG
                     RDETNRKQDKADRRTPHFKLPTSPKQLELPEGADAKAFIVFVTSDDPTTGQSWCPDVR
                     AAWPVLEATFSGVNAPALRVVEVGQKPEWKDLNNVYRTNWKVPCIPALVRYERVNGET
                     AETGKLVEGEILDKKRLGEFIGTTL"
     exon            738862..739012
                     /number=1
     exon            739070..739395
                     /number=2
     exon            739429..739996
                     /number=3
     exon            740046..740068
                     /number=4
     exon            740112..740170
                     /number=5
     exon            740222..740268
                     /number=6
     exon            740319..740369
                     /number=7
     exon            740493..740700
                     /number=8
     exon            740757..740925
                     /number=9
     CDS             complement(join(741186..741198,741216..742154,
                     742451..742542))
                     /codon_start=1
                     /locus_tag="AO090103000284"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000057"
                     /protein_id="BAE65731.1"
                     /transl_table=1
                     /translation="MGTSVRGFWIDQECIDQDNEAEKQRAVQSIELESEFCIKSTDFR
                     SKATKLCMEYRKDPELQHMCERILDRASKYNVQLLELDNEGKRTIRQSMSPIIFSNVG
                     KRGMRDESDRLAVIANCLGYFVRLDSQRLEREAYSLSISMLALFLLNGEILMNGPDNS
                     QSAIRSNIFNNLRSQSLRTFQTPDIDQKLTFIKSCRFAEVELLEQGVITSGHLWRLGR
                     IVEDLGRTRPPQRGHDYQLSWYQRMRLGQLARHLGPGECGSRYGYIASAIDEYLDQDE
                     RWGDKDVTFSKFYKDLTAEEVVKAMMDDPRSPRLRLGALISQGDRTGTDPYSGIFIRE
                     AGHRWEKDETMSG"
     exon            complement(741186..741198)
                     /number=1
     exon            complement(741216..742154)
                     /number=2
     exon            complement(742451..742542)
                     /number=3
     CDS             complement(join(744490..744599,744662..745045,
                     745151..745391))
                     /codon_start=1
                     /locus_tag="AO090103000285"
                     /note="enoyl-CoA isomerase"
                     /old_locus_tag="AO070333000058"
                     /protein_id="BAE65732.1"
                     /transl_table=1
                     /translation="MRTVFDRLSTDPSVRAIVFSGSGEKGFSVGIDLKWVSNKDSPFM
                     ARPDEIVDPGRRAVTTLRRFGVEFQECISSIERCEKPVICAMHGYALGMAMDVCSAAD
                     MRICSKDTVFCVKEVDIGIASDIGILARLPKVVGSYTWVKDVAMSGRNFNADEALRVG
                     FVSTVLPTKNDVIGEAFRVARNLSEKSPVAVQTIKHFLDYSRDRTVAEGLQYQLAYNV
                     AAVQTKDVPVAISSILSKEKPIFGKL"
     exon            complement(744490..744599)
                     /number=1
     exon            complement(744662..745045)
                     /number=2
     exon            complement(745151..745391)
                     /number=3
     CDS             join(746229..746271,746324..746406,746506..747192,
                     747245..747391)
                     /codon_start=1
                     /locus_tag="AO090103000286"
                     /note="dioxygenases related to 2-nitropropane dioxygenase"
                     /old_locus_tag="AO070333000059"
                     /protein_id="BAE65733.1"
                     /transl_table=1
                     /translation="MPFNTALTKTLGIKIPVVQGGMHWVGYAELAAAVSNAGGLGLEI
                     RKCRSLTNRPFGVNITLLPSLMPPDYGAYVQAIIDEGVKVVETAGNNPGSVIRPLKEA
                     NIIVIHKCTTTRHAKSAVKLGADFLSIDGFECGGHVGEDDLTNLILLNRARQVLSVPF
                     IASGGFADGHGLAAALALGAEGINMGTRFMCTVEAPIHIKVKEAIVAAQETDTALVMR
                     RWKNTTRLYANKVAKDALKVETQSESGKFEEIAPYVNGKRGQQVFLEGDVDSGVWTAG
                     QVIGLIHDIPTCADLLARIEQEALTSMKRTESLWTGEASQSRL"
     exon            746229..746271
                     /number=1
     exon            746324..746406
                     /number=2
     exon            746506..747192
                     /number=3
     exon            747245..747391
                     /number=4
     CDS             complement(join(748948..749115,749166..749325,
                     749378..749934))
                     /codon_start=1
                     /locus_tag="AO090103000287"
                     /note="Zn-dependent hydrolases, including glyoxylases"
                     /old_locus_tag="AO070333000060"
                     /protein_id="BAE65734.1"
                     /transl_table=1
                     /translation="MAGIQTQLDQGAVPNAISNVCPPGTKFQVLEVGWLECDKGFVIR
                     GGNTSTKSTETGSFVNERCEMPMYCILIDHPHEGLILWETGSGKDYPTVWGPAIADIF
                     ARVKYEPRHELRAAVEATGHKLDDIKKIIIGHLHLDHAGGLDEFLHRTDVEVWVHEKE
                     LTNAFWSVATGADVGVYLEHYLKLSLNWKTFNDQTLDFCQGITLHHLPGHTDGLIGMQ
                     INMLNTGTFFFISDHCHVIENWRDGIPQGWLARDHPSWFRSTQRLKHLQRITKGQVIP
                     GHDKETFLALQSQANVFT"
     exon            complement(748948..749115)
                     /number=1
     exon            complement(749166..749325)
                     /number=2
     exon            complement(749378..749934)
                     /number=3
     CDS             complement(join(750791..750970,751026..751335,
                     751384..751439,751449..751615,751710..751731))
                     /codon_start=1
                     /locus_tag="AO090103000288"
                     /note="carbon-nitrogen hydrolase"
                     /old_locus_tag="AO070333000061"
                     /protein_id="BAE65735.1"
                     /transl_table=1
                     /translation="MGFLNIWSTGKVQNLANATQKVLQAASKGASLIILPECFNSPYS
                     ATKFREYAEPLSASPDPAKLRCIGTNSQGYRCIHHRWHILSPKGELIAFHRKMHLFDM
                     DVPGGMSFHESDTLSAGKKTTTVDLEGYGQIGLGVCYDMRFAELSTIAARQGAFALVY
                     PSAFNTTTGPLHWELLGRARAVDNQGYGMVTDPMGQVVAGTNQSEDIAYALLHPETIK
                     RSRMAIPITFQRRHDVYPDIGKLVQT"
     exon            complement(750791..750970)
                     /number=1
     exon            complement(751026..751335)
                     /number=2
     exon            complement(751384..751439)
                     /number=3
     exon            complement(751449..751615)
                     /number=4
     exon            complement(751710..751731)
                     /number=5
     CDS             join(751982..752539,752552..752726,752790..753167,
                     753286..753316,753373..753999,754043..754244)
                     /codon_start=1
                     /locus_tag="AO090103000289"
                     /note="serine racemase"
                     /old_locus_tag="AO070333000062"
                     /protein_id="BAE65736.1"
                     /transl_table=1
                     /translation="MADLDTCLPLTVDPFHTAHRSISLYIHRTPVLTSKTLDRIASTP
                     QERSALEGTHFEDQEPAKPVFRLYFKCEKFQKIGALKARGAFHAVLRLFSGLGLEEVR
                     KRGVTTHSSGMKLNAHQNGDCYLLLSKGNHAQALALAAATLKIPAHIVMPSISTSSKI
                     AGTKAYNVRVLFGGSTEPERVAVVNETCAILVPPHDHPDIILGQGTAALELEKQVAAL
                     MKDVDTEVDIKKDHPLNVVITPLGGGEPSFQGGDDGRHGLAAGSRIPTVSTLTIADGL
                     RTPVGEINWTVIPDQKKVRGVFAVTEDQIKDAMKLVLERMKLVIEPSAAVPLAVVLFD
                     EEFRTIAEKEGGEKGWDVGVIFSGGNTTVEAIWNLHGITLFQLTFTSEGALWNKLFPG
                     YAKLLGIYSHSSLSYAGTKPQEAMQHLIKEIEGCKEGLQRHLQFFPLKDLVISVGATT
                     QALSSQFLLQDGYPDPELNTLRNLLANPFGNDLDAKVKIEIHAGVYPLLNMQQFSTNA
                     SIEMGRPEDDIAILVLAEVCSVCNDGERPRPEALLVAGTLALGRPVSFTRPIVERISQ
                     EHSIVSWEEKQADSSGIPRSRTVLFISDIFEDDTYPQHQCFRNLKAVLESAGSILEKT
                     VEVKVFLSDMEDFEKMNEVYLQWFGDIKPART"
     exon            751982..752539
                     /number=1
     exon            752552..752726
                     /number=2
     exon            752790..753167
                     /number=3
     exon            753286..753316
                     /number=4
     exon            753373..753999
                     /number=5
     exon            754043..754244
                     /number=6
     CDS             complement(755154..757067)
                     /codon_start=1
                     /locus_tag="AO090103000290"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000063"
                     /protein_id="BAE65737.1"
                     /transl_table=1
                     /translation="MLDTSDSIALTAFVVSIIALAATASQLLQQYFTTAYGYNRCSRR
                     FIGDWSRFRHRRYIWREFRFETTFVRPHIYIGFADAKFNAPAPPSPSWNVLDLIPPVR
                     KDNAWQSKYLGKSILISQLGDDFSDVRTHVSWTLFLQHIKMFNDLSNRRMQTVSSSLH
                     AGTDRDSETSRLYDQLSDSDQIDDRELEDGSGYVLSAKADHSVEPNRHFGICVKFEPC
                     TWDDLPGTANILTGTVSLRDLAVFGRLLGLQWNCGPFMGTPGRLEQQGASAGVDSLPP
                     RGGFQAIGNSLALTEKELPQLRYEQREQSPPGFRFPRMETFIIHEATVAMFYGHIVPD
                     DDLLPGYLPIRVGDAAAWETRLQQMWIHQRPAASSTFVHCLVPLLSTVISDRFTYAVR
                     VPKPHQFTIGPFARPNITDSFRETVDRVIQSCSHLDNMVQERRPGTLVRKIAAAIDDL
                     RQYPRRANTGVQDLNYWTVCQGEASAWAHFENDNNKEAEIFFHKVHDYIDMVQEELSS
                     LIRRKDAAIGIYTNLYFDLVCAFFEFAIEQNNNGQSGKANKTRKGPIMQWRATMEALF
                     DNLNVIEASFRERGKRRAIMHANGMSAGTLGDQFDVVVRCEGIRGYDSVDSDEIREAT
                     IAMVFRAMCWLVT"
     exon            complement(755154..757067)
                     /number=1
     CDS             join(758734..758998,759049..759561,759679..759725)
                     /codon_start=1
                     /locus_tag="AO090103000291"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000064"
                     /protein_id="BAE65738.1"
                     /transl_table=1
                     /translation="MTKVFRACVVLTLFLLANAADDRTCYYLDGSTANNHVPCTTNSV
                     TNCCGSNDICLSNGLCYLQGSQGLSLSRGTCSDKNWGTECYKPCFNETITNSHLMLAS
                     YRRNTGMPIMNIGYNYSSTQYCCGTVIVDNNAVGCKYEDPFELTEATVIPGVAYLANN
                     GVSGNSTSSPSSSSCIAVEAGVSIPLGVIAIAAGIWALWERRRGRRQLRNYSPMSDAE
                     GTVSVAPAPSHQHQTAELGGQGVAMSLPELMDTRTEYREAPKRCIPRVQKGNVEGK"
     exon            758734..758998
                     /number=1
     exon            759049..759561
                     /number=2
     exon            759679..759725
                     /number=3
     CDS             join(761254..761528,761577..762084)
                     /codon_start=1
                     /locus_tag="AO090103000292"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000065"
                     /protein_id="BAE65739.1"
                     /transl_table=1
                     /translation="MRLLLIAPLFSAVSYGAQATNSSISICPPATKPANASDAIPATF
                     PGYAFEESSFVYYAGNKTNPNRISQNLIRAVSQKTKTRPVIRVGGTSLDRATYDPNLS
                     DPIYNPDPNSGIPTHLKIGPSFFDLFANFPEAKYVIDIPMYHDNLSNSILFAASANKR
                     IGASNIYAWEIGNEPDNYGNTGADWNEKQFSEKWGNWSKAISKALNASLDSQTYQAVA
                     LSSQTGVTGTPGGDADSWKMYVLSLMVFQGDTYQKKIQRGDF"
     exon            761254..761528
                     /number=1
     exon            761577..762084
                     /number=2
     CDS             join(762268..762489,762548..763072)
                     /codon_start=1
                     /locus_tag="AO090103000293"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000066"
                     /protein_id="BAE65740.1"
                     /transl_table=1
                     /translation="MTEIADLMNHDEVIKGTAFIKTALQNLATIGVDVPIVLGEVGNT
                     LGNGSSGVNLEGVLGSALWEVDLSLYTMFLGVHGISMQSGTKFPFALWHPQYSNTAGA
                     VLPAFYAQIFAAEFIGSHGNVTVANIDLGQPHLSAYAAYEGANLARLAIINLELWDGR
                     HESQEKRHSKQMLLHVPAGTDSVTVKRLTSPAGGMARSSNQITWGGMQWTYENEGRGE
                     NVSTGAERLTVKDGTVHIAVNASEAAMVFF"
     exon            762268..762489
                     /number=1
     exon            762548..763072
                     /number=2
     CDS             join(765504..765717,765812..766329)
                     /codon_start=1
                     /locus_tag="AO090103000294"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000067"
                     /protein_id="BAE65741.1"
                     /transl_table=1
                     /translation="MVMLYRCRYKIGRSTGGAAARGHIYYSSGFLLNVQLAYLTSPFR
                     YMFFQTQSSHQYLHSRVEDGPIFQISGVIVRPRFAEDVAALVSVLATNNVPFSVRVGG
                     HDMFGRSQIHDAVTIDLREIAYVDIDHTGHTARLGGGILVAELIKELEKDNLVTPHGV
                     IPGVGYVGWATYGGYGLLSTQYGLGVDQILDAQVVDCEGRIRRADKDMLKAIRGAGGL
                     LGIIVEVTIKVYPLGQVSEASPSRT"
     exon            765504..765717
                     /number=1
     exon            765812..766329
                     /number=2
     CDS             join(766652..766670,766803..767092,767165..767245)
                     /codon_start=1
                     /locus_tag="AO090103000295"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000068"
                     /protein_id="BAE65742.1"
                     /transl_table=1
                     /translation="MPKSVHVPSLDSVIYTRSPHFVLEIGAIVETPHLLPDAIKWGQS
                     FYNAVHKTDLANIMPSTYLPLTGPEKVDMGAIYGPNLEVLRDIKQRYDPRDVFRHALV
                     KLLRGALEGSSVGGVLNTIAGAKLGDD"
     exon            766652..766670
                     /number=1
     exon            766803..767092
                     /number=2
     exon            767165..767245
                     /number=3
     CDS             complement(join(767783..767957,768017..768236,
                     768295..768414,768441..768496,768536..768639,
                     768678..768776,768801..769392,769442..769549,
                     769610..769845))
                     /codon_start=1
                     /locus_tag="AO090103000296"
                     /note="acyl-CoA synthetase"
                     /old_locus_tag="AO070333000069"
                     /protein_id="BAE65743.1"
                     /transl_table=1
                     /translation="MIDINASVSQLLLCNIRAQANQTFTSARDVRRPTLEASVVYQNV
                     QDYDCFIFDSLSINYISISVQVKHIAMPQRSRWNVDALAFADAEDPETLSMTWTEPRL
                     WSQRLAAGLQAAGGIYQSANPHSNARELAYQFKLTTPHFILASQETLVCALEAAEMVG
                     IGRERVYVFNHAPLAKDGSGNDDSKTGVKHWKNLLASTEIGRSFYWKRLTPSESKLTT
                     VYMIMTSGLVILRLPMISSHPNLTIGSTTGLPKAAEVSHYGILSNCVQTDFVMSLEPN
                     LRTKELAAKNSRWLCTIPLYHGLALCYFCTISVARQYEIHCMLESIEKYRITELHLVL
                     PIIVAMTKDPATFSCAAPLGPEPTFQYESLWPEGQVNIKQGLASTDLKSMPLLTSPVD
                     PAVIQSAGSVGEPIPNCEIRLMDDDENEVEPGQSGEIWFRGPNLMKGQGMWPARMRMG
                     GITSWTERRQVTVDEGLKPMRADILWQEMIKVKGVQVWRAELEALLLDHPAVRDAAVI
                     GVRKDHEEHPRAYIVAAPETSVTSDDILQFVNNRVSTIKRLTGGVVFTNTIPRSPVRL
                     TRY"
     exon            complement(767783..767957)
                     /number=1
     exon            complement(768017..768236)
                     /number=2
     exon            complement(768295..768414)
                     /number=3
     exon            complement(768441..768496)
                     /number=4
     exon            complement(768536..768639)
                     /number=5
     exon            complement(768678..768776)
                     /number=6
     exon            complement(768801..769392)
                     /number=7
     exon            complement(769442..769549)
                     /number=8
     exon            complement(769610..769845)
                     /number=9
     CDS             771777..772823
                     /codon_start=1
                     /locus_tag="AO090103000298"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000071"
                     /protein_id="BAE65744.1"
                     /transl_table=1
                     /translation="MATITRNPLDSMKSTWRSWDRTQWTAAHWLIETLNIHHIDLDKE
                     VPIHQKTDKVPYAPELQFHRWVLIHASIPLIIHQLYINYIGQPSALLVFIFYSLSLEL
                     IAIHEVHVLRRVGHKIGFFDGDKHPRDGVPDVGVRKTVQTLLSVIFLRPMATVIISYR
                     ADEPPSSIRWFWLIFETGVYAVVLDFWYYLFHRSAHETEFLWQFHRRHHLTKHPNPLL
                     TAYADLVQEFFDLVGTPLITYGTMKLMGFPMGFYEWWFCQQYIIFTEILGHSGLRMIA
                     TAVNPWTSFLRLFDMELLLEDHDLHHRKGWKSSYNYGKQTRVWDRLFNTCTTRIEGHR
                     DNIDYVNTAEIPLH"
     exon            771777..772823
                     /number=1
     CDS             join(773557..773685,773754..774523,774614..774738,
                     774865..775112)
                     /codon_start=1
                     /locus_tag="AO090103000299"
                     /note="metal-dependent
                     amidase/aminoacylase/carboxypeptidase"
                     /old_locus_tag="AO070333000072"
                     /protein_id="BAE65745.1"
                     /transl_table=1
                     /translation="MTQITSNLSSPLQAPGQQAGCTLDVIVHAIDAHDKELQLINEQI
                     HKNPELAFEEFKAHDNITTLLEDLGFSVTKHAYGLATAFVAEYGSGGRVVAFNAEYDA
                     LPGIGHACGHNLIATSSIGAFLGVVAALKASTLPGRVRLIGTPAEEDGGGKIKLIEAG
                     AYEDVDACLMVHPAAHKRFPDGVTGVSYVTSNAIVKFRARFTGKPAHAAGAPWQGINT
                     LDAVCLSYNGVSMLRQQIQPHERIHGVIVEGGTKPNVITASGTVDYFCRSTSLEEAEA
                     LKDRVIKCFDGAAIATGCSVEYETREAYADLRPNKALCANYDSAMATLGFPVASSGAT
                     QPGSTDMGNVTYVCPGFHGGFAVPADPGAFNHTPSFTKAAGTSKAYELALNTAKGMAV
                     VGWNVLSDDSLAEGVRNDFEEDKKMRESSRR"
     exon            773557..773685
                     /number=1
     exon            773754..774523
                     /number=2
     exon            774614..774738
                     /number=3
     exon            774865..775112
                     /number=4
     tRNA            780022..780122
                     /locus_tag="AO090103t00007"
                     /note="tRNAscan-SE"
                     /product="tRNA-Tyr"
     CDS             complement(join(781235..781378,781912..782656,
                     782719..782786,782851..782970))
                     /codon_start=1
                     /locus_tag="AO090103000301"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000074"
                     /protein_id="BAE65746.1"
                     /transl_table=1
                     /translation="MPNRPDKRDYITLASSILQFHPEPVNGVFVDDIDKKAYPSNWDH
                     GKLPAEMGAWRAHMNVMQRIVHERISTAFVLEDDADWDVNLKKQLQRFASASQLVQGD
                     TGPSHSPYGDLWDLLWIGHCGIQYKTGPIHVTTDDITTVPLPELPRYWHGFPAGADNG
                     TRLVARMHDGVCSLGYAITYLGAQKLLSALSLTPKGDGAPFDVAIGRFCQNGWLRCIA
                     PFPSLIGLWKAAGPKARESDIHNDDGWIEKETPVGTVYSAMDNAHRLLNGERTVHAVL
                     NDAPAPEIDPTKLELPEGTLKMLDDTGISEIIKGNPQMSSSSLRLISLGYPPHGRDAG
                     PQRNYPELEPPMKRGCRMIRYSYT"
     exon            complement(781235..781378)
                     /number=1
     exon            complement(781912..782656)
                     /number=2
     exon            complement(782719..782786)
                     /number=3
     exon            complement(782851..782970)
                     /number=4
     CDS             complement(join(786523..787157,787219..787270,
                     787324..788229))
                     /codon_start=1
                     /locus_tag="AO090103000302"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000075"
                     /protein_id="BAE65747.1"
                     /transl_table=1
                     /translation="MATQLDFPALSKQMMGKWTTEGFDILVSYSEEKVNQLLRARSEQ
                     LKSILKMGPLETSYVDPLTDETIHLNVFMDLEHPLLQFEDEHGNITLTFDIQKGHYVI
                     IAKNITKDLPSGMAISFKTTLNNVKGTVELSQSEDESTGKGVKTASANELVIFNPGEK
                     DISQHVCITFEKASADFIGTTEESKKRVAGMAFLLGAVKEYFQQHAELKYFVAGVSNK
                     YNPESGSDSLQPRSFRFNTLKGKTENDESALCMWISVKEGTNRPESYTQAFEGTFYAN
                     GLIPIPRGRTCSLIMHNDLLIKQFIMPNLSKGFKSFKDKTSGKGGLNLSATMIADDID
                     IKEMKKKESWGPGGIKTTTVDPMKFSLSDPETTISFGDGIISKSNKINYTNKQQVKWK
                     IDTVTGRVPGHEHGTTNLEFKWTATGSWKDKKTPGHPNLLGFDWAGDKNWTITKSAED
                     VHWWEAFGGASNKIPEPLQNLQVPSPNTKLEMNTLDYFLTTNLLYPGKHIFDADDPSS
                     GSTDKGLAFPHDLILTGETKIK"
     exon            complement(786523..787157)
                     /number=1
     exon            complement(787219..787270)
                     /number=2
     exon            complement(787324..788229)
                     /number=3
     CDS             join(790616..792135,792246..792253,792372..792444,
                     792579..792741,792769..793393,793470..793996)
                     /codon_start=1
                     /locus_tag="AO090103000303"
                     /note="serine/threonine protein kinase"
                     /old_locus_tag="AO070333000076"
                     /protein_id="BAE65748.1"
                     /transl_table=1
                     /translation="MLDAQKEAEAKIDLLTSSNGPLVTGIYKISSLTKEVKTKRQLLT
                     KKLTNIQFAAKQFDWTILLDAASTLVSLRADPKSIVDTVKQGYEIYKKGTDESTAKNL
                     HGDAVKKEYIIDQLAQCSDTLESLEKAFTTRKDNQIEIDDPGALKIMATKGNIQKILR
                     EFKNAIVEKDKKDIESALDDYIAVTLNRNNAVLDYNSSLQLLFEASNAREYSKSQAES
                     LGQRRHTLDPNTPAILFWLRKTRDNMRLQLMQRLNYESRAIRFWGLKKHLDYSSPGPL
                     RSFIELRDGQSKLNAAYEDSLNSYANNIRVTWPREEKEKGLFYILSNAELKSFKQRQR
                     LTTSKGDDGVYSASIRLEPGAPPFGPGRADVRINQVRLWLLGVEVKADNAGRKQLMVK
                     IAHSGNETLENTDRQALGFSHDAVNIQFEYNTAKVQTPDDFKTDVVFGKQGLENDWSG
                     GDSKPTASTFAAIGPFTEWRFSIRESENVGLDMGSVTAAYVEFRGANRPFSVDYRKAP
                     INPMVDQRIKPHSTGRKLDMIDIPYGALADNEWKFEPITLPCEWVEDYRPGGYHPVVL
                     GDIFNNGQYKVIRKLGEGSYSTVHLLYFVVHRYLFRFRNRRYVALKILVSEISGSTTE
                     LRILRHITEVAPAEAGRHITRLLGEFEHHGPNGVHRCLVFEPMGPSVNTMVEELPQFK
                     PRMRGMKIRYPLRMAKSILKQSLQALAFLHENGIAHGDFQPGNILFTLDDIGSTPEDV
                     LRQEEDVQAESISPPVQRLDGKEDKWAPRYLCVAQSLVPFTYYAEGFKVKLSDMGGAY
                     FFTDPPTKPVTPLGLRAPELILTGAVDNTLDIWSFGCLVFELITGQPLFCIPGSDFED
                     DDHLLSLTDRLGALPDELFKHWKTSSLYFTSERKLFNCQLGGVAPGGEPLMVEQTSME
                     ELFDQAGPDLDEEEARKVKALIRWILQYDPAKRPSPAEILSDPWFCEIDVESESARV"
     exon            790616..792135
                     /number=1
     exon            792246..792253
                     /number=2
     exon            792372..792444
                     /number=3
     exon            792579..792741
                     /number=4
     exon            792769..793393
                     /number=5
     exon            793470..793996
                     /number=6
     CDS             join(794301..794430,794487..794677)
                     /codon_start=1
                     /locus_tag="AO090103000304"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000077"
                     /protein_id="BAE65749.1"
                     /transl_table=1
                     /translation="MQSQIIPTNSRSPPASLPKRAAALAFINCLSNVCQIYAPYLYLD
                     SGAPRYTTAFSVNIGMSSTTIIFSTILRIYLGSLNKKLDQEEGIDLGTDAHDNEEHGL
                     PGLL"
     exon            794301..794430
                     /number=1
     exon            794487..794677
                     /number=2
     CDS             complement(join(796055..796234,796274..796605,
                     796749..796764))
                     /codon_start=1
                     /locus_tag="AO090103000306"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000079"
                     /protein_id="BAE65750.1"
                     /transl_table=1
                     /translation="MQRVYTFIIGGAIGGGIGGSLGVKKSTNPQPSIPASTTSSAPVT
                     STSATSSSESGRSITASTTSSAPVTSGTSGIAANSCPGINETIVTGSTGSAFTVLCGV
                     DWPKGVQAINGKGKECIDSCLGSHKDDCKGVTYSANLTSSFDGGQDGNCFFKDQAGIY
                     FPGGDTIISAGVIGG"
     exon            complement(796055..796234)
                     /number=1
     exon            complement(796274..796605)
                     /number=2
     exon            complement(796749..796764)
                     /number=3
     CDS             join(798209..798455,798509..799017)
                     /codon_start=1
                     /locus_tag="AO090103000307"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000080"
                     /protein_id="BAE65751.1"
                     /transl_table=1
                     /translation="MTDSLKEVSQIQGIEVVQAGLEPIPNQNNPHHVVVPVLANESVP
                     RESRICGLRKMTFWLAVIVAALVAIVIALAVGLGVGLTRSHSVSTPPMATTSSKSTST
                     PSSSPSSTSSDTASSSSTSTSAPSPTSTTFFNKNTNYTCPDANNTEIRNVSGGSGNSS
                     YYIFCDADISSSSKKDLSSSVQSSFADCLALCNSMNNFQDRTDVGCTYNFEGTGSQDK
                     GTCWCLSGGNKSIITNVGNMAAVLSTENALLNL"
     exon            798209..798455
                     /number=1
     exon            798509..799017
                     /number=2
     CDS             join(799511..799625,799682..799756,799816..800082,
                     800138..800415,800471..800761)
                     /codon_start=1
                     /locus_tag="AO090103000308"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000081"
                     /protein_id="BAE65752.1"
                     /transl_table=1
                     /translation="MAWLMSLGFVHLVSLLSLGEAKVLSDLSDGFCRSYTFGANIVND
                     VLYMVDLDGGLIPGDTNSSNNYLVQLDLSSSFSTDDGEKYKMSLVDSEVPKIKGQALW
                     SDKANTTLFTYGGNYLDVASVDQGLWTYTIADGSWKLQQTSIKPVRLQGGAYVDAPQI
                     QAAYWVGGFQNSDTTPAITDSTVDYATGMIQFNTTTGTFTQLDAPFAPVQQGALVYLP
                     IGEKGVLVFVGGEVPSIQNGINATLTPNQWNYAWVYDIAGNKWYNQTTTGSVASRTQF
                     CAVVEKDLSTSSYQVYVIGGADYKSKDSLTDVYVPIIPYRTIQPNTDSPAPIYRSHRS
                     NGFKPRR"
     exon            799511..799625
                     /number=1
     exon            799682..799756
                     /number=2
     exon            799816..800082
                     /number=3
     exon            800138..800415
                     /number=4
     exon            800471..800761
                     /number=5
     CDS             join(800773..800781,800974..801433,801507..801535)
                     /codon_start=1
                     /locus_tag="AO090103000309"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000082"
                     /protein_id="BAE65753.1"
                     /transl_table=1
                     /translation="MTHPGLSTYSLPSATANDIKSSPYPSTWADPALKSLFVQKPNDT
                     TNSPDAQPDPSTSTSGSSTKVGPIVGGVVGGVAGAAIILAIIFFALRKRRRDYQKEPQ
                     GEKWPDNAPVTMGRVGGELPAEAPRRELDARSNARSELRGTTRSVYELDGGRGTGSQI
                     IKTRQ"
     exon            800773..800781
                     /number=1
     exon            800974..801433
                     /number=2
     exon            801507..801535
                     /number=3
     CDS             join(802419..802618,802661..802841,802849..803583)
                     /codon_start=1
                     /locus_tag="AO090103000310"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000083"
                     /protein_id="BAE65754.1"
                     /transl_table=1
                     /translation="MAVENAIPTTSSTDAQALPDEPKPAKKGYGWRFWAIFPGLCVGG
                     LLSALDTTILSTVLPTISHNLDSQTAVQPLYGQVANIFGRRWPTILSVALFALGSGLG
                     GGASSTEMLIAARVIQGLGGGGINVRSLLPTWCLPVYFQLVLEATPKKSGIDLFASFI
                     PMVPGAIVGGVLITVTGKDKPLLVAGFILMAVGMGLFTMLDDRTNTVRWVIYQVILAL
                     GSVISLIATLPAVLASLPESDVATATATWAFLRSFGSIWCVSIPSAVFNSRFTDLVGR
                     IASPQLRGVLLGGGAYQLATKAFMESLDDTPVVKAQVVSVYVDSLKLVWQVGIAFAAL
                     GVPLSLLIRSLALRDELNAEFGLEETRTENVEEVRVQ"
     exon            802419..802618
                     /number=1
     exon            802661..802841
                     /number=2
     exon            802849..803583
                     /number=3
     CDS             join(805908..805933,806275..807249,807327..807609)
                     /codon_start=1
                     /locus_tag="AO090103000311"
                     /note="3-hydroxy-3-methylglutaryl-CoA (HMG-CoA) reductase"
                     /old_locus_tag="AO070333000084"
                     /protein_id="BAE65755.1"
                     /transl_table=1
                     /translation="MSSKHLDWILEKTLENIVSAGSSSTATTRLEAFTRAVRIRRITV
                     SRTPSTQDLSGGIQNSLLPYHSYNYELVHGACCENVIGYLPLPLGLAGPMVIDGQAYF
                     IPMATTEGVLVASASRGCKAINAGGGAVTTLKGDGMTRGPCLGFPSAKRAAEAQRWAE
                     SPIGRRVLTDTFNATSRFARLQSLTFAQAGTYLYIRFRTTTGDAMGMNMISKGIEQAL
                     QAMTAHGFPDMNTITLSGNFCADKKSAAINWIGGRGKSVIAEATIPAETVRKVLKTEV
                     DALVELNTAKNLVGSAMAGSMGGFNAHASNLVQAVFLATGQDPAQNVESSSCITTMKN
                     IDGNLHIAVSMPSMEVGTIGGGTILEAQGAMLDLLGVRGAHPTDPGANARRLARIIAA
                     AVLAGELSTCSALAAGHLVNAHMQHNRSAASSRVN"
     exon            805908..805933
                     /number=1
     exon            806275..807249
                     /number=2
     exon            807327..807609
                     /number=3
     CDS             complement(807884..808735)
                     /codon_start=1
                     /locus_tag="AO090103000312"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000085"
                     /protein_id="BAE65756.1"
                     /transl_table=1
                     /translation="MPLREAGLTEPIPVVVSSGGFDSTQEELYFYIAAGARRRGYAVL
                     TFDGPGQGIFHRRLDQRAGFPAQAPEGAYMRHDWEAVIRPVLDRLWTYSKANQHLHLG
                     LNRVSIFGESMGAYFALRGAGGPRIKACIAMDGFYDMWDIADSRIPPVFVKAWDRLGD
                     RFFDRVIRSLGRVHFRTRFEFAHARFALGLPTYAQATRAFQKFSLRGDGEQGEYLARV
                     QCPVFVTGAADWAYFPAQGNATRIFEVFNQLHPEMAKLWVTKGVGSSGLQAKVAAISV
                     VHDKTFE"
     exon            complement(807884..808735)
                     /number=1
     CDS             join(809402..809479,809554..810105,810107..810457)
                     /codon_start=1
                     /locus_tag="AO090103000313"
                     /note="polyketide synthase modules and related proteins"
                     /old_locus_tag="AO080541000307"
                     /protein_id="BAE65757.1"
                     /transl_table=1
                     /translation="MSSVILSSNNYYICIRFPDHLAQCSSFLNLLPLSGALVGSLVEP
                     LLPPNCGSCCILPATSFARFPPNDSTQPAFIIHDEHHGASNAQHPYLLEEDPCVFDAP
                     FFSWNAREAEAMDPQHRVLLETVYECLENAGTSIQELQNTQTGVYVGLMTNDYHDIHL
                     RDMETIPKYSGTGTTRSILSNRVSYFFNWKGPSMTIDTAFSSSSLVAVHPAVQSLRSG
                     ETPVAIAAGANLIFGPEMYIIESKLHMLSPHGRSQMWDDKADGHGRGEGVAAVMLKTL
                     SGGSYIRTTWLRLSARIDQWHAEACGSSGGRLSTSFVAKQPLVLAYEVGG"
     exon            809402..809479
                     /number=1
     exon            809554..810105
                     /number=2
     exon            810107..810457
                     /number=3
     CDS             join(811682..812149,812234..812266)
                     /codon_start=1
                     /locus_tag="AO090103000314"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000087"
                     /protein_id="BAE65758.1"
                     /transl_table=1
                     /translation="MLCYLHIVMDGISLRTFLGDLNQSYVSPGVSQPASQYLDYAIAE
                     SKQLKGQAIKDDLKYWKQQFETPVDCLPLLPFSRVQSRPPLSISKSFTARAFIKKETV
                     ARVKECSRQSGSASFHFYAAALQVLLFQLLNGSFDELCIGIADANRHDDRYFDTNIHV
                     RGPRAL"
     exon            811682..812149
                     /number=1
     exon            812234..812266
                     /number=2
     CDS             814218..815300
                     /codon_start=1
                     /locus_tag="AO090103000316"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000089"
                     /protein_id="BAE65759.1"
                     /transl_table=1
                     /translation="MARRLWSNHSVSSSHFAWEDEACVLISDLDLEYANLEAESASLT
                     GDAGKIMILTGASGFLGKQILQGLVSSPSVSEVHCIAARSQTSMEKLNANESSKIIVH
                     TGDLTLPRLGLDITTARSLASRANIIVHNGTDVSFLKSYSSLKKSNVDSTAELVRLAK
                     PCRIPIHFVSSAGVAGFVPRNELPLREVSVAAYPPPRDSSAHGYQIAKWVSERLLEMA
                     NQQYGLDIVLHRPTGIVGEDAPDANILGNLLHYSRQLELAPDMDGWDGYLDLVDVEAV
                     AQQIVAVLESPNVSETGVRAVRVVHTCNPGAFPVHELAEYLGRTRGKPLGALPMTEWI
                     GRAMQAGMNEMVGLYLQEVTSKRLSW"
     exon            814218..815300
                     /number=1
     CDS             complement(join(816856..817344,817406..817602,
                     817656..817773,817826..817857,817912..818104))
                     /codon_start=1
                     /locus_tag="AO090103000317"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000090"
                     /protein_id="BAE65760.1"
                     /transl_table=1
                     /translation="MVTRQHPRCSITSGKRTIDLINSLTGPVVDHIKSEAARTEQELR
                     ELKNARVTPSTTTATGQHLTYYHSLLYSLLSWEQPRATAVSFATVVTFIFAARYLPLL
                     RWFFKFIYVALGFTAAAELGGRLVLSQGLASSFRPRKYYTIPKETIEGVYEDLEQLLN
                     FVLLEFQRILFAENIVHTVAAFAAAFSAYWLIKWLPFWGLSLIAVTIAYIGPLVYMNN
                     REVIDAQIENIQEVVNSQAHQLKDLAEERTSHATGLMKQYVDDYSAKAQEYIGQRRSV
                     SPQMTKVSTPEPVIKKEIDTEPVFKTTDFPEAPKEEPVAVKEEPVAVAESIEHPALNA
                     EKEPLLAA"
     exon            complement(816856..817344)
                     /number=1
     exon            complement(817406..817602)
                     /number=2
     exon            complement(817656..817773)
                     /number=3
     exon            complement(817826..817857)
                     /number=4
     exon            complement(817912..818104)
                     /number=5
     CDS             join(821021..821199,821255..821345,821397..824183,
                     824246..824548,824603..825163)
                     /codon_start=1
                     /locus_tag="AO090103000319"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000092"
                     /protein_id="BAE65761.1"
                     /transl_table=1
                     /translation="MAASGARAQKPVGSAAWISTEKENFTNLLNQEMEEVEYPVRHEM
                     DWLNEHMAEIFSNNQFNFTEAFKTPGKLRGKTPRTARKRDPAENRVPLSEIFSTSHNR
                     FEDKVASPTPHRSPAKQKAPVSVPTPAPAAATPTKPKHATENAPRLQYPDLSKDLNSL
                     TTYNTDSGYHEMPDEGEEEEDDDVVLTQVQPESQISTQPFDSQPTPKDVQEHRSSISR
                     RSTAASFHSAHEDVQQRGNTVEPMQIDSTPKEATKEHTPQPLPKPKEPEPKPETEVQP
                     EPEPEPEVEPEVQSDVEPDGEDDAEPEAKEPTPALQQEAEQVEEPEAAPETQLPKTIS
                     SPAKSSPMKTSAPQPSEPREEVKDDAKDDMALDDENLDDIGSPSDGSTPDRPLIRKSS
                     LSFASLPAREPLMKKSLGGSRISRTSHIDIAKINNTGGSGFLGRQTGGHKSTQAALDE
                     NATNGEKMDLDDDKQGSQEDTDADTKASKLHNKSSTQRLHEKISMLGKLQPSRPTKSI
                     PAVQGLSSTQVTYPELPSSKADTKPETASQKSHGTPAPEPMETEDDDWIRPFGSPSKA
                     NFPRGQTADAPEKRSGVGASHATDHDDAPAARKESAASEEPARSSAKQGLEAVLGKYS
                     TPTYSSPQRPSHQAKVSTSHLDSQVSTTPAGSPLAQDGLVSASKSRLQSIVRSAKGLF
                     TNSGGVAAAARMEASSPDEHRVQRSERVEPDRTSRKVPQPTRDHSPPRQEGRRTRSST
                     EREERRKQKELEDRQREEEEEQAERARQQEKERQRAAQLKAAQEKLSAENESRKAPVA
                     PTPQKMSQLQKHSSREPEPSYEAASKPTARPSVSQQQSTRQRPPRPTRETLQKPKPQP
                     QPVSIRVGSALSRHIPLASSSVSGAAESSVPAPTPASASKQPTLKKKASNSSLHTASS
                     NSSFKSSVSSQTQRKAQLASERKREQEEREARRREEQRRELERKRAAQQQEETRRQEM
                     RSRAEAERRERLASEDPKKAAQMQAIEKRRLENARRLERQGSQQPEMNTTHPPERPAS
                     QAARPASRLGSMQPYNRTINPPQPNPAKPPKRGLDDEPGHRSAAPKPGTMQPSGETKR
                     RRTEDEHNPVMRPTMAPPIRQSNIRKESMIRKEPTKPSMYGHAQPGSSIFKTAQSQRP
                     AHPMDMAKYASGKIPFAEPSNAPQPATHKTPVASSSAKKSAHKPSPNYPNGENIHLPE
                     IATDSEDEDSDAEMLPVPKWAQPKELESLLRQQEGLEADSIFGPIAPFSLEETFKSDK
                     RIKKFRERTSSANWAGTDALTQEEIRRDLAERQRLRLNGGWSFN"
     exon            821021..821199
                     /number=1
     exon            821255..821345
                     /number=2
     exon            821397..824183
                     /number=3
     exon            824246..824548
                     /number=4
     exon            824603..825163
                     /number=5
     tRNA            825738..825808
                     /locus_tag="AO090103t00008"
                     /note="tRNAscan-SE"
                     /product="tRNA-Gly"
     CDS             complement(join(826181..826354,826407..826604,
                     826667..828967,829055..829465))
                     /codon_start=1
                     /locus_tag="AO090103000320"
                     /note="predicted signaling-associated protein (contains a
                     PDZ domain)"
                     /old_locus_tag="AO070333000093"
                     /protein_id="BAE65762.1"
                     /transl_table=1
                     /translation="MDLNGDAGAKRKRSSIVPAERPAKHLKPESSALTPGDSTPANGT
                     VYDIEDEDDASRLLPIGPAQADSPEWQATIEEVVKSVVSIHFCQTCSFDTELSMSSQA
                     TGFVVDAERGYILTNRHVVCPGPFWGYCIFDNHEECDVRPVYRDPVHDFGILKFDPKA
                     IRYMNLTELKLQPDAARVGSEIRVVGNDAGEKLSILSGVISRLDRNAPEYGEGYSDFN
                     TNYIQAAAAASGGSSGSPVVNIDGHAIALQAGGRADGAATDYFLPLDRPLRALECIRR
                     GEPVTRGTIQTQWILKPFDECRRLGLTPEWEATVRKAAPTETSMLVAEIILPEGPADG
                     KLEEGDVLLQVNGELLTQFIRLDDILDSSVGQTVRLLVQRGGQDVEIECQVGDLHAIT
                     PDRFVTVAGGTFHDLSYQQSRLYAIATRGVYVCEAAGSFKLENTLSGWLIDSVDKRPT
                     RNLDEFVEVMKTIPDRSRVVISYRHIRDLHTRGTSIVYIDRHWHPKMRLAVRNDETGL
                     WDFSDLADALPALPPVPRKADFIQLDGVSQPAASEIVRSFVRVSCTMPLKLDGYPQAK
                     KTGFGLVVDAEKGLVVVSRAIVPYDLCDINITVADSIIVNAKVVFLHPLQNYTIIQYD
                     PSLVQAPVQSAKLSTEYIKQGQDTIFVGFNQNFRIVVAKTAVTDITTVSIPANASAPR
                     YRAINLDAVTVDTGLSGQCSNGVLIGEDGVVQALWLNYLGERTPSSHKDVEYHLGFAT
                     PSLLPVVSKIQQGVMPELRILNMESYVVQMSQARIMGVSEEWIEKVTQANPSRHQLFM
                     VRKVDCPPAGFDNMADTFQEGDILLTLDGQLITRVSELDVMYDKEFLEALIVRNGQEM
                     RIQVPTVPTADLETDRAVVFCGAVLQKPHHAVRQQISKLHSEIYVSARSRGSPSYQYG
                     LSPTNFITAVNGVPTPDLDRFVKEVSKIPDNTYFRLRAVTFDNVPWVVTMKKNDHYFP
                     MSEYLKDPSQPCGWRTVSHNKSKHKDGIAPDAANLNPDAMEQGYDGASDIEPEAE"
     exon            complement(826181..826354)
                     /number=1
     exon            complement(826407..826604)
                     /number=2
     exon            complement(826667..828967)
                     /number=3
     exon            complement(829055..829465)
                     /number=4
     CDS             complement(830747..831304)
                     /codon_start=1
                     /locus_tag="AO090103000321"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000094"
                     /protein_id="BAE65763.1"
                     /transl_table=1
                     /translation="MASISANNLVPAQPQRPAPQQNPQQASAPPVTPSPATAREKARV
                     TVLLDINSMLLQEVVNLQAAGKAGGPPAQPQDSNPPSDQNPDTAKGPTQKPSQEYIDC
                     MRRLQANLAYLATIADRAKKSGGVPPTAPSIMTPPPHMPSMNEMYKKLAELFPRTAPG
                     TTGTPQPSPQGNGKPSPSPATETVV"
     exon            complement(830747..831304)
                     /number=1
     CDS             complement(join(831629..831714,831789..832017))
                     /codon_start=1
                     /locus_tag="AO090103000322"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000095"
                     /protein_id="BAE65764.1"
                     /transl_table=1
                     /translation="MDPNATGFSMLQQQQQHFPVTSQSPQQFPYYPNAIPSYPQQKAP
                     SHLPQQHSFGAMPMQAGAPGGAMMPAGFPQHSGWLSILALFLYSGLPSTLCAPLDNGM
                     DR"
     exon            complement(831629..831714)
                     /number=1
     exon            complement(831789..832017)
                     /number=2
     CDS             join(836978..837045,837096..837631,837685..838190)
                     /codon_start=1
                     /locus_tag="AO090103000325"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000098"
                     /protein_id="BAE65765.1"
                     /transl_table=1
                     /translation="MAGKSPMSPQSPGTSNLSRKNSMFQTHQDGHQAKRKRVSHECVV
                     PMSINCHQKTMLPIRNHGLLRKYYEKAFESLQQINCRILAKAYIKLVEPRKQVNYPYN
                     GRKIISGSSQQFDPELTKPAWWPSGVTHREPDHLLKAERIRLLVHILCELRSSHAICV
                     EKLREADQSIRRQILPGERLQVLDEIYSVREEEEAFLDGRTDGQAVVCVSRVNLPDMA
                     EAQAMGSPGSTMQTDLNPVYRKEVPDMESHTSVFPSTGSSPTSDTTKHSMASTKSTSS
                     VSTTWDPCLPPSLPSLSTLKRTRPGESSYPLEFNTNIFQHEPPTTVSIDSHYPLKYYS
                     EPHLGHNQHSQPLPVMGMTGTADMGCANPYYFTSY"
     exon            836978..837045
                     /number=1
     exon            837096..837631
                     /number=2
     exon            837685..838190
                     /number=3
     CDS             complement(join(838733..838764,840178..840738,
                     840796..840909,840969..841101,841173..841329,
                     841405..841457))
                     /codon_start=1
                     /locus_tag="AO090103000326"
                     /note="beta-1,4-xylanase"
                     /old_locus_tag="AO070333000099"
                     /protein_id="BAE65766.1"
                     /transl_table=1
                     /translation="MRFQHLTTALAVGVSAHLAQAAGLHDAAVAKGLLYFGTATDNPE
                     LTNTSYVTQLNNTGDFGQITPGNSQKWDSTEPSQNEFSFTNGDVIADLADANDQKLRC
                     HNLVWHQQLPNWVSSGSWTNETLTAVLQNHITNVVKHYKGRCYAWDVVNEALADDGSY
                     RDSIWYKTIGEAYIPIAFAAAAAADPDVKLYYNDYSIEWGGAKSTAAQNIVKLIQSYG
                     GKIDGVGLQAHFTVGQTPARKDLASNLKAFTDLGVEVAYTEVDVRMETPATDANLQQQ
                     STEFSNIVGACLDTEGCVGVTIWDWTDKYSWVPSTFPGYGAACPWDENFEKKPAYQGI
                     LEVLGGWIALRLLFV"
     exon            complement(838733..838764)
                     /number=1
     exon            complement(840178..840738)
                     /number=2
     exon            complement(840796..840909)
                     /number=3
     exon            complement(840969..841101)
                     /number=4
     exon            complement(841173..841329)
                     /number=5
     exon            complement(841405..841457)
                     /number=6
     CDS             complement(join(842439..843154,843217..843489,
                     843596..843704))
                     /codon_start=1
                     /locus_tag="AO090103000327"
                     /note="Hsp90 co-chaperone CNS1 (contains TPR repeats)"
                     /old_locus_tag="AO070333000100"
                     /protein_id="BAE65767.1"
                     /transl_table=1
                     /translation="MPPAMEAVRSHTTDEIADMMNKTPLFMTDIDKAKDENGENVFLD
                     ALQALQNEGTRAEVAQNFREQGNEAAKELRWIDAKEFYTKALAVIFAKVDKWEKPEDL
                     DAEQKLLRQVEEASYINRALCNLELGNYRQCTLDCASTLKMNPKNIKAFYRSAMACLK
                     LDKVDDAEDAAKRGLAIDPNNKSLQIAAEKAAERKAAIERVSAKRKAEEERKKQEKKL
                     LDVALKAREIRTRTTDNPADLQDAVMHLVPDPLSPESTLEFPAVFLYPMDAQSDFIKA
                     FSEMHSIEDHLEYIFPLPWDANNEYTIKSVDCFMETATGGLIKAGKKLPLLQILSGSK
                     VEVVDQLVKFFIVPTAKSGQFIAEMKKRKQV"
     exon            complement(842439..843154)
                     /number=1
     exon            complement(843217..843489)
                     /number=2
     exon            complement(843596..843704)
                     /number=3
     CDS             join(844428..844905,844987..845404,845475..845694)
                     /codon_start=1
                     /locus_tag="AO090103000328"
                     /note="3-isopropylmalate dehydrogenase"
                     /old_locus_tag="AO070333000101"
                     /protein_id="BAE65768.1"
                     /transl_table=1
                     /translation="MTIAKTYNILVLPGDGIGPEIMAEATKVLSAFNTSTVQFNTRSE
                     LIGGCSIDLHGKPITDAVKEAALASDAVLFAAVGGPKWDNMRRGLDGPEGGLLQLRKA
                     MDIYANLRPCSADSPSRSVAREFSPFRQEIIEGVDFVVVRENCGGAYFGRKVEEDEYA
                     MDEWAYSTSEIQRITRLSAELALRHDPPWPVISLDKANVLASSRLWRRVVEKTMAEEY
                     PQVKLVHQLADSASLILATNPRVLNGVILADNTFGDMISDQAGSIVGTLGVLPSASLD
                     GLPSETRRRTNGLYEPTHGSAPTIAGKNIANPVAMILCVALMFRYSLDMEREAQQIEE
                     AVRTVLDSGIRTPDLGGKAGTTEVGDAIVAVLRGQKL"
     exon            844428..844905
                     /number=1
     exon            844987..845404
                     /number=2
     exon            845475..845694
                     /number=3
     CDS             join(847624..847733,847836..848664)
                     /codon_start=1
                     /locus_tag="AO090103000329"
                     /note="catalase (peroxidase I)"
                     /old_locus_tag="AO070333000102"
                     /protein_id="BAE65769.1"
                     /transl_table=1
                     /translation="MSTPGDYDAVRRDIVAQLKKPDYDDGSAGPVFVRLAWHSAGTYD
                     AESDTGGSNGAGMRYEAEGGDPANAGLQHGRAFLEPVKERHPWITYSDLWTLAGVVAI
                     KELGGPEVEWKPGRTDLVDDSKVPPRGRLPDAAQGAEHLRFIFNRMGFNDQEIVALAG
                     GHNMGRCHMDRSGFHGPWVNNPTRFSNQFYNLLLKLEWTPKTLENGIQQFVYVDPDAE
                     EGDEQLMMLPTDVALITDPKFRVWVERYAQDKELFFDHFAKVFAKLIELGIKRDAKGV
                     IINSDNVKGGYVSAPKKSNVPTGLSQRGGGCPMARL"
     exon            847624..847733
                     /number=1
     exon            847836..848664
                     /number=2
     CDS             complement(849332..852367)
                     /codon_start=1
                     /locus_tag="AO090103000330"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000103"
                     /protein_id="BAE65770.1"
                     /transl_table=1
                     /translation="MSSENSDARSLKEEDDFKYNPELNYPMVKLADLPEPPKNWRVCG
                     RTAEEASKARKATSEEAKKWVRYHSWGIDMGVKGDLTNLRCFKVLWKLFYYQQDKHRP
                     QDFDQIKDFKTRDAGPRLLQCSLDVPGLLPISRYYPHPPPATRLPAEGFHRPLDALAS
                     RPDSHIEQMLYPVFGVPKEVDNFPEEIETPTAQATGNSTGNRNQHKIRLPKVMARSVM
                     EAIERTVMQFAYEDLARDCSAVAQDGQVHLTAKTEEDLRQANIGSFPATSHVKLAVDP
                     DNSDRLVFSADGDKYPYRGRGPVYRNNSSGIDSIIVLGKLLDAGSTVLDRKDPEWRGR
                     FTNVEKAFIEATDVNWDLCSRGDSRDRFWAVMAAEAENVGVGVQSPLLDMWNVSTEHF
                     DQFLFTYDEQTTFCSPCTNRTTNAAYQSATVAPPTCPEDMKGVSMQQLISRSFASEYI
                     SRCGKCQDKVVKCRRMLHGLPMRLTVTLDGSVPVKKHTRDISFDYITNGGERGTAAYR
                     WLGGIYCKADHYRVYWNDTKRGEVDTGQIQMYDSAMLSGVIVGGIAQAHRDDKVPETW
                     WKNKPVPLLVYERIMNPDDEVMNVALHALGDMVKVRNQQKLLLQGHISWTPSEPPRAR
                     AGFPWRRLIDRKEDRFHLASGAYDPRNQGQISTEPSGVDRHANIPGPSSAGPSKIDVG
                     SSTSSAPVPEPQPEIGRISPSLWEAPTASMFAEISPLFALAPTPSLSGLESIIEDTAL
                     INEQLNGPHQEQYRAQSNVQNNAQYATQSSSQLHAGHNMQQTTQPSGQQHGQADRQYN
                     ATQTNTQYQRPYNPHHRTQTTAQQPNGYNAQQHQVQHNAQYRVQPSTHPHEPHGTFND
                     TSFGLQDIMHDGLFQDWTSGGIDDFGFSFPELSSSIFFSPKPSHASSTNSAPAPVENS
                     IKHSHQNTNNGGSMPQYIDPSVLTAAPQNPSSLPQQVRPRPVDGQRPASHVAPAAGIR
                     WHSHGNVASSHMSANQTPQGSKRKRVDEAEPRRHPPNLR"
     exon            complement(849332..852367)
                     /number=1
     CDS             join(853540..853543,853761..853926,854077..854374)
                     /codon_start=1
                     /locus_tag="AO090103000331"
                     /note="ribosomal protein S18"
                     /old_locus_tag="AO070333000104"
                     /protein_id="BAE65771.1"
                     /transl_table=1
                     /translation="MSLVSGEKTNFQYILRLLNTNVDGKQKIMYALTQIKGVGRRYSN
                     LVCKKADVDLNKRAGELTTEELERVVTILQNPTQYKIPTWFLNRQRDITDGKDSQVVS
                     NNLDSKMREDLERLKKIRSHRGLRHYWGLRVRGQHTKTTGRRGRTVGVSKKKG"
     exon            853540..853543
                     /number=1
     exon            853761..853926
                     /number=2
     exon            854077..854374
                     /number=3
     CDS             complement(join(855169..856334,856387..856849))
                     /codon_start=1
                     /locus_tag="AO090103000332"
                     /note="serine carboxypeptidases (lysosomal cathepsin A)"
                     /old_locus_tag="AO070333000105"
                     /protein_id="BAE65772.1"
                     /transl_table=1
                     /translation="MRVLPATLLVGAASAAVPPLQQVLGRPEEGMSFSKPLHAFQEQL
                     KTLSEDARKLWDEVANYFPDSMDHSPIFSLPKKHTRRPDSHWDHIVRGSDVQKIWVNN
                     ADGEKEREIDGKLEAYDLRIKKADPSALGIDPNVKQYTGYLDDNGNDKHLFYWFFESR
                     NDPKNDPVVLWLNGGPGCSSLTGLFMELGPSSIDENIKPVYNDFSWNSNASVIFLDQP
                     VNVGYSYSGSAVSDTVAAGKDVYALLSLFFKQFPEYAEQDFHIAGESYAGHYIPVFAS
                     EILAHKNRNINLKSVLIGNGLTDGLTQYGYYRPMGCGEGGYKAVLDEATCESMDNALP
                     RCRSMIESCYNSESAWVCVPASIYCNNALIGPYQRTGQNVYDVRSKCEDESNLCYKGM
                     GYVSEYLNKAEVREAVGAEVGGYDSCNFDINRNFLFHGDWMKPYHRLVPGLLEQIPVL
                     IYAGDADYICNWLGNKAWTEALEWPGQKEYASAELEDLKIEQNEHTGKKIGQVKSHGN
                     FTFMRLYGGGHMVPMDQPEASLEFFNRWLGGEWF"
     exon            complement(855169..856334)
                     /number=1
     exon            complement(856387..856849)
                     /number=2
     CDS             join(857458..857524,857682..858646)
                     /codon_start=1
                     /locus_tag="AO090103000333"
                     /note="predicted exosome subunit"
                     /old_locus_tag="AO070333000106"
                     /protein_id="BAE65773.1"
                     /transl_table=1
                     /translation="MPIMQPSNQIKFTNVSVVRLKKGKKRFELACYKNKLLEYRSGAE
                     KDLDNVLQVPTIFLSVSKAQTAPSAEIAKAFGANTPADEIRQEILRKGEVQVGERERK
                     EIIERVEKEVLDIVSGRLVDPTTKRVYTPGMISKALDQLSSASGQMQQAQSQNNNGEA
                     SGAGDESRPAQPRKPLWTGVTPNKSAKIQALEAMKALIAWQPIPVMRARMRLRVTCPV
                     PLLKQTVKSAAPAGLNKEKEAPSGGNSKSNKKGGKGSKKSARQQDSDAEGGSDAEPSQ
                     PKAPTNVKDKILSFIESVESQEIAGDEWEVVGFAEPGAFKGLNEFVGNDTRGRGRVEV
                     LDMAVTHED"
     exon            857458..857524
                     /number=1
     exon            857682..858646
                     /number=2
     CDS             join(860012..860085,860152..860275,860326..860366,
                     860420..860629,860693..861029,861107..861196)
                     /codon_start=1
                     /locus_tag="AO090103000334"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000107"
                     /protein_id="BAE65774.1"
                     /transl_table=1
                     /translation="MKTGDDIMLTRTVLTGTIIARLSTDVCTGGEVNKHSNILTVPYS
                     HHMFTMLLGNKLCLAPISDDVQRVLDIGTGTGIWAIDFADEYPSAEVIGTDLSPTQPS
                     FVPPNLQFEIDDAEDSWAYPENHFDLIHVRALYGAISDWPAFYRNVLIGLRPGAWFDQ
                     LEMSIQFRSDDGTVTSDHILAEWSRIFIEAGERFGKTFRIADLARQHMIDAGFENVTE
                     RRFKLPVGPWSNDEHYRQLGRWNLLHCEQGIEGWSMALLTRVMGWSYEEVQVFLAKMR
                     KGLRDYSKIHAYFYV"
     exon            860012..860085
                     /number=1
     exon            860152..860275
                     /number=2
     exon            860326..860366
                     /number=3
     exon            860420..860629
                     /number=4
     exon            860693..861029
                     /number=5
     exon            861107..861196
                     /number=6
     CDS             862741..864474
                     /codon_start=1
                     /locus_tag="AO090103000335"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000108"
                     /protein_id="BAE65775.1"
                     /transl_table=1
                     /translation="MTRQIVSPVPADDEYYDLGSFGHSITTNSGDAQIWFNRGLTWVY
                     SFNHVEGAYCFEQAIAHDPTCAMAYWGLAYAVGPNYNKPWEKFDLGDLHRSVQRGYEA
                     SREAAKHAVNATHLERALIEAIQSRFPTDQPATDYAALNKGYAAAMKLVYDIFGRDLN
                     IATLYADALMNMTPWSLWDLFTAKPNPNAPTMEVKAVLERALAQEEDGPYLNPGLLHL
                     YIHFIEMSPTPELGINVADHLRDLVPDAGHIHHMPTHLDILIGDWRRSIASNHNSTLA
                     DDKYFRKSGAKNFYTFYRLHDYHSLIYAAMFAGRRKTALDAVTRMEATVPEDVLRIQS
                     PPMADWLEQFMSIRLHVMVRFGMWEELKRKELPHDQELYAGVTATTHYAKGIAFAATG
                     DVATAREEQERFHQAWARVPATRRAYNGKIVDVLGVASAMLEGEIEYRCANYDKAFAS
                     LREAIDLEDKLPYSEPWSWMQPVRHAYAALRMEQGYLEEAAQTYRADLGLDHSIIRQR
                     RHPNNVWSLQGYYECLVRLGRMDEAAMIEQPAKLALAAADVPIKASCFCRLDTAEIPQ
                     VLNGCSKGKCC"
     exon            862741..864474
                     /number=1
     CDS             865197..866522
                     /codon_start=1
                     /locus_tag="AO090103000336"
                     /note="1-aminocyclopropane-1-carboxylate synthase, and
                     related proteins"
                     /old_locus_tag="AO070333000109"
                     /protein_id="BAE65776.1"
                     /transl_table=1
                     /translation="MGSIGYPDVQPLEIFSKRGQNAVELGSKRIIWDVISDMWNPDTN
                     PSGILSIGMAENTLLHNTLLQYIEANFRLSAEHLTYNNGSMGSNALRKAVSHFLNRHF
                     NAFRPVEPSHILMTNGCSSAIEHLSWAFVNPGEGVLLGMPYYSTFIADISLRPEAVVI
                     PVKMGNVDPLSIESVDLYEKAAVEFEASTGRRVRAVILCNPHNPLGRCYPRETIDKFM
                     EFCQSRQMHLISDEIYALSVWENRVDKDIPFTPFESILSRDITRLIDPSLVHVLWGMS
                     KDFGANGLRVGAIISQSNPELHIAQKCLSLYSFVSGMSDQITASILSDDHFTDKYIEM
                     NRERLSLSHQFLVHALNKHKIEYLRGCNAGFFLWVNLGAKYLAAHPEEEGRATDLTDR
                     IFQKLLDNKVYVAHGTAYGSENPGWFRLVFAHPIPWLMEAMARIVCAIQ"
     exon            865197..866522
                     /number=1
     CDS             join(867365..867745,867821..868001,868050..868513,
                     868564..869130)
                     /codon_start=1
                     /locus_tag="AO090103000337"
                     /note="amino acid transporters"
                     /old_locus_tag="AO070333000110"
                     /protein_id="BAE65777.1"
                     /transl_table=1
                     /translation="MGIYMENATDKAQGEPVDHGADTQLHRTLGTRHLTMVALGSAIG
                     MGMWLGSGTSLANGGPASLFIGFLISSSIIWSVCQSIGEMAVIYPLPSAFVQWATIFI
                     SPAAGFALGWGYWFSYWITIANELQGVVTVLNYWTDEVPKAAWISIFWAVIILINIWA
                     VRFFAEVEVVASTIKFGWMFICVIALIVVTAGGSPQGGPIGFRYWNAQPVNNGFKGFI
                     SVIPTCIFAMAGSENAALVATEVANPRESVPKAIKSVWFRLGLFYILGSLMITLTVDP
                     NDPSLFGGSGSNASPFVIAFKNAGIPILAHITNAVIFISVISTGSISGYGGSRILMGL
                     AHVKMNHKDVLQVFGKADSVGRPWAGYIATIGIGGALAYLNVTHTGAQVFTWLSNLVS
                     LLTLFGWSMICLSHLRFRYTWTLQGRNEAHLPWRSWAYPYAAWWGLIWCLVVFGIQFY
                     LSIWPLHEKTSAKNFFANYISVIAVAIIWVCAQVWYSCPLWADARNIDLDMCRRFYAD
                     TVDEESTPVAKSLARKLRVVCK"
     exon            867365..867745
                     /number=1
     exon            867821..868001
                     /number=2
     exon            868050..868513
                     /number=3
     exon            868564..869130
                     /number=4
     CDS             complement(join(870701..871517,871579..872268,
                     872325..872674))
                     /codon_start=1
                     /locus_tag="AO090103000338"
                     /note="purple acid phosphatase"
                     /old_locus_tag="AO070333000111"
                     /protein_id="BAE65778.1"
                     /transl_table=1
                     /translation="MKATTASVLLALLSAVNGRPTVDNRFPYKGPAVPVGDWVDPTIN
                     GNGKGFTRLVEPPAVKPASSHPTNNVNVISLSYIPDGIHIHYQTPFGLGQSPAVKWGT
                     SPYHLVNVARGFSHTYDRTPSCSQMKAVTQCSQFFHEVSLPHLESGKTYYYQIPAANG
                     TTESEVLSFTTARKAGDPTEFSVAVLNDMGYTNAQGTQKYLTKAASEAAFAWHGGDIS
                     YADDWSSGIMACEDSWPVCYNGSSTSLPGGVITSEYKKPLPQGEIPNQGGPQGGDMSV
                     IYESNWDLWQQWMGNITKKIPYMVLPGNHEAACAEFDGPHNVLSAYLDHNEPNSTWTK
                     NDLNYYSCPPSQRNFTAFQHRFRMPGSESGGVTNFWYSFDYGLAHFVSMDGETDYANS
                     PEWSFAEDLTGDETFPTESETFVTDSGPFGAIDGSVKNTKAYEQYKWLKKDLSSVDRT
                     KTPWVIVMSHRPMYSSAYSSYQKNIREAFEALLLQYGVDAYLSGHIHWYERLWPLGAN
                     GTIDTASVLNKNTYRVNPGKSMTHIVNGMAGNIESHSEFSAGQGLTNITAVLNTKEYG
                     FSKLTVANATALKWEYVKGSDGSAGDTLWLVKPEAAGFQGRGKSPYGKKTRS"
     exon            complement(870701..871517)
                     /number=1
     exon            complement(871579..872268)
                     /number=2
     exon            complement(872325..872674)
                     /number=3
     CDS             complement(join(875369..875652,875743..876067))
                     /codon_start=1
                     /locus_tag="AO090103000339"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000112"
                     /protein_id="BAE65779.1"
                     /transl_table=1
                     /translation="MSLREKVRRVFRRSPSGSKSKDNSNSIKIEYYKRHEIPPSKFKG
                     PFDREHQKRLAAWSFDDAQAERPRSPDLSLSPCASLPDYLRPRVQEDSVAPDEVPSLA
                     PEGLSDASATISDNERAERQDDSGSTSSTAYDPDSYSSSMMTLFDEAIRQDSIAQFKE
                     TIRYTSPVVRAISPPPLSPKGSYMPFAPEDLTRALNAVQICG"
     exon            complement(875369..875652)
                     /number=1
     exon            complement(875743..876067)
                     /number=2
     tRNA            877967..878038
                     /locus_tag="AO090103t00009"
                     /note="tRNAscan-SE"
                     /product="tRNA-Arg"
     CDS             join(879812..879915,879999..880252,880314..881842)
                     /codon_start=1
                     /locus_tag="AO090103000340"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000113"
                     /protein_id="BAE65780.1"
                     /transl_table=1
                     /translation="MPKKGGKGKNKNKGGKAGGAGVAATKKVTDIQNPVTPGHEVEET
                     VAKGEGEVSDVVTEPVEAVTASPTATVPDAITNIPSAAPPASTEEAREILQDAVNKAE
                     TGPTDKPELVEGEAIGAVEPSVTDEPLKLTPETLPATTGTETSLPERPKETVTDTSDV
                     HAKRPYESSLTAKDDELPHKIAKVDDTVAAAGATSGHVAETGSLARKPGVPAETGSVQ
                     PQIVPGLGADPNDNVSTVLNVPGLSPIEEKSTVPSAAEASAVPAPNTSTEPKGAEDIA
                     PTGAPTSDANADATEKSKDSEISKAEEETVATEPKGAEDIAPTGAPTSAGNVDVAEQP
                     KDTELSKAEETVASEPPTTAAPAVASEPEAPSTAELTTAAAPSEVTGTETVSPSGATA
                     PSATDSTTKAASASADTGTGTATSAPAPPAEPVLKVPSSIHDGPDSKVTSANKSAADQ
                     AVSNVEQEAEGASANTQAPVTETIPEETKPAAEVQEGTGAVKNQVPENQPTAREAQEA
                     GAGAAKQPEEIQKPEEAKTKEPRAVQDAQEEGAATVKKPEELKPEDIKKPEEAKTKEP
                     QAAQAAPADATSKPEGKETVKTEAGKAQDQAQESAKAEAAKLEKRKSGFFGWFKRKLK
                     GEKA"
     exon            879812..879915
                     /number=1
     exon            879999..880252
                     /number=2
     exon            880314..881842
                     /number=3
     CDS             complement(join(883813..883841,883897..884425))
                     /codon_start=1
                     /locus_tag="AO090103000341"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000114"
                     /protein_id="BAE65781.1"
                     /transl_table=1
                     /translation="MEVPMGCFTKIPMEILLEIASLLDIKCLSNLLAANEDIAAHCLH
                     LVTLPRLVHVIQQIDIDSLMNLLIVGIEPNTTDSEGNTLLAIAMKRSETVEENVPQNG
                     EERAKEKPRQSDKLPELIALLLLCDADPKLPNRYNRLPLDFASLEILKNRELCAALYE
                     EGARVTDLATVGRIYEFYEEASTKT"
     exon            complement(883813..883841)
                     /number=1
     exon            complement(883897..884425)
                     /number=2
     CDS             join(885471..885706,885763..885790,885844..887009,
                     887068..887182)
                     /codon_start=1
                     /locus_tag="AO090103000342"
                     /note="glutamate decarboxylase/sphingosine phosphate
                     lyase"
                     /old_locus_tag="AO070333000115"
                     /protein_id="BAE65782.1"
                     /transl_table=1
                     /translation="MVHLAQVHRNADLDSTIKRVDSIQLENTDEDGFYSSVYGTRFAT
                     EQLPQTEMPEREMPREVAYRMIKDELSLDGNPMLNLASFVTTYMEDEAEKLMTESFSK
                     NFIDYEEYPQSAEIQNRCVNMIARLFNAPVHSEDEHPMGTSTIGSSEAIMLGTLAMKR
                     RWQNKRKAEGKDYSRPNIVMNSAVQVCWEKAARYFDVEERYVYCTEDRYVIDPQQAVD
                     LVDENTIGICAILGTTYTGEYEDVKAINDLLIERNIDVPIHVDAASGGFVAPFINPKL
                     EWDFRLPKVVSINVSGHKYGLVYPGVGWVVWRSPEYLPKDLIFNINYLGAEQASFTLN
                     FSKGASQVIGQYYQMIRLGKRGYRSIMTNITVTADFLAQELEKMGFIIMSQRRGHGLP
                     LVAFRLPAEREGQFDEFALAHQLRERGWIVPAYTMAPNSNNLKLMRVVVREDFTKSRC
                     DALLSDIKLGLKTLGDMDKAMLDKYTQHVRTHATHSHKSKHNHPHYKGETHSLQGKHG
                     KTHGVC"
     exon            885471..885706
                     /number=1
     exon            885763..885790
                     /number=2
     exon            885844..887009
                     /number=3
     exon            887068..887182
                     /number=4
     CDS             join(889514..890375,890426..890521,890576..890694)
                     /codon_start=1
                     /locus_tag="AO090103000343"
                     /note="threonine dehydrogenase and related Zn-dependent
                     dehydrogenases"
                     /old_locus_tag="AO070333000116"
                     /protein_id="BAE65783.1"
                     /transl_table=1
                     /translation="MRAVVYTGKDTISVEERPKPSLLEPTDAIVKVQHTTICGTDLHI
                     LQGHVQTCTPGRILGHEGVGIIESLGTGVTRFSVGQPVLISCITSCGSCNFCRKRMPS
                     QCTSGGWILGNTIDGTQAEFVRIPHASFSLHALPNGLDPKVAVTLSDVLPTAYECGIL
                     NGQIQPGSTVAIIGTGPIGLMALQMARNLFGPSMTAVVGRGQPRLDTAKEMGADHAIS
                     VLGGQADAVASALAVTSNQGFDVVIEAVGTTDSFELAQALVGPGGTIASLGVFGTPCA
                     LHLEDLWHRNICIRTRLVDACTTPDLLKIVESGKISPHFLVSHNFSFDQIYKAYETFQ
                     TPSKSGSLKVVISMAELQPANPRL"
     exon            889514..890375
                     /number=1
     exon            890426..890521
                     /number=2
     exon            890576..890694
                     /number=3
     CDS             join(893860..893950,894302..895068)
                     /codon_start=1
                     /locus_tag="AO090103000345"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000118"
                     /protein_id="BAE65784.1"
                     /transl_table=1
                     /translation="MGDIAEYPRHIPYNSDKKSFSEKTGRESFEGYWMPFEAAKAVAA
                     TFCWNIRHALTPLFGLDFPSLCVPPTNTSQYGHMLIDREIVQKATETAHYYRMLELRS
                     PVDTSLRPPKLHNSELDRPASSPERSTPDRYYGTPTSPFHNTFTPVNTPRSTEAASSS
                     PRQVLASLSSVRGIPNDDSSSEVTHSSTPYSESMDTPTESDDEYHASDSDNGNAIGNI
                     IGPQNPTNDDDEYNVETRARRKYRSALFAREVKAAHALLSLCMQDATGSDEEYVWVDR
                     GRKRRRASA"
     exon            893860..893950
                     /number=1
     exon            894302..895068
                     /number=2
     CDS             complement(join(895314..895640,895713..897158))
                     /codon_start=1
                     /locus_tag="AO090103000346"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070333000119"
                     /protein_id="BAE65785.1"
                     /transl_table=1
                     /translation="MQSYLQYRRIGRAVRKQFADHPEWGQRVQGESTDPSGNTSENDE
                     TVWEKRSESRPLALPPGVQRRDITDSSGTPSSVFLVSWEQDQDPMNPRNYSMTARITA
                     TLIVSALAFAVGAASSIESAVIPQNAAAFNVSEVVASLATGLYLLGFAAGSLVSGPLS
                     EILGRNAVYIGSLTLFMIFIMASGLAPNIGAQLAFRFLAGVFGCPPLTCAGGTIADLW
                     NPLEKTLTFPLYAILSFGGPVFGPVIASYMGQGTLSWRWTNWIMLIMSGLVMGLILLL
                     QPETYGPLLLKWKAAHLRQVTGDKRYRSAMDVQKIALIERILGACKRQFSLTVHEPII
                     LLISLYMTVIYIVLFTFFDGYPFIFQDVYGLSQGLTNIVWVAMYVGIAAAGLWVPVVY
                     GWTKREFEAASSSSTTTTSGTGVVPCVTGIDPNVNAEGEQGQQEQEPEGGRDEQNTKN
                     PHPARPENRLWFAMLGAPFIPIGLFWMGWTDYEKISIWPPILASTIFGFGTITVFISS
                     YMYVIDSYDIYAASALGFMTVSRYCAAGGMTVVGIPFYRNLGVQYTLTILACISVLMT
                     PVPYVFWFWGSRIRGMSRFAVSGV"
     exon            complement(895314..895640)
                     /number=1
     exon            complement(895713..897158)
                     /number=2
     CDS             complement(join(897675..897842,898398..902477,
                     902909..902974))
                     /codon_start=1
                     /locus_tag="AO090103000347"
                     /note="DNA topoisomerase type II"
                     /old_locus_tag="AO070333000120"
                     /protein_id="BAE65786.1"
                     /transl_table=1
                     /translation="MDDSIMDDSVFEDDGSDFEPEPLTQLEHIIKRPDTYIGSIERTS
                     QQMWVYSTESDGMEFREVSYVPGLYKIFDEIVVNAADNKQNDANMDEIRVTISRETGE
                     ISVWNNGRGIPIEMHAKEKIYVPELIFGHLLTSSNYDDTQQKVTGGRNGFGAKLCNVF
                     STEFSIETQDSRQKKKYKQTWTSNMTKMGKAKITDAKGDDYTKVTFKPDYAKFGMDGM
                     DNDFEALVKRRVYDLAGTAKVAVKLNGSRVPVRNFKKYMEMYTKAIRRERGDDGPAAK
                     DEIITCSPDPRWEVGFAVSDGSFQQVSFVNSIATTSGGTHVNYIADQICSKLADQVKK
                     KNKNGATLKPAQIRNHIFIFVNAQIVNPAFTSQTKEQLTTKSSQFGSKCVLEEDFYKK
                     ILKTDVMSNILHFAQQKADQMLKKTDGGRRARMNNPKLTDANKAGTKDGHHCTLILTE
                     GDSAKGLAMAGRAVVGPDLFGVFPLRGKLLNVRDATFEQISKNAEIQNIKNFLGLQHK
                     KEYTDTRGLRYGHLMIMTDQDHDGSHIKGLLINFLQAQFPSLLRIPEFLIEFITPIIK
                     VWKGDPKNPTKQRSFFTMPEYEAWKEEHKHERGWEHKYYKGLGTSTTEDAQVYFRDLD
                     RHLKEFHTMQDNEVGLIELAFSKKKADERKEWLRQFKPGTFLDHSVSKISYTDFINKE
                     LILFSMADNVRSIPSVVDGLKPGQRKVLYTCFRRNLKKDMKVVELAGHVSGMTAYQHG
                     DISLQQTIVGLAQSFVGSNNVNCLEPSGNFGSRLQGGSDCASARYIYTRLSPFARRVF
                     HAHDDPLLTYNEDDGEKIEPEIYVPVVPMILVNGADGIGTGWSSSIPNYNPEDIVDNL
                     KRLMDGEETRPMQPWFRGFTGEVTDVGGDRFKFSGIIKETGEKEVEITELPIRTWTQD
                     FKDKLEDIIKAEKTPSFIKDYKDYNTHTKVHFVIQLDEKNMKSALSEGLEEKFKLSKT
                     VATTNLVAFDPEGRITKYATVDDILKEFYTYRLKFYEKRKQYQLSQLQKELDKLSNQA
                     RFVQEIIDGKLVVSKKKKNVLVQELKDKGYKAFPKVAEAVKAGEEERVVEEDDDESDS
                     QDTEVLSSAYDYLLGMAIWSLTQERVEKLRRQIGEKEVEVDALIKMSKEDIWKRDLDD
                     FIAEWRFQLEDEHRRQRKVAMMGRRTSAKLMTAAGRGAGAKKRKAALGDDPDDEDFAA
                     PKTKKSAAAKKAEPKGGLLNYLNKPATKSKSPPKDEDNSDEDFAMEVMPKKNRGASKP
                     PKEEDEDDEMGLSEVEEVMPKKSRSAPKAAAKAAPKAKEVDEDVMEVEAPPKRGRPAA
                     KAKPKPKPKDEADEDDLDDDDFAEITKAEAAKSSAPPSRSRKPVKYAIESDSDDNGDD
                     LLGDAADSEEEDEEVRPARKPAGRPARRTAAAKKTYVIEDDDSEDGGDASEDDFEEDS
                     D"
     exon            complement(897675..897842)
                     /number=1
     exon            complement(898398..902477)
                     /number=2
     exon            complement(902909..902974)
                     /number=3
     CDS             join(905342..905740,905805..906406,906459..906815,
                     906866..908189)
                     /codon_start=1
                     /locus_tag="AO090103000348"
                     /note="predicted GTPase activator NB4S/EVI5 (contains TBC
                     domain)/Calmodulin-binding protein Pollux (contains PTB
                     and TBC domains)"
                     /old_locus_tag="AO070333000121"
                     /protein_id="BAE65787.1"
                     /transl_table=1
                     /translation="MDNSETITPQIHSPGVPKNIPAIHQHSDSMVTVPLSDVQSSSEH
                     TQPDWRTLDIPQTPIEVTSPTGESVDDDEPTSTTPTRDSEPQILQPRTYRASVVSRSS
                     EEIFRGDIDGVDWRELDKSEEQEPRGEGSDESTSLLLARLEQENNALATDPKSGLQAQ
                     QFRGVRKSRSQSLRQVKQLINDDPRSLRYSQLPPPPLTELEFWAALVSDYPQTAQRLP
                     TLTSNKIRCGIPPPLRGVVWPSLAGARDTTLLAEYQRLCGETSPYEGLIGKDIGRSFP
                     NVEMFRDPNGEGQQMLARVLKCFSLYDTKIGYCQGLGFVVGPLLMHMTDAEAFCVLVR
                     LMDHYDMRTCYLPDLSGLHLRVYQFQNLLARLRPALYAHLESLHVEPIYVSQWFLSFF
                     AVACPMPMLLRIYDIIFLEGACETLMRVALSLMQRNEKKIMACAEFEDVMQLLLSRSL
                     WDTYACHADDFVNDFVSLTSLVTKESLQTLEASYNQSQGVPTGISFPQMQAAASRFLG
                     RFWAGSGSHTSAKPFTLNPNHASSSASIRRTTSKQSMTSTLNSIESTSDASTAPTELS
                     TDAPKPRVKSVMSQHKDRDLHSQIEDLLMALSDLQRQHADLTRELQQEREEREADQEL
                     SKSMLSYIKELETPPTDLITKVEERFGATDAPARESIGQTKQQLLEDLNRWKEMHSVE
                     SGRCHDLTRRIDEHEKENASLREQVREARGRIQDGYRERQRLERMLRELRTARNPRSS
                     AETSTDYGSPVSEPGEGIPGGLRELRLVRTNSQKSTFTRRTSSLGLQNVLSTENNKPA
                     AEEALLLELVNAKTAEAVAKQELEEMKVKMEGMRKLIAASQRSPSQNGDRNSIVRSPS
                     SAGSLHKASTEPATGGGGFFGWGRRAASTSNEQYAEK"
     exon            905342..905740
                     /number=1
     exon            905805..906406
                     /number=2
     exon            906459..906815
                     /number=3
     exon            906866..908189
                     /number=4
     CDS             913936..914367
                     /codon_start=1
                     /locus_tag="AO090103000351"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000124"
                     /protein_id="BAE65788.1"
                     /transl_table=1
                     /translation="MARIRVPESGSRNCNDGQKLLLIRAQKARWPRPLLPTSEPFSVK
                     GFKRQLKPHQVYGAYQLLKWEPTTEIGGFLVDGICLGKTTPPLAVMVLLRLIGVACLG
                     EGFSGRVGMGQKSITITPIKGKSVASPMESFPFHSAAPVSR"
     exon            913936..914367
                     /number=1
     CDS             join(915215..915686,915778..916019)
                     /codon_start=1
                     /locus_tag="AO090103000352"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000125"
                     /protein_id="BAE65789.1"
                     /transl_table=1
                     /translation="MNKSLPRIACFHGGGSSAAIYEIQCSFLTALLAHEFQFEFFEGP
                     FDSIAGPGILPAFGGFEPYKSWFSKGESNGHNWTEQDSLEWVWTMMEERRAGQGGEWV
                     GVMGFSEGTRIASGLLLDQQRREKLGLRPAVPSIQLRFGVLCMGGGPPMAAHFDYVSA
                     GTTTNDQRVIRIPTLHMHGLRDKFLALGRDQYNTYFDPSRAFLFEVDYHHAMPWLEKE
                     SLALAQRIQSLHKKTQASR"
     exon            915215..915686
                     /number=1
     exon            915778..916019
                     /number=2
     CDS             complement(join(916110..916966,917027..917218,
                     917280..917557,917592..917675,917743..917777))
                     /codon_start=1
                     /locus_tag="AO090103000353"
                     /note="asparagine synthase (glutamine-hydrolyzing)"
                     /old_locus_tag="AO070333000126"
                     /protein_id="BAE65790.1"
                     /transl_table=1
                     /translation="MDQTPFSKAYIIFDRVTTSSVRASVHWSKPNTGTVSSPTSTHTG
                     QRALEPRSEEEIILGLRKHLLEAVKLRLRADVPAGVYLSGGLDSTAVAGMVSHLMKNG
                     ERLGNNPDGLKSQLHCFTVQFDRDSGYDESDVAERTATWLGANCHLVPVDEAVLAAGF
                     EDTIWFSESPLPDLCGVGKLALAEAVHKEGIKVVLTGEGADEHFGGYSYLRLDALAEP
                     DPSWPAAQFPESERLQMHEKLYRQVDSSGSVGRVESAERMLNGSFYGQEMAYFNFLPF
                     ASWTDLYASVPPHTALAESFSGSTRDRMMNKWHLLHTSEYISIKTFLSTFILRNAGDN
                     VDMVHQVESRPPFLDHRVTEYANQIPPSLKMSVDPVSKTFRDKHILREAVKPFIPDEI
                     YSRPKRSYAAPVRYPKDGPLCQLFNQLVTEENVKKLGFVDWGKAKGNLHRAFEGSDDM
                     AFRFTLTLAQFVVLMQRFGVATCCPSPNALS"
     exon            complement(916110..916966)
                     /number=1
     exon            complement(917027..917218)
                     /number=2
     exon            complement(917280..917557)
                     /number=3
     exon            complement(917592..917675)
                     /number=4
     exon            complement(917743..917777)
                     /number=5
     CDS             complement(join(917852..917861,917912..918200,
                     918259..918412))
                     /codon_start=1
                     /locus_tag="AO090103000354"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000127"
                     /protein_id="BAE65791.1"
                     /transl_table=1
                     /translation="MCGIGAFLDFHNHSQPVSHQQLESEIDNGLDFIKHRGPDARGKW
                     VNADGRVGLGHIRLSIVDPSPSGNQPFHDSRGDIHAVVNGELYDHERYREQLASEFDF
                     KGNSDCEIVIALYKHYGASFLSHLRGEFALVLWDAKRELFFAARDRRN"
     exon            complement(917852..917861)
                     /number=1
     exon            complement(917912..918200)
                     /number=2
     exon            complement(918259..918412)
                     /number=3
     CDS             join(920082..924521,924584..935773)
                     /codon_start=1
                     /locus_tag="AO090103000355"
                     /note="non-ribosomal peptide synthetase modules and
                     related proteins"
                     /old_locus_tag="AO080541000347"
                     /protein_id="BAE65792.1"
                     /transl_table=1
                     /translation="MGSIGETVKAWNHNDGVENQWMWNAKVPTCAESTVHELIAQRVQ
                     DQPNAAAVCAWDGSLTYQELDRLSRRLACHLVQKLGIGEGSIIPLCFEKSMWTPVAML
                     AVMKTGAASVALDVTLPKPRLQSITQQIQPNVILSSKAQCSLAGNLAASPVLTVDCPA
                     LDAMDTAGVCLPNVDPSSTLYVVFTSGSTGTPKGVMISHRNICSGLRHQRALGYANAR
                     RVFDFASYAFDAAWLNFLHATVSGACLCIPSETDRRENITTCMQDMRVDFALLTPSIA
                     RVINPAAVPALRTLVLGGEAMAEVDIMTWASQVDLRNAYGPAECTIVATAARIGDSTG
                     QSGNIGYGLGLNTWVVSLQGDCLASIGSVGELWLEGPLVGKGYLNDPGRTDASFVHNP
                     PWLTQGCGLVTGRRGRLYRTGDLVRYEKDGSLVFVGRKDSQVKIRGQRVELGDIEYHV
                     QSGLSQQLQGPAVAILATPCGSDKTFLVVFLSVSRAFMESYHERRRMVQDLTSALHDK
                     LVEDLPMYMVPSAYVPVAEMPMTATGKTDRRQLREMANAMKVEELVQLHPKWEGKRAP
                     VTEMEKRLQELWAQVLNINSSSIGLDDTFFSHGGDSISAIQLSAKCRAAGFSITIPQI
                     FRHKSLQDLATAASPLPSLVTKPIVETNNARFALSPAQQYFFEHHPDGNNHFNQSFFL
                     RVTQTIDPARLGKSLQQLVSWHPILRARFNRAGDGSWMQSIQTEAAQCYHYHVTRIEE
                     PNQVKDVLNSAQKRLDIEKGPLISFDLIQTVDSQFLFLVAHHLVVDLVSWRILIEELE
                     ELLTTENTTREHSSLSFQAWCKMQETYSMQHLLPEKSLPFPVTIPSYDWWGLERKENT
                     HAHAVRKSFLTCKSVTHLLLGEANHAFQTRPVEILHAVLLHSFAMTFRDRPPPTVFSE
                     GHGREAFDDTIDLSRTVGWFTTIWPAHVEWNNRHSITEVVRRTKDARRRVPMNGWAYF
                     ASRYLNESGKDMFRGHGLPEILFNFEGLYQQLERPNSLFRNTDKPHDTISDFSGTTHM
                     SAIVDVTALVVDGCLTFQFLYNGNMKQRDGVERWIAQCKESLELAGHELVRLKPSYTM
                     CDFPLLSLTDETLKKLNEDVLPELGISYGEVEDIYPCSPVQQGILLSQAKNSGWYNTQ
                     VVWRIRSSSPISVTRLQLAWKEVVKRHPILRTVFTDGVSPESYRDQIVLRKLEPEVNC
                     DCQENGTHIAASKTPQPNWKVRPLHSLSLVSRSSGDVTAELNINHAIIDAASMEILRR
                     DLCLTYSGLSLPTNDVSYRGYIEVVQGFPVDPARAFWKKYLEGVKPSIFPSLRSDTPT
                     DRTHVELPVTRVAQELQANIHTFCERHGVTPSNIFQLAWALVLRYYLNDEAVCFGYIV
                     SGRDAPIAHVEDIVGPFINMLVSRFDLNDSVTVLEILKDTQDNYLEGLDHQHYPLASV
                     LNSLGMTGKQLFNTVLQVQRNVTSNEIEGSAISVDIIEYDDPMEFDISITVTENTRDM
                     AISLQYDPAIMTETQAISLIGSFQKFVEEIIQLPKSKPDNLIAIGNQDLSRVWGWNKE
                     ILSPNSICVHDLFSECVRQQPDAPAVCAWDGDLTYSQLDELSTSLAYRLLAHGIGPGS
                     IVPLCFEKSLWTPVAVLGVMKTGAASVMLDVTLPRQRLLSVINQLEKGRVGASVILSS
                     TSQYKVASDLVAGLTICVDALDQINQPPGPKLPNVDPSNTLYVVFTSGSTGTPKGAMI
                     SHTNFSSGIWYQLQVLGLSSTSRVFDFASYAFDVCWSSILHTLVAGGCICTPSTAQTR
                     NDIHGALAMMRANWALLTPTVARLLDPATVGHGFVLVLIGEKMTDEDVTKWQPHVDLV
                     NAYGPAECTVINTVNRVNDIPQGSGNIGRGFGCHTWVVSPSNHHHLLPVGCTGELLIE
                     GPLVGQGYLNDPAKTVSHFVEAPSWLKQGSPTVPGRKGLLYRTGDLVQYQEDGSLKFM
                     GRRDDQVKIHGQRVELGDVEHHVRQILHDQFQEPDGVVAEILQTGIGDAPVLVVFLTA
                     GKEDGVSGHGTYPALHRHSGVLREGLLTQLPLHMVPASLIVVEAIPTTATGKTDRRKL
                     RELGGLLTREELAWAVPTHTEGVDTEGSPTLNSMELQLRELWAQVLRISPSRINGQDS
                     FLQIGGDSVGAMRLVAAARNQGLSLNVEKVFQSPRLCEMALATGISHETRQPIPCFSL
                     LSSDVHVSQMCEDVAQRCNVPVDKIQDVFPCTPLQEGLLALSAKQPGNYVNQLTMKLS
                     QGTNLAQLIGAWNKVIQETPILRTRIVDTPGLGLVQAIISEEVTWRTAYDLSVYLKQD
                     TQTHIGLGTPLVRFVVVKDEQSGEGSIVWTIHHALYDGWSMQLILDQVHKVYHTKDTL
                     PLGQFQRFLQYTLQTEDSQDEFWQRYLSGADIASFPSLPSPSYRPQANAIVSHNLTNI
                     KWPESDNITSATVIRAAWAILQSQYTNTSGVCFGAIVSGRQAPVVDIERIAGPTIATV
                     PIHVNIDWMKDIRGLLLQIQADAAAMIPFEQTGLLKIRRTKSDVAKVSEFQTLLVIQP
                     VARDEQPPHVGDLWSIEKSAHDTSAPGLNDFNNYSILVDCELKSNGAELTVSFDTHVI
                     DECFVQRMVTQLEHVIESICNHPLDSTLVKDMTTISTTDLDDIRRWNRTVPEPHTVCV
                     HDWIIDQARKHPAKMAILSWDGSLTYEELDKLSTSLAQSIIPMINPGSIIPLCFEKSM
                     WTPVAMLAVMKAGAASVALDTTLPKQRLQAIADQVKPRLILSSKVSATLALTLLGDVK
                     GSQVITVDYDGIKTLGVKSPKLDLPIVDPSSTLYLVFTSGSTGSPKGAMVSHANFSSG
                     LFHQLSALQYNTDTRAFDFASYAFDVSRTVCLRTLAAGGCLCVPHETDRRNNTAQSMC
                     QLGVNHAHLTPTMARLLLPSEVPALRTLVLGGEPIGKDDVDKWYGHVSLINTYGPAEA
                     TSTNTIQRINNTEAPCIGRGIGCTTWIADPLNPNHLLPIGCAGELLIEGPLVGQGYLG
                     DGESTMTNYIENPPWLLKMGRRGILYRTGDLVRYNSDGSLMFIGRKDAQVKIRGQRVE
                     LGDIEHHVRSILVASEFQGSIAAGVTKPQGNSAAFVVAFLTGDKTHSEPNTYIQSLTN
                     RLNDGLANELPSYMIPRVYIPLNAMPLTATGKIDRRRIQEMSERLTLDDIRKFQPQHQ
                     DRHAPTTDMELRLAQLWGRVLNISTREIASEDSFLQVGGDSVGAMRLVGAARDQSLSL
                     TVEQVFKSPRLRDMALLVKAVESSEKPVAPFSLLHLGVPEEGCPNIDTWRARAALLCN
                     VKPRQVEDVFPCTPLQQGILALSQKRPGHYINHAILQIDRAKVSLDRLKQAWQQTIQM
                     TPILRTRIIDVEGHDILQVVISEENALKSLVGCTLESYIENDRRNTMTFGTPLARVAF
                     VEESNQSGDNAIENKSTRAVYIVWTMHHAVYDGWTMELILNQVHNIYREKDNRPCLEP
                     FQKFLQYSIKRNDAEERFWNDYLSKSDMFSFPALPSTSYEPQANTSLQHEINDLTWRR
                     KDDITASTMMRTAWGILLSCYTTTPDVLFGATVTGRQAPVAGIENVAGPTIATVPVRI
                     GVDPHITVHELLHQVQRQALDMIPFEQTGLQRIRRISANTNRGCQFQTLIVVQPPPSN
                     QKVREESIWQVVGREGEGISSFNSYAVLVECQMNSEGAHIEVSFDSQVIDTNTMSRML
                     KQLHHILRLLCADQSNELQVSALGITGPEDLHTIWSWNSLQPAAYETPVHEMIVARAR
                     KSPDALAICAWDGELTFKELDDLSTCLADYLLAHHSCVGSIIALCFEKSMWTPVAMLA
                     VMKAGAGAVALDVDLPKQRLQSIVSQVKPVVILSSVASYELANGFNGGAVIVVDHQSI
                     YSMKCSLNSNMHKLTSSSTNPSLPPVDPSSILYIVFTSGSTGTPKGVMVSHGNFSTAL
                     RYQQDVLGYASATRVLDFSSYAFDAAWLNFIHSTVAGACLCIPAEHERKTNVGACIDR
                     MRVDFALLTPSVARLIDPESVPTLRTLVLGGEAHNPTDVARWKSDRVDLRNAYGPAEC
                     TVVATVTRLANGTTKPGNIGRGWGLNTWVIDVSGNNRLAPIGAVGELWLEGPLVAQGY
                     LGDSKKTLESFVKTPPWLARGIPTVFPGRQGRLYRTGDLVRYNHDGSLTFVGRKDSQV
                     KIRGQRVELDDIEYHVRQSLPKQFRGAVIADVFAPRESDHAILAVFLSLAEDVTLSNL
                     LEGLGDKIMDLLPEYMIPTAYIPVHEIPMTATGKTDRRKLREIGSSLTIAELAGLRPS
                     QNSEPPVSEREWQLNAMWAEVLNVEPSLIGRNDSFFGFGGDSITAMQLCAKCRMAGIS
                     MTVPQVFHCRTIARLASVVTADVAVQHHNEVPETDFSLSPIQLRFFEYEPNGHDHFNQ
                     SMLLQLTRQVSSLDVAQALESLLVHHSMLRAQFSKGPQGAWTQRINATAGGSGYRYRS
                     HQMLTMKDSIHAINESQKSLNIREGPLMAADLFTTEEDGQYLFVVVHHLAIDLVSWRV
                     LLEDLEEHLTTGGISSATPLPFQAWCEGQVRYARKHLSSHILPPLDISSHAHDYWGVD
                     MTNNIYGTVLEESFTISPDITQVLLGPANTTYQTQPVEIFHAALVYSFAQVFQDRRPP
                     PIFTEGHGREPWNLALDPSRTVGWFTTLWSVLVTPNIADGFKDTIRRVKDSRRRVPMN
                     GWASFTAMYLSSEDNRRRYDVPEIMFNYLGLYQQLERPKGLFRLADAPAGALSNIADN
                     VHRFSLIDVSALVMQGGLHFKFSYNRFIRNQEAIADWIIACKSVLEEAASTLVRSTQA
                     RTLSDFPLLPLSSYDELDTLINHTLPSHGIMLDQVEDIYPCSPIQQGILLSQAKNESR
                     YWTRKRWQVRSSSPICLQRFKDAWNKLVDRHPILRTVFIESALPDAYLDQVVLKSVTP
                     EIHIITLADVDLESSLIKHKRLRKPQDRLPYVLVLYATPSGRVICELLINHAITDGMS
                     MRLIQDELQLAYDDALPLCSTPPYSDYIAHLRSLAPDTSRTHWQQYLVGVSPCMLPHM
                     NVNHQESDSVKRLPAMHLGNELNSCLRDLCKRHVLTASNIFQVAWALVLHFYTGHETP
                     CFGYLTSGRDAPIDNVAAIAGPFINMLISRICLSHDRSILSIMQETQADYLRNLEHQH
                     LPLAEILHSLPASTSPLFNTAISVQTSRSGPADSVTSTIRLQDTATEDPSEVCNPVAP
                     KGV"
     exon            920082..924521
                     /number=1
     exon            924584..935773
                     /number=2
     CDS             join(936497..936706,936855..939730,939787..940233,
                     940292..940405,940472..941135)
                     /codon_start=1
                     /locus_tag="AO090103000356"
                     /note="multidrug resistance-associated
                     protein/mitoxantrone resistance protein, ABC superfamily"
                     /old_locus_tag="AO070333000129"
                     /protein_id="BAE65793.1"
                     /transl_table=1
                     /translation="MPPPICNDHLFGPVVSGCSGRTFDFTRTFEDIFLSLVPNTLFLI
                     TALVRIGYLVRQVRVANGLLCQLLKLLTTARTAMTVVSAAAMIPLSFLEHTRSPRPSD
                     LLTIFLVLTILCDIVLTRTSWLAGSQSWQIGDACIQTAAVVVKCIILAVESKSKDNCI
                     MNHSGVEHSPEETSGLLSLAFFSWLNPLFLQGYRENLRVDSLYALDEKLKAKTMFSNL
                     ATALNGMPFPRGFARTLAKELIGPFLLPVAPRLAMLGFTFSQPFFINALVANIAESNS
                     VSAVNDGYGLIGACVLIYGGIALSTSLYSYYSLRALHMLRACLVSVIYQKMLESDTNT
                     LDNGTTVTLMSTDIERIMTGWMDIHSVWASVIEIALGCYLLHSQLGMAFLSPIIVILV
                     CFSGMACVSAKAGNSQSAWMEKIENRVSMITTLLANIKPCKISRMASEFAHILQTARD
                     EEIQVGSHFRWLQVIAATLAYTPMCLSPVVAFAFAGQHLNVAGFFTSLSFLTLVTSPL
                     TAIFQQIPGVIAGFTCLSRILLFLEGGIRSDRRTVFRLQDNQKPAASSAPSAALVSVT
                     NGHFGWTQTHSVLRNINVNVPRGQLTVVVGPVACGKSTLCKAILGEVPFVEGEVLLTS
                     RIPSVGYCAQTPFLSNLSIRDNIIGFSPFHPGKYQEIITATALGPDIAMLPAGHDTIV
                     GSCGAMLSGGQKQRVSLARALYQETPLLLLDDTLTGLDQATEAEVFARVLGAEGLIRR
                     RGTTVILFTSSWRYLSSADYIITVGKDGTIREPGHETELLEQKDELFNPEKNTETAFP
                     ASTDSNASVTQQSHNMVVKGKASQNLHVRASQVRDLDVYKNYFGTIRTAVLVTFALSC
                     TLFGFGGSFPTVWISFWSSNSYNAPNSYNAPNAFYIGIYSLLSFLQLLGFFLAALMAL
                     GPMVTDAGSKLHSNALTTVIRAPLRFFTDTDTGAITSLFSQDITIIDGELPERLFNIT
                     AGLCGIIGAACVIAVASPWLALVYPVLVIIFWIVQRLYLRTSKQLRFLDLEAKGPLYA
                     NFMETTQGITTIRAFGWTTQKLEHNHYLLDQSQRPSYLLGVIQFWLLLTANLITTGIA
                     TSLTVLATQLRTDPGFTGASAVTLMTFSGLVTIFIRDYTAFETSLGAVSRLKTLSDNV
                     KAEAREGEDLHPDEQWPKKGSIEIERLSASYDDVPVDHPSGESHPNLILKDLSLTIAP
                     GEKIAICGRTGSGKSSLVLLLLRLLDPIYSPSAKLTIDDIPIQHVDRSTLRERIIGVP
                     QDAVFLPNGNTVKDNLDPSGLATEDECLSVLSTVNLDGLANGSHGLHTPLTTNHLSGG
                     QKKLFGLGRAILRRIIRDRATTDTESHGGILILDEISSGVDAATERTMHEIISHQFED
                     YTVLEVVHGLDIVPHFFDRVIVIENGSIVESGSPAELLQRPSSWFKQLLLMNSACDQP
                     "
     exon            936497..936706
                     /number=1
     exon            936855..939730
                     /number=2
     exon            939787..940233
                     /number=3
     exon            940292..940405
                     /number=4
     exon            940472..941135
                     /number=5
     CDS             join(943831..943906,943975..944033,944090..944464,
                     944510..944707,944761..944844)
                     /codon_start=1
                     /locus_tag="AO090103000359"
                     /note="reductases with broad range of substrate
                     specificities"
                     /old_locus_tag="AO070333000132"
                     /protein_id="BAE65794.1"
                     /transl_table=1
                     /translation="MVLAQPENKHVLKAFDLSGKVAAVTGGARGIGLEVSIALAEAGA
                     DVALIYNSSKTAETLATEVATKHNVKAAAYQADVANQEDIEKAIKQIAADFGKLDIIV
                     ANSGICSNVPAEDYTAEQWHNITKVNLDGAFYTAQAAARIFKEQGHGNVIFTASVSAT
                     LVNVPQKQAAYNASKAAVVQMAKCLSVEWVDFCRVNCISPGFIATDILDIHPKEWREK
                     WFDMIPAKRMAEAYELKGAYVFCASDASSYMTGANIVIDGGYTLP"
     exon            943831..943906
                     /number=1
     exon            943975..944033
                     /number=2
     exon            944090..944464
                     /number=3
     exon            944510..944707
                     /number=4
     exon            944761..944844
                     /number=5
     CDS             join(945831..945991,946050..946283,946393..946972)
                     /codon_start=1
                     /locus_tag="AO090103000360"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000133"
                     /protein_id="BAE65795.1"
                     /transl_table=1
                     /translation="MSGRNINLLSLDGGGVRGLSSLIVLKEIMESIDRENPPKPCDYF
                     DLIGGSGSGGLIAIMLGRLEMDIDQCIHAYKLLSKNVFSQKRLLPIGSNLRSRAKYDI
                     KKVELALRKILRELSYEKDTLLREEAGCKVFVCATDDTNRRLVHLTSYPSKYCSNELF
                     KSAKVYEAGAASFAHSPLFDSVKIGPSGRRFHDSSLEANNPMREVWIEARGVWPAGAL
                     ENQLKCMVSIGTGEPSIKRSRRRLFGLVKGADVDAVDPEIDTNRFIQEHTELDDENRL
                     FRFDVPNGLGEIDLDSIEEMETIVDATQDYLEKELVYKQIRRCGRALA"
     exon            945831..945991
                     /number=1
     exon            946050..946283
                     /number=2
     exon            946393..946972
                     /number=3
     CDS             complement(join(948513..948586,948651..948861,
                     948965..949222,949301..949409,949471..949561,
                     949586..949734,949786..949854,949902..950151,
                     950206..950219,950276..950437,950470..950495))
                     /codon_start=1
                     /locus_tag="AO090103000361"
                     /note="predicted flavoprotein involved in K+ transport"
                     /old_locus_tag="AO070333000134"
                     /protein_id="BAE65796.1"
                     /transl_table=1
                     /translation="MAKPRTTEKKLRVVCIGAGLSGLTIAYKLKHEKPLDFLDLTIYE
                     KNPEVGGTWFENIYPGVACDVPVHSYQFPFAPNPAWSSYYASGKEIQEYIVSTAEKYD
                     LKENIKFNTKLVKAIWCETQGKWKLQLQQGGLIIEDEADIVLDGSGVLNQWKWQEIEG
                     LDTFKGKLLHTARWDPEYNYEGKKIAVLGNGSSGIQVIPSLQPNAAKLVNCIRHAIWT
                     TPNLGGTNFQYTEEEKQRFQDNPDEFLEYRKSIEGAINSVYNAMISGSEESKAFYEWV
                     QGVMRSRLSKNPELEDNSRIAFSKINRITPNGIETDEGEEEFDLIVCATGFNYSFIPP
                     WELIGRDSRRLDEGWKDTAEAYFATCAAKVPNYFIFGGPNYPSFPSNSRQELISSRPV
                     VVKDSVVHAYNKFAQETLKRCVWSKGCHAWYNKRNEGADNTVTAMYPGSVLHFKEKLR
                     PEHFEIQYNTSNPFRFMGNG"
     exon            complement(948513..948586)
                     /number=1
     exon            complement(948651..948861)
                     /number=2
     exon            complement(948965..949222)
                     /number=3
     exon            complement(949301..949409)
                     /number=4
     exon            complement(949471..949561)
                     /number=5
     exon            complement(949586..949734)
                     /number=6
     exon            complement(949786..949854)
                     /number=7
     exon            complement(949902..950151)
                     /number=8
     exon            complement(950206..950219)
                     /number=9
     exon            complement(950276..950437)
                     /number=10
     exon            complement(950470..950495)
                     /number=11
     CDS             complement(join(951716..952091,952142..952170))
                     /codon_start=1
                     /locus_tag="AO090103000362"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000135"
                     /protein_id="BAE65797.1"
                     /transl_table=1
                     /translation="MVKDKNTVIEEFNDLVNMTPNELRNWLKEEQSQSSGWSGESGET
                     IGHERSHLLTPLLQSLYEKLTKHSGRKIVDILEHNPSKDPEGYSDQDIDHMRRVVSYC
                     KRHLAQEEKAKQDPNSKSHRSLKNWGHDPFKS"
     exon            complement(951716..952091)
                     /number=1
     exon            complement(952142..952170)
                     /number=2
     CDS             complement(join(952615..953041,953096..953355,
                     953396..953424,953488..953968))
                     /codon_start=1
                     /locus_tag="AO090103000363"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000136"
                     /protein_id="BAE65798.1"
                     /transl_table=1
                     /translation="MGTTTDGTKSGHFMPITYVYHPILDVGTSFDANLFKFLQHPDEG
                     VGGPGCYSNFIVLYPSELSIYWPSYLPCCRQRKHWKMAERMTRELLDAIYEDSCRETR
                     DDGVMPPELQDMSSEVRMRKETELIATSVKSAAYMYPNASPVRAGISSQSMLLVFLHD
                     DVVETSPLDAVNLKGSTITDAIFATYEPKTGIAQSRREALGGFLTAMIEEDPSLGKRL
                     LSSIFTWLNHTKGYGSISPAIFESLRNYLEFRSDDIACEFIIAQALFACNIHLSEMEI
                     QVFNNVVRIYVTHISLTNDLYSFEREREEYERTDGLLINAIGVIRKVYQVSPVVAKQL
                     PWGFILDTECAFSGEFKKLISSGLLNSAQIRFVKALAECLAGQIFYSISSGRYGGDKA
                     ARVIST"
     exon            complement(952615..953041)
                     /number=1
     exon            complement(953096..953355)
                     /number=2
     exon            complement(953396..953424)
                     /number=3
     exon            complement(953488..953968)
                     /number=4
     CDS             complement(954644..955834)
                     /codon_start=1
                     /locus_tag="AO090103000364"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000137"
                     /protein_id="BAE65799.1"
                     /transl_table=1
                     /translation="MPRYISHASPLEDGSGDALEGLLTDLSLTDARETGTVEKGSSAF
                     NPFLALLSPAPVTGPIEKNTGGFNPFLPYLVASAGEPNPEQTIEKLTRDVIPQQLAEL
                     QKPRRFILNETDDLYLQGRRFQKKWGISEEGFNNWKSLLLGWVEFPAILLLNPSPWDH
                     LPFDEMVDESPTLSWLQKTLKELQLQLEDVIILDTFPMLRDKLGDDTLRQMGPARRDE
                     LARESFALTRASLALIQPRVLVSCQCCTRPGNDRWGFFNNDELAEQLCSSGVRARSRQ
                     VRELDLSGHKMHVVQGMHPQYVMEREPTQKEVLVELFTQVFRPFGMWQSRRAAMQQQL
                     RDAGAVLLGLVMLLQQQMKLYGQLCAQSGSGVEGPLAAEHVEELRKQLAEWEDGNKLK
                     RKEG"
     exon            complement(954644..955834)
                     /number=1
     CDS             complement(join(957630..957973,958032..958352,
                     958412..958541))
                     /codon_start=1
                     /locus_tag="AO090103000365"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000138"
                     /protein_id="BAE65800.1"
                     /transl_table=1
                     /translation="MDNGPSEVVFTTTSSPIESGVVFRYGQGSVKVPAPRKRGRPIGS
                     TKRRKTGNDVDEPERKDHERFQFINLGSNSANIDRDTRKYIRKRVMLNHTHTNQKRKQ
                     LSTERTKEKTSTATGLSPEVMPSQFGRVDPFDTLPIQFEPYMHDLLSLYITTIWETLY
                     SIEKRSGCNPMVNYWLPLAFNDPALLHSLIGCAASFLVTANQLCGYPFFVKHLNEAIA
                     IVNQRMADSTISVSDETLVVVASIAMIKVCCRNVQILGFTLLLTSK"
     exon            complement(957630..957973)
                     /number=1
     exon            complement(958032..958352)
                     /number=2
     exon            complement(958412..958541)
                     /number=3
     CDS             join(958936..959469,959528..959708,960122..960162,
                     961325..961522)
                     /codon_start=1
                     /locus_tag="AO090103000366"
                     /note="dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /old_locus_tag="AO070333000139"
                     /protein_id="BAE65801.1"
                     /transl_table=1
                     /translation="MPQYNAPTTAEEVANDCRASIANKTILVTGVTLGSLGAGFATAI
                     ANYAPSLIILAARDVTKAQQTATEISIINPSVKTRILHLDLGSQVQIREAAKEVLEYE
                     EHIDVLVNNAGVMAPPFSLTQDGVESQFGINHIGHFLFTNLIMSKLVTPGKSSRVVNI
                     SSDGHRLGPIRFDDWNFDDGNTYDPWLAYGQSKTANMLFSVSLAQKLGTKGLISVSLH
                     PGVVSTQILRHDVDESVKALDETAICYYYIRYESVAANLTEIISEFASSRLQKALSEA
                     YRTIRRLRPIVERDRRDGSGACYRELKQHLSPGTFKATSGL"
     exon            958936..959469
                     /number=1
     exon            959528..959708
                     /number=2
     exon            960122..960162
                     /number=3
     exon            961325..961522
                     /number=4
     CDS             962403..964382
                     /codon_start=1
                     /locus_tag="AO090103000367"
                     /note="ferric reductase, NADH/NADPH oxidase and related
                     proteins"
                     /old_locus_tag="AO070333000140"
                     /protein_id="BAE65802.1"
                     /transl_table=1
                     /translation="MLSPRHADIPDSGPGVEHHWGYLNRQLPCTSGVEKCAYLDTVYH
                     SHDLSVLYSAIFWATILGIILLCFIGHYCNPISRKSTSSCVQKEGEIEHRSQSSFYRM
                     RRSLGSIYHRYFVQESLTFIFGRTTRFNILILAILAGYLVIFSFVGIVYKTWYIPVKG
                     TNLTSTPNGIGPWADRIGVLAYALTPLAVLLCTRESLLSLCTGIPYHHFNFLHRWLGW
                     IIYLQSALHTFGWTLMEGRMYKPQPSTWNAFIAQEYIIWGVVAMIFLSFLVFFSTKWA
                     IRLTGYEFFRKAHYVVAMLYVGACWGHWKQLSCWMIASLVVWLLDRGIRLLRTFLTHF
                     GPHASETYSFWGLHIPKARMTSFPNDEDGDVVRLDFEHDHSPWEIGQHFYLCFPGLSI
                     WQSHPMTPSSVPGGSKQSHTYIIRAKNGLTKDLAHMARQPQESNSEEPPSTSIVLSGP
                     YGQTIVDNDLHCSDDINLFCVAGGTGVTFVLPILQAIVLNRYFSTRRSLVELIWIVRR
                     KSDMRWLSDELEIFRTAAQACTHFRIRVYVTREDDRANVRNSFTPQYITDSEIKRPVS
                     TVSHETHLSDSPFSVHCLRPGNSDTSVHPDVPADLTDFVQRTVHGPTRVIASGPTGLI
                     SSLRTTVASLNDPGQVWKGNERYDVELIHDDRLEY"
     exon            962403..964382
                     /number=1
     CDS             complement(join(965455..966254,966566..966704))
                     /codon_start=1
                     /locus_tag="AO090103000369"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000142"
                     /protein_id="BAE65803.1"
                     /transl_table=1
                     /translation="MHPCRNNKSYPKMSPTNQHTQSVPVNVEQQCGVTLPDGGQCTRS
                     LTSTTPPIPTNPPPENEFKPNQHQIHFTDPTIKQYLQYPEILQSNAQNHLAITEATSH
                     TTIAKDSLTYLLQFTEPYTTTPSKIKTSYLLSYATNYWAVHARLAHPETDPELTALIL
                     RFLGSETAYLNWTAFLDGYTPFSGTDGSSLIRHPHQIYYATSFGLTNIVTALLDTGAP
                     VNSRGPSGSALAAAALAGHLDTVKVLVDSGADVNLAGPFGTPLVLASGRGFVDIVRFL
                     VERGADVEARGEWSETALVEARKNGFEDVVGVLLGR"
     exon            complement(965455..966254)
                     /number=1
     exon            complement(966566..966704)
                     /number=2
     CDS             complement(966912..967949)
                     /codon_start=1
                     /locus_tag="AO090103000370"
                     /note="proline racemase"
                     /old_locus_tag="AO070333000143"
                     /protein_id="BAE65804.1"
                     /transl_table=1
                     /translation="MPFSRSLTVVGCHSEGEVGDVITGGVLDVPGKTMYEKLAHISTK
                     YDHLRQFLLNEPRGRSSMNTNLLLPPCDPRADAGFLIMESEEYAPMSGSNLICTTTVL
                     LETGMIPMKEPVTELALDTAAGLVTVTAECEAGKCKTVEFNNVPAFVFELDFKVQVPG
                     IGEVSVDIAYGGMMYVLVDAASVGLKVDNSHARQLIEIGERIKRAVEASYTAVHPENP
                     GVKGFSVLEYTEPIKIEDGVKVAVNTVVVSPGRFDRSPCGTGTCARLAVMHARGEIAE
                     GEVFKHRSIIGTEFICHIRGTSMVGDYKAVLPTVKGRGWITSFKQIVLDSTDPFPEGF
                     RVGDQWHMAPN"
     exon            complement(966912..967949)
                     /number=1
     CDS             join(968818..969486,969547..969783)
                     /codon_start=1
                     /locus_tag="AO090103000371"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000144"
                     /protein_id="BAE65805.1"
                     /transl_table=1
                     /translation="MYALQRLLYGFPAPAPHKRTKPVEVLCLGMPRTGTESLSMALRT
                     LGLQTYHGWDLVFEPDGSKLQLCAELVRRKYKGARDGDVHISRAEFDILVGDSQAVVD
                     SLCILFAPELLAAYPEAKVVLNVRPDSNAWYRSINKTIVEEVDQSWVIWGMQWFSAEF
                     HWLYSLYLRDGYPGIFHSGTTQDGIQRNAKWVYRDHCNMVRGMVPKENLLEWSVEDGW
                     EPLCKFLDKPVPNEPFPRTNNPGDYAERADKLIKQRLAQCLRNLTLTAVTLGGITTTV
                     VIWWQGRIPKVTRLGDLLVRFTKMT"
     exon            968818..969486
                     /number=1
     exon            969547..969783
                     /number=2
     CDS             complement(970247..971113)
                     /codon_start=1
                     /locus_tag="AO090103000372"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000145"
                     /protein_id="BAE65806.1"
                     /transl_table=1
                     /translation="MQYAKPRMNYYRSNTDFEMPTEYIDLIEKYLRIVPHITHCEPDT
                     ADLLQPTLWHSDLHLNNIYVDLDTETITDIMHWQSITVAPLLLQAKIPRMARHINPLP
                     LGWVMPEKPEGYETFFQKDKLKADKLYESALCQKYYEVCTAKKNQRHYAAMCHNDTWK
                     SPLILPLKSISGAWSSREVFMLRSSLMEVVDHWAEIQPAADCPISFTDEERNLHNEEM
                     ENRDYIEGLMEEFQGAGILPSDGIVDPEDYEVVQKTNYAQKERFMSLAEDEEQREWMD
                     KIWPYQDRASEA"
     exon            complement(970247..971113)
                     /number=1
     tRNA            complement(972814..972897)
                     /locus_tag="AO090103t00010"
                     /note="tRNAscan-SE"
                     /product="tRNA-Lys"
     CDS             join(975581..975713,975747..976270,976422..976544,
                     976598..976603)
                     /codon_start=1
                     /locus_tag="AO090103000374"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000147"
                     /protein_id="BAE65807.1"
                     /transl_table=1
                     /translation="MSPNLELTSHITLPPFTYPTLPPEPYTTRMIRLLPHKDKSAPIQ
                     CMGTHLYQALSYVWGSEVKPESIILNGCIFHVTTNLHVALSHLRNSLFERILWVDAIC
                     INQDEEDQGHEKSKQIPLMRTIYAQAERVIVWLGGATEDGDKALEEIRCLGESADIWH
                     DRERQRYTNSILDILESSYEEIRSPGEAAAIWYEDDPDPIENSDACLRLLQRDWFSRI
                     WGIFGFSKHDWTCRLSHKRCILSPKIRAWFTRVYLYGGAHWNV"
     exon            975581..975713
                     /number=1
     exon            975747..976270
                     /number=2
     exon            976422..976544
                     /number=3
     exon            976598..976603
                     /number=4
     CDS             join(977041..977557,977595..977674)
                     /codon_start=1
                     /locus_tag="AO090103000375"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000148"
                     /protein_id="BAE65808.1"
                     /transl_table=1
                     /translation="MPQERCSTNGLCDILLTWKTPLAERENKEKSGIMFPLMNKPLKF
                     REEPYEAEKRLKHIMLVVIDIAMRTLAQAIFRSKVIKQLLRQSGTKDPIIQELVADDV
                     RGYNKDMEPKPWDLFLYQDNDQPISEETVIAATVTCGTYGCIIMELFLQHQGANLPVS
                     EDVVKAVAGSLYEGRISQSLKRWSGKLQGIMEIMDLKS"
     exon            977041..977557
                     /number=1
     exon            977595..977674
                     /number=2
     CDS             complement(join(979245..979821,979874..980482,
                     980610..981433,981494..981634,982439..982494,
                     982533..982605))
                     /codon_start=1
                     /locus_tag="AO090103000376"
                     /note="putative alpha-1,2-mannosidase"
                     /old_locus_tag="AO070333000149"
                     /protein_id="BAE65809.1"
                     /transl_table=1
                     /translation="MAEAYYKSLSATISMRTGIKWIVKGTQYTHYGFTPRGHTILFDR
                     LKPAANIHKGMAKAVADTQGENQAGFAFDTETVTGFSHTHDSGTGGSPSMGNFPIFAQ
                     PNCPDDDLNQCKWQQNDRAVAWVRDSPKARPGYFSIAMENGVQAEMTVTNHSALYRFT
                     FNNVPTESLSPVILVDLMDLPQSRKGGIASVDSSGRLTGNATFNPSFGIGSYELHFCV
                     DFKGGDIRDTGTWVKNRANSSQKTVSLVEDGSNTPATLSAGTFARFHTLRDNTITARV
                     GVSFMSVEQACSNVETELPNFDFANTVSAAESAWRDKLNVISVNAEGISSDLQKVFWS
                     GAYRAMISPQDYTGENPLWKSEEPYYDSFYWSLVDIYRHEGYLPDCRMSLCKGYTQGG
                     SNADVLIADAFLKNVSDVDWDTAYEAIVKDAEVEPANWGVEGRGGLRSWKGLGYIPTD
                     DYDPDGSGLHTRSISRTVEYAYNDFCIAEVAKRMGHDSDYEKYLMRASNWQNMFKDDQ
                     RSTINGVDTGYVGFMQPRYLNGTWGYQDPIFCSPLMNFTSCYLNPDGHETYEGSSWLY
                     TFYAPQDMSLLIKRLGGAQLFTSRLNYLHDSGILYVGDEQAFLTVFQFHYAGRPALSA
                     ARSHFYIPSQFNTSVSGIPGNDDGGAMGSFAVLSMMGLFPVHGQDVYLITPPFFKEIS
                     IRNSVTGAVATIRNLNFDPTYKAIYIQSATRDGKPWTKNWIGHDFFNQGGVLELELGL
                     TESAWGTQNEDLPPSMSHY"
     exon            complement(979245..979821)
                     /number=1
     exon            complement(979874..980482)
                     /number=2
     exon            complement(980610..981433)
                     /number=3
     exon            complement(981494..981634)
                     /number=4
     exon            complement(982439..982494)
                     /number=5
     exon            complement(982533..982605)
                     /number=6
     CDS             join(984713..985038,985092..985571,985630..985682,
                     985723..985760)
                     /codon_start=1
                     /locus_tag="AO090103000377"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000150"
                     /protein_id="BAE65810.1"
                     /transl_table=1
                     /translation="MNAVNFMANQPITDTTPTEIIGLNQSRSTSSRSAGHSPLNFNNA
                     TSPHVPGNAYNIVRSRPPSSNTASGSPSQPSERDEFQDIFSELLTGTEHEIAFLVRHF
                     SESLGPWLDVSDSTRFFEVHVPIRAINDPFLNFAIAALAAKHLGRMKGATSPASGGMF
                     TSPATMEIYPNATQVDWFLKATNYYYIAASRMNSAISEAYTSVSSSAILEESAIQIAS
                     RWLSSQPQQSSSAAEEAAASTFSRKAENILAASTIMTMYKILDEPAENWQSHLSGIKS
                     LFDSLIEVHSGRRSGTLPGWIT"
     exon            984713..985038
                     /number=1
     exon            985092..985571
                     /number=2
     exon            985630..985682
                     /number=3
     exon            985723..985760
                     /number=4
     CDS             join(988379..988753,988807..988936,988988..989405,
                     989461..989802,989857..990391)
                     /codon_start=1
                     /locus_tag="AO090103000378"
                     /note="alpha-amylase"
                     /old_locus_tag="AO070333000151"
                     /protein_id="BAE65811.1"
                     /transl_table=1
                     /translation="MSPFNSGTRSESSSPVQKNVKKWWKESTVYQVYPASFKDSDGDG
                     IGDIQGILSKLDYIKSLGANILWLNPIFCSPQVDMGYDISDYYNIYRPYGTVEDLDQL
                     IAAIHERGMKLVLDLVVNHTSDQHRWFQEARSSKANPYRDWYIWRKPIYGEDGKPQPP
                     NNWKSYFGGSVWEYDEPSGEYYLHLFAKEQPDLNWENPYVRAAVHDIIRYWLNKGADG
                     FRMDAINLISKDQNFPNAEITNPDSPWQDGTKHFACGPRLHEYLQGIGKILKQYDAFS
                     VGEMPEVYDLNEMLRSVGSDRNELSMVFHFETVSLDHGPGGKFTSRKWELHELKTIVS
                     RWQTFMHENNGWNTLYLENHDQPRIVSRFGSDEPEYRVPSAKMLATFLGFQSGTLFIY
                     QGQELGMPNVPKHWGINQYRDIETLNHWNEITSNAPQNTPLHEACLAEYRLKSRDNAR
                     TPMQWDDSPNAGFSSVRPWLPVHDDYQSLNALDQVNDKESVYHYWASVLRLRKAYPDV
                     LVYGSFELLSPEHPDLFVYARMASSGRAVIVTNFRPHEVTWSVPEKAFNSSGDVALSS
                     YPGRTSHSLLQPTVTIKPFEAFVWLSGTETSRL"
     exon            988379..988753
                     /number=1
     exon            988807..988936
                     /number=2
     exon            988988..989405
                     /number=3
     exon            989461..989802
                     /number=4
     exon            989857..990391
                     /number=5
     CDS             complement(991214..991792)
                     /codon_start=1
                     /locus_tag="AO090103000379"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000152"
                     /protein_id="BAE65812.1"
                     /transl_table=1
                     /translation="MLALTLHMAYPNPVEPPWFNFGFCTCYDEYQERALGGLFGKLLS
                     GDNLFDDVPTSILRMQNIQTATFTEFRKAYESGTMIQLMDSKGFKQYRLQFPYLEEFF
                     TSPPCGPHLSVWSLKQFLAIYNPAEFPPDNTISADYGFMNCKTFTETCTLMELYKRLL
                     RKASLLDLHEACVAGKLFEFAECFHKMDQAHR"
     exon            complement(991214..991792)
                     /number=1
     CDS             complement(join(991951..992009,992110..992447,
                     992513..992745))
                     /codon_start=1
                     /locus_tag="AO090103000380"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000153"
                     /protein_id="BAE65813.1"
                     /transl_table=1
                     /translation="MTPGSWEKISNALIQLQRRLKKELKAEIKKEISQEKTSVVGGSS
                     ILTNHDPSGARRKADIERVRIKAEQNRVAEAFKRLEKEEGASAHQASSSDVQPNASST
                     QHGHAEYLAECDICSRETSRNCSLCQRDFYCSQSCEDKRSGRHLFTCAKRPLTSADVL
                     YRSIGEDRMPEEEDVCAGFGFNYFESFADKKKFFTRYLSDTGVDISHGF"
     exon            complement(991951..992009)
                     /number=1
     exon            complement(992110..992447)
                     /number=2
     exon            complement(992513..992745)
                     /number=3
     CDS             complement(993575..994033)
                     /codon_start=1
                     /locus_tag="AO090103000381"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000154"
                     /protein_id="BAE65814.1"
                     /transl_table=1
                     /translation="MNEQFTWTSPNLNQHHFITFANLLALRNGGQVEPASSPHDSEEK
                     EEEEDNPNNTNDADSINTTQVHQISDSGNTKLKRKFLDCLAELAANDKGARFVACSCM
                     REGEDEVTVWISRNEGFREVDYTVFERLGRLLRGLGSGDSGEFLSQCRFI"
     exon            complement(993575..994033)
                     /number=1
     CDS             complement(995599..996591)
                     /codon_start=1
                     /locus_tag="AO090103000382"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000155"
                     /protein_id="BAE65815.1"
                     /transl_table=1
                     /translation="MNTEFQTTLTNLENKLNTLITSLTTSPTATGAPAAAVNLLDADD
                     ALTTSISTLRHHQDNYARILRLRNEAASLEEKVKEIVKTVVNYEKEIRTVCNSDEIDS
                     DSDFDSDSSGYDSDAEMQDAGGRPRKLRGIREVDYRLLLDFARRISKYNHQAAADAEA
                     GAKARVQIGEDRDTEMTGTGAIGTNGVEDGEAEPVSSVTKDATSWLDESANMTRQVYM
                     LPYPMEDRIRLGLMGQIQLAAGEGRPGFDPDQEVERLIREAEGLGAADAPPVANVSDE
                     ESRVGEAAKAAVKAGSGAVGSGAGTGGVSAAVPKPKPKATLDLDLDDDDDEDDF"
     exon            complement(995599..996591)
                     /number=1
     CDS             complement(join(997276..997330,997383..997996,
                     998061..998077,998134..998182,998232..998483))
                     /codon_start=1
                     /locus_tag="AO090103000383"
                     /note="mitochondrial carnitine-acylcarnitine carrier
                     protein"
                     /old_locus_tag="AO070333000156"
                     /protein_id="BAE65816.1"
                     /transl_table=1
                     /translation="MSSASASTPETIRDDVKVAETKAVNQTIAQIRSLVAGAAGGVCA
                     VVVGHPFDLVKVRLQTAEKGVYSGAIDVVKKTVAREGLVRGLYAGVSAPLVGVTPMFA
                     VSFWGYDVGKTLVSKFSEVRVENNTPQYTIGQISAAGFFSAIPMTLITAPFERVKVLL
                     QIQGQNPPPPGQKPKYSGGLDVVRQLYKEGGIRSVFRGSAMTLARDGPGSAAYFAAYE
                     YIKRSLTPKDANGNATGQLSMPAVLAAGGAAGIAMWIPVFPVDTIKSRLQSAPGKPTI
                     GGTIRSVYASGGFKAFFPGFGPALARAVPANAATFAGVELAHNFMKKFFDDE"
     exon            complement(997276..997330)
                     /number=1
     exon            complement(997383..997996)
                     /number=2
     exon            complement(998061..998077)
                     /number=3
     exon            complement(998134..998182)
                     /number=4
     exon            complement(998232..998483)
                     /number=5
     CDS             complement(join(999599..1000339,1000397..1000480))
                     /codon_start=1
                     /locus_tag="AO090103000384"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000157"
                     /protein_id="BAE65817.1"
                     /transl_table=1
                     /translation="MKTTALSFALLAAATTMVSADVSVGECAQMCISNMNAKASELGC
                     SSGDLDCLCKSGNYSYGVRDCTTEACPSEDAAAVVAAALASCPNGSSDSSATGTNGGG
                     ASKTGDSASATGTDASKTGDSTATGTATGTDASKTGDSTATGTDASKTGDSTATATGT
                     DASKTGDSTATGTDASKTGDSTATGTDASKTGDASTTVTGSTLSTSASTTTDGSSSSE
                     TGSNGSSSTDGSNGGSNGGSATETAPSSTSTNSGASKTVLGSGALGALALAAFFVL"
     exon            complement(999599..1000339)
                     /number=1
     exon            complement(1000397..1000480)
                     /number=2
     CDS             join(1001534..1001900,1001986..1002047)
                     /codon_start=1
                     /locus_tag="AO090103000385"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000158"
                     /protein_id="BAE65818.1"
                     /transl_table=1
                     /translation="MVTAQYQGLIWRAHGIGAGKFIRALDRLKGNGSPVDPITSDQQI
                     VIEQQTPIIPPTVQLSCGSLLQWELHQPHFSRLRGSFSGTLDSVTVQNPLDVEKALVF
                     RHPLTATIAYGNRGRLARRERLGRFPATAVMRSGWNEGLH"
     exon            1001534..1001900
                     /number=1
     exon            1001986..1002047
                     /number=2
     CDS             complement(join(1004309..1004361,1004469..1005489))
                     /codon_start=1
                     /locus_tag="AO090103000387"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000160"
                     /protein_id="BAE65819.1"
                     /transl_table=1
                     /translation="MTTPNPIPLPTLSTFTQTTLNIPSATLTRHPKIEGDDHMIFTIA
                     ESPNHLLRVTKPRKDRPLTGTQMQKFDIAVRELVASEYVSRGLDGDIIPRAVAHEVLS
                     GDGVYAVSLETMLDGTGLCRGGLGEFLSERTVGGLVELMSVMKGVDISGLEGRLRDLG
                     VGFEVPFIPWPEIRGMRERAVIAWRRLVSRGQILAGDFGVTDGDEFEGLGERKTAFID
                     RVKRPDEGVSRKVLIHNDIKGEHILVDSDGGITGILDWADAGVGYPATDIAGLVLTVG
                     MRLAVRIAREVGYNEDEVLQGLMQARCECVLRLDDRLNGDDEMTPVDLLKGQLVLSME
                     DCELVDYRIARDYDNVGLRHVTD"
     exon            complement(1004309..1004361)
                     /number=1
     exon            complement(1004469..1005489)
                     /number=2
     tRNA            complement(1006123..1006194)
                     /locus_tag="AO090103t00011"
                     /note="tRNAscan-SE"
                     /product="tRNA-Arg"
     CDS             complement(join(1006367..1007152,1007211..1007423))
                     /codon_start=1
                     /locus_tag="AO090103000388"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000161"
                     /protein_id="BAE65820.1"
                     /transl_table=1
                     /translation="MLLRFLSLTGALCLSSCAALSLPEHKVELSGLDPEFRSRIISNA
                     RPTNVPTALCSFSDSECSKDIDLHSQLTLDFSTENGTLLANHDPIFPPTFPMRFHAVR
                     HFQSGRETVDLAYELDVRPMPSRPDEALGGVFLLKLRLFDLQGRPASDHLVTITLNQD
                     SEGNLQITQLETNPVLGHHHHDGPPSWMAQLTASLQAMKDAVKDCMHGPGPRHPTARP
                     QHGHMQPPVDHHRTIAPEHHRYHHRPGYWAGREKNFGRLMRPVVMPALLGVMAGVIAC
                     MVGFVLGKIFISVFYCVRGYRKQHQKQNETAIPRIVVVESAPSEKERLMAMCDDQC"
     exon            complement(1006367..1007152)
                     /number=1
     exon            complement(1007211..1007423)
                     /number=2
     CDS             complement(join(1008886..1009127,1009271..1009346))
                     /codon_start=1
                     /locus_tag="AO090103000389"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000162"
                     /protein_id="BAE65821.1"
                     /transl_table=1
                     /translation="MSGEDSTLVVGHQHRGMPGHSIENDRPDSMWRLSQVKPGHSMTV
                     HELGFGDNNHEEIFYTRVNRVGFRRVLASREVERAHYVPEDVSEVDDGSEAPNDKKGY
                     LME"
     exon            complement(1008886..1009127)
                     /number=1
     exon            complement(1009271..1009346)
                     /number=2
     CDS             complement(join(1010217..1010532,1010621..1010695,
                     1010868..1011285,1011363..1011657))
                     /codon_start=1
                     /locus_tag="AO090103000390"
                     /note="dienelactone hydrolase and related enzymes"
                     /old_locus_tag="AO070333000163"
                     /protein_id="BAE65822.1"
                     /transl_table=1
                     /translation="MAAPPLPSASPVSLGQNILLQPPLSRCGRGPGLIIIRPYSYAEC
                     QAKNTSLDPEPVQKWAEESYAVVQITLEHEMSADGGGVLGLVERGIAAFESSNEFYGS
                     PADYAPGFGKILGNVITALNKKLAAAVFFSSWDMSEESNPILSHIPGNFQPTGPAKKD
                     NHTVYSYADVSSAGFIVPGHADFKITSAGVAHTRSLTFLKKHLNGPYFDLEKIWEEHT
                     WYEFGDRSVEKTMATMVQEPRTVGTDRIVDEFIFSLTHNKEIDWLLPGIPPTGKPLRI
                     PFTSVVNIRGDRLYHEHIAWDQATVLVQLGLMPEYLPYPYALPGGQLPGPGKRFEYRV
                     PAAGVETAMKLQDEHAVPSNGMFEFKVREVDDE"
     exon            complement(1010217..1010532)
                     /number=1
     exon            complement(1010621..1010695)
                     /number=2
     exon            complement(1010868..1011285)
                     /number=3
     exon            complement(1011363..1011657)
                     /number=4
     CDS             complement(1011989..1012744)
                     /codon_start=1
                     /locus_tag="AO090103000391"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000164"
                     /protein_id="BAE65823.1"
                     /transl_table=1
                     /translation="MAIQKYDTIGASYNDVSQLATGKLQLAAIQALIGDIKGLTVLEL
                     ACGPGFYCRKAISWGARHATGVDISPTMVHAARANAKGDKRMEFHIADCIQPFNFNIG
                     QFDIILAPWLLNYARNESELVGMWRNVYNSLKPGGKVIGITTNLHLLDNPAAFPTGRR
                     FGQELEVLGAIEDGGLEVRATLFTSKPFSFTNYYLPSVLYEKSALLAGLSDFRWISIT
                     EALLGDCEVDWDAFSKCPPFLTFTAVRPLDVLK"
     exon            complement(1011989..1012744)
                     /number=1
     CDS             complement(1014089..1014694)
                     /codon_start=1
                     /locus_tag="AO090103000392"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000165"
                     /protein_id="BAE65824.1"
                     /transl_table=1
                     /translation="MIEALPLELLEMIIQIALDLDEQHKPTGVPKVWEAYPGRRRKRP
                     PGQSVSRTALPLILSCKTLCTITHAIILSHVQFWSPHHWQMDSLLKSLDQANLLPKLR
                     TVAIKLDSDDDITWDDKGQSYEDDGRSDQLVARTQTLLERLPDGLLTLSLATKFEDYS
                     SYIYVGRIQPAFHPRLEKFRNLRHLELDSSGFRSSHKQPFR"
     exon            complement(1014089..1014694)
                     /number=1
     CDS             complement(join(1015303..1015773,1015786..1015919,
                     1015930..1016249,1016346..1016476,1016555..1016587))
                     /codon_start=1
                     /locus_tag="AO090103000393"
                     /note="sorbitol dehydrogenase"
                     /old_locus_tag="AO070333000166"
                     /protein_id="BAE65825.1"
                     /transl_table=1
                     /translation="MLATPLLTQCRNPSFVLRKVKDVVIEDRPKPVLKDPDDVIVHVK
                     QTGICGSDVHYWQRGRIGDYVLAGPMVLGHESSGKVVEVGVAVSHLKAGDRVAMEPGV
                     PCRCCNQCRSGAYHLCGGMSFAATPPWDGTLAKYYVNTADFCYKVPDHMSMEEAAMVK
                     PAAAIAKTADLRAHQTVLVFGCGPIGVLCQTVAKAHGAKTIIAVDVLEVAKSYGVDHV
                     FMPEKPEPGADPIAHAEKMAQKLKEECGLGEGADVELECSGAEPCVQMGVFAARHGGT
                     IVQARMGKEVINFPITAVCTRGLVVKGSIRYLTGCYPAAIDLIGKGIIDVKRLVTNRF
                     KFEEAEQAFELVKAGRQDVFKVMIAGVV"
     exon            complement(1015303..1015773)
                     /number=1
     exon            complement(1015786..1015919)
                     /number=2
     exon            complement(1015930..1016249)
                     /number=3
     exon            complement(1016346..1016476)
                     /number=4
     exon            complement(1016555..1016587)
                     /number=5
     CDS             1017160..1017918
                     /codon_start=1
                     /locus_tag="AO090103000394"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000167"
                     /protein_id="BAE65826.1"
                     /transl_table=1
                     /translation="MEREARFLRNGHEHPWLFRGQLDQLRSFICRWCGGLAVSDRFTV
                     HVHLRSLCNCPMASRVAEVRCLPLFRPIDVSPITDLLCHPKRRWLMQKGYEKEAIEIL
                     SCIEDKPIDDPYVVAQKNEIEYTIYYERENAIRWRDILLRRKTDSTDSKSLRRLILGA
                     GTQFMQQFEGINIMSYYLPIVLMKFVGLSDSMVRLLTAVNSVTYLICTCCAVGLIERM
                     GRRGLIMLSTAGQFFAFLIITILLRYAEANAGTV"
     exon            1017160..1017918
                     /number=1
     CDS             join(1019573..1019607,1020603..1020710,1020769..1020822,
                     1020877..1021338,1021399..1022332)
                     /codon_start=1
                     /locus_tag="AO090103000396"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070333000169"
                     /protein_id="BAE65827.1"
                     /transl_table=1
                     /translation="MTEDLRRYHKIKLKGFFGFDNDVDPDELRNSKDIEIHSWNGPND
                     PENPFNWSLKYKWLLTVTVCFISILTGLPAGTYGSGNDWMEEKFHVQNSPFPNLYWAT
                     TSWNMGAAFWPLIFVPLTESSGRMPGYFVAYVILVISLFPSAFANNFATLVVTRFFGG
                     GASSVSINIVGGSISDVWLGEKARSLPMSLFGFTSVVGIALGPFIGSAIVQIHKSDPW
                     RWIFYIQIIYNAALIPVFYLILSETRPDVILKKRARKIRKETGRPVYAQAELNKVNTL
                     KLLQISFQRPTRMLLTEPVVIFFTLWISFAWGILYLFFSSVVQTYSTNYGWGVMATGL
                     VQLAISVGAVIGTAINPIQDWIYLSSARRNSEKPGKPIPEARLYTAIPGSLLFAAGLF
                     WYGWASMPDVHWIVPTIGITAAGIGIYSIYMAVVNYLTDAYEKYAASALSAASLGRNS
                     FGAFLPLASPQLFSNLGFGWAGSLLGFIGIALSVVPVVLVLKGPQIRNSSPFMRESMW
                     TSDEVDEVDEPSAEKVPTAEIP"
     exon            1019573..1019607
                     /number=1
     exon            1020603..1020710
                     /number=2
     exon            1020769..1020822
                     /number=3
     exon            1020877..1021338
                     /number=4
     exon            1021399..1022332
                     /number=5
     CDS             join(1022998..1023098,1023333..1023564)
                     /codon_start=1
                     /locus_tag="AO090103000397"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000170"
                     /protein_id="BAE65828.1"
                     /transl_table=1
                     /translation="MDPFKATITLSARLDTFITINTFFKKDPKDDDVCWVGERQTPRT
                     SCNYKWDMLCLQRWLVVEVLGVEQGYDCLLLKDISSLKQLVKERSSCLVEDVHSIFDN
                     SIPLLSFV"
     exon            1022998..1023098
                     /number=1
     exon            1023333..1023564
                     /number=2
     CDS             join(1026172..1026327,1026412..1027350)
                     /codon_start=1
                     /locus_tag="AO090103000398"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000171"
                     /protein_id="BAE65829.1"
                     /transl_table=1
                     /translation="MVVSSLVRRGMELASDMPMNSKNPEVPSIHLSGWLAGLFVFSVL
                     AFFFVVFSIEYTYGMVVAALAAVEETNPDIYIRVKTDSNPDKDVDAAEPEADILRPQP
                     ITSKLRTTIKHLRARAGFWSRFRGFGLFFTYSLAEGFLFSILPVSMTNFAGQLVARMI
                     IGMALANLEMTWVHIVISEPSPKRFYQRIPGFKSWLRIAPVVAFEQGAVCAAFYIPLL
                     IAGAAGALSDLVVDPNANLPPAELVSRAATVIAIPSLLAGLVSIPVRAVTIRVAASML
                     PKEDEAIIPFDRSFGGKVVPATLGGSGKLSIKDAWTTFDGPARIRYLKVIGKVFAMEF
                     AATILFSFVLGCQVHAGALAYGVRRSEVSA"
     exon            1026172..1026327
                     /number=1
     exon            1026412..1027350
                     /number=2
     CDS             join(1028030..1028189,1028289..1028381,1028450..1028695,
                     1030051..1030076)
                     /codon_start=1
                     /locus_tag="AO090103000399"
                     /note="ubiquitin-protein ligase"
                     /old_locus_tag="AO070333000172"
                     /protein_id="BAE65830.1"
                     /transl_table=1
                     /translation="MATSPAGRMLVRQLQQMQSAKDLPGISCGLVDENNVFEWEVMLM
                     ISDDVKLYGGGFFRARLSFPPEYPHMPPKMKFETPLFHPNIYPNGDVCISILHPPEED
                     KYGYESAAERWSPVQTPETILLSVISMLSSPNDESPANVEAARLWREDPKEFKKKVRK
                     CVRDSLGLIAGHVT"
     exon            1028030..1028189
                     /number=1
     exon            1028289..1028381
                     /number=2
     exon            1028450..1028695
                     /number=3
     exon            1030051..1030076
                     /number=4
     CDS             1031724..1032308
                     /codon_start=1
                     /locus_tag="AO090103000400"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000173"
                     /protein_id="BAE65831.1"
                     /transl_table=1
                     /translation="MICIALPRLPGSRGESSSMTENLIFIFELLKGVTKIFTITRSWL
                     ENNLFASKNGFYEKSVTPLDAGTEAALTRLADLNDTLLSSVEPGQHSIIKDAISHLRR
                     CFARYAHEQDAASVLSWLAGVDKEFVHVVCRRQPLALLVLMHWGVLLAELDGKTWWAR
                     KSGSALVSEILIALQGGDARWEEAVLWPKQKLGL"
     exon            1031724..1032308
                     /number=1
     CDS             join(1033474..1033527,1033574..1034002,1034069..1035634)
                     /codon_start=1
                     /locus_tag="AO090103000401"
                     /note="copper amine oxidase"
                     /old_locus_tag="AO070333000174"
                     /protein_id="BAE65832.1"
                     /transl_table=1
                     /translation="MTLSMHPFDPLTPREISKAATITRSALPGESPIFRVITLKEPPK
                     QDTIHFLDREHSGQPLDVRPTRVARVQVITRSESKNKLTELLIDLDHAAVVKQEHLAG
                     KHSYIDSEYMKSVEQACLADARIQEEIKKLKLPTGATVIVEPWAYATDGMNDMSERLS
                     MCWFYMRLLDNPDANYYAYPLDLCAEVSEQLQVTKIYQLPSSSEERIHNHPQPYDQRK
                     VHSTEASEYHPSLRPPPRNTTKPYQVVQPEGPSFNVEGNVVTWEKWRMHVGFNYREGL
                     TLHDIRYDGRSLFYRLSLAEMFVPYGDPRAPYPRKAAFDLGNDGAGINANNLRLGCDC
                     LGLIKYFDGWHNTNSGEPLKLPNVICCHEQDDGILWKHTNFRTQNAVVTRARVLVLQT
                     IITVSNYEYIFAFYFGQDASIHYEVRATGILSTCPINIGHKVPYGTIVAPGVLAPYHQ
                     HLFCLRIDPALDGHSNSLQIEESIPIPLSDPTNPNPFGVGYTTTSRIIEHEAGLDLDF
                     TKNRTFKIINEHSTNPITGTPIAFKLLPYYSQMLLADPSSYHAKRSEFASHAVWVTRY
                     HDDELFPAGRHTMQSAGGEGIASVIESRRRQSSPHSSVRNQDIVVWHTFGSTHNPRIE
                     DWPVMPVDKMVVGLKPVNFFTGNPALDVAVSTQERNKSVLFEGVGKASSGGGAACCKL
                     "
     exon            1033474..1033527
                     /number=1
     exon            1033574..1034002
                     /number=2
     exon            1034069..1035634
                     /number=3
     CDS             complement(join(1035998..1036883,1036935..1037153,
                     1037201..1037419,1038388..1038779))
                     /codon_start=1
                     /locus_tag="AO090103000402"
                     /note="putative Zn2+ transporter MSC2 (cation diffusion
                     facilitator superfamily)"
                     /old_locus_tag="AO070333000175"
                     /protein_id="BAE65833.1"
                     /transl_table=1
                     /translation="MSTGAPVSSVDTISPTLSTQGHYKPTPSRGHSRSKRWSQGPISY
                     SASDAASTQQSSQPLTGPTDVNGNASSSSHGHQHSHSHSSSHGEPWGKFDHANGLHTH
                     ISKHSHSGSVTGLVPDTPIVSSNPESLRTGVLAGIAVLASRFEDRQLRLVMQAHNHHH
                     HHHTHSIDDASNITKLILRYSEPYPLLYSILKESDSRRIFYFMTLNFAFMLVQLSYGF
                     LTGSLGLLSDSIHMFFDCLALVVGLCAAVMSKWPPSARFPYGYGKVDTLSGFANGVFL
                     MIISIEIIYEAVERLSSGSQMHRIGELLVVSAAGLAVNLVGIMAFDHAHHRHDHGHDH
                     SHDNENMHGIFLHILADTLGSVAVVISTILVHYSGWSGYDPIASCMIAILIFASAVPL
                     VSSTAKKLLLTLPADVEYNVRETLAGVSTLRGVVGYTVPKFWLDDTAKSDHDHGCSHS
                     HSHSHSHNHSHHDHDHGHEHSHNHSHGHGHDHSHNHNHSHSHSHSHSHSHSHSHDHDH
                     AHEKSNPNVLGVIHVIASRSSDLEDVRQRTVDFLREKGMDILVQVEREGDGRCWCGGG
                     GNKSS"
     exon            complement(1035998..1036883)
                     /number=1
     exon            complement(1036935..1037153)
                     /number=2
     exon            complement(1037201..1037419)
                     /number=3
     exon            complement(1038388..1038779)
                     /number=4
     CDS             join(1039538..1039775,1039837..1040033,1040100..1041044)
                     /codon_start=1
                     /locus_tag="AO090103000403"
                     /note="beta-1,4-mannosyltransferase"
                     /old_locus_tag="AO070333000176"
                     /protein_id="BAE65834.1"
                     /transl_table=1
                     /translation="MIESVVSVAFYISTAVTLFILLLPSQYAPKRSTAQDASTDPKTT
                     VQILVLGDIGRSPRMQYHALSIAKGGGQVEIIGYHESEVHPDISSDPRISIVALPPHP
                     AYLQTSNKLLFLVFGPLKVLFQVACLWWSLAYRTRPVKWLLVQNPPSIPTLAVASLTC
                     FLRQTSLIIDWHNFGYSILALKLGNGHPLVKLSKWYEKTFGRYATAHLCVTTVMASVL
                     KKEFLLEAPILPLHDRPANHFRPILDDNVRQEFLLSLPVAASVQSLINSGALRVLVSS
                     TSWTADEDFSLLIDALCRYSQLAATTMPELPQVLAIITGKGPQKEMYIKQIADLEKAG
                     KLQKVTVRTAWLTTTDYAKLLASASLGVSLHTSSSGVDLPMKVVDMFGAGLPVVGWNR
                     FEAWPELVTEGVNGRGFGSSNELVEELVDLFGDTSKLDRLRVGAQKESTRRWDDEWNP
                     VAGKLLGLI"
     exon            1039538..1039775
                     /number=1
     exon            1039837..1040033
                     /number=2
     exon            1040100..1041044
                     /number=3
     CDS             complement(join(1041104..1041282,1041346..1042021))
                     /codon_start=1
                     /locus_tag="AO090103000404"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000177"
                     /protein_id="BAE65835.1"
                     /transl_table=1
                     /translation="MTLSGIQSSDELPETPWKKQLDNAREQFDIARDLGGYTISRIWG
                     LASHDSLVVAAFTLHPGDTVEYRTSAEERTMLVFSHANAELTEHDDLAFPYPLPDRSP
                     DTLRRKREAALGYILFTEGGDYSRLALSRKMLYAAACCAIVDSQNDKILSQARKALEW
                     LASGIDVDLSNEIGKCSAPGSTIDAKTAEQLEGSGQQIFEQCTICDAGLSWYSAVEAQ
                     CAAGHLFVRCGVTFLAIQEPGLSKFCSRCGTEYLSEDLVHDELKHTCRILSDVFDTCI
                     YCSGKFQA"
     exon            complement(1041104..1041282)
                     /number=1
     exon            complement(1041346..1042021)
                     /number=2
     CDS             complement(1042370..1043377)
                     /codon_start=1
                     /locus_tag="AO090103000405"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000178"
                     /protein_id="BAE65836.1"
                     /transl_table=1
                     /translation="MKQSTVKINDHILVNRANERQTPKHTTEKEGGNGPGSQAATKNW
                     NVTRIRTNVFTNGEWPIIYPQKRENFSIGPEQSISTVVGLAWSPPGLAKYRRCVLAVL
                     TSGLLLSFYDISPQGKWTRVAIVNDCLNSYFKSLIDDEELRLRKSNIRSFTWCPPLKV
                     PIPEQDATSYAVPPPESRWGMYLLSVTNDDNDVILLQARRSTDPTSASLYSFEVLSLT
                     SLYEHTENQNVQPGSIFSSALRNRARASFMSPGPWIYQPTKENKGVCSAIGNVAITLG
                     VKLKMVRHVVTLILDNDQTDSAVKYKARCVSEENTSYGGLLNNYHLTGALHWIHTVSL
                     H"
     exon            complement(1042370..1043377)
                     /number=1
     CDS             complement(join(1043939..1044139,1044193..1045137,
                     1045195..1045347))
                     /codon_start=1
                     /locus_tag="AO090103000406"
                     /note="acetyl-CoA acetyltransferase"
                     /old_locus_tag="AO070333000179"
                     /protein_id="BAE65837.1"
                     /transl_table=1
                     /translation="MAIQASATRLFKRAAIPASRQWQRQFSAAAPALKEIQDAYILSA
                     SRTPTAKFNGSFASVSAPELGAVAIKSAVTKSGLPVEKITDVYMGNVLQGSVGQAPAR
                     QASIFAGLSPTVESMTVNKVCASGLKAVALAAQNIQLGLADAQVAGGMENMSRVPYYL
                     PRSSQLPPFGEIKLEDGLIKDGLWDVYNKFHMGICAETTAKKYEISREEQDEYAIQSY
                     QRAQKAWNENKFADEIAPVTVKGKKGETVVERDEGYENLRVDKMKTLKPAFLRDGTGT
                     VTAGNASTMNDGASALVLASKDLAREFGQGNRALARIVSSADAAIDPVDFPVAPAKAV
                     PIALERAGITKDQVAVWEFNEAFAAVIKANEKILGLQNARVNPLGGAISLGHALGSSG
                     SRILVTLLHQLQPGEYGVAAICNGGGAASAMVVQKLDRVD"
     exon            complement(1043939..1044139)
                     /number=1
     exon            complement(1044193..1045137)
                     /number=2
     exon            complement(1045195..1045347)
                     /number=3
     CDS             join(1047249..1047290,1047445..1047509,1047582..1047806,
                     1047871..1047994)
                     /codon_start=1
                     /locus_tag="AO090103000407"
                     /note="ubiquitin-protein ligase"
                     /old_locus_tag="AO070333000180"
                     /protein_id="BAE65838.1"
                     /transl_table=1
                     /translation="MSTSARRRLMRDFKRMQTDPPAGVSASPVADNVMTWNAVIIGPA
                     DTPFEDGTFRLVMHFEEQYPNKPPGVKFISQMFHPNVYGTGELCLDILQNRWSPTYDV
                     AAILTSIQSLLNDPNTSSPANVEASNLYKDNRKEYIKRVRETVEKSWED"
     exon            1047249..1047290
                     /number=1
     exon            1047445..1047509
                     /number=2
     exon            1047582..1047806
                     /number=3
     exon            1047871..1047994
                     /number=4
     CDS             join(1049041..1049045,1049202..1049319,1049400..1051816,
                     1051879..1052107)
                     /codon_start=1
                     /locus_tag="AO090103000408"
                     /note="kinesin (SMY1 subfamily)"
                     /old_locus_tag="AO070333000181"
                     /protein_id="BAE65839.1"
                     /transl_table=1
                     /translation="MAITDQFSVVVARFRPQNKVELSSGGEPIVEFENEQSCQISSKE
                     GTGSFTFDRVFPMNSKQTDIFDFSIRPTVDDILNGYNGTVFAYGQTGAGKSYTMMGSD
                     IDDDIGKGIIPRIVEQIFASILTSPSNIEYTVRVSYMEIYMERIRDLLVPQNDNLPVH
                     EEKSRGVYVKGLLEVYVSSVQEVYEVMRRGGTARAVAATNMNQESSRSHSIFVITVTQ
                     KNLETGSAKSGQLFLVDLAGSEKVGKTGASGQTLEEAKKINKSLSALGMVINALTDGK
                     STHIPYRDSKLTRILQESLGGNSRTTLIINCSPSSYNDAETISTLRFGVRAKAIKNKA
                     KVNAELSPAELKQLLRKAQSQVTNFESYISALETEVHVWRSGESVPKDRWTPGRNDVV
                     SATKAEARPRPSTPSRLQEARSETPRPDSRVGDRSSTPSLVLEKDEREEFLRRENELQ
                     DQIAEKESHIVNVERGLREAREELRALKENSARSGKDNEKLNTEVNELRMQLEKVSYE
                     SKEAAITMDGLREANSELTTELDDVKQQLLDVRMKAKETSAALDEKEKKKAEKMAKMM
                     AGFDLGGNVFSDNERKLQDLINRVDTLHQISEAGETIAPDDLLELRTSLSETQGLIRQ
                     AELTMNDRGELSELQDSRRIEVEQKLADLERDYEKLLERNLGEEDVEEIRERLEKVYV
                     TRKDAEMQAASELRKEIAHKDEELSKLRQSLADSQTRVSTNGAAGKNLQQQIAEFDAM
                     KKSLMRDLQNRCERVVELEISLDDAREQYNNVLRSSNNRAQQKKMAFLERNLEQLTHV
                     QRQLVEQNSSLKKEVAIAERKLIARNERIASLESLLQESQEKLTQANHRFEAQLTAVK
                     ERLEAAKQGSTRGLPSMDSGGNFSFGGSRIAKPLRGGGGGSESSAPVAGVQSQETGKR
                     TSWFFDRR"
     exon            1049041..1049045
                     /number=1
     exon            1049202..1049319
                     /number=2
     exon            1049400..1051816
                     /number=3
     exon            1051879..1052107
                     /number=4
     CDS             complement(1052882..1054024)
                     /codon_start=1
                     /locus_tag="AO090103000410"
                     /note="protein involved in rRNA processing"
                     /old_locus_tag="AO070333000183"
                     /protein_id="BAE65840.1"
                     /transl_table=1
                     /translation="MATATQQPETSGLQNISALLETITGCLTAAGSSLPKDKRDAPSE
                     VSIEPPQDGISLLDTKSDLLLSYTHNLVFLMLFQLRGLSKDRDDEAEADQSLREETVK
                     KLAELRVYLDRGVRPLEGRLKYQIDKVIKAAEDAERTERTAAKTKATEAEYSGSDDES
                     ASDGEGDGADESDEDQEDIDEMAYRPNVSAFAKKVEPEARAEKSNKMAPSDGIYRPPK
                     IMPTALPTTETRERRERGPRRSTVIDEFVNAEMSSAPMAEPSIGSTIVHGGRHTKSKK
                     EREHEMERTTYEETNFIRLAKESKKDRAKRGGQAARSTYGGEEWRGLTEGADRISRLT
                     RRAKGSGGALDRSRKRKHGEDGQRGDGAAVGQIFEKRRKKIEGWKR"
     exon            complement(1052882..1054024)
                     /number=1
     CDS             join(1054442..1055549,1055603..1055940,1056008..1056443,
                     1056502..1056569)
                     /codon_start=1
                     /locus_tag="AO090103000412"
                     /note="endosomal membrane proteins, EMP70"
                     /old_locus_tag="AO070333000185"
                     /protein_id="BAE65841.1"
                     /transl_table=1
                     /translation="MAFNKRTFSIYSLLLAAPSLTTAFYLPGVAPTSYDEGQSVPLYV
                     NHLTPGLAQQDEQLHSVFSYDYYHPAFHFCAPENGPKYIRESLGSILFGDRIQSSPFE
                     LFMGKNETCKAVCKEEAKFDSRSAKFTNRRIIQGYNFNWLVDGLPGAQINVESVTEAK
                     FYNPGFALGSLNDNGQAVLNNHFDIFIEYHAVGYGAKDKYRVVGVLVQPDSRGNSKVQ
                     GDGTVDCGSSDVPVILDEDSETGVTWTYSVYWRESSTPWATRWDKYLHVYDPKIHWFS
                     LINSAVFVVFLVGMVSMILVRALRKDIARYNRLDMINLEDLDGTSAAVEDGIQEDSGW
                     KLVHGDVFRCPKSPLLLSVLVGNGAQLFMMTGATVLVALFGLLSPANRGFLATATLLI
                     YTLFGFIGGYVSARVYKSFGGEAWKRNIIMTPALVPGFIFSAFFLLNLFVWAKGSSGA
                     VPFGTMLALVAIWFVISVPLSVAGSWLGFKQRAVEGPTKTNQIPRQVPPMTGSLRTIP
                     SLLLTGILPFGAIFVELYFIMTSLWTNKIYYMFGFLFLCYGLMIITTAATTVLLVYFL
                     LCAENYRWQWRAFAGAGMTGGYVFLSALLFWATRVSFGGFTGAVLYVGYSALIGFVVF
                     ILTGSIGFFASWAFVQRIYGSIKVD"
     exon            1054442..1055549
                     /number=1
     exon            1055603..1055940
                     /number=2
     exon            1056008..1056443
                     /number=3
     exon            1056502..1056569
                     /number=4
     CDS             join(1057414..1057424,1057660..1057745,1057812..1058107,
                     1058165..1058344)
                     /codon_start=1
                     /locus_tag="AO090103000413"
                     /note="Ca2+ sensor (EF-Hand superfamily)"
                     /old_locus_tag="AO070333000186"
                     /protein_id="BAE65842.1"
                     /transl_table=1
                     /translation="MGKSQSKLSPSQLDELQKATHFDKKELQQWYKGFLKDCPSGTLT
                     KEEFQKIYRQFFPFGDPSSFANYVFRVFDSDNSGMIDFKEFICALSVTSRGKMEDKLD
                     WAFQLYDIDGDGKITYDEMLAIVEAIYKMVGSMVKLPEDEDTPEKRVRKIFRMMDKDE
                     NGSLDMEEFKEGSKRDETIVSALSLYDGLV"
     exon            1057414..1057424
                     /number=1
     exon            1057660..1057745
                     /number=2
     exon            1057812..1058107
                     /number=3
     exon            1058165..1058344
                     /number=4
     CDS             join(1059452..1059465,1059584..1059909,1060050..1060317,
                     1060504..1060534)
                     /codon_start=1
                     /locus_tag="AO090103000414"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000187"
                     /protein_id="BAE65843.1"
                     /transl_table=1
                     /translation="MAATGRNRWVSLKIMTADLRDSRDLEKLKVLGSHSRGGLSSNYI
                     VQLLDSFSHEGPNGVHQCLVFELLGPSVDRVLADYREGHDKLCPETVLQMSTQLLKAL
                     KFIHSAGMSHGVLGTPEIELLARVDGAPLHNGLPTQLVKAAEWVEWVDEDDEEIRLLD
                     VGESFLQGEEPNVLAQPGTLRVPETFSQTILIIASICGAQGACHDLTMEQGE"
     exon            1059452..1059465
                     /number=1
     exon            1059584..1059909
                     /number=2
     exon            1060050..1060317
                     /number=3
     exon            1060504..1060534
                     /number=4
     CDS             complement(join(1064506..1064539,1065753..1067930,
                     1067982..1068961))
                     /codon_start=1
                     /locus_tag="AO090103000415"
                     /note="helicases"
                     /old_locus_tag="AO070333000188"
                     /protein_id="BAE65844.1"
                     /transl_table=1
                     /translation="MEEFVVRIYNCIFGPAGRRAEPFLNFLADVVQLDVELHSDATST
                     YLELSLQVFCKIIELNSTAFIQEPLKPVARRFYDLFMILHALKTAGSLDLSRHHLEVL
                     QRRLKIGAALPPLLGSSKPLQTYKSPVTFVTPKDPPGGRHDNDHADICSVQILPTFQE
                     IMSPRSEYLPGKHPQQWHIGGLAGLLDRNFRLLREDTIGQLRDVIHAELMPSHLRQVQ
                     RSQVRTNVYQNVQVRGLDFDRLTGLQFVVQFAQPLNVRTMSEAHRREWWELSKRLQSS
                     ALVCLTDHQGFAIFCTVAGPERPRTDGRQERRQRKVSSLWKEASVVSVTMEPRHSNRA
                     VSLIEFPGILLPSFQPTLKALQSMKKAADLPMSEFLAPDEMLTGLVDMPPPKYAAVPG
                     FSFNLRCLMNDQSDLLLSPSQPLDLKKLQEKSTLDDAQAQALVHTLQRKIGLIQGPPG
                     TGKSYTGVALIKVLLANKAKVKPRLGPIICVCYTNHALDQLLEDLLDDKITTQIIRIG
                     SQSKSERLQPLNLRTVARQIDKTRLEKQEQWKLQMNFDEYENSFDALRLDAIGTDRSL
                     EFHLKRNHPRHFSQLFDKDEDGFEKVTGRRRQHLLQTWLRSGPATKGQQRAVNDLLEV
                     PVDNMTSKERRILYEHWIRESREELHTQAHSILTSHQENKASYDKIRDELDLRCLRNA
                     DVIGVTTTGLARNLNMLRRLQSKVIMCEEAGEVLEAHLLTSLLPSAEHVILIGDHQQL
                     RPQIQNYGLSRENRAGQQYSLDRSLFERLVEPDDDAGIRLPFSTLETQRRMHPSIAQL
                     VRDTLYPRLQDAPSVSLYPEVAGMRKRLFWLDHRRPEGNSSVQDAMATSHWNDHEIEL
                     TLALVNHLLRQGEYQAGDIAVLTPYLGQLHRMRRKLSQAFTITLGERDQDDLDKAGFT
                     EDERPTTPSAVSRSTLLQALRVATIDNFQGEEAKVVVISLVRSNDQNRCGFLRTPNRI
                     NVLLSRAQHGMYIIGNSETSRGVDMWHKVLNIFEGHDNFGTSLELKCPRHPSTPITVS
                     QPDDFVQFSPEGGCSLRCGKRLQFKGHLTIKSD"
     exon            complement(1064506..1064539)
                     /number=1
     exon            complement(1065753..1067930)
                     /number=2
     exon            complement(1067982..1068961)
                     /number=3
     CDS             complement(join(1070196..1070740,1070835..1071047,
                     1071112..1071124))
                     /codon_start=1
                     /locus_tag="AO090103000416"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000189"
                     /protein_id="BAE65845.1"
                     /transl_table=1
                     /translation="MEDPVSEIPTVIQHLTQSPPAQQAQTIDKYFTPDASFVHPFCRI
                     QHFRGSRWVVKKIYQWYKVMSPRIELKIHSVAYDSDNQKLYVTMSQIFTIWIVPFHVA
                     PVTLTTVLSLTTNPHGYLSSSDSSTAASEKAHEPKEEEEASYADVVANGNPDHKTPLT
                     AHTNGHRKLYYITKQEDLYQTSEFIKFVLPHIGHWIVLAIHAFATVFCVLGAFLWWPF
                     VWMEEQGWIPGLVLRGGNIAYDIRWKKRAIGAGSGPSS"
     exon            complement(1070196..1070740)
                     /number=1
     exon            complement(1070835..1071047)
                     /number=2
     exon            complement(1071112..1071124)
                     /number=3
     CDS             join(1071760..1071837,1071914..1072323,1072377..1072637,
                     1072687..1073172,1073223..1073332,1073421..1074085)
                     /codon_start=1
                     /locus_tag="AO090103000417"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000190"
                     /protein_id="BAE65846.1"
                     /transl_table=1
                     /translation="MSEQQQRRKRERDINEGISWSGRSLTTIYAGISVLHRDYEDSRA
                     AIAFRNSAYLFDYIVFDLLAESSNTPVHTICNRIVSELRTYSEKHKEKIVGLAMPLSL
                     ADKYPPLCPQLWRELDILPLVLEHKERARADADQGELATFASWNTKELDEQADSMVRK
                     CLRSFGAGHVLQGEIGLGSLVGVDRNFRVRLADLQDYQETVNARTWSMAQYYAEELKR
                     RNVKIAFFSLSSHGRPDIHTRHSLVRFLHYLGGLNMWSRYVPKPRPGINSIIRKMQDS
                     LEGLGERDDSITVDEEMCILQWVYENARRYWLCEDDPLQARSKGGADIVVIDDVPLTP
                     AALLSKQTDPGRPVIIENRLQVQKGALQDASNFSTRPWNFLRERLKHVDLVVSQAPKE
                     LLPNIMPQKKVVYIPVSVDQLDGLNKCMSDFDLTFYGREFNTLCRSFETPTLNYPNEE
                     YILHLSQFRNLDETITVLNAYQKFRSHCMDAGMNTLFPKLLIYHYGPSRSSRSTLIYD
                     AILSYIETDMPRLKSCIYVMQIGPPDQLWNTLLTRAKVVIELSMCEGIPAMLLAAVQK
                     GKPIITAKEIGQFSFTKGVNNILFCEKGDADVIARLLRDLWTDPRLSELLLPGPRRLR
                     DEYTTVGNAVNWLFLAAEMSREGNVVEPDGRSIYELAGQGAGLCA"
     exon            1071760..1071837
                     /number=1
     exon            1071914..1072323
                     /number=2
     exon            1072377..1072637
                     /number=3
     exon            1072687..1073172
                     /number=4
     exon            1073223..1073332
                     /number=5
     exon            1073421..1074085
                     /number=6
     CDS             complement(1074308..1074844)
                     /codon_start=1
                     /locus_tag="AO090103000418"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000191"
                     /protein_id="BAE65847.1"
                     /transl_table=1
                     /translation="MEGLFIEGSIATFGYWEAQHIFSSCLILVISALLNPNVATSDLL
                     QTSINILRTMRDHGNIPAVDYSKRLSLIQAGVSTGSGSEHANPNLGRSQQTDRVQQVG
                     RTRNHGRPSDIAELAVQHSISHSLVADSGMNCADTLAHPLMDTFLDENLSAWPSSMFM
                     DDNAWRSLATEMEEHFLF"
     exon            complement(1074308..1074844)
                     /number=1
     CDS             complement(1075171..1075833)
                     /codon_start=1
                     /locus_tag="AO090103000419"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000192"
                     /protein_id="BAE65848.1"
                     /transl_table=1
                     /translation="MQEIEAVYQTTVRPTVLWLCKLLALLALGELYTNRRKLNDAQII
                     PGTNYYLQALHMLHDTYEEATLLHVEVLILIVSASQSLNQRHIDQRQAWYSNSLGRIR
                     SAYSYSGVAMRLALSLGLHRSGSAPATATAVELESRRRTWWMLYYFERMSASKLGLPI
                     TVRDEDIDVELPSMNGLTEEEQQEFADPAHICANVKLARITGNICTSATSLTYKSMLT
                     RQ"
     exon            complement(1075171..1075833)
                     /number=1
     CDS             join(1076828..1079984,1080014..1080813)
                     /codon_start=1
                     /locus_tag="AO090103000420"
                     /note="oxoprolinase"
                     /old_locus_tag="AO070333000193"
                     /protein_id="BAE65849.1"
                     /transl_table=1
                     /translation="MIRNGIRIAIDRGGTFTDAWADIPGRPDHVVFKVLSVSPDEYDD
                     APTECIRRILELASGEEIPKGSLLDLSSVESIRMGTTVATNALLERKGDRVALMVTKG
                     FRDSLLIGNQARPNIFDLSVQRLKQLYETVIEVDERITIEGYSEDPEPKPIDTASDPN
                     LVVGLTGEVVRILRTPDLDAVRSQLDTLQSQGYQNLAIGLMHAYTYPEHELQIAKLAE
                     QMGFKVSASSVLQSMAKFVPRTQSAVADAYLTPMTASYLEGFRKGFRGQLDDENTNKV
                     LLSQSDGGLATWNSFSGLRGVLSGPAGGVVGLSRTCYDAEEGRPVLGFDMGGTSTDVA
                     RYSGALEHIFENTIAEVTIQTPQLDINTVAAGGGSILTWETGLLKVGPRSAGANPGPA
                     CYGKGGPLTVTDANLLLGRIIPEYFPKSLDLDIVKQKFAHLTDVVNRDKGGGDAFTSE
                     TLALGFLAIANATMTRPIRKLSEGRGYSAASHNLGCFGGAGGQHAVFIARDLGIQKAI
                     IPRYSSILSAYGMALADVVVENQEPVAWKFEDDTLSELQARLDLISKKGIEALKLQGF
                     DEESIVHECFLNMKYQGSDTTLMIRKPDQLSDFGAAFNTRHAQEFGFSQSRDILIDDI
                     RVRSIGRPRVVDTSSPFNELNKLDDRSTVQPPAPAFTRRVFFDILGWADTNVYTLPDL
                     KPGTRINGPAMIIDETQTIVVDHASRATILPEHVVLEVGSVNQEQLSTNAVDPVQLSV
                     FSHRFMTVAEQMGHTMEKTSISVNIKERLDYSCAIFSADGGLVANAPHIPGHLGSMST
                     AITAQIERHPPGDLKPGDVIISNHPAAGGTHLPDITTITPVFDDDENPSAILFYVANR
                     GHHADVGGIAPGSMPPNSTELWQEGAAIESFRLVNQGVFDEAGLIRHLYEIPGTFPGC
                     SGTRTLSDNIADLKAAVASNQKGIQLIQALIKEFTWPVVEFYMKAIQENAAQAVRDLL
                     KGFAQRYEGGVLEAEERNDDGIPFHLRVTIDKETGKTIFDFTGTGPEHSGNLNSPQAC
                     LHSAIMVGVHGLIDIQSLLTNDNIPLNHGCLAPIHVVCPKGTILSPSITAATVGCTTE
                     TSSKIADLVLKAFQAAAASQGTMNNLTFGYGGTDPITGKVIKGFGYYETIAGGAGAGP
                     DWEGTSGVHTHITNTRITDPEILEKRYPVILHEFSIRRGSGGAGLHRGGDGCVRDMEF
                     RIPLQVSILSDRRVTAPYGMAGGKEGKRGENVWIRKDPVTGSTRKVALGPRQTAHFRA
                     GDRIVILTPGGGGWGEEISRDQKESVGLRQKIDSAGQSLLKTQGSLYERNAIAVGN"
     exon            1076828..1079984
                     /number=1
     exon            1080014..1080813
                     /number=2
     CDS             join(1081853..1081859,1083099..1083359,1083415..1083676,
                     1083738..1084734)
                     /codon_start=1
                     /locus_tag="AO090103000421"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070333000194"
                     /protein_id="BAE65850.1"
                     /transl_table=1
                     /translation="MSELQGNVPTRRIMDNTKSPEDPVVKPPVDLGKDEPETRVVAGD
                     SIDACAERALVRKFDFRILPVLAIMYLFNSLDKSNLGNAKTAGLEETLNLKGDQYNII
                     LSIFFIPYVLTAPFLGILGKMYGPNLVLPCMMLTFGLCTVLVVVVYNFGGLMAIRWFL
                     GMSESAFFPLVIYYLTTFYRRGELARRLAIFYAAQSIASAFSGLLAFGVFQIHSGPLT
                     PWRYLFLIEGLATVLFALFVFWYLPRSASEARFLSEAEKALAFTRMQLDSSAVVNEKL
                     NLRDAFRIFKHPTSWAIVGIQICLGVPLQSVQLFLPQIISKLGYGTVKTNLYTVAPNV
                     SGAVVLLILAFCSDWTRWRFPFIALGFLFTFLGMIIYVAIDPEKNINVAYFASFMMTW
                     GTSAPSVLLDVWYNNNIASEGKRIVLTSIAVPLANLMGVVSSNIFRNQDAPKYLPALI
                     TTASFGGTGIILTLLLGFWMMLDNKRRDRAQGIKLRAMDVPTERLAEGPSSPDFRWFL
                     "
     exon            1081853..1081859
                     /number=1
     exon            1083099..1083359
                     /number=2
     exon            1083415..1083676
                     /number=3
     exon            1083738..1084734
                     /number=4
     CDS             1085925..1087406
                     /codon_start=1
                     /locus_tag="AO090103000422"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000195"
                     /protein_id="BAE65851.1"
                     /transl_table=1
                     /translation="MQRLPPPARSNRKKTPWTRLLPEVGGGIRWITNTDERRCFSYFQ
                     YYTIPTLSGFFNSTLWEKLVLQMSYAEPAVYHAAVALSAIHQDVEMHGMPLPGQELEL
                     YNTWHRFTLEQAGRSFAILNERHFSQDPRLREVMLLCCLLFVLMELLRGKYDDAFQHL
                     EGGLRILNELKAQRQLVTWVPHESPVEEALVAVFAQLDIQAASFKVGGPILRIENELE
                     ASVTEDCLLFSNVREARRAIEPLLSRAFGFLLDCWSKSDKEIICHYKWLQQEQQKLIS
                     ELNRFSAQFDNFYNYSYTRVSRKDQRGADMINILRHTTSLAIRTSLIRDEVLLSQYQP
                     EYKVNLALIEGVMYKFRERPNYTLDMGVVPPLYIISIGCPDYTLRWRAIELLRSWPHR
                     EGVFDSNWAAFIAEEHIKVQLQLQGFHGIDGLSSYVGDSGSPTSSVESKEDSGTDEKL
                     EKGRWSTLGQEEYTIEQGLEKTKCMEDWPCVQSLMAARRRCML"
     exon            1085925..1087406
                     /number=1
     CDS             join(1088140..1088377,1088425..1088465,1088517..1088565,
                     1088629..1088750,1088801..1088946,1088992..1089080,
                     1089275..1089363,1089413..1089478,1089535..1089624)
                     /codon_start=1
                     /locus_tag="AO090103000423"
                     /note="beta-1,4-xylanase"
                     /old_locus_tag="AO070333000196"
                     /protein_id="BAE65852.1"
                     /transl_table=1
                     /translation="MVHLKALASGTLFASLASSAVISRQAAASINDAFVAHGKKYFGT
                     CSDQALLQNSQNEAIVRADFGQLTPENSMKWDALEPSQGSFSFAGADFLADYAKTNNK
                     LVRGHTLVWHSQLPSWVQGITDKDTLTEVIKNHITTIMQRYKGQIYAWDVVNEIFDED
                     GTLRDSVFSQVLGEDFVRIAFETAREADPDAKLYINDYNLDSADYAKTQGMVSYVKKW
                     LDAGVPIDGIALTALASTGVSEVAVTELDIEGASSESYLEVVNACLDVSSCVGITVWG
                     VSDKDSWRSSTSPLLFDSNYQAKDAYNAIIDAL"
     exon            1088140..1088377
                     /number=1
     exon            1088425..1088465
                     /number=2
     exon            1088517..1088565
                     /number=3
     exon            1088629..1088750
                     /number=4
     exon            1088801..1088946
                     /number=5
     exon            1088992..1089080
                     /number=6
     exon            1089275..1089363
                     /number=7
     exon            1089413..1089478
                     /number=8
     exon            1089535..1089624
                     /number=9
     CDS             complement(1090042..1090935)
                     /codon_start=1
                     /locus_tag="AO090103000424"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000197"
                     /protein_id="BAE65853.1"
                     /transl_table=1
                     /translation="MKLDIPAGDLAFLVTVLKETIKQHLKGGREYKVASFALSNQDAE
                     KYNALIPRLADFSFVKDPEKPGRSNLLMLMQTASPSKGEIYFNKPLLASGQEFMVLIS
                     NQVFLQNFVMPAMIENVKKQAKQKDKVASQIAVKSLSEPYLYQVYNTQDINLQKDHDP
                     WISSLTASVDTTEKALCFYLDVKADVTFAGFRVETWDKSWQKFQIDEKQKITLKQTKE
                     DKGKSTKAEPWEWLVAAVSWITLLIFGVMYAVVENKNQDLGGTVVETAPLVVQWPNQK
                     YVTLKSITTPNHVVLDLSVQF"
     exon            complement(1090042..1090935)
                     /number=1
     CDS             join(1091038..1091363,1091391..1091469)
                     /codon_start=1
                     /locus_tag="AO090103000425"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000198"
                     /protein_id="BAE65854.1"
                     /transl_table=1
                     /translation="MSFSPLGMVTFVVFRVTLHSMHGEQDVNLTTRAVLNLQLRLMDS
                     DVDMSDICISQKLERDICLDTHWWYLGKLRIERVLGSSGDQIPAIASSFVLRHCGVGC
                     QHITPHPTNGSNFAPFFSITYPSLLHNFCPLS"
     exon            1091038..1091363
                     /number=1
     exon            1091391..1091469
                     /number=2
     CDS             join(1092740..1093611,1093702..1093761,1093865..1093868)
                     /codon_start=1
                     /locus_tag="AO090103000426"
                     /note="shikimate 5-dehydrogenase"
                     /old_locus_tag="AO070333000199"
                     /protein_id="BAE65855.1"
                     /transl_table=1
                     /translation="MTLPTPQHYHIFGQGISQSLSPTIHNAAFAHYGLPHRYDIQECN
                     SLQDVKSLIDDPTFGGSSVTMPHKLSAGVFCAHVSDSATRLGAINTLIARSIESGDGT
                     LTREIHGDNTDWSGLYSLIKEYASGERKQVGLVIGAGGAARAGVYAMAQAGIERIYVG
                     NRTLAKAEQIARDFEDLCRVIPVQFPSALPEAPDVIIGTVPGEAMPQEAFKGLFRNEK
                     GLCIEMAYKPRLTNLLAVARENPGWTTADGVEVLLRQGFEQFRLWTGLDAPEAVMRKA
                     IEAATEGKVGGTSSLPSNMGCLSTGYPINHLTCEV"
     exon            1092740..1093611
                     /number=1
     exon            1093702..1093761
                     /number=2
     exon            1093865..1093868
                     /number=3
     CDS             complement(1093965..1094708)
                     /codon_start=1
                     /locus_tag="AO090103000427"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000200"
                     /protein_id="BAE65856.1"
                     /transl_table=1
                     /translation="MPDLHSLPAGTRPQHAIRNNGPPQLALERYMLRELAEGWPCYRD
                     ACEWENLLSIFHPEAHIYTTWTGLTHHKKFIEASQAGMDKGAFIMHRIHGSTTDIDPD
                     ATRAVTKMKATITQRFSDVSCVSGGTCDADAESDCRFIFFWEKMMDPAYPDLRGQWRA
                     RFVRHWYEKDKLIPVNPGRVPVLDEERLKKYPPGYRYLAYMQEETMGVKVLLDLPGHR
                     REGSTINGQKHDLLYFQAKDWMDGKDVAW"
     exon            complement(1093965..1094708)
                     /number=1
     CDS             1094995..1095903
                     /codon_start=1
                     /locus_tag="AO090103000428"
                     /note="shikimate 5-dehydrogenase"
                     /old_locus_tag="AO070333000201"
                     /protein_id="BAE65857.1"
                     /transl_table=1
                     /translation="MPSETDPRAYAYLVGVGVTHSIAPPMHNYIAKALGHDWTFIAKE
                     CPTVEDAVELFRRSDFAGGVVTMPYKRTIMDHLDGLDEYAIRLGACNNVYRTSDGKLR
                     GTNTDWRGIKGCLLGASAEGRGKPAVLIGAGGAARAAIFTLHDQLECRQIYLVNRDRD
                     EVKVLLEEVKQVYGDGLEIIYVERVEQVAGLPSPYYIVGTVPDAEPSTPDEVEVHQII
                     GSFLSTPQEKGVLLDMCFKPRKTRILQAGQANGWKTVEGTEIIGHQIHEQYRLWCGEE
                     ESSQIPVTDAWAVLRKAAEESPAINF"
     exon            1094995..1095903
                     /number=1
     CDS             1096122..1097126
                     /codon_start=1
                     /locus_tag="AO090103000429"
                     /note="sugar phosphate isomerases/epimerases"
                     /old_locus_tag="AO070333000202"
                     /protein_id="BAE65858.1"
                     /transl_table=1
                     /translation="MPCAPAIASMSLGRAWVHSLPEKLSQAAKAGFKGVEIFYEDLEY
                     LAKEKGPVNDSTLFAAAQEARAICDHYGLEVIGMQPFLFYEGLTDRAQHREKIERLKL
                     WFAIVKILGTDIIQIPSNFQSEGISGDLDLIVSDMIEVADMGLKEEPVVRFAYENLAW
                     GTFISTWEDLWEVVRRVDRPNFGCCLDTFNIAGRVWADPASASGKTPGADAALAASLQ
                     SLVRTVDVNKVFYVQVVDAERMQQPLIEGHPFYVEGQPARMSWSRNARLFLYEQERGG
                     YLPVVQVAEAFLKRLGFEGWVSMELFSRSMADPDPTVPETHAQRGINAWRKLAEELDL
                     "
     exon            1096122..1097126
                     /number=1
     CDS             join(1098829..1099019,1099553..1101602,1101651..1101848)
                     /codon_start=1
                     /locus_tag="AO090103000430"
                     /note="pentafunctional AROM protein"
                     /old_locus_tag="AO070333000203"
                     /protein_id="BAE65859.1"
                     /transl_table=1
                     /translation="MDSISVFETFTGVWVVRSGLCVSHDSHWWSSSPSPRASYISSCE
                     TGANRRLTPLATLELRHIDVFQVPSSHVQHHGLPSSSRRYSSDASLVLVGFPGAGKKT
                     LGIMAAVALRRRLVDFVAVFQQRHGMHPQAYIVSHGSERYRKLELEVTEEILTEHRKG
                     CVIVGLGWLASRQQQVLLEEFASCHPVLYIRRDRRDLQQLIATSQDKFERMWDAGNSF
                     FESCSNLEFYNVTEGSTDEARSALPAYLKLKETERTFVRFLHRIWGREHLTRYSADPL
                     SASYTYALQVPMACLEGPLESYEELENGADAINLKVELSEFHGRRPSESMARAVAMLR
                     RHSRALVIVDIIPSSVPDILSYRKLLGMALRTIPDAITCSMAHGDDLAQEVAAAKGYI
                     KAIATYHQEYSLARNETRPELFTFRQKAQSIGFDAIHITGESTAPGDSLHGISFPHTL
                     AKDSLIPTIAYDTGLFGRTSVCLNPILSPVVLESMKPTGVTLREAEMAVSACFLRRRK
                     RFGIFGQQLSHTLSPAMHNAAYAACGLPYTYGIAERERLSDIREILDDESYGGVAVSL
                     PYKTEVLPYLDEISPEALDINAVNTVVLHQECQPNGVRKTIRKGYNTDYLGIKDCIYK
                     HLSPANAIRDGSTALIIGAGGMAHAAIYACYQLGVRRICVYNRTLSNARRLVDYYREW
                     VKSKDKAPLELTILSSADDPWPAHLRQPTVIVSCIPGQKCDIESSSALNIPDHWLQSR
                     TGGVFVEVAYDPLETRLIRSMRQHVSRGWIIVDGLSVLVEQGIAQYELFTTRPAPVHV
                     MRRAIQQSILERTV"
     exon            1098829..1099019
                     /number=1
     exon            1099553..1101602
                     /number=2
     exon            1101651..1101848
                     /number=3
     CDS             complement(1103047..1104069)
                     /codon_start=1
                     /locus_tag="AO090103000431"
                     /note="shikimate 5-dehydrogenase"
                     /old_locus_tag="AO070333000204"
                     /protein_id="BAE65860.1"
                     /transl_table=1
                     /translation="MSEHTLDTEALLRDSYKYGTSFFSPVSQKDTQTLKTYLLGSPLR
                     NSLAPLLHNTLFSLAGAACTYEAIETDNSEKLLELLVKPDSLGTAVTMPLKVRSMDMV
                     DAVTDEARSIGAINTVFIRRGDNGRSRLIGTNTDCIGVKESFLQNVDAKDLAFGSSQP
                     GLIIGGGGACRSAVYALHFVLGVKTIYLVNRLKEEIDDIIESFRRVPDFKAKLQFVDT
                     VESAAELSRPYLVVGTVPDRDPETEAEILAKRIVDTLMGCDAGGMQKSQGVVLEMCYH
                     PRVQTSFYQFAERNGWRVISGTEAMIWQGVAQHILWTEKGEVFEKESTLSTIRAKIRD
                     ALMRRN"
     exon            complement(1103047..1104069)
                     /number=1
     CDS             complement(1105041..1105901)
                     /codon_start=1
                     /locus_tag="AO090103000432"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000205"
                     /protein_id="BAE65861.1"
                     /transl_table=1
                     /translation="MARIANLTGHQADAHRYADLSHDIRNAFNTAFWNDSNHRYTDAG
                     NNDTSNATQTAQELALDSGLVPEKHRQQVLNALVELTYDYPSRDGVGPHLSGGQIGLG
                     PIVRALSAGGRDDVLWDALQQNDRPSYGYFVAPTVANPNGFTTIGEQWDHSDSKNHMI
                     LAQIDEWFHAGVVGIQPVALTTLSSTWENRLIFQPKLVGDLTSASGTYQMLQGEARCE
                     WQRTAEGNFHLTVNVPANAEAEVRLPSVGKVNASRRARFVRVDSDYTIYAVPAGTHVF
                     NNETAHAVGG"
     exon            complement(1105041..1105901)
                     /number=1
     CDS             join(1110194..1110264,1110296..1110338,1110407..1110545,
                     1110590..1110999,1111016..1111774)
                     /codon_start=1
                     /locus_tag="AO090103000433"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070333000206"
                     /protein_id="BAE65862.1"
                     /transl_table=1
                     /translation="MDVSSDLPGPGQLTLSMLALFMGMSQLFHASRMISTVLVFKYFH
                     LKWSYLLSLFIFELGSLICAVAPDSATLITGHAIAGIGTAARALASFHGCHGVSYALA
                     SFIGPLLGGAFNERISWRWCFHINLPIGGVAALIISLFFWTLNAAKPMAAPLRERIIQ
                     LDPIGCALIMGGVVCYLLALKWGGLQKSWSNSSVIGTLIGFILLFAAFGINEWCFGEY
                     ASIKRRILVNSTVVFFNLSGFFVPIYYLPIYFRSIKGTSPITSGVYNLPLLIGGIFSM
                     IAGTLLTATQQFVPFMVVSAALSAVGGGLIYTLDQNTSTGKWVGYQIIAGSSTGFISQ
                     IPIMANTACVEMQDMSTASAMTLFFQLIGGSFSVSAAQSVFGNVLFNRIQNTVPGLSP
                     EAVIGAVAANLRTSFSAEQLPGVLTAYMDGLKGTFAVATVLLAMSAPLVLLPKWERLR
                     PEAPQSIDLEVAVEKSPIESESK"
     exon            1110194..1110264
                     /number=1
     exon            1110296..1110338
                     /number=2
     exon            1110407..1110545
                     /number=3
     exon            1110590..1110999
                     /number=4
     exon            1111016..1111774
                     /number=5
     CDS             join(1112417..1112813,1112871..1113097)
                     /codon_start=1
                     /locus_tag="AO090103000434"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000207"
                     /protein_id="BAE65863.1"
                     /transl_table=1
                     /translation="MSIEILTTASDDGNVLADIFFAAFNTDFDRRILPPTPDVRDWLT
                     AKFNRVSKAQYVSPAGSVLIKAVDTTTGDIVGFAQWKLPPIELSTPGENVDKEKQVTW
                     PKSGDTALCEKHFKAIDEKEEEFMGSTPHFSLEMLATHPKFGGRGIGSQLLGWGLEQA
                     DDERTPTFLTATVAGKPLYEKKGFQVVGSNEITEGFVQIYMVRPAKA"
     exon            1112417..1112813
                     /number=1
     exon            1112871..1113097
                     /number=2
     CDS             complement(1113738..1114766)
                     /codon_start=1
                     /locus_tag="AO090103000435"
                     /note="flavonol reductase/cinnamoyl-CoA reductase"
                     /old_locus_tag="AO070333000208"
                     /protein_id="BAE65864.1"
                     /transl_table=1
                     /translation="MASETVLITGASGFIATHIVESFLRAGYNVRGTVRSERTANRVR
                     YAFQEYKDKLSFVIVSDVVAAKAFDEAVEGVTGVIHTAAPFQTEVEDKERDLLQPAIE
                     GTINLLDSIKRNGHQVRRVIHTSSFGDILDASKGDRPGHIYTEADWNPMTYAEALSES
                     TPDVVSYCAGKTMAEHAAWDFMATENPSFDLVTICPPYVFGPVKNATTSLVNLNTSSM
                     DVYRLMSPMSKPSHAVPPTLVWAWADVRDVADAHLKAFEVPEAGGQRFLVAQGRYSYQ
                     RIADILRDKVAEVRDRVPLGKPRSGMGDVYGIDASKSENVLGLRYRPLEDSIVDAARS
                     YLKLEQAN"
     exon            complement(1113738..1114766)
                     /number=1
     CDS             complement(join(1115506..1116045,1116102..1116226,
                     1116493..1116607))
                     /codon_start=1
                     /locus_tag="AO090103000436"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000209"
                     /protein_id="BAE65865.1"
                     /transl_table=1
                     /translation="MIAPSEPVPSSNSAAALTQFFPNANFKEAFDEKVVLIVASLFDR
                     VFKTYKRIDHVVVTAGSMEAGNNWFDQKLNLESVQQPPSTKDIDVNLIGSLYVTRIAS
                     VYLRHNRGPGVDRSILLFSCAAGFKETPGVSIYQASKHGVQGLMRSLRPYFPSPYKHN
                     LRINTICPWMTETRTTLTKTVQDRWTKEGLPVSTPQEVALVSAGVLANDSLNGTSMYV
                     EGGRAWEIEANIDRLEPEWLGEEPSKTLALGQKVLNDAWAA"
     exon            complement(1115506..1116045)
                     /number=1
     exon            complement(1116102..1116226)
                     /number=2
     exon            complement(1116493..1116607)
                     /number=3
     CDS             complement(join(1117271..1117500,1117541..1117652))
                     /codon_start=1
                     /locus_tag="AO090103000437"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000210"
                     /protein_id="BAE65866.1"
                     /transl_table=1
                     /translation="MVTEGISGSADVGKAAAIRVGGFGGSDVNPVADGWKDGNLKPLD
                     SYFGTDTSGLHREQKRMVALSSPVRYSIEGDGFLFRSCPVLSCWWPEKLTEAQDRKVN
                     NVWKVWRWVVI"
     exon            complement(1117271..1117500)
                     /number=1
     exon            complement(1117541..1117652)
                     /number=2
     CDS             complement(1119383..1120084)
                     /codon_start=1
                     /locus_tag="AO090103000438"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000211"
                     /protein_id="BAE65867.1"
                     /transl_table=1
                     /translation="MASPSVCARTVRISLFSYGHANGPVVQQHREAQYHKTLAYNIRH
                     LPNPPRHLRLKATGLSRRLQKEFLQNDNVEAFLVKVQREILLVVKEGCDQLLYSTEQG
                     ETKQGPEEADKHSDSNAPSSEEVALEGAGIDIAVTICCEEGRHRSVAFVEELARRLAM
                     FKYEDGFSQHWQLIINVTHRDIGDLEDCEQSSGQNKGSNKTQAKTRQRERREKGNRYK
                     PRLGDDYDEDQVTTH"
     exon            complement(1119383..1120084)
                     /number=1
     CDS             join(1121102..1122696,1122790..1122856,1123027..1124397,
                     1124455..1124631)
                     /codon_start=1
                     /locus_tag="AO090103000439"
                     /note="2-polyprenyl-6-methoxyphenol hydroxylase and
                     related FAD-dependent oxidoreductases"
                     /old_locus_tag="AO070333000212"
                     /protein_id="BAE65868.1"
                     /transl_table=1
                     /translation="MIQKIPREESDVLPVSVIDCHKREIVPVCGPCDYVALSYVWGQT
                     AAQEAPKGDSLPHHLPRIVEDAMTVVRELGLQYLWVDRYCLDQSKKAEFQAQLNQMAD
                     IYRHALITIIGAAGSDGDYGLPGVSSRHRIKQPRIKIGDYTLWYSMTDPRKLVRESAW
                     MTRAWTYQEGVFSWNWIAFTDEQVFFQRSNTEQTNLERWWKTSCEMFPDGGLGADANC
                     PLLNMYDKVWQNEGAIHQLLAQYTARKLTYQSDAINGTLGLLKRCGNGPYRMNHYFGI
                     PILGPLVIHRKAMGRDPSRRWPLMEAFLVNLCWKTKGPGPRRAEFPSWSWAGWQAVYE
                     GSAQPLAHIGLTGRSLTKVKLSVKMKQVLVDWEAMCNMIHWDLYGDLKSLPPELYIQA
                     PTVPLTVCQGLKESEDNFAGHAAHLAPMSWCAVLNDNEYQILIEIDLVDEEVASTLQT
                     KDSLLLKGIILRHLDPHAALEYNYYDNQVWAFALVVLEDKGGTRRVGSLELRPDNYLV
                     RWKYSVDHSSAKSGKCWVRGLLKEVSADVEIPPSSGASSGPNTSILATSVHQPVIIVG
                     ASLVGLSAALCLSKHRVPTIVLEKHAAISKHPRAIGFTSRTLEIYRWLGIADQIPEVP
                     KDFNLMRARVESMTGKWFESTSWSDTGNSNKRSSQEVPAPKKQYSPSRGAALPQDQLE
                     AILQVTAIDRGVDIRRQHWVKNVMQNQASVIVTVVDPQGKEIQIEGSYLIAADGSRST
                     IRELLQIPRNGRGHMQTMRSVLFRAPLEEYMQGVHQFNIDQPDLKAFMTTYNDGRWVL
                     MFHDDVERDEPTLRSAINQAIGRSDLSVDIITTGRWDLAALVADTFQSGRVFLAGDAA
                     HTLPPNRGGYGANTGIHDVDNLAWKLAAVLSGKSSPELLDTYDVERRPVALLRHDQIF
                     ARADYKVHLDKATPAGKKLDDDAMEFGQLYLSNGFIGVDNNLPRALKPDEWAGQPGTH
                     VPHFWVIQDGTPFSILDRVGEDSWTLLSESAEWGNVVAQFADEGSFQETLGVSATGAS
                     LLRPDGYIAWRTKEMPANPAKCLDDVVTQVAFRVNSRQN"
     exon            1121102..1122696
                     /number=1
     exon            1122790..1122856
                     /number=2
     exon            1123027..1124397
                     /number=3
     exon            1124455..1124631
                     /number=4
     CDS             complement(join(1124943..1125409,1125473..1125659))
                     /codon_start=1
                     /locus_tag="AO090103000440"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000213"
                     /protein_id="BAE65869.1"
                     /transl_table=1
                     /translation="MTARPLVFYVIQRRLDAEARGSATEDWKDGLSQNTVAVIDSCIT
                     AARATTVIMDAAAKHNLVATYGYLDGEYIFSAALLLVMVNAAFPHNETNARAMETALS
                     LLRGMADRGNTYLGSRHSLLLELQSAIGPNRTRGEDAVLKAPVTPDSTQQPTPSTNVV
                     EEQPPAVSPWPLEQDLPTMRDITFNFDINDDPGLWEEVLHQIDIDMDTDWIENTLRK"
     exon            complement(1124943..1125409)
                     /number=1
     exon            complement(1125473..1125659)
                     /number=2
     CDS             join(1128173..1128448,1128502..1129522,1129570..1129610)
                     /codon_start=1
                     /locus_tag="AO090103000442"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000215"
                     /protein_id="BAE65870.1"
                     /transl_table=1
                     /translation="MVVCVITVLILGFLASVRALCNYTRLSTVPGPLFTGLSDLWRTY
                     ARSTSDYGCSLAGLHMKYGKVVRLGPRSISVSDPTAIFPVYNGRPSERPIFEHGDRIV
                     FTQGSFTKSADIESSLMSKVDRRRSLDSAMRYEGIIDQAANNLITSLRQRPLVRLTTL
                     LQGFATEFINRLVLEESATQVMPFSAQGASCHWYNRTGKWLKLPMIEYVLLRSPAARL
                     KRRRGISFVPRKVQGGINGSQSSRAMNDGGISYNISLPRSYSNADGAYACIAMAFVST
                     FSSLLKHENVMTRLRSEIDTAFSKGLLSDPPRWQELGKLRYLDAVIKESMRQLPSLGY
                     NREVVTPPEGAIVAGYYIPPGTMMELHSEALRDDPGIYGEDVHTYRPARWLTADLRQR
                     WAMNQNLQQLSTSINDCPKVRVTWLELKKIVVLILLKFNVAAARTSWRRTNSQ"
     exon            1128173..1128448
                     /number=1
     exon            1128502..1129522
                     /number=2
     exon            1129570..1129610
                     /number=3
     CDS             join(1130277..1132799,1132856..1134175)
                     /codon_start=1
                     /locus_tag="AO090103000443"
                     /note="oxoprolinase"
                     /old_locus_tag="AO070333000216"
                     /protein_id="BAE65871.1"
                     /transl_table=1
                     /translation="MAGDGKITISIDRGGTFTDVHAIVPGKPDIILKLLSVDPAHYQD
                     APTEGVRQILELVTGEPHPRGQPLKLDRIGSLRMGTTVATNALLERKGARSVLLTTKG
                     FRDLLKIGDQSRPNIFDLSMARPGVLPEGVVEVNERIVPCHPSADKDCFSGARIVEGV
                     TGEKFRVVQELNLEEVRSELQRYKEQGYQSLSVALVHSFAYPEHERQIGELAESMGFS
                     VTLSSKLQPMIKIVPRGMSAAADAYLTPVIKTYIDSISSSFEGGLERQRECRFEFMQS
                     DGGLVDFRRFSGLKAILSGPAAGVVGFAATSWDPTEKTPVIGFDMGGTSTDVSRFDGH
                     LEHVFGSKVAGVLIQSPQLDINTVAAGGGSILSYRNGLFYVGPESASAHPGPACYRKG
                     GPLTVTDANLFLGRLLPEYFPHIFGPNEDQPLDIEVTTKLFNELTQKINAERKEKGQP
                     EYAPEEVALGFLKVADESMARPIRNLTQARGFETASHHLACFGGAGGQHACSVAASLG
                     ISRIIIHKYSSVLSAYGLALAEVVKESQEPVSADFETSQSSLEKRFNDMTDSATAEMS
                     TQGFSADQVRHELYLNMRYEGSDTSLMILKPEDDSGFLEQFKTRHRREFNFNSDRAVL
                     VDDIRVRTIASSNVRTEKSPLVQLREASLQDVSGTPDNTTKAYFDGYSSRIDTPVYLL
                     DKLQKNARVHGPAVIIDKTQTIVVAPNSIAKILDTCIVIDLKEEQTTVNGVPSELSSE
                     IDPIRLSIFGHRFMSIAEQMGRTLQKTSVSTNIKERLDFSCALFSPDGGLVANAPHVP
                     VHLGSMQFAVRYQHQKWLGNLRDGDVLVANHPSCGGTHLPDITVITPVFDKPGGSEIM
                     FYVASRGHHADIGGILPGSMPPKSTELWQEGAAIEGEKIVSNGVFEEERIIDLLVNKP
                     AEHPGCSGSRCISDNLSDLKAQIAANTRGIALIQSLFAEYGVETVQKYMYAIQATAET
                     AVRNLLKDLYKRFNGEPLEAVDYMDDGTPIRLKVTINESDGSAVFDFSGTGPEVYGGW
                     NAPIAITHSAIIYCLRAMIASDVPLNQGCLAPIDIQVPSHSILSPTKTAAVVGGNVVT
                     SQRITDVVLKAFRACAASQGCCNNLTFGTNSKVDPDTGATIPGFGYYETIAGGSGAGP
                     TWKGESGIHVHMTNTRITDPEILEKRYPTLLRQFTLRSGSGGKGLHPGGDGVIRDIEF
                     LAPMECSILSERRVHRPYGLEGGEDAQSGLNLWISKDEETGEERIVNIGGKNTVSMKT
                     HDRIVINTAGGGGWGAAQ"
     exon            1130277..1132799
                     /number=1
     exon            1132856..1134175
                     /number=2
     CDS             complement(join(1134610..1136101,1136155..1136348,
                     1136430..1136640,1136706..1136809))
                     /codon_start=1
                     /locus_tag="AO090103000444"
                     /note="5' nucleotidase"
                     /old_locus_tag="AO070333000217"
                     /protein_id="BAE65872.1"
                     /transl_table=1
                     /translation="MSAVETDGLTITHSSERTGTPDLRLIHYNDVYHVEPGSAEPVGG
                     VSRFQSVINHYRSDPRFAGQPDVLTFFSGDAFNPSLESTVTKGRHMVPFLNKAGTDVA
                     CVGNHDLDFGVAQLRHLRSQCQFPWLLANILDPALGEDVPIANCERTRMLTSSNGLKV
                     GVIGLGEREWLGTINSLPPDLIYKSAAQTALDLVPRLREQGADIIVAVTHQREPNDYK
                     LAERLPPGFIDIILGGHDHYYAHAIVNGIQVLRSGTDFKQLSYIEAWRKADGPGWDFN
                     IIRRDIVRSIPEDPATVALVAKLTSSLKSKLEKPIGYTVRPLDARFSTVRQRESNLGN
                     FVCDLMRFYYAADCAMMAGGTIRGDQIYPPGILRLKDILNCFPFEDPIVLLRAQGRAL
                     MDALENGVSQLPALEGRFPQVSNITFSYNASAPPGSRINWAKIGGHPIEYDRTYSLAT
                     RGYMGRGKDGFASLLVQSAGGEVEEVVDEESGILVSTLLRQYFLSLKVMGRWQRWSKS
                     LARHWDTVHQNLHCNGWLKPASGQTSPVTEKAPVRPQRPTLQRSKQYYQYGRFTEIDT
                     EESPEKEAQSHEDMDSDSDSDPEILTSPQPTTNYVTLPAQSAAEEERRLRLARRVVRK
                     WMQKAGFQPTTLNGTDDAGFTPTWTPGISPRLEGRIVIEDTR"
     exon            complement(1134610..1136101)
                     /number=1
     exon            complement(1136155..1136348)
                     /number=2
     exon            complement(1136430..1136640)
                     /number=3
     exon            complement(1136706..1136809)
                     /number=4
     CDS             complement(join(1137707..1138976,1140759..1140871))
                     /codon_start=1
                     /locus_tag="AO090103000445"
                     /note="phosphatidylserine decarboxylase"
                     /old_locus_tag="AO070333000218"
                     /protein_id="BAE65873.1"
                     /transl_table=1
                     /translation="MDHAKPSYLRQQGERIDLPWDDQFVDEIKVALMACRVIPGLWLP
                     KDYHIQQEWTKKIARDTIANPKPLHPAVQDLKDLIEGDSRIYLLANGMYDDIPANFTD
                     PSGQPVVRSYTDMLSIMNHLLTIAPSWSEHENQVGLVGLPMHALLDWPMGTFHGHGFF
                     LDPAVNAILKRVLDVWKDYLQSPASAEVLNNSTTGWFSPAAIKQLTAVANVDGSSYSF
                     NELFVCDPSEKHYNFTSWDGFFTRAFRSERRPVAEPHNDSVIANVCESLPFAIAHNVK
                     RRDRFWVKGQPYSVEDMLGKDELSEHFVGGTIYQAYLSSLSYHRWHAPVTGTIVKVAK
                     FNGTYFSEPLFASMEIYGAWPKAPRYSQGYLSAVAARAVIYIQADNPAIGLMAVVEVG
                     MSEVSSCEVTVKEGQRVVKGDEMGMFHFGGSTHCLLFGKGVKVSGFPEPGSRTDNVPV
                     RSRLAVVEEL"
     exon            complement(1137707..1138976)
                     /number=1
     exon            complement(1140759..1140871)
                     /number=2
     CDS             complement(join(1141392..1141542,1141614..1141738,
                     1141814..1141869,1141920..1142092,1142153..1142181))
                     /codon_start=1
                     /locus_tag="AO090103000446"
                     /note="H+/oligopeptide symporter"
                     /old_locus_tag="AO070333000219"
                     /protein_id="BAE65874.1"
                     /transl_table=1
                     /translation="MKEPTEEQIITPGDNENAPSTNEQVGPTREELETLPRIADKIPY
                     TIFMVVIAEAAERFTFRSITGPLQNYVQNPLHDDRLPGALGKGQATATAIGYFFQCWC
                     FLMPILGAVIADCYLGRVKTILLGSITATIGTLILFLTSLPVSLENGAGWPGLLVALI
                     IIGLGYVKYTTRAVNNT"
     exon            complement(1141392..1141542)
                     /number=1
     exon            complement(1141614..1141738)
                     /number=2
     exon            complement(1141814..1141869)
                     /number=3
     exon            complement(1141920..1142092)
                     /number=4
     exon            complement(1142153..1142181)
                     /number=5
     CDS             1142891..1144486
                     /codon_start=1
                     /locus_tag="AO090103000447"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000220"
                     /protein_id="BAE65875.1"
                     /transl_table=1
                     /translation="METKHPRPRPPMEDIVSPTLEDLIHLALRRMRYLVAPDLDNNHP
                     PPLLFPLAESMRGNPFTVDDWDTYGNLESEYGRLTYLISVYPERGAPFACEEVLLDLL
                     QRPSLLTEWPNFLPTLIAHAQATVHGVVQRMVSSSSNRTRSAKSDYVAIPVDYKATSS
                     ARTIALQLWKRSLGEMASQLGRGHFDGALAFLQIHAFLKDPIYGLSRPFSLQQFFFSH
                     LLGKCMAATRVDILHAKDLERLAAQAAQEASYLANPLLQRLTLVHFNAHHQLPYVNVP
                     LDRLARAEFSVPMHVLEVVEEMLGAVAMSDGQACPLVPILVATYPRYAHDDQWLIPII
                     DGNHRATATLLLRFLATLTLPVDRQAMLEGLRGYCTAHHLGRKWQIDLCDVVTELHSP
                     TNRKMYDQITSQAALVRKFAWVRYIPALVVQEDDFYTICKQRSAGKHKPVLLHPYHQA
                     LFNDDDIPIALPQKAGQTHGRPEPFRLMSLTPFGGEHSGGVDVGVARICQAKVRPSMN
                     GLAQEPQPHEKVQQHRAWSCVVS"
     exon            1142891..1144486
                     /number=1
     CDS             1145141..1146424
                     /codon_start=1
                     /locus_tag="AO090103000448"
                     /note="selenocysteine lyase"
                     /old_locus_tag="AO070333000221"
                     /protein_id="BAE65876.1"
                     /transl_table=1
                     /translation="MTALDDLDLLPEDFPQPSPFMSEWPLRRDVVHMDHGSSGACPTK
                     VLEHQNALRWELDRGSPEFFLSRWSPRHRAAKEALARFVHANYDELLLTPGSTLGLNI
                     VTQSQQFQPGDELLTTNHAYSSVTMLLRHVANRDGAKVVIAQVPFPVASEEEIVQSIL
                     ACVTERTRFAIIDHIVSRSGLVFPIKRIVQELADRGVDTLVDGAHGPGQVPVDLHDIG
                     AAYYTTSCHKWMCAPRGVGFLYARRDRIRRLKPLIIARSGHWRDSDGAAYSWLEHTFE
                     WNGCHDPSGVHSMPKIIEFLETALPGGHAAMVKRNHELAVDARRKVLGILGIDLPCPD
                     DMIANMVVFPLPDSVLPETQGILPLCKTLWENDRAEIQCYHWPAYPKRIFRFSVQLHN
                     SMEQYVWLAGKIKAALDEETRIAQAHAAEVNGLGT"
     exon            1145141..1146424
                     /number=1
     CDS             complement(join(1147536..1147673,1147732..1148199))
                     /codon_start=1
                     /locus_tag="AO090103000449"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000222"
                     /protein_id="BAE65877.1"
                     /transl_table=1
                     /translation="MDSLQNHTAIPNPTVFPLDILSGFHYTFLIRNPRQSIPSLYQCS
                     IPPKSHITGWNGFKATDAGYAELRILFDYLVQVQIIGPGTGNDICIVDADDLLADPEG
                     IVEEYCCSVGIPYDPRSLHWGAEKDQQRARDIFQNWIPFHDAALKSTSLNPQPPRVTT
                     LEDDIAEWTEKFGAEAAMLIHQNVEDNMEDYLYLKQFAIKT"
     exon            complement(1147536..1147673)
                     /number=1
     exon            complement(1147732..1148199)
                     /number=2
     CDS             join(1149705..1149952,1150000..1150066,1150117..1150576,
                     1150616..1150758)
                     /codon_start=1
                     /locus_tag="AO090103000450"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000223"
                     /protein_id="BAE65878.1"
                     /transl_table=1
                     /translation="MDKTDIAHLEVLSFAKLASKDQTELNKLLDACRKQGFFYLDLAG
                     SNVSHGLHQRLKALSLMKDWFDRPNEEKMKLHKDSVTNGYKPPGTLSGVVKHMKDGFE
                     NIKLPRDNFLGTGDSLPEVFKNDKEVFRDDLEISHGVTLTILSCLSDLLQPPVRLEDY
                     HQENMSSQSTMMYFRYAKQCADKSSGVGHNMHTDLGTLTLLYCEQWGLQVYAQATNSW
                     KYVQPRPGLYVVNVGDALRFLSGNDLLSALHRVVPVPGHERNETEFRTSENTVVSALN
                     WHDQKYNVFKAAHVEQEKNTILTGGIGAF"
     exon            1149705..1149952
                     /number=1
     exon            1150000..1150066
                     /number=2
     exon            1150117..1150576
                     /number=3
     exon            1150616..1150758
                     /number=4
     CDS             complement(join(1151311..1153156,1153280..1153314))
                     /codon_start=1
                     /locus_tag="AO090103000451"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000224"
                     /protein_id="BAE65879.1"
                     /transl_table=1
                     /translation="MGKAPAAIVIARHGARLDAADKNWHLTSPTPYDPPLSYGGWLQS
                     RALGARIGNVLKSLDNDILPEQTDGETLPSFRPHPSKRKRRIVIHSSPYLRCLQTSIA
                     VGSGISQHYPDSTGPGPGWSQPNGFLSAPVMSPAQEPTTGAITSAPAAPGDQRSLLRV
                     DAFLGEWLCPDYFEEITPPPKSERLIAAAKAELLRRDSIVPEADTKPATGFFPGGWGS
                     LGNKPLSPPIEEEDRKVYSVYTSNERREGQRNRAGSCDTLRSADTPRTRRLLSKINTN
                     LPPIPDGAYMPPTPSYAISPSDPIPTGYVTHARDACVRIDYPWDSMRDPPNWGNGGEY
                     GEEWSTMHTRFHTGLERMVRWYQEHDASLPSGRRRRHSQLSVSESAEESKIPDDEDEP
                     TDTILVIVTHGAGCNALIGAITGEPALVDINTASLTLAVPKDRVAVTEKADTIGGPVA
                     PYRPGNDQVELRDYKLQLVASTDHLRPVTNLSTSVLSSPSSLSSPSSAYRPRFSTRPS
                     LPQGGFVIGPSAVSGPGTGSWTFSRPSTAPRGPSGLWGSNSISAGDTADDIIPNFGDP
                     WSGSNGTSNNDHHSGKKSEESSDWTPQLPQRTLSQRGLWGSRPSKEPHVKRRWTVTER
                     RV"
     exon            complement(1151311..1153156)
                     /number=1
     exon            complement(1153280..1153314)
                     /number=2
     CDS             join(1154826..1156111,1156167..1156458)
                     /codon_start=1
                     /locus_tag="AO090103000452"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070333000225"
                     /protein_id="BAE65880.1"
                     /transl_table=1
                     /translation="MESDMYDATPSPSASRSDVSRNELNGKLPDDPNDDPEALTRTDT
                     TLSAVVPPKELWREILFVVVVCMAQFMTQAGLCISIAPVYIIGRSFQTSTPGELSWFA
                     AAYSLTVGTFILVCGRLGDVLGHRLMFIIGFAWFGLWSLLAGFSVWSNQVFFDCCRAL
                     QGMGPAMLLPNAIAILGRAYPPGLRKEMIFSFFGATAPSGFIIGGVFSSILAQMTWWP
                     WAYWVQGMVCFAFAVLGVLVIPHTSRPHFQKDLPIWVRLDLLGAAAGIIALVLINFAW
                     NQAALVGWATPYTYVLLIVGFIIFGGFLWIERIAQCPLLPSAVFTGDLAWVLGCIAAG
                     WSSFGIIIYYFYQFMEEIKGNSPLLATAKWVAAAPSGAIAALLTGFLLGRLPPSVIMF
                     CAMVFFTAGLSVFATVPVDQTYWAQAFVASLITSWGMDMSFPSGTLILSNSMPHHHQG
                     LAASLVTTTVNYSISLGLGFAGTVESNVNDGGRNVLRGYRGALYLGIGFAGLGLVVSI
                     LFMFVSWRRSQVSHKSG"
     exon            1154826..1156111
                     /number=1
     exon            1156167..1156458
                     /number=2
     CDS             1156670..1158226
                     /codon_start=1
                     /locus_tag="AO090103000453"
                     /note="FAD/FMN-containing dehydrogenases"
                     /old_locus_tag="AO070333000226"
                     /protein_id="BAE65881.1"
                     /transl_table=1
                     /translation="MEAHNIAVATIAAQVHQFHKNQQPFRIYHGSTNSTRQSQHSAAN
                     TINTANLNHVLAVDTDRKTVLVEPNVPMDELVKATLPHGLIPLVVMEFPGITAGGGFS
                     GTSGESSSFRHGFFDATVNRIELVLANGDIRTASQKAPDEKELFWAAASSFGTLGVVT
                     MLEIQCREAKPYVELTYHSTSSMSQAMTVFREATASPKTEYLDGIIYAPDHIVVCAGR
                     LVDLPSNQTPIQRFVRAQDPWFYIHAQRQTRKIHRPNAEPPASVTYYAPIQDYLFRYD
                     RGAFWTGRYAFSYFVTPFNRITRYILDTFMHTRVMYHALHESGLSKQHIIQDVAVPYK
                     ATGEFLTWLDNKETFGAYPIWLCPLHHSQGIMARGAEAGPHQSQKEEDPEDDGDCLMN
                     FGLWAPSPHASDTGAFIAQNRRLEHKVRELGGKKWLYAHAYYTEEFWSIYDRKRYDAL
                     REKYHAAHLPDLYQKVRVNLSPKSDGATEGWIGWAKRMAWETWPVCGLYGVYKAWRGG
                     DYYLIKSKKD"
     exon            1156670..1158226
                     /number=1
     CDS             complement(1158428..1159414)
                     /codon_start=1
                     /locus_tag="AO090103000454"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000227"
                     /protein_id="BAE65882.1"
                     /transl_table=1
                     /translation="MGRFPSLELLQRPESEGLADKFVPICRLIVRGDYIAFREHLALD
                     SPATEWFAQKGILLALRNRCEIIVWRALARKVFIHGGFHGEPQGSAQRGPPPFLYLHK
                     LETAVRWLQSQHAQSLHGSLGFDPSGQNRDAQAGQNEFGSQLVYKLPDHDFAGVDEVD
                     GPESKPDPELLSKYEDFLTPDGCFDDMGQWQSNPPGVLVDGQPDADYSQYELDPYTHR
                     VELDSETEQGKPTPMMRELESILASLLTQGLMRGYLTHKNPRFAIPGARLRGALPTGF
                     PNVWQTISARESEDDRVPGWVQPPPPVAGGSLAAAGGGRVVNLSGARPVGVQ"
     exon            complement(1158428..1159414)
                     /number=1
     CDS             complement(join(1159594..1160020,1160189..1160526))
                     /codon_start=1
                     /locus_tag="AO090103000455"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000228"
                     /protein_id="BAE65883.1"
                     /transl_table=1
                     /translation="MAMQGAPVLDKFLSGISEIIGNRDGSKLQDFLQIEPPLSDIYRQ
                     MVEELRQQYPNGPKEADLLRRCEGLVPRTRNGSSWTAFPTFMKLYFTFLRDVNVDNLL
                     ETYNLLKGLVNQYGVIVLPTVLYLSKVLAKLAMGLDRRPELIAHLLRMEGRSDQDESI
                     EKVTLVEKSANVVREAFIKCLTDRSGTPGVHGKPEGKRVGIYLMANLCLKLLFQVRSR
                     LRPLRPLLGTDADDSSAGNSEMQNRCFLVSAPSPRR"
     exon            complement(1159594..1160020)
                     /number=1
     exon            complement(1160189..1160526)
                     /number=2
     CDS             join(1161614..1161904,1161960..1163225)
                     /codon_start=1
                     /locus_tag="AO090103000456"
                     /note="flavin-containing monooxygenase"
                     /old_locus_tag="AO070333000229"
                     /protein_id="BAE65884.1"
                     /transl_table=1
                     /translation="MVQPGTSQSSWVDFIKHPFVGTFTFFYLLFQAVLNWFFAPAPPP
                     PASLVNGLPKKRVAVIGAGLTGVSAAAHCVGHGFDVQIFEARSKAKGLGGIWSRVNST
                     SSLQIHSIMYRFHPSVKYDNAYPTQGEIREQIVDVWKRYGLQKHTAFETPVTSVKQAK
                     DGKWIINDDEEKYGRFDGVVASVGVCGDPKMPPLPDQEQFKGNIYHSSELDGKDVEGK
                     KVLIIGGGASAIEALEFAVQSKAAEIDVLSRSDKWIIPRNVLVQSLLALNIFGMETSF
                     SWIPEWFLHKFFYRDLQDIAPSGGLFTTTPMANSELFDKIREGKARWLRGDIVSVKEN
                     GILFNRRARKVPKGGPGHESVVTGDVIIMATGFKRPSLSFLPDDAFEEPYTPPSWYLQ
                     VFPPKYPEICANNSTYVDAIGTVGNMHIGIYTRFLLMFLTDPLTQPTEGRMKTWIDFT
                     RFVKQHSPTNAFDFFTYSELIYWFVFVILVNPFRWKWAPFVLFGVGRALPMGVVRQEE
                     SFRKQLKQQR"
     exon            1161614..1161904
                     /number=1
     exon            1161960..1163225
                     /number=2
     CDS             1169794..1170474
                     /codon_start=1
                     /locus_tag="AO090103000459"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000232"
                     /protein_id="BAE65885.1"
                     /transl_table=1
                     /translation="MGCASISGVIESRSCVMIQTSSSSPHTNTAISTGIHIAKMVYRS
                     NLNTVARRIPSLIAITSKPRVQPCVVATQGRLPKARAMTLMPQFHRGPSTIKRLLDDY
                     DRYLSGHTLDPHPRAYAPTFDMRESKDTYQLEGELPGVKQSDVDIEYVDAHTIVIKGH
                     TEHASEVEEGSWWISERSTGDFRRSFSFPSAVDQENTRARLKDGVLLVTIPKVASTWD
                     VKKVKVDE"
     exon            1169794..1170474
                     /number=1
     CDS             join(1177214..1177359,1177419..1177758,1177826..1177885,
                     1177976..1178584)
                     /codon_start=1
                     /locus_tag="AO090103000463"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000236"
                     /protein_id="BAE65886.1"
                     /transl_table=1
                     /translation="MHSSLLPMLAAMLLSPVSAAGVSGTAFGFAQGTTGGGNASPQTP
                     SSLDELKTWITDDVARVILIDREWDFTNTEGHTSGKCCSSDTTTKCPGGTSAGQAWIQ
                     DKCDDGTWVSCTYDNAAKKPLDVGSNKSIVGVGNKGVLKGKGLRLTGGANNVIIQNIH
                     ITDLNPQYVWGGDALTLDGTDNFSLIGRQMIVSGWNKGGHVTISNNEFDGVTEWSAGC
                     NGKHYWSLLLLGLEDWYTFSGNWLHDLSGRAPHMGTDHDDSKIYFHGVNNYFQDIDGH
                     AFDVDTNTWVLLEGNYFDNVKTPMTDTSLKSGAQLYTTSTVNAASGCVSPLGYICEWN
                     RNGGSTGAWPDRTDASVLTGFSNLKEHLISHTGVADVPTNVKANAGVGKL"
     exon            1177214..1177359
                     /number=1
     exon            1177419..1177758
                     /number=2
     exon            1177826..1177885
                     /number=3
     exon            1177976..1178584
                     /number=4
     tRNA            1178797..1178884
                     /locus_tag="AO090103t00012"
                     /note="tRNAscan-SE"
                     /product="tRNA-Ser"
     CDS             1179615..1180082
                     /codon_start=1
                     /locus_tag="AO090103000464"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000237"
                     /protein_id="BAE65887.1"
                     /transl_table=1
                     /translation="MKTHSVAWDLHQNNCSAGVGLDFIKVPSPTLALPLSAWASLLAT
                     WNITTHSHTDYTGYPTSLTGEMQSFANRCSYSIHFSIRNECFKDFVRRTPQSPTKIQQ
                     DWSVLWGNILPCGQKQASFDRAEAQPRWNCLGSLSSLSSHQLPSAPLSSPHDK"
     exon            1179615..1180082
                     /number=1
     CDS             join(1180170..1180281,1180347..1180870)
                     /codon_start=1
                     /locus_tag="AO090103000465"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000238"
                     /protein_id="BAE65888.1"
                     /transl_table=1
                     /translation="MSVEIAQLHSEVEALVEKFDVLSKIKEIQEAGDVRSSVPVTISV
                     TTDATISLLEDKSTIGESTEAPKSLSKGEKSSFNITQGDELKYTVTAGELTSDFKIVF
                     DVDKSAPKLKLSDELEDDNAPIGFETTKTETKTEIEIEREVEVEKEWTKGKKPERKTS
                     KETKHEAKAGAHSLQHEVETKFKQEKDKSETETETEIEISNKKVEVEYVIY"
     exon            1180170..1180281
                     /number=1
     exon            1180347..1180870
                     /number=2
     CDS             1185834..1187258
                     /codon_start=1
                     /locus_tag="AO090103000466"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000239"
                     /protein_id="BAE65889.1"
                     /transl_table=1
                     /translation="MKTSTLCTIAFSATALAVPVSVTTSDHGLADPVPAHAPEGEDHA
                     RLQSRTFFPMGGLCPPCGEEGASLKARTFLPLIEGLIQHKMDKFGLCSPCDTSTNSNE
                     NSNSNDNSNTNDNSNTNTNTNTNNNSNTNNNSNTNNNSNTVTNNINGGTPPGGTPPTG
                     GTPPTGGTPPTGGTPPTGGTPPTGGTPPSGGMPPTGGMPPTGDVPPTGGTPPTGSIPP
                     SGSNPPTGGTPPTGSTPPTGSTPPSGGTPPSGGTPPTGGTPPTGGTPPTGGTPPTGGT
                     PPTGSTPPSGGNPPIGGTPPSGGTPPTSGTPPTGSNTSCEEDDDTCTPTGGTPPTSGT
                     PPTGGMPPTGGTPPTGTNTACEEGDDSCTPTTGGTPPTGGMPPTGGMPPTSGTPPSGG
                     TPPTGGNPPTGMPPTSGTPPDGNNTGTNKGGNTSSGSSGSSSSSSSSSSSSSSSSSSS
                     SSSTTGGTPGCAECQAPPPEDCEE"
     exon            1185834..1187258
                     /number=1
     CDS             join(1188222..1188424,1188489..1188728,1188782..1189718)
                     /codon_start=1
                     /locus_tag="AO090103000467"
                     /note="adenylosuccinate lyase"
                     /old_locus_tag="AO070333000240"
                     /protein_id="BAE65890.1"
                     /transl_table=1
                     /translation="MSISALDSRIFRNLFGTEEVREIFTDEAYAKFLVQTEAALARAE
                     SKVNAIPADVGDAITSVLGNIELDFDRLSRETEIVGYPVLPLVMQLVENTPEDLAKYI
                     HWGATTQDVMDNASMLQIKRGLDLVKRDLNKLIDILQVMAEKYRDTPMAGRTHLQHAL
                     PCTFGYKCAVYLSSILRHRDRLRQIERRCLLVQFGGAAGTLASLGSDRTGILVRAQLA
                     KELELEDPMITWHVARDNIAEVLNFLALIGGTLGKIALDIIVMSSNELDEVAEPFVPH
                     RGASSTMPQKRNPISSEIILATSKLLRANASLGLDAMVVDFERASGPWHLEWVAIPES
                     FTYAVGALYQTTFALSGLCVKEESMEKNLHSTRGLIVGEAVMMGLAPFVGRQRAHDVV
                     YEACKSAIEHDRVLLDVLKENTEVSEHFNEAKLTQLCDPLSYLGSGQLMVDDVLKRVA
                     EGKAGLKAM"
     exon            1188222..1188424
                     /number=1
     exon            1188489..1188728
                     /number=2
     exon            1188782..1189718
                     /number=3
     CDS             join(1190244..1191517,1191568..1191688,1191744..1191895,
                     1192009..1192120)
                     /codon_start=1
                     /locus_tag="AO090103000468"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070333000241"
                     /protein_id="BAE65891.1"
                     /transl_table=1
                     /translation="MRPSSFMGLCGSALNLAQLLLIVCPAFILFGYNQSNLGGLVSVT
                     DFTNHFPRIDTVHTEGEQKSSNATIQGVVVATFTLGALFGCLSCSYTSDRFGRRIVIL
                     AGAILTVVGEVLEASSFQLAQLIIGRVILGAGVGMLSGTVPTWQSECSSSSNRGKHVV
                     LDGLFISIGYILQAWINLGFYQVKTGSASWRAPIAIPIFFSLLLSLAILAMPESPRWL
                     SQQGRMQEARSTLAALKGLSDDDASIIDELSAIERSLEQSGRTAASLGDMLKMGQDRL
                     LYRFCLCILLQFYQQMSGGNLISVYSTVIFQEGLRMDSETSRILSGGTLTWKLLSCFA
                     GFFAIDRFGRRFVLMVSGTGMATCMMGLAVATSFPHSNFGAQVSSVFFIFLFNFFIPI
                     GFLGANFLYCTEVAPTKLRVAMSSISTANHWLWNFAVTMITPVAINTIGYQYYIVFTC
                     IGFCIPISVYFFYPETMGRSLEEIDLIFRNSPSVFSTVRYARENPHLALEHVLEHEKG
                     EIRHEENVEESLGRSIPNLGQVIQCGLRREAMDAWVHHKTPTPE"
     exon            1190244..1191517
                     /number=1
     exon            1191568..1191688
                     /number=2
     exon            1191744..1191895
                     /number=3
     exon            1192009..1192120
                     /number=4
     CDS             join(1192241..1192269,1192636..1193582,1193692..1193844,
                     1193911..1193921)
                     /codon_start=1
                     /locus_tag="AO090103000469"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000242"
                     /protein_id="BAE65892.1"
                     /transl_table=1
                     /translation="MAERRPAQVWYIEPTEELIQQLRQELESARAQLQLFSAREKGLQ
                     ETIVSQNKEIEHLRELLTASRPGGYTQHGGERAGNGSVVAHLGRLVLGDGNSEFFAGS
                     TTGVHFVLSAQQLYQTTFSSQEHFPECLFRLHILRHKELPVALEQNISIASCLENGQL
                     TSSNIFEPLRNHLRNVGVVAVRKAFDKYQQCWGILYPVLLSKQFLDTFDATINDVWTT
                     PLEPHLRIPFLLQVYALMALDNVDSSTAATEIVPLPYHLDTILSNLLGQMPCRGDISS
                     LQGLILYLLYLQMTSQHSLAIRTCGMIVRLAQSLGLHRHTRRFKHTPGENNQASYMVY
                     PETYKQQTQIPISLPIPTMMTCIAISCRIRYLEKLPISNHFSKVE"
     exon            1192241..1192269
                     /number=1
     exon            1192636..1193582
                     /number=2
     exon            1193692..1193844
                     /number=3
     exon            1193911..1193921
                     /number=4
     CDS             join(1194119..1194518,1194566..1194738)
                     /codon_start=1
                     /locus_tag="AO090103000470"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000243"
                     /protein_id="BAE65893.1"
                     /transl_table=1
                     /translation="MLIHRPALTFGQQEPQFADSLRACKEATTHLILAFELASDASFV
                     PGIWPSGHHLIFQSGLMLLYDRWFQNPIQSPGISSEPDTLPKFIHIAITLLSRSAAYL
                     DERVGSGRPRSPSTTDTIESLRQTSSYLHYLSQWRPHGKPNTSGYSNNRRQSFISWTS
                     ATDTTSRLLFLPMGAIVYRGDQSNEDIRAY"
     exon            1194119..1194518
                     /number=1
     exon            1194566..1194738
                     /number=2
     CDS             join(1196677..1196803,1196862..1197030,1197083..1197170,
                     1197226..1197291,1197392..1197421)
                     /codon_start=1
                     /locus_tag="AO090103000471"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000244"
                     /protein_id="BAE65894.1"
                     /transl_table=1
                     /translation="MAGLFKGIHGVVQDKTGVAAGDVQEAVTAVGEIPKGILDIIAND
                     KKEPQLILHVYSYSRESRLIKEKCCLPFKNVKDEEMQLTDIRKLLIGENILEPRLVWS
                     SFCNQRGAVVQDITNFKAYLQILNEKSSEVAVSSTIPLIRISAMCSWLRSKGHYRRM"
     exon            1196677..1196803
                     /number=1
     exon            1196862..1197030
                     /number=2
     exon            1197083..1197170
                     /number=3
     exon            1197226..1197291
                     /number=4
     exon            1197392..1197421
                     /number=5
     CDS             join(1197637..1197751,1197884..1198073,1198128..1198278)
                     /codon_start=1
                     /locus_tag="AO090103000472"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000245"
                     /protein_id="BAE65895.1"
                     /transl_table=1
                     /translation="MSEKQWSVVIRNNSLLNPYRVVDLGSKGGKFVERSIHSARRYVH
                     SLKLSYTNNLLTGIQQLLRIPFFRIEDDSYVEQFEETKSVSRAVAASSMSQFDASLAI
                     EGGAFGFSASASASYGDTSSSSDSSSSNEENKVMNITYNVSITFDHQCT"
     exon            1197637..1197751
                     /number=1
     exon            1197884..1198073
                     /number=2
     exon            1198128..1198278
                     /number=3
     CDS             1199277..1199804
                     /codon_start=1
                     /locus_tag="AO090103000474"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000247"
                     /protein_id="BAE65896.1"
                     /transl_table=1
                     /translation="MPLNYSLRTRRTPHLKSSTLMSNPLMIPQRLRQVLAPIYFYVGS
                     RRIGLADCIGSQLKYNYPYKIYGKDGNEDKLWLFSNQTMPGFMSTAFVWAAKEKGATS
                     FRFLLPSNLDNSPSRDIEDGEEASVQLFDKHDHEINLATRFDRRGDKVGTVVDLDDFA
                     KLANELDTTWEVHYL"
     exon            1199277..1199804
                     /number=1
     CDS             1202635..1203195
                     /codon_start=1
                     /locus_tag="AO090103000477"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000250"
                     /protein_id="BAE65897.1"
                     /transl_table=1
                     /translation="MTLPIKPQTWTKDAFIISTDKTLLSVSAINTAFDNDFMYWTKSY
                     PENILKQIIDGSFCFGVYKAKQNITGQNGDSNSIPSHGPTKLIEGVDQIGFARLITDN
                     VTFAYLTDLYILPEYQGHGLGGWLIDCVDEVLRPLPHLRWFMLRTSAEKSKQAYEKRL
                     GMHVLDTSCVSEGGIMMGRKGKANMA"
     exon            1202635..1203195
                     /number=1
     CDS             1204211..1206154
                     /codon_start=1
                     /locus_tag="AO090103000478"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000251"
                     /protein_id="BAE65898.1"
                     /transl_table=1
                     /translation="MRWLISTIWALAVGSSFATARKAMHFAMEQNLDMLPRTHSARGL
                     PAPGKKGVMLMNRIGPSSSELYVANIDGSNERKLLGNNSRFDYHASFSPDGQWITFTS
                     ERNGDGNSDLYRCRADGSGLEKLVATSSVEDAGVLSPDASKVAWVSTANGYTTNVWVM
                     DLKTGEQRNLTSLEGVKGDPTKPNGYFRPSWSPDGEWIAFSSDRNTEWRGHGNGTGWE
                     HTQELSVYVIRPDGTDFRKIASREGWSLGSPRWSPDGSRIIFYEITTENTWDAHRPES
                     VASATSQIVSVDFATGLDRIQHTNGTGVKVSPQYVTADNIGYLIKGGSSEGIHYTAES
                     STGTVINGTMRSPSWSPDGKSVVYEKSEFEARPMEKKLYSWDPEWEYRFTDVFPDLSQ
                     QGRLAITQKQLGNSSIVTMRPDGLDQKLVFDPLTQSNISSSEVGQGLAGAFQPSWSPD
                     GEWIAFGIGAWFQSRATGKGYIARAKADGSYHEILTNGTINAGFPSYSLDGRYLVYRV
                     WGTEFGLRIMDLTDKSVRVLTTTRDNLPFYSPDGQRIVFTRRTSYTNFDVCTIRPDGS
                     DLKVLTSSGANDAHATWTADGRILYASGMYGFRDEAAIYDNTFQPYGQIFVMNADGSN
                     KTILTDSIWEDSMALYLPNEVLE"
     exon            1204211..1206154
                     /number=1
     CDS             complement(1206598..1208979)
                     /codon_start=1
                     /locus_tag="AO090103000479"
                     /note="sexual differentiation process protein ISP4"
                     /old_locus_tag="AO070333000252"
                     /protein_id="BAE65899.1"
                     /transl_table=1
                     /translation="MVLSAVSRKFSRATEDPLDTPSPVTDNDSDRISNVDKKLASVDE
                     RSSSDEEHVKKPSETYAIEQETEEDPEIAALPREVRQLVSLTDDPTLPTITFRYFLLS
                     IIFIVPGAFLSQMSHFRTTQAPYSIFFVQIATHYVGNFFARVFPAWEIRVPFTKWSFN
                     LNPAPWSAKEHVLVTLTAASGATYNLGYTPIALAELFYGEKLNPAVAIFFMFAIVWVG
                     YAFAAIARQLLLYDPTYVWPQALMQTTLFETFRKQDVSSPLARRQLKIFFLSLVGMTL
                     WQFLPEYVFPFTSSLAFLCWVAPHNPVANFIGSGLGGMGFLNLTFDWSNINWNGSSIL
                     LTPWWTQVILFLAYVVSCWVLLPAAKWGNLGSYKHGLMSNSLFMANGTKYPVLDVLTP
                     DFRLNQTAYEEHGLMYMGLHNAWATFFDYAKVTAAVTWIATFGFYQVKSNLKKAIASR
                     RKSEKAKGQNINYQYHDRLNVLQRQYKEVPLWWYVALFMAGFIILLVATACGYLWIPV
                     WTLFVGLATAGVFVLPFGWLYAISNYQLAVGTFNEMLYGYMVHTKAGASHRHPCGPST
                     YGAIAGDAWYRAQYMLQDQKIGHYMHIPPRTVFFSQIFGTVLGIPVNYGVIRWVLNTK
                     GNILKGVEKDPLNQWTGQSIIGSNTLGVQYAVIGPQKMFENPELRILPYSFLVGAVIP
                     PILYILHRCFPRLRVDLWNVTIFFSGLSVFYGNISTGYTSAIIGGYVVMYWAYRRRFE
                     TWKRYSYMVAAAFDAGFNLNMLLIFLFFGSGKQIKMPNWWGNNADSVERCFAL"
     exon            complement(1206598..1208979)
                     /number=1
     CDS             complement(join(1211083..1211258,1211310..1211847,
                     1212045..1212740,1212793..1212869,1212950..1213334))
                     /codon_start=1
                     /locus_tag="AO090103000481"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070333000254"
                     /protein_id="BAE65900.1"
                     /transl_table=1
                     /translation="MKDELGPDAGHQKKSDGMDEVSPTAEHSEKPRRSSIYDIEGRPA
                     NKLSAVFKNPLEGIPRQQLMEDVDRFCAQYGLETHKELFRKGALISQNPQDAHNMPEL
                     TEDERAAIRREHTHKWSQPWQLYFMASMCSLAAAVQGMDETVNNGAQAIYLKELTIKS
                     EYITGLVVGAPYLACAVIGCWLTEPMNRYLARRGTIWVSCFIAAVASVWEGVCNSWVN
                     LFIARFVLGLGIGSKSSTVPVYAAECSPAPIRGALVMMWQMWTAFGIMLGNIMGVAFM
                     GLPDNLSWRLMLGSTVVLPLIVCAQVYLCPESPRWLIEHNKINKAYEAFRILRPSDLQ
                     AARDLYYAYVGVQLEREVNKGKNFFTMFLELFTIPRNARATLATWIVMFLQQFCGVNV
                     IAYYSTTIFTESGYSIQEALLASMGTGILNWVFALPAFFTIDTWGRRNLLLFTFPFLA
                     ICLFWAGFSFWIEEGIKYSKKRVAMVTTGMYLFEVFYSPGEGPVPFTYSAEAFPLHVR
                     EVGMSWATATTWCFNFILSFTWPSLLRAFQPQGAFGWYAAWCLVGWVLVLLFVPETKS
                     LTLEELDQVFSVPTRKHAMYQLRNTVWHFRVWVLRQKLEPLPKLYEGAEHLSEAGEK"
     exon            complement(1211083..1211258)
                     /number=1
     exon            complement(1211310..1211847)
                     /number=2
     exon            complement(1212045..1212740)
                     /number=3
     exon            complement(1212793..1212869)
                     /number=4
     exon            complement(1212950..1213334)
                     /number=5
     CDS             join(1218124..1218381,1218456..1218845)
                     /codon_start=1
                     /locus_tag="AO090103000482"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000255"
                     /protein_id="BAE65901.1"
                     /transl_table=1
                     /translation="MANDKSEAIIIVTSIFLALSLLAVSLRCYVRLHLIRAFGADDYM
                     MVLAMAFNLAFAICGIAGGSTGLGKKMNYFADKPTDLRDSLRFWWLGQVFYALTGTAG
                     RTSIAISLLRITIVRAHLIIIYATIALSIAVGLLFFFATLVECRPIHYVWDYGMKSPH
                     CVSKDFLLDIVYTHSVIAALCDLTLGILPLFMIWKLQINRRAKFSLGAILGLGCL"
     exon            1218124..1218381
                     /number=1
     exon            1218456..1218845
                     /number=2
     CDS             1221289..1222827
                     /codon_start=1
                     /locus_tag="AO090103000483"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000256"
                     /protein_id="BAE65902.1"
                     /transl_table=1
                     /translation="MKTSFLLAAIGFLYRLPCSAAQTLNIVAHQDDDLLFLSPDLLHE
                     IQGGRRVRTVFLTAGDAGEVSSGYWEQRQAGSQAAYAQMADVSDIWTQSDAGIDGKNI
                     PTFTLDGNPDISLVFLQLPDGNGYGNGFPSTGSVSLQQLWQSEISSIQTVNGSTSYTS
                     DELLDTLATLMSDFNPDRINTQDYAHAYGDNDHSDHHTTAYYVQKAAERYSTTHTLTG
                     YTGYSIASMAQNVFGDDLNAKQSAFFTYAAHDSKVCHDSASCGNGNEAQWLQRQYAVT
                     GEPVANARLLNSRRTVGLGENVVLDGTQSRDPNGASLTYQWTQTSGADVVLSNATAAR
                     PSFTSPKSSETLGFSLVVGNGNTRSTPAKVTVVATNLENVARNATATASSQNSDGGQT
                     AEKALDGIIDGYPGTATTEWATVGGKAGSTLRLTWAQPQSISEVYLYDRPNVDDQVTG
                     GILQFDNGSNITVHVLDNYGRPNRIQFEAKTTRSLLFIVTSVSPSTRNVGLAEIEVYG
                     ASSG"
     exon            1221289..1222827
                     /number=1
     CDS             join(1224047..1224199,1224276..1224830)
                     /codon_start=1
                     /locus_tag="AO090103000485"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000258"
                     /protein_id="BAE65903.1"
                     /transl_table=1
                     /translation="MTTPKITLYTNHRCPWAHRAHIALKELGLNYEEVIIDLTKPREP
                     WYLDINPRGLVPSITYGEHIITESAVVAQFLADAHPSHLLPPSNSENGALQRARIAFF
                     VDTFFSKVQPHFQTSLRASTTEERDAAAEALVAAIKSELEPQLPEGSDGKGPFFGGSE
                     KLTLAEVLTGSFLLRILSFHRHGLLSEKLPSLLEDTPRFKRWAEATVQQDSVNYIWDE
                     KVSADAIKAKLAALAKK"
     exon            1224047..1224199
                     /number=1
     exon            1224276..1224830
                     /number=2
     CDS             join(1225871..1226009,1226114..1226276,1226334..1226680,
                     1226735..1226985)
                     /codon_start=1
                     /locus_tag="AO090103000486"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000259"
                     /protein_id="BAE65904.1"
                     /transl_table=1
                     /translation="MRIIAVAGGTGSVGQTIVEALVAHGKHTVLILTRKVSRHTMGYG
                     RRAKALETANVDTVICAFGMESDAISEAQVNLIRAADMSGSTKRFVVSGYDMLFKEEH
                     IPMVPTAKWALAASHAVEESSLEYTRVVNGLFLDYYGLPHWRSHLKPWVNAVNVEGKW
                     AVLPGDRASKVNFITSQDMARFVARLMDLSEWSPVSFIAGQTASFKDILRLAEEARGE
                     RFSVKNESLEDLRNGRISFPEFEETGLESTGRSTEYIFALFHYISGTGGYTISRDGTL
                     DAQFPDIKITTAAEVIESSWRNP"
     exon            1225871..1226009
                     /number=1
     exon            1226114..1226276
                     /number=2
     exon            1226334..1226680
                     /number=3
     exon            1226735..1226985
                     /number=4
     CDS             1228328..1229059
                     /codon_start=1
                     /locus_tag="AO090103000487"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000260"
                     /protein_id="BAE65905.1"
                     /transl_table=1
                     /translation="MTRYLSFLFLLILFGNSVFTAVIPKSYGSDDHEVTAEREDEPGN
                     DLVLDDMWSLEDGSGSLNTRATDAADSSDEAALLDERQPLAPEDPSASKRDDTSSTDL
                     PLSDTIVARAPEECRRALGTGVDSCKKSVQSGVANCKKKIQDDIAKCKVDAKGEIDRC
                     KKKAKDPFSKARCESRRPKLMAQCESRRAKIPLCEKARPKVLLCCERMRPQFQALCAI
                     PSFPVSVVRSRLQDAQQQCMKGFII"
     exon            1228328..1229059
                     /number=1
     CDS             join(1235464..1235721,1235771..1235829,1235885..1236050)
                     /codon_start=1
                     /locus_tag="AO090103000490"
                     /note="predicted protein"
                     /old_locus_tag="AO070333000263"
                     /protein_id="BAE65906.1"
                     /transl_table=1
                     /translation="MENLFPHPRRIVTGHDNDGKAIVVADSLIPCEPTRINCNFAVLY
                     ETHQFPEVNDQWIDPTRTRTPDLANQKGVVLRVVDFPPRTKTMFHRTESLDFGILHAG
                     EITCHLDGDERIDMKPGDVCVQRGTIHGWTNYSDAPARVFFVLTGTFCILLFRPDQMD
                     "
     exon            1235464..1235721
                     /number=1
     exon            1235771..1235829
                     /number=2
     exon            1235885..1236050
                     /number=3
     CDS             1236464..1237036
                     /codon_start=1
                     /l