LOCUS       AP007171             2505489 bp    DNA     linear   PLN 16-DEC-2016
DEFINITION  Aspergillus oryzae RIB40 DNA, SC011.
ACCESSION   AP007171
VERSION     AP007171.1
DBLINK      BioProject:PRJNA20809
            BioSample:SAMD00067075
KEYWORDS    .
SOURCE      Aspergillus oryzae RIB40
  ORGANISM  Aspergillus oryzae RIB40
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Eurotiomycetes; Eurotiomycetidae; Eurotiales; Aspergillaceae;
            Aspergillus.
REFERENCE   1  (bases 1 to 2505489)
  AUTHORS   Sawano,T., Tanaka,T., Machida,M. and Yamada,O.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-JUN-2004) to the DDBJ/EMBL/GenBank databases.
            Contact:Toshihiko Sawano
            National Institute of Technology and Evaluation, Genome Analysis
            Center, Department Of Biotechnology; 2-49-10 Nishihara,
            Shibuya-ku, Tokyo 151-0066, Japan
REFERENCE   2
  AUTHORS   Machida,M., Asai,K., Sano,M., Tanaka,T., Kumagai,T., Terai,G.,
            Kusumoto,K., Arima,T., Akita,O., Kashiwagi,Y., Abe,K., Gomi,K.,
            Horiuchi,H., Kitamoto,K., Kobayashi,T., Takeuchi,M., Denning,D.W.,
            Galagan,J.E., Nierman,W.C., Yu,J., Archer,D.B., Bennett,J.W.,
            Bhatnagar,D., Cleveland,T.E., Fedorova,N.D., Gotoh,O.,
            Horikawa,H., Hosoyama,A., Ichinomiya,M., Igarashi,R., Iwashita,K.,
            Juvvadi,P.R., Kato,M., Kato,Y., Kin,T., Kokubun,A., Maeda,H.,
            Maeyama,N., Maruyama,J., Nagasaki,H., Nakajima,T., Oda,K.,
            Okada,K., Paulsen,I., Sakamoto,K., Sawano,T., Takahashi,M.,
            Takase,K., Terabayashi,Y., Wortman,J., Yamada,O., Yamagata,Y.,
            Anazawa,H., Hata,Y., Koide,Y., Komori,T., Koyama,Y., Minetoki,T.,
            Suharnan,S., Tanaka,A., Isono,K., Kuhara,S., Ogasawara,N. and
            Kikuchi,H.
  TITLE     Genome sequencing and analysis of Aspergillus oryzae
  JOURNAL   Nature 438, 1157-1161 (2005)
COMMENT     URL:http://www.bio.nite.go.jp/dogan/Top
FEATURES             Location/Qualifiers
     source          1..2505489
                     /db_xref="taxon:510516"
                     /mol_type="genomic DNA"
                     /note="SC011"
                     /note="phrap>=30:1-2505435"
                     /organism="Aspergillus oryzae RIB40"
                     /strain="RIB 40"
     repeat_region   1..23
                     /note="VII left telomeric region"
                     /rpt_family="Telomeric Region"
     CDS             complement(join(3798..4168,4221..4716))
                     /codon_start=1
                     /locus_tag="AO090011000001"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000001"
                     /protein_id="BAE64566.1"
                     /transl_table=1
                     /translation="MALCGYPTNIQFVHSDNSQIDMVFDMGCRTLKIHDRWLDPGAVH
                     YQSPCRPGMEYALTACGSFFCDHVIEELFAMVQGEMSRVSPSVMNHSRRNREIRLVRS
                     KLRMMPRDVFVRAGSMPGTLRVSWQDRETESFLELHGSHAAYHVVLHEEKCAGVMAHH
                     LHSDKVDIRITQAPCGCMQKFTPQNQKCVEFDRLDFHKKYFPMIAANELAAFFGQPTS
                     PIHPARLPQPPLYTGWNGTTRNGSIWQVQNTMNPTFGGIVATSSGQAIYYDGRLPKRA
                     LPPLYPNDRRIA"
     exon            complement(3798..4168)
                     /number=1
     exon            complement(4221..4716)
                     /number=2
     CDS             complement(4937..5848)
                     /codon_start=1
                     /locus_tag="AO090011000002"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000002"
                     /protein_id="BAE64567.1"
                     /transl_table=1
                     /translation="MGSNTNALGFIRYEKKSGRVILVNACAQLRTDALQLGHTSKKGQ
                     LQFAGCHGEGLKLAAMVMCREGHSVSIETGNSHWSFAYGGPSKSRFCCNIGPLSVATP
                     DGKPNPAQDMACFTYRTWRDVCVEIGPDSGGTGGGVSLEKFKQWLTVSLDIRGYSYPE
                     SNIETDQGDLIIDPRFRGKAFLKGLLLPASVLEARPFELSYNFVQGGVNRDRQRLVSR
                     YEQADLVRRIWESAIRENEVLVLPIYVNLLRNFPRAPDVELADQLLDHPTRFRIWKYL
                     LREAGDKRFYFCQKTGSQVSEAGVIRS"
     exon            complement(4937..5848)
                     /number=1
     CDS             join(6608..7040,7103..7506)
                     /codon_start=1
                     /locus_tag="AO090011000004"
                     /note="1-Acyl dihydroxyacetone phosphate reductase and
                     related dehydrogenases"
                     /old_locus_tag="AO070335000004"
                     /protein_id="BAE64568.1"
                     /transl_table=1
                     /translation="MSKSVLITGCSKGGFGEAMAKVYHAKGFQVFATLRNLTKVGSLA
                     DYDGVRILELDVTSVESIHQCAQTVAKHTGGRLDVLVNNAGVNAIVPLLDASLDEAKK
                     VYDTNVWSIVGMVQAFAPMLIQAKGVVCNISSVSGEMVFAWAGIYSSSRSAGTRISET
                     LRLEMAPLGVRVVTVILGGVQTSGNNPENIADLELPPSSHYRKITSVIDRHKKTMVHP
                     NKQNIEIAAKNVVDDVLHGHGIFIRRGQASMLSWLCNTFLPYRLFTWMINRESALDEI
                     RC"
     exon            6608..7040
                     /number=1
     exon            7103..7506
                     /number=2
     CDS             8086..8922
                     /codon_start=1
                     /locus_tag="AO090011000005"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000005"
                     /protein_id="BAE64569.1"
                     /transl_table=1
                     /translation="MRIARLEEKMESLLAAMDTFVSSSGSLVGLADTTRSGATSISAS
                     VNMTSSGFSERLALSNTTVSTHTNSSPCSDSSAPSPTASLPNQEDGRLEYFRTQMLPY
                     FPFINLTPEMTTQYLRQNRPFLLRAVYAVTTFSTQEKLAQVEELKHLLFTSALLKVES
                     SIDMLLGLLTYIAWSTDTFLGRADLVSRLMMLATSLVYDLRLFRPSPPDVQVMMAISQ
                     GQDEEARQGPNTETPFSLSEGRRAVLACFVLSSKYVSGLLDLHYFATLHPLGQYLICD
                     PP"
     exon            8086..8922
                     /number=1
     CDS             join(9357..9780,9918..10105)
                     /codon_start=1
                     /locus_tag="AO090011000006"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000006"
                     /protein_id="BAE64570.1"
                     /transl_table=1
                     /translation="MTYEPQPLNISGRLGFERFECLWQSVEDIKVWLDSFNAIHHSTL
                     IGQPFHFWSQMIMSLTLLKYLSTLQDPEWDCQAVRNAVPLISTIDSMLQKLDQGSQQP
                     ELQCNDHLLHYLSKLLLRCRLWAEARWDMACPMQEVNVFLAFQLFIKATYSTTMASIR
                     SITGSFKCSDRRTLCTIPARSTIQVMGMADGGWETQLRLYPLR"
     exon            9357..9780
                     /number=1
     exon            9918..10105
                     /number=2
     CDS             complement(join(10195..10202,10669..11005))
                     /codon_start=1
                     /locus_tag="AO090011000007"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000007"
                     /protein_id="BAE64571.1"
                     /transl_table=1
                     /translation="MATFSPIPAYVLGTLTLALGCNAVARPGPEYPRFGLPFESAASP
                     PSTHGNNKRTHPPGAVSPLMYIKGIREMSYGLTLLALQYYRQEIAVTIFAAVCALVGL
                     ADGFVVWASGAH"
     exon            complement(10195..10202)
                     /number=1
     exon            complement(10669..11005)
                     /number=2
     CDS             join(11859..11941,11988..12114,12167..12213,12274..12485,
                     12626..13263)
                     /codon_start=1
                     /locus_tag="AO090011000008"
                     /note="permeases of the major facilitator superfamily"
                     /old_locus_tag="AO070335000008"
                     /protein_id="BAE64572.1"
                     /transl_table=1
                     /translation="MGTLPFARLRAVPYRMTSRSPYLTLAVVCTAMFLDLANLSAITI
                     ALPTIQKEWGATEGDLQWVISAYSITFGAFLLLGGRGGDLFGHHRVLLFGMSFFALST
                     IVCGLAPNFIGLVVARALQGRLFQTVHRRGDQALTEHHRHRCCFHDSLGAGPYCCGVL
                     TAYVGWRWIFWISLILSGVIIPAAFFILPRPDRPPADVVASPESELEAGQQQARTNNS
                     LAAIFQRIVNRFDPLGIALSVAGILLLTYALTSANTEGWGSARIVAPLVVSGALLGLF
                     IFHECRTTNGIVAPHLFRSTSFNLTLVLAVNTYAVRQACTYFLTLQLQSYGNSAIHTS
                     VLFIALGVSALIFNTLSGRLVPILGARLMVSLNN"
     exon            11859..11941
                     /number=1
     exon            11988..12114
                     /number=2
     exon            12167..12213
                     /number=3
     exon            12274..12485
                     /number=4
     exon            12626..13263
                     /number=5
     CDS             complement(join(15322..15747,15814..16155,16208..16771))
                     /codon_start=1
                     /locus_tag="AO090011000009"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000009"
                     /protein_id="BAE64573.1"
                     /transl_table=1
                     /translation="MADAEHFTDPFWAPEPDEILSGGVPCSYNAPTASIEMTIGGLGT
                     IAVRSKTTGQLEFIVRSAGPDSPTLKLTVTAESCVLQMKDNDSEPFRDIPVIEYRAET
                     RKSEGPKKLPYVYYPKQPESAYLNVRSKKDPTVYWISVDRSNKRFRYGQHLTNASLTY
                     LEAHFDGDRPSKQWMDQLKSTQILQNGREIPGNDVRYDPLPVTMDKPPLVVSDEQVSL
                     EDLDKYHRTTYANLPPGCQALYHNIAGHNVSLESASFPQLAQAIDYSCRDPRLVCGKI
                     LAQKQKKNEFHDKSKTYLRITVGSNLANSPGIPYVMEIWPPGHSSPIHDHGRASAVIK
                     VLYGSIDCSWYDAVQDGREPQQVGKPHKLSKGDVTWLGDKQFQIHKLENNYKTVCITL
                     QCYQFEQSDNEHYEYFDFLDNDLHKDRFVPNSDRSYGELIEELKIEWDRKH"
     exon            complement(15322..15747)
                     /number=1
     exon            complement(15814..16155)
                     /number=2
     exon            complement(16208..16771)
                     /number=3
     CDS             complement(join(18383..19279,19336..19469,19517..19625))
                     /codon_start=1
                     /locus_tag="AO090011000010"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000010"
                     /protein_id="BAE64574.1"
                     /transl_table=1
                     /translation="MQSLITLLALPASTLAGSVLWSGISDSSLTVDDIDKWSWSNQVG
                     AWQWYIHGSGKTSEYLGISPEFKNPAAADAQGLRITIDGTSFWNGQTMERSELIPQTK
                     ADLGSGHLYYHFSLSTKETNAPNPSFEHQIAFFESHFTELKYGASGSSDNTLSWNADG
                     KSHWSVQLEAGTWYNFAYDIDFDSKKVGLWASNGSEPLTQVVEPVSASTSTNSADWHV
                     GQLRLPGSESDDAAEDWFWSGVYIEEGPITTEIGSESSSGSSSSAGPSSTTIATTAPA
                     SSTAHSATSTGGITATVSSVGLTTTATPSPVSTAVSSSVTPSSLNAAPTKSTEVATPT
                     SSSVATFASPTSAAEFLTDIRALLKTLLSRSEAGSVHARDFIRRG"
     exon            complement(18383..19279)
                     /number=1
     exon            complement(19336..19469)
                     /number=2
     exon            complement(19517..19625)
                     /number=3
     CDS             join(21450..23348,23404..23832)
                     /codon_start=1
                     /locus_tag="AO090011000011"
                     /note="vacuolar sorting protein VPS1, dynamin, and
                     related proteins"
                     /old_locus_tag="AO070335000011"
                     /protein_id="BAE64575.1"
                     /transl_table=1
                     /translation="MSPSREEQALHQLQSQQSKLLDKIDELRAIGVGGLVELPQVIVC
                     GNQSSGKSSVLEAISRVRFPAKSNVCTRFATEVILRRSPQPKIKVSIEPGESRTNEAE
                     RQKLREFAPQAFSSDGDLPKLIEQAKECMGISNEDTVNSGFSDDVLKVAISGPDKPEL
                     TLVDLPGLYYSTSRDQGAKGIEIVRGLTEKYMKNTRTIILAVISAKTDYHLQEVLNMA
                     ERFDSKRERTLGIITQPDILEADSEEEGNYLQFMRNEKIHLRLGWHALRNRSFETRDI
                     SDDARDEREKTFFEQGRWASLSRDYVGVESLRRRLSTVLLQHVRRNLPSLIADIQDQI
                     ADRQRRLAKLGPARSTLQQQRGFLLDISSSFERITSQALNGMYADEFFGEFGDDTQDS
                     QDFRRLRAVIRELNECFADAMNTRGSRRIVRELLSHFYDLDQEKKKMYMEDWSPEYIT
                     REALEKEIGEQARKNRGIELPGSANQLLVGNLFRDQSKPWEGIARLHLLNTWESVKYF
                     VYLLLRHLTDEPTYTLLVGTVLAPQLERMKDGLLNKLGELTAYTKRGHPLPIGKSFLS
                     KIQVARTNRQIAALRKGLGLSRSFFGLKDGSRSFDADDLERAASELRSSSDQFAAAEI
                     IDQMQAYYDTSIVTFVDNIATLAIENCLLGPLERIFTSQTVNNMDDQQIRELAEELPH
                     VQHDRQRLDQELNKLQAGLDTFNIFSTESSSLQRPPMFAKPKPASAHPSLFQGLDPIA
                     LRKKLEPQSKCRYPDPCKIIVCANLSNSTLDSYNK"
     exon            21450..23348
                     /number=1
     exon            23404..23832
                     /number=2
     CDS             complement(25245..28910)
                     /codon_start=1
                     /locus_tag="AO090011000012"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000012"
                     /protein_id="BAE64576.1"
                     /transl_table=1
                     /translation="MGKLDKLTRVEADLVGAETLTESKRTGRVVDGMSATVTSTHATV
                     VETGMTVNQVNVRVNEVQEMLGTLLVSVKENKQESTEDREKALQEHVSKTLRPSKTDY
                     AQDWYDKINKARIPGTGDWVRDERIFNEWHDKHMPVMFISGNPGAGKSYIVANMINRL
                     HELHPQGVQNTSLTSVGFFFFKDDNPGTRSFHQALRDLALQISKNDPVYLKHLATIAN
                     YEMISTLESAWRLLFVDYFVKKPNADSDVYILLDGVDEAFDEERRTFFSLAKDLYDSA
                     EKSHLQLAVIGRPHISDQLLEGLELEVPTIHVTTQKNSRDINQYIHASIKKSVVLRRV
                     SAKLRQEIVEKLSARAEGMFLWVNLMLQELVKKRNESSMRKALDQAPKGLKEMLRHVL
                     LSFSTSSNEEELEFLNEILLWVTCSRQPLTLAEVESILKLKSPEGDGMIYPEGALRRQ
                     FASFFSLNREDGLTTAELQIMSTNRNGLDESDEEGEGRNADEDAFEDVENFTDFDSHK
                     ETTTVTFCHASIGDFFRDQTEGKVSDEESHVPVGVDYLHAKAHVLKTFLRIFTDKEFA
                     KKADDGEHMLRHAAENWVHHLLTTHASDCSLEDRRDIAKMLLVALTSEESITGWIGYR
                     GWVSTEANIRAIRQWWEDEEVLESLTPDEQEFISSTKEDPITTLKPVVMLCTKKYVAD
                     DMWLAAPVAAVVWSYQSLMKGKEVNFIEMFDPTAEEIIAAAEFGDFEKNALWYRRCAI
                     VLRQLEYFDQALDYFSKAVELAPDMWLCKAGMAIVYSMKKEWQKAIDLDEEVVQTLSA
                     QIEANEEDSGLRASIHTSLERLGDSYQQLGNLEKRFEAYKRAQALTPYCNTCINVLLE
                     HYGTKHDHEATIDLLQTLADTPVPDEDFSRLTQSLWDNPEEDTRYFVLAADAALATDN
                     LDFMVESWRTAARAARKASKTVTATQLDMSLARIYSEFLHDQAKAVKRWERIMNTYAS
                     SKDETVVGFAKLKASFELAKQFLCDAVEAGIGTPQAEEAGAKLEKLCKQVKLNDESVL
                     WTVSSMRAICLGIYYRLSGREAEARALFKPSIKRGIAILSDDDPENDMLGFLDLLNAL
                     VAAGDVKNVTAAAYHEVFGKYNADDPEGATDNESPGDEDSNWLTCDGPCRKELPTLDD
                     SYQCPICLDTAFCPSCVRLLEDGTMGIRKCNPKHVKDFIYVPPRPKNVTSGKMLVDGQ
                     EIDFEVWKQGLKKEWGI"
     exon            complement(25245..28910)
                     /number=1
     CDS             complement(29127..29522)
                     /codon_start=1
                     /locus_tag="AO090011000013"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000013"
                     /protein_id="BAE64577.1"
                     /transl_table=1
                     /translation="MTVSKNQIPAIYERAIKKYQEITDEPFDVQFLAKIQNVEDLTKE
                     IDARNNSFREFREKRGAIFEVLNAAMIPVQLFGNLAAGGASMVFPPSSLVFGAVTYLM
                     GAAKGVSTSYDAIQDLMGTLKVTRGSTDN"
     exon            complement(29127..29522)
                     /number=1
     CDS             join(31570..32076,32136..32289,32360..33318)
                     /codon_start=1
                     /locus_tag="AO090011000014"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070335000014"
                     /protein_id="BAE64578.1"
                     /transl_table=1
                     /translation="MSFPDQRETHAVHAEDSPSSGDATDSELNAPVDISNELAEKRSE
                     RSDGKRELKEKDCYQILGYSWPRWKKWTYLAAVAFVQVSMNFNTSVYPAAVKPLSEAF
                     NISEQHARTGQMAYLVTYSIGCELWAPWSEEFGRWPILQLSMFLINIWQILAALAPNW
                     GSMVVARALGGISTAGGSVTLGLIADIYESETQQFPLAFIVLSSCIGTSIGGVIGGPI
                     ARFLDWQWFFWIQLIFGAVTQVIIFFMPESRSTIIMDKEAKRRRKSGEDPNIYGPNEL
                     KVPRISFKEAGKIWMRPFHMLLREPIVLCLSLLSGFSDALIFTFLESFAIVYEQGWGF
                     GTLGQAWAVIPINAAYFIAYFSYFPWFMRDEKLRLRHGDAAIPPERRLKWLLFLAPLE
                     PIGLFGFAWTTFAAGDSRNVHWIASMIFSASVGIANYAIYLSSVDYMVASYGVYSASA
                     TGGNAFARDLLAGISAMYATPMYSNIGDEWHVQYASTILACLSCLVVIPIYIFYWKGP
                     QIRANSKFAATLAADRLQNNGRRVSQISAEP"
     exon            31570..32076
                     /number=1
     exon            32136..32289
                     /number=2
     exon            32360..33318
                     /number=3
     CDS             complement(join(33837..33930,34006..39949,40005..40128,
                     40176..40560,40704..40820,40877..40994,41051..41492))
                     /codon_start=1
                     /locus_tag="AO090011000015"
                     /note="polyketide synthase modules and related proteins"
                     /old_locus_tag="AO080523000015"
                     /protein_id="BAE64579.1"
                     /transl_table=1
                     /translation="MAMTPQTSDSSLSMGSVRPVQEPIAVVSMACRLPGHSDSPQKLW
                     EFLMKGGVAGTDVPKSRFNIDAFYDGSDRPKTMRSPGAMFMESVDPAKFDASFFNISA
                     QEATAMDPQQRIILEVIYEALENAGLTLESLAGQRYGCFVGGHPGDYWDVFARDPDSR
                     PVNAGIGGSGTMLSNRVSHFLGITGPSMSLDTACSSSLVALDMACKFLQTGEINGAVI
                     AASNLVLHRNTHSPTGRCHTFDAKADGYIKAEGINAVILKRLDDAIQDGDPIRAVIRG
                     TANNHSGRTPGIASPSADAQAAAVRTAYENANITDFSLTSYLECHGTGTLAGDPVEVA
                     GVSSVFAPSRTLDRPLHIGSIKSNIGHSETAAGLSGLMKAIMILETGLIPGNPTFETP
                     NPKIDFGGSRVKVSQSVVPFPNDVPFRRVGVNNFGFGGSNSHAILEEPRVVHLDYCPA
                     HRSSYTSPSPDSIKEEPAKQPYILCFSANHKDSLKHYIERFSQHCTSPGVHLNVRDVA
                     YTLGVRRSKHFHRGYLITDNLKHLDPTKVVYGKKSVNAVKVGFVFTGQGAQWPQMGFD
                     LLTSFPVARRCVERLETVLQRLPNKPTWSLYEELTKACSPDHVRAPELSQPLVTALQI
                     AIIELFRSWGVSPTSVVGHSSGEIAAAYAAGYLSDAEAIVVAYHRGMASQQGQLNDTL
                     PLGMLAVGLGAEQVTPYIDGLEGVEIACYNSPASVTLSGLSSVLEQVKDRLTEGGVFA
                     RMLQVELAYHSTHMEAIGEVYESLLNRDLPAIAREFPLPGDVTMFSSVTGSRQEACPD
                     IEYWKRNMTSPVRFEDAARAMLCGNSSVTLLVEIGPHGALKGPITQVQRALEGAPSKV
                     SYLSALNRGSDSIHNTLAVAGQLFLAGAPVDLERVITDSQATRPMVIVDLPNYCWEHS
                     TSYWFETQPSKDWRFRPFVHHDLLGSKILGTSWLHPTFKKTMDLSHLPWLRDHRIGTD
                     VVFPASGYIAMAVEAMYQTSCMRKPTRPFPLPNELGYQLRNIRFNAALVLEEDVDSEI
                     YLTMNPFPGGNENWSEFSISSHRDGAITHHATGLIRLQEPVIDPADETDIAPFEHASP
                     GHLWTKACAELGYHYGPAFHLLEKVESRAGQRRARALITLADPPSAHDPQSLYPVHPA
                     ALDGVLRAVVPAAIAGDRSRMAETLIPAMVDDLIINPTHRPHAGIAVASSYYSGRGRE
                     DTEKSYLGSTSVYDPSSGALLIRMTGLSSHRIDLGIDPISRHTLVHDVLKPDISMLNV
                     EAVQQLGQVHTNMTPLLLQLMVHKKPALKVLELDLGTREPGSLWFESLETVEDLQCQY
                     RYVARDATNLSGVESKYRDQANTSFQLLDPDCSHLGVGEQERFDLIILKAISPLPQRS
                     ASVVSAVKDLLSLDGYILAIDHTEAGLNAHSESSLVRLVENTTLGRVLSIPSERRAVF
                     LCMPLITRDCPPPAAKQVHVVYMEEKTILPPIAERSLTEGGWQITQHQYLTANVPAGA
                     LVLITDELYSPLLTHITEEQWLCLRHLITSGCKLVWVTRGGQLSASEPNSALAAGLLR
                     SIRSEDPAATLITLDIQSQDGAAALACLPLVLEQLQMREAGLGTENEYVEQDGVLHIH
                     RVLPYRPLSHDIQSWKEGFVETPLSTDGSITRLVAEDIGTLEGLRFVQAPDDTLPENH
                     VEIEIQAAGLNFKDVAVTMGIVPENEHLLGLEGSGIIRRVGSSIDDKSIVGTSVVFME
                     KGAFANRIQVPLDFTHPIPKTMSFSEAATIPVAFCTALYSLFDMADLQPGQSVLIHSA
                     SGGVGIACIQLAQYVGAEIYVTVGSDAKRRFLHDTYKIPYERMFSSRCSKFAAGIMKA
                     TNGEGVDVIVNSITGDLLDATWRLCAAGGILVELGKRDMVERNTLSMEPFDRGCSFRA
                     VDLSHPKLLKKLPRYVNRISVDVSYAHLYISILRRVFSLASNGHIRPIDPITTFPITQ
                     AAEAFSFMRSGKHIGKVVIRGMAATGSLTAAVRPLRQDITFNAGSAYLIVGGLKGLCG
                     SLALHLAQRGARHLVVMSRSGCADRRSQAVISNCESLGCHIHVCRGDVSRILDVRQAF
                     KQAPVPIKGVIQGVMLLRDRPYELMTIKEFHESIEGKVQGTWNLHNVSIESRSELDFF
                     LLLSSISSVVGTPGQANYAAANSFLDSFAAHRRSMGLAAQTINLGVVEDVGVVAESDD
                     LSQRLEASRDLIGIPERVLHRIVDYSLRQQFLQSTCRPHSGSSEFPTRLITGLAVPQD
                     PTQSGLRFNPLFRGLFVGNSSSHANAGKPTDELAAALQSFHAMIRAGVGAEELQEPCL
                     SILATRLARMLRYNENQQIEPGQPLSVYGLDSLSMVELRNWIKAQMGATVTTFDVLNA
                     NSLIMLAQRVVNKWTVRYGLDFSIRARFTCAKGCLNSLRVKRQ"
     exon            complement(33837..33930)
                     /number=1
     exon            complement(34006..39949)
                     /number=2
     exon            complement(40005..40128)
                     /number=3
     exon            complement(40176..40560)
                     /number=4
     exon            complement(40704..40820)
                     /number=5
     exon            complement(40877..40994)
                     /number=6
     exon            complement(41051..41492)
                     /number=7
     CDS             complement(42160..43011)
                     /codon_start=1
                     /locus_tag="AO090011000016"
                     /note="multidrug resistance-associated
                     protein/mitoxantrone resistance protein, ABC superfamily"
                     /old_locus_tag="AO070335000017"
                     /protein_id="BAE64580.1"
                     /transl_table=1
                     /translation="MDFSAVERAMEYTEVPIENSDGEDAPDRWPTEGRLSVRSLTVAY
                     SPELSPVLHNITFTVEPGQRLGVVGRTGAGKSSLALALLRCLEAREGAILIDGVDIST
                     IKLHHLRRRLAMIPQNPILFTGTVRSNLDPFGQYSDDSLIEALKRVFWDNPEALHASV
                     ADGGSNLSCGERQILCLARAMLSAPAVLVMDEATSAMDHDTDQMIQRSIRSQIGKKSP
                     TLIVIAHRLQTIADFDRVLVLHEGRAVEFGSPQDLMQSRNGLFRQLVDDDVGKENLYN
                     QMNIAGR"
     exon            complement(42160..43011)
                     /number=1
     CDS             complement(43815..46139)
                     /codon_start=1
                     /locus_tag="AO090011000017"
                     /note="multidrug resistance-associated
                     protein/mitoxantrone resistance protein, ABC superfamily"
                     /old_locus_tag="AO070335000018"
                     /protein_id="BAE64581.1"
                     /transl_table=1
                     /translation="MARINHGIVGISILITLSLPRRSRIFRDGKAIDGEGSSSVLGRL
                     SFHWVSELVAVAEARRRVTLDDLPELDDRTRAGILQEEFTQAPCNNPSHRCDEWSLFR
                     LLLLSHGKCLRNQIMLSIPLAVVAFTPQLALWMMLQLLEEQSTRQSDTASLTWWALVC
                     GLTIGLSAWLENWLLWLAMNKISVPLTQQLTAILYHKLISHSQLAGDSLNEQNLTNLI
                     SMDTQRIATVAGFLYSNVLQAMKLIVASTLLAHLLGWQSLLAGLSTLLIITPLHRIFL
                     QRYGAAERALTGLRDSKMAALTEALQCIRQVKIAALERKWEVKINQLLERGLQEHRAA
                     FHWYLMNLACHLVGPVLVSATAIGIYTWRHGSLTPSVAFPALSLLGYIQFILGLIPDL
                     WSGIVGARISLRRIGSFLETEKASSTIASGERIEFQSATVCYESSAGDQGSGTLHNVT
                     ASFPPKELSIITGATGMGKSLLLRTILDECHIQSGILRRPVPASHDEIYGQTTTTQPR
                     WVIDHAVAFVPQLPWNEAATIRDNILFGLPLEPKRYQSVLYACALIKDLEQLEHGDLT
                     DIGPNGCKLSGGQKTRVALARALYSRAGILLLDDIFSAVDIHTARHIFIHGLTGELAQ
                     GRTRILVTHHVQLCASKAKYLVTLDNGTVVFAGIPPYLLHPSLEENRDTAGNESKHDI
                     HTPESTPVRHSYNTLVSADDPTERTKGAFMEDGRSPQNLVRRDVLRHYIQTSGGSRSW
                     AVVAGCYIGYNGLLLALVCTVSFLLLRIPIKSIN"
     exon            complement(43815..46139)
                     /number=1
     CDS             complement(join(48102..48118,50110..50376,50438..50821,
                     50887..51095,51151..51240,51292..51674,51743..52051))
                     /codon_start=1
                     /locus_tag="AO090011000019"
                     /note="predicted iron-dependent peroxidase"
                     /old_locus_tag="AO070335000020"
                     /protein_id="BAE64582.1"
                     /transl_table=1
                     /translation="MPVPKQNRSVDTDNIQGSIWPRLPKYYETYLFFKITDNEKFRQH
                     LRGILDKGVITTGTECEEHLKSVGEFEEACAYSRRHVPEKDRKPFTAVNVAFTHMGLL
                     KVEHPEVEVNFAQALAEDPEEYCRDRINEGLFEKGMFDDLVYEGADSPPALDPDFRAP
                     PGNESKTGLDRWKWRVDGVFIVAAHNAKALRRKIVDLEDAFNVGDADENSMKIAFRRD
                     GKTRPGANRGKEHFGYEDHISQPKIDGLDDPPARGEPQACPPGYIFLGHEGDPERRRG
                     PKWAKEGSFLVFRQLDQKVPEFEGHLKELAEKIPGNYGGNPEKLGAHMMGRWKSGAPV
                     AKAIHEDNPDLAFDNTFDFRPKKDIKGCPFAAHIRKMRPRADKKRDFGSEEDDENHKP
                     LPEPGEDEAFDEGQKEDASVILRRGITFGPELTAEEISKGETIEHRGMYFVCYQSLIR
                     DGFNFLMTRWASNSSFPEYKTKTFPDGPGMDPFINQRLRTDHPEGHISLYDGSNPNKT
                     VKLDLGLSPWVDQKGGEYFFTPSIRALREQFSADTVNTEGLSVS"
     exon            complement(48102..48118)
                     /number=1
     exon            complement(50110..50376)
                     /number=2
     exon            complement(50438..50821)
                     /number=3
     exon            complement(50887..51095)
                     /number=4
     exon            complement(51151..51240)
                     /number=5
     exon            complement(51292..51674)
                     /number=6
     exon            complement(51743..52051)
                     /number=7
     CDS             53603..55930
                     /codon_start=1
                     /locus_tag="AO090011000020"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000021"
                     /protein_id="BAE64583.1"
                     /transl_table=1
                     /translation="MKFQWASGLLLGAATVDAFKPAEFSYESSEAECVEIAKSVTGEV
                     KYQSPPPNSYLISKTNPEEPDENWVVQCSSQYRGYACDYAIDDRDDRYWLSNPADGET
                     SEIVVDLRKKYLVSGLTMLPELNKNSKHGQIGEHRISVSQDGKTWTPVAYGTWGSNKS
                     PKLSVFNPKLAQYVKLVSESQSLPDRTQKKHGQISIVNLSVYTYNGTDYPREDPSKGV
                     WGPTIDLPIVPVSSAVEQHGDIIMWSAWADDQFFASPGGKTLTSTMNRDGIITQSEVF
                     ETKHDMFCPGTSMDIDGNIVVSGGADSGRTSVYNGTAWVKGPSMAIPRGYQSSTTLSD
                     GRIFVIGGSWSGGDKVAKNGEVYYPYPDGNAVWETRPGCEVEPMMTDDRLGQWRADNH
                     GWLFGWKKASVFQAGPSKEMHWYDVDDVSRDRNGRRRVRGSVHSAGLRGKDQDSMSGS
                     AVMYDATKGKILTFGGQRHYDGSYGSKRAHLITIGEAYQRPVVKVAGKGPDGKGEGGM
                     HEPRVFHTSVVLPDGKVFIAGGQTWGKPFHEDQIVFTPELYDPETDTFVQLSRNNIKR
                     VYHSISMLLPNATVLNGGGGLCGNCSANHYDAEIFNPPYLFNPDGTRAVRPEITRMIN
                     GNVLTVGGAVTFETASEVESASLVRVGTTTHTVNTDQRRIPLDITHKGGNQYTADLPN
                     DAGVILPGWYMLFAMNDQGTPSVAQMVKVELSSPPEWKTRQYAEEQAGELESEYRGDA
                     HDCDHEEEVKGLISSMLASSSKFWNTWKPSLINQA"
     exon            53603..55930
                     /number=1
     CDS             complement(join(56616..56779,56832..56984,57042..57113,
                     57166..57457))
                     /codon_start=1
                     /locus_tag="AO090011000021"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000022"
                     /protein_id="BAE64584.1"
                     /transl_table=1
                     /translation="MYSRNQVLAALATVGITSVNAAMGPALSTGPVASNSFIREATST
                     LILPKGPSGGSTDAITSLWVGMGTSNGDLIQSIADNWQQSDWTMYAYTLMKTSDTSQM
                     PIYGDGQENAGEGDKVTMHYKFDDASGNYTQTVQINGETVSTLSTSDGQAQGWGSSVE
                     CAENNCGTVGAHSWTDTKIILDVADANYINTLAKGEGVTGGDMTTSDGGKTWTISTFG
                     IPDHTFSD"
     exon            complement(56616..56779)
                     /number=1
     exon            complement(56832..56984)
                     /number=2
     exon            complement(57042..57113)
                     /number=3
     exon            complement(57166..57457)
                     /number=4
     CDS             join(60265..60449,60545..60835,60906..61362)
                     /codon_start=1
                     /locus_tag="AO090011000022"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000023"
                     /protein_id="BAE64585.1"
                     /transl_table=1
                     /translation="MASFFLNITCPNRACLAAGNSAQLLGKHVIAGVSPRTVFTPGRR
                     PQSTQSSLVTKSSWTHPVYTTSQLHSIQTAHRNAKDWSDRMALGTVRFLRWGMDLVTG
                     YHHSHPRDAHSPRFRMTEEKWITRFIFLESVAGVPGMVAAMLRHLKSLRRMRRDYGWI
                     ETLLEEAYNERMHLLTFLKLSQPGPAMYFMVLAAQCVFFTGFSLAYLISPRICHRFVG
                     YLEEEAVITYTKAIQELDKGNLPLWSNMEAPAMAIKYWQMPEGQRSIRSLLLCVRADE
                     ANHRDVNHTLGNLNQDSDPNPFSAKFRNALKEAS"
     exon            60265..60449
                     /number=1
     exon            60545..60835
                     /number=2
     exon            60906..61362
                     /number=3
     CDS             complement(join(61854..62782,62851..62940,62994..63088,
                     63148..63375,63433..63563,64566..64643))
                     /codon_start=1
                     /locus_tag="AO090011000023"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070335000024"
                     /protein_id="BAE64586.1"
                     /transl_table=1
                     /translation="MSFTQNEVGSSVSAVLLQSYIWGGSATSKKDELELVFSNPTAKE
                     AGTVPGESIRIDPSIEKSVLRKLDFKLLPVLSLMYFFNSLDRSNLGNAKTDGIDQDLK
                     LVGNQYSIILAVFNVTFSLFDLPSNLLLKKFSGKAMLPIMMLGWGSVTLLQCAAFNFA
                     GMLVCRLFMGIFEAGFFAGVIFYLTQFYKRNEIAFRLSIFYGMVTIAGAFSGLIAFGV
                     FQIKENLPGWKYLFLIEGGATIIIATFAAWWLPLSGSKCHWFNEAESQVAQMRLLQDG
                     SVRTTDRLSITEALGALLDWRVLVWAVSCFCFGVAQSSVSNFLPQMVALQGYSAVKTN
                     LYTVAPYCVGTVVLWIIAKSSDHFRERSFHLAAALIITFIGYVILATVDPNTNKGVAY
                     FACFLLAAGAFVPSSIFHSWHTNNVTHESQRAATVGFLVGSANCAGIPSSLSFKAETA
                     PRYMPALIVNCVFLLVGACVVIGLGTWFRLDNRRRDKEQGVRLTAGDVATQNLVGGWK
                     DPNWRWTP"
     exon            complement(61854..62782)
                     /number=1
     exon            complement(62851..62940)
                     /number=2
     exon            complement(62994..63088)
                     /number=3
     exon            complement(63148..63375)
                     /number=4
     exon            complement(63433..63563)
                     /number=5
     exon            complement(64566..64643)
                     /number=6
     CDS             join(64682..64868,64925..66201)
                     /codon_start=1
                     /locus_tag="AO090011000024"
                     /note="FAD-dependent oxidoreductase"
                     /old_locus_tag="AO070335000025"
                     /protein_id="BAE64587.1"
                     /transl_table=1
                     /translation="MAYHPPLKDKQSPVVIVGAGVFGLSSAIHLAKRGFTDITVFDRQ
                     PYHETLYDFDKGCDAASADCNKIIRAAYGDEVWYQNLTFKAIEVWESWNKSLAEETIL
                     PPGMTSKDRIYVNCGNYHFGDETDGLNDFEKLSVNNITKAGKGPTQYLLYFDSKEVAR
                     ARADGFSYAVDPFNLSKDGKHQGYLDMIGGFVYADKACTYALHLVKKLGVKLVLDRGA
                     GSFESFLEDPTGKVVGIKTADGKHHKAAATVVACGGWTPSLIPEIDGLCETTAGSIAM
                     IQIPEGSPLRERFSPDNFPVFQWNTRAGENGNLYGFPLDSRGVMKIGYRGTKYTNPQR
                     VQSGQVRSIPITKWTSPFITGLPEKSVQVVQRFLDKYLPELKQSGIGISQTRLCWYTD
                     SFDNHWVIDGIPGKEGVIVATGGSGHAFKFLPLLGEFVADKVMGIESDMLRRFQWRKP
                     PHGETPRNQLMKGFNDANALHRVRMVPDDGSHYSSKL"
     exon            64682..64868
                     /number=1
     exon            64925..66201
                     /number=2
     CDS             68099..69673
                     /codon_start=1
                     /locus_tag="AO090011000025"
                     /note="glycerol uptake facilitator and related permeases
                     (Major Intrinsic Protein Family)"
                     /old_locus_tag="AO070335000026"
                     /protein_id="BAE64588.1"
                     /transl_table=1
                     /translation="MGGPEDGTQLRQAHEPFVQPGYSDLNPSYEQPSNAKPVWSLAKP
                     LPRVVRAGMVPTKEELLDARLQPERPAENSQKLGLDVDPNDLEQGQIPKMADPRKMAA
                     QVEDARLQRENNFVNKVLTGDVGSSRVSRTSSTRRRRPSVRIDAPGDQLSIVPEGPSA
                     VPSVASDQAGDSLPHGSDEPLEPVPEQPEQPEVQTAAADALPDLSALHESSLPEDLHP
                     LVQELVEDEVHNNHTTWSVIRTHHREALAESLAVFVQLTIGFCADISVTVADAGNPNT
                     TAWAWGFATMIAIYVSGGVSGAHLNPSVTIMLWFYRGFPKRKMPEYFLAQFVGAFVAA
                     LTAYGVYYQSIHQYLLTHPDTGIVTSFVTGQRQSWIDPATAFFTEFLGTALTATTILA
                     LGDDQNAPPGAGMNSLIVGLMVFVLSNTFSYQTGAAFNPSRDFGPRLALLALGYGSEL
                     FTNPYWFYGPWAGSLCGAMIGAFLYDFMIFTGGESPVNYPWERTQRSLRKSRIKWKRR
                     LRMDRRRRGISEKVVR"
     exon            68099..69673
                     /number=1
     CDS             70123..70809
                     /codon_start=1
                     /locus_tag="AO090011000026"
                     /note="uncharacterized protein conserved in bacteria"
                     /old_locus_tag="AO070335000027"
                     /protein_id="BAE64589.1"
                     /transl_table=1
                     /translation="MPPKAHAIAEPSDLPIHPFKSATDFEHFLEREHSTSPGIYVKLA
                     KKSSGIPSVSRDEAVETALCFGWIDGRAHAYDEDWWLVRYTPRRAKSIWSKKNVTTVE
                     SLLNAGRMRPAGLAVVEAAQADGRWARAYDGPATITVPDDLTTALTQTPAAATFFEGL
                     NRSDRYSVLVQLQWAAPQRRAKRIETLVQMLADGKTPGASDKSAKTSKRKAVDRNHEK
                     GGRRKTSKKK"
     exon            70123..70809
                     /number=1
     CDS             join(72392..72487,72557..72928,72982..73239)
                     /codon_start=1
                     /locus_tag="AO090011000027"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000028"
                     /protein_id="BAE64590.1"
                     /transl_table=1
                     /translation="MRLSEILAVALVTGATAYDLPDNLKQIYEKHKGKCSKVYQKGFT
                     NGGHSDGKSFEYCGDIEGAIFMHSSAKGGQYTNMDVDCDGANNSAGKCSNDPSGQGVT
                     AFKDEVKKFGIPDLDANLHPYIVFGNEEHSPQFKPQKYGMEPLSVMAVVCNGKLHYGI
                     WGDTNGGTSTGEASLSMAELCFPEEKPDGDHGHDDNDVLYIGFTGKDAVPGKSANWKA
                     KKTEDFEDSIKSIGDKLVAGLKA"
     exon            72392..72487
                     /number=1
     exon            72557..72928
                     /number=2
     exon            72982..73239
                     /number=3
     CDS             complement(join(73290..73297,73643..74944,75011..75179,
                     75231..75898,75947..76294,76351..76576))
                     /codon_start=1
                     /locus_tag="AO090011000028"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000029"
                     /protein_id="BAE64591.1"
                     /transl_table=1
                     /translation="MTMPGLLGYFMTMIYNPNNVAVEASPFTTVVELKAGQQLCKMFG
                     YNTDEKATDLPLSWGHITCDGTVANLESVWVARNLKFYPLTLYQAMKEGPLGFIADTF
                     QVTTCVGEEKLFKDLGVWELLNLRSDEILGMGDALYRQFGVTSKFLEEALRPFTIQTT
                     GKDVLEREFRIQKPIKYFLAQTRHYSWPKSGAIAGIGSANIQGVELDMEGRLSLDALE
                     RELNRCLEERQAVYAVVAIMGSTEEGAVDRLHDILAMRRRFQDRGLSFLVHADAAWGG
                     YFASMIPRHLMDSRMPSEEGDGEEAVGNVPSLPLREDTLRDMIALKETDSITVDPHKA
                     GYIPYPAGSLCYRDGRMRFLVTWTSPYLTQGSMENIGVYGVEGSKPGAAAMAAWMSNQ
                     TIGLDPSGYGRLLGEAAFTSARLSAWYAAMHVRQPLDNKGQRRYIIIPFNPLPIEKKG
                     YHSLDPEVDDRRQVIFDTVINLNINAFAINWYRENGKLNTDLEEANYLMRRVVNRLSI
                     TKSSGNPSEIPLFLTSTQFEPALYGQCAQNFMQRLGLNACAQDLWVVRNVVMSPFPTD
                     QDFIRTIMKELEDVIIKEVEWCRERNSPDDKEVEFLLRGTDEVFLDFQTSFHRATQRQ
                     QIILAAQLEEDTKKNYINLKKKYPMQDIAFRSKNPENLEKMMTTISQGKSYTVHGKIG
                     AREGKEFIGRTVECSVRMIQIVKSRPLNSANRDDHYPRHFMPFYLYGSQDQYHISHML
                     LQAPNVNLSACDVKLSEALSKTVRTRLRKREGLILTLTGYREETMHPFPQKNDDAVFT
                     SDHFFFRPERTFKVKVYEDPKPDIANGPGLIDNLGTPIARGEMTLGNDVHVDVEALNW
                     DPLEEVGLDVPWDSELDKIQGVLNTGRRMVSAMATTSFRDSDGRRIPTET"
     exon            complement(73290..73297)
                     /number=1
     exon            complement(73643..74944)
                     /number=2
     exon            complement(75011..75179)
                     /number=3
     exon            complement(75231..75898)
                     /number=4
     exon            complement(75947..76294)
                     /number=5
     exon            complement(76351..76576)
                     /number=6
     CDS             join(79521..79958,80017..80377,80431..80554,80614..80980,
                     81035..81352)
                     /codon_start=1
                     /locus_tag="AO090011000030"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000031"
                     /protein_id="BAE64592.1"
                     /transl_table=1
                     /translation="MGSLCRLVAVSASLFAVATAQIRVRLSPSTVNELAEPDFHTWNI
                     ENESQNASTTIDSLDLILSSSADSDLEGNSYKYQYTRPVSHLGERVVNQGITTSSDNP
                     GPITLTIQGLEAGEHTLLTWHNAWDSLNSTATISVSVDGEDKASDIEQSIRVDNIWEA
                     ATSYVTFTVDSADQAVEIVYTPTSADGLVYLNGFEIDTPALKDQISFPSPPHREEHLE
                     LGDGKSITATWRAPSSGDSVTYNVYMGNASDTLEVVNEGLSETQVTLSGLNTMDTFYW
                     RVDVISGDTTYTGRIFMFRLAQLAIPGAEGYGRFARGGRGGKVIKVTSLEDSEEPGTL
                     RYALAVATGPRIVVFDVGGVITIDSRLTVSDRYVTVAGQTAPGKGIAIQGHPLGLSGA
                     SDVIFRHVRVRPGSSSNETVDGMGMAGSNYCILDRCSMGWAIDECFSSRTAHNITFQR
                     NMISEPLNVAGHKNYPAGTAHGYAATIGGDVGSFHHNLISHAEGRSWSMGGGVDDNST
                     FAGRLDIRNNVVYNFGMAVNSISSTFN"
     exon            79521..79958
                     /number=1
     exon            80017..80377
                     /number=2
     exon            80431..80554
                     /number=3
     exon            80614..80980
                     /number=4
     exon            81035..81352
                     /number=5
     CDS             complement(join(82097..82230,82865..84347))
                     /codon_start=1
                     /locus_tag="AO090011000031"
                     /note="amino acid transporters"
                     /old_locus_tag="AO070335000032"
                     /protein_id="BAE64593.1"
                     /transl_table=1
                     /translation="MSDKTDLEKPVEKLQDDPDQALGELGYPSELRRNRSLSTILFQS
                     LSIAGIPFAESGALMQAIYGGGQLSIFVGWIVVCLMDQCVAMSLAELASRYPTSAGPY
                     YWSFQLSGKHAKLLSFMTAWVWLIGNWTITLGVNFAFAQLLVATVSIYSSWEATDWQL
                     LLVLYAICILAFVICGFGNRFLPLVDTLCAGWTLVSILVVLVAVSVSAKAGRHAPSDA
                     LAQYDTSLSGWGNFSFCIGLLPPAFVFSAIGMVSSMAEEVHAPAIKVPKAMALCIPVG
                     GTAGLFFVIPLCVTLPGLVDITNAPSGQPIPYVFQVVMGTRAGAVGLVSLLLVVGFFC
                     SISITNAASRCTWALARDTALPLSRLFSRVDDRVRIPLWALGLVTVVQMLLGLINLGS
                     SSAFTAFVSVGVIALAITYSIPISISLFYNKRAEVSKARWNCGRAVGTTVNFIALAWI
                     GFELVLFSMPSTLPVTPVSMNYASVVFVGFTTLALIWYIVHARKDTEPNSPPDTLKAG
                     LENPPARLAKSYSIDAPGATNTCGSARKLI"
     exon            complement(82097..82230)
                     /number=1
     exon            complement(82865..84347)
                     /number=2
     CDS             join(86201..86217,86352..86438,87536..88640)
                     /codon_start=1
                     /locus_tag="AO090011000032"
                     /note="magnesium transporters: CorA family"
                     /old_locus_tag="AO070335000033"
                     /protein_id="BAE64594.1"
                     /transl_table=1
                     /translation="MAVGIYIISTNLTVSKVVFSRSAYSINYLPGYSYRTIHPFRPIH
                     TQSDPNHKNAHQSQRLFDLSLSFSRTPLSGNTNMRYTRYNGHGVAMPFSKLTKLDIVN
                     QYGLSARDLRTLDVPSDGFPHILIRESTLLIHMFNLRLLVQADQMLVFHLAETSTQEP
                     DTISRVFLRDLKSKLRGDPGLGVSVGLPYELRILEAALAAVTSTLEAEYVLTKDQVMK
                     TLGMVDKEEGEIHSNLRTLLELVRKLAATEKRARQVRSAVQDVLNTDEDMAAMYLSDK
                     QAGKPHQVEDHQDVEYLLEAYYKASDAVVQEATSLMGTIQQTEESIQSILDVRRNQIM
                     VLEAKIEILMLGMAVATLVAGWYGMNVVNYFEESGTAFAVLVSSSLVAIAFLSRYGFR
                     QLRRIQKMHL"
     exon            86201..86217
                     /number=1
     exon            86352..86438
                     /number=2
     exon            87536..88640
                     /number=3
     CDS             complement(91046..91600)
                     /codon_start=1
                     /locus_tag="AO090011000033"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000034"
                     /protein_id="BAE64595.1"
                     /transl_table=1
                     /translation="MDVTQAEALGTKLHGGGREMEQAYQFRLKERERDYHRRVQQWEK
                     HRRQGTHTGGRPRRRLKPTSLDENEDSEKPSWRIQATATFPYWDVRTQILEPGTYCKA
                     CTYHWEEGNANDWRRMETIWHPHPPSREAYYRAFLEADLPRHFLNCVAVKENYDFRVK
                     RPSDIFFRRHGTDFIVGPKNNTDV"
     exon            complement(91046..91600)
                     /number=1
     CDS             complement(join(93304..93329,93385..94993))
                     /codon_start=1
                     /locus_tag="AO090011000034"
                     /note="amino acid transporters"
                     /old_locus_tag="AO070335000035"
                     /protein_id="BAE64596.1"
                     /transl_table=1
                     /translation="MLPPNKSDPEIERVDHVEKQDADPKPTLEQKNVGTLQRRLKSRH
                     VQFLALSGAIGTGLFVGTGQVLSLSGPLSMTLAFAISGLDLYAVINSMGEMATWLPLP
                     GAVPVYAARFVDEALGFALGWNYWYQFAIGVPIEISAAAMAIEYWPNTVSPAVWITIL
                     FVPMIVVNSLPVRTYGEVEFVLGAIKLTTIVGLMLLMLIITLGGAPTHDRIGFRYWKH
                     PMEEYLKTGALGRFLAFLKVFVQAIFSYGGSEIVVVAAGETENPRRNIPKAVRRVFWR
                     ITIFYVGSVFLVGMCVSARDNRLLNAIKAGAKDAGASPFVIAIQNGGIRALPSIINAV
                     ILSSAVSAGNSFFYASTRVLYSTALDGKAPRFLRYEKFGVPYACVAITTALSLLVYLN
                     VSSSSAEVFFWISNLSSVSTLVVWTAIGITYLRFHQALKYHGIPRSSLPFKSPFQPYL
                     AWFAVIFSAIMALLNGFDAFFPGHFSAKTFIPPYIAIPIFGTLYLGYKFVKGTSIIKI
                     EEIDLWSGKEEADRLEAIWEQPKPRNFLERIWFWIA"
     exon            complement(93304..93329)
                     /number=1
     exon            complement(93385..94993)
                     /number=2
     CDS             96263..97636
                     /codon_start=1
                     /locus_tag="AO090011000035"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000036"
                     /protein_id="BAE64597.1"
                     /transl_table=1
                     /translation="MASKKQIIPILLLTAIQASAAPAPQASSGAQPTSFTANPNVGPG
                     GASYKDSDHFRLYSSDQSNADAVLTMLEAAYSCYVGDLGWTTSGIPYNADPSTVTTLW
                     KENMYEVNDLGSAAGVQKSDPNTGLSWLEVVPSSLADPRVTVHEYGHALTYHSRNWVD
                     QTATGAWWETVANWVADTFSTSPLCAKARSNYNQPTGDTMIELNKVIGDSFQVIVDGS
                     TGSGNYYQAWPFLTYLTNNPDNYAGLGSDVVRQLFQQYEKDSNETPLHTLARISTAAS
                     VQEIVGRYWARMAYVDIGHTIAQKAFLNQRNRLNYANVDPQGDGTYVVKSSRKPQYMG
                     ANILPLSNAGAGNLQVSITSNGVFSATLAIRNTNTGAVRYVSLENGSGAAVMTGNEEA
                     SVVIANTPKTLYEYDAFKLTQEVQQGLDYTIKISGATVQGTAESTSTTGSTTGSTGYQ
                     GLPSFFS"
     exon            96263..97636
                     /number=1
     CDS             complement(join(98545..98731,98791..99205,99265..99815,
                     99873..100267,100318..100674))
                     /codon_start=1
                     /locus_tag="AO090011000036"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000037"
                     /protein_id="BAE64598.1"
                     /transl_table=1
                     /translation="MRGLLLAGALGLPLAVLAHPTHHAHGLQRRTVDLNSFRLHQAAK
                     YINATESSSDVSSSFSPFTEQSYVETATQLVKNILPDATFRVVKDHYIGSNGVAHVNF
                     RQTAHGLDIDNADFNVNVGKNGKIFSYGHSFYTGKIPDANPLTKRDYTDPVAALRGTN
                     EALQLSITLDQVSTEATEDKESFNFKGVSGTVSDPKAQLVYLVKEDGSLALTWKVETD
                     IDSNWLLTYIDANTGKDVHGVVDYVAEADYQVYAWGINDPTEGPRTVISDPWDSSASA
                     FTWISDGENNYTTTRGNNGIAQSNPTGGSQYLKNYRPDSPDLKFQYPYSLNATPPESY
                     IDASITQLFYTANTYHDLLYTLGFNEEAGNFQYDNNGKGGAGNDYVILNAQDGSGTNN
                     ANFATPPDGQPGRMRMYIWTESQPYRDGSFEAGIVIHEYTHGLSNRLTGGPANSRCLN
                     ALESGGMGEGWGDFMATAIRLKAGDTHSTDYTMGEWAANKKGGIRAYPFSTSLETNPL
                     TYTSLNELDEVHAIGAVWANVLYELLWNLIDKHGKNDGPKPEFKDGVPTDGKYLAMKL
                     VIDGMALQPCNPNCVQARDAILDADKALTDGANKCEIWKAFAKRGLGEGAEYHASRRV
                     GSDKVPSDAC"
     exon            complement(98545..98731)
                     /number=1
     exon            complement(98791..99205)
                     /number=2
     exon            complement(99265..99815)
                     /number=3
     exon            complement(99873..100267)
                     /number=4
     exon            complement(100318..100674)
                     /number=5
     CDS             complement(join(102008..102251,102310..102690,
                     102759..102842,102906..103008,104049..104079))
                     /codon_start=1
                     /locus_tag="AO090011000037"
                     /note="multidrug resistance-associated
                     protein/mitoxantrone resistance protein, ABC superfamily"
                     /old_locus_tag="AO070335000038"
                     /protein_id="BAE64599.1"
                     /transl_table=1
                     /translation="MAYVVTITYPSTIESEHLADETAVPPPDWPARGAIEFSNVVASY
                     KNSSTRALDHISLSIKAGTKVGICGRSGSGKSSLVSSLFRLIELTSGTINIDGLDISL
                     LARNHLRAQLNCIPQEPFLLPGCSVRLNVDPGMSIHDDIIIDALKKVQLWDPVRELGG
                     LDATITPDTFSPGQKQLLCFARAMVRPEGKILVLDEATSSIDTKTDDLIQSLIRSEFA
                     DHTVIAIAHRLETIIDFDEIIVVDAGRVEEQGPPAVLLERGGAFAELYWDKDRGSDRA
                     PLRL"
     exon            complement(102008..102251)
                     /number=1
     exon            complement(102310..102690)
                     /number=2
     exon            complement(102759..102842)
                     /number=3
     exon            complement(102906..103008)
                     /number=4
     exon            complement(104049..104079)
                     /number=5
     CDS             complement(join(104867..105963,106018..106297,
                     106355..106584,106648..107179,107241..107483))
                     /codon_start=1
                     /locus_tag="AO090011000038"
                     /note="multidrug resistance-associated
                     protein/mitoxantrone resistance protein, ABC superfamily"
                     /old_locus_tag="AO070335000039"
                     /protein_id="BAE64600.1"
                     /transl_table=1
                     /translation="MSSFWLHPRAATACPIAVEDTFGPVVNHECKDGFDFTLYFEETV
                     LTLPVTLFFLFWALPRIYHLRQQTIKVQGGYRYFVKLGGYALLAVLQLTLVGLWAAPS
                     GKTTRATIATAVVSWLASIVFGVLSHYEHICTIRPATINCGYLFLSSILSLAETRTLY
                     FLEKNREIAVVYTVTQCIKVVLLITETMSKRSLLRRNYRDSPPESTVGILGECLYCWL
                     NPLLMLGNRVDLTVELLPPIEDSLRSTGQGESGLHALWRKDPNRNSPHSLLWACCRYY
                     LVPILLGVVPRALQVAFTFAQPFLVEATTTWVASNELTHPKAQGYALIGAFGIIYTGI
                     AVSTAFAHHQAYRVVSMIRASLVDMLYSHVMVMRDIDVETSAPVTLMSADMERISGGL
                     HYIHDAWACIVEIPIALYLLWRQLGVASIAPIIVVFICMAMSLLISGLAGPRQQVWLE
                     AIEKRVDITAKVLGSVKGVRTAGLTDKLFNLVQTMRIEEVVKSEKFRRLLILVVGVAY
                     SNVTLSPLASFTIYALIARHKGDETLTAAKAFTSLTLFTLLATPISNLVEAATGVATA
                     IGSIKRVNEFLQSDPRRDDAHEPRGTRSNISIPASVLSSALTEMGVVYDGKGMSVVEG
                     VPSISSREKLPLYYEVTGPVFVAEGRSAGWEESKPAVVQDLTFEIHRGTVTFVVGPVG
                     SGKSTFVRTLLRETPIFSGGLKADPDSIAYCSQTPWLTNNTIQENILGESLFDLRWYN
                     TVIDACALYDDIRKQPDGDRTMLGTQGAILSGGQKQRVVCFFLLTLTSSSFHG"
     exon            complement(104867..105963)
                     /number=1
     exon            complement(106018..106297)
                     /number=2
     exon            complement(106355..106584)
                     /number=3
     exon            complement(106648..107179)
                     /number=4
     exon            complement(107241..107483)
                     /number=5
     CDS             complement(107885..108643)
                     /codon_start=1
                     /locus_tag="AO090011000039"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000040"
                     /protein_id="BAE64601.1"
                     /transl_table=1
                     /translation="MNHLVWKRNQSSISSSDGPSVLFRPLRTRSYCSLAEVDFNLHKS
                     NSTFYADLDISRIELLLLLFKDVITPLSPPSRYHHSGGPYKSDEQQAGSLKHLTPALG
                     GVSCIFRREIKPWQRYDLESRILCWDDKWLYIVSHFLKPGSHSETGTGGSEEGVLASA
                     ISKYVFKKGRRTVTPEEVLQFLHLVEDGDHADADADANANADAYADASIERSGLGPKV
                     RGQGDQQEHIEVKRKRGLALAAHMAGLDGLHRVA"
     exon            complement(107885..108643)
                     /number=1
     CDS             complement(join(109146..109226,109285..109853,
                     109920..110408,110473..115780))
                     /codon_start=1
                     /locus_tag="AO090011000040"
                     /note="enoyl reductase domain of yeast-type FAS1"
                     /old_locus_tag="AO070335000041"
                     /protein_id="BAE64602.1"
                     /transl_table=1
                     /translation="MFSTINASSVASRSPSLASAGSAASFALGSGWATPELLSTSSTS
                     SHACQTLTITYHVFEHSLTVASGSYPTALQLRDDFLHDLSKTSGDEELSSLVELWARF
                     LSFTVRRLERERRGLKEDDLRVLLATAMDTFERDILWNREVHVVVKELDASTEVKSTI
                     LAAYFQARHALRKISRPSHPPSALMAAALDRKAHLYTMFGGQGNDENYFDELRMVYNT
                     YRPLVRDLVVSASSMLQRQSLDDRFSRFYHQGLDIITWLEHSERAPDSAYLISAPLSM
                     PLIGLLQLAWYRVIGRVLGSTPAQIQAALAGTTGHSQGIVTATVTAVAQSWTQFDSLS
                     LDALRLLLAIGAYSQDHFAVAELPPVIVADAEAHGEGFPGPMLSVTDCPLDQLQKYVD
                     AVNAHLSEDARIAIALINGPQSAVLAGPPLSLHGFNVWLRGVKAPAKGTQHRIPFSKR
                     KPEISNRFLPITAAFHSSYLADVSDAVLASVPDLTIRGDDLRIPVFCTRTGSDLRAFG
                     SQNIVPDLVAMITSQELVWTEATKLPGATHIIDFGPGGVSGIGALTNRLKDGTGVRTI
                     LATVAEGTNTDLGYRSEIFDWCPSPALAYGQIWSEQYRPKLVQVSGSRPMVDTKLSRL
                     LGLPPVIVAGMTPTTTAWDFCAAVMKAGYHVELALGGYHRADQLETAIQRLLKEIPPG
                     RGITVNMIYAAPKAVRWQVPLLTRLRASGVPIEGLTVGAGVPSLEVATSYIRDLGLRH
                     ISFKPGSLPAIHQVIAIARAHPNFPVILQWTGGRGGGHHSFEDFHQPILQAYGAVRSC
                     SNLILVAGSGFGGAEDTFPYLTGEWAQRYNRPLMPFDGILVGSRMMTAKEAHTSPAVK
                     QAIVAAPGVADEADWEQTYTQPAGGIMTVTSEMGEPIHKLATRGVRLWAELDRTIFKL
                     DRAKRLTELQKQRDYIIRRLNADSHKVWFGRDELGNVVDLEEMTYAEVISRLVELTYV
                     SLEGRWIDPSFQQFLFDFLLRVEARIGHEREEQDGDDMEITSSVVASVDDLRDPKPAI
                     DKFLEQNPCAADQLMGTQDAQYFLHLCRRRGQKPVPFVPVLDENFEEYFKKDSLWQSE
                     DLNAVVDGDVERVCILHGPVAARHSTVVDEPARKILDAIHDGHIERLEMRDPDYFEDG
                     IPIVHCFGPYPTVSEWSMAQAGIHCVPVGNTGSLLYEVSPEMNAPMPSLDQWLAALGG
                     TQGGWRQAFFNAPTIVQGRAISENPLRRLFQPTRDSYVMVQTGHRSDTTVSLFEYRPH
                     SEPVKVVDIRADESGSITLEIINYRNAGGAAIGLRLMYQYRRDAVYAPIHEIMDGRNE
                     RVKEFYYRVWFTNSQPKKWTSVHDTFCETGLEVTADSIAEFAHCVQNASDASSKRRGK
                     TLYAPLDFGVVVGWEALMKPLFSHELDVDLLTLVHLTNGFRIPPDAQPIQEGAVLETK
                     SRIQAITIEDAGKLVEVRGDVCQDGKVVLELTSQFLYRGTHTDWENTFRKVDEEEMEL
                     CLSGPMEVALLKSKPWFKPRDADLDLQDQTLIFVLQSTYQYASRDTFKAVTTVGDVRL
                     KSSLPGRSSSVATVAFYAATCRGNPVMDYLQRHGSPVKKRHMFNSPNPLTGEGSSLMM
                     RMPDSNEAYAHVSWDFNPIHVSSSLSRYADLPGLITHGMYTSARVRGLVEHYTCASAI
                     GAFRSFNCSFTSMVLPGDEIEVIFQHVGMLAGRKIISVEAKHVGRGETVLRGEAEVEP
                     EETALLFTGQGSQQKGMGMQLYTQSEAARQVWDYADTYFSDNYGFRITDIVRNDPKEL
                     TVYFGGPQGRHIREKYMSMKRESVGTDGNVQLLPLFPEIDEDTEFYTYHAPQGLLSAT
                     QFTQPALTLMELAIFADLQAKGLISERSSYAGHSLGEYAALGAVGKIFSVESLVQVVF
                     YRGLLMQFAVERDDRGQSDFRMCAVDPSRVCAGFDQAALQLVVETIAAETGQLLQIVN
                     FNVAGLQYVCAGQASLSDSCVLPCSLANSQQVQPLRCLKSVLDHINATAASTLPSNVL
                     SPDQLTSLVKSQVATTQTNTALTRGCATIPLKGIDIPFHSSHLLPGVPGFRRCLLDLI
                     DRHALDPKRLVGKYVPNLTARPFQLTKEYFEMVKDLTGSVALGGVLNEWETYMSTAGT
                     CGMEKIESVIQSMKVF"
     exon            complement(109146..109226)
                     /number=1
     exon            complement(109285..109853)
                     /number=2
     exon            complement(109920..110408)
                     /number=3
     exon            complement(110473..115780)
                     /number=4
     CDS             join(117022..117192,117250..117666)
                     /codon_start=1
                     /locus_tag="AO090011000041"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000042"
                     /protein_id="BAE64603.1"
                     /transl_table=1
                     /translation="MNIYTAGIAIQEFFILCFLALLIVFHKRMLSGYRNLERGNGWKL
                     MVYGMYATLLCLTTRIVYRLIEFANPNQAGKTVLSTKEAPFYILECVPIFIGMMLWNV
                     LHPGRMMPGPDSEFPKLSRSEKKQMKQEAKEAKKQERRVGFSKKYTAVNDSEYTLTRP
                     SDEEHEAGYGGGRWPLNEVESGRGGYGGREYGYVR"
     exon            117022..117192
                     /number=1
     exon            117250..117666
                     /number=2
     CDS             complement(118053..118754)
                     /codon_start=1
                     /locus_tag="AO090011000042"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000043"
                     /protein_id="BAE64604.1"
                     /transl_table=1
                     /translation="MAGRGPSYNPIEEAYALANTNNGNLSNSHPSAVPVSAADTVKSS
                     QPIHAPSPSITPNPSPPTVVESVPSHSTPPGESSLANTALHRAALYGHESVLGVLISA
                     GADASIADSAGLTPLHLAAMEGHARLVTLLLDSPTGSGVNINVTTREGETALHLAVKH
                     HRPEVVQVLLCPTRRHALQVDAQDWLGRTALHLACERNRRDLVEMLVQAGAQLMIRDL
                     EGQTPLHTACLGKNM"
     exon            complement(118053..118754)
                     /number=1
     CDS             complement(join(121832..130825,130881..138728,
                     138796..141011,141067..142147,142205..142723))
                     /codon_start=1
                     /locus_tag="AO090011000043"
                     /note="non-ribosomal peptide synthetase modules and
                     related proteins"
                     /old_locus_tag="AO080523000042"
                     /protein_id="BAE64605.1"
                     /transl_table=1
                     /translation="MGDAGDYTAFQAITAQIPMGSKGSSFFFPTLTDGVILDKEQTDQ
                     AQIPLDLGTVSQGKALAAFCERHGLSVLSVLNVAWAMVLSAYADTETVGFLFVRFVAG
                     VPHVGVYQAEIDGGKSVLKTLVDAEETLQASISSSALMTPAEFQELSARAGGPAFNSV
                     VMLYDEESPEREQPGNYLAIHARYLQDQFVVDLQCPTSLIPASQAKHCAATLSHVLGE
                     IIKAPRTPLSEVSLMSQDGMHQIWEWNKRMPEVVSRCLHHLIDERARKEPEALAIQGP
                     DGCMTYGELQALTDRLAHYLVDRGVGPEVAVPLFFEKSKWAIVTMIAVVKAGGAIVNL
                     DAKQPRSRLMEIMEQLQAPLILTSQQYEPLWQDNCNVFSVHQESVMALPAQKASPVVA
                     VTPKNILYIIFTSGSTGTPKGCVVEHESFLTAAIQHVTAGEIDPTSRILQMTPYTFDV
                     SMLEIFTTLTTGACVCFPSDELAQHGIAHIINALRITWTFMTPSVVRLVDPADVPTLK
                     TLALGGEALSQIDVTTWAGKLHLINGYGPSECSVAATINPHLTPDADPANIGRGYGAV
                     CWVVHPDDHNRLVPIGAVGELLIQGPIVARGYLNEPAKTEAVFLDEAPVFLQNMTSKP
                     APFRLYKTGDLVRNNSDGTISFIGRKDRQVKLRGQRLELGEIEQRLSVDSMVRHARVL
                     LPKAGPCKGNLVAVLSLHTFPYEGPRDAEVHELLIDQRKQARGFIPEISTRLAAQVPG
                     YMVPTFWVVVAALPFTTSGKVNGVALNQWVRDMDEDTYNEIAGIAEEEETNETVQLSD
                     TELLLQEIWAEELGLPLPKLKHNRSFIALGGDSITAMKVVARCRREQLKVSVLDVVRA
                     KSLIDLASKTVRSSQVSVEEDTVIAPASTPAERTAAIDDALLSKAGLSSKDDVEDIYG
                     CSPVQDGILLSQVKFPGTYEIRRVLKVLSIMDATTTILGLQRAWQGVVDRHQSLRSIF
                     VDAGGIFQQIVLKNVTASVHCCEYMCSDDEAEVTNFLKSLPSPTYNASEPQHHLTICR
                     TRGDNVYMMVELSHAIVDGGSTEVVLQEMSLAFDGKSFTEPASLYSDYIQYISSPEHS
                     QGESMSHWTSYLAGVQPTIVPMYPRDGQSKQIRSVKVPFAGMKDLSKFSVAHGVTIAN
                     VIQTAWALVLRAYTGSDDVCFGYVASGRDVPVKGIENAVGAFINMLVCRVRLDQHQAA
                     LDAVDTMQNDYFTALAHQHCSLAQIQHGLNLSGMPLFNSIISLQKGVPDQQFGDALSF
                     RAVQEDDPTDFDLAVAIDITTDDVEISIGYWSSSLTQGDAMNLANTFSAAIYGIIDQG
                     GVKPTDIDLFNEQDRAQIFEWNKIEPVAESGCVHEYFYDQVKKQPDAQAVCAWDGEYT
                     YSELDLLSEKLAHHLAKLGAGPEVLIPHCFEKSRLATVTMVAIMKSGSAGVGLSSAHP
                     LSRIQDILDGCQARVAVVSAQHAKLLEGLVEHIVVVDESFLDELPAPTDNCTLPQAQP
                     SNPAFVSFTSGSTGKPKGIVLEHRSLITSIQAHGSEWGVGPGSRVLQFSAYAFDASVS
                     DTFTTLTRGGTVCIPCEKDRVDDLAGAINKLGVNWAFLTPRVLGLLSPETVPTLKTVV
                     LGGEAISREDIAPWTDALELRIVYGPTECTIYSMGTEPLTADSDPAGLGHAVGTRLWV
                     TDPENTNKLLPVGCIGELIIEGPLVTRGYLNEPEKTKAAFFEDPAWLPKPENGQPRRF
                     YKTSDLVRYYPDGQLRFIGRKDTQIKVRGQRVELGEIEHAILENLPGAAHVTVDSVVL
                     PPQTLVAFLKMENASSTENELFVPLSPEFTAKLRVLEKVLSDTLPVYMLPSLFIPISH
                     IPMTISGKVDRIALRRAVPGLSHEQMEMYALANQDKAAPQTKEEEQLRTLWAAVLGKD
                     PSLVGRNDNFFRLGGDSIGAMKLVVATREANLLLTVADIFRYPELSQMAQRVELAKAD
                     EQVNVYEPFSMLNNATNTDALLEEAAGHCSIARSDIQDVYPCTPLQEGVFSMSNTHTG
                     AYVAQSAFRLPAGFDIQRFKDAWQTLVDAHSILRTRIVTIGSTSYQVVLTEDAAKLEW
                     QQDSSLEKYLQRDHAISVTSGTPLTRYAIVEDSGSSIFVWTAHHAMYDGWTVPLLFEQ
                     LEQAYTGGVAPSTAPSYAQFVEYIQETDPEASQEFWRSMAPQEPPSSFPRLPYATYQP
                     RAKKTCHRDVEVALEPGSSLTMAILLRAAWAIVMARYTDSEDILYGLTLSGRDALVPH
                     IESIVGPTITTVPMNVHLDSEASLQSFLESQHEQNVEMMNFQHVGLRNIRQISPQVLA
                     ATDFTNLFVVQPKADGRRAFAELEAVPTDMTEFDPYALVVECNLGDGSVHLEARVDDD
                     VLSVDLTEKLLGHFEHVLRQIIRPSADVKLGDIDLFSKEDEQQIWEWNAVAPTAVNEC
                     VHEKISQQATLNPENMAIEAWDGNLTYRELDELSSRLAYHLSSEYSVKPETLLPLCFD
                     KSVWTVVTMVAVIKAGGACVMLNPDHPVTRLQALIEDTGSHLVLTSPQHQGLFGSVSA
                     SVVPITKTLIQELAPVSTSQLASLQVQPTNPVFMIFTSGSTGKPKGIIVQHNSVCTVA
                     TQHGEGLGFGGPGSRVLQFASFTFDVSMGETFFTLMKGGTLCIPTEHDRINNLAGVIN
                     SMQITWTFMTPTVAALLDPKEVPHLETLTLGGEAVSQSLVDRWASQVNMIDSYGPAEC
                     TIWASHANPSATVSPANIGTGTACRYWVVETSDYNRLAPVGCVGELLIEGPNVARGYL
                     NEPEKTRDAFVESPAWMQGKETPQYKFYRTGDLVRYNPDGTLNIAGRKDSQVKFHGQR
                     IELGEIEFHLRAQRAVEAGMVTLPKAGPCKGKLVAVVALSDLQPLALEGDCVELVSDD
                     AKSTAQPLIMEIEEELSSVLPSYMVPSVWIVLDSIPLTASRKINRVPITRWVTDITEE
                     TYRRIVNISSASVNLPTTALEKQLAQVWSQVLNIPEKSIGLNRSFMSLGGDSITAMQV
                     VSRCRATGIKLTVQDILLPKSLAAVVSRASSLGDRAVTRQETYDVPFGLSPIQKVYFN
                     DVVRQATQHHYNQSVLLRLTRPVSTAAVSSAIEQIVARNSMLRAKFIRGDNGEWSQMV
                     QSQSNGSFKIGFHSAASRQEMLDVINSSQRNVDIENGPIFVVDHFNLCDEERGESSLD
                     CREGQLLSLIAHHLVVDAVSWHVIVAQLEASLLSQGSSPHAPMPFHNWAQEQCHFGEQ
                     LAPKSVLPTDIPPANLLYWGMQELPTWKNVEEVRFTIDDNTTSLLLGAANTALRTEPI
                     DILLAAIQQSFNQTFTDRAVPAIFSEGHGREPWDNSIDLSETVGWFTTFYPVHRRMRK
                     DESIKDGIKRTKDVRRSFNDNGFSYFSCRHYSAEGRKAFNDHRAMEICFNYLGQAQQL
                     ERSDALLKEEPLRVDEEVQNIGEGMGRLAVFDISAAVSFGQLGVSFFFNRDMGRQEQV
                     RDWINRCEKAIQFAVQDLVASSVEHTLSDFPLMKISYPALSNFTNTVLPALGISPDNV
                     EDLYPCSPIQEGILLSQTRRPGTYEVRQLFEVVPRSDVGAVDLPRLLKAWQQTVDRHS
                     ILRTVFIGSLSGDGVYDQLVLRSYQAAVQRLTFSGTDVVSLFQGQQSPDYTKPVPGHR
                     LTICEGPQSIYCQIELSHTLVDGTSLALLVRDFVSAYENTLPAGPGPLYSEYIRYLGG
                     LSKSASLKYWTDRLAGAQSCHFPNMRIGNGDSGSETKTYKDMLIHIDEDGKLQRFCES
                     QSITMSNLVQAAWGMVLRAYTSQEDVMFGYMASGRDVPLDGIYDAVGPFINLLVSRMQ
                     LVDDMSVYKLLKDIQLSYMNSLPHQQTSLAAIQHELGNKDVALFNTVLSLQRQPSRGP
                     APQVDFHIVDQADPTEYDISLCITTHDVPGVEIHMTYLTAILSDSQANELMQAFTNVL
                     ATLADTPEMSLSSVDVISHSRGEELQRLKAVSRTLNGRTFDLASIQNRLSMALPDTED
                     AVVEVISLNQLGARQCMAVFHSEVNNAKAEVSLMPVTDGHRAKFTDLKETLGSYLPEE
                     LIPTLYLPVNGLPLERAALQKLVDGLNEQQLKQYQLVTVEECVALTANEKILLALWVE
                     VLELSDSSTVTPSASFFRLGGDSIGAMKLVAAARNQGLALTINSVFQKPTLSAMAKEL
                     SLLDQSEEHQLEPFSLLPPQLDSERLATEAASLCGISRTAVEDIYPCTPLQEGLMVLN
                     RQNAASYTNQTIFALPDTLDLPRFKEAWERVAERSTILRTRMVNASDGLFQVVLKQTM
                     TWESADDLDAYLKNDSSNPIDYGQPMARYAIVSAATQKYFVWTAHHSIYDGMTIPIIT
                     KQVSAEYNNEMALPEVPYNRFIQYIKGITPESATEFWTAQFAEPSVTYPILQDRTYQP
                     YPNQAITRAVHLSREPSDITFTTILKAAWAFVLAGLTETEKVTFGVTVSGRNAGLAGI
                     NQVVGPTIATVPVSIAVDGSQPPLDFLQNIQQNFLDMVPFEHTGLQNIRLMSEQAKEA
                     VEFQNLLVIQPKAAPVEASDFLGLTPVPTSHRDDQDPYALIIECNLLDDGVDIKAQFD
                     DNVISSEEIKRIISRYSRAIERLSSIQEAGGDDSINALEEIGTISEEDLQQILEWNKD
                     RPETIQSCVHYQFEEQVRRQPDAPAISSYDVELTYSQLNLLAEKLAHELISRGVKQEM
                     IIPLCFNKCSWTIIAMLAVMKAGGVCCMFNPEHPRDRIQLLLDDLDASLVVCDQASSA
                     MLSSLLPPSGVLPIGADYLDSLPCPNEPVGAIAQPSNAVFIVYTSGSTGKPKGSILEH
                     RSLVTGLIAHLSEMSVGPGTRAFQFASYTFDVSFDEIIGSLMLGGCVCVPSEYERMNA
                     LTEAMAKYRVTWTELTTTVASLLVPSRIPTLKTLVLSGEPLTKEVVNLWSDHVQIINS
                     YGPSECCVCTTCNSQTSFTKDPTNIGRGLGCTLWVVDPDNIDRLLPIGSTGELLIEGP
                     IVARGYLNEPEKTAAAFINPPKWWIPHDKGNGRMYRSGDLVRYNRDGSFKFIGRKDTQ
                     VKLHGQRIEMGEIEHRIRTVYDDNSYQVAVEVLTPKSRGSLKILTAFICVPEAASGDV
                     DTLLVPLSGPLRRSFQALQARLREVLPKHMVPQLFIPVSHMPLSPSRKLDRKVLRTVG
                     NGLSPETLASYALSQAEKKAPSTETEKALAQLWARVLGTDSIGVDDHFFHLGGDSIAA
                     MKLVAAGSKAGLSMSVADVTNYPKLNKMAENLDRSSSRKEVNDAPPEPFSLLPGDQVK
                     DILTQATTQCAVDASVIEDIYPCNPSQEALMALTAKDETAYVSRQVFRLPVDIDLEKY
                     QQAWESLAQLQPIMRTRIIYTADSKSFQVVISEPLVWRWEDSVEEYVRADKLSPMVHG
                     QPLMRNAVVPGDQNDPRPFLIHTSHHATYDGWSQGSMFEQVGIIYREGLSALPPVVPY
                     SKFIQHLTTSDREAAEAFWSSQIEGNLPAQFPNTSHSAKSLRPNQTRSLHIRLPERDN
                     LTFTTPTVLKSAWSLLLSRYTTSHDVVFGHVLSGRSTSLHGAADIMGPMIATVPLRVR
                     LDQAQTIEELMGGIQQQALDMTPFEQFGLQNIRRMQPNGSAIADFGHLFVIQPILEDS
                     ENDLDLELVSSVQFEFDTYPLIVECHLGDSELDVRVRYDDMLIPEQQMGWLLQHYENL
                     ILQLFRLPQNTLMTDLTMAGQTDVDQLLDWMGAPIEPVNARVHDLFSVQSRFHPQRQA
                     VDAWDGSLTYQELDQLSSQFSDVLVKLGVTAGCTVGWCFDKSKWAIVSQLAIMKAGGA
                     CVNLNPEDSVSRLTDIAHDTGIDHVIAAPQYADLAAAIGSSHVVIADATTASELAATS
                     TDLPRARTAVDSSSPAYLAFTSDSTAKPQIMAIAHRAICTSIRNHGSAVKITSKSRVL
                     QAAAYTSDVSYAEIFTTLLSGGTVCVISEHDQTKDLASAINRVGANWACLTPTIANSL
                     RPTDVPKLKTLVLSGECPTQDSLKVWAGKVDTLLNAYGSSEASVWCSVSQFTHPKDSF
                     ANIGFPVGCRLWVTEPENVNKLAPLGCLGELVIEGPVLSEGYMGHPQASEAAFVDRPD
                     WMQHIYPADGFARVYRTGDMVKFNVNGSIEYLGRKDTQLKMYGQRIDPRELEHTIKSH
                     IPSTYDVLVDTTLVSSRNRNMLVAYLYDESIQSPDVEIDSLTDTMTTNLQQELTTVQS
                     ALQTSVPHYLLPILFIPLKTMPTDSFGKADRDMLSRMVDSLSDVQLQTYSLATAGKRP
                     PKTEMELTLTRLWAEVLMINRESIGADDSFFALGGDSIVAMKLVSLARASKIFLSVAD
                     IFNHPSLADIAALATANAPVTPGDGTPVLSPSKGSSTCDSSLLDTIAAKVGVEEGQVE
                     EICPTTSMQEIALIGAMTRPRWMLNYFYFESSDPVDVDRLRQGCFELVRHFSILRTVF
                     TEHDSQFWQVVLRQLDPVFLVIPTDDLDETTQRVYEEGKAGDLQIEKPFIQFVLAQQR
                     RGHAHRLIMRISHAQYDGVSLPTIWEALQNAYAGQALSPSPSFSTFTSFCPASDDAAA
                     IEHWQSLLEGSTMTNFVERHKPGLRDVSDEVITVRRRVPNTKLTSEGITFATVAKSAW
                     ALVLARMAARPDVVFGHTISGRNLAIDNIDRIVGPCLNVVPVRAQFKDHWTVMDLLRT
                     IQNQQVANMPFESLGFRSIVEQCTDWPRWMRFSSVIQHQNIDPDRAMMMGNGSYEPGF
                     IGSELDLMDVSILSTPAGDHVDIDLITATSVMSPIQAEDLLDQLCLTIRSFSSSPSTT
                     FLPSVEELEAGRPLIPMVRESSVPDVVIGADFSEPKVAALREAVHQAWTDTLPSTNKS
                     IVSPTECYFTAGGELMGLSQVLLRLQEHAPQLRLEDLLHHSSMEQMVNLLYTHTP"
     exon            complement(121832..130825)
                     /number=1
     exon            complement(130881..138728)
                     /number=2
     exon            complement(138796..141011)
                     /number=3
     exon            complement(141067..142147)
                     /number=4
     exon            complement(142205..142723)
                     /number=5
     CDS             join(147752..147881,147953..148093,148156..148775,
                     148831..149100)
                     /codon_start=1
                     /locus_tag="AO090011000044"
                     /note="branched-chain amino acid
                     aminotransferase/4-amino-4-deoxychorismate lyase"
                     /old_locus_tag="AO070335000046"
                     /protein_id="BAE64606.1"
                     /transl_table=1
                     /translation="MTFPPAPAANIGPYPIRAYTGWMETNDSCGIDWTKLGLAVTDLV
                     NGHVESTYSVTTGEWTSPKFVEDPYLRIHGLAPALNYGQQVYEGLKAYRSATDQILLF
                     RPRFHAARMQHSAEVVSIPAVPTDHFLECVNLAVARNAEWVPPHASGAALYVRPVLLG
                     SAAHFALTPPAEFTFCVYVQPFSTYHGIAPLPAVVLEDFDRAAPRGTGHAKIGGNYAP
                     VMKWSEKAKKEGFPMTLHLDSATHSEIDEFSTSGFLGAKMDGDKPVLVVPKSDNIIGS
                     VTSDSCMQIARSLGWTVEHRSVKYEELATFKEVMAVGTAAALVPIRSITRKSRDDHFV
                     YTEEKSAGPVCQQLYAALTKIQRGEAEDQFGWREEVKGTSDVGSSGSFCIIM"
     exon            147752..147881
                     /number=1
     exon            147953..148093
                     /number=2
     exon            148156..148775
                     /number=3
     exon            148831..149100
                     /number=4
     CDS             complement(join(149759..150396,150455..150820,
                     150877..151143,151209..151268,151330..151480,
                     151538..151615))
                     /codon_start=1
                     /locus_tag="AO090011000045"
                     /note="cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies"
                     /old_locus_tag="AO070335000047"
                     /protein_id="BAE64607.1"
                     /transl_table=1
                     /translation="MQAVALLRHVPLFAYVTAVPVALLAYVLAICIYRIWFHPLAKYP
                     GPLLAKVTNLYGGYYAWKGDLHIDMMRCHEKYGNYVRYAPNRVLFNTNTGLKEIYAYS
                     KSFQKSAAYGAMVHRAPNTLTLIDKKQHGRKRRIIGQGFGDAALRGFEGTIMSLVRKF
                     CDELAKDISGRKAGEWSTPQNMGKWSNYLTFDIMSGIIFGESFDLIGSPKNREIVKCI
                     EDSNVRTGVLSQAGELSTRRLDRWLFPQAIQGRNAFIRFVNILLKKRMSAKPLKRHDA
                     FSFLLDAVDPETQQGFTPAEIGAESTTMIVAGSDTSSTAIASTFFYLCRNREWYEKAK
                     EEVRAAFPGPDDVALGPALNNCVILRACIDESLRMSPPASSSLWREVLDDGVIIDGQV
                     VPRGYDVGTCIYAIQHNPDYYPEPFEYRPDRWLDPVPEKVQLARSAFSPFSIGPRSCL
                     GKGLAWTELMLTMAYMLSKYEFRSAPGEDEKVGGGHVDMGAGRQREGEYQLRDHVTAA
                     KDGPIVQVSFR"
     exon            complement(149759..150396)
                     /number=1
     exon            complement(150455..150820)
                     /number=2
     exon            complement(150877..151143)
                     /number=3
     exon            complement(151209..151268)
                     /number=4
     exon            complement(151330..151480)
                     /number=5
     exon            complement(151538..151615)
                     /number=6
     CDS             join(152334..152389,152459..152485,152545..153008,
                     153071..156781,156843..157428,159228..159735)
                     /codon_start=1
                     /locus_tag="AO090011000046"
                     /note="3-oxoacyl-(acyl-carrier-protein) synthase"
                     /old_locus_tag="AO070335000048"
                     /protein_id="BAE64608.1"
                     /transl_table=1
                     /translation="MQPEVEQQLAYVLLIELLAHQFASPVQWIETQDGLITEQNVERF
                     IEIGPADILTGMLRKTVGQQYKSQDAARHMTRKLLSYAQNADEIQYISGSSTATSRPA
                     VKPHPLLSQGPSASSKTAETIPPAPAETQINTAPAPVAKVAMVADAPVQAKDIVIAII
                     AQKLRKSHAEVATDKTIKLLVSGRSTLENEIVGDLDAEFGSLPERAEELGLEELCNTL
                     QSGAAFSGQLGKVSTGIVSRVFAQKLPAGFSSGDARDYLQTRWGLGAGRQDSVFLRAS
                     TAQTSSRLASSGEAQTFFDQIVQQYATDNGLNLSASAPAAEAAAVSAPVDSKALGLVK
                     KDQERLRKAQMELYARLLGKDLGHDAREALKAQLATVKLQEQLDFITAEVGDVFISGI
                     RPLWAAAKVRRYNSSWNWVLQDTLHLFHRILRGNFGNADFPKYSNAIANRSSPRLLQM
                     IKYLSNSPCSLWGTRFPEAKTVMRRLVDLCEKPRAPRFEPLAANYDAFIKGPSTTVDE
                     NGHIKYREVPRGGSPVIASIHIKTQRHSTWLTDRSVTALYLDEVQSSWNDGITFINKC
                     VLMTGVSIGSIGAEILKGLLSGGAKVVVTTSSYSSATTRFYQRLYVEHGSRGSELIVA
                     PFNQGSQHDLDGLVEYIYTSGTGLGWDLDHVVPFAAISEAGREIDNIDAKSELAHRIM
                     LTNTLRLLGAIKRQKQLRGYRTRPTQVILPLSPNHGAFGNDGLYGESKIALESLFEKW
                     HSESWSTYLSICGAVIGWTRGTGLMADNNIVAAGIERHGVQTFSTAEMGAYILVLMTR
                     KLANQCNVQPLYADLTGGLNTIPNLRATLDKVRREIVDKSAMRTVLAREQAAEQKLTT
                     CSSPTTPEKGARTRLANIRFSFPALPDAKTEVDPLRANLMGMADLERIVVVTGFSEVG
                     PYGNSRTRWQMEATGRLSLEGCIEMAWIMGLIKHHDGPLDGKHFTGWVDAKTKKPVQD
                     MDVKARYEEHILNHTGIRLVEPDLDPSEPPGKRRLLQEVVLEEDLPPFEVSPEVAEQL
                     INEHGENLVDISPQGEQCVVNLKKGVVLMIPKALQYQHAVAGQVPTGWDARAYGIPED
                     IVAQVDRGTLFTLVSTMEALVASGITDPYELYQYIHLSEFGNCIGSGLGGVHSLKKMF
                     RDRYLDKDVQKDILQETFINTTAAWVNMLLISSAGPIRTSVGACATSIESLETGFETI
                     VTGRAKICLVGGYDDMTQALAEEFANMKATTNPEEEAKKGRLPQEMSRPAAESRSGFV
                     ESQGSGVQVITSARLALDLGLPIHGIVAWVGTASDKTSRSVPAPGQGILTNAREKPNS
                     RFPSPLLDIRYRKRRLEARLKQINESVDLEVQMLEEQMTQDGEVPEELQEELQNHKRF
                     VEGEAERQRKEALNTFGNEFWKNESAISPVRGSLAVFGLTIDDLDFVSLHGTSTVMND
                     KNEAAVLEAQMRHLGRVPGNPLYAISQKYLTGHPKGAAGAWMLNGGLQVLDTGLIPGN
                     RNLDNVDGKLQDNEYILYPNRSIQTKGLKAFSVTSFGFGQKGAQAIVVHPRYLYAMLE
                     DGEYHAYRTRRLTRYRKAFRFFHHGLATNTMFVAKTEAPYRPDQQNAVLLDPTARMQS
                     KESTDAVPVEIMRDVPAEFTSGKQQRAYWAFTVQGVKYGSSGEEAAALKTDSNPWQVF
                     VDTGNDFSILPEAVVDPVNKQFSPPGVWDDKLKVYVVDCDAKAPEFGVTIGDQTFYHA
                     AEDLIYEVGEGVCVSSLLPAEKVGMKYVVVYILGAPFYKNVIAVHDFGKNELRFAQK"
     exon            152334..152389
                     /number=1
     exon            152459..152485
                     /number=2
     exon            152545..153008
                     /number=3
     exon            153071..156781
                     /number=4
     exon            156843..157428
                     /number=5
     exon            159228..159735
                     /number=6
     CDS             join(161418..161786,161859..163049)
                     /codon_start=1
                     /locus_tag="AO090011000049"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070335000051"
                     /protein_id="BAE64609.1"
                     /transl_table=1
                     /translation="MESADCKESNSSATTMTEKEPGREQPDLEQGKTQMAETSHLYPE
                     TDLDRGVVGWEGQDDPANPLNFAPGKKWALLGLISAFTFVSPLASSMFSPAVSYMAAD
                     FKETDETIISFTVSIYLLGYVFGPLVLAPLSEIYGRRIVLSISNWFFVVWQIGCALAP
                     NIASLIVFRLFAGVGGSACLTLGAGVIADLFEPQQRGKATSIWGVGPLIGPVAGPIAG
                     GFLGEEVGWRWVFWVLLIVGGATALGIEILNRETYAPVIIRRKTAKLSKELGRTDLRS
                     AYELNRGQASTGQFLKQSLVRPMLLLVKSPIVLLLSTYMSLIYGLLYLFFTTISSVFT
                     EQYGFSTGLSGLAYLGIGVGFMLGLVFVAGTNDRIMLKLAARNGGKTEPEMRLPLMII
                     FSCILPISFFWYGWTADKHVHWIVPIIGMAPFGIGMMGVYLPIQTYIIDSYPAYAASA
                     NATLTATRSLVGALLPLAGPSMFEALGLGWGNSLLGFLALAFVPIPIVFTKWGKLIRE
                     KYPVNFDKANA"
     exon            161418..161786
                     /number=1
     exon            161859..163049
                     /number=2
     CDS             complement(163207..164331)
                     /codon_start=1
                     /locus_tag="AO090011000050"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000052"
                     /protein_id="BAE64610.1"
                     /transl_table=1
                     /translation="MSSVEKKRLRDRRAQQNLRSKRSQQMAVLEKEVAHCREHHDDQG
                     IQRLLQVITGLRKQNETLRSRQEHLKLLVNSWDASPAEISANMHGSSDQRSPGFIAIP
                     REIMNNSDSSSNPIQSTRNNTPRADPSPSSLLVSGDSSHQQAPYPQTLAREPRTADTN
                     LAWKQLPLHDDNFLNPQTISCAWFEYPERIALCPDSPSSPLDLLYGTNTNYLANMIYK
                     ATQRRPIRDPERLAVGWLCYHLARWIVSPSPATYANVPPFLRPVPDQLQIPHPMVLDN
                     IPWPQVRVNLIRHWDMFRDMRDDLFGLFSCCVKVRWPWGESILERNSHNELCIKERFF
                     ETFMSETGWGITPEFMQRYPQLFAGVDLGAITCELVDKEF"
     exon            complement(163207..164331)
                     /number=1
     CDS             join(165358..165523,165589..165914)
                     /codon_start=1
                     /locus_tag="AO090011000051"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000053"
                     /protein_id="BAE64611.1"
                     /transl_table=1
                     /translation="MASPTVYLIRHGEKPDDGGNGLSAQGVQRAQCLRSVFGKDSKYN
                     IGYIMAQTPKKSGKRTRPYETVLPLAEDLGLTVDTSCDRDDPKCVKKAVEKYKGDGNI
                     LICWQHEALTDIVKKLGAKDAPEYPSDRYGSPFPYPFPSRIESTTIEMISNDSNDFSV
                     QDN"
     exon            165358..165523
                     /number=1
     exon            165589..165914
                     /number=2
     CDS             join(167016..167168,167228..167654,167729..168045,
                     168102..168338)
                     /codon_start=1
                     /locus_tag="AO090011000052"
                     /note="transferrin receptor and related proteins
                     containing the protease-associated (PA) domain"
                     /old_locus_tag="AO070335000054"
                     /protein_id="BAE64612.1"
                     /transl_table=1
                     /translation="MRFLPCIATLAATASALAIGDHVRSDDQYVLELAPGQTKVVTEA
                     EKWALRAEGKRFFDITERASSLELASNKKQKLAVTYPDSVQHNETVQNLIKSLDKKNF
                     ETVLQPFSEFHNRYYKSDNGKKSSEWLQGKIQEIISASGAKGVTVEPFKHSFPQSSLI
                     AKIPGKSDKTIVLGAHQDSINLDSPSEGRAPGADDDGSGVVTILEAFRVLLTDEKVAA
                     GEAPNTVEFHFYAGEEGGLLGSQDIFEQYSQKSRDVKAMLQQDMTGYTKGTTDAGKPE
                     SIGIITDNVDENLTKFLKVIVDAYCTIPTVDSKCGYGCSDHASATKYGYPAAFAFESA
                     FGDDSPYIHSADDTIETVNFDHVLQHGRLTLGFAYELAFADSL"
     exon            167016..167168
                     /number=1
     exon            167228..167654
                     /number=2
     exon            167729..168045
                     /number=3
     exon            168102..168338
                     /number=4
     CDS             complement(join(168906..168928,168999..169545))
                     /codon_start=1
                     /locus_tag="AO090011000053"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000055"
                     /protein_id="BAE64613.1"
                     /transl_table=1
                     /translation="MRLAPITVGLAACANLVSGMAFTAPARCLTMKDTAEKLDVNRWI
                     DLWLETTCKRCQSPKLSDYRTLRESHVAPFVKDCSDSMGTSHLSSNYLALADSLLDLA
                     KSKCEVTDETDLCEDPDQLKTVAKCVQSNAWSFVLGNVGNFLSILLADPCGRQMDFIA
                     NPDTLDRTIRSHLANYEKTCPKNSKSLGQ"
     exon            complement(168906..168928)
                     /number=1
     exon            complement(168999..169545)
                     /number=2
     CDS             join(172063..172348,172442..172604,172671..172837,
                     172903..173162,173263..173574)
                     /codon_start=1
                     /locus_tag="AO090011000054"
                     /note="geranylgeranyl pyrophosphate synthase/Polyprenyl
                     synthetase"
                     /old_locus_tag="AO070335000056"
                     /protein_id="BAE64614.1"
                     /transl_table=1
                     /translation="MTAAGGFNYWMSHSERYFRTDFTTTAEDRARLVRNPDSCLGCLQ
                     GYPAPLALNGHSTSTVELDAVSESHVSGSDSSLTSMTTASSHVSVDGLGFSGEQLCMD
                     PYNYISSLPGKGTVAKLADTLQTWFKVPAGSTEIIKTCSTILFHSSLMLDDIQDDSSK
                     RRGMPAAHVMYGVGQTVNCVSYTGAKAFFLCEELKNANACRKALYDELDNLFSGQALE
                     LHWKFHKTCPSMNDYIIMIDNKTAGFFRLVLRMMAAEASVSMSLEKKNTLLHFITLLG
                     RYYQIRDDYQNLVSDEYAAKKGFCDDLSEGKFSLILIHTLNNSPTADRIRGLMFGGDR
                     AGMSQEIRSYILSEMEAAGSLEYTKRIITELYETLWRMLDELEATLGPNTLLRALVQF
                     LKI"
     exon            172063..172348
                     /number=1
     exon            172442..172604
                     /number=2
     exon            172671..172837
                     /number=3
     exon            172903..173162
                     /number=4
     exon            173263..173574
                     /number=5
     CDS             complement(173976..175001)
                     /codon_start=1
                     /locus_tag="AO090011000055"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000057"
                     /protein_id="BAE64615.1"
                     /transl_table=1
                     /translation="MLAKFSLLSLLLTSTACAAGGQGLSYDNIDKSATPGAKALLKHI
                     QSQYGSHYISGQQDAGSWDWVKQNIGVAPAILGSDFMYYSPSAVARGSKSHAVEDVIQ
                     HADRNGINALVWHWYAPTCLLDNAEQPWYNGFYTKATCFNVADAVNDRRNGTNYRLLL
                     RDIDAIAAQIKRLDQANVPILFRPLHEPEGGWFWWGAQGPAPFKKLWDMIYDRITRFH
                     NLHNVVWVCNTAEADWYPGNDKCDIATVDHYANAGDHGVLADKYKKLQAVTNNERVLA
                     LAEVGPVPDPTVQARDKVNWAYWMVWNDEFIKDGKQNSRQFLQNVYNNTRVVTLDGGS
                     KLAWNNA"
     exon            complement(173976..175001)
                     /number=1
     CDS             complement(join(176517..176723,176833..177117,
                     177239..177271))
                     /codon_start=1
                     /locus_tag="AO090011000057"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000059"
                     /protein_id="BAE64616.1"
                     /transl_table=1
                     /translation="MYIVWCVSTNKNPLSKRNVSIPEVVPATGWTYINEYTSAKPYDK
                     TIYHPSGQRQISDLGAAAVHRTSVFSGYRDCPGRRKVLGVIKVSATELDILSESGLLY
                     VLQDGVRNCRVPCLSSKHSQTMAATNAAQGVFQLYCWAGLNPTSGTAVAIDKITSSLG
                     KGIVPYPIWSLPVP"
     exon            complement(176517..176723)
                     /number=1
     exon            complement(176833..177117)
                     /number=2
     exon            complement(177239..177271)
                     /number=3
     CDS             178545..179660
                     /codon_start=1
                     /locus_tag="AO090011000058"
                     /note="L-alanine-DL-glutamate epimerase and related
                     enzymes of enolase superfamily"
                     /old_locus_tag="AO070335000060"
                     /protein_id="BAE64617.1"
                     /transl_table=1
                     /translation="MSDLKIARIDVFQVDLPYSGGVYYLSAGREYRSFDATIVRITTD
                     TGIEGWGESTPFGSNYIASHPRGVRAGIATMAPSLIGLDPRRVDRINDAMDDALLGHE
                     DAKTAIDVACWDIFGKSVGLPVCELLGGRTNTRLPLISSIYVGEPEDMRARVAKYRAK
                     GYKGQSVKISGEPVTDAKRITAALANQQPDEFFIVDANGKLSVETALRLLRLLPHGLD
                     FALEAPCATWRECISLRRKTDIPIIYDELATNEMSIVKILADDAAEGIDLKISKAGGL
                     TRGRRQRDICLAAGYSVSVQETCGSDIAFAAIVHLAQTIPERSLRCILECRDMVTVKT
                     ADGAFDIQDGFATAPTTPGLGIMPRLDVLGEAVASYF"
     exon            178545..179660
                     /number=1
     CDS             join(180370..180883,180957..181314,181371..181545)
                     /codon_start=1
                     /locus_tag="AO090011000059"
                     /note="zinc-binding oxidoreductase"
                     /old_locus_tag="AO070335000061"
                     /protein_id="BAE64618.1"
                     /transl_table=1
                     /translation="MTQPQPTSRQAFRRTDDHTPGTPKVKLVTEAIPPLSPSGVLIKV
                     HAVSLNYRDANIANGGNPWPVVPHGIPCNDAAGEVVAVGERVKNLAIGDRAAPIVDTE
                     NITGRESTRSWLAADEDGVLADYIVFDEHKLCKLPMYLDWVQASLIPCAGVTAWAALK
                     DMEIGQTVLIQGTGGVAMFALKLARAAGLKVIMTSSSDAKLQKMKEQFPTPPLLTVNY
                     SKNPEWHEEVLKLTEGAGVDIVVEVGGSSTLVKSMKCTRRGGIVSQVGYLSKQNTSEF
                     AELLSVLIDRRVILRGINAGSKQDQDDLCAALSATQIQFDDIIDSVYPFEKADEAIEY
                     IWQGKQVGKLVLRL"
     exon            180370..180883
                     /number=1
     exon            180957..181314
                     /number=2
     exon            181371..181545
                     /number=3
     CDS             complement(join(182419..182505,182559..182702,
                     182756..182953,183006..183220,183277..183364,
                     183441..183785))
                     /codon_start=1
                     /locus_tag="AO090011000060"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000062"
                     /protein_id="BAE64619.1"
                     /transl_table=1
                     /translation="MSGVSWYTGYVIGQFKLRFPQTHSMGDAGELILGRFGREMMGIG
                     QLLLLIFLMASHILTFSVLFNTITGHGTCTIVFAVIGMVVSFIGALPRTMNKVYYMSI
                     VCQYFHYLGIFWTAPDHVQVDATRDVSFQDAFLAVCNIIFAYITHVAFFGLISEMRDP
                     REFPKSLTMLQVVDTSMYVVTAIVAYRYAGPDVASPALSSAGPVMKKVAYGIAMPTVV
                     IAGVIYGHVACKYIYVRVFRGSDHMHQKSILAVGTWVGIALALWVIAWVIAESIPVFN
                     DLLSLISALFGSWFSYGFPAIFWLIMNKGVWFSSPRKILLTIVNLIILGIACAICGLG
                     LYVSGKSIHENSSSSSWTCANNAI"
     exon            complement(182419..182505)
                     /number=1
     exon            complement(182559..182702)
                     /number=2
     exon            complement(182756..182953)
                     /number=3
     exon            complement(183006..183220)
                     /number=4
     exon            complement(183277..183364)
                     /number=5
     exon            complement(183441..183785)
                     /number=6
     CDS             complement(join(188625..188825,188883..189369,
                     189433..189463,189518..190387,190441..190585))
                     /codon_start=1
                     /locus_tag="AO090011000062"
                     /note="adenine deaminase/adenosine deaminase"
                     /old_locus_tag="AO070335000064"
                     /protein_id="BAE64620.1"
                     /transl_table=1
                     /translation="MKFLITTAALLFSLVSAQTGVPDVNSLAVQKHLRSRSALIAFEK
                     RQRQDHFFRQNLSSVAQRADAIVAAIRQEEIDDYWRVPGTPEKNDTDERFAGEVFPKA
                     RPLINGTKLWDVVKHMPKGALLHAHLPAMLSYDTILETILHTEGMVVSASQDVSTPEN
                     RRNASVSFAHVNHTIATNVSSIHSKDYVPNTQIPVTVAANTFPGGQEGFIDFVKTKVT
                     ISPELSIRHELGVDEIWRVFQTAFGPAGTMLTYEPIVRTFYKKLFSRLAEDHINWVEI
                     RSGSGQLVQEGQEDLDPDLDIWWNVLLEELKKFQESPEGADFWGARVIWSDNRGKNRT
                     ALTKSMGNALERKRRHPQLFSGYDVVAQEDLGRPLADMAPELIWFQQQAEESNLTIPF
                     FFHAGETLGDGNSTDENLFDAVLFGTRRIGHGFSLYKHPRLIDEVIENGIMVEVCPIS
                     NEVLRLATDILHHPLPAMIAHGIPTAISNDDPAILGQNTAGLSYDFYQTIQAFDNIGL
                     AGLGALAHNSIRWSNFEDQNDVEWFRDIDFGENGDGIKAQRLQQWNEKWEAFCEWVVK
                     EYGDRYATEAL"
     exon            complement(188625..188825)
                     /number=1
     exon            complement(188883..189369)
                     /number=2
     exon            complement(189433..189463)
                     /number=3
     exon            complement(189518..190387)
                     /number=4
     exon            complement(190441..190585)
                     /number=5
     CDS             193641..195803
                     /codon_start=1
                     /locus_tag="AO090011000063"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000065"
                     /protein_id="BAE64621.1"
                     /transl_table=1
                     /translation="MALPKTITLQTDVLSVNVYVDDQGAAFLQEVIPLPGSSRPSVSK
                     YFANPYAPLVEVRLAGEGTAKHKSSKSLIGTYVGTRLRYRSHEIRQHADTHTLNVTLK
                     DPVSNVTIIAHLTIYQSTRVLRATSTIRNDSDNDIVVTQLSSLVLGGLTTGAEKWWSN
                     YVLAVPNNSWFREAQWIDHDLPSLGIDDYGVYGRPEEHAASLGHYSVSNRGTFSTEGH
                     LPMGLLKRTDNTETWLWQVENNGSWRWEVGDWKDSVYLAAGGPVETDHDWRQTLYPGQ
                     EFTTVPVALCHVLENYEHAFAEMTRYRRQMRRKHQDHEQLPIIFNDYMNCLMGDPTDE
                     KILALVDPVVRTGAEYFVIDAGWYADDSGWWDDVGLWEPSKKRFPMGFRELLLHLKTK
                     GLTPGLWIEPEVIGVRSVVAEQLPYEAFFQRNGQRIVEKGRYQLDYRNAAVREHMHAV
                     IHRLVTEYGVGYFKFDYNIEVIQGTDINCSSSGSGQLDHNRAYLQWVTELHDRYPGLV
                     IENCSSGAQRMDYAMLAVHALQSTSDQQDPDRYAAIAAALPTAVTPEQGAIWAYPQPE
                     WDDETNAMTVVNSLLGRVHLSGRLDKLRPHQFELIKQGMDVYRTIRADLPTATAFWPL
                     GLPRWHDEWVALGMAVHTPDNCDSGVRYLAVWRRGGLDSVELPIPGLRGLRVKAELLY
                     PSTFPCEISWELAQGILHIRIPSKLSARLLKLTSGNVR"
     exon            193641..195803
                     /number=1
     CDS             join(196469..196971,197021..198179)
                     /codon_start=1
                     /locus_tag="AO090011000064"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070335000066"
                     /protein_id="BAE64622.1"
                     /transl_table=1
                     /translation="MADKKIESPVSAHIDHLRNHGEENNAVWDSAIEEAQAANINEHN
                     MTVRQALRSYPWAVVWSLTISMSIIMEGYDTNLIGSFYGYPAFQKQFGVEHGDGYQVP
                     QAWQSALGAGGTAGCIIGAFLNGYLVKHFGFKKVFTGAMFVMCAFIFVSFFGHTLGLQ
                     VAGQVLSGIPWGIFATIGPAYSSELLPMALRSYLTAYTNMCFAIGQFISAGVLQSLIS
                     RDDQWSYRIPYAVQWIWPIPLFFIGVLMPESPWWQVRHGWYDEALATVQRLTAGEEKT
                     KARQTVAMMIHTNEIEQEIEAGSSYWDCFRGNNLRRTEISCMSFTGQVLAGSQFAYTG
                     TYFFEQAGMSPTDAYKLGLGGTAVAFVGTILSWFLMKNFGRRSMYLSGMGLMSSYLLI
                     IGFLTSKSNNNVVWAQSALCIVWLFTFSLTVGPMGWSIAPEVSSTRLRSKTICLARNA
                     YYLAITVANVIEPYMMNPAAWNWRGRTGFFWFVFAFLTFAWGYFRLPETKGRTFEELD
                     IMFAAGAPTRKFRKYHVDPYAENVAIKDRARESPLEKSIDMMSPC"
     exon            196469..196971
                     /number=1
     exon            197021..198179
                     /number=2
     CDS             join(199215..199706,199784..199972)
                     /codon_start=1
                     /locus_tag="AO090011000065"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000067"
                     /protein_id="BAE64623.1"
                     /transl_table=1
                     /translation="MAHAHNAIIRGLNAILQQAPYVPIVTDEHFNAQNVKDLLFYVQS
                     WAKMVHHHHWVEETYIFPDVEEFTGRPGFMDDPKHQHELFHDGLERLLAYSSATKPEE
                     YRWKGADGMEEIINSFSKDLTDHLYAEIDLLLGMGDIDGEGLKKIWEKAQKAAKQAGN
                     IAMLYDIFPLVLGCADKTYEGRCDFPPLPWVLPYVVKYWFAAGNGAWRFNPCDWWGQP
                     KPLEFGPR"
     exon            199215..199706
                     /number=1
     exon            199784..199972
                     /number=2
     CDS             complement(200100..201653)
                     /codon_start=1
                     /locus_tag="AO090011000066"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070335000068"
                     /protein_id="BAE64624.1"
                     /transl_table=1
                     /translation="MNLKAHIFRRPVIAVAGLACETSTFTPSRTLAPAFHPRRGNEVI
                     DEYKFLQTGTPLGDAAEWHGALIGHALPGGMVTRDAFEELAGEIVSRLGDIVATTVVH
                     GLWFDIHGAMCVEGIDDAEVELLRRIRGVIGPDVIVSASMDLHGNVSRELAHELDLLT
                     CFRTAPHEDESETKSRACRNLLDLLTRSSDITGGLVRPFKAWIPVPILLPGEQTSTRI
                     EPAKSLYEVVPEVEKEPGVIDAAIWVGYPWADEPRNRGAIVVTGWDEAAIAAGAECLA
                     TKFWNSRKDFKFVAPTGSFEECIHTALASPVHPFFISDSGDNPTAGGSGDVTWGLTQL
                     LARSEFKDPTGPKVIYASVPGPQAVQTMVNAGVGANVTVTAGAEVDHIHAGPITMTGR
                     VHSIKHGDKDAVIEAVLQVGSVFAILTQLRKPYHHERDFTDLNLNPRATDIVIVKIGY
                     LEPELFDMAADWMLGLTPGGVDQDIKRLGHKRIRRPMWPFDTTFQEPPDLTARIIAKS
                     NEPRNGPDE"
     exon            complement(200100..201653)
                     /number=1
     CDS             202682..203254
                     /codon_start=1
                     /locus_tag="AO090011000067"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000069"
                     /protein_id="BAE64625.1"
                     /transl_table=1
                     /translation="MIRPHAESFYYSDTDFEAMKRTMHSLREKGADGFVFGILTQNTP
                     AQAAPRIDVARNKELVELAQGRPCTFHRAFDLISESNWDTALAGIVECGFTSILTSGP
                     SGGTAIECVDHLDRLVHERLEQLRGRVEGHARLPQIIVGGGVRATNIGMLWERTRAPA
                     FHSAALAQSSVELVSDAEVEALRAALNKAT"
     exon            202682..203254
                     /number=1
     CDS             complement(join(203319..204149,204206..204349,
                     205013..205072))
                     /codon_start=1
                     /locus_tag="AO090011000068"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000070"
                     /protein_id="BAE64626.1"
                     /transl_table=1
                     /translation="MVYRGKPSPACEPCRTRRLKIVTCEGPPLIGRWLNHIEGGVKLI
                     EIRGFEQLHHQAGLELFTQIRIQIALGNLYKKERTPSWLLDLSKEALKHRGDTGDQVL
                     DYFFRILVEVGDLVAIINESAFAHPARLLKRALTLDADLITWAMSIDPNWKYTVVKVK
                     KTEEENDTLHPIYSDHYHVYPNSTVSMAWNHYRFIRIILQGIIGYLYDTHFQDSGGRG
                     SHIESERHSTAVSQQLAEDICASVPYHLGMTGSSDGSTLGIPFAGGVVRLMWPLFIAS
                     DCRGASPKMRAWIAQCLEKIGHGVGVNMAVTMSHILRADMRLNWLEEEETSIVKRPYL
                     VRNEYFTTGT"
     exon            complement(203319..204149)
                     /number=1
     exon            complement(204206..204349)
                     /number=2
     exon            complement(205013..205072)
                     /number=3
     CDS             join(205948..206192,206253..206523,206585..206824)
                     /codon_start=1
                     /locus_tag="AO090011000069"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000071"
                     /protein_id="BAE64627.1"
                     /transl_table=1
                     /translation="MNGLFPADLAVYLFLTPFVLYVYWSHRWVGWMPWTNLLVFCIVR
                     IVGGATGVKDSTSIAANVISGIGMSPLLLAIDGLLHEARYYRHPEHSVLLSRIVIVAI
                     TGLMGAGLGLSIGGSLQVYQGKGTSSDLLHWKVGSGLVVAVWETEVVWAIFSLLPSQC
                     KKDAPGFKDGTKLIYGALGAIVFAGVRVIDNLVGVCTQRKDLSTVFGSTAVRVVLVFL
                     PELLAALSMIVAGLSSRNIRKHNHVAEKESMSA"
     exon            205948..206192
                     /number=1
     exon            206253..206523
                     /number=2
     exon            206585..206824
                     /number=3
     CDS             complement(208120..209757)
                     /codon_start=1
                     /locus_tag="AO090011000070"
                     /note="predicted metal-dependent hydrolase with the
                     TIM-barrel fold"
                     /old_locus_tag="AO070335000072"
                     /protein_id="BAE64628.1"
                     /transl_table=1
                     /translation="MASTILTNGRIFTPSTSSDGYEFQQTMIINGDRIEYVGSPNHDA
                     IQQAKDSSAREVDLQNKIVVPSFIDSHMHIVHFALSRRKLSLLTCKSLEEIRQAIKSF
                     AEAHPKEPRIMCKSWVQSTTGGEALASMLDDLDPRPIYIHANDMHSGWCNTAALEELG
                     VATMADPPGGTIHRDENGKPSGLLSEMAHLGIVPQFLVRATPLEAKLDALDDAMAAYT
                     AAGYSGMIDMGMDDIEWDVLKAWRQRHGEKFPFHIAAHWVIPPNDDLDVVLGEVDRAI
                     ALHREYDPATSPTFCIVGIKLMCDGVVDGCTAALTDPYQGCENPVDPIWPEDFLQAVV
                     KKADAAGLQIAIHAIGDKAVKNAIDALSLAQPGRRHRIEHLELTSPEDAKRLGQLGIT
                     ASVQPVHSDPALFRAWPELIGEHRCARAFAYREFLEGGAPVAFGTDSPTASHPALPNL
                     YNATTRRSAIEPECTETVNSHFGLPLAAAVTAATTGAAYSRWADSWTGSLKAGLSADF
                     VVLDMDWKAENLLKGKVQQTWARGRKTFDSSSDRAQL"
     exon            complement(208120..209757)
                     /number=1
     CDS             complement(join(210249..210647,210710..211114))
                     /codon_start=1
                     /locus_tag="AO090011000071"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070335000073"
                     /protein_id="BAE64629.1"
                     /transl_table=1
                     /translation="MTAFEPTDGISFKTYWRHMWTPFLLFFRIPAVAFVGIEYSLMMC
                     WVAILATTQPILFAAPPYNFSSVGVGNINIAPFIGAVVGAIYGGPLNDYYVVYMARRR
                     AGIYDPELRLHMLLAPLIVCPLGLFLYGISIANEQPWIVPCIGSSFVGFGIGSVTSII
                     LPYYGDSYREVWLLSLHFTDLATSWSLIISQLVAEGLVVITFIRNVVSTGISFAINPW
                     MTGLGVQNMFISTGCLCFGTMVFIIPMMIWGRKARSSTADYYLSAVAAG"
     exon            complement(210249..210647)
                     /number=1
     exon            complement(210710..211114)
                     /number=2
     CDS             complement(join(211386..211415,211485..211556,
                     211618..211909,212117..212175))
                     /codon_start=1
                     /locus_tag="AO090011000072"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000074"
                     /protein_id="BAE64630.1"
                     /transl_table=1
                     /translation="MPTAMLFFSPNHRTIPMNHCLDVGTVTWPSLGEELGYGDGYLTD
                     SYAAGLAGMALGCIFFIPAADLIGRKPVYLFASLIMVLANVGQATFQTRTQYIVLHTI
                     AGLAGSVNDTIIQMTIVDLFFVHQRATMNGIYTTMVVVGSHSGRIHHQ"
     exon            complement(211386..211415)
                     /number=1
     exon            complement(211485..211556)
                     /number=2
     exon            complement(211618..211909)
                     /number=3
     exon            complement(212117..212175)
                     /number=4
     CDS             join(213498..213576,213642..214360,214412..214995,
                     215107..215215)
                     /codon_start=1
                     /locus_tag="AO090011000073"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000075"
                     /protein_id="BAE64631.1"
                     /transl_table=1
                     /translation="MTPQTKSYRPPRRRPAHLRTKTGCLTCRKRKKKCDETPGTCSNC
                     ARRWLSCEWPANLRVNQKHTGPEQLPHSKTHSERSPQLLINEWHATQYAFVADYAASA
                     SPSWDTEGGSEVLPSPMESNTPSSQDDFMMALSSNPSSSLNYISPSICLSPAITPASA
                     PLFNFLRAVFLPQLIRPMAHDRVIKSAADESLILALHTPFYMHALLACCGAEIPVDDM
                     CSQVHFQKLARMHYVKAIAGLRESLDSGILDAENTAIIRTSLMLCIYERSKPRLSRGV
                     DAHILGLAQLIQLRFRHNQTTTEFQSESETNTARVILEAFIFHATTCIPFQQTTKQPE
                     PVEAALSLAETRLQEMYRWKVPVHPESPVLGAPPKLFVYAREIALMHERSSVEGIDIA
                     RCYELQQLLSHFNECGFEESAHSSEYDRLARTTYTPLLLGPRLYIVVSKILLEHMINN
                     NSTTTDTSLQDAHRKCLLSQAMAFWKATRNGTMRRLVDMLTTLWQI"
     exon            213498..213576
                     /number=1
     exon            213642..214360
                     /number=2
     exon            214412..214995
                     /number=3
     exon            215107..215215
                     /number=4
     CDS             join(216735..217824,218256..218320)
                     /codon_start=1
                     /locus_tag="AO090011000074"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000076"
                     /protein_id="BAE64632.1"
                     /transl_table=1
                     /translation="MKYLLARPQTQENLKLWAGNAKLVIASHFFWGAGTDMQKSKQGL
                     LRSLLYSMFSHSPDLFSMACQRRWKATMLDEQDDSIWSVEDLLEAFKTLTSQTEFPTK
                     FCLFIDGLDECTEDHSELIKLLNSLVQSNVKICLSSRRWKVFEDAYGEPEDRRLYLEK
                     NNREDIHSYVQSELEQHPAWGPLVEINPRTSGIVAEITDRSQGVFLWAVLVVRYFHEW
                     LTHGDTMFFLEQKLRNFPVDLELLFKSMLESLHPMYTSYVRRIFKLALTAPEPLPVMA
                     YASLERGVKDESNVHPQGNKPLSYRDQLLRIGQLDRQLQHMGKGLLEVYRQHNEQDAL
                     RYRVDFLHRTVRDFFSRNEILQGTDGVSQNIFSKRVLPYQGSACLQLLEM"
     exon            216735..217824
                     /number=1
     exon            218256..218320
                     /number=2
     CDS             join(220386..220412,222215..223018)
                     /codon_start=1
                     /locus_tag="AO090011000076"
                     /note="dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /old_locus_tag="AO070335000078"
                     /protein_id="BAE64633.1"
                     /transl_table=1
                     /translation="MFNTRVVPMNENHVNLNCGLGGLGSSIGKKLRQQGARLAILYAP
                     FEAARRDQLLESTYGRVPDSDEIRAYECDITSPESVQSAFKALDKEMVQPSSFSVADR
                     TFPSILINTAGYVNLSDMESTPPEDTMKHLTTNVFGPMLCSQAFARLYFTASKGAKSS
                     GSPPPTGRIVNIASQAAHVALPRHGAYCASKAALLGLTRSMASEWGGRGITTNSVSPT
                     VAWTELGKKAWGQEDVREAFLKTIPTGKFALPDEVADAVLFLCKASVLELFGSFLHTN
                     "
     exon            220386..220412
                     /number=1
     exon            222215..223018
                     /number=2
     CDS             join(225866..226021,226116..226650,226705..227316,
                     227384..227706)
                     /codon_start=1
                     /locus_tag="AO090011000077"
                     /note="synaptic vesicle transporter SV2 (major
                     facilitator superfamily)"
                     /old_locus_tag="AO070335000079"
                     /protein_id="BAE64634.1"
                     /transl_table=1
                     /translation="MDSLSKHAQDNEARLGPESNNLTLSSGSTAHDILEALDLDPALN
                     RKMHLVNDALDQIGWTPYHRRLFFLCGMGYIHSFAIIVSLANRLMIFTRYGVDALQVS
                     LQGIIATQAAYEFQPSYPKGLTIALYVGMLVGALFWGLSADIVGRRLAFNISLFICSV
                     FTIVVGASPNWASLAFFIAFSAFGAGGNLILDTTVLLEYLPSNKQWLVTGLAAWWGVG
                     CTIAGLVAWGFMPNYSCSNPSEAPFMPCTKANNSGWRYLMYTMGAMIFVMSIARVAVV
                     KFKETPKFLLGQGKDTEVVERFNQLAEKYHRSCPITLQQLQDCGPIATAHSQSSQFSV
                     GEFSIHLRSLFSTRKLVLLMALLWLSWLMLGLAYPLFNVFLPSYLASRGVKFGVLSTY
                     ETWRNYALAQVCSIFGPIASAYLANRRFLGRRYTMTIGGLLTMAFLFAYSQVTSQQQN
                     VAYTCVISFTLQIYAACLYGYTVEVLPSAHRATGNGVSVALHRFMGVVSAIIATSADT
                     ETTAPVFICAALYGGLAMCAVLLPFEPCAKRAS"
     exon            225866..226021
                     /number=1
     exon            226116..226650
                     /number=2
     exon            226705..227316
                     /number=3
     exon            227384..227706
                     /number=4
     CDS             complement(join(228401..229002,229057..229126))
                     /codon_start=1
                     /locus_tag="AO090011000078"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000080"
                     /protein_id="BAE64635.1"
                     /transl_table=1
                     /translation="MKFSAVLSTLMVAGLVAAAPPADRPTDLQKVPVPLPTADAPVPP
                     KPENDNDKRGDVPPPKKPTDLPAPPKDPKENDNGKRGDVPPPPPPTDKPLPPKEKEND
                     NDKRGDIPPPPPTDKPLPPKEDDKSKRDEVPPPPKPTDLPAPPKDHDNDKRGDVPPPP
                     PTDKPLPPKEKENDNGKRGDVPPPPRPTEDKPAPPKENDNGKRGDVPPPPPTDKPLPP
                     KPVQQ"
     exon            complement(228401..229002)
                     /number=1
     exon            complement(229057..229126)
                     /number=2
     CDS             complement(join(231109..231606,231668..232038,
                     232085..232356,232414..232706))
                     /codon_start=1
                     /locus_tag="AO090011000079"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000081"
                     /protein_id="BAE64636.1"
                     /transl_table=1
                     /translation="MAESPLRIIIVGGSVTGLTLAHCLDRAGIDYIVLEKHKEIHPQI
                     GASVIIFPNGGRILEQLGLYQRIEGLTQKIRRIHTCFPDGFHYESNVPELVKELFGMD
                     FAILERRQLLEVLYMGLRDKSRVHTGKQVTSVLPTESGVSVTTADGARYDGDLVVGAD
                     GVHSFVRSEMWRIADLEHPGLISKKEKTDMTVEFACVFGISNPVEGVKSWEHVIRYNP
                     GVTLFVFPGTDNGIFWLLFRKLDKRYTYPDTPRFTKEDAISTCESLADLAVWEHIRFS
                     DIWGQRRTFHMTALEEGLLGTWHYGRIVCIGDSVSKMTPNQGQGANTAIEAAAGLTNV
                     LFSLNQNTEGKRPSEDEIQRGLGHFNTTQFQRLLAIHQSSEFLTRLQACDGLAKSVFA
                     RYVAPYCGGTIEGISGLATTGTVLEFVPLAERSGKHWSPISSWAPWISKMAYLGTRTF
                     VGLAIASLPAGFAWTLYKIAIPRVLRR"
     exon            complement(231109..231606)
                     /number=1
     exon            complement(231668..232038)
                     /number=2
     exon            complement(232085..232356)
                     /number=3
     exon            complement(232414..232706)
                     /number=4
     CDS             complement(join(233401..233827,233889..234358,
                     234419..234466,234524..234568,234631..234684))
                     /codon_start=1
                     /locus_tag="AO090011000081"
                     /note="monodehydroascorbate/ferredoxin reductase"
                     /old_locus_tag="AO070335000083"
                     /protein_id="BAE64637.1"
                     /transl_table=1
                     /translation="MASTLRNIIVVGGSYVGKTTAQELAQVVPNTHRVLLIEPHSHFH
                     HLFTFPRFAIVPGQEHKAFIPYTGIFPSTSSLTQHAVVQARALSVLPQHVKLDREWQG
                     SRQIPFDYLVVATGTRLVQPAGMRHDDKLSSVAYLQNHQNDVKKAKSILIAGGGAVGV
                     QMATDLKEFYPEKEITVVQSRPQLMSGFHEGLHELVKERFDELGIKFVTGARVKIPAE
                     GYPTEGGAFNVELTNGTQLSTEFVICATGQTPNNGLISELTPSTSESLINPDNGFIRI
                     RPTMQFLDPKYSNLFAVGDIADTGLRKAARPGSAQAAVVAKNIQAMIEGKSPEDVFPR
                     MPAAIHLTLGMVS"
     exon            complement(233401..233827)
                     /number=1
     exon            complement(233889..234358)
                     /number=2
     exon            complement(234419..234466)
                     /number=3
     exon            complement(234524..234568)
                     /number=4
     exon            complement(234631..234684)
                     /number=5
     CDS             complement(join(235562..236396,236446..236710,
                     236962..237520))
                     /codon_start=1
                     /locus_tag="AO090011000082"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000084"
                     /protein_id="BAE64638.1"
                     /transl_table=1
                     /translation="MLLLRSVRAHQLLQLVSFLLFTLVYGEDSCPLQTPLYPPPRNLL
                     SRQDVKSASKSLSQTIEEALTTGITDLGSLPLNTTTFAVKVFSSHTEDSIYEYIYTSP
                     TYSPKPGAGAEKTALDSVYRVASISKLITVLTLLAHDGYTHWNHPITDFIPELDILAR
                     NQSSRLQWREVTLGDLAAQLSGVPHDSFLSGIVSEDPTFAPGTTAAYSNAAYQLLRYA
                     MENITGTDFPSMFQNSIVKPLNLNSTSLLAPGNASVGIIPVNETVSVWDFDLGDGDAF
                     GGAYSSAHDLAVIGRSILQSLSRSSALNLSSTLARHWLKPLSHTTSFKTSVGAPWEIF
                     RYELPNRPNHVIDVYSKSGNLGAYADIIALIPEYDIGFSITAADLPTNPLTNVWGLAD
                     LIIDRLSPAFDKAAQQEANATYAGTYKVQGANSTTDSYVAITTDHYKPGLQVAEWVSN
                     GVDFLQSLAALSGFEGLAVRLYPTGIEETVPGESSKRVFFRSTFDYDTSGQSKGVISA
                     CQSWLNVDGSRIGNIGVDEWVFTLENGQASSAEPRILRKRLRRL"
     exon            complement(235562..236396)
                     /number=1
     exon            complement(236446..236710)
                     /number=2
     exon            complement(236962..237520)
                     /number=3
     CDS             complement(join(240830..240836,240870..241115,
                     241166..241656))
                     /codon_start=1
                     /locus_tag="AO090011000084"
                     /note="acetylcholinesterase/Butyrylcholinesterase"
                     /old_locus_tag="AO070335000086"
                     /protein_id="BAE64639.1"
                     /transl_table=1
                     /translation="MVRLSTFIATILSSTALASELLIDTTSGPVEGFYNSSSVRAFLG
                     IPYAEPATGPRRFKPPVPKSRSNQTVQADSFPATCPGQYTFSNESIWSVLPYMPWNTE
                     SMSEDCLAINIWAPKSKKGNGKSAVMMFIYGGGFTQGGTAIPFYDGTNLVEDHQDIVV
                     VTFNYRVSIFGYPNAPGLEPGQQNVGLLDQVRYYTNISMSRKANEVRGLPLNGSTAIS
                     PNLAEILQESCCLARVLERRLRICTPMRN"
     exon            complement(240830..240836)
                     /number=1
     exon            complement(240870..241115)
                     /number=2
     exon            complement(241166..241656)
                     /number=3
     CDS             complement(join(242023..242035,242106..242413))
                     /codon_start=1
                     /locus_tag="AO090011000085"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000087"
                     /protein_id="BAE64640.1"
                     /transl_table=1
                     /translation="MFYYPSIFAQFNSASVPDVFIWVGIEEVKRFALALYKVYRRYRV
                     DGTRLLSLADLQFAMPDSDELWHASSDLASRIPASYGDKNKEENWISQTARLLQPGGA
                     DGWV"
     exon            complement(242023..242035)
                     /number=1
     exon            complement(242106..242413)
                     /number=2
     CDS             complement(join(243835..244052,244109..244247,
                     244339..244487,244533..244846,244903..245667,
                     245719..245955,246009..246588,248219..248333))
                     /codon_start=1
                     /locus_tag="AO090011000086"
                     /note="UDP-glucuronosyl and UDP-glucosyl transferase"
                     /old_locus_tag="AO070335000088"
                     /protein_id="BAE64641.1"
                     /transl_table=1
                     /translation="MKIANSNSPLYWICNGQASSNLVSQGASMNTHGIPNDMNDGRVD
                     IAVNDDDPQVASLLDALQRQTTHRPPPVRNDGAQFPVRLNVLIHVVGSRGDVQPFIAL
                     GRAMKQHGHRVRLATHLVFRDFVKENGLEFFNIGGDPAELMSFMVKNDKLIPKMETLR
                     QGAIGKRRKDIRLMLGGCWRSCIEAGEGIDLTSDDPITAPPFVADAIVANPPSFAHVH
                     CAEKMGVPLHLMFTMPWSPTQAFSHPLANVRVRDTKPSVANFASYALMEMVIWQGVGD
                     LINAFRRFELGLEQLDVMRAPSLIPRLRVPFTYMWSPSLLPKPDDWQDHIDVTGFNFL
                     SANADYVPPSDLVEFLDSGPPPLYIGFGSIVVDDPDALTKIILDAVEMTGQRALVSKG
                     WGGLGAEKINRPDVFFLGNCPHDWLFKRVSCVIHHGGAGTTAAGLALGRPTTIVPFFG
                     DQPFWGALIAFNGAGPSPIPYKKLTADRLADAIHFCLKTTTIDKAQELSEKMRSEDGA
                     RDSLKSFHSQLDLRRIQCTLCPDRPAVWRVRRTKILLSTFAATVLVQEKKLNPKDVKM
                     YRAKRYEMNHGCAGTDTFTGAISNFLTGLVDMPVNAVQNISRPAADRFAENYNLPSCE
                     ARKAMITPAASVPTPSATSRKDRVQTNDDAKSTSSLLSTSTSSSQEAMNSSYLGRRVL
                     NWVVEVPMGVTLLFSQFTHNVPRCYNDRTVRELPEVTGEFGYSFYDGITGVVTQPSHG
                     WKDDGFGGLSKGVGKGLGGLILKPQAGIWGLIGYPLNGVHRAIEHSYGTNREGYIVRS
                     RIRQGVAESKAASQEEKLAVLEKWSTYEKGVRLKHQKNPR"
     exon            complement(243835..244052)
                     /number=1
     exon            complement(244109..244247)
                     /number=2
     exon            complement(244339..244487)
                     /number=3
     exon            complement(244533..244846)
                     /number=4
     exon            complement(244903..245667)
                     /number=5
     exon            complement(245719..245955)
                     /number=6
     exon            complement(246009..246588)
                     /number=7
     exon            complement(248219..248333)
                     /number=8
     CDS             join(251677..251681,252929..253719,253774..253861,
                     253912..254143,254216..254653)
                     /codon_start=1
                     /locus_tag="AO090011000088"
                     /note="serine/threonine protein kinase"
                     /old_locus_tag="AO070335000090"
                     /protein_id="BAE64642.1"
                     /transl_table=1
                     /translation="MEAPSLAVPQSRSPSTSSVDEIETTAEEEDSEDYCKGGYHPVTV
                     GETYNNGRYVVVRKLGWGHFSTVWLSRDTTTGKHVALKVVRSAAHYTETAIDEIKLLN
                     RIVQAKPSHPGRKHVVSLLDSFEHKGPNGVHVCMVFEVLGENLLGLIKRWNHRGIPMP
                     LVKQITKQVLLGLDYLHRECGIIHTDLKPENVLIEIGDVEQIVKTYVKEEQKKDHKED
                     NRNGRRRRRTLITGSQPLPSPLNTTFDFKHSSHHSQSSLSQMINEESETAPSEKASMK
                     EILGIKEEDEKQKQREKTADLLEREVSGISLNKSSKEAKDELECDIISVKIADLGNAC
                     WVGHHFTNDIQTRQYRSPEVILGSKWGASTDVWSMACMVFELITGDYLFDPQSGTKYG
                     KDDDHIAQIIELLGPFPKSLCLSGKWSQEIFNRKGELRNIHRLRHWALPDVLREKYHF
                     SAEESMRISEFLLPMLEIPPERRANAGGMASHAWMKDTAGMDAVDLGISPGSRGEGIE
                     GWASEVKRR"
     exon            251677..251681
                     /number=1
     exon            252929..253719
                     /number=2
     exon            253774..253861
                     /number=3
     exon            253912..254143
                     /number=4
     exon            254216..254653
                     /number=5
     CDS             258217..259206
                     /codon_start=1
                     /locus_tag="AO090011000090"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000092"
                     /protein_id="BAE64643.1"
                     /transl_table=1
                     /translation="MGSNNHQLLPDDEFETNIHAEVKGIRAKINEKVVCERASKLNGG
                     RKCEIEHPPAWGRRSLMGCANYHAHIRFPADDSVWLLRVLRISPQSLADYLIHSEYAN
                     LKFLETINVPAPRSFDYGLASDENNNVGVSYILMEQMAGKQWIMQGPHGKRFTDDKDK
                     ERVSKGLADILIEIQRHPFSKAGSLLLGPSPSEPIVSAVASERFLVLSPSGPFDTASD
                     YYTSFVEQNMALIADGQLFTSYPVNAYPVFSFLKSQIQALAAIPVNGAPATTEQFYIK
                     HVDDKGDHLMMDDELNIVGIIDWQMARVVPAREAFGPSLVTAEMGDITTESRP"
     exon            258217..259206
                     /number=1
     CDS             260133..261083
                     /codon_start=1
                     /locus_tag="AO090011000091"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000093"
                     /protein_id="BAE64644.1"
                     /transl_table=1
                     /translation="MSTGSSSSPSNWVTGSYTGNSDGLRITITIFVVIAWYNSIELMV
                     LIFSIFKQYKGIYFWSLLISTAGILPYSIGFFMKFFDLTSAIWVSLTLVTVGWWTMVT
                     GQSFVLYSRLHLVVQNTRLLNFVCCMIIANVFLLHVPTTVLTYAANYEQSYKFLHAYN
                     IMERVQVAGFCAQELIISGIYIWETTRMLKLNPNRDNRNIILQLFMMNLVCILMDIAL
                     IAVECANYYIYQTTLKATVYSIKLKIEYGVLNKLIYIAKQSAGRPAEDPYIELSRLSP
                     IANSDATRTTTQSKPRRSSIEDISFRLRSLVASRHCRQDR"
     exon            260133..261083
                     /number=1
     CDS             join(262325..262532,262600..262930,262986..263199,
                     263254..263678,263738..264092)
                     /codon_start=1
                     /locus_tag="AO090011000092"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000094"
                     /protein_id="BAE64645.1"
                     /transl_table=1
                     /translation="MTLFQVVETSFILLALWTSVEAIRRLFSHSLSHIPGPRLAALTW
                     WYEFYYDAVQSGQYVFKIQELHKQYGPIIRITPDEVHINDVGYLDTIYAPSMTRLDKY
                     DYQLRTLRVPGGVGTTADYYLHRIRREALPPFFSKRNVLWLESVITEKVNQLCGLIAK
                     HAATETPVNLSDAFYGFSNYVVNNFLFAHQTDVLADEQEAARLRHNSHELLKGINMNK
                     HFPWIPDILEALPQLLTRPTMPPGLIDMLELFDRVRAELITIITRISSNTSGEKESIN
                     TGAKGSVYESVLDSPNLPASEKALLRLEQEGALLTLAGTESPAQTLNIIFYHLLANPS
                     LLTKLREELATLPTLSTWTQLEQLPYLSAIIEEGNRLSFGVTARTARIQHTPITYTPS
                     AITTLSAHTAESVFPDPYAFLPERWLGDEGRERRKFQLTFSRGGRKCLGIELARAELY
                     LVTAALVRKFDLVLWETDERDVSFEHDYHVAMPRDGSRGVRVVARIRGGLALSRDRLT
                     TK"
     exon            262325..262532
                     /number=1
     exon            262600..262930
                     /number=2
     exon            262986..263199
                     /number=3
     exon            263254..263678
                     /number=4
     exon            263738..264092
                     /number=5
     CDS             join(267818..267828,267875..268444,268509..270942,
                     270970..271109,271157..271241)
                     /codon_start=1
                     /locus_tag="AO090011000093"
                     /note="sensory transduction histidine kinase"
                     /old_locus_tag="AO070335000095"
                     /protein_id="BAE64646.1"
                     /transl_table=1
                     /translation="MSSRSQGLELVATIKASQIASSLELLEVTCKTISTRLLVQSALR
                     RYYAGNISEANWATSITDVQSALGSRGYLSTYQAILYSKNGQGGRERLLNVTSDSVPE
                     ITLPYTYPNGSSVKLGDEGLGYPSVLYPNLTYTQSSEKGNATTVNAFSDYTLGLASAL
                     LLGPIAINSSFSLLSLTLPIVNNTSNTDILGFMTVVASAANVQSVVSSRDGLANTGQV
                     LLLGPSRPDNRFSTESATATSSPDRPALTDAQVHYIFEPTPLPSQDSRHRGVSTGTSF
                     ELSKYPMALKLMTESEENENRSVSKLSTKNEQGYNVAVGAVRPKTSLVEWILLVEETH
                     SEAFSPVVRLRKIILACVFGTAGFIILVVPLLAHWAVAPIRRMREAARKSIEPEVPPT
                     PSAGYVEHITDGHGDTVQAIEEHMDEKGAPVSWVKRLRRPLERFNSSHSFGDRRDPRS
                     SFHIPSRVKERRSCVTDELTELTSTFNEMSDELAIQYNRLEERVVERTKELQKAKLAA
                     EAANESKTLFIANISHELKTPLNGILGMCAVCMGEEDLHRIKKSLQVVYKSGDLLLHL
                     LNDLLTFSRNQIEQAIHLEEKEFRLSDIRSQLSIIFQNQVHEKHIDFSVNYVGIGNSQ
                     PRGTMCQERGVERTHPAVGPPQTGRLKDMVLWGDQHRILQVLINLVGNSLKFIPENGK
                     VEVRIRCVEEVPDAESSVTLVQGSQPSSQARSRTPSRLTATPVDGTNLLDSQLEKQTP
                     VPSDLRTLIFQFEVEDNGPGIPANMQRRVFDPFVQGDLGLNRKYGGTGLGLSICAQLS
                     RLMGGVILLDSEEGNGALFTLKIPLKFVKEAAASTRSSSIAGSRTPSVVSLSLEEFSN
                     IAQTPSNHSSVGNKETLTNGFEKPDVQPRLVGLSQPFFAPTVPSAPSSPSKGQESNQS
                     SSDNGSKKIRVLMAEDNKINQEVALRYVQNAYKNTLSSADLDRMLALEEVYDVTVVKD
                     GQEAYDTVKANMEEGKVFDLIFMDIQVKHLLHHMPILDGLQSTRLIREMGYSAPIVAL
                     SAFSEDSNIKDCMDSGMDMFISKPIRRPILKQVLNKFATIPEESDGSSS"
     exon            267818..267828
                     /number=1
     exon            267875..268444
                     /number=2
     exon            268509..270942
                     /number=3
     exon            270970..271109
                     /number=4
     exon            271157..271241
                     /number=5
     CDS             join(271774..272815,272880..272917)
                     /codon_start=1
                     /locus_tag="AO090011000094"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000096"
                     /protein_id="BAE64647.1"
                     /transl_table=1
                     /translation="MEYPVGLEEEFLIEEWRYWGERGARRWLRLADQKGEEGLERGDR
                     QELREVLQEVAGERWREVAQEISNQGYWEHLQQREGIRERLGERLVRWAEESWASQTD
                     DEVVNSFESQPQLQSRLIDHFRQLPLFGKPESSVPPIDRFELIRIWLRSCDQGHRDCR
                     AESSNHHPSRVISVRQDDANRLQLLELECGIEYVALSYCWGNKPQEQKPYLTTDENFQ
                     SRKDKGFDFNDLPKLFQDAITVTRELGKRYLWIDALCIIQGNKEDWQNEGTKMEHIFA
                     SAYCTLAPSSAFEWKEGFLKTYRDRKPGVSLCGPSPVKYFRRLVDDGPLNKRAWVLQE
                     RVLSRRTVFFTSSACQIFDQVFSAN"
     exon            271774..272815
                     /number=1
     exon            272880..272917
                     /number=2
     CDS             274198..275205
                     /codon_start=1
                     /locus_tag="AO090011000095"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070335000097"
                     /protein_id="BAE64648.1"
                     /transl_table=1
                     /translation="MPSSSLADYLAKNYLTADPATERPKKKRKKTKEVDTAVQGLIIA
                     DDDPPDLKSSAANFGNDDEDGPAVVTSGRSAEFRRTKKSNWKNIGGAGNEQDAADAII
                     ASAAAENAARRTEGEDDDAPAVIEGEDEDDGEMRMESGARAGLQTAAQTAAMVAAQER
                     RKKVEAALYKDSPAGGQAQETIYRDASGRIINVTMKRAEARKAEQEKLEKEEQAKEAL
                     MGDVQRQEREKRRQQLQEARAMPVARTVDDEDMNDELRARERWNDPAAQFLTKKGPGK
                     SATGKPLYNGAFQPNRYGIRPGHRWDGVDRSNGFEKEWFAARNRKGRLEALDYQWQMD
                     E"
     exon            274198..275205
                     /number=1
     CDS             complement(277123..278016)
                     /codon_start=1
                     /locus_tag="AO090011000096"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000098"
                     /protein_id="BAE64649.1"
                     /transl_table=1
                     /translation="MVRMTQTIDAELMSTDPLSVVEDPTILPPGKSLERAQAYAKLMT
                     RLWHYQLIAWLHLPLLLESGTERRYDYSRQSCLEASRHMITCYTSIRHLTANSFCCKS
                     LDFQAFTAAVTLLINILGPTGRSHLDSNDWTAIETVMTSLETLAEGQPPDKVATRGLS
                     VLRTLKSVATRNNTPQSDISDGLPPMDCQSRRIKLDIPYFGTISIDYSTRSGLPGQQR
                     LNNVPPKPTGTDLAANSALSSNVGNAAEASAVHEQATDVGPLLEARLELGPADIWSFD
                     PDLTALPSFLPGLEDSWDLGL"
     exon            complement(277123..278016)
                     /number=1
     CDS             complement(join(280214..280521,280577..281521,
                     281590..281785,281948..282070))
                     /codon_start=1
                     /locus_tag="AO090011000097"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070335000099"
                     /protein_id="BAE64650.1"
                     /transl_table=1
                     /translation="MEVRNKEDSGSGVDDAPTEEPSTGGFTLLMTVTALAMSMFLTIV
                     ATAIPKITDEFGGIEDEGWYGSAFFITLGSFQAAWGKAYKYFPLKTSFLLSIFLFEVG
                     SLICGVAPNSLALCIGRAITGVGGAGISSGAFTIIALSAPPKQRPAYIGILGASYGVA
                     AAIGPLVGGAFTTNITWRWCFYINLPIGGLAAGIILFFYRPPPPLPFLDTPLKEKLLQ
                     MDLVGTLILVSALVCYVLALQWGGISLSWGDSKVIGTLVGFVVLLAVYAIVQWVQKER
                     AAMIGRLFRRNVVVMMIYIDLLAGTFFLLVYYLPIYFQVVSGVSAAQSGIRNLPLILA
                     QSVSTVISGVTLSKFGYPQPFLLVGGVLTAIGSGLLYTLEVNTGSGKWIGYQLLAGIG
                     IGWCFQIPVVTAQASVAPEDLPSVTAMVLTVQTLGGSVFVSAGQSAMVNVLLKNLRSE
                     TSTVDAVKVAMTGATELRQKFSSAQMPFILTAYMNGLQAAFLVAVVASSVATVVCLAT
                     RWIKFSGQTTAVAAA"
     exon            complement(280214..280521)
                     /number=1
     exon            complement(280577..281521)
                     /number=2
     exon            complement(281590..281785)
                     /number=3
     exon            complement(281948..282070)
                     /number=4
     CDS             complement(join(283156..283248,283271..283504))
                     /codon_start=1
                     /locus_tag="AO090011000098"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000100"
                     /protein_id="BAE64651.1"
                     /transl_table=1
                     /translation="MSMHSKDAANWSGIELIFEEVLMGRDAIDLPLLAVPFGLPGIFS
                     LRVRSTGRHSAPDSLHRRQELGLYPEHFNCTPDSLVPSSRDHHLSATAELTDDMVRSI
                     CYRRGA"
     exon            complement(283156..283248)
                     /number=1
     exon            complement(283271..283504)
                     /number=2
     CDS             complement(join(284536..284701,284782..284942,
                     285011..285304,285351..285605,285647..286234,
                     286271..286384))
                     /codon_start=1
                     /locus_tag="AO090011000099"
                     /note="cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies"
                     /old_locus_tag="AO070335000101"
                     /protein_id="BAE64652.1"
                     /transl_table=1
                     /translation="MRSSTQLTALYWVHLVIYNVFFHPLASFPGPFWARASFLYPNIL
                     ASDMANVAYFHWPCSSRHRISTQSSWWALTDPPIYSNIINPGLRLGDIVRISPNELSF
                     ASVESWKAIYQPKSAPLVKSEFYEIYGSGFNSLCIGSERNPETHSRMRKSLAAAFSTK
                     ALLEQEDIIQGCVNDFIEGIRSQTTVNFTKWFEMLAFDILGEMAFGESFHCIENSKGD
                     SNIASHPSIIAVFRLIEHLYFITILDNLRRYPLIAAIGKTILPHLTVSVRNKHTNYSR
                     RKVAHRLQSSSPRADFMSRLIAKVEDEEMEMEELTAHASTLVYLTWKGGESIAGGETV
                     ATFLAAVTYHLLSTPNAYQKLRDEIRARYNHLSEITSTTALQLPYLQAVISEGLRIYP
                     PGSQGFPRNTPPQGIVVKGTYVPGNVEVYTSAWTVTHDARYFHDPYTFKPERWLDPNC
                     TDNKDASQPFSLGPRGCLGRNFAIVEMSLILCKLHFQFDAELVNPFQEWESASQLHVM
                     WWKPDLPVRFIPCTRDH"
     exon            complement(284536..284701)
                     /number=1
     exon            complement(284782..284942)
                     /number=2
     exon            complement(285011..285304)
                     /number=3
     exon            complement(285351..285605)
                     /number=4
     exon            complement(285647..286234)
                     /number=5
     exon            complement(286271..286384)
                     /number=6
     CDS             join(287266..287350,287397..287420,287471..288130,
                     288183..288616)
                     /codon_start=1
                     /locus_tag="AO090011000100"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000102"
                     /protein_id="BAE64653.1"
                     /transl_table=1
                     /translation="MFEGAYTTLGTHSRLLPQVVRAQLNQYLPDVLPEIQFKVALQIH
                     REIPFNAITECFAKSDWTVINVTELMAVLVARVSSRMFGGPALSQNREWIEASLRFAH
                     DGFNAAQKLKMWPDTLKFIGQHFIPEVRSIKNTYKIAERAIIPLLDEREVDKSKKAHD
                     LLTWMYDQAQGAEKDKKFIAGTLLKVSFAAYHTSAAAPTQLLFDIAAMPEHIAPLLGE
                     YLSAPRDNNQNISVKGFAQMVKLDSIMKESQRFNPLLLLTFERIIKRDFTLSDGVVIP
                     ANTWIGCAAQAIGMDRKLYPDPDTFDAFRFVAKEEATATSTSVPATKAHYTSANPGSM
                     AFGYGQHACPGRFFAMMEIKAIIGEILSRFEMRLADGEMRPPSVTFETQHLPHPAGKV
                     LFKRRRCT"
     exon            287266..287350
                     /number=1
     exon            287397..287420
                     /number=2
     exon            287471..288130
                     /number=3
     exon            288183..288616
                     /number=4
     CDS             complement(join(288916..289087,289146..289452,
                     289517..289654,289717..289915,289986..290040,
                     290117..290472,290512..290557,290624..290744,
                     290800..291007))
                     /codon_start=1
                     /locus_tag="AO090011000101"
                     /note="predicted protein"
                     /old_locus_tag="AO080523000098"
                     /protein_id="BAE64654.1"
                     /transl_table=1
                     /translation="MTLISLSLLALSLWIIIRVLVIIYRLAWHPLARFPGPKFAAATS
                     AYEFYFDAIKGGQYTFEIGHMHKKYGPIVRISPHELHINDPGFIEELYPGPGKPRDKY
                     AYATGQFGIPDVCSLVLTPYDLSSVFGAVSHDLHRMRRGALSPFFSKAAVTKLEPVIY
                     SAVDKLISRIEEVVESTGFVDLTMAFSCMTTDIVTQYAFAESSRFLENPDFTPNFHEA
                     ILAGTRMGSWARHFPILFPVLRSIPIDILSRMSPETGVFLRWQESMRKKVSEIWQDQS
                     ALPVKDKNVSPFGSTIFHELFHSDMPDSEKHPGRMWQEGQIVIGAGTETTAWTLTATT
                     FFILDNPNILSKLRKELAATMPNRYEKPSCRELEALPYLIIIQEGLRLSFGVATRLQR
                     INSEAPMIFRQKKTNDTIEEKVWEIPTGTPVGMTAALVHLNPELFPDPHEFRPERWLD
                     QDGQLHRGLDKYILSFSRGSRQCIGINLAYSELYMGIGILIRRLGDRMQLFETDRTDV
                     DMVEDCFVPVPRRESNGVRVRLSAQ"
     exon            complement(288916..289087)
                     /number=1
     exon            complement(289146..289452)
                     /number=2
     exon            complement(289517..289654)
                     /number=3
     exon            complement(289717..289915)
                     /number=4
     exon            complement(289986..290040)
                     /number=5
     exon            complement(290117..290472)
                     /number=6
     exon            complement(290512..290557)
                     /number=7
     exon            complement(290624..290744)
                     /number=8
     exon            complement(290800..291007)
                     /number=9
     CDS             join(291277..291439,291995..292404)
                     /codon_start=1
                     /locus_tag="AO090011000102"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000105"
                     /protein_id="BAE64655.1"
                     /transl_table=1
                     /translation="MNCKATFSRRTRNNMDTPPNILLMPILIRHTSMASMQLSDADIP
                     SCAGKTVVITAPWQLIGLMRALRATLPLDNITINTVAPAATLTGLIPPELAKPIIAMG
                     LPTSSADFVGLAVAYSAVALETRQVELYGKDPDTATVECKGRWNGRTILTLGDRYTEL
                     EQAISDLRPQWFGVDNATLTRMQQKATDFR"
     exon            291277..291439
                     /number=1
     exon            291995..292404
                     /number=2
     CDS             join(292746..293103,293161..293434,293470..293902)
                     /codon_start=1
                     /locus_tag="AO090011000103"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000106"
                     /protein_id="BAE64656.1"
                     /transl_table=1
                     /translation="MLQRLWALSTSAIKLPFQPFSFGAPRDLLIEKDRRSMPCLAKEA
                     PPPSAFSATIHPLSDSVSTEVDNYFLQNWPFRTDNERARFHAAGFSRVTCLYFPMAMD
                     DRIGFACRMLTILFLIDDLLEEMSLDEGSTYNEKLISISRGDVAPDRTIPAQWIMYDL
                     WEDMRACDHVLADELLEPVFTFMRAQTDKTRLTIHQFGEYLDYREKDVGQAIKAQTKC
                     IRSLLSGLQRYTMKLYLTEEDLRMAAPAERNCAKHIAILNDIYSWRKELLASKTLHHE
                     GAAICSSVQVLSEVTALSHAATQRVLWTMCREWESVHKQLVTEVAGTGSRDLLDYIHG
                     LEFQMSGNERWSESTPRYHF"
     exon            292746..293103
                     /number=1
     exon            293161..293434
                     /number=2
     exon            293470..293902
                     /number=3
     CDS             join(296607..296652,296706..296835,297369..297660,
                     297725..297865)
                     /codon_start=1
                     /locus_tag="AO090011000104"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000107"
                     /protein_id="BAE64657.1"
                     /transl_table=1
                     /translation="MAGLWLGLGFTAGKSIAITLWSAITAPFRGQTGGATAYKHVAIT
                     FARSFFGTASIEQIQLSLSENLRGALLLSPWIDFGTDHESFRTNADKDAISAESLGRW
                     AEALFGDTKMDKYTNPTDAPTGWWKLLPVEKIFIGVGGDEVLLDSIVSLAHKMKTEHP
                     DVLVSRVPREFHVEPITDFGLGLSPGVQYQAMAAWLNQTFSQ"
     exon            296607..296652
                     /number=1
     exon            296706..296835
                     /number=2
     exon            297369..297660
                     /number=3
     exon            297725..297865
                     /number=4
     CDS             299220..300125
                     /codon_start=1
                     /locus_tag="AO090011000105"
                     /note="carboxylesterase and related proteins"
                     /old_locus_tag="AO070335000108"
                     /protein_id="BAE64658.1"
                     /transl_table=1
                     /translation="MRYLNFTNIQYGTSRRFQPPIPPPVNSTIQTAGAYNIRCPQGQP
                     AWLSLFGQPVGNLTGVPPVTIADLPPVDPSTSEDCLYLDVFVPEDVFQAKGDYKSSVV
                     IWIHGGGYVGGWKSLYGPGLGLMETAKKEGRDVIFVSINYRLGLFVSGHYLELILPLN
                     TNCFRRQGFLADPDSSDITRNLGLQDQLFALKWVHKYIHLFGGDPNTITVMGESAGGG
                     SIMYHLTSGNASYRPLFQRAIVQSPFTINIPARMQRSTLQEVYQRANVTSFEELKGLS
                     TQALQTANALVVGNAKPYGTFVFGE"
     exon            299220..300125
                     /number=1
     CDS             300249..300803
                     /codon_start=1
                     /locus_tag="AO090011000106"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000109"
                     /protein_id="BAE64659.1"
                     /transl_table=1
                     /translation="MAGHNTNEGVLFASPFVKNDEDYANLVASLFPGISSTALSIITD
                     KLYPSTLSGKYGYVDQTGRVASTIGESLISCNEYFLGEAFARSNTSFRYEFSVPPAIH
                     AVDLSYTFYNAGEATSGVNITLAGIMQRYFANFITTGQPYSHRPTDFPVDDMIQNFNI
                     SSVGRMKDSVSTKRCKWWQKADFR"
     exon            300249..300803
                     /number=1
     CDS             join(302791..303801,303858..303875)
                     /codon_start=1
                     /locus_tag="AO090011000107"
                     /note="predicted hydrolases or acyltransferases
                     (alpha/beta hydrolase superfamily)"
                     /old_locus_tag="AO070335000110"
                     /protein_id="BAE64660.1"
                     /transl_table=1
                     /translation="MFVGYHRLISATEGFLSSASKRNASTLPASNSNHVIPTEPRNKS
                     STLVDPAQLDQTLTLSDGRTLGFAEYGSPHGKPLLYFHGLPACRYEIDFHELGLRHGA
                     RIFALDRPGMGLSAFQPNRQLLDWPADVKDFTGKLGLVEYRVLGGSGGGPYSLVCAKA
                     LPKESLKGVGVLAGFAPLEAGTQGMSLRSRILWNLGRWFSGLGRLYTDWTIVPAAHHP
                     DPKVLEELLAKTVKNNFNETDSSVFEDEKILKHAAKIVRESFRQGSQGYVQECKILTR
                     PWGFDLREIDFPGVRLWYGDNDRHTPIQMARWMADRIEGSVLTEWKGYSHFTFTDDHT
                     EEVYSGHS"
     exon            302791..303801
                     /number=1
     exon            303858..303875
                     /number=2
     CDS             join(305320..305483,305538..305922)
                     /codon_start=1
                     /locus_tag="AO090011000108"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000111"
                     /protein_id="BAE64661.1"
                     /transl_table=1
                     /translation="MSDSNDLRHNGTAAKRVYNHKSKWAYGGRAALPHRDVSLSDPVT
                     RPAAPQTHSLKYSRLLQLDRKAKSNQLATTAKSTLRRDIREALDSGPSDSSAAEDVEE
                     PSAAKDILGHLQEEDLLEPYQVSGQTILSDAISKAVEKFETRETEKLVEEYEIITRES
                     EIATGYLADDDFELVDHDHARL"
     exon            305320..305483
                     /number=1
     exon            305538..305922
                     /number=2
     CDS             join(306785..306899,306961..307856,307915..308262)
                     /codon_start=1
                     /locus_tag="AO090011000109"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000112"
                     /protein_id="BAE64662.1"
                     /transl_table=1
                     /translation="MDKRSAESPMDFEWQTRAPGDVTSPFYQLSMQHDNQKKRPHRVF
                     ESPGKKQMPALREPNSQPFLFSQPRSQDPPGTPKSLFGQSAFMTPRKFDVDFSSGAEN
                     MSSPENADNEDTPEPPMKSGHRNSLFNMYGRFAPSPGRGEIPRLNHYSNALARRVQKR
                     RRRDKALDMQFRRESDDESDDEHVSGNKQNQKQGHVQGEAQPASRMNSFSDFFALLEA
                     HPNVPSILSWWAQLIVNLSLFSLAVYVVFGFVSAIRAEFEQAAEEVSDTILAEMATCA
                     KSYVDNKCGGGDRLPALETVCENWERCMNRDPAKVGRAKVSAHTMAIIINSFIDPISW
                     KAIMFFLATISTVTVVSNWSFRSFRNRYNQHEYTHPSAPSFPRQPSGQHHPSLGPSQP
                     SYQHSVGFNYQSHAPSLDHKKETPLMLEDSPTRDFVNERSRTRESRMRTPSPTKRDRK
                     LL"
     exon            306785..306899
                     /number=1
     exon            306961..307856
                     /number=2
     exon            307915..308262
                     /number=3
     CDS             complement(join(308746..309705,309758..310075))
                     /codon_start=1
                     /locus_tag="AO090011000110"
                     /note="monocarboxylate transporter"
                     /old_locus_tag="AO070335000113"
                     /protein_id="BAE64663.1"
                     /transl_table=1
                     /translation="MTRSPEHTMISPRSEVDQEKVSVVSSKYEEAPDGGRAWLVAAGG
                     ASLFFCCLGFANSFGTFEEYYLSHQLRGQTPDNIAWIGSLAAFLQFATGACSGPLFDR
                     YGAWIIRPAAVAYVFAMMMLSLCKTYWQIMLVQGVLMGVVTGFLQFPAFPAVSQWFDK
                     RRAAALGIAAAGSSVGGIAIPIALSKMLNGSSLGFGWSVRIIGFLIMPIMAFACLTVN
                     RRLPPSTSPFWIPSALKEAKFALLIVSLFFMFIGMFFPLFYIPSYAVSRSMSATLSGY
                     LLAILNAASTFGRVIPGILADKFGRLNAFMVGGITTAIVIFCFNLATTNAGLIVYSAV
                     IGFTSGTIISGASAAFTLCPKDPRDMGTYMGMGIALSSFATLIGPPVNGALVKHYGGY
                     SEASIFSGVMCFTGGFFALATKAMTPQGIFGRT"
     exon            complement(308746..309705)
                     /number=1
     exon            complement(309758..310075)
                     /number=2
     CDS             join(311173..312765,312817..312906)
                     /codon_start=1
                     /locus_tag="AO090011000111"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000114"
                     /protein_id="BAE64664.1"
                     /transl_table=1
                     /translation="MLEPHVRDETSDILSGMQRCKTLARVIKSRRTPLWPSPLASALP
                     SKDVADELVDCYLRTSETVYRVLHIPSFQKDYEALWMSDTAPDMAFMVQVKLVLTIGA
                     TVYDENFSLRASAIQWVYEAQTWFSEPVCKSRRSLQFLQINILLLIARELVNVGGDTI
                     WTAAGALLRTAVYWGLHRDPAYLSNRTIFVGEMRRRLWNTILEMALHSSMACGAPVGI
                     SLDDFDTAPPDNYDDDQLVADAPVPKPEDTQTQVSVAIALRKTLPIRLAIVKFLNELG
                     SKSTYEETLRLDAEFRVGYRDLCRALQRYNAGTGLKSQFTTHMVDCLMLRYLVTLHIP
                     FYAMAPHETAYAYSRKTVVETSLRIWCALNPSSSIMAAHTRHDTASTGRNDFDRLAIC
                     GTGYLRVFGMQASLAIAAELSTQLQEEERLGPVFLRADLLSMVQESKEWLFRAIEAGE
                     TNIKGYLLIELIEARIAGLRQGLARDQLVMLLLKAAADAEARCLRILEKMAAQGQTEG
                     FSNGLGQMGLEITPDSMDDWDLMMTDVLLNQSTAEPMNWVYNEIPLVPLLPS"
     exon            311173..312765
                     /number=1
     exon            312817..312906
                     /number=2
     CDS             join(314112..314391,314447..314664,314727..314967,
                     315023..315630)
                     /codon_start=1
                     /locus_tag="AO090011000112"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000115"
                     /protein_id="BAE64665.1"
                     /transl_table=1
                     /translation="MKPSFVSLLSLACLGAASREGAPIMSHLMSIKTEHRERARAQGL
                     FKPNSYIDLAKTPCVDGKAGEYSCENVDLLGFLSHQAMGSTTREGNDIWGWTSADGRE
                     FGIVGQTDGTAFVEVLDDGSLQYVGRLPTQTTATIWRDMKVIGDHAYIGSESPGHGLQ
                     IFDLKKLLETDSNNPTNFSTTEDLTAWYSGFGSSHNIVAHEETNMIFAVGTARNLSCA
                     GGLWMIDVSDPANPTSPGCVSEDGYVHDAQCVIYTGPDKEYTNREICFNYNEDTLTIV
                     DITDRASPIQISKTPYVGASYTHQGWIAVSDMSYLLLDDELDEQDGTGEAANGHTTTY
                     IFDIKDLANPKHTGTYQSPVRSIDHNQYVIDGLTYQANYGSGLRIVDVSSVKDDPTGK
                     GFKQVGFFDCHPEDDAQGGEVEFVGAWSVYPYFRSGNILLNSIERGVYSLKYTGKA"
     exon            314112..314391
                     /number=1
     exon            314447..314664
                     /number=2
     exon            314727..314967
                     /number=3
     exon            315023..315630
                     /number=4
     CDS             join(317748..317933,317982..318199,318270..318540)
                     /codon_start=1
                     /locus_tag="AO090011000113"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000116"
                     /protein_id="BAE64666.1"
                     /transl_table=1
                     /translation="MVMLRSLLVSALAALAAGSPIAEPADQSLEARQLGSSNDLTNGA
                     CKDVTLIFARGSTEMGNMGTVIGPPLCSSLKSKLGADKVACQGVGGLYTGGLMQNALP
                     QNTDPGAISTAKSLFEQASTKCPNTQIVAGGYSQGSAVIDNAVQQLSAEVKDKVKGVV
                     FFGFTRNLQDKGQIPNYPKDNVKVFCAMGDLVCDGTLIVTAAHLTYTINAPEAASFLA
                     SKVQSA"
     exon            317748..317933
                     /number=1
     exon            317982..318199
                     /number=2
     exon            318270..318540
                     /number=3
     CDS             join(319126..320093,320189..320828,320923..322349,
                     322408..323335)
                     /codon_start=1
                     /locus_tag="AO090011000114"
                     /note="multidrug/pheromone exporter, ABC superfamily"
                     /old_locus_tag="AO070335000117"
                     /protein_id="BAE64667.1"
                     /transl_table=1
                     /translation="MPNRDCGDQQASVQEGQDSTLANPPLNTVSSALADGDQKEEDGD
                     PFKHLPEHERVILKRQVDLPATKVNYMTLYRYATRNDKIILAIASLAAIIGGALMTLM
                     TVLFGGLAGTFRSFLLGDLSDNQFTSELARFSLYFLYLAIGEFVMVYLATVGFVYAGE
                     HITATVREQFLAAILRQNIAFFDELGAGEITTRITADTNLFQEGISEKVGLTLTAIAT
                     FVAAFVIGFVRYWKLTLILCSTVVAIVVTLGAVGSFVAKLSKKYLGHFAEGGTVAEEV
                     IGSIRNAAAFNTQEKLARRYDGYLVEAEKSEFKLKSTTSSMIGFLFLYIYLNYGLSFW
                     MGSRFLVDGSVGLDQILTIQMAIMMGAFALGNITPNIQAITSAVAAANKIYATIDRVS
                     PLDPLSTEGEKLEDLQGNVELKNIRHIYPSRPEVVVMDNVNLLIPAGKSTALVGASGS
                     GKSTIIGLVERFYDPVDGSVHVDGHDIKDLNLRWLRQQISLVSQEPTLFATTIFGNIK
                     HGLIGTAHEHESEKAIRELVERAARMANAHDFITSLPEGYETDIGERGFLLSGGQKQR
                     IAIARAMVSDPKILLLDEATSALDTKSEGVVQAALDKAAQGRTTVIIAHRLSTIKNAD
                     NIVVMSHGRIVEQGTHDDLLQKKGAYYNLAEAQRIATKQGSADQDEDPILRETNYDLR
                     RSESSENRYSLVKEDQGENLDDLQGDKTRSDRTASRTALANKEQEDIADNYTLFTLIR
                     FVAKLNKKEWKYMVFGLLLSPLFGGGNPTQAVFFAKCITALSLPLSERSEIRRQANFW
                     SLMYLMLAFVQLLTLISQGIAFSYCAERLIHRVRDRAFRYILRQDIAFFDERSSGALT
                     SFLSTETSHLAGLSGITLMTILSLLTTLVASCAIGLAVGWKLSLVCMSTIPLLLACGY
                     FRLAMLVRLEKEKKKAYEHSASYACEATSAIRTVASLTREGDVCDHYHEQLLSQGRSL
                     VWSVLKSSILYAASQSLQFLCMALGFYYGGTLFGRHEYSIFQFFLCFSVVIFGAQSAG
                     TAFSYAPDIAKARHAAASLKALFDRTPEIDSWSHDGEMVQSIEGHVEFRDVHFRYPTR
                     PNQLVLRGLNLHVKPGQYVAFVGASGCGKSTAIALLERFYDPVSGAVYVDGKEISSYN
                     INKYRSHLALVSQEPTLYQGTIRENILLGTDREDVPEDEMVLCCKNANIYDFIISLPN
                     GFDTLVGSKGSMLSGGQKQRLAIARALLRNPRILLLDEATSALDSESEKLVQAALDTA
                     AKGRTTIAVAHRLSTVQKADMIYVFNQGRIIECGTHSELMQKQSAYFELVGLQNLGEM
                     "
     exon            319126..320093
                     /number=1
     exon            320189..320828
                     /number=2
     exon            320923..322349
                     /number=3
     exon            322408..323335
                     /number=4
     CDS             complement(join(325124..326031,326040..326286,
                     326339..326557))
                     /codon_start=1
                     /locus_tag="AO090011000115"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000118"
                     /protein_id="BAE64668.1"
                     /transl_table=1
                     /translation="MPPSSLSKAANLKALLTRALTLNLPLYPDSPTPSGLSLSEIASA
                     AATAVPESPVSNVPGLAFDRFYHLWMENTDFKVAAADENMQWLASQGILLTNYYGVTH
                     PSMPNYCSSVGGDIWGMDHDNFVQMPSNISTVVDLLDTKGISWGEYQEHLPYAGFNYS
                     NQNTHTDGYVRRHNPLVLFDSVTNNDTRARQIKNFTTFEEDIKNKRLPQWAFITPNVT
                     NDAHDTNITFGAKWERSWVADLLNNTYFMNNTLFLLTFDEDAYDGNNRVFSVLLGGAI
                     PEHLRGTTDDTFYTHYSTIATVSANWGLPSLGRWDCGANIFEIVANKTGYVNYEVNTT
                     NLRLNETYPGPEAIGWIGQYSPVWPVPVTDAQCSAGHGVLESVKAAFAESTPTYNYTS
                     PYPWDAKNGYNADVTATRPTNGTVTNTTSDDEDVTLSNAAGMAGGSPSSVTITLVLAG
                     VLSWLFI"
     exon            complement(325124..326031)
                     /number=1
     exon            complement(326040..326286)
                     /number=2
     exon            complement(326339..326557)
                     /number=3
     CDS             join(329115..329274,329328..329439,329486..329612,
                     329658..329815,329866..330045,330093..330187,
                     330238..330609,330682..331082)
                     /codon_start=1
                     /locus_tag="AO090011000116"
                     /note="amino acid transporters"
                     /old_locus_tag="AO070335000119"
                     /protein_id="BAE64669.1"
                     /transl_table=1
                     /translation="MSIKSGKDDTIMYQARSDLDEEDPGSQAGSIDPLAAPLKRRLKS
                     RHLQMIAIGGIIGPGLLVGSGNALNKGGPAGCLISFSLVGLIVFFVMQSLGELATAIP
                     VSGSFTEYAQRFVDDALAFGLGWAYWYLWVTILASEYNAISLVIGFWTDAVPQWGWIL
                     IFWVLFLGLSNLGVLAYGEMEFWLSLIKVLALLAFFILAICISTGGVGPGPIGFKYYH
                     DPGAFADSINGVARTFVVAGTLYAGTEMVGVTAGESANPQKAVPTAIKQVFWRILIFY
                     IGTFFFLGILLPYNHPKLLSSTSTAASSPLTIALTDAGILPAAHLINALIVISVISAG
                     NGSLYVASRTMLFMARNGKAPRFIDRTNSRGVPWVALIFSNIFTCIVFLTLSSSAGRI
                     YSALITLAGVATFVVWAVICIAHIRFRKAMVVQGDDPSRLPFRAALYPYGTYFALGAT
                     IFLVFFQGYTAFLNPFSVDDFIINYILLPVFVMLVVGYKIWNKTKIVKLEEMDIWTGR
                     RVAVIDETETGKEHGWLAKLKDIIIG"
     exon            329115..329274
                     /number=1
     exon            329328..329439
                     /number=2
     exon            329486..329612
                     /number=3
     exon            329658..329815
                     /number=4
     exon            329866..330045
                     /number=5
     exon            330093..330187
                     /number=6
     exon            330238..330609
                     /number=7
     exon            330682..331082
                     /number=8
     CDS             join(331346..331485,331558..331643,331696..331877,
                     331925..331946,331996..332076,332135..332234,
                     332288..332338,332387..332450,332505..332897)
                     /codon_start=1
                     /locus_tag="AO090011000117"
                     /note="Zn-dependent alcohol dehydrogenases"
                     /old_locus_tag="AO070335000120"
                     /protein_id="BAE64670.1"
                     /transl_table=1
                     /translation="MSIPKYQTAATIERPRPGAKLDLRHDIPVPEPKAGEVLVKLECT
                     GFCHSDLHNINGELPMSTNVPGHEGIGRVVQVGPDTTEDMMGKRVGVKYHSPISQLLK
                     NGLTSTRWLYSTCMKCPTCKVNYPNCPNQSNSGRNVPGTFQQYIVSPADFVSIIAEEL
                     EPEAVAPLLCAGLTMYGALNKLHKFCQKGDWVVIMGAGGGLGHLGIQIGKEMGYNIIA
                     VDSATKQDICMKSGAAAFVDFRNDVEKEVQNLTDGAGAHAVVVVVGLASAYNQALRLL
                     RPLGTLVCVGLPSQDYRMPISPLDCVNRGIHVVGSCVGTEEEMQDLLRMAAAGRVSTH
                     YQVFELMEVNTVIERLERFAIEGRAVLRIPTESPKATE"
     exon            331346..331485
                     /number=1
     exon            331558..331643
                     /number=2
     exon            331696..331877
                     /number=3
     exon            331925..331946
                     /number=4
     exon            331996..332076
                     /number=5
     exon            332135..332234
                     /number=6
     exon            332288..332338
                     /number=7
     exon            332387..332450
                     /number=8
     exon            332505..332897
                     /number=9
     CDS             join(333523..333537,333652..334029)
                     /codon_start=1
                     /locus_tag="AO090011000118"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000121"
                     /protein_id="BAE64671.1"
                     /transl_table=1
                     /translation="MMYSKLLTLTTLLLPTALALPSLVERACDYTCGSNCYSSSDVST
                     AQAAGYQLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGAD
                     RVVFNENNQLAGVITHTGASGNNFVECT"
     exon            333523..333537
                     /number=1
     exon            333652..334029
                     /number=2
     CDS             338252..339073
                     /codon_start=1
                     /locus_tag="AO090011000119"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000122"
                     /protein_id="BAE64672.1"
                     /transl_table=1
                     /translation="MRFSAIFTLGLAGTALATPLVERAGSSPTDIISGISDKTDALDS
                     AIKAYNGGDPSKVESASADLISTITKGTDAIKSGDDISTTDALALPEPVQALTKKVEQ
                     AIDDIIAKKDKFVEAGAGGKVKDSLNQQKSAADGLASAITSKVPESLKEIAQSLSAGI
                     STAIQKGVDAYKDVSDSVPSSSAGSSASATATGSASETGSASTTGSASATSSSVIPTS
                     SGAASSSAAPSGSSTPTGSGSASATSPPLATGAANKATIGYSLGAVAMAAIAVAV"
     exon            338252..339073
                     /number=1
     tRNA            339554..339637
                     /locus_tag="AO090011t00001"
                     /note="tRNAscan-SE"
                     /product="tRNA-Lys"
     CDS             341288..341818
                     /codon_start=1
                     /locus_tag="AO090011000121"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000124"
                     /protein_id="BAE64673.1"
                     /transl_table=1
                     /translation="MPKEMVDDPTQYRGRVTLTERFLYLVKKAYEGGEAINTMNALDW
                     VGPDSSRVDEEDDDYVSMGEGGDESIGEMKKSKEDKDKYSVMTRSSTRRQDAESTLEE
                     LRTGTEQLSIEGQSHPYSSLEWKRGSISVSFDDSKSKWYYTAQRKRVYIQLHEDPDEG
                     DIFVMNNLRHRARKYT"
     exon            341288..341818
                     /number=1
     CDS             343051..344394
                     /codon_start=1
                     /locus_tag="AO090011000122"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000125"
                     /protein_id="BAE64674.1"
                     /transl_table=1
                     /translation="MWPAIDSLGFKMDWKFAQRHVLRLAAATAALLLVAFLYINFNVG
                     SSTMGEAIRVNNKTQSCIDFDPATVSEKLHSTIRLKQHTYNNAEISEFVCSILNHDMN
                     LTAKLDCSVSIDSRYEHLRPSPSGSPRIQYYFALDLYQAVHIILPLMGAIMEAIRYLG
                     PEYCALSIVEGRSTDGTYAILAGLKTELAAMGVPYFLVRDYLDPKAGGENRITALSHL
                     RNLALEPLLEESKSKHSRLASKPTIIFVNDIVICPEDILELIHQRVIQSASMTCAFDW
                     NKNAGNFYDSWVSRSMSGNLFFEVTHDGRHWLGDDMFFDHPDSAARWDQTLPIQVYSC
                     WGGMVTLDAEPFIRGSIAFRSSDKEECYMGEPMTLAKDLWKQGRGQILAVPSVNTGYE
                     YDQARDAKGRRGYVHDIVNHTQYNTEAELVKWQKAPPPMVKCMPVFERQWWTTPV"
     exon            343051..344394
                     /number=1
     CDS             complement(join(346936..347104,347548..348353,
                     348405..348494,348547..350191,350292..350600,
                     350779..350828))
                     /codon_start=1
                     /locus_tag="AO090011000125"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000128"
                     /protein_id="BAE64675.1"
                     /transl_table=1
                     /translation="MAPQTNSNNSKPSKLLRTRWLISYRYQSDAVADITLTIGYLSAL
                     ISILSQALTPRAKFMKIMFFNLLSTCVSASLCCLTIYCAVKAREHNTPPDANESVKNG
                     YSSDACAVSAIWLIFMIWVANTIRAWRPMELQDPMVAFSIFASVTITRAGTFVTVSDG
                     LAFVSRLLKGFMIGFAIATGVSLLILPITSRRNVFHDIKGYVAQIDAVLQSQMAFVER
                     TPQLLTGGQGLLNRTRTAQTIRDVENNPGSDLEARKKQLTASITKLNALHGKLQSDLF
                     YANDEFAWGKLSASDLNRIGGLLRSILLPLAGMAQLPEVLDMIIKNEGSRENDRVSDG
                     ERGDELLKQSEMEKVSGTLHDRLADATSLTTGGLQYVLLALELAKPKQLESKRNESGD
                     EESKGEAISPLDSNFTSRFEQEMSKYFERRKELPRSLASLEAFSASEKVDDISNDSRA
                     VIPDSDVRQEFFLILYMGHLQESLLNGVLELIKFADSKVADGTMKKSGPIFPMQNSIR
                     GWLSLKSEKDKSRGSDSRQPSQANPASIHAEDEPDRFPDPEHLPPANLLEKASTIIRF
                     ISHVIKSEYSIFGFRVAAAAFSVGILAFLHQTQNFFIRQRCIWAMIVIVIGMNPTSGQ
                     SMFGFVARIVATAVSLVLSLVVWYIVDQKTPGVIVFLYLANVFEYYFYVNVPQYFGPS
                     IISIVTLNVIVGYELQVRKLGMEVATSNGQPYYPIYIFGPYKLAAVAAGCAISFFWVI
                     FPYPITAKSTLRKSVGRALFVLAKFYSCMHTTVELWLHGELSNGQDTRSASYKLETSG
                     HKIFKEEMMLLNQLRTYSHFSTYEPPIGGKFPKETYDHIISEIQRMLTSMALMAHTTQ
                     HLNVSSRETESSRNSGERWVSQLASIALQSADFHSHSLTSLLCHLSASLANAQPLPPY
                     LSVGDSFPLARHLQRIDGELLSIRHVQDPAFSAFVTLEVLRSVVGFTLRDLLRSRLNL
                     NFRGRRKPIILRPKDPIIARDMHDLHDKRLRQFGRIYKKHTKPWDCCGVR"
     exon            complement(346936..347104)
                     /number=1
     exon            complement(347548..348353)
                     /number=2
     exon            complement(348405..348494)
                     /number=3
     exon            complement(348547..350191)
                     /number=4
     exon            complement(350292..350600)
                     /number=5
     exon            complement(350779..350828)
                     /number=6
     CDS             join(352134..352244,353380..354073,354878..355105,
                     355158..355344,355403..355466)
                     /codon_start=1
                     /locus_tag="AO090011000126"
                     /note="Ca2+/H+ antiporter VCX1 and related proteins"
                     /old_locus_tag="AO070335000129"
                     /protein_id="BAE64676.1"
                     /transl_table=1
                     /translation="MDDTNGAIGASAPLLRGLDSEPLTSIPPIIVRYRHGRDGSIRFV
                     SHTKHALCHSWVNVLLVFVPVGIAVKAVGLSAGLIFAMNAIAIIPLAGLLSHATECVA
                     SRLGDTIGALINVTFGNAVELIIFIIALVKDEIRVVQASLLGSILANLLLIMGMAFLL
                     GGLRFQEQIYNSTVTQMSACLLSLSVMSLLLPTAFHASWSDNTAADKYTLKVSRGTSV
                     VLLLVYVLYIVFQLKSHSYLYASIPQQIIDEESHPGVLADFMNHSSDSSSIVMLLLST
                     GLVAVCAEFLVDAIPEMIESSSVSEAFIGLIILPIVGNAAEHVTAVSVATKNKMDLSI
                     GVSVGSSIQIAIFVTPLVVILGWCMDKDMSLYFTLFETISLFVTAFVVNFLVLDGRSN
                     YLEGALLIAAYVIIGVAAFFYPPASQSSDVASAGY"
     exon            352134..352244
                     /number=1
     exon            353380..354073
                     /number=2
     exon            354878..355105
                     /number=3
     exon            355158..355344
                     /number=4
     exon            355403..355466
                     /number=5
     CDS             complement(join(356742..357111,357166..357743))
                     /codon_start=1
                     /locus_tag="AO090011000128"
                     /note="NADPH:quinone reductase and related Zn-dependent
                     oxidoreductases"
                     /old_locus_tag="AO070335000131"
                     /protein_id="BAE64677.1"
                     /transl_table=1
                     /translation="MGLMMTHQVLSTPLRTQPRTNPIPADYYKFVPRPFHIMGYDGAG
                     IVQEVGPECTRFKPGDEVFYVSSPTKQGAYCEYQIVTDATVGHKPKSLDFVEAAAMPL
                     TYGTAYESLVDRLEIKKGEKAGILIINGAGGVGAMASQIARWVLDLPVVVTTASRPET
                     IDFTKKMGATHVINHREDLKKQIDELQLDVPIKYVYITHSTAQYLGVCSDIIAPLGKV
                     CSIVQSADMNMYGTQFMSKSLTFVWCWLGSRLYHGLETDQGEMLEELSALIDAGKIKC
                     HLTRRLQLNLEGIKEAHKILESGKAIGKVGLGLSEGGWA"
     exon            complement(356742..357111)
                     /number=1
     exon            complement(357166..357743)
                     /number=2
     CDS             complement(358492..359421)
                     /codon_start=1
                     /locus_tag="AO090011000129"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000132"
                     /protein_id="BAE64678.1"
                     /transl_table=1
                     /translation="MQSFRFTLPNNGTVEGVHSIPPSSGTPLKYRPLIVGLHGGCYDH
                     RYFNATPKCSASLASAAFGVPFVSIDRPSYGGTSSILPIPEGSDFFEQSGFLLHQQIL
                     PTLWREIGMPSQCNCIVLLSHSLGVMPAIITAALHAQDKTPSYPLGGLIASGMGDKQS
                     SFMKDGPPSFLPVDNDYALFPLDAKDDIMFKPETFDPVVLEHSERLNAPCPLSEVSQF
                     AALWLPVWKQKWAAHVSTPVMFSLVEDDPFFVATEEEIETCVRAFKSSVRVDGSLITG
                     APHCVELSYWSQGWYARCFGFAMECAASFASST"
     exon            complement(358492..359421)
                     /number=1
     CDS             join(362415..362846,362997..362999)
                     /codon_start=1
                     /locus_tag="AO090011000130"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000133"
                     /protein_id="BAE64679.1"
                     /transl_table=1
                     /translation="MADTPNTSAALPQHAAPFNIPSHNIAPCPGCENIGPLKGDFHMD
                     PLSLSPECIPLTLFNSYPQSPFKNSLDERITNPGPATQGEPEVGLDMHLSTTSQLSEV
                     VVSPRNHTAIHNHECVNLGLSGTRWNAAFEDNTALDRQHGNL"
     exon            362415..362846
                     /number=1
     exon            362997..362999
                     /number=2
     CDS             complement(363807..364898)
                     /codon_start=1
                     /locus_tag="AO090011000131"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000134"
                     /protein_id="BAE64680.1"
                     /transl_table=1
                     /translation="MIERYLIVSQSLRMLSFFCVVASAALAAATSLHIQGHRNGPLIL
                     QDAGDFFVGGREVKTLVNTGDRSNPLFDYPPEDWIFVDQMYVEYQIPMNGTNHLPYIL
                     VHGCCLSGKTYQDTPDGRMGWAEYLVRKGHPVYIPDQTSRARSGFDPTIFNQVQLGEV
                     APSALPRIEIAGRQRAWDLFRFGYTYPQVFPGLQYPIEAMAELSKQVIPDLNAMLPNP
                     NPTYANLASLASKVHGAVLVGHSESAFFPFYAALNNSSAVRGIVSIEGQCPTLTDEEI
                     AVLATIPTLFVYGDYLDQAKVSRRVWPQSLQGCQAVVDRLTAAGGRAFMAELPKLGIY
                     GNSHMMMQDKNNLQIADFIMDWIEENVDN"
     exon            complement(363807..364898)
                     /number=1
     CDS             complement(join(366420..366482,366737..367441))
                     /codon_start=1
                     /locus_tag="AO090011000132"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000135"
                     /protein_id="BAE64681.1"
                     /transl_table=1
                     /translation="MPRDNVSRVKKTNTIGILTFIGLRAADSVFQYALLQRGWASSLI
                     ERLGATAVSREMIVHVSTGQLQPQYAIIAFMALGSSVKQILNILLVLQQEMSPSSAVI
                     IAFFNTLCNTLNTVLSVWAVTSQAPGPDSFFGIFRRPFLLAGIGFYSAGILIEAVSEL
                     QRTAFKKDPNNKGKPYAGGLFSAARHINYGGYTIWRASYAYTSAGWLWGLGVFSWFFY
                     DFAARGVPVLDQYLLGRISLSTARFSLLADADFFVFL"
     exon            complement(366420..366482)
                     /number=1
     exon            complement(366737..367441)
                     /number=2
     CDS             complement(join(368497..368523,368695..369063))
                     /codon_start=1
                     /locus_tag="AO090011000133"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000136"
                     /protein_id="BAE64682.1"
                     /transl_table=1
                     /translation="MEIPEAAGQRFLAAVDPCSNHQIAKIIKENFSDLASRLHEQVAV
                     PNTGSRFMVDTSPMKILGISFKPLKDSVIDTVSSVLERGWPAQQRLCLTVLRKLSSPK
                     AHALVFKMICMESMLGSSRKLIFAPSENL"
     exon            complement(368497..368523)
                     /number=1
     exon            complement(368695..369063)
                     /number=2
     CDS             complement(join(370126..370213,370319..370339,
                     370424..370586,370636..370770,371285..371477))
                     /codon_start=1
                     /locus_tag="AO090011000134"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000137"
                     /protein_id="BAE64683.1"
                     /transl_table=1
                     /translation="MRLQLHDDISCREIVLSRTLSFQNIRCRPPTSTFLHLLPSPTGN
                     PPWLSCSSTVGCEKIELIPVAEFHEGAYNQVQESQGHEAHLTHDLIGGAVGYEAIKKF
                     NEYQAKNGKPVEHAQAKELIGGFVSAALTNLVETKGLDQVDKFRAEQEAKRHAEEALS
                     PHYETTVWPATGTVGYVSDRPSTHGSVLNGRGTMPPDCR"
     exon            complement(370126..370213)
                     /number=1
     exon            complement(370319..370339)
                     /number=2
     exon            complement(370424..370586)
                     /number=3
     exon            complement(370636..370770)
                     /number=4
     exon            complement(371285..371477)
                     /number=5
     CDS             complement(373494..373949)
                     /codon_start=1
                     /locus_tag="AO090011000135"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000138"
                     /protein_id="BAE64684.1"
                     /transl_table=1
                     /translation="MTLFNQLNFYAVPPLKGDNQFPTVLKIELGILSGRLYLDFEEYS
                     ETMQYLRIVGTCATGAEESGSTAVDERGKFADDPLGLLQGWLAMTRKGREFGHTPAGY
                     ICQGRQLSKNHSAFRWSTTDMLMAEDISRLHVNDDDTSINGHEDSETFD"
     exon            complement(373494..373949)
                     /number=1
     CDS             374631..375029
                     /codon_start=1
                     /locus_tag="AO090011000136"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000139"
                     /protein_id="BAE64685.1"
                     /transl_table=1
                     /translation="MKACWWCWSERMLLYVEEAWRLMDGLANPYLALSAILAAGLDGL
                     EKETPLLGGPCDQAYAHLRPEEQKALGITTMLPKTLKDSLAALEANSELGVLLGLGMV
                     SAYAMVKRGEVDSLRAMPDDARKAWLISRY"
     exon            374631..375029
                     /number=1
     CDS             join(376433..376626,376691..377759)
                     /codon_start=1
                     /locus_tag="AO090011000137"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000140"
                     /protein_id="BAE64686.1"
                     /transl_table=1
                     /translation="METPALESEKPLLDSKDDWSDSEPASPIDLPSMLEDGPALKSDN
                     ISLVSTIIHCLLGIFFWAPARFLSYYFPPLERVLPAPSPVSQESQLQMKFLSSLLLLL
                     AGADAINGHPAAVEQFTRELEVASPNPSGLTLRALQQRAPNCSRVDYFISRITSVKAQ
                     YVKSIPADAHRLHPTNNFNRVAFVTFGPEAAKYICRAITHGDPTCDDWAQGIRYALGL
                     IFAIFGKDGAEPAVRPGEPVRRINARSYMDIATTALKDSSLEFASIEADDNLPSVEKR
                     SLDEPSLVERFLIRGLYHADLGNDATNIWVNHYSNGDNILQIAPEDGQHNGNSTPTRR
                     WDKPGFKIAYTTRNKSPLNEQDALKMARHISMKWQGMAIGNDISDFIGFVETGHTANF
                     YFRIIPEHKGYGLNYESVDICGGMAGML"
     exon            376433..376626
                     /number=1
     exon            376691..377759
                     /number=2
     CDS             join(379500..379588,379668..380101,380164..380299,
                     380337..380436,380509..380822,380924..380964,
                     380997..381152,381221..381465)
                     /codon_start=1
                     /locus_tag="AO090011000138"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000141"
                     /protein_id="BAE64687.1"
                     /transl_table=1
                     /translation="MGRLHPAYRLYPDYAGAFIAPTVPTEDPYCYKPLDAAAYGETYP
                     SSLTVAVPSRLYHSPTPENPFAGTRVGVKDIMDLCGLRTGASSRAYTQLLGPRTENAE
                     VIQKLLGLGFIVVGKLKTTQFADSEWPTCDYVDYHAPFNPRADGYQTTSGSSCGSAAA
                     VASYVWLDFALGTDTLGSIRAPATVQGLYGMRPSLDATSFKGIIPYTKYDDNPHRIET
                     SLLADTVGGFARDATSFAKLSRALYGSINDPPFSKKPSKVLYPVEYWSETSTEHDAVL
                     ESFIVKLERHLGVERTRISLEEIWATTKPVHENITMKEYLEHVFEWAGNPSQWKDFLS
                     PFITEYRNTYGRDPALNPQLQYKRRKRVSKDGKPSSLDGFSDTLLLLPWSTGKPDYRD
                     TYRDGPQRFTGIGFFFYNLSPYSEGPEAILPVGQTSYTSRITNSTEHLPASIGISSGK
                     GSDVMLTDFIADLMTETNIQGVGVGSRAFENIDNMGTTSLYTQSAAQLPLRGDF"
     exon            379500..379588
                     /number=1
     exon            379668..380101
                     /number=2
     exon            380164..380299
                     /number=3
     exon            380337..380436
                     /number=4
     exon            380509..380822
                     /number=5
     exon            380924..380964
                     /number=6
     exon            380997..381152
                     /number=7
     exon            381221..381465
                     /number=8
     CDS             complement(join(382479..382627,382693..383548))
                     /codon_start=1
                     /locus_tag="AO090011000139"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000142"
                     /protein_id="BAE64688.1"
                     /transl_table=1
                     /translation="MSYYGAPPQPPYGQPPYGQPPYGQSPGGYERPPYDQRPPYGERP
                     SYDRPPYEQGPPGDRPQYDRPPYEQGPPSGERPPYDRPPYEQRPPSGERSPYDRPPYE
                     QPPPGERSQYERPPYGQPPQDQRPPYDRPPSERPPYESDRSFDSRPPYSSAPPSARPP
                     QIPPPPLPMGWVQEWEPNARRAFWVEVATGNSQWEQPFGDSSRDMGPGGPPAIMSPPP
                     SGPISPPPGGYYGGPPPQEGGYYPPPQQGEYQSEADRKKSEKKKMLMGAAAGLALGGV
                     AGAVLNHEFGGSDSESEKEEEEEEEEEVVEHKIVEQHIYHHYDEPSEERAYSPPPDDW
                     "
     exon            complement(382479..382627)
                     /number=1
     exon            complement(382693..383548)
                     /number=2
     CDS             complement(join(385437..387703,388071..388272))
                     /codon_start=1
                     /locus_tag="AO090011000140"
                     /note="beta-glucosidase-related glycosidases"
                     /old_locus_tag="AO070335000143"
                     /protein_id="BAE64689.1"
                     /transl_table=1
                     /translation="MAPSQPFRVSATVLLSLMAVQTGVHAAFVCNHDNSEPTAVYNAS
                     KSYVGCYLDPKVTILTAAKLSTIACQTQPLCSHPVCDTSLSIAERVDSLVKSLTLEEK
                     ILNLVDASAGSTRLGLPSYEWWSEATHGVGSAPGVQFTSKPANFSYATSFPAPILTAA
                     SFDDTLIRKIAEVIGREGRAFGNNGFSGFDFWAPNINGFRDPRWGRGQETPGEDPLVA
                     QNYIRNFVPGLQGDDPKNKQVIATCKHYAVYDLETGRYGNNYNPTQQDLSDYFLAPFK
                     TCVRDTDVGSIMCSYNSVSGIPACANEYLLSEVLRKHWNFNSDYHYVVSDCGAVTDIW
                     QYHNFTDTEEAAASVALNAGVDLECGSSYLKLNESLAANQTSVKVMDQSLARLYSALF
                     TVGFFDGGKYDKLDFSDVSTPDAQALAYEAAVEGMTLLKNDDLLPLDSPHKYKSVAVI
                     GPFANATTQMQGDYSGDAPYLISPLEAFGDSRWKVNYALGTAMNNQNTSGFEEALAAA
                     NKSDLIIYLGGIDNSLESETLDRTSLTWPGNQLDLITSLSKLSKPLVVVQFGGGQVDD
                     SDILKNKDIQALVWAGYPSQSGGTALLDVLVGKRSPAGRLPVTQYPASYADQVNIFDI
                     NLRPTDSYPGRTYKWYTGKPVLPFGYGLHYTKFMFDWEKTLNREYNIQDLVASCRNSS
                     GGPINDNTPLTTVKVRVKNVGHKTSDYVSLLFLSSKNAGPAPRPNKSLVSYVRLLNIA
                     RGSDQVAELPLTLGSLARADENGSLVIFPGRYKIALDHSEELTFEFTLKGSPAVIETL
                     PIPDVQYNFTVPVHIQPASTEAHS"
     exon            complement(385437..387703)
                     /number=1
     exon            complement(388071..388272)
                     /number=2
     CDS             join(389147..389685,389743..390364)
                     /codon_start=1
                     /locus_tag="AO090011000141"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000144"
                     /protein_id="BAE64690.1"
                     /transl_table=1
                     /translation="MLTQLLLLGLAGLVCVKSVKPPLTPAPPTPSPRPWSTFAENIIY
                     QPDSNHSVLYPRQVELSDGSLLATASFAGDKTPYFPIFKSADGGVTWSWISNLTDQVN
                     GLGMSAQPALAELPFAVDDYPAGTILASGNSWGSKSTNIDIYASKDSGHTWKFVSNVA
                     RGSGPDITNGNPCIWEPFIEFFNHTIGVFYSDQRDPLHGQKLAHQESADLRSWGPVID
                     DVSYLNYTARPGMTSISYIPPLGKYILVHEFPGGDSWSGVGYPVYYRMSDSPFDFRFA
                     YGIPIMVNGVQPNASPYVVWSPSGGDNGSIIVSDADHSGVFTNQAGGQPDQWELHDTP
                     QAPAYSRSLHVFEKYPDHLMLLGAGVFDATVNLPLYLSVVSVEDTLKKPAGK"
     exon            389147..389685
                     /number=1
     exon            389743..390364
                     /number=2
     CDS             join(393170..393590,393673..393871,393942..393951)
                     /codon_start=1
                     /locus_tag="AO090011000142"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000145"
                     /protein_id="BAE64691.1"
                     /transl_table=1
                     /translation="MPDLPASSSCSSYFLLSQIPSHTTPLSHCPSYQPITTSTTMANL
                     PTSFIITLNGTPIAKNINPDEEQIHAEADHNNPAVFTFSNGLLESDGWYLGRSVIEDR
                     SLLPKRVLWHKKGGEVGEDLIQKTTIEDQGGNLVLTNGGTVLTLIDGQVYGDLIRSKW
                     FTICPYCDIGMKVLIPTDCVYRKPCYCGYSSCLGYEWVGSLGIFYMTII"
     exon            393170..393590
                     /number=1
     exon            393673..393871
                     /number=2
     exon            393942..393951
                     /number=3
     CDS             complement(394529..395326)
                     /codon_start=1
                     /locus_tag="AO090011000143"
                     /note="SAM-dependent methyltransferases"
                     /old_locus_tag="AO070335000146"
                     /protein_id="BAE64692.1"
                     /transl_table=1
                     /translation="MGVYTTDHSTSVLQTHNWRTASNSTAYLLPHITSTSKILDIGCG
                     PGSISVDFASRAPQGHVTGIEYVPDPLDQARELASSKGLTNIEFRVGDIHSLDFPDNT
                     FDIVHVHQVLQHIADPVKALQEMRRVVKPGGIVAARESSVMTWYPENKGIEAWLDITI
                     RMAKAKGGNPHPGRLIHVWAEEAGFEQSRIQKSTGSWCFSTPEERQYWGGSMGARARS
                     SGFAKTALEEGFATKEELESISDGWKKFVDAEQGWFGLLHGEILCRK"
     exon            complement(394529..395326)
                     /number=1
     CDS             complement(395516..396007)
                     /codon_start=1
                     /locus_tag="AO090011000144"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000147"
                     /protein_id="BAE64693.1"
                     /transl_table=1
                     /translation="MLYFSPRGGPSLVNDKMMITLMELAFQTARNGLFCAAELAHARP
                     KWESWIVVAAKRRAIFTMYLFSSVYNADRLLPNFVADEMRGVYAPGNKALWEAKERET
                     WSREYDRYLLQWEDGILEISELWRSAETGSAERRERIERWVQSADEFGMTLFGVCAHI
                     HGC"
     exon            complement(395516..396007)
                     /number=1
     CDS             397026..398417
                     /codon_start=1
                     /locus_tag="AO090011000145"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070335000148"
                     /protein_id="BAE64694.1"
                     /transl_table=1
                     /translation="MVTTTSDDVHETTALLGRNRVPKEEKPLPKAQILLLCYARAVEP
                     LAFFSIFPYVSQMIQDNGGIKFSDVGFYTGLTESLFSLTQAIVMIFWGRAADRVGRKP
                     VLVFSLFGVTVATVLFGLAKSITQMVLFRCLAGVFAGTIVTIRTMIAEHSTSETQARS
                     FSWFAFSGNLGLFLGPLLGGSLANPARQYPGVFKDTGFFADYPYALSSLVVALIGATA
                     AFSSLLFVQETLKKEPATSGSNPDKDLSTWQLLKAPSVGIVLYTYGHIMVLAFAYTAI
                     IPVFWFTPTYLGGYGFTPLQISVLMGVNGAAQSAWLLLAFPPLQKKIGSNGVIRLCAY
                     AYPFFFLACPAGNILLRLDSEVSVKLFWIFLPIALAVGCGVSMSFTAIQLILNDVSPS
                     PKVLGTLNAVALTGVSGLRAICPALFTTLFALGVRTQLAGGYAIWVLMILLAATLSVA
                     ARYLPEPEKPDES"
     exon            397026..398417
                     /number=1
     CDS             403403..403951
                     /codon_start=1
                     /locus_tag="AO090011000147"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000150"
                     /protein_id="BAE64695.1"
                     /transl_table=1
                     /translation="MRTPLPRTWSKQPSIRISQLPLCLSSRLSPKHHRYTSQNARELN
                     QGPSPQSRTRNIHYAFDPVDNATAKQLSSPFSFLSPENIPLPVFQHANRLVPSSLGVP
                     WPTSFPTTFQSKYWVEVEERTRAYTQELLALRPGKYQAKYIEAVIDGAVSLLVNAVPM
                     GNLTRLKSLTKLYVFFFLSDGD"
     exon            403403..403951
                     /number=1
     CDS             join(404017..404300,404362..404767)
                     /codon_start=1
                     /locus_tag="AO090011000148"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000151"
                     /protein_id="BAE64696.1"
                     /transl_table=1
                     /translation="MLRPYRCGLLKWNVDLELQRVTMVPSHVDGKDEQEPEYTVYNML
                     AKEFLSEDFVQGKRLLESVISWISAAQHTPPETFPTLEDYMAYRASDVGAGMEFACDI
                     TLSNTDIEAVEHLRSLCEKHFLLTNDLYSYAKEAIAEQEHGDSVLNAVRVVQRLMNTS
                     ENSSKAIVRQLIWDVERQMNEEYERLLQDAPKSQLTYAQGLIVCVAGNMFFSATCARY
                     ARVVEGSRLHV"
     exon            404017..404300
                     /number=1
     exon            404362..404767
                     /number=2
     CDS             complement(join(404962..405500,405567..405644,
                     405719..405986))
                     /codon_start=1
                     /locus_tag="AO090011000149"
                     /note="NADH-cytochrome b-5 reductase"
                     /old_locus_tag="AO070335000152"
                     /protein_id="BAE64697.1"
                     /transl_table=1
                     /translation="MAQIRRLPASLATKTTFFSALAVFGIGAYCARSYFLPQVHAESD
                     EAPVMFSKFGFTTLRVQSVKAVNHNTKRLVFEFPDKNARSGLSLTSALLTFSRPAGRW
                     LPVLRPYTPISDLNQQGTLELMVKQYPNGKASTHIHSLAPGDTLTFLTALKGFSWVPN
                     QYPQIYAIAGGAGITPIYQLIRGILDNPNDKTKIKLVFGVNSEQDLLLREELEEFKKL
                     FPGRFEYVYTVSRLEGEKEGLRTGYVTEELLRGVVDGKGEGAKVFVCGPPAMEESLVG
                     KRGILDRLGFEKGQVYRF"
     exon            complement(404962..405500)
                     /number=1
     exon            complement(405567..405644)
                     /number=2
     exon            complement(405719..405986)
                     /number=3
     CDS             complement(join(407770..408045,408203..408296,
                     408355..408442,408560..408684,408736..408880,
                     408987..409180,409254..409270))
                     /codon_start=1
                     /locus_tag="AO090011000150"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000153"
                     /protein_id="BAE64698.1"
                     /transl_table=1
                     /translation="MIFARLMRFSLLSLAWAFQAAATILENGQERLNPYPGQAEQVSV
                     DDSWKSYGADASEISYKGRWDSTYTSLFLVSSLDLRAIRYALLQLGVELYQWLTFRQL
                     AVSFGEHTSKDVLVAYRIGGLDWEFSNVTANSAYQFVEPGSSALNETEYTDHKTFELR
                     VQIDSVYVASDARLVKAAEFNRTVEIIGDSLASGQYATYEGLASWGFNFAAGLGNAEY
                     TITTYQWSRASDVGDRANAAFGDKPEAWNFTAHRVADLVIINLGTNDARTVNNVPSDD
                     YYQSYVKMVENVHGVWPDAQIVLMVRHYSHVSIGLC"
     exon            complement(407770..408045)
                     /number=1
     exon            complement(408203..408296)
                     /number=2
     exon            complement(408355..408442)
                     /number=3
     exon            complement(408560..408684)
                     /number=4
     exon            complement(408736..408880)
                     /number=5
     exon            complement(408987..409180)
                     /number=6
     exon            complement(409254..409270)
                     /number=7
     CDS             complement(join(411094..412169,412242..412465,
                     412517..412617,413966..414253))
                     /codon_start=1
                     /locus_tag="AO090011000151"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070335000154"
                     /protein_id="BAE64699.1"
                     /transl_table=1
                     /translation="MRQQKCCMGVRAVDNSFCCHDSSRRMHIPELWLRLVTPQFSSRT
                     KREQLPSARYNRLEEKLCELCWMTGSSWPLVCCDGTVYFRLCLRFFAFIELDRHTVIK
                     YLDQQNINNAYVSGMKEDLNLFGNELNLFTTYFNAAYCVMLIPSQIILTYVRPSFWLP
                     GLEIAWGVLTGLIAMCNSAKQIYVLRVFLGLCESSAWPGMMTLFMYWYTPTELAKRMG
                     FYQSCQAAGQMMSGALQTAITNTMEGHHGLAGWRWLFVINAIITVVWGFLGFFMIPDL
                     PNRPNPRAFWFKKVHAELSMERLARNGRAEPKRMTWAGVKRTFSGWVVYFIAVLYIAT
                     VLGTYGYVYFSLFLKALKRPDGSPRWSVSQVNAIPIGGSAINVVFVWVWALLSDFLET
                     RWTLIVLQGIIGIIPCIIMSIWTRHPTSVDVSAAYASYFIAHTCLGTAPLIFAWLSDL
                     IPQDPEARTLVVGVAVAGYYAISAWSQVLVWPASQAPYYRYGWQSALALLVLVIVMTC
                     VLRFIDVRYLLPKRVAFQEALDAEVVAGGSLKNDEERPRDADLKTPTTSTRVDE"
     exon            complement(411094..412169)
                     /number=1
     exon            complement(412242..412465)
                     /number=2
     exon            complement(412517..412617)
                     /number=3
     exon            complement(413966..414253)
                     /number=4
     CDS             complement(join(414922..414987,415121..415157,
                     415218..415427,415503..415881,415942..415990))
                     /codon_start=1
                     /locus_tag="AO090011000152"
                     /note="phosphoglycerate mutase"
                     /old_locus_tag="AO070335000155"
                     /protein_id="BAE64700.1"
                     /transl_table=1
                     /translation="MPDKDAGTPRVFLYRHGQTEWSKNGRYTGVTELELTQDGEKQVL
                     ASGKMIVGSGKLIDPAHLAHVYISPRKRAMQTFEIAFSDAAKQQLRDANKVSETDRLA
                     EWGYGLYEGLVTKEIRALRKEHGLDTEQEWDIWRDGCEEGESPQEVTDRIDDLIKEIR
                     ELHKDNMHGEKHCDVLLVAHGHLLRAFTKRWLGYPMEFPLSMMLEPGAVGVLSYQHHS
                     IDEPALMLYVNSSALLESANLLLQPRNL"
     exon            complement(414922..414987)
                     /number=1
     exon            complement(415121..415157)
                     /number=2
     exon            complement(415218..415427)
                     /number=3
     exon            complement(415503..415881)
                     /number=4
     exon            complement(415942..415990)
                     /number=5
     CDS             complement(join(416864..417126,417185..417293))
                     /codon_start=1
                     /locus_tag="AO090011000153"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000156"
                     /protein_id="BAE64701.1"
                     /transl_table=1
                     /translation="MPAYMKTANETLITCVQIESKAGVENVDAICAVPGVDMIFIGPN
                     DLALSLLGYVPAKGDEPEFVDAIDKIVAAARKHGKWVSRLSNNGALCKEHLKVFDTVA
                     MSYDVRAIQNWYTAELQVARS"
     exon            complement(416864..417126)
                     /number=1
     exon            complement(417185..417293)
                     /number=2
     CDS             complement(join(418657..419354,419406..419745))
                     /codon_start=1
                     /locus_tag="AO090011000154"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000157"
                     /protein_id="BAE64702.1"
                     /transl_table=1
                     /translation="MKEAVVDKSVTVAIRDVDIPVVKPGQVLIKVVVSGTNPKDWKVP
                     TWQPDAPAANQGDDIAGYVEAVGEGVPNFRKGDRVAAFHEMLTAGGSYAEYAIAWAHT
                     TFHLPEETSFEEGATIPLAAMTSAIGLFQELNLPLPWNPAKESLPLVVYGGSSAVGAF
                     AIKLARLSNIHPIIAVAGKGTSYVETLIDRSKGDTIIDYREGDEAIRKNIKAAAGGLP
                     IHHAYDAVSEKGSYRNLGAVLTAPAKITVVLPGIDSKEVPEGVQLLRTSVGSVHQSAA
                     AGQTVGNIEFGAAFFAFFGWGLAQGWFTGHPHEVRLNGLAGLEEALQDLQAGNASAIK
                     YVVRIADTPGL"
     exon            complement(418657..419354)
                     /number=1
     exon            complement(419406..419745)
                     /number=2
     CDS             complement(420251..421627)
                     /codon_start=1
                     /locus_tag="AO090011000155"
                     /note="demethylmenaquinone methyltransferase"
                     /old_locus_tag="AO070335000158"
                     /protein_id="BAE64703.1"
                     /transl_table=1
                     /translation="MSQSSILDRLSALDTNTVSDALDFLGLKGATYGLRPLWDCPKIV
                     GRASTVKVGPKTDTAPTTHLLTPVIDAVTTDDRVLVISGGIDGISCWGDIVANASKQK
                     RIRGTVIDGMSRDIDGSREVGYPVYGRGVTMISARNRLVQVDSGTPLQVRGVTVHQDD
                     YVIADRCGTVFVPAQRIEDVLEFGERIDRRQAKMVDAVRAGQPVSEVMHDKQFEAIRE
                     NAPLSTVLPVAPASKRNPKQASPEDQELVALFADSDTPGVSDALDKLGIPGQAFGIMP
                     LTDYKKVTVGPAFTVRYVPASDPPGSVGDFIDEVAIGDVVVIDNGGRTDCTVWGDIMT
                     QYAGLRDIAGTVIDGVCRDVNRAIDDDYPLFTAGRWMRTGKDRVQVGGVNESIGIGKV
                     RVNPRDIVVADANGVVIVPRDRAREVAEVARRIEKSEAGIRELIASGATIAEAREKLG
                     YHTLQRKV"
     exon            complement(420251..421627)
                     /number=1
     CDS             join(422423..422763,422824..422865,422925..423181,
                     423245..423353,423428..424085,424401..424448)
                     /codon_start=1
                     /locus_tag="AO090011000156"
                     /note="predicted hydrolases or acyltransferases
                     (alpha/beta hydrolase superfamily)"
                     /old_locus_tag="AO070335000159"
                     /protein_id="BAE64704.1"
                     /transl_table=1
                     /translation="MSTLISSYLLGLVACAAAAPAASRASPHGTRGYGEIQWKPCGDL
                     GVNGTTELECGSLAVPLDYTEPDSGETLDLEILRAPAPNQPSKGSVFVNFGGPGASGV
                     AEMSLLGSVLSIFVGGSYDVVNVVPRGTGNTLPFSCFEDEQERIAAALRAPFATNASD
                     TALGQVWAEAKNRADACAHAQNETGSLIGTAFTARDIMQVVDALEEDGKLRWWGQSYG
                     TLLGSTLIAMFPDKIDKAVLDGVINAHEYYHINVEQVAGADSAFSGFCSQCVDNKDKC
                     PIASNRTAEELEEDIYAAMEALKSEPIPVSVEGKGYIVDYATIKGTIHYALYFPATWP
                     TLAEKLDILFSGNITGILPDLVAPLPVTPDADAIQGIKCSDNQEPLETLEDALPGVEA
                     RAELSKIAGDIADVSALQCARWGMPAKEQYTGDFKAKTQNPVLLVSTQHDPITPLVSA
                     KKMSEGFEGSVVLEQEGYGSTSGNGNIHIYFILE"
     exon            422423..422763
                     /number=1
     exon            422824..422865
                     /number=2
     exon            422925..423181
                     /number=3
     exon            423245..423353
                     /number=4
     exon            423428..424085
                     /number=5
     exon            424401..424448
                     /number=6
     CDS             complement(425217..426191)
                     /codon_start=1
                     /locus_tag="AO090011000157"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000160"
                     /protein_id="BAE64705.1"
                     /transl_table=1
                     /translation="MIFVDFPDAPASDTTEELYQLFVPGAPDWYKHSSFGQLSLNITA
                     DTSRFYRMPNPSTSYPYDRGITAQLHGKYIQDALNSVGQAIDFSGTDVLYIVPTKAAK
                     HISFSPTYMGELTAGDGTVIGKTVTFGQDAPDSWGFLVMNHETGHTMGLPDLYPSNGG
                     RATMYVGGHDIMGLISGGLPDYFAWHKWKLGWFSDDQFDCVDGAGSTTHTVTAVGTKE
                     GVKAVVVKRDETTAIVAEVRAREGADIAACSTGVLVYTVSTSTASGQGPIRVHDATPN
                     SGGCDGEELNDAHFTTEAGRDVFVSEDGVQIKVVSQNGDVYTIEVEAT"
     exon            complement(425217..426191)
                     /number=1
     CDS             join(427684..427904,428058..428220)
                     /codon_start=1
                     /locus_tag="AO090011000159"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000162"
                     /protein_id="BAE64706.1"
                     /transl_table=1
                     /translation="MASRLTCGNISCKPVKSSALLPLLQERHQSISICDDILLSSLNQ
                     GVCDYYFGPVFQKVLHGWNIASFKDNLGHPKSALPFYTAVLPNFMKETFNSDVHIRTL
                     VKHPFHHVDLAIAHGLSEESLGDRD"
     exon            427684..427904
                     /number=1
     exon            428058..428220
                     /number=2
     CDS             complement(428328..430550)
                     /codon_start=1
                     /locus_tag="AO090011000160"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000163"
                     /protein_id="BAE64707.1"
                     /transl_table=1
                     /translation="MSRRFRWADLQVKRLEECRTDDHMKEALRTIPDSLEATYQTIID
                     NIAERDRSIARGILIPMCFSAAPLDLQTVADSVSLRSSRHVMDICTTSLLSTSGEEVR
                     LAHFSVKEFLVSEDAVGNICRFSERAAKDHLAKKTVDCISCQTEELNQEMAAIKPFLA
                     YASCHWQAYVAALVDINPQNADLGRKIDSLFTEPTVYFNWSRIADSYAITNDNQWNKL
                     RSECKPAIDRATEMGLVGPVDTPVNQGADPLQSWKAMSWCPLKRAALEGRLKIVELLL
                     RKNITISTELAKALIGLVKHDVEVEHALEGVLKALLDRGVLQDTARGPSESISEHIVS
                     YAMTNRYSGLLILNIFLDWRDRGLVSVPITGDVMRCAVVFSSPAEEMLELLSRRSQEG
                     FYISPTMFIDTGGLPMLFDGIAALARRRPAKLPLSDALLEGMAIKCDSATMDTLLQAR
                     PDIKVTEKILVAAAQNNLGVDMLKLLWPLREPGASITEDVLTSAAKSRSPIILKLLID
                     KLQPSVQLTETVMKSIIGNWECGLSMMKTILDDPRVTFEVSEPLISMAASTTQAPLEM
                     LDLLVNNSETEVHITEDIVCAAAGNIIYSSSVLEYLSHLEARPLPVTEKVVMGAIRNP
                     KTLEILFEKCPNAPITDRVSLGACSYADQMRLLLDKPHGVLPIEKMVEKLSNNYLDSC
                     VVLDLLFERNILTVNEQLVETLAASYGPLNTLLNQRPDAPITVKVLLQAARNPRSIRL
                     "
     exon            complement(428328..430550)
                     /number=1
     CDS             join(432385..432567,432618..433274)
                     /codon_start=1
                     /locus_tag="AO090011000162"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000165"
                     /protein_id="BAE64708.1"
                     /transl_table=1
                     /translation="MFVTIAQEISGFLNLPPEILLLVYCSLDSIADAYFLSQTCQQAY
                     HVFSRPQSQPKIFESIIHNVLQDAAPNQAWLEKQFGPGSLWRPKEADLPVDLTNKPAR
                     EFLINIGFPSVKLPRIGFNSTHLKTFADKGDSLCRYTGEELYGIYDPDDEVPALSFCL
                     GEVYTQLVMLENEHGHVFWYNGDCYDSLGRDRGLVAQGLDSLAVLLGMVVAVTKDLRE
                     SPLDLSLEELERRVEILKRPLDILRGKMRDYDFYAEDAEFWNDLFSELLDDWEFRDES
                     LGS"
     exon            432385..432567
                     /number=1
     exon            432618..433274
                     /number=2
     CDS             join(433704..433817,434094..434143,434592..435180)
                     /codon_start=1
                     /locus_tag="AO090011000163"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000166"
                     /protein_id="BAE64709.1"
                     /transl_table=1
                     /translation="MGPRFRMIYICDRIPEVELGHVEEKRKKKKKKKKRGGFRPLNHT
                     AAPLRHWDRQWKGGIVRLTNFSIEGVTLQTGWRPSPEPKPIDLTKLETDSHPDWISYH
                     CAFYSDGFRRGHSYAKAFIPRTPRREDTFFEQWIEPGWDCHPQGSLVQKGTGTDTYAR
                     WTNEMIQFIVEMPLPVQENLFSPIDGKPSTGSIAATLEFAEQQQKAREEGREDWRALE
                     EDGSKTLKARMVNVSLTLSTEIKQRLPSEGVR"
     exon            433704..433817
                     /number=1
     exon            434094..434143
                     /number=2
     exon            434592..435180
                     /number=3
     CDS             435512..436360
                     /codon_start=1
                     /locus_tag="AO090011000164"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000167"
                     /protein_id="BAE64710.1"
                     /transl_table=1
                     /translation="MPYHDWKDAVNCKSLGSWNLHSVLPRGMDFFILLSSASGLAGIK
                     GQANYDAGNTYEDALARYRVSQGEKATALDLGAMVDDGILAEDPSLLRRVLAYGTLEP
                     ITRAKFYGILDYCCDPARESVTPREAQIAFGLGTDRGDGLESIDYQRQPMLQQLMLAG
                     NRQQVGAGAGVGSGGAQHAISDREQIAASASLEEAAQIAAEAIIKKLAKSLITMQDGS
                     SVERDRPFSVLGVDSLLGIELRNWIVKQFKVDLAVFETQGAATLETLSLLVAQRCTKG
                     RGGVGS"
     exon            435512..436360
                     /number=1
     CDS             join(439076..439169,439242..439395,439450..439744,
                     439799..441463)
                     /codon_start=1
                     /locus_tag="AO090011000165"
                     /note="protein required for meiotic chromosome
                     segregation"
                     /old_locus_tag="AO070335000168"
                     /protein_id="BAE64711.1"
                     /transl_table=1
                     /translation="MGLLTGSRQLDAADAHNFGVDWVIHYQFEDTEMLKAIEEFRTLI
                     KDLQDAKLQVQVRPGYGASLLLCIRVPRDHLGNMVYKSRVKDWLYGIIHELPIGDEHT
                     SIDSETPAEELRSVYHAVTWSKALGGAGVTAQLGPWKNVASTFPLHDPTANAKLLRKW
                     SHTLLLNAEDLDAIRALYGEKVAYYFAFIQCYSTFLVFPAAWGIFTWLYLGPYSITSA
                     LVNCLWCIVFVEYWKIRETDLSLRWNVRGVGALKVNRPQYVWDKEVRDSVTGETVRVF
                     PAHKQFLRQLLLLPFASIAGLALGSLIVVTFAMEILISEVYTGPFKEYLEFLPTVLFS
                     LSLPWINDTLTDMATKLTDYENYRTQDQYDIAQTTKTFVMNFITSFLPTILTAFVYVP
                     FGARLLPYLDVIRVGKLATAFDTRRVHIDPSRLQQEVIYLSVMGQVMSFGEEIVLPYV
                     KRVVMQKWRDYRQKNVPAGQGRRYSYRTDQLLNDSPAEASFLSRVRNETEADEYNVHD
                     DTLEMCVQYGYLALFGASWPLVPLGFLLNNWLELRGDFFKLSLECQRPPPIRADSIGP
                     SLQGLEILTWLGTLSTAAIVYLYRGNMADVRLSTLLLILLAAEWAYLGLRFVVRTAVE
                     KIATGSLRKEAAKRYALRKNYLDSLTRSTSPKGRQRVRFEDRVNVYTTGTDVRTNSQE
                     FLHPGHHETSSEQRFWSCAAQDTADAGVRLIKALCMGDRVQSENKSEKIKKCA"
     exon            439076..439169
                     /number=1
     exon            439242..439395
                     /number=2
     exon            439450..439744
                     /number=3
     exon            439799..441463
                     /number=4
     CDS             443151..444518
                     /codon_start=1
                     /locus_tag="AO090011000166"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000169"
                     /protein_id="BAE64712.1"
                     /transl_table=1
                     /translation="MCPLSESKTELFLQEENETGKIVPMVTVVRRRGRLHLVHPPWYR
                     NSLLASTGFLEFANAGDFAANVWNEIPVPRHAMILMAIGGPIALLMSIVALRDFILSW
                     RNVKLLRAERRYLQSLKHDYLASANPDPDLIRLIDSRLGLGWRELGTELIDRVAMDVF
                     LGLGALLVGTGTIMAIWGAHPKVFDASNLLSGFVGNSFAAAFGVVNAVWSVYLARRFH
                     RYDRLCTRAPALSPFRDRLHLRFSKFKWHAVVSGLTGLIAGAASMVTAKMWWGYVVLA
                     PCMVLQLLCNRFWRTQLGYDRPIVSDYDQRGILIRETQEIRDEEKDGPLLDSLASTVT
                     LFNALGALPSPSEALDWTSLDSLVQFMITNDLFDSLCDWLARDKSVPSDVRDAVFRDP
                     SSSSEHTEITVSPDHLLRVPVALQTQLRDLCRQFLQEDGRRVLLYRERYLLEMMGSML
                     SRESQ"
     exon            443151..444518
                     /number=1
     CDS             complement(447104..448366)
                     /codon_start=1
                     /locus_tag="AO090011000167"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070335000170"
                     /protein_id="BAE64713.1"
                     /transl_table=1
                     /translation="MTAKVLQVDSQYLYVPGCMIMSFDDPSTRTAEVKLVRVSQGVDL
                     GRLSETHNIYKNVIHDVIGIEEATQELEDIMKRKPRYNKLIIVLVCGLATAMVGPFAF
                     GARPIDMPIIFFNGCLLGIMQHVIAPRSVLYSNVFEVTAAVLTSFIARAIGSITTTIH
                     GTPHQRLFCFSAIAQSSIALILPGYTVLCSSLELQSHKIVPGSIRMVYAIIYSLFLGY
                     GVTVGTTIYGLIDRSATSSTTCPNILGFKNPYVARFPFVIAFSICLLIINQGKWKQGP
                     VMVIISFTGYVTNYFVTKRLGTNTQVANTVGAFAIGVMGNLYSRLWHGHAATAILPGI
                     FVLVPSGLAASGSLIAGVESADAIRSNITRNASHGDTQSTGVGQQKSVQDLGFGMVQV
                     AIGITVGLFVAALVVYPLGKRRSGLFSF"
     exon            complement(447104..448366)
                     /number=1
     CDS             join(451557..451697,451734..451746,451811..452059,
                     452120..452550)
                     /codon_start=1
                     /locus_tag="AO090011000168"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000171"
                     /protein_id="BAE64714.1"
                     /transl_table=1
                     /translation="MNTRRADSDSTGDAISFSFYHYDPSMAGAVIFIILFAGTTIFHI
                     YQMIGGIFEVLGYIGRAMSSRESPNWTLGPYLIQTLFLLLAPALLAASIYMFLGRIIL
                     ILQAESHAIMRKKWLTKVFVTGDVLSFLLQGSGGGIQSGGSLDSMKLGEKIIVIGLFV
                     QIFFFGFFIVTAGSFDMKLKRYPIPRCYSAEIPWRKHMNVLYASSMLIMIRSVFRLVE
                     YLQGNNGYLLHHEIYLYVFDAVLIFITMVIFNICHPSEIGRLLANQADYELKDTYTTV
                     P"
     exon            451557..451697
                     /number=1
     exon            451734..451746
                     /number=2
     exon            451811..452059
                     /number=3
     exon            452120..452550
                     /number=4
     tRNA            454409..454480
                     /locus_tag="AO090011t00002"
                     /note="tRNAscan-SE"
                     /product="tRNA-Arg"
     CDS             455236..456267
                     /codon_start=1
                     /locus_tag="AO090011000170"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000173"
                     /protein_id="BAE64715.1"
                     /transl_table=1
                     /translation="MAAPIGVHLVGSIPLPNTEQVLRQIPTALPNRLYSIPDGEPGVR
                     QNYIGWELSCFPPETWRPFLPGSTGLPADHPGFTQDSVAPSQYDGAALDSYKRFVELR
                     DQGIIPPGVRFQVSLPSPLACIQGHLRPEIHAQLEPFYERRILDSLNAIIAGIPAHDL
                     AVQWDLPFEVIDLEYERGRLPDDFPFKPHFAPVKQGVLGRIQRLCAGIPGQVHVGFHL
                     CYGDLEGKHLIEPEDLGLLVEFANDIVKAIRPRTVNWVHMPVPKDRDDVAYFEPLKGL
                     AVDDNTRLVLGLVHFDDEDGTKRRIKAAQLATGKRFSVATECGMGRVPKEHLDSILRI
                     SKNVTEPIN"
     exon            455236..456267
                     /number=1
     CDS             457016..457972
                     /codon_start=1
                     /locus_tag="AO090011000171"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000174"
                     /protein_id="BAE64716.1"
                     /transl_table=1
                     /translation="MSSSTLPKNASLVNIGTHSLALYTHGPEPSCPKDPVVLFISGVA
                     SSSLNWTAVVRLLPPSLRSYTYDRSGFRNSELSPLEPTAENIALELSLLIKKAPILNP
                     LIIVGHSWAGVLINEFIALTGNGPHIAGLVLVDANHETMPDILNVNDPVLSVIAEGVH
                     PYAGRGIEAEHKFTQEEWDAFKSDQFSEKTLLIGEKEDSEHYAPSFETLRKKELGKKQ
                     PLVGDKPVYVIGGMRSRDWSGLYKAGVEKGNGTEEQRSHVRELIRTADEKSDGLMKKH
                     LKLSTKSKLVFAYESGHFVQLTQPDIVVDGVKWVLENLQPSS"
     exon            457016..457972
                     /number=1
     CDS             458591..460768
                     /codon_start=1
                     /locus_tag="AO090011000172"
                     /note="ankyrin repeat"
                     /old_locus_tag="AO070335000175"
                     /protein_id="BAE64717.1"
                     /transl_table=1
                     /translation="MVSKLPNEILHAIADLLEQNDINSLAKSNSHVFPVFNSILYRKN
                     MLESDGWALIWGIINRQHNTVAYALSTGATVLGEALALAVEDGQEQVVQWLLSVKSAD
                     FSPKYDFHGQFANWTSQHRIASKCTAASSKCIEQLKGRQQWERHGTFDNRSPLSRAAR
                     GGHLGIVKLLIAFNGDDLSVEDLDGKTPLFQAVERGFLDIAKALFNTGHCDLNRTDNE
                     FKTVLSHAASSGNGDIVQWLIRCGGAINLNHQDRYGQTALHYAAERSDVPTTKLLIES
                     GRVDPDITNLYDLTPLHIAIQRSNAVIIKLLTEPRTVDPDFRVTNNFTRLYDVTKNLY
                     VSQPILSIESGEVDNHSRTPLHGATEHSHASLLEPLRDLSRLDSNISEEHSQLMLSQA
                     IMNSDTSTLRLLICSGKIDLDRIDNEGRTPLSRAAKHSDRSIIKLLIDSGRVNLDSKD
                     KNGRTPLSYAAEYSDASTVKLLIDSGKVDVDSKDHQGRTPLSYAVQHMDLSNLTRLVV
                     LWCQGDLEPGLNPNTIVPRRSLAGTSTLKTLLDCGKADPNSRDQHGQTPLAYAAEWSD
                     SATIRLLLENPLVEVDSKDRSGRTPFFEAVANGNFAAAEVLLDSKMVNPNPRDKYGDA
                     PIFEFMDLYTSLETLNDDQVLDWSIEDTVKTGYNRLLKLLLSRSDVIVDFRDHHGQTP
                     LLYAAEECGYDVVRLMIESGKVDFAELYAQSLPGQTGPQLMES"
     exon            458591..460768
                     /number=1
     CDS             join(463067..463675,463711..464448)
                     /codon_start=1
                     /locus_tag="AO090011000174"
                     /note="multiple inositol polyphosphate phosphatase"
                     /old_locus_tag="AO070335000177"
                     /protein_id="BAE64718.1"
                     /transl_table=1
                     /translation="MQLLPVALLLGALAAPTASESFNPLNHLAGIAPYRTINDPPLES
                     APPQGCNVTKAAYLIRHAAIYANDFDYESYLEPFVEKLRNTTQDWSKTTDLKFLANWT
                     APVDEEHLEKVTKVGYKEAVELGVNFRTRYASLPHPSKVWSSSADRTTKTAAGFIEGY
                     TLNKTAGMDLVEVKEKKDTGVDSLTPYKSCPAYSGSYGSDQSQHLTGVNQEWVEKYTA
                     PIKERLNAQAPNFNFTTSDIVSMFEFCGYETVIRGDSPFCATTLFSSNDWLAFEYGED
                     ITYFHNVGYGNYASPRIGFPWVNASFNILSSNSSQDVYVSFTHRELPPTVITALGLFN
                     NSAFSGTDNVNKTMPTDEINYGRQWKSSDILPFLTNIAIERLSCDSYGYDEGDYYRVL
                     VNSSPQPLEDCRGGPGDSCSATKFGDFVKGLGERFGDFVGACGAPKNESQVVTIYN"
     exon            463067..463675
                     /number=1
     exon            463711..464448
                     /number=2
     CDS             complement(465249..466826)
                     /codon_start=1
                     /locus_tag="AO090011000175"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000178"
                     /protein_id="BAE64719.1"
                     /transl_table=1
                     /translation="MQSNDGSLLPEQPSGIETVGGSAGQFNQWTPGLTERQSNTGLNS
                     QNQDSSWDGGAQSSTPDDGLYHPGRKTAGTQETKKSATDNGLASSGSQGAYGWSQDSG
                     QPQSGSAAWGTAGTASGGQWVQGTTSGSTGSNAGKASIEAKSPQTSMTRSGLQATPTP
                     SQAPTPYESSQYEGQNTWGNGNGGQWSSSSSLPQAGAGTPDDGMYHPEYSNTNGQGAQ
                     QWTPDDGLYHPDEWSPSSTTKPTSTSSLPENTATQSSPPLSSSSTTGTPTATSNPSNS
                     TTTSTNEAKKLAIPITLGVATAAMAGIILWWLYRKVQDAKAERKRMNTLEEGGYIQGP
                     RLSFFKRRLATLRSYSLSKSATKSTPVAARSSLSISESPCKQCDGHSDASETSSLDET
                     SSRDIEKLQPPEYSSSTESLTPEGHRRGDISMPYNTQKADTCARPRTVTPTSLPGVPE
                     EPEESEEAKEAEEPSPQITPVDSKGAVEEVYTVEISFNPISAKHVELKQGQTAKILKE
                     YGDGWVRLIPFLFLVSF"
     exon            complement(465249..466826)
                     /number=1
     CDS             complement(join(468498..468665,468727..469275))
                     /codon_start=1
                     /locus_tag="AO090011000176"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000179"
                     /protein_id="BAE64720.1"
                     /transl_table=1
                     /translation="MLDELKFNPIPIPSNGGIITYTDVKSTIKEALYAPNSWPLTSEL
                     IYYVQTRNATVLGSSEVYSTVKSYGLSASLTSSSNEVESGIRCSDKAASASMSDVLPY
                     SNVRASLSRIASDGANTDMRCAQWNKKMYAKERYTGDFDVKTPHPVLVLSNRYDSSTP
                     LAAAKNLTATFEGSVLLEQNGYGHTTLSVPSLCTAKVVRAYFSNGTLPAEGTICEIDV
                     PLFTNLTYADVWPKSFQAGL"
     exon            complement(468498..468665)
                     /number=1
     exon            complement(468727..469275)
                     /number=2
     CDS             complement(join(469508..469620,469679..469938,
                     469991..470032,470084..470397))
                     /codon_start=1
                     /locus_tag="AO090011000177"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000180"
                     /protein_id="BAE64721.1"
                     /transl_table=1
                     /translation="MRQSSSFTAGLLSMASLASLTQAELGKIQWKGLCDPTNATGPMI
                     CGTLDVPLDYTDSTSNKTLTLDIGKWPAAKKATAEPVFVNFGGPGVNSFEGLGSYGKE
                     FQTILGGHSDVITFNPRGVGNTIPFSCYSNDSSRELASLQAPNDGTASNTARGEIWAQ
                     STNYAQACYAQNGENGSLIGTTFAARDTLQVLDALRGKNALLNYWGISYGTTVGAVMA
                     AMFPERMGYLALDGVDNPAEYFNG"
     exon            complement(469508..469620)
                     /number=1
     exon            complement(469679..469938)
                     /number=2
     exon            complement(469991..470032)
                     /number=3
     exon            complement(470084..470397)
                     /number=4
     CDS             join(471630..471863,471960..472204,472839..472983)
                     /codon_start=1
                     /locus_tag="AO090011000178"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000181"
                     /protein_id="BAE64722.1"
                     /transl_table=1
                     /translation="MLLRLYQKLRGRNYSDPCLYTFPFSLYSIMVQFTIALALRDKSQ
                     SSRELAKIKHRLVNLHRNENLSEDYLLHVNPKGKVPALTSKSIPAPLTDSLSISYWVC
                     EQHPSLIPEAHRTTIQRLLSQLHHIQAENNPNPAVDDLLARTDISPEHRRALEYKRDW
                     LLDVAPEVLPYIAAENVNWVGSLFLTDPCQPSMAGRNVCDLVVMDNL"
     exon            471630..471863
                     /number=1
     exon            471960..472204
                     /number=2
     exon            472839..472983
                     /number=3
     tRNA            474346..474417
                     /locus_tag="AO090011t00003"
                     /note="tRNAscan-SE"
                     /product="tRNA-Glu"
     CDS             475472..476098
                     /codon_start=1
                     /locus_tag="AO090011000179"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000182"
                     /protein_id="BAE64723.1"
                     /transl_table=1
                     /translation="MISFATDETIPSNSWLFMSDSVSIDNALNWFMVQQGMGYLSKIL
                     NRNPNGSVWNTELDADTSCNPQFVIKDDLPSYSDLELIPQTLAEICCITADNTPDNNS
                     YYTPLVLLSRAFRIKSVGFGNLNSYLSFGPHVTQSYRLLLRQKDERALLLFMLWLMLF
                     EEETCWWIGARTRNEYTAVLWLLSRSEDQRIREVARDPSVFVRSNASV"
     exon            475472..476098
                     /number=1
     CDS             join(476996..477359,477422..477675)
                     /codon_start=1
                     /locus_tag="AO090011000180"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000183"
                     /protein_id="BAE64724.1"
                     /transl_table=1
                     /translation="MLTHIRALEVLPQLKVYFDGLEELRKSELEWTVFHIGMFMDYFA
                     TPALKSYLKPHIAALDLENKVAAIPGDGKVPVTLIYSFDMARFVVASLDLEHWEEESR
                     VVGDEITWNEFLVLAEEARGSKFEVHYDDIEKLKRFEITELPAQKALYNRVPKETFQW
                     VTAIFERFTADGSSHIPKTGSLNERFPEIRTLSVKAMLNTYWKSG"
     exon            476996..477359
                     /number=1
     exon            477422..477675
                     /number=2
     CDS             complement(join(478393..478459,479848..481472))
                     /codon_start=1
                     /locus_tag="AO090011000181"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000184"
                     /protein_id="BAE64725.1"
                     /transl_table=1
                     /translation="MRLLHTEESHTGNFEIIEFTDDRIPPYAILSHTWEGEEVTFQDM
                     HADQLHTRQKKGYSKIQRCCHLAKTEGFEYVWIDSCCIDKTSSAELSEAINSMYRWYQ
                     DAEVCYAYLADVPSKEFKESRWFTRGWTLQELIAPRKITFLDENWKELGNKADLQQAI
                     CECTRIPIGVLSGDEDIESFSIAQRMSWAAERVTTRVEDRAYSLLGIFGVNIPLIYGE
                     RETAFIRLQEEIMRISDDHSLFAWTSADNRGGLLATSPAAFIGSHNIVRFNPFDPFNA
                     PFAGTSTGINLTVRFMGIGPRGLGLAILHCKEEGEGERLIALYVRDSEFLTMERFERV
                     CSEGFNQLDLRKYRPSQYPMRQMIIRAGRLARHRKSKGCGKCDGITPEIYSDAKLMTL
                     MEFENPSALLQAAERGLEDIVWLLLTRSDVEGDCRGPGGLTPLMHASRNGHETIAKML
                     VARRDVIADSTDDEGRTPLWWAAEAGHEAIVKMLVEKGIAIEGRDRDGWTPLTIASKN
                     GHEGTVGLLLDKGVAIEEQDLRGGTLLSAAVWRGRPSPGARGAISCCATGGTASR"
     exon            complement(478393..478459)
                     /number=1
     exon            complement(479848..481472)
                     /number=2
     CDS             complement(join(482275..482788,482879..482943))
                     /codon_start=1
                     /locus_tag="AO090011000182"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000185"
                     /protein_id="BAE64726.1"
                     /transl_table=1
                     /translation="MVDMCRRAKSAGLVFRNFCLLKAWIFGAGLILGFSMFAGEPRRD
                     VERLFDSALLLLDDIGHTSPQAQLYYQILTSFLEAVNKYRNRVAGEVYRTVQDYMDQI
                     LTIDAVMPGNSAAPPSGRQDVYPGWDDSWLAGAMQDVEASAIALDPISFGTRGAQMFR
                     EPCNWGDMDTMQLEGGLIIDVEPFDQLFYTVE"
     exon            complement(482275..482788)
                     /number=1
     exon            complement(482879..482943)
                     /number=2
     CDS             complement(join(483033..483091,483210..483266,
                     483291..483430,483531..483940,483991..484139,
                     484256..484646))
                     /codon_start=1
                     /locus_tag="AO090011000183"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000186"
                     /protein_id="BAE64727.1"
                     /transl_table=1
                     /translation="MPRPKVRLEDRQRSSRACHTCKALKIRCDSQCPCASCMRRGQAH
                     ACVYSGTDRRRRKPCVTDLTTHGRAIDGVDVFSRRSGVTTRNSNPPFELDGHVSEMVT
                     PESRSDDHPLPDARPHQRFPLRPDQSTKVKAYVGSVPFTDSERHHIVVDMDHCSSISV
                     NVDSVEREKLHVWMGFYNDATSGILDLFTEHEVETLIAARTPISQDTSSLFVGREDAA
                     AMDVALAIGAQVEGSPEDTHFANSYFHRARQVAFADMLMVQNVETVRLFLLMAFYMLG
                     ACHRNAASMFLGVAARAAIILELHSSEAYSSALSKEDSERSFVLSRPRSLPTVPNWSN
                     IIESKTESAFHAIGDGCILLDNIVDTLSKAEDLLMQLRKWSGSLPTTLRHILSHISRH
                     GYAEKRRII"
     exon            complement(483033..483091)
                     /number=1
     exon            complement(483210..483266)
                     /number=2
     exon            complement(483291..483430)
                     /number=3
     exon            complement(483531..483940)
                     /number=4
     exon            complement(483991..484139)
                     /number=5
     exon            complement(484256..484646)
                     /number=6
     CDS             complement(join(485559..485648,485720..486283))
                     /codon_start=1
                     /locus_tag="AO090011000184"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000187"
                     /protein_id="BAE64728.1"
                     /transl_table=1
                     /translation="MVKKGYLSPLKRCPTARLAIPEAILGLLMCSPLLISLRLKLICY
                     PVYDPEAWAEVSAAVNARREIVGVVVYGNADSPISNATIPMLQHLAGASATAKVMSKN
                     SNTQVYGYANVDTYQFATPFQGTFDYTTEAVSHTRNLGFLKPLIGGPYFDLETIWEEH
                     TQHEFETRSVPHTMATMVQEPYVNHIPTLTGGIGRAHLQLFTKTILFSTTLQTLNLS"
     exon            complement(485559..485648)
                     /number=1
     exon            complement(485720..486283)
                     /number=2
     CDS             complement(join(487719..487723,487783..488709,
                     488764..488833))
                     /codon_start=1
                     /locus_tag="AO090011000186"
                     /note="acetylcholinesterase/Butyrylcholinesterase"
                     /old_locus_tag="AO070335000189"
                     /protein_id="BAE64729.1"
                     /transl_table=1
                     /translation="MKEEGIGNLGFRDQRLALHWIQENIDAFGGDPSQVTIWGESAGG
                     NSVGTQLIAYGGRDDGLFRAAISESGSPSTYIPYQTPEKWQPYYDAVVDAANCSSASD
                     TLQCLRSIPTEILVSIFNNSTIIPAHTLSGVEGPQFVQVIDGDFIQESATLQLEQGKF
                     VKVPYLIGANTDEGTSFAIRDIDSDEQFREVVSNWGLDNATVDILAALYPDIPQIGIP
                     AIMPGRPPAGYGKQYKRVAAFQGDVNVHAPRRLAAQAWARHEVPVYSYLFNVVNNLNG
                     PYAGADHGAELPYVFRIPQSLGRGDHQLMKAQSQLAILLSRSWVNFVATLDPNPSAS"
     exon            complement(487719..487723)
                     /number=1
     exon            complement(487783..488709)
                     /number=2
     exon            complement(488764..488833)
                     /number=3
     CDS             complement(489040..489459)
                     /codon_start=1
                     /locus_tag="AO090011000187"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000190"
                     /protein_id="BAE64730.1"
                     /transl_table=1
                     /translation="MPGQRWLNRILRGLAFSYVVMLQGGDCTAYNTGNKNIGHQSFEP
                     TARVLNGTYYGVHNDHYGQDLFLGMPYAQQPVGDLRLRTPQSLNESWTTPRNATEYSP
                     ACLGYGQTSGASEACLTLNVVRPSGASPGDNLPVAGT"
     exon            complement(489040..489459)
                     /number=1
     CDS             complement(join(490088..490193,490245..490329,
                     490450..490495,490526..490869,490984..491034,
                     491100..491273,491325..491346,491458..491542,
                     491592..491602))
                     /codon_start=1
                     /locus_tag="AO090011000188"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000191"
                     /protein_id="BAE64731.1"
                     /transl_table=1
                     /translation="MLTRSEVSKHQSRDRGLVIIKGNVYDLTSYLDSMELSACTRPCS
                     RVQRGHPTRSSTTRTSLSERTTDKKVFSLLRSVVNIHDFEHAASQVLAPRSFAFFKPG
                     ANDEYTAQWNQERGSKLTHPSGDLALTQAAGKHDILDWVPNNSGCTQKQLANARAVSQ
                     TLYWQIYAMEDLSVTENEIKQAIALGYRAFALTVDAPRAGKRERDVRLTIEVCKCVTC
                     ASVVRTALQCLGMKITVLPVARRSRGPIKCIQSWEDAVLCMEHGVHPWLSNHGGRESS
                     EVFRRCEVIVDGGICRGADIVNHYSNIYRYS"
     exon            complement(490088..490193)
                     /number=1
     exon            complement(490245..490329)
                     /number=2
     exon            complement(490450..490495)
                     /number=3
     exon            complement(490526..490869)
                     /number=4
     exon            complement(490984..491034)
                     /number=5
     exon            complement(491100..491273)
                     /number=6
     exon            complement(491325..491346)
                     /number=7
     exon            complement(491458..491542)
                     /number=8
     exon            complement(491592..491602)
                     /number=9
     CDS             join(491884..491891,491954..492266)
                     /codon_start=1
                     /locus_tag="AO090011000189"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000192"
                     /protein_id="BAE64732.1"
                     /transl_table=1
                     /translation="MKRGLYEPLYPKSLDSIGAVKDEQYGPAERNRLDVFFPRDDKTK
                     GKPVVLFVHGGGFLSGDKGWSEKVLSATTILAYLADYTTQVERTWGGLLLGVDSSLCS
                     QTID"
     exon            491884..491891
                     /number=1
     exon            491954..492266
                     /number=2
     CDS             join(492416..492434,492484..492634,492809..492856,
                     492932..493042,493167..493176)
                     /codon_start=1
                     /locus_tag="AO090011000190"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000193"
                     /protein_id="BAE64733.1"
                     /transl_table=1
                     /translation="MSLYAAGDPKRTPKALIFLPVAGVFYLSVPFWFDRKKPVRQKSF
                     AIIWIGRGRSLGGDPERLPAYIGSVKWEIKETADATATFFNAHRERSIPQGTLPTFHV
                     QEKHNHISRV"
     exon            492416..492434
                     /number=1
     exon            492484..492634
                     /number=2
     exon            492809..492856
                     /number=3
     exon            492932..493042
                     /number=4
     exon            493167..493176
                     /number=5
     CDS             join(494244..494376,495643..495818,495871..495965,
                     496026..496627,496675..496914,496982..497139,
                     497194..497314,497376..497461)
                     /codon_start=1
                     /locus_tag="AO090011000192"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070335000195"
                     /protein_id="BAE64734.1"
                     /transl_table=1
                     /translation="MTGLRGERSEDIAHREACVRLTAWTDLQPVFSITLEQKRKTSNV
                     YVAHAGVNVNGTRTSNALNLLAEQRVEVDLESPRARRLLRKIDMRTMPLVLGLYTLQL
                     LDKNSLSFAAIMGIRTDTNLSGSQYDWLGSIVYFGYLFGEIPAAFLMQRVPLAKYLGI
                     MSMLWGTVVALHAVCHNFGGLAAVRFLLGSIEVCTTPAIIYVTSSWYTRSEQVTRVAV
                     WYSTSGWAQVFGGFFSWAINQASQFKWQGLFIFYGALTFTTGVILFFFLAASPIDASW
                     LSDEERIIALERVRDNKTGVEMWNFNWSQLKEALCDPRLYIVFLLMVATGLPNGGLTA
                     FGPSIISGFGFDTNTTTLLSMVPGACAAIGTMVTLVVIKYTNRTVGGIFTILLGCIGI
                     IMMLAIPESYYTARYGGYILTMQYPNSILVVLAFITSGVGGSTKKVAFGASFQLGYAV
                     GNICGPQTFQEHEAPHYYTAKFTMLAFLIFTAILLASVGVLHWHWNRQLDNQDALDIQ
                     NGVIHEHGVNEEFADLTDFQQRSFRYPL"
     exon            494244..494376
                     /number=1
     exon            495643..495818
                     /number=2
     exon            495871..495965
                     /number=3
     exon            496026..496627
                     /number=4
     exon            496675..496914
                     /number=5
     exon            496982..497139
                     /number=6
     exon            497194..497314
                     /number=7
     exon            497376..497461
                     /number=8
     CDS             join(502761..503245,503329..503368)
                     /codon_start=1
                     /locus_tag="AO090011000195"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000198"
                     /protein_id="BAE64735.1"
                     /transl_table=1
                     /translation="MHFHRLLVLAAGLLTTATSAPTELFKRDAAGVVDAVAEIADKMT
                     TLNTTVTGYQGGVLGTGTALKIEFQSIQLSHALKDAISTTEDSQNFTGDESNKVAAAF
                     IDLQPKISSTLNNIVSKKPQFDTGLLGIGSVSFLVKWNLQQEKDLSADLGQAVVAKLA
                     EPGALQRWPPSGIF"
     exon            502761..503245
                     /number=1
     exon            503329..503368
                     /number=2
     CDS             join(507063..507448,507557..508115)
                     /codon_start=1
                     /locus_tag="AO090011000197"
                     /note="TPR repeat"
                     /old_locus_tag="AO070335000200"
                     /protein_id="BAE64736.1"
                     /transl_table=1
                     /translation="MGCCCSRSKSSSSPSPTSPPNEMEDVRPTLQSLIAESDALLEEN
                     RWVEARGKLDQAVQLSEQQQGPDHEDTLETKAILAYNLRKHGEYQEAEQIDREVHATR
                     LRVSGPDHTETAKALNNIALDLKGLASYHQQCRFGDAARLHEKTLELRVKTLGRDHFE
                     TIMAMDLLGVDCRELGQVEKAARYQEEALELATNSLGEGSETTLRCSINLASTYQAFG
                     TADGQQKALTLLERALDLSRRNLGEESPETVGTMNNLAVAYVKADRLDDAYPLLKAAY
                     DINRKTLGPDHPKTRASEGNYNYVMEKLGLTQANIFGA"
     exon            507063..507448
                     /number=1
     exon            507557..508115
                     /number=2
     CDS             complement(508649..511435)
                     /codon_start=1
                     /locus_tag="AO090011000198"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000201"
                     /protein_id="BAE64737.1"
                     /transl_table=1
                     /translation="MRRPSLWVALGALASEVLSRPMDSRSSDTVKVHWVGDAPEYHAG
                     TTFGLPWPQGKYRTNDTQFSISGPSNEQIPLQSWVTGYWRDGSIKWTGHAIPPLDTID
                     SEYRVSASASRRPASNHSDTPSGLKVTTKADEITVNTGKLTASFPKQGNVIVGSITTS
                     SGKVVGENGKLVLHTQSGVAEDVSARAKSSINYFNFQSNIENVTVSKDNAVRTLVTVN
                     GKHQTSGSGDHDDWFPFVLRFYFYANSDSIRVVHSIVFDGKPEEDFITGLGIQFEVPL
                     EGEELYNRHIRLPGVDGGYLHEAVQGITGLRRDPGEEVRSAQYEGKVTPNISTWDERV
                     SSRMQWIPVWNDYKLSQLSPDGFTLKKRTKPGQAWINIPGGTRSSGLAYLGGATQGGL
                     AIGLRDFWKRYPSGLDITDAGANKGQITLWLYSPEAAPLDLRPFHDGLGQDTYEKQTD
                     ALEITYEDYEPGFNTPYGIARTSEIFLHAFDATPESDNLALLGKYINEPPVLVPEPEY
                     IKDTKAAGSYWALPDTSNEKSSTIENHLDFLAKFYQGQIEDRRWYGFLDYGDIMHTYD
                     EDRHTWRYDVGGYAWDNSELSPDLFFWQYFLRTGRADVYRFAEALTRHTGEVDVYHIG
                     DWKGLGTRHGVQHFADSAKQVRIAQPLYRKYFYYLSGGDERVGELLEEAIDADKTYGI
                     LDPQRKVRTDGWTPEPGKPVAFSLGTDWAGLAAGWLIEWERRGPRWQEARSKLTGTAR
                     GISSLKNGFVTGSGLYAISNGTLLPPPTDPNNEGIVSISHLNAVFGMPEVVSELLEYW
                     GDDAPDGLESAWLDYCYYYGATSAEQKARYGKSFSGISLIQGHSRLTAYYAKHSNNVT
                     VAERAWKEFYNNTDGFTADESWVSERVNGSAVLIPVDEATWISTNAVAQYGLAAIQDL
                     ALAGDALTQSPYGA"
     exon            complement(508649..511435)
                     /number=1
     CDS             complement(517571..518140)
                     /codon_start=1
                     /locus_tag="AO090011000199"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000203"
                     /protein_id="BAE64738.1"
                     /transl_table=1
                     /translation="MAGSSNPREPARFKFLEVFIPLPKEYHTFYDKLEQMKDRLTAHK
                     SQLDQTTPLNPGYYDLYFKVIEDENDETLELIRKLEARKKKQNIGEIIRICVPEDVRV
                     DWDGMTPAQEKPEDGRKYVRYQNLWYNEGFLTCYNAVMLMVNGLLEDAVRMQEAEVRR
                     RLQNPNPYCPPQEPEWNFFIKEESDDGHT"
     exon            complement(517571..518140)
                     /number=1
     CDS             join(520345..520625,521243..521309)
                     /codon_start=1
                     /locus_tag="AO090011000200"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000204"
                     /protein_id="BAE64739.1"
                     /transl_table=1
                     /translation="MRLLLPFLVLPLATLDVPPPQDVSAVNSVAALRLAELNKPKGDF
                     IRSCKDVKLDGKKDDMHELIATCAAGNGTEITSKLDLSYCYSSLSAGGNNGKELKQGK
                     TTTTSEFISIILL"
     exon            520345..520625
                     /number=1
     exon            521243..521309
                     /number=2
     CDS             522676..523257
                     /codon_start=1
                     /locus_tag="AO090011000201"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000205"
                     /protein_id="BAE64740.1"
                     /transl_table=1
                     /translation="MQLTLLTTLLVATSALAAPQIDNLVSQAEGIAQTAVNGGQSIAS
                     DIASAATSIASAAETGVPGAASSITSAAGAAASSAESWGSSVASDAQSRASSIASEAS
                     SKLSDSLTTLTGTNGQPTSTGLVSTTSASGTETTTATSTSTTGTSSSSSSSSSAGSAS
                     STSSDGAGAMPTPFSFGAGVAGVAGVLGVMAAL"
     exon            522676..523257
                     /number=1
     CDS             complement(524617..525867)
                     /codon_start=1
                     /locus_tag="AO090011000202"
                     /note="globins and related hemoproteins"
                     /old_locus_tag="AO070335000206"
                     /protein_id="BAE64741.1"
                     /transl_table=1
                     /translation="MPLSPEQIQLIKATVPVLQQHGTTITTVFYNNMLTAHPELNAVF
                     NNANKVNGHQPRALAGALFAYASHIDDLGALGPAVELICNKHASLYIQPEQYQIVGKF
                     LLEAMGEVLGDALTPEILDAWATAYWQLADLMIGREAELYKQADGWTDFRHFRVAKKV
                     PESSEITSFYLEPVDGKPLPKFRPGQYISVQVFVDSLKFPQCRQYSLSDAPRSDYYRI
                     SVKREAGLNTAEPNAPAHPGYVSNILHANIKEGDVVKVSHPFGDFYLSDADSPSPIVL
                     IAAGVGLTPLTSILKTLTSNPPDAPQRKIHYIHGARSAATRAFKKDVDSLAEKYPNLH
                     ATFFETHPAAEEKQGEDYDHQGRVDLSKLDKSKDLFLDDPKTEYYVCGPDRFMTSTRA
                     ALAAEGVSPDRIKLELFGTGGVPA"
     exon            complement(524617..525867)
                     /number=1
     CDS             join(527349..527693,527730..528182)
                     /codon_start=1
                     /locus_tag="AO090011000203"
                     /note="aquaporin (major intrinsic protein family)"
                     /old_locus_tag="AO070335000207"
                     /protein_id="BAE64742.1"
                     /transl_table=1
                     /translation="MKFMNHGARADRAEHSGSTPVYSSTQKQLPMLHLKDTARNNVIA
                     VIGEFVGTFLFLFFSFAGTQVSNTPKPVDGAPPNTANLLYSALSFGFSLMVNVWAFYR
                     VTGGLFNPAVLWHVTLALCLVGGLSPIRGVLVFAAQIVAGIASAGVVSALFPGDLNVG
                     TRLGGGASISQGLFIEMFLTAQLVFVIIMLAVVKHKSTFLAPVGIGLVFFVTEMIGKF
                     ILFRCHRTICLTRINVGDYYTGGSLNPARSLGPDVINRSFPGYHWIY"
     exon            527349..527693
                     /number=1
     exon            527730..528182
                     /number=2
     CDS             join(529788..529878,529955..530100,530159..530206,
                     530262..530409,530458..530990,531053..531139,
                     531199..531583,531650..531828)
                     /codon_start=1
                     /locus_tag="AO090011000204"
                     /note="amino acid transporters"
                     /old_locus_tag="AO070335000208"
                     /protein_id="BAE64743.1"
                     /transl_table=1
                     /translation="MAKMESQAAVQAHAGADEAGLADPGDIQLLAKMGYKQELRRQYS
                     TVQIFAVAFSIMGLVPSIASTLAFSLPAGPAGMVWGWLTASIFIFTVGLAMADMASAM
                     PTAGGLYWWTHYFAGEKYKKVLSFLVGYSNTMGLIGGMCSVDYTLSLMLLACVSITRD
                     GNWSASNGTIYGVYVGLIIIHALCGIYTGKIMPKIQTFCIFINVAIIVATVIALPVGK
                     VTRGEKLNSGSFVYGHVDNLTSWPTGWAFVLSFLAPIWSIGFFDSCVHMSEEALHAAK
                     AVPLGIIWSAGCATVLGFFVLSIIAACMNPDVSATMNSVYGQPMAQVYFDALGKKGAL
                     GFMGVLIVIQFLIGLSLIVAASRQVWAFSRDGALPFSGYFRHVSKRVRYQPVRAIIGL
                     VVVCIIFGLLCLINSVAANALFSLFVASNYVAWGTPILCRLIWGKTRFRPGEFYTGIL
                     SRPLATIAVVWLVFGLILSMFPSTGPNPSAQDMNYTIVINGFVWIAAMTYYVLFARRW
                     YTGPKMTIDAPPSATDSASGDEGRVEQKAE"
     exon            529788..529878
                     /number=1
     exon            529955..530100
                     /number=2
     exon            530159..530206
                     /number=3
     exon            530262..530409
                     /number=4
     exon            530458..530990
                     /number=5
     exon            531053..531139
                     /number=6
     exon            531199..531583
                     /number=7
     exon            531650..531828
                     /number=8
     CDS             complement(532194..533600)
                     /codon_start=1
                     /locus_tag="AO090011000205"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000209"
                     /protein_id="BAE64744.1"
                     /transl_table=1
                     /translation="MLRDILQGLQDTLKASTVSYGVINIVLLLSLVFILVVQNGNTST
                     TRKLKQLQRLGLSISNMTDQYDSKYNEPEGTTSKGPVRIKAICIHPIKSCGRIELNRA
                     LLTKTGFKYDRCFAFATELGKNNPAMESKWRFISQRTKPTMSQIKTELWLPHKESNQR
                     DPLVQAGGCVVVSFPDPDGPGCFNYLEKFFHIGNPVAKPEVRFIVPLQPTPAMINEYK
                     IQFKTFGIHGRDAKGLDMGTIPSVAEALPKLKKYLRIANDQSLTLLRCTPDTLVRTDE
                     NLAPLEHIGTPSVHGYTDQQPININSLSSVHAVSTLLPKENQPLNAFRFRANLWITGA
                     PAFDEESWKRYRILPKGPDAGPRADVAPTVSVVCRTSRCTMPNVDPETGKPSTDNPPP
                     EKKRGKPQPSATLVKFRRVEDGNKSALGYIGMHCVPEDRALRMAEEQEKGLYVAVGDE
                     IEVLERGEHLYGSTGNDY"
     exon            complement(532194..533600)
                     /number=1
     CDS             join(534120..534164,535227..535252,535867..535902,
                     536189..536390)
                     /codon_start=1
                     /locus_tag="AO090011000206"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000210"
                     /protein_id="BAE64745.1"
                     /transl_table=1
                     /translation="MLPNFPRPKRPFPWPAFRGDWDDKFSASAHTQTEPLFDRATWMV
                     EYYFCIFFLLVTITVSISITTSTVTIIITMSRRNCKKKRTKPPINSNHNGKTQSGTST
                     "
     exon            534120..534164
                     /number=1
     exon            535227..535252
                     /number=2
     exon            535867..535902
                     /number=3
     exon            536189..536390
                     /number=4
     CDS             join(541491..541891,541994..542032,542055..542103)
                     /codon_start=1
                     /locus_tag="AO090011000207"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000211"
                     /protein_id="BAE64746.1"
                     /transl_table=1
                     /translation="MIEDPSAPIRPPSENKPSEDGGFTVHCKDLKWLPLAPKVFIKII
                     KTVPETGEYSIMVRAEKGGVLPRHRHLDSAEIYVMKGSGAHPQTGSFAEGDYVSESKG
                     ATHDPLVFENDTELLMVSRGPSMFLDDDGSDLIPASLYAFCVLWTHFYWGSLGWRIWS
                     CL"
     exon            541491..541891
                     /number=1
     exon            541994..542032
                     /number=2
     exon            542055..542103
                     /number=3
     CDS             complement(542386..543357)
                     /codon_start=1
                     /locus_tag="AO090011000208"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000212"
                     /protein_id="BAE64747.1"
                     /transl_table=1
                     /translation="MGIFDYDFLYSQLFIRPAYPTTSFTNQTIIITGSNVGLGLEAAR
                     HFTRLGAAKVILAVRNRSAGEEARQSIERSTGTTGICEVWDLDLASHESVLAFAKKVA
                     ELPRLDVFIANASIATGTFQLAEGHERTITVNVINTILLELLVLPTLRKSARLHPGTK
                     PRLTTVVSEVHAWAKFAERSAENVFKALDDKEQANMPERYELSKLLQVLLLREMVAQG
                     AGDSVIINMVNPGFCHSRLGREMGLAFALLQMVLARSTEVGSRTLVAGAASGEESHGA
                     YMTNGKVDNGALSTFVRSEEGKKTQMKLWAELVEILEALEPGCTRVV"
     exon            complement(542386..543357)
                     /number=1
     CDS             complement(join(544258..544425,544477..544633,
                     544694..544801,544862..545169))
                     /codon_start=1
                     /locus_tag="AO090011000209"
                     /note="predicted short chain-type dehydrogenase"
                     /old_locus_tag="AO070335000213"
                     /protein_id="BAE64748.1"
                     /transl_table=1
                     /translation="MATYIVTGSARGLGLAMVKELASREPTDVSLVIAATRKSSTALD
                     EIVARDSGRVVFIPLDVSNEASISSCVEKTGSVVGQKGVDVLINCAGVHSWLEGKTAN
                     MSDLDYQLSVNVVGTHNVTRAFLPLLKIGKSKKVANISTVYASMAQAEMSSFANCPAY
                     KISKAALNALTVQYAMSYKDEGFIFLAVSPGWLKTDMGGDDAHLTAEEGAQAVLNVVD
                     KAESDSNGCFKNIYAPGWDMYDGKDIPW"
     exon            complement(544258..544425)
                     /number=1
     exon            complement(544477..544633)
                     /number=2
     exon            complement(544694..544801)
                     /number=3
     exon            complement(544862..545169)
                     /number=4
     CDS             complement(join(545868..545890,546038..546419))
                     /codon_start=1
                     /locus_tag="AO090011000210"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000214"
                     /protein_id="BAE64749.1"
                     /transl_table=1
                     /translation="MPLSGSFNNIPKHGHCKLRLIQPLLLIGRNLSSGIRGIELRTEG
                     LESSLIGESKLSISIEVKVGLLSDKHSGRGQGIAVAGTLDGGLDGVACDLSALVRERE
                     VFTGELLDEVDVSLRVLLEVLEGDYGGGQMTL"
     exon            complement(545868..545890)
                     /number=1
     exon            complement(546038..546419)
                     /number=2
     CDS             join(547974..548376,548432..548739,548823..548882)
                     /codon_start=1
                     /locus_tag="AO090011000211"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000215"
                     /protein_id="BAE64750.1"
                     /transl_table=1
                     /translation="MLLTCSSESPNVLASISEPEENAPAKRRKLDSHRNTEVRNECNP
                     AATPDNSTHHAQQAKLVIQIEVDGRRLGRRHLSNERRRIFESAVKLVDRMSRGEHLAL
                     HESIAPGESARELLDIEIPQTPPAEILYMLLPVMGDGLHHIRWPDHISDKAFERMMSS
                     LLDGDCRGRLFYQYSICVYVKAMFHLYQLARRSTNPSVKKQLQKSKRTYEAAALQALK
                     HINLMSTPSLSLIQALLSASMLATKLICCSPGRLFELS"
     exon            547974..548376
                     /number=1
     exon            548432..548739
                     /number=2
     exon            548823..548882
                     /number=3
     CDS             551576..553042
                     /codon_start=1
                     /locus_tag="AO090011000212"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000216"
                     /protein_id="BAE64751.1"
                     /transl_table=1
                     /translation="MDRFMNILRKPGAKPEIQGVAPTQHLAGKETLDHPNAKGYIPKS
                     KPKMLDRWLDFVVRVSGSEPVFFLILAGLLTWALLGIKYGSTDSWQVLISDIQAIVSY
                     IFDSFLVRQQLNAYEEEMVVAAELESRILSHKRMLAKLHQTLEAQDQEKTTQLVNLVK
                     KHQNALEFGTELPTETRFGRTITWISHVIGHLGTITLFWAGVFTWIALGHRSHYSDKW
                     QLYMNSASSALMVFIFAFLANIRERHAAYTRSCLDAIFQVDASLEAKLRHLTDDTLPN
                     DIVIIPAPRVSKIQRAIFYYADFVGTLVGIAILVAVIIIWIAIGPLLHFDSNWWLLIG
                     TYAGLIGMNDGFVLRNMQARLRCYVDAEFARITAQDATLFATAGIPAPSDEVVRGASL
                     TRRVSETMGRVCAHEITVVLGFLTILGLIAGASAMRWTMTGQLLCNVPPSLIESFFMI
                     VLVTGHNSADDRIRVDLRNTYARRLQLLGFVHAVQSVW"
     exon            551576..553042
                     /number=1
     CDS             join(554450..554704,554771..555472)
                     /codon_start=1
                     /locus_tag="AO090011000213"
                     /note="predicted nucleoside-diphosphate-sugar epimerases"
                     /old_locus_tag="AO070335000217"
                     /protein_id="BAE64752.1"
                     /transl_table=1
                     /translation="MTVGIFPAAGGLGTSIINHLVKRIPADQLILIARKPDSLAHLSR
                     LGAPVRRADYEDPSSLERVFDGVDVLMLISYASFEIQYRVEVHRNAIDCARRSGVKHI
                     FYSSLAFAGDLTDSSVAHVMGAHLRTEQYLADLQAQSHITYTAIREGLYSESFPIYTA
                     WFDLAHPVDEITIPHAGSPPGVTWAKRDELGEATANLIASYVQDPRSFPYVNRRLLLS
                     GPREYSLQETVEILGRAVGRTVRIREISPDEYAALSTHGTKHTYHGINLAREWATAWD
                     AIRRGETAVVTPLLREILGREPEDYETTIRGLAREVRTQEAS"
     exon            554450..554704
                     /number=1
     exon            554771..555472
                     /number=2
     CDS             join(558776..559105,559164..559742)
                     /codon_start=1
                     /locus_tag="AO090011000215"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000219"
                     /protein_id="BAE64753.1"
                     /transl_table=1
                     /translation="MAYTRTDPSFTLSDDERMYMSHHSPMHRPYDTFAAPKGPDPLSA
                     NWNYDSAIDLFSLNTMMPENFALDVPNEPMGVDPKDFPADFFAPPPDISGFTISNHSG
                     EDAGSITSDLESDDQSWSPTYAAPAEMLPAPGRQSTRRKTTPAVKRETTWSSSPELAP
                     QEYPAHTSPQTTPTSPPVNRKMTRTTSVDSNASTGQTTTATTTSGRNAAKRAAHNIIE
                     KRYRTNMNAKFVALEKAMCGGVQKSNKSGSASLKKSEILTNAIAYMQELQEENKALQK
                     ELALFKQNMVPSGMWRHTKGAETFRA"
     exon            558776..559105
                     /number=1
     exon            559164..559742
                     /number=2
     CDS             complement(join(562249..562655,562880..562886))
                     /codon_start=1
                     /locus_tag="AO090011000217"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000221"
                     /protein_id="BAE64754.1"
                     /transl_table=1
                     /translation="MIFKPSASATASNALVKVRPFLPGSIPYSLVPLTWVGIKGGWDP
                     ETGEFHKEINAQIDQAFANVDLALKTAGGKGWAQVYRVNSYHVPINNEALEAMVRNFR
                     KWMPDHEPLWTCVGVTRLGEDDMRVEIEVVAHDPK"
     exon            complement(562249..562655)
                     /number=1
     exon            complement(562880..562886)
                     /number=2
     CDS             complement(562997..563794)
                     /codon_start=1
                     /locus_tag="AO090011000218"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000222"
                     /protein_id="BAE64755.1"
                     /transl_table=1
                     /translation="MAHAHLYGSANDIRWAPKPLLKEHQRPAFLKSCLLDLRSWFYDL
                     PTELRIDRANDIPQAYTLHMVYHTARILLAKPFIMRENPPPKAQNETTDLAHSICRES
                     ARSICLVAQKYRHTFGGYHLSPITATHCTLSAALVLLDETENLNAPSHKNKLALCLTV
                     LDELSKSWYPAGHIGHNLRKLCQSVISDDTFSIEKGLYPFETNPSPPLDLGVELPNVI
                     DEIESNPSVNPGNALANQLELSVPMESLPVDYGFFDILNQINWERMW"
     exon            complement(562997..563794)
                     /number=1
     CDS             complement(join(563951..563974,563989..564198,
                     564253..564846))
                     /codon_start=1
                     /locus_tag="AO090011000219"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000223"
                     /protein_id="BAE64756.1"
                     /transl_table=1
                     /translation="MNGSIRHDDASSDMDSLAENFKGRLALDESLNFDQDGEMRYFGP
                     TSGRLQFQGSSSNRVSIDGSAFSVSPPDQVSDSYGYIDPIDPITAGMGVPKDVQDHLI
                     DLYFRWEQPWYAVVDEELFRESMNNGGRYWTPLLHNCILALGSRYSDRVDVRSDPDDP
                     NTAGKSFLEEAKTQLHREMERPSLTTIQALGLIGMVYIAMGADAAGWLHHGMANRLSL
                     DMGLNLDPAGFEETNAMTPREIQLRRQIYWTLYCHDKLSSSYTGRICSMLVVAGTVF"
     exon            complement(563951..563974)
                     /number=1
     exon            complement(563989..564198)
                     /number=2
     exon            complement(564253..564846)
                     /number=3
     CDS             complement(566157..566735)
                     /codon_start=1
                     /locus_tag="AO090011000220"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000224"
                     /protein_id="BAE64757.1"
                     /transl_table=1
                     /translation="MPTPPGPPPPPPPENPLSKIPPIVLKLRSTPPKHFYQPPNPHPT
                     INQSTTPTGPYFFYGTLTDPNMVAEILNLDHEPKFRPAIIQGYECKMWGQYPALVDGS
                     DTIVEGAVYHVQTAEDGMKLAAYETNNYRSESCIIKYMDGKEPAEEVGYTFKFVGNLR
                     DLHEGRFELRAWLKLMGREDAVEKLDDRVSFV"
     exon            complement(566157..566735)
                     /number=1
     CDS             complement(join(567037..567776,567796..568429))
                     /codon_start=1
                     /locus_tag="AO090011000221"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000225"
                     /protein_id="BAE64758.1"
                     /transl_table=1
                     /translation="MHYLQRTIPDLASFRLAYRFIKIWAQRRGIYSSKLGYLGGIHIT
                     LLLARICTLSFRQAGTISAADIITTFFKHYAQFNWEKQVVYDPSFYKSPPRYFRPQRE
                     PLVILSQHQPKVNVARAASIPSTRTLVQEFQRADKLLSQQDVTWEQLAGSIENSTGAD
                     EFLKSYRSYAKVNVQYWGGAATKGRMLVGWLEWRCVSLLVGRLHPLPTFQRHIHRKFP
                     DIHARIWPARFTDMEEVGETTKEYQGCYLIGLTRESTPGATPLSDADRQSAHISLLAV
                     LNSFAEQIREDENYFDSSSSWVDVSLVQPSALSGLRVDISNWGNGAYDEASFDDDEDE
                     IELEDEEDEELVQARLRTMPIRGTKAVAMPEGAKLRSASDVLNRLRWDAEFDIENYIV
                     GYDDRFLGEREMPVGQWKADLTDEAFIPMHRILYFKRKSDGVKVWDRETRTDLLFGSG
                     VSSKVQE"
     exon            complement(567037..567776)
                     /number=1
     exon            complement(567796..568429)
                     /number=2
     CDS             complement(568572..570734)
                     /codon_start=1
                     /locus_tag="AO090011000222"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000226"
                     /protein_id="BAE64759.1"
                     /transl_table=1
                     /translation="MASTEETRAIPLTSYETALCVVPPSHLTGDIDRLRALYDKAHGR
                     WPPHANLIYPFVAPEALPQASKLLQSVLSNRREVDPIRLRLDKSDFFAHKRSNTVYLT
                     DSGSDGLKALAQLQHDITDAFGGQSRSSGRLHLTVGQSEADDLAERQFLLEKVGLIPA
                     VEWEVEELVILIRDRSQGLDTASSPMVVWGAVSLSGTPSPNPKALEYLSPSSLPARSE
                     TTFQFSPSQDDSEEGKWNAIPKSPAPTGGKLVDSPVTVASYNVLVESLHPPPTERYPL
                     LLQNLLSDAASANILILQEVADDFLSFLLRDKKIRLRYPFATHGPPDQAEIGPLNSLR
                     NIVVLSRWQFRWEWLPFDKRHKGAVVLQLEHLGTFHDSKFLPLVVTGVHLSCGLIDSS
                     IMAKRSQLQTVLKYLSGIYPNNHWVVAGDFNITTSSYTIDTALKRKSISAQGASVLAS
                     LDGMLTDAGLLDCYYASRAASSGLGNPQGRLDLGASYEGEEGATYDPTENEHAARIAG
                     QSFHSRPQRYDRILVRGVEFEVLSYNLFGIPSGDESQLASDHWGVRATVKLNGPRSGG
                     LESEKALITVEKAPLNLGGIDGLKGWLKGYLAFPSNEEITQRQEAFELIKELVNRRDA
                     NLPAGTRLDLLFEVVPVGSYGFGVWNSSSDMDILVIGQVSPRTFFALMIAKLRRATDS
                     DVVLLRKVKAASGIMLELEVRGVRVDLQYCAATRVVER"
     exon            complement(568572..570734)
                     /number=1
     CDS             complement(join(571516..571796,571854..572022,
                     572092..572210,572272..572864,572915..573162))
                     /codon_start=1
                     /locus_tag="AO090011000223"
                     /note="serine/threonine protein kinase"
                     /old_locus_tag="AO070335000227"
                     /protein_id="BAE64760.1"
                     /transl_table=1
                     /translation="MDTLKATLLKSWSRLASILGNPSQKAPLCRLNHFRNTEEPDLYT
                     TGGFHRVSLGDTFDHGRYAILRKLGYGQYSTVWLAQDFKHKKYVTLKLLRADCYGGPH
                     DIFEREILSKISDMSRNSTHDGARHILPLIGDFTHTGPNGDHVCLVFDVLGHHLDFQC
                     AKYEDGRLPVRAVKLIARQLLLGLDFLHRECGVIHTGMGIVSNTFVLYFLTGRIFPID
                     LKPTNILLELENPDRVISRYLEKVPPLMDTQGNAEVPLREVITTPLISEMEAPRIRII
                     DFGVASWRDNHLSEQIQSSALRAPEVTIGAPWDTGVDIWSLGCLIMELVQGIVPFSGE
                     ASERGTWTAEDDRLARTIEILGPFPLELLRKGSRTPDLFDEKGDLLRIPNMKSTSLER
                     LLNGTTKPFLKPDDMPDAEVPIFINFLRACLRLILSTGVQRQSCFSMNGSDHDAIEWL
                     KVERIEGSYETMHTSIRTQ"
     exon            complement(571516..571796)
                     /number=1
     exon            complement(571854..572022)
                     /number=2
     exon            complement(572092..572210)
                     /number=3
     exon            complement(572272..572864)
                     /number=4
     exon            complement(572915..573162)
                     /number=5
     CDS             complement(join(574654..575092,575329..575435))
                     /codon_start=1
                     /locus_tag="AO090011000225"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000229"
                     /protein_id="BAE64761.1"
                     /transl_table=1
                     /translation="MAGKAYWYSGDDPGMHFLCTPCKSRTCIEPRIYKSRIKMQFTSF
                     KALAIFAASFFAFSAAAHPSCETGAVWADPHDCHSFFECAAGGIPVRKTCGPGTAYNS
                     RFGICDYEEKVRSCHGHGPVGHDESSEGHGHQWKDHGNGQSEGHGQEGKKDSKGQSSE
                     GHGQGTQEHGSGEQEHSEGSH"
     exon            complement(574654..575092)
                     /number=1
     exon            complement(575329..575435)
                     /number=2
     CDS             join(578772..578976,579051..579222,579307..579355)
                     /codon_start=1
                     /locus_tag="AO090011000227"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000231"
                     /protein_id="BAE64762.1"
                     /transl_table=1
                     /translation="MNMNERLDAIERHLQALDPKLWGATDTPASSGQVKDLERRVEEL
                     TARLETVTAQTSRPSGDMLYPMDHTRVGVSEYGRVGRVEAGRAAVTRRKGGGPTRIAF
                     KQRFDRVPHVQITPERFGGPGTGNVGQTVVFRWLAVEIV"
     exon            578772..578976
                     /number=1
     exon            579051..579222
                     /number=2
     exon            579307..579355
                     /number=3
     CDS             581318..582334
                     /codon_start=1
                     /locus_tag="AO090011000228"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000232"
                     /protein_id="BAE64763.1"
                     /transl_table=1
                     /translation="MTPFQNQPVPVQQQGQNHVNGQPNMAAQFPHHGNRPMTQVDMTA
                     LQVLNTFYATRAQQLVPDTMAQQQAGMAAPPRQGVNSANVSGAQQAPGTMAQPPTGMA
                     APHGKSVNLINGIVQQQVPSTMVPLQAGIAGPYGPPVYPINAVPQQEVHGTMVPLQTG
                     IAPQYQHGTHLPPSQGLQFSPQQHARMVQIKEERMKEAQLLEQNVMAKVNQKVAEVNQ
                     KNEMLHQKIEEVCQENKQLRQGMQSFKRRTERRMCNRIKGVEKRAVERITHDVQQKIN
                     LWLQSSEAVRSPGLQAEIKELTSALSKAERRIQDLEGWAVLGRRFLYEVFFSEPQGYV
                     EEES"
     exon            581318..582334
                     /number=1
     CDS             join(585202..585533,585579..586739,586797..587724)
                     /codon_start=1
                     /locus_tag="AO090011000229"
                     /note="copper amine oxidase"
                     /old_locus_tag="AO070335000233"
                     /protein_id="BAE64764.1"
                     /transl_table=1
                     /translation="MRLTISAAVLPSLLLLPCFLGDALAHPRPDPKTAWVRQGRRRKS
                     SPRNLQVHSSMLSTCVESNATVIKAPKHNVWEGMTDEETASVVKWLFQQPTLNLTVTE
                     GAGEWDNTIALVELMRPNKTDVLSYLDHQGPAPSRYAHVVLDNRATTDPHYADLLVGP
                     LAITNQSTPSWTPLEYPYTRKTHGRVRNLDADYSTIYSEWLYKISASIADITLDLFNG
                     TALGLDNDTLDIWGIDPLWQDDGRIIRWDTFWNMPTDEFDTGSILPLGLFFKSDVTGR
                     DPSQWKLEGWLYNDIFYETTEAFRHAFFSTGFVKLKPNTEGPWAQTDQRGPILPQDKQ
                     QSPLMVAPSGARYSVDLDRKYVTWMDFSFYISFSRDTGVSVFDIRYKGQRVLYELGLQ
                     EALAHYAGNDPIQSSVAYLDSYYGFGPYAFELVKGYDCPVYATYLNSSFYVSETTHTH
                     IDSLCVFEYDADYPIQRHSTSDYVSSTKNVYLTLRSVSTIGNYDYMTSYTFHMDGTIG
                     VEVRASGYIQAAYYAHNEDFGYRIHDALSGSMHDHVLNFKADFDILGVNNSIELTTVA
                     PVTRTFTWSGGRSRNTMTLERSILSSEDEGRFNWGPNGATMMHVINQDARNPYGEYRG
                     YRVLPAAGTAHLTVQDSSNLAHAAHWAEYDIQVTRQHDHEPRAAHAYNSQDIHNPPVN
                     FAEFFDGEPLNQTDLVVWLNLGMHHVPHTGDLPNTVFTTARSGVQFTPLNYLAGDPSR
                     QTVNMVRVNYANGSATEVKTFGQAEEVCTVPITGIGEELWRYQGDVVVRKFPYNPNDP
                     YYEMEGDA"
     exon            585202..585533
                     /number=1
     exon            585579..586739
                     /number=2
     exon            586797..587724
                     /number=3
     CDS             complement(588649..590157)
                     /codon_start=1
                     /locus_tag="AO090011000230"
                     /note="mannitol-1-phosphate/altronate dehydrogenases"
                     /old_locus_tag="AO070335000234"
                     /protein_id="BAE64765.1"
                     /transl_table=1
                     /translation="MAPLKLNNKNLSQIAAAGETQVKVPTYKRGGDVKEGIVHVGVGG
                     FHRAHLAVYVDQLMQKHGVTDYAICGVGLQPFDAAMRDALGSQDHLYTVIERSAKGSF
                     AHVVGSINSYLFAPDNREAVIAKMAHPDTHIVSLTITESGYYYNENTHELQSEHPDIQ
                     FDLQPANEKSPRTTFGFLYAALARRYQQGLKPFTVMSCDNMQKNGSITRHMLESFARL
                     RNPEIAKWIAEQGAFPNAMVDRITPQTSATDKTALADNFAIEDSWPVVTEPFMQWVIE
                     DQFSDGRPPFEKVGAQVVKNVHDVEEFEKHKLRLLNGSHSAIGYPGQLAGFKYVHEVM
                     ENPLFSKFVWQMMQDEVKPLLPEIPGVNIDEYCKTLIERFSNPTIMDQLPRICLNASG
                     KIPQFIMPSIAEAIWVTGPFRRLCFVAAAWFHYINGVDDSGKKFEVDDPMREELQAKA
                     RAGGTSPAELLSIKSLFGDDLRGDKRFLQEITKAMEDIARDGILKTLPKYID"
     exon            complement(588649..590157)
                     /number=1
     CDS             complement(join(592017..592801,592891..593260,
                     593310..593320,593370..593449,593517..593680))
                     /codon_start=1
                     /locus_tag="AO090011000231"
                     /note="amino acid transporters"
                     /old_locus_tag="AO070335000235"
                     /protein_id="BAE64766.1"
                     /transl_table=1
                     /translation="MLAFAATSQASWEAIGASMFAGLENGGPVALIYGLILAILGSLG
                     MALSLAELASITPVAGAQYHWTYDLAPFAPRFLSFMQGWITIIAWWANTATSPFLIGT
                     QIKALAVQNNPSYNPKPWHTTLIIWAVLLIPLAVNIYGRRLLSAVEVIGGTIHIVFFP
                     AVLITLIVLGSRNSSEFVWTYFENSASGWHNDGIIWSVGLLTAVYTFSGFDGVVHMAE
                     EVKDARRTIPRSMVYSVLINGTVALGFTIGLLYTMGSLDDALNTPTGYPLLEIFYAAT
                     KSNAAASGMLMMFILPGFVALLNGLASVTRLTWAFARDEGLPFSSYFVHISSWHKIPL
                     RALFLVSTIIVLLAVINIGSTTAFNALLSLATLGQYISYLIPIIFLLIKRIRAPQEVR
                     WGSFRLGKWGIPLNIFVIMYGIYIVIFLPFPPNYPVTATNMNYAAPVFLAVVFFAVID
                     WFVRGHKCWHGPRIKVTAD"
     exon            complement(592017..592801)
                     /number=1
     exon            complement(592891..593260)
                     /number=2
     exon            complement(593310..593320)
                     /number=3
     exon            complement(593370..593449)
                     /number=4
     exon            complement(593517..593680)
                     /number=5
     CDS             join(594465..594653,594738..594842,594869..594892,
                     595046..595140,595247..595391)
                     /codon_start=1
                     /locus_tag="AO090011000232"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000236"
                     /protein_id="BAE64767.1"
                     /transl_table=1
                     /translation="MPISTALRPPLEEKSVDNNGPLVSIFTFIPFSVTLIVVIIKTWS
                     MVYLKRVVLSVDIPIWAGTIVALVQSLLIQFAVDHGMGRHLEDLLSTTFHTYNKFDSK
                     LALRLLADGQYWQSLATCSNAKRHVGNISLVTALESACGSTNNNALECPNAVASSPED
                     HLNIRVSDFVSLLSTQAACKQLNYN"
     exon            594465..594653
                     /number=1
     exon            594738..594842
                     /number=2
     exon            594869..594892
                     /number=3
     exon            595046..595140
                     /number=4
     exon            595247..595391
                     /number=5
     CDS             596529..597839
                     /codon_start=1
                     /locus_tag="AO090011000233"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000237"
                     /protein_id="BAE64768.1"
                     /transl_table=1
                     /translation="MLLDLVSWRLLNLVEIHAGLAISCHYYFTSDSSGLERKLWWRLT
                     RRAFLIGGTVPLYVTLLKSENSPWMKILAMPLVADSILIELLSLFWDTSEADLGFNRD
                     WPHRTLVVKTANPPTRKHENKGDADQNTKTVEDKDTPSSNVTADGLCDRVYGLWSPTA
                     EVDDKKDLQSLPPNDSNLERIFSPTHRAPLGKCGQGHWRCLTYLAMYIAMRVIRWPLM
                     FGDLALITWLLHGGLQPLTLTVADMLLNIRLLKDLLTISYMACIVFLGNILIFVAVRL
                     LFRQLCQYISFLRRVTQWFQDLPSVAPITYKAIHLFQWIIAIATVSHLSVILVIAVIP
                     QLSRNILSAFMELIVIPMFYITMYMLVCGREKPEKAPANPEPRLRADPAPEAGPCPNI
                     TSQDHTNDADNDASKSLQSANGDRFNILRLGLLISTTAIWFLFC"
     exon            596529..597839
                     /number=1
     CDS             599125..600102
                     /codon_start=1
                     /locus_tag="AO090011000234"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000238"
                     /protein_id="BAE64769.1"
                     /transl_table=1
                     /translation="MAHHVSSVAWSANRLDVFGIGTDNACWHMWWNASSWGGWESLGG
                     VFSSPIEAVSWGPNRIDLFGPGTDNTCYHKYWNGSSWSGWDKHGGVASSAVRAVSWGP
                     NRLGIIVRGTDNACWHKWWNGSSWAGWESLGGKINSCVETISWGRNRLDLFTLGTDNA
                     VWHKWWNGSSWGGWESLGGVATSPVSAVSWASNSIDLFVKGTDNALWQRWWDGTNRGV
                     WESLGGVVTSDVKVASWGKDHLDVFVRGSKNDAWHISWHNGKWGQWGRLGDKTLFSAI
                     SAVCWGVGRLDLFAVATDKNALLHQAWDGKAWRGWESCGGILLSQLRNV"
     exon            599125..600102
                     /number=1
     CDS             join(603017..603116,603197..604173,604227..604952)
                     /codon_start=1
                     /locus_tag="AO090011000235"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000239"
                     /protein_id="BAE64770.1"
                     /transl_table=1
                     /translation="MFFSRGALSLAVLSLLSSSAAGEAFEKLSAVPKGWHYSSTPKGN
                     TEVCLKIALAQKDAAGFEKTVLEMSDPDHPSYGQHFTTHDEMKRMLLPRDDTVDAVRQ
                     WLENGGVTDFTQDADWINFCTTVDTANKLLNAQFKWYVSDVKHIRRLRTLQYDVPESV
                     TPHINTIQPTTRFGKISPKKAVTHSKPSQLDVTALAAAVVAKNISHCDSIITPTCLKE
                     LYNIGDYQADANSGSKIAFASYLEEYARYADLENFENYLAPWAKGQNFSVTTFNGGLN
                     DQNSSSDSGEANLDLQYILGVSAPLPVTEFSTGGRGPLVPDLTQPDPNSNSNEPYLEF
                     FQNVLKLDQKDLPQVISTSYGENEQEIPEKYARTVCNLIAQLGSRGVSVLFSSGDSGV
                     GEGCMTNDGTNRTHFPPQFPAACPWVTSVGATFKTTPERGTYFSSGGFSDYWPRPEWQ
                     DEAVSSYLETIGDTFKGLYNSSGRAFPDVAAQGMNFAVYDKGTLGEFDGTSASAPAFS
                     AVIALLNDARLRAGKPTLGFLNPWLYKTGRQGLQDITLGASIGCTGRARFGGAPDGGP
                     VVPYASWNATQGWDPVTGLGTPDFAELKKLALGN"
     exon            603017..603116
                     /number=1
     exon            603197..604173
                     /number=2
     exon            604227..604952
                     /number=3
     CDS             complement(join(605270..605294,605433..605809))
                     /codon_start=1
                     /locus_tag="AO090011000236"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000240"
                     /protein_id="BAE64771.1"
                     /transl_table=1
                     /translation="MFNTGAPATSDATTTITSTTTSRSTRTMTSTESTATATSDEDSS
                     SSSSADSSSRSRTTSAEETRSTSSSTSRSSSRSSSASANDSVGTTASSTSFAQGGETG
                     SANAAPVITGYVGLEMGAVAVGAFYDIGGFF"
     exon            complement(605270..605294)
                     /number=1
     exon            complement(605433..605809)
                     /number=2
     CDS             complement(join(607707..609163,609220..609373))
                     /codon_start=1
                     /locus_tag="AO090011000238"
                     /note="amino acid transporters"
                     /old_locus_tag="AO070335000242"
                     /protein_id="BAE64772.1"
                     /transl_table=1
                     /translation="MDLESNSQPLKPHLVDQDVQDAHDLAAMGHDQALTRKFDLWSML
                     ALAFCVLGTYSTFAQDLSSGLTNGGAVAILWGLVLVTACNLCVALSLGELASSMPTAL
                     GQAYWVFRLWDTPLGRFASYMCAWINTFGWWTLTASQIAFMTEFLLGMKVMFEPTWEG
                     AGTGWLEFLVYIGCVLLLTVINVVGCRRDKILPWINNFVGIWFTALFVILSLVLLISV
                     GVKKDLSFQPASFVFGKWINQTGWSDGVVWFTGLVQAAYGLTAFDAVIHMVEEIPAPR
                     KNAPRVIWLAVLLGAVTGFIFMVVCLFCIQDVDKVVDSPSGLPFIELMLETIGLKGGA
                     TLIALFIFNGLGQGIGILTTASRLTWGFARDGGLPWSGYLSHVDPVWRVPARSLWFQG
                     VLIALVGILYLFANTVLEAILSVSTIALTISYGMPIAALLVVGRDKLPPGQFNLGRWG
                     KPLNWISIIYCAITTVFFFFPGSPNPPAGDMNYAIAVFGVMLVVSVGFWFLQGSRTYL
                     KTEDAIAQMIVAQRLENEGTVEPDSKKK"
     exon            complement(607707..609163)
                     /number=1
     exon            complement(609220..609373)
                     /number=2
     CDS             join(615102..615262,615315..615474,615526..615761,
                     615823..616334,616362..616450,616474..616826,
                     616891..617014)
                     /codon_start=1
                     /locus_tag="AO090011000240"
                     /note="amino acid transporters"
                     /old_locus_tag="AO070335000244"
                     /protein_id="BAE64773.1"
                     /transl_table=1
                     /translation="MTDTADIKNQLPYEVEKLSDESLAPDDAVLQAQGHRPELARSFS
                     WVGAIGLSFSIANSWLGYGATFGTPLAYGGGPTVLFGVMIAAVAQWIVLLGLAELCSA
                     LPSSGGQYHFTYILAPPKYKKFAAYTVGITNVIAWWVSAASGIIYTGISAFGIAVFWY
                     PDFQHERWQIYLCYVLVVTLTCKAPRRYDYLTKTTFTLSITGLIIVLIAVLASGRGRY
                     HPEILTTFQGTSGWDTAPAWLLSITMGQYCYAAIGAVTHIAEEMPQPGRRIPLVMYDR
                     PQINVDIPLTVGSNLGVLVGVMTAVPWVTVMLCGIHDIDAVHKAFIPSMEVYYQATGS
                     KVGATALQAFMTFLYWSKSVPFACGPSQWITSSRIAWAFSRDVCFQAQPRIKNGLPFS
                     HYWNFIDPKFNIPVRTTFLSVSFCLLYGLVYIASSTAFNCIVNMSILFLNISFTVPQA
                     ILATVGRDKLPVRAFNLGRWGYAVNIFSTVWLTFSGILFCFPTKLPATAGSMNYGSAV
                     LVGVYILIMLLWLERKNKFTGPKINWDALNMSNKLA"
     exon            615102..615262
                     /number=1
     exon            615315..615474
                     /number=2
     exon            615526..615761
                     /number=3
     exon            615823..616334
                     /number=4
     exon            616362..616450
                     /number=5
     exon            616474..616826
                     /number=6
     exon            616891..617014
                     /number=7
     CDS             join(617710..618069,618177..618578,618631..618984,
                     619053..619421)
                     /codon_start=1
                     /locus_tag="AO090011000241"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000245"
                     /protein_id="BAE64774.1"
                     /transl_table=1
                     /translation="MNHILHGWTDNTWQRSNCRANLGCIPLLFTWFSAVLGPVDIKTQ
                     ILISESQRLPKSMATNNPDLDSALAQQSPTPEKSAQQAKPVFKEAERWNHPRSNILKT
                     LATFWSFLVMGANDAAYGLENYYNLSYTIVSLVFLSPLGGYTLAALLNNKIHTTLGRR
                     GVAWISPGCHLLAYIVNCVHPPYPVLVVSFIFAGFGNGLADSAWNAWIGNMANANELL
                     GLLHGLYGVGAVLCPLIATSLITEAKVPWYYFYYIMIGCAAIELAFCLTVFWDSTAAA
                     LQEATPQGDDPAGGLRQALFTKRSARVTWICAFFLLGYVGIEVALGGWIVTFMMRVRH
                     GEDFASGMVATGFWLGIACGRVVLGFITPRIGEKMAIIVYSLFAIACGLILWLVPNFY
                     ASAVAVSFQGFFLGPFFPAAVIVATKLLPRALHVSAIGFAAAFGGGGAAVLPFVVGAI
                     AQARGVQVLQPFIISLSGGILLLWLGLPRMPKKGDKKGEGTSHV"
     exon            617710..618069
                     /number=1
     exon            618177..618578
                     /number=2
     exon            618631..618984
                     /number=3
     exon            619053..619421
                     /number=4
     CDS             join(619917..619927,619991..620004,620084..620969,
                     620979..621054,621183..621542)
                     /codon_start=1
                     /locus_tag="AO090011000242"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000246"
                     /protein_id="BAE64775.1"
                     /transl_table=1
                     /translation="MLPRSYTHSTTLVTGLILILGGYTYHVYYQNSVLSKIQNAFYNK
                     VSNSNHDSDTPRNTEKFYIQRPEQPLIDEIVRGNEAGHYWLIFGEKGTGKTSMLVHAM
                     RDIHGQGVVLLDAHDDIDVFRLRLGRALDFAYSEDYLGGWLSNREPRDGTALLDIERA
                     MNSLEKVAIRHRETHGRPLVLVINDIHHIQDDTENGRRLLTLLQQRAESWAAGELLTV
                     VFTSDEYRTSDLLRLHAARMNVLNVRDITVDLAVQSLKEYWLHAFWEEVPVETLERIY
                     SMVGGRLSFVDEIAKSRDILKTCESICERWFLKKCWILGKNMHEGAKEQQEYCLPGIP
                     LHKAQEMMTRADLPEKLNQMNIISIDDNDIVTASSVPMQSAFRAVCSEDGIKKKLKAT
                     TDRLNEIESLERTTEITMKDLVNDGQYEISKERGIRGEKNIRTSYRKPLSYSSWSW"
     exon            619917..619927
                     /number=1
     exon            619991..620004
                     /number=2
     exon            620084..620969
                     /number=3
     exon            620979..621054
                     /number=4
     exon            621183..621542
                     /number=5
     CDS             complement(join(622675..623141,623197..623517,
                     623574..623945,624007..624098,624187..624350,
                     624537..624629))
                     /codon_start=1
                     /locus_tag="AO090011000243"
                     /note="amino acid transporters"
                     /old_locus_tag="AO070335000247"
                     /protein_id="BAE64776.1"
                     /transl_table=1
                     /translation="MESEMSPKAKAEYNLGDAEADQGIGQIDHVKHYGIWSCQRRPAC
                     ANLWLYKSDNDPLLEYNWTNNSSVSFIGSLATAASLAELASMFPTAGGQYHFISKMAP
                     LRIVKGLSWVVGWITTFGWIAVAASAPFLSGTMIQGLLVLNYDSYAFQRWHGTLIYWA
                     ILVISAIVNIQGSRVLPVVENLSLGFHVVAFIIVFVVICVVSPTKHVPEFVFVDTINN
                     SGWGNNGIAWCVGMLSSCYVLVGYDAAIHLCEEMKDPRTDIPLAMVGAVLINGTMGFG
                     FLVAILFCMGDLKSALDTTTGYPIIEIFYNITGNSRSATALCSTIVIMAGLASIPLLT
                     SASRMVWVLARDKALPATTWLSKMDERRQIPTIAVAVTSFLLGLLGLINIGSTSAFNA
                     IVSLAVFGLEISYLIPLCFLLYQRTVFPESITPGPWSMGRYGIGVNVLSICFLVFTCI
                     FLLFPPYQPLTAENMNYACLVFGSVCIFSGVYWLFKGRSVYEGPVLPDFENL"
     exon            complement(622675..623141)
                     /number=1
     exon            complement(623197..623517)
                     /number=2
     exon            complement(623574..623945)
                     /number=3
     exon            complement(624007..624098)
                     /number=4
     exon            complement(624187..624350)
                     /number=5
     exon            complement(624537..624629)
                     /number=6
     CDS             join(624895..625231,625288..625541,625573..625629)
                     /codon_start=1
                     /locus_tag="AO090011000244"
                     /note="phenylpropionate dioxygenase and related
                     ring-hydroxylating dioxygenases, large terminal subunit"
                     /old_locus_tag="AO070335000248"
                     /protein_id="BAE64777.1"
                     /transl_table=1
                     /translation="MFQILSSFNKSDQSQEKGPEARALPASWYHSSPLYELERRAIFS
                     KRWLLVTHRSRLTKPGDFIRYEEAGFPIFLCLDRQGNLRGFHNVCRHRAFPVVISDSG
                     SANILACKYHGWSYGLNGKLAKAPRFDGVSGFDKEDNGLFSIHVHVDQRGLVWVNLDA
                     KETPTTPWNEDFLGADTQGRLQDFNMTEYKFDHAWDMTIITRYGTQTTLWSVLDD"
     exon            624895..625231
                     /number=1
     exon            625288..625541
                     /number=2
     exon            625573..625629
                     /number=3
     CDS             complement(join(626487..626742,626902..627413))
                     /codon_start=1
                     /locus_tag="AO090011000246"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000250"
                     /protein_id="BAE64778.1"
                     /transl_table=1
                     /translation="MAYWEAMVAIVTTQSPRSLEYLIPFCKQENHDTLVYPNPWTGAS
                     TTIFIYAAEVSTLCRQNRLTKHLSTSLASTEVCENIFHEQLTKAGELEAKVLQYSPPV
                     SGCIKDPDDRFTPVSHLQCLAQIYRFSVLVQLYLTFPDLLQKSNTTMSTLDTDLSNET
                     SQRSLNEIIVGIEKAILSVHSSDFMILHWRSLVRQKLKVLHEFVRLDPVPRALQILEA
                     VWLRADLCVSNRTNTSTQVFIHWLDVMNEERLESIFG"
     exon            complement(626487..626742)
                     /number=1
     exon            complement(626902..627413)
                     /number=2
     CDS             join(630109..630880,630941..631016,631077..631647)
                     /codon_start=1
                     /locus_tag="AO090011000247"
                     /note="predicted protein"
                     /old_locus_tag="AO080523000234"
                     /protein_id="BAE64779.1"
                     /transl_table=1
                     /translation="MAPPSNEGFLWTPHGSTSGLETDAVQESSPVIHDSYDVVVIGAG
                     FTGLIAARELSQRHDLKVLLLEARDRIGGRTWTARALGEELEMGGTWVHWAQPHLYSE
                     LRRYGLHINLKTSAGTAAPTKQMFKQGKATPCEISIEETGDILERIAQSFFTIDGSSS
                     RELMPYPHDPFKRPALWMKYDHLSVQDRLDSLRGFSSWEKDLFESNTSTFGSAPGKDI
                     AFTEALRWYALGGHNMKGVFELAGVYKIGNGGMTSFARAAKLGVRVTTRLGQEINAKY
                     VVSTIPLNCLADVKFYPPISSSRQSAMTKGHINKGAKIHFKLKAAEPGWFVTANSSDS
                     AYVFAFSDHNGTRESEPSGTWCIGFGYNGRLDDKNNHRHIIDHFRKDIYPTGDVEAYV
                     THDWVNDPYAKGAWACWGPGCATAYLQELQKPHGRVIFASADWADGWRGFVDGAIEQG
                     HQASQCVVASLKSETETLRSRL"
     exon            630109..630880
                     /number=1
     exon            630941..631016
                     /number=2
     exon            631077..631647
                     /number=3
     CDS             complement(join(637506..638250,638278..638552))
                     /codon_start=1
                     /locus_tag="AO090011000248"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000252"
                     /protein_id="BAE64780.1"
                     /transl_table=1
                     /translation="MEQHQNPKDSMKSTWRRWDRSQWTLSHKLLEQANVYHVDLDREV
                     PVHSKEEKLPYVSDLSLHRWIIFHAAIPLILHQLYVYLTGHNFGPIIAIFTSRELRKL
                     REMGRTYGFLDGDKHERDGVPDVGVSKVLISVMLASLVRPMMMVYLTYTANKAPASLS
                     WRWLPLEVSLYGIVLDFWFYWYHRIMHDVNGLWKFHRTHHLTKHPNPLLTIYADSEQE
                     FFDIAGIPLITYLTMKFMGFPVGFYEWHICQLYVLFAELAGHSGLRLHASPPNPLTWL
                     MRIFDAELVIEDHDLHHRKGWRKSHNYGKQTRVWDRVFGTCCDRIEGVDTNVDYNNTV
                     QMSIF"
     exon            complement(637506..638250)
                     /number=1
     exon            complement(638278..638552)
                     /number=2
     CDS             join(639926..640075,640195..640240,640374..641614,
                     641764..641844)
                     /codon_start=1
                     /locus_tag="AO090011000249"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000253"
                     /protein_id="BAE64781.1"
                     /transl_table=1
                     /translation="MAVVRFPALGFHAFNSILSAYQTPVALITTACSAPAGESGPIET
                     TTGSAGSPVPLPELCEVSVPFVINRGTSTISSVSQAPTSDTLTSLSPSVEPTCYTSSQ
                     WLVISGTTLFWPTSTDYLYGPTDSPGVDCAAQWIQYDGRSGGLESLGPTATSTLTELI
                     PTSTGACTTSSHLESYYDTHTGPVTTLCDGHARALGPRETVTDYYPGTGACSTFYIPT
                     TITTTLYNVPSASPTCQLDREGCKGVWETYKSRSRAYKSSISVSIPGDTNSPLIPGRC
                     PMTTSERPEQCGSCHFLPDTATLFYWPVTTAGSDLCAQNGTTIPATPTGNGPNTAMLG
                     DQTLVSPSAYIFFTSIYAWGNSRHAGQCGEYHENKMISVNPTTITSRRGHRNARYPIR
                     GTAYPFNFAEFLPQTVGNYTQPLIPWPQYWGGSQCGVYDSACTLIRDDYLPFIDMPSE
                     VTQIDAKWENCDCSWYIPAVTLVPIVDGTWWCSRLRRPLAPVHRYFSWRKTFLVT"
     exon            639926..640075
                     /number=1
     exon            640195..640240
                     /number=2
     exon            640374..641614
                     /number=3
     exon            641764..641844
                     /number=4
     CDS             join(646604..647015,647085..647246,647367..647413)
                     /codon_start=1
                     /locus_tag="AO090011000252"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000256"
                     /protein_id="BAE64782.1"
                     /transl_table=1
                     /translation="MSGVELLGVLSAVITVLDATTTLYQRARKDIRLSETFEVAARRL
                     PVLLHILQTFKSTLEPLKDSLSSDVCEALEETLNSCEEKARRLSEIFTKVLSGPTDSV
                     SWRQRYSKIVHRLGQRNKVDLLMIAITQDVQLLVNYHCDTTLLEDGFSLSFHSSGAQN
                     NNVNSGNGQLNTGNGQQINTHARVETQTFNFVIQSPTSYFASWSMG"
     exon            646604..647015
                     /number=1
     exon            647085..647246
                     /number=2
     exon            647367..647413
                     /number=3
     CDS             join(647525..648003,648061..648086,648162..650057,
                     650097..650248)
                     /codon_start=1
                     /locus_tag="AO090011000253"
                     /note="TPR repeat"
                     /old_locus_tag="AO070335000257"
                     /protein_id="BAE64783.1"
                     /transl_table=1
                     /translation="MSPGLFVGRDAELRTIRKDLHPSSQGGQRKQQQQQRLAIGGIGG
                     VGKTQIALTYAQTPHASYETVLWFNAATEISLKNSFATAAGLIFGSKVSQSLEGNEAV
                     RRTREWLSDPENSKWLLIFDNYDNPSDFKLDSYYPPAAHGAIIITTRQADQVTGRTAL
                     SERDNLLSVQLAERLAGLPLALATAGAYLRKSPFTFQRYLQEYENRWNIDPRRPVKLQ
                     EYQERTLYTTWEISYNRLMKDDTEAAAMLRILAYFDNQSLWYELFRAGLKDGCPLYEV
                     INNDISFNGAMTVLAEYSFLEFHPGLKEWSMHKCVHDWVSASLRKAVGRQGYWYAFGC
                     VSGSIEVSDEESLAYPLYSRYVPHAKHLSQSRFLTSDIIEMITPERLRAVRGISSLLL
                     YQTQYDSAVRLLKLFLQSQAAHDPDDDVTLSIMNDLGYLYFAQKRYSEAKELLGTALT
                     RKEKILEANDLSLVGTRINLGHVYTFQGDYQAAKEMYLQALFGKDVAADGHILATLLL
                     ARVKSRLHSNSKHNDFACLYWRLEIAHNEKSLIHSGLVTDLLDVSDNLCHLLGLTGKK
                     NEAELMLKEVILIRETLQGPAHSSTLVSVSILGFLYKDQGKFDDAEKLYERVFTEREK
                     LYGPNHYSTIKVLQDLGHLHLKQNHFQDAEDSYTRALNGLKRTLGPHDERTIQVMLDL
                     AFLYENHGKSVAAEQMYTQALTMREALLGSSDPLTLDIAARLGQLYLTMRRLDDAENM
                     LLRVLGYPSSPQAVGLEVIKRSDAALNLSSLYMLTKRLHDAERLLLRMSTVIAQTPDP
                     DNFWLRNGQLDKAEKEFITIREGCKEVWGSEHPLTAVVSESLAKVYEQKQFQ"
     exon            647525..648003
                     /number=1
     exon            648061..648086
                     /number=2
     exon            648162..650057
                     /number=3
     exon            650097..650248
                     /number=4
     CDS             complement(join(652194..652372,652433..652595,
                     652651..653359,653409..653662))
                     /codon_start=1
                     /locus_tag="AO090011000255"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000259"
                     /protein_id="BAE64784.1"
                     /transl_table=1
                     /translation="MVMQCPVYPVRQSIFAPPPSPARKSSQPGILLDPNDKLEEEQLP
                     GYSPEDFYPVKIGDVFQSRYQVAGKLAFGGHSTVWLCRDLEQHAYVTLKVYERDPSHA
                     RREKDVYKHLRNVESSHTGSMLVRRAMDDFQISSAGYAHSYQCFVHPPLAMSLCELRT
                     RTIDGVLPEDLLKSTLIHLLLALDFLHTEAKIVHTSMIFLILIVKPRTLLEFPIDPIS
                     DIQEDNVLLSVEDESILVDFEEAESSSPGPRKVVGDRVIYSSRDLGMPKVHGRPILSD
                     FSEARFSSSLGKQWEDVQPFVYRAPEVILRMPWNEKIDIWNIGALAWDLFEKKRLFYV
                     RDSYRNVSDSHHLAGMIAIMGAPPKEMLRNSDYAMKFFDSDGNWIGTAEIPSISMEKL
                     EDNLRDTEQSLFLCFMRKMLQWQPEGRASAKELLADPWLKST"
     exon            complement(652194..652372)
                     /number=1
     exon            complement(652433..652595)
                     /number=2
     exon            complement(652651..653359)
                     /number=3
     exon            complement(653409..653662)
                     /number=4
     CDS             join(657080..657482,657531..657578,657635..658558,
                     658623..658690)
                     /codon_start=1
                     /locus_tag="AO090011000256"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000260"
                     /protein_id="BAE64785.1"
                     /transl_table=1
                     /translation="MVTQNTVIEHDPGDVTAFYEMVCFTYSLNPVRGDRIKPRSSAER
                     DGIGVAKCRRDFADAIAYFCARSCDPDNVTAVAVGRKDTKVVIWVASNANVSREVLEF
                     LDNDVLNMVQRLAKMKQGQLPSEENRTVTRLLTTITAWKAIGEFSKSEDKITTDPSMF
                     YDWFKREFYKSGDVLKECDMPRLAISCFFAHTDGTFGILEHRSSQGNEKGPDYERLYK
                     LLSKLGKHVRLFERMIHAIEALRRDFCEGFVVEPIAASIPKPNPLPKLHEQSMGKIVA
                     RVFQEEDERHQFYHHLNQFFNKEYISQSLQRCKKRRARVHAEILLIDFFDKFDANFLD
                     NDDKYIACSKPACYLCYEYICQHPDKYTLPPTHQKLYYAWSLPIVRVNDRNCIEKFAR
                     HKRFLNHVTETLQSDLRKEVQRQLAPRKNHADSTAGASSVFNTGRVRPTSKIYEHHIR
                     ALTQLLSEAKISAKFDAGLEDEDGGVVLNC"
     exon            657080..657482
                     /number=1
     exon            657531..657578
                     /number=2
     exon            657635..658558
                     /number=3
     exon            658623..658690
                     /number=4
     CDS             complement(661912..662367)
                     /codon_start=1
                     /locus_tag="AO090011000257"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000261"
                     /protein_id="BAE64786.1"
                     /transl_table=1
                     /translation="MALERSLPAEFAHIVLFYPITDTHKKLESYEIFKDGPFLKADTL
                     NWMIDAFIPEEKDRQTAQASPLSFLSDDVLPRFPPTSLILSAVDPLLDEGLAFSRRLQ
                     KAGVDAAVIRAEGQMHAFVLLKAIRDSPTARAIMDLTTLRLRTALASPP"
     exon            complement(661912..662367)
                     /number=1
     CDS             join(663232..663504,663563..663775)
                     /codon_start=1
                     /locus_tag="AO090011000258"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000262"
                     /protein_id="BAE64787.1"
                     /transl_table=1
                     /translation="MTTTPTLDNVLAKPADLCCLKGAIHSGEPTGSITQIEGIDTYIA
                     RTHPERSNGNVILFFPDAFGLHINSFLMMDAFAECGYLTLGVDYFLGDSVTKYCARPL
                     SDPKFDFEGWKTRHLRASEEVAAKWVNGVKAQYGATDDVKFACVGYWGVLHAAQLGAK
                     D"
     exon            663232..663504
                     /number=1
     exon            663563..663775
                     /number=2
     CDS             666138..667859
                     /codon_start=1
                     /locus_tag="AO090011000261"
                     /note="predicted acyl-CoA transferases/carnitine
                     dehydratase"
                     /old_locus_tag="AO070335000265"
                     /protein_id="BAE64788.1"
                     /transl_table=1
                     /translation="MACNSLNHDPQDSYGPGTVVDTDFLPLPAECRRLLRIFAARTPG
                     FTKDNTLLDGVVFHGDDLPCIPGPIKSQAVTAVLHAMVGIVGLEILHLRGISTSTVTL
                     VDINHAGLYPATAALVNIDGHTGPSVINLPTVPQWDKDRASNSPLVYRATAIYETADK
                     GVWFQLHGSLDSWKTLALLGIGKDLDAEIRTNDTAYALIQDRVRKYRAREIEQLMVAK
                     GFSGSIVFSPEGWLQTEMGRSLARHPLINYRQQTQCPILEPPLFSKVDDKRPLAGIKV
                     VELVRIIAGTAAGAALASMGAEVIRVNSSKLKDYTPAQPSSLMAGKIAIDLDLEDPAD
                     HKRLTRLFEQADVILQGYRLRSLERRGFGLQAALEMANKRGKGIIYVDENCYGPDGYY
                     AERPGWQQVADAAAGSSYVMGQSFGCPPGQGVLPSLPISDMSTGILMALTVMCAIRDR
                     AKFGGSYHGHASLTAYNMATLDPDVRLYQRQVVQMINDKYRFPVWSSDAHVAPLYYSI
                     LDAWDKNSDLIQDEKYYVHFSDSEFGTDLRVLAPVVKYAKQECSPRWDSPPVSFCHHQ
                     FRDFSEI"
     exon            666138..667859
                     /number=1
     CDS             complement(join(668500..669114,669191..669521,
                     669578..669858))
                     /codon_start=1
                     /locus_tag="AO090011000262"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000266"
                     /protein_id="BAE64789.1"
                     /transl_table=1
                     /translation="MRTMDLIEPGFRPLYERVCVGNKGENAQSIFFEGMLLEEGFGTS
                     LSCLGERFFMLMLIPYLRSWSAMAWQVRMGPPRLRSQICQYARRLWETRTFIPIENVQ
                     FNKRLTHIEQGPAGVTLTFSDGTTAEAAILAGADGIKSTVRKHVLKDAYPGQVAPVYA
                     GAYCYRAVIPMSEAYEILGDLTDVAKFYFGHKRSAVTYRISGGDELNFLLCVADSKNA
                     WKPKDAITERITHEAMMADFEDPAIDDSFRQLLRKAKPVKWGFFHHLHTATYFRDRVV
                     LVGDSAHASLPFQAAGAAQGLEDALVLSNVLAELAKLREGGVNQALAIHAGLTAYDSV
                     RLPRAQKQLEQAAEVGRMIFFQHEEAGADMEEILSRLQQGRFNWLWSHDMNDDVQEVL
                     RRMQKQIRTRSHEAMI"
     exon            complement(668500..669114)
                     /number=1
     exon            complement(669191..669521)
                     /number=2
     exon            complement(669578..669858)
                     /number=3
     CDS             complement(join(673412..674469,674557..674573,
                     674620..674705,674765..674802,674847..674885,
                     674946..675179,675261..675464,675519..677191,
                     677267..677397))
                     /codon_start=1
                     /locus_tag="AO090011000264"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000268"
                     /protein_id="BAE64790.1"
                     /transl_table=1
                     /translation="MPEQASKKPPSEHGRESALDPAPPASKRRRIGLACNACRVRKSR
                     CDGHRPSCSSCTSLGLECLYEPSESATNVIVRKGYVSDLEQRVTSLEHKLQRLNDAFR
                     GHLSPCPNNRPCHSTSSTPALVAATCAKETHATGLEEPQDEDASTNGMAMTFVEEQSS
                     AFFGESSNINFTQLLLRGIAAVHQPSPAVASAVDKDYALRESITAIVSQGQPYHPVAA
                     PSTHLDSSPTTLPSVEEMDSLLDIYFDTAGAVFPFIHEDTMRKTYTECRLNGFTRARR
                     TWLGTLNMMFAMASSFDRDHVPSAKKRFERSNIFYKRAQELCSDLSRRVISLEMVHYL
                     LLVVIHCQGTQRSVQAWNNHGLVIRSAIALGLHSDSNGQAVDPVNEEYHRRTWAVIYC
                     LDKVLSVAFGRPASIPDELMTGREPASGLSTTASSGPHGNVDLPGEFLAVSFRLYQVM
                     AKSLINQYGANLEKANSNLDDIASLKASGELRKMLQDWATSLPSYLSPCEPESGILSQ
                     NTPANRFRVILTLRYYNLAILIHKPLLRATIRHLFRVDNAASGSPSYLIQLAMAEAHE
                     CVRAAQLTIAIVHCIISADAKSKNNLGAWSFTLYYVFTASLVICGRLLWAQHGETVAD
                     EAAVKDSKTLLSKAEAIFQDLDYENSLVLSCLEYIRRLARMCGVKGAAPNPSESRTGT
                     GSALDPVVFSSESTFDPASVFHNRDDMEAFQLFSSEMFDPCIFEGFQQSPVEGAALGN
                     GFWDGSPPIESTLAAGGAALEINRNSLQFSLKIPQQIVHWQSRKDSESSKFPVRAYLP
                     AAPTLRKIFHYPVMSSNSAPNELTQLPLDEDARPRYSDAELRDYFECIKLPQKYLDSI
                     VLKDKTQTGTKEYGLPLLQALTRYHTCHVPFDNLVLHYSPHKTVTLDQAELYTKIVRR
                     RLGGRCMENNTFFGTVLRSLGYEVRNCGGRVARAMSPYPDVRHNQSATYDGWNHMLNL
                     VRLDDEWYVVDVGMGSMGPNLPYPLRDGFETTSIPPRWIRLQLRSIPESYASRSANST
                     GPPKMWCYDVCYKPGDDGKKTWLPVYCFTETEFLPQDYEVMSWFTSTNPRSFFTRYIT
                     CTKMLMDEDKEMIVGNVTLFKDTVRKSIGANREVIKECKTEDERLQALAEIFNVYLTE
                     EEKRGISEDQMLA"
     exon            complement(673412..674469)
                     /number=1
     exon            complement(674557..674573)
                     /number=2
     exon            complement(674620..674705)
                     /number=3
     exon            complement(674765..674802)
                     /number=4
     exon            complement(674847..674885)
                     /number=5
     exon            complement(674946..675179)
                     /number=6
     exon            complement(675261..675464)
                     /number=7
     exon            complement(675519..677191)
                     /number=8
     exon            complement(677267..677397)
                     /number=9
     CDS             complement(679029..679589)
                     /codon_start=1
                     /locus_tag="AO090011000265"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000269"
                     /protein_id="BAE64791.1"
                     /transl_table=1
                     /translation="MESWTSASEEFEDQAWWACLNNAELYNFGSDWQRVYEILPEIAG
                     PSAGGLVSLETLSFIRSGFKKWLSEAKQIEPELWRKDPHRFIELKASRLLGAVTTRYM
                     LLADQEAFETDGRLRLIYLDNKRNIVRETRVDADGQTITDIIMAWFELTDPLELEDGI
                     TGDRYRVTGDLGRELYELTDSDFADP"
     exon            complement(679029..679589)
                     /number=1
     CDS             complement(join(683073..683697,683909..683946))
                     /codon_start=1
                     /locus_tag="AO090011000266"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000270"
                     /protein_id="BAE64792.1"
                     /transl_table=1
                     /translation="MAPSHLLCTFSPSRLTLFLSPPIFLLSSYLVICLSFAFRVYTFN
                     SNTLVQIKTHLNNNTSTFIMSTTTTSVAASATASCNSVTYWQLPVDDAACALPKTGNY
                     SDVMDKCCSPAKVTDFDNGCGLYCLAQGQSVGDLKDCLRKNGAQDGREFYCKGNDTAT
                     ATASAPSSTKTGDKTGTATGSGASSTSSDSAAYAIQPAVSKGGLGLLAMVFCSALMGV
                     VA"
     exon            complement(683073..683697)
                     /number=1
     exon            complement(683909..683946)
                     /number=2
     CDS             complement(join(684545..685587,686537..686570,
                     687465..687575))
                     /codon_start=1
                     /locus_tag="AO090011000267"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000271"
                     /protein_id="BAE64793.1"
                     /transl_table=1
                     /translation="MVFPFPGTSIQTWGTESISRVLPISSCKEFISWISKSHQNRARV
                     FSFLKAFTVCREAPMVPRSSPLTVIVTTSPTPSIPSTDLISSVLQSFHRHCRDLVSAR
                     VIVVFDTFDRIGLRSRLKKGQVTPEVAANYGIYKENVKELILREYASPDASPNHVTQE
                     WQDRAEFGLNDLSNVVDLSITQTDDKQVTFIEPAARLGFGLAVRSALRVCETPYVWVQ
                     QHDWALVADIPLTPLLEVMERSDADPAVPVKYVSFPSVRMLSYATQPCVVEFPALRAL
                     TGDLTRDFVPPSHPEVTVPLTPLYFWFDKPHIASTEHYLSRVFPNRLTMRRGEFIEDK
                     VGQQARQQMKEGQWHKWACWLYYPEEGKQLCLRHLQGRTWNGAEGELLTKYGFSEVDT
                     DST"
     exon            complement(684545..685587)
                     /number=1
     exon            complement(686537..686570)
                     /number=2
     exon            complement(687465..687575)
                     /number=3
     CDS             complement(join(688005..688335,688424..688753,
                     688855..689564,689641..689736,689821..689986,
                     690040..690254))
                     /codon_start=1
                     /locus_tag="AO090011000268"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070335000272"
                     /protein_id="BAE64794.1"
                     /transl_table=1
                     /translation="MEQEAISQSQPHRPTDTSSSNKETDDRITEVLPQKHDVETGSTA
                     DSAQAGVQRAAILQKTWSKKGMIITFMGLFLYTLATHFGDYSSQVYIPYTTSSFKNHS
                     SMSAARVASNIASITAYPIIAKLGDVFGRGEMFTFSILITTLCYVIYAACTNISQYAI
                     AAVFHSIGSTGFGLTQQVFIADVTNLVNRGLWSTLPDSISTIPTLYLGTTIGQSVLDH
                     STWRWGWGMWAIVLPVCGLPLLGSVFFHQHQAIKNGLGKKRLAAQLGLNASQPWWKQA
                     YELLWVQLDLPGALLLLAGLALTLIPISLTGANRSDRWQSATFIALLVVGIVLLVLFA
                     LWDIFVAKKPFIPYRMVRSKTVAAACLLGALDFLHYSMFTVFYSSYLQVVGGYSPGHA
                     TRIDNALRVSFQASGIFAGLFMKYTKRSQIWVLIGAPLCVLGMGILLYLIDMGDGKMG
                     NEASFVTAKALIGIGRGFYQTASQVSAQAVVTKQEISVVTAVFFASMGVGGAIGTSIS
                     GAIWRNNLPTKLRQYLPEELKPQAMAIFQSIVTAKKYAKGTPAREAIDRSYRETQRLL
                     AIGGLCAVSPMLIVMFFLKNVHLDKRDNVVGDAEERLDKVEGESGKQVS"
     exon            complement(688005..688335)
                     /number=1
     exon            complement(688424..688753)
                     /number=2
     exon            complement(688855..689564)
                     /number=3
     exon            complement(689641..689736)
                     /number=4
     exon            complement(689821..689986)
                     /number=5
     exon            complement(690040..690254)
                     /number=6
     CDS             join(691008..691138,691201..691456,691479..691571)
                     /codon_start=1
                     /locus_tag="AO090011000269"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000273"
                     /protein_id="BAE64795.1"
                     /transl_table=1
                     /translation="MFAHAPNTIQLELKSSDGDAYLIQVAWPLAWDDPKAPGHSASIL
                     YVLDGNALFFTTTEAARRSAMLPTSDNAVVVGIGYPMEDRPYSPRRHYDYTPPCDKYE
                     APCGIDGQQQALPHGGANQLLDFLVSTTFSLVYASIRRSLSVILWAGFAHYMHFSST"
     exon            691008..691138
                     /number=1
     exon            691201..691456
                     /number=2
     exon            691479..691571
                     /number=3
     CDS             complement(692402..692995)
                     /codon_start=1
                     /locus_tag="AO090011000270"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000274"
                     /protein_id="BAE64796.1"
                     /transl_table=1
                     /translation="MRFNTIVALSALSTMAHAWGFNCADSQPTPDDIQAISAGQELLM
                     ADDTPSAAELMADTLSGDGENCQDNLGKCHNSLNNVTNQLDTCKKSISDINFLRKTYE
                     EVAWKALRSMPYFNLNQRYYTVDGATYVVYVGVSLSTYGRPVHAPDLQTCVRICNKKS
                     GCRAAHFRPYSKQCDTWTLVAPRPGFDMDGIAAVRAW"
     exon            complement(692402..692995)
                     /number=1
     CDS             694699..696720
                     /codon_start=1
                     /locus_tag="AO090011000271"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000275"
                     /protein_id="BAE64797.1"
                     /transl_table=1
                     /translation="MRLTHPIWLIALIGGRQVCLGAPHESGCGLDHLDWLALHNDAHV
                     AIDAQIPDLNGEAVVEDREVDDFWFGKDEEIWNAKDNYQYNSGQVLLQSPLEENVPLD
                     EVASDSISFDCKTKEQVIYNGQSQMVFTEVRNKAPQKVDKLIIETPDLRPWNLSITKF
                     WGSCPGTKPGATRIRCEYIDVHPGSVRIAQIKVQLGEYEGSAIEFPMKMTSYVNGHLK
                     DDKEVKVHWDKREPLVYKQTDPSKFPQPRTFKVSPLVSPPDEALRLRQQFHWSDLQST
                     GFYLNPNEPLTVFVESSVRDGPKPRLVLGPPALVHPDHGKEHVPAQLVELPPLENGRN
                     KSVHNFGGIIYIRYTHRASDQPPPPVFLRLGDTAEPFPLFREGSTTDAQWKSMLDVTK
                     VPFAEHDGKRVIITGLAKHAKKYADNGQRQQELLDTYAHIIAIQDRFSALKYNARDPR
                     DRPSLLRPMVVESVNSGVATATNYRAAIPNRLSDQIYWVPRLRNSWMVFHELGHQRQI
                     TRTWSWRAMTEVTVNIYSLANLREYKPPGHKNVAEWDNAKQYLTKASKEKDFDSAGFY
                     LSLVMFEQLRVVFGDGFYHELHRDARHTLVVDKDADKKHHFMTKAAQLTGQDLTEYFT
                     KWGLKPEDRTINEMKKQPKPKRDYTKTPVYGGHQMYRMLERSRRIEEAL"
     exon            694699..696720
                     /number=1
     CDS             698876..700591
                     /codon_start=1
                     /locus_tag="AO090011000272"
                     /note="thiamine pyrophosphate-requiring enzyme"
                     /old_locus_tag="AO070335000276"
                     /protein_id="BAE64798.1"
                     /transl_table=1
                     /translation="MSETIHLTEYLFRRLREAGLQAVHGVPGDYNLLMMDYIVPAGLE
                     WVGNCNELNAGYAADGYARVKGIGALVTTFGVGELSAINAIAGSYAEMAPVIHIVGTP
                     KRAMQTRGAKLHHSVCSGKPSDFTMFAEMYSKITVAQENLWDASTAPAQIDRLIRECI
                     IQSRPVYLQVPADMVTEPVPAAALSRPLDLTPPSNDPESEQEVCDIIVERISNGKQPF
                     ILIDAGTSRYGLVSEADELVRITGFPTATTPFGKGIPDETLPNFHGIYASVGEGAYLP
                     YVESSDLIINIGPVHSNVNTSCFTTIPNPRVSIVFDQTSITIDGEVYNVFPKGVLKRV
                     LDHLRDAMLSFWPYPNLPDPRSTLKHISRATSAGALTQDIFFKRMSYFFRPGDIILTE
                     TGTASNGGRDFVFPQNVSLINSGVWLSIGYMLGAAQGVALAQRNMGSQGRTILFIGDG
                     SFQVTAQELSTIIRKKLSAIIFVINNDGYTIERLIHGMDADYNDIAMWRYLDSPSYFG
                     APSDDSYPVFTARVSTWGELDGVLSRESFQRGPGLRMVELMMGVSDCMETLRHFLKMY
                     AARKE"
     exon            698876..700591
                     /number=1
     CDS             complement(703716..704120)
                     /codon_start=1
                     /locus_tag="AO090011000274"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000278"
                     /protein_id="BAE64799.1"
                     /transl_table=1
                     /translation="MGKDGDLILITKFGYRIIGTLVLRVVDTVSELDEHIFVPEERLR
                     IGVLGNGIKIGVIRAWAVQLQYRGVGVGRSLLEAAVEVSRKTGWRGPVFSVGHATSKW
                     FGLGVGSMGMERYEWAWELLEDVRGEFGIVGG"
     exon            complement(703716..704120)
                     /number=1
     CDS             complement(join(706505..706653,706705..707784,
                     707845..707971))
                     /codon_start=1
                     /locus_tag="AO090011000275"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000279"
                     /protein_id="BAE64800.1"
                     /transl_table=1
                     /translation="MSEKTEIGEGSDKVEVPPNAVSFFDPALRSVRRQVFMQWGRTVL
                     TLCVFILCILSLYWAVQFRVEQNLHSLTVWVVDFDGMVDPYRDTKPIVGPAVTDVAEN
                     LIQTPETGRLGYTIKSPDEFNYDPWAVRQGVYDEHAYAAIIVNANATTLLHDAVKNGN
                     SSYDPTGAAQFVVITARDETTYSSYITPGLTAFASTVLAEFGPRWVQTVAQESLNISN
                     VPQAINPAIGFNTVDLRPFGPAAATPSVTIGLIYLIIIAFFNSPFLMPIHAQFLKGNH
                     PPLKIPQWLLWRVCSNITAYFFLSLFYSFVSLAFQIPFSNSPAPDTVSASNPNAYGHG
                     SFVVFWMLNWVGMSALGFPLENMAMVLGFPWSSLFLIFWVISNVATGFYALDLAPGFF
                     RWGYAWPLHRIVEALRTILFGTHSRIGLDFGVLFAWIGVSILFFPFASFIMRWKMKRG
                     L"
     exon            complement(706505..706653)
                     /number=1
     exon            complement(706705..707784)
                     /number=2
     exon            complement(707845..707971)
                     /number=3
     CDS             join(717721..718590,718687..719236,719294..719304)
                     /codon_start=1
                     /locus_tag="AO090011000280"
                     /note="DNA-binding centromere protein B (CENP-B)"
                     /old_locus_tag="AO070335000284"
                     /protein_id="BAE64801.1"
                     /transl_table=1
                     /translation="MQRRPISNSQKLALRSQHALKPYLTQLQLCQWFEAEYQQPIAES
                     SVSRILSSRYDSLDGASSHQLRAKRRRAESWPELERALYEWIRRVQDQESLSQHLILQ
                     KARTFWERLYPGQAMPQFSNGWMRGFQSHWDINKSNLQGKSASHSDDGTVEMIGIRQL
                     LNQYAPRDIFACDETALLWKRIPESGLAAAGHTPTGTNGNDRLTTCFCCNSDASERLP
                     LWFVGTAKRPQAFSAAGINIENLGCHWRFNTRAWMTSTIFTEWLLWFDQRMTGRKVVL
                     LMDGLSAHKFAFEEKSYWKCKWASYLVHEHDRGWDPISTMTILHAIRWAISIWEIDLA
                     DDIFTHAFRATMSIESIERIDNRQTIMDIENLLHQLYLSGYVSEPMDTSHFIDPVEEK
                     VDDSTLHLDDSILCHFENASELQESASTAIQPLSLVSVSDALEGLYKLRLYEEQQVIA
                     NMDLLQVLKHHEKLLLQKQTESQLLY"
     exon            717721..718590
                     /number=1
     exon            718687..719236
                     /number=2
     exon            719294..719304
                     /number=3
     CDS             join(723308..723336,723648..724248)
                     /codon_start=1
                     /locus_tag="AO090011000282"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000286"
                     /protein_id="BAE64802.1"
                     /transl_table=1
                     /translation="MLEDSREFARKTGQSPSYPASGPNKLRNLIILSSNFVTFHLLIP
                     LPIPPSLSHHLLKHSSVDIPTHDSLRERPYRLNPTERPQRHVQIRCNEQNRTQSTNAR
                     CTSNPVSSCSDTATTQNNRTPASQDDSGITRNRDPRARRTGIFELQARGTVLEDDSEG
                     AVVSVGAASIQGSRGSGHGVIIAETEVHVVGTVRGCKICASNDTESREY"
     exon            723308..723336
                     /number=1
     exon            723648..724248
                     /number=2
     CDS             complement(join(726114..726190,726568..727000))
                     /codon_start=1
                     /locus_tag="AO090011000283"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000287"
                     /protein_id="BAE64803.1"
                     /transl_table=1
                     /translation="MFGRDSKVLKTPSESHPMVEYKPLSDRPSIDIGFPLAQDSEADI
                     STENGVNDTYLTPDCSRRRRRCEGFARTPIKQTFLLLLAGIGLMNIGYQTYWFLRSLK
                     PISCNCGETVSEAIANGCRYDSFAAAWLPPACRNDELIDRFERIYVSMSPREPRSVFS
                     WWLPRSVFI"
     exon            complement(726114..726190)
                     /number=1
     exon            complement(726568..727000)
                     /number=2
     CDS             complement(join(727836..728185,728243..728309))
                     /codon_start=1
                     /locus_tag="AO090011000284"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000288"
                     /protein_id="BAE64804.1"
                     /transl_table=1
                     /translation="MQFKIFTVLLAIGLPLALASPIPTEEVEAIPYYPKRSGDAEAIP
                     YYPKRSEEAEAIPYYPKRSEDAEAIPYYPKRSEEAEAIPYYPKRSEDAEANPYYPKRS
                     EEAEAIPYYPKRSENAEAIPYYPKRSEDAEAIPFYP"
     exon            complement(727836..728185)
                     /number=1
     exon            complement(728243..728309)
                     /number=2
     CDS             join(729003..729312,729372..729859,730148..730165)
                     /codon_start=1
                     /locus_tag="AO090011000285"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000289"
                     /protein_id="BAE64805.1"
                     /transl_table=1
                     /translation="MSHCQLKETARTSIDGKGGFCKGDSERDSERGLLTDSLPAESGN
                     YWSCSGTESKRPHCLSLWIICLNILIFSASIVFLLSPLSSRACLSHLSDQDKWKATSY
                     YAPILERFDIPRVVLTTNGSLYDSEPPSIMRIPQGDEADAEWSRISSGVFPILISAEE
                     VRKLGKDPALAVRVPDEFGYGPDAYLAQTEVFHLLHCLDMLRKEISYEHYYYPEFGNN
                     PDAQHTAHITHCIDILAQYLKCQGSTDVILFNWVGGWDQPFPDFMNKHFIAKM"
     exon            729003..729312
                     /number=1
     exon            729372..729859
                     /number=2
     exon            730148..730165
                     /number=3
     CDS             complement(731977..733290)
                     /codon_start=1
                     /locus_tag="AO090011000286"
                     /note="1-aminocyclopropane-1-carboxylate synthase, and
                     related proteins"
                     /old_locus_tag="AO070335000290"
                     /protein_id="BAE64806.1"
                     /transl_table=1
                     /translation="MSLPETTHSTISQRAQSALVAGSKNLMWDVMNDLWCEKTNPNGY
                     VNVGVAENVLMHDHLLSFINRQLDLPAKLLTYNDGPTGSGRVKRAVSAFVNRHFRPFH
                     PVEPSHLFITNGVSSAIEHVSWAITEPGEAILLGRPYYGTFIPDISLRPGATVIPVSF
                     DDCDPFSLEAVQKYEQALLSFQETTGRKVKGLALCHPHNPLGRCYPRDVLLKLMELCQ
                     KYQMHFISDEIYALSVWKNTVDESPKPVDFESALSLDLTGIIDPQLVHVLWGVSKDFG
                     ANGLRLGVIISQANRDILAALRNVGLYSYVSGVSEYLVALLLEDVNFTDEYIRLNREK
                     LSENYSFVVQQLKSNGIEYSTGANAAFFIWMNLGKKYHELHPEVKDDEDVSETVMDLL
                     LQKKVFLASGSLFGSERGGWYRIVFSQPQEYLSEAVRRIMAALEA"
     exon            complement(731977..733290)
                     /number=1
     CDS             join(734676..734704,735068..735353)
                     /codon_start=1
                     /locus_tag="AO090011000287"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000291"
                     /protein_id="BAE64807.1"
                     /transl_table=1
                     /translation="MSCWFGTGKLTPKKTIRLILRSSAEMSSNLQNNTQANQEAALQN
                     LEGTDSKPKTIKPEDRAALNEALTDQATMMLLSTAGRSSQQERERKRADAEARSRANG
                     GL"
     exon            734676..734704
                     /number=1
     exon            735068..735353
                     /number=2
     CDS             735691..737115
                     /codon_start=1
                     /locus_tag="AO090011000288"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000292"
                     /protein_id="BAE64808.1"
                     /transl_table=1
                     /translation="MDFDDINLDTVDNLRQEWIKLASNSSAGICELANRYRQRDDCKL
                     CSMHCGSFNFSFRLNWDDEGEDWLIRFPLPGKSMFLDEKVRREAVLMKYIARETKIPV
                     PRVIAYRMGDENPTGLGPYIIMTWIDGKKMSDVLRQNDLPDKHDTLDPTINPETLKTL
                     YGEMAEILLQLWGLDFDKIGSISEDSMTGKPVVDGRPLTRELNELIRTSGLNDCTPRR
                     IYHTSVDYITSLLALQSMHLEQQRNSVYDSKDCREKYACRQLMKATALNFIPKEDCGP
                     FKLFCDDLCPGNVLVDDSLRIVGVLDWEFSYAAPSQFAASIPWWLLLRRPHSLLNQYG
                     PDAFFESFLPKATLFLEVLEEREQIRGLTGHDCRLSVRMRQSIEDKSAWFTLASHMVA
                     SVDLLYWDLLDEYCWGPRSSIAQRVRAITTSPEMHKRREDFVHLKIQQLQEYYNELGV
                     DNNVSYEPEPPLQPIAERDPGPKV"
     exon            735691..737115
                     /number=1
     CDS             complement(join(739314..740208,740264..740298,
                     740355..740561))
                     /codon_start=1
                     /locus_tag="AO090011000289"
                     /note="SAM-dependent methyltransferases"
                     /old_locus_tag="AO070335000293"
                     /protein_id="BAE64809.1"
                     /transl_table=1
                     /translation="MAPATLEQENHTRDAEFNRVLHGKSSQAQGGFAAMLGGKDAAAQ
                     KAAVDEYFKHWDNKDAAEETEEIRAARRAEYATLTRHYYNLATDLYEYGWGTSFHFCR
                     FAQGEPFYQAIARHEHYLAHTMGIKSGMKVLDVGCGVGGPAREICKFTDANIVGFNNN
                     DYQIQRATRYAEREGLSDKLSFVKGDFMQMSFPDNSFDAVYAIEATCHAPELEGVYKE
                     IFRVLKPGGVFGVYEWLMTDEYDNDNAEHRKIRLGIEQGDGISNMVKVSEGLQAFKNA
                     GFEVLHNEDLADRPDAIPWYYPLAGSFKHMTSPWDFFTIARMTWWGRGIAHRFVGALE
                     TIGLAPKGTQKTADSLALAGDCLVAGGEKKLFTPMYLMVGRKPE"
     exon            complement(739314..740208)
                     /number=1
     exon            complement(740264..740298)
                     /number=2
     exon            complement(740355..740561)
                     /number=3
     CDS             join(741455..741490,741560..742573)
                     /codon_start=1
                     /locus_tag="AO090011000290"
                     /note="predicted RNA-binding protein (RRM superfamily)"
                     /old_locus_tag="AO070335000294"
                     /protein_id="BAE64810.1"
                     /transl_table=1
                     /translation="MLKEDYGAECKICTRPFTIFRWKADRTARTKRTAICLTCARLKN
                     CCQCCMLDLSFGLPIVVRDAALKMVAPGPESTINREYYAQEHEKEIEEGRGAVEAYEK
                     TDEKARELLRRLANSEPYYRKPRQIEAPQDEESEKPSTDAPVVHSRYGNGPGPIRTTE
                     SRRGTPLPGRGRGNMRGGRGGRPFPGTAQLPPSQEDILPPADPNVTSLFVTGVEDDLP
                     EHTLRTFFSQFGQLRSLVCSHRAHSAFINFATREGAEAAAKHCQGKAVIQGCPLRIRW
                     GKPKPLDNMDREERMKYAREGRSSATTARASGSGNKAITAAGADLGKQEKPRSYAVAP
                     PPGSGEVQYTSLSGD"
     exon            741455..741490
                     /number=1
     exon            741560..742573
                     /number=2
     CDS             complement(join(742811..742905,742984..743160,
                     743217..743289))
                     /codon_start=1
                     /locus_tag="AO090011000291"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000295"
                     /protein_id="BAE64811.1"
                     /transl_table=1
                     /translation="MTAPALSARGAYRQILRATRIAFHEDTRVLLAARQEARRQFDEH
                     KRVGIDTPMQINHAIEVASILKHNIVQGVKPEGDEAAKWELRIHDDIERGDNDSIKHA
                     GKDIKIHKACSA"
     exon            complement(742811..742905)
                     /number=1
     exon            complement(742984..743160)
                     /number=2
     exon            complement(743217..743289)
                     /number=3
     CDS             join(743780..743932,744027..744167,744235..745278)
                     /codon_start=1
                     /locus_tag="AO090011000292"
                     /note="zuotin and related molecular chaperones (DnaJ
                     superfamily), contains DNA-binding domains"
                     /old_locus_tag="AO070335000296"
                     /protein_id="BAE64812.1"
                     /transl_table=1
                     /translation="MTTVQVVNVSLPALSEGWSAEKDFKAVGTLSAATQRNLEPVGPH
                     FLAHARRKRHHRTFSEDERIQAQQNVKKTEEEEDDEISEDEDPMMLSRDAKDWKNQDH
                     YAVLGITKYRWRATPEQIKRAHRKKVLRHHPDKKAALGDRDENDSFFKCIQKAHEILS
                     DPVKRRQFDSVDEAADVEPPTKKEAAKGNFYKLWNRVFESEGRFSKIQPVPKLGDDNS
                     TFEEVDNFYNFWYNFDSWRTFEYLDEDVPDDGESRDQKRQTEKKNANARRKRKVEDTA
                     RLRKLVDDCAAQDERIKKFRKAARADKDKKRLEKEAEAKRLAEEKEKARLEEEQRKKD
                     AEEAAKAEREKNKKAKEAAKNATKKNKRVVKGSVKEVNYFADGEASASQVDSVLTDVE
                     LIMSKIDAEELAGLAERLTAAGKDAAAVKNVYAEESKRLVGAGKLKEGETKNF"
     exon            743780..743932
                     /number=1
     exon            744027..744167
                     /number=2
     exon            744235..745278
                     /number=3
     CDS             complement(745779..747455)
                     /codon_start=1
                     /locus_tag="AO090011000293"
                     /note="amino acid transporters"
                     /old_locus_tag="AO070335000297"
                     /protein_id="BAE64813.1"
                     /transl_table=1
                     /translation="MAETTGPPHSDESIIGKKEALDLGKVESCSAGQYIERAGVKRNI
                     KSRHAQMMAIGGAIGTGFFVGAGQALAIGGPGFLLLAYGLMSLLVYGVFTAVIEMSTY
                     LPIPGSSIAYYCSRYVSPSLGYALGWLYFYSFGIIVAYEITAASLVINYWPNNVHIAL
                     WVTVLLVVIVGLNLCPVGVYAEAEFWFAGIKVIMIIGMIILSLIIMLGGAPTHDRLGF
                     RYWNDPGATNAYIVPGSGGRFTSFLYVWVWSGFSFFFGPELMVFTGGEMRSPRKNLPK
                     ASRRYFGRLVVFYILGTLSMGVTCPSNAKGLTSNTGDANASPWVIAIRNAGITALPSI
                     INACILTSAWSAGNAYLYMSSRALYSLAVAGSAPKIFARCTNYGLPIYAVLGSSCFTL
                     LAYLNAGSQAGEVFNWFVCLTNTSGYTSWLTCCLIFLRFRKACNAQGIVMPYRSNIQP
                     LAAWICLFVFAALLLCNGFTVFFPGRFSASEFLTAYLGIPLFLAIYFGHRLTVGRKDP
                     WVYRPEDVDLRSGVEEVDAETETWARLEAMKRERNVRPNVVWSKISLIWS"
     exon            complement(745779..747455)
                     /number=1
     CDS             748065..749753
                     /codon_start=1
                     /locus_tag="AO090011000294"
                     /note="predicted flavoprotein involved in K+ transport"
                     /old_locus_tag="AO070335000298"
                     /protein_id="BAE64814.1"
                     /transl_table=1
                     /translation="MGSMGAREQNYDVLIIGAGLSGIYSLHEVRKNLPSLSVKVLEAG
                     DGVGGTWFWNRYPGARFDSETISYQFSWDKELLQEWNWKDTFSAQPDTLEYIERVCEK
                     HDLYKDIQFNTRIKSAHWQDAERTWLFVDEAGFHYRARFFISCLGVLSNPTLPAIPGL
                     KDFQGQSFHTSRWPKDFDMKRDFANKRIGVIGTGATGIQTITETSKEPSIRSLTVFQR
                     TASWSAPLRNTKITPEHMEKMKAEYDDIFQRCASTPTGFLHKPDPRKSSEVSHEERVA
                     LWEKLYGEPGFAKWLGAFCDTYTDREANRLYSEFMASKIRARVHDPVVADSLIPKNHG
                     FGTRRVPLESGYFEAFNQSNVHLVDLQKTPIERVTPNGILTSDGKEHELDILIYATGF
                     DAITGAFNAVEWHGRNDRPLIASSGTEAGKRAVWLDHRPYTYLGLMAPSFPNMFMVLG
                     PHQPFGNIPRSIEHAVQVVNQLLQFCHNEGYTVVEATEEAADRWTEHVVECSKGALSN
                     EIDSWMTGVNTNVPGKTVRSVARYGGSAIEYRKRCQQTRAAGWEGFKFARGYSL"
     exon            748065..749753
                     /number=1
     CDS             complement(join(750195..750382,750556..750694,
                     750754..751134,751195..751218))
                     /codon_start=1
                     /locus_tag="AO090011000295"
                     /note="dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /old_locus_tag="AO070335000299"
                     /protein_id="BAE64815.1"
                     /transl_table=1
                     /translation="MASFEGKVIAITGAASGMGLATAKLLASRGAIISLADINEAAVK
                     EATASLTGSDKHMYTVVDVRSSQSVDSWIKSTVERLGKLDGAVNMAGVITPTKPITEE
                     TDDTWDFNFAVNTRGVFFCLRAQLKAMTAGGSIVSAASAFGQMGSPGVAPYCASKAAV
                     IGLTRTAAKENQHIRVNCVAPGSVNTPMSQGENPEDVKRGLQATVQKRRAEASEIATV
                     IVHLLSDEASFVTGTVYNVDGGWLC"
     exon            complement(750195..750382)
                     /number=1
     exon            complement(750556..750694)
                     /number=2
     exon            complement(750754..751134)
                     /number=3
     exon            complement(751195..751218)
                     /number=4
     CDS             join(751641..751715,751772..753784)
                     /codon_start=1
                     /locus_tag="AO090011000296"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000300"
                     /protein_id="BAE64816.1"
                     /transl_table=1
                     /translation="MATLTDEQSIQSHPTRTRSFGGCTTCRSRHVKCDEGRPTCAMCR
                     YFGFVCAGYEKGIFFDFESSTDERRFRRPLLTEAEQERMSQWLVSSVPPESALQLLTR
                     IDDLCEKAAPFRDLQVDCGPFGAFRLSQLPSAPSPDIVPEETLDPLSSSPPEDVVRFD
                     DDFTASSEPPLTPRTQRILESIFGQAPNPTSPDTDTGDMAMDLCRIEAVLNDAPLSNF
                     QDFPMTSMTAEQQPQYLHNTDLAPIPPPNPCFSLTTTSKTVPQEVMLLLKHYTTTVIS
                     LMTPIRHAKTPWHILFIPHAKTCLAALTLNEDLDNASLAAFYGILAISAFSLSGLSQS
                     QMWLAQGTAYKQQALKHAKLMLRTAYDIPKVSKYKSTMIALLTMVYVSMFSVDREQTE
                     YFFLETERLIRLRGLKRKKSRKVRLLHHCYAFERFFYESTFTGGMNSRQRHYFRRSIE
                     SSGLAQYSRDDLSFRLRGWENLDQEMMEVKSQEDGENDLHLERPGIFSATLYPEIFGV
                     PESWVQLLSLVIRLGREKDIAESHDLPNPLTLKDFSSRAKAIERRINNLERPGQAQLD
                     EHLNDMLDAMHQALSIYFYRRVYDMEASILQQKVIAVRDCLWRCADPPMLHASAGVIW
                     AAFIAACEAEDRELQMSFSKWFQDSAQRSGLSSFRETMTRIEKIWREKRCGNGISATW
                     LNLMRIDASFTVG"
     exon            751641..751715
                     /number=1
     exon            751772..753784
                     /number=2
     CDS             complement(753876..754691)
                     /codon_start=1
                     /locus_tag="AO090011000297"
                     /note="dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /old_locus_tag="AO070335000301"
                     /protein_id="BAE64817.1"
                     /transl_table=1
                     /translation="MDVPGIALITGAASGIGRACAHTFARDGASGIALLDLDKTALET
                     VQAEINSQSSQDKTARCRVEIYPVNVTDENRVDEVINSAAQTFSRLDYVVNAAGIAMK
                     HQGGAAFAETSDWQRILDVNLTGTFFVLRAAARIMLSQEPIRSSIDGRPLQRGSIVNF
                     SSIQGVAGIPLSTAYTATKHAVIGLTRTASEDYAKDGLRINAICPGYTETPMTTKSPL
                     VLQAMQERVATAVPMQRMGEPREIADGVVYLSGGRSSFVTGTALFVDGGYTQR"
     exon            complement(753876..754691)
                     /number=1
     CDS             complement(join(755476..755724,755774..756049))
                     /codon_start=1
                     /locus_tag="AO090011000298"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000302"
                     /protein_id="BAE64818.1"
                     /transl_table=1
                     /translation="MGDFMNDQFDQPMEYKIDSTGRPVYQRHNDFGPLRQLRNIIPKI
                     VDFGHCARLDSDDDWGIYPIQPDHYRAPEVVLGCGWRMNTDLWNLGVILWDLIEGKEL
                     FRQVYDEQGRYQAKAHLAEMIALPGPPPQELITRYRSLLKYQWPQPIATVDDNVYESS
                     NQFFGGPFFDGDGI"
     exon            complement(755476..755724)
                     /number=1
     exon            complement(755774..756049)
                     /number=2
     CDS             join(758271..758462,758526..759554,759629..759664)
                     /codon_start=1
                     /locus_tag="AO090011000300"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000304"
                     /protein_id="BAE64819.1"
                     /transl_table=1
                     /translation="MLTRQSLVALLGGLSLAAAQTSSEQNPSLEEIQAAQATVLPHSP
                     VSNVKGLAFNRFVNIWLENTDYESAANDPHLSKLAEKGLLLTNYWAITHPSEPNYCAS
                     AGGDTFGMDNDNFNQVPANVSTIADMFDVKNIAWGEYQEHLPYPGYQGKNYSNQETGA
                     NDYVRKHNPMVFYDSVTKDATRLRQIKNFTTFYDDLKHERLPQYSFITPNMTNDAHDT
                     NITFAGSWTWRFLSELLEDEYFTKDTLILLTFDENDTYEIGNKIYSFFVGGAVPENLR
                     GKQDDTFYTHYSIIASLSANWGLPSLGRWDCGANLLSWLAEKTGYVNWEVETGNLFQN
                     ETHPGPLSAGEYNTFSPEWPVPLTKGSCSAGHGILPVVQQTWKNLTATFNYTSPIPYD
                     SVSGNNVGVKYSRTLKNGKTESGTTE"
     exon            758271..758462
                     /number=1
     exon            758526..759554
                     /number=2
     exon            759629..759664
                     /number=3
     CDS             join(760064..760870,760920..761747)
                     /codon_start=1
                     /locus_tag="AO090011000301"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000305"
                     /protein_id="BAE64820.1"
                     /transl_table=1
                     /translation="MPPNKRLRTEPIVRVRTGCYTCRRRKKKCDEVRPSCGGCVRNKL
                     SCEWPVNIPASSTRQNGSHTINQQAVPDQPGSPCTTRTQRGSSGSPTSPSGSAGSPSA
                     LSNGFEATEAFSPPTDEQALLVPMGYSHATPRSSISGPDSPTSMTIGSFMPRSLSMLP
                     GYSPESFQLLSHYLATTADVMANGSTPVNPFLVQIVPLAFTSDLLLQLVLTQSAAHRA
                     FRCRNDSDEVAQSHYTKALQLFRKGVTEFIDGKESNPLMLTVGALVMCFTETAKGDMN
                     GTIFDHLSAANSLLTRLLSLSDTAVPKDLKDFVIEYYTYTAAVSMISIDARVSHQLLL
                     NFDLEQKARQLLESEYVGNLCGCWLELLLMIPCIFDLGRQWMMLDGQPAMPTADDIAM
                     FGSLQAQIMRWNPFSFVTPEVFLAGRVFQQAMLLYLYTSLGSFSRTEQGMHQGLINTA
                     ITEAMSYLNQLSATARINSGLCWPIAVVGSCLYDIEQQEQLRQRLITMVNTFGLGNMQ
                     RTLLLLESMWQMPLDEAGPWNICRAMQQHQIWISFA"
     exon            760064..760870
                     /number=1
     exon            760920..761747
                     /number=2
     CDS             complement(join(761831..762071,762122..762664,
                     762720..762769))
                     /codon_start=1
                     /locus_tag="AO090011000302"
                     /note="dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /old_locus_tag="AO070335000306"
                     /protein_id="BAE64821.1"
                     /transl_table=1
                     /translation="MVGRLAGKNAIVTGAAGGIGLETTILMLREGASVLMTDISEPGL
                     QKALAKANDVVPQRDGKVEYRVVDVSKESEVEAAVAHLDAWGGLDVMFNNAGIMHPKD
                     GDSEETPEAIWDMTMNINVKGVWYGSKHAVKSLRKHGKKKGSIINTASMVALVGAATP
                     QLAYTASKGAVLAMTRELAIVHAREGFRFNSLCPAPLNTPLLQDWLGDDKEKRFRREV
                     HFPSGRFGEAIEQAHAVIFLASDESSFVNAADFVVDGGLTKAYVTPEGPATEAPKNLG
                     Q"
     exon            complement(761831..762071)
                     /number=1
     exon            complement(762122..762664)
                     /number=2
     exon            complement(762720..762769)
                     /number=3
     CDS             complement(join(763535..763757,763828..764280,
                     764339..764493,764539..764957,765015..765202,
                     765293..765407,765464..765817,765874..766036,
                     766099..766832,766879..767128,767202..767471,
                     767534..768325,768381..768569))
                     /codon_start=1
                     /locus_tag="AO090011000303"
                     /note="multidrug resistance-associated
                     protein/mitoxantrone resistance protein, ABC superfamily"
                     /old_locus_tag="AO080523000285"
                     /protein_id="BAE64822.1"
                     /transl_table=1
                     /translation="MDTTNVGIVCPPYSDNAFGPRITTACRSFDFTLLFEDAFFSLLP
                     AALFLLILPGRVLYLARTSVDLSGDTDSLICQWQISLSILLILHIVYTILQRETAVLR
                     TTLSTASEVVQSLAIAGCIVLSILEDRSHISPSSLLSLYLSVLTILGIPRLRSLSLIQ
                     TENVCQGMWTAIFIITVLAVIQQSLCKIGFLHTCYGDIGREQRVGFWSRSFYTWVIPL
                     LRQGYRDILEVEQIPKADTRLDSQYSLRKLQHAWENTKPKHRLVKAVLRAYLDTLLLG
                     VPSRLVLSAFTFCQPFLINTTIHLFQENGEDVRLYSRMLILAFALNYAGMAISRAVYV
                     RQTNCLAAMARAGLISIIYQHTTALTRSEVQDIAAVTLMGTDVERIWISLKILHDCWA
                     SLLEVAVAIYLLERQVRAACVVPAIDVPVCLCGTFPISTRMATAQRAWVEKVQVRLTV
                     TSTMLASIKTVKMLGLTDVLYSMISSLRQMELNTSQRFRKLLLWTVSLCKANIPLDFA
                     PFATFGVYAMISVINNDKSLLTAQAFTSLSLISLMTSPLLTFVQAVPQLLQSQACYDR
                     IEAYLSRNPITLNDQALVPNVFEKAASNNSISLSPCSRHGIDKNTLISFRGADISWSS
                     KSEPVFKNFSLDIGQGITMIIGPVGSGKSTLIETIIRETIVQKGHINTNFSDVAYCGQ
                     TPWIMNKSIRYNITCEDLVDEEWYNQCLSICSLKKDLMLFLAGDMYVPGSDGNGLSGG
                     QKQRIALARALYSKLPVAVLDDVFSGLDLDNIRMISEHLFGKNGFFRGAGRSVILATH
                     TSSLLSFADEIIVLDKGAVSSRGSYTEIFSAVPRVALQSLEQIDEEDVHTTDEKINAN
                     SPISLAVDNKANPRVDQQELDLSRRDGTWGVYRFYAQNAGLWTACCFVISAFLAALVM
                     TFCTIWIQWWADSNAKHPNAELGRYLGVYAVLSFLNITLYICLLFIKVINHTGVGLHT
                     ILLKTTLNAPLAFFYQTDSGTTTNRFNQDMDIIDMRLPSAAVGFIGGLALCVVKLVVL
                     CVMGKYLAISLPFLIGAIILIQRVYLRTCRQLRLLDIEAKSPLYSQFLETLKGLSVIR
                     TFGWESRLHHLFEENMNYSQRPFYMLLSVQQWLTIVLDLVLAGMAVILVAITTSLRDK
                     FTPGEVGVALNLTQLEISIGAVSRVQQFAKTPSERRTLAANAAASHGWPREGTVVFDR
                     VTAGYGNPPVLRNVSLNIKAGQKIAICGASGSGKTSLFMVILQMIDNQCGSILVDGTC
                     LSDLDPEVVRSRVNVIPQEPFFLPETVRYNLDPHAKVTDDRLELAIQKVGLWDRVSGN
                     GGLNMQLNPSTWSSGERQLLALARALVRDSPLLLLDEAASSVDDTTATFTQQIIEEEF
                     RDHTILAILHRFACIERYDYIVVLERGEVVEFDSPTVLLGRDSKFRTLYTAMEKED"
     exon            complement(763535..763757)
                     /number=1
     exon            complement(763828..764280)
                     /number=2
     exon            complement(764339..764493)
                     /number=3
     exon            complement(764539..764957)
                     /number=4
     exon            complement(765015..765202)
                     /number=5
     exon            complement(765293..765407)
                     /number=6
     exon            complement(765464..765817)
                     /number=7
     exon            complement(765874..766036)
                     /number=8
     exon            complement(766099..766832)
                     /number=9
     exon            complement(766879..767128)
                     /number=10
     exon            complement(767202..767471)
                     /number=11
     exon            complement(767534..768325)
                     /number=12
     exon            complement(768381..768569)
                     /number=13
     CDS             join(769058..769506,769559..770003)
                     /codon_start=1
                     /locus_tag="AO090011000304"
                     /note="predicted protein"
                     /old_locus_tag="AO070335000309"
                     /protein_id="BAE64823.1"
                     /transl_table=1
                     /translation="MTIKVIVAGAGGNLGHHIVSALDDDHRFTVTILARASSKSKFPS
                     HITVHRVDDYYPELEVVEAFKGQDVVISTVTTGAIQRQKTLIDAALKAGVGRFIPSEF
                     GHDTRNGNASKMLPQMYQQKREVVEYLRAKQNDGLEWTAFVTGPFLEVAIENFLGFNL
                     SQQHATILNEGSDRWSATTRATVGLAVKNSLLIPEKTSNRYLFIDTVTASQNDVLLAL
                     RKMTGTEWGVDYVDAEEQKRVAIEHLSKGRLIGIPMLMRYITCVRGYGGDYLDYETSA
                     NEILSLPVRNVDEVIASILKG"
     exon            769058..769506
                     /number=1
     exon            769559..770003
                     /number=2
     CDS             complement(join(777629..777742,777807..778751,
                     778810..779211))
                     /codon_start=1
                     /locus_tag="AO090011000306"
                     /note="NAD-dependent aldehyde dehydrogenases"
                     /old_locus_tag="AO070316000001"
                     /protein_id="BAE64824.1"
                     /transl_table=1
                     /translation="MVNQIRTLSPSTNKVIFEHPGTSLDEARAIAQASENAFQSYKQL
                     SLADRKAIMVKALNIVDANKETLANELTAQMGRPIAYCTKEIDTMRKRADYLLSIADD
                     SLKNLPGQAESGFRRFLKKEPLGVTLISTAWNYPYLITVNTLLPALLAGNTVLLRPSP
                     QTPLLGERLVSYFHEAGLPTNVLQLLHVGSLDVLDEIVKLPQIKLVSFTGSTAGGLRL
                     REATARRVVPVNLELGGNDPAYVRPDADIAYVAAQIVDGAVFNSGQSCCSIERVYVHA
                     DIYDNFITEVQKELSTLVELLLVYLKITSRRTNKSSYKLGDPTDKATTTGPVISKQAL
                     KNIQSHIDDALSKGAIDATPENTTFTSLPAEGNYIAPKLLTNVTHDMVTMREETFGPV
                     IPVMRVSSDEEAVALMNDSDYGLTASVWTKDIKAGEALIEKIDAGTVYINRCDYPSPD
                     LAWIGWKNSGLGCTLGPHAFDGFYKLKSFHIKEEQT"
     exon            complement(777629..777742)
                     /number=1
     exon            complement(777807..778751)
                     /number=2
     exon            complement(778810..779211)
                     /number=3
     CDS             complement(join(779478..779500,779636..779879,
                     779926..780134,780197..780422))
                     /codon_start=1
                     /locus_tag="AO090011000307"
                     /note="predicted glutamine synthetase"
                     /old_locus_tag="AO070316000002"
                     /protein_id="BAE64825.1"
                     /transl_table=1
                     /translation="MTRIIRVAILETDTPIDPILARYGTYGAIFNRWLNTGLQGLTLT
                     DTEIQTTIWDVVNKSEYPKPGDFDALLMTGSNVPWIIELVKYVHDIHEQHKKPIVGIC
                     FGHQIVARALGARVGRNDEGWEISVEPFQLTDTGKQLFSKDSLDIHQMHRDIVYDVPR
                     GCVNLGSSPRCKVQGLYMPQRVLALQGHPEYDEFVMTEVINLRHAVGVFDAELAKDGL
                     SRAGKQHDGVHFVKS"
     exon            complement(779478..779500)
                     /number=1
     exon            complement(779636..779879)
                     /number=2
     exon            complement(779926..780134)
                     /number=3
     exon            complement(780197..780422)
                     /number=4
     CDS             join(780866..781280,781333..781592,781642..781694,
                     781740..782420,782471..782501)
                     /codon_start=1
                     /locus_tag="AO090011000308"
                     /note="glutamine synthetase"
                     /old_locus_tag="AO070316000003"
                     /protein_id="BAE64826.1"
                     /transl_table=1
                     /translation="MATNVTLENLSSLLADDIKVKVAGIDCDGILRGKVMSKEKFLGI
                     AEKGFGFSSAVFGWDMQDVLYTTDANIAPKDSGYVDFIAVPDLSTFRRIPWEDDIPFF
                     LVRFIQNGQTVSADGRNMLKLICDKLAAENCQGMAGVELEFMNFQTPSEDGYSNGSQT
                     QNIAAFLEKNTPGSLRPITAGSFSYSATRPVAFKKYFYDIFNTCAQINCGIEGWHTEG
                     GPGVYEAALKVCDVREMADRVSLFKLLAKSIGVEHGITPCFMAKPIQGQPGSSGHIHV
                     SLCDLDGKNLFARETPDDNAPWPDAVGLSDLGRQFLAGLLEALPDIMPLFAPTINSYK
                     RLVENFWAPVNVSWGLEDRMASIRLITPPVCKPGATRFEVRIPGADLHPHYALAVILA
                     AGWRGVQKKLEIKVPPVSAMKKDNTRPELLPNTLEEALKRFNAADSVAREILDGEFVD
                     FFTATREHELRVWREAVTDWEFKRYIETV"
     exon            780866..781280
                     /number=1
     exon            781333..781592
                     /number=2
     exon            781642..781694
                     /number=3
     exon            781740..782420
                     /number=4
     exon            782471..782501
                     /number=5
     CDS             complement(join(782743..783557,783614..784051,
                     784131..784374))
                     /codon_start=1
                     /locus_tag="AO090011000309"
                     /note="dienelactone hydrolase and related enzymes"
                     /old_locus_tag="AO070316000004"
                     /protein_id="BAE64827.1"
                     /transl_table=1
                     /translation="MATISINAPGATGFLYNNASGKARLCISAETPDFDTETLRNWRD
                     EGFDVIYVPYDGDQREYVARLKSVKEGLGVGENYAVLAFGDAASFCLDYYLKPTNCSR
                     LCALVTYYPTNIPDTRSRYPPSVRILTHLAGTTVDVTTIPTLVGLQGKKKRRTRQINP
                     GMGTGERLNIGHTAYTYEYVQPGFAEHDLDEYDRLACDLAFSRTLQVLRRGFNKDIDL
                     EERWEEHLEAKFFSMNLSNTMEAYVSHINPAVTYVPTVSGGIGNHALRRFYEQNFLRQ
                     LPPSMRLRLISRTIGVDRVADELHATFQHTQEVPWMLPGVPPTNKQVEVILVSIVSLR
                     AGRLYSEHVYWDQASVLVQVGLLDPKLVPQGVHGVDRLPVVGREAARRILDENPEVEK
                     KEYHNRLIRRAKAKKKGKDGVTPGVDESGTEYFKSEAEKPLENGKGKGKTVQKQPPEH
                     GPEGNESHRNDNTEDNQDNKEEEDGQDRAQTPTPFKGSASVEDANDEE"
     exon            complement(782743..783557)
                     /number=1
     exon            complement(783614..784051)
                     /number=2
     exon            complement(784131..784374)
                     /number=3
     CDS             786052..787938
                     /codon_start=1
                     /locus_tag="AO090011000310"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000005"
                     /protein_id="BAE64828.1"
                     /transl_table=1
                     /translation="MLSSVLLVLFSAAVGAKTVPNGQTLTLNGIPYYLSGIPISNFSH
                     NVFDKASNDVDIFPFTVIQTSSTVHSSFLSETVANFTQQDDVFQPAFLQTVYLTSSVE
                     ASQIDELSGSEALHQFDNKMFLTESDASLSTPLPNGPYFASARTGHIFRAYRLYSDDS
                     LAFISAAISDESGGFIPMTGVTEGVMTKNVAVPSRLYYTPTAEKPLAGFRLAVKDIFH
                     IKGLRTSGGSRAYYYLYDEQNVTTPSVQRLFDLGAVMVGKVGTVQFANGDRPTADWVD
                     LHCPFNPRGDGYQYPSGSSSGSGAAIAAYEWLDLAIGSDTGGSMRGPAGVQGIYGNRP
                     STGAITLEHALPLSPPLDTAGMFARSASLWSKTVQAWYPNFNRSYPSHPKQLYLSHSN
                     WDESTAPEANEHLETFMQRLEDFLDTNRTIVNVTERWSETHNSPSLINLLNTTYAYLV
                     GVGQWNNLAKGFFADYAQSHDGRRPFINPGPLARWEWGQANGGNASYDAALHNMTVFR
                     DWWSTSGYGRSDDDSCSEGIFVHAWATGAADYRNRYFNPPGPPFGFTDDAIAVFAGAP
                     EVVVPLGESPYNSTITLHEEYLPVSIGLQMARGCDRALAELVDDLGKAGILKPVSAGS
                     RLYS"
     exon            786052..787938
                     /number=1
     CDS             complement(join(789036..789070,789086..789605))
                     /codon_start=1
                     /locus_tag="AO090011000311"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000006"
                     /protein_id="BAE64829.1"
                     /transl_table=1
                     /translation="MGEEQVLSPYDPSDDLALDTSADSNHTLQYGECYKVQADGNWLG
                     SDSNPWNYYLFGGYSNSRTFQVCRLMSSCQRQNTQDQEVRHRGHLYLWDFRGNHYSRN
                     GEFVANNNRGYFYPAGLSARNYAYFEAHMEDCDDITHSKDTCYINLVLVGQASNNNGI
                     EIRSNNYLANAYNVQFRRVKCLLD"
     exon            complement(789036..789070)
                     /number=1
     exon            complement(789086..789605)
                     /number=2
     CDS             complement(join(792318..792570,792627..792745))
                     /codon_start=1
                     /locus_tag="AO090011000313"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000008"
                     /protein_id="BAE64830.1"
                     /transl_table=1
                     /translation="MKVVDEDPLKPSALPTPDSYQFFHGWEVKSNWKNEVTLKSLEAL
                     RGYVPSTHIAHISPTPLLMTVADNDVITPADIALEAYSRAREPKKLHIFPGGHFDGYA
                     GKGFERIVSVQVDFLKEHFVE"
     exon            complement(792318..792570)
                     /number=1
     exon            complement(792627..792745)
                     /number=2
     CDS             complement(792824..793471)
                     /codon_start=1
                     /locus_tag="AO090011000314"
                     /note="hydrolases of the alpha/beta superfamily"
                     /old_locus_tag="AO070316000009"
                     /protein_id="BAE64831.1"
                     /transl_table=1
                     /translation="MPLNDLWGRLEFKHFVNSLLRLSPPFCKIYSNPKHAEPLHNMPR
                     DNIEFQTADHVTLRGWFFRPPTKAPETRLPCLVMSHGFSALKEMELDTFAEYFTQNLP
                     ISCLVYDNRGFGDSDTKEGQPRHEILPSQQTSDISDAITYAQSRADVDPDRIGIWGSS
                     YSGGHVLWVGAVDRRVKVVLSQVPFVDGWQNMGRLIRPDIMEALNKSYQEGMRVT"
     exon            complement(792824..793471)
                     /number=1
     CDS             complement(join(793909..794299,794371..794698,
                     794783..795124,795182..795489,795546..795690,
                     795774..795792))
                     /codon_start=1
                     /locus_tag="AO090011000315"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000010"
                     /protein_id="BAE64832.1"
                     /transl_table=1
                     /translation="MSMYKTSATTVKLVATLPLDSIKPPSSRSDVHFNVQQAAADAVP
                     LDKQLMGLSIEFGNAVDYFGDVNNPNAFSKQLLQNIVDRSQSPAILRIGGNTQDRANF
                     CENCNQTMSSIVLNDPNDPKGTEAVNVTFNKNLFNVLANNVPAGTPIIFGLNFRNNSY
                     SLAQAEIDGAFKYIDQSLVMAYELGNEVNLYGDFRPPDYDVNDYARQMREWIPRLRAR
                     SSAASSFQFPSFAGPELFKPDMSISELVRLGVPQSIPGIEYFSVHGYPWNICTDEDAA
                     KVDLRNLLDHQQTLDLLDQYSSQISAAKPLGKMMHMGETGSVACHGKDGVSNTLGAAL
                     WQLDYALSGATAGIDRLFFHNGKGDFYYSTWEPLSTETSPVPHINPTYYSMLFIADLV
                     ADLNGPRITPITSLDSNSAVHFAIYDNDQIQKLVLLNTEYFNETTTRSSREFNIASSL
                     GLNLKVRRLTGQSSDARTGVTWAGQSVDASGGITGDLNIESVSTGIVTLLASEAVIVE
                     RA"
     exon            complement(793909..794299)
                     /number=1
     exon            complement(794371..794698)
                     /number=2
     exon            complement(794783..795124)
                     /number=3
     exon            complement(795182..795489)
                     /number=4
     exon            complement(795546..795690)
                     /number=5
     exon            complement(795774..795792)
                     /number=6
     CDS             complement(800027..800491)
                     /codon_start=1
                     /locus_tag="AO090011000317"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000012"
                     /protein_id="BAE64833.1"
                     /transl_table=1
                     /translation="MAPGPALDGLSKFFAQHLPNLAPTPTPPKFQDSTEYTSNAVSNT
                     PTGLDNIGGAVEGWVRKMTSRAKAGFNELQQSTQGHQINGTAHRPATRGVGDLIELND
                     GLESRDSSKILRPEINRSATSLHDGGSVRGRFHSPSAGTSRTRATGDRFKDD"
     exon            complement(800027..800491)
                     /number=1
     CDS             complement(join(803116..804234,804356..804421))
                     /codon_start=1
                     /locus_tag="AO090011000318"
                     /note="AAA+-type ATPase"
                     /old_locus_tag="AO070316000013"
                     /protein_id="BAE64834.1"
                     /transl_table=1
                     /translation="MASARGPRWQQFLQELVMVAGTKEEQRRKSAAILRRLDGGEESD
                     EDSPRREGKRGRRQKRGDLALTQYEQAIAMDVVAPDDIPVSFEDIGGLDEIIEELKES
                     VIYPLTMPHLYSSTSSLLTAPSGVLLYGPPGCGKTMLAKALAHESGACFINLHISTLT
                     EKWYGDSNKLVNAVFSLARKLQPSIVFIDEIDAVLGTRRSGEHEASGMVKAEFMTHWD
                     GLTSANSSGEPQRVVVMGATNRIQDIDEAILRRMPKKFPVVLPPAPQRLRILSLVLKD
                     TKVDRENFDLDYLVKAMAGMSGSDIKEACRDAAMAPVRELIREKKAAGLQMNTVDPEE
                     VRGLRTEDFFSRAGGVRIIPPPAQLQAPIKASSEKDWSTESEATSEVETRPSAEMVEP
                     PE"
     exon            complement(803116..804234)
                     /number=1
     exon            complement(804356..804421)
                     /number=2
     CDS             join(804799..805699,805753..806187,806239..806462)
                     /codon_start=1
                     /locus_tag="AO090011000319"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000014"
                     /protein_id="BAE64835.1"
                     /transl_table=1
                     /translation="MPPKRKAAAKLSNLAESDNEDATQAQEPRDDERPTKKPRGRPRS
                     KSAELKPLIQSKNDTATAPSQAPEAAPKRGTRRGRPRGSRGSLQSVNQEIEEQKEPEE
                     GEEESGPQVPESAPASNDELVASQPAARSTRSAKPAKPTTTRGRRKATVEKQVKTDGE
                     FQYTPRNTRHYKSPVKANEEAEQSTKQQQKADPQSELEEEVSEGEKAAPDVVEETFVQ
                     EEPMEPRSISMSPAKRRQSTQRPLQGSPLKPNAEPELRRKIGELTKKYDTLESRYRTL
                     KEIGVVEANANMEKLRKQCEAMTNASNNLVAGLKAELEAQKALGQRSRTLQKQLKERD
                     AEIAQLKSQAEEATSQLSSAQTEVKALQTKLAAARNTAASLESAAAKVPGSAIKGGSN
                     RANAAASAEAAQAAQFAQLKEDLYTDLTGLIIRDVKKGDSDNLYDCIQTGINGTLHFK
                     LAVPHVSSANFENAEFQYVPLLDDNRDRDLIDILPEYLTVDITFVRQQASKFYTRVID
                     ALTKRRTSTGN"
     exon            804799..805699
                     /number=1
     exon            805753..806187
                     /number=2
     exon            806239..806462
                     /number=3
     CDS             join(807032..808774,808837..809024,809097..809235,
                     809341..809449,809555..810444)
                     /codon_start=1
                     /locus_tag="AO090011000320"
                     /note="glycosylphosphatidylinositol anchor synthesis
                     protein"
                     /old_locus_tag="AO070316000015"
                     /protein_id="BAE64836.1"
                     /transl_table=1
                     /translation="MARVGRVGFLTLAVVFHLMYAYSIFDIYFVSPIVSGMRSFGVER
                     EASAEAPAKRLVLFVADGLRADKAFQALPDPDAPSDLENDEPIYLAPFIRSRALSHGT
                     FGISHTRVPTESRPGHVALIAGLYEDVSAVTTGWKLNPVDFDSVFNRSRHTWSWGSPD
                     ILPMFKEGAVPGRIDADTYGEEAEDFSADATKLDIWVFDKVKELFASAKKDPELDAKL
                     REDKLVFFLHLLGLDTTGHAYRPYSKEYLRNIKLVDKGVQEITQLVEDFYGDGKTSFV
                     FTADHGMSDWGSHGDGHPDNTRTPLVVWGSGVASPRYTHEGTITGHEDGVSADWGLDS
                     VQRNDVAQADVAALMAYLVGLDFPTNSVGQLPLGYLDTSPKDKALAALANAQGVLEMY
                     RVKEEQKRDALLRYTPFEPLADNGETSVEARLERIKTLISNKSYDASIQLSSELLLTA
                     LEGLRYLQTYDWLFLRTIVSLGYLGWIAYALTTVIDLHVLHGKSESNRTTFSIMFFSS
                     ILVALFSVLLYQGSSWRYYLYALFPIFFWEEVFARRKALLAGREILLGHVHSVSGYFA
                     FAIQLLLYVGVLEALVQSYFHRDIFTVCFILGGFWPITYGTKFLGQHKLLSASWALGC
                     FLMSIFTLLPANKVEDMMMISCGSLLMFLTGLLYLIFERSILGQKRSSDPNSVVSSCG
                     SRTIMGAQVGMILLALIVTRSSVASLQAKQGLPLGNQVLGWAILVSSLLLPFLHRLYP
                     NSHYLHRLMVIFLTFSPIFIILTISYEGLFYFVFCMTLLAWVRLEQAIYIHTTAPTRE
                     QDHSVANGSLPAKKPSPGNTVVVEGQPYRYRTLSVSDARVALFFFFLLQSGFFSTGNI
                     ASVSSFSLDSVYRLIPIFNPFAQGALLILKLLIPFAIISANLGILNHRLEVAPSALFM
                     VVMSISDVMTLNFFYMVRDEGSWLEIGTTISHFCIASFLCTFVAVLEFLSELFISGVD
                     FGHPATTVGSAVAKAVNGSVACGHSPDSDISGEDSTSVGITAKADPDARS"
     exon            807032..808774
                     /number=1
     exon            808837..809024
                     /number=2
     exon            809097..809235
                     /number=3
     exon            809341..809449
                     /number=4
     exon            809555..810444
                     /number=5
     CDS             join(813341..813471,813678..813922,814064..814160,
                     814244..815035,815091..815520)
                     /codon_start=1
                     /locus_tag="AO090011000321"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000016"
                     /protein_id="BAE64837.1"
                     /transl_table=1
                     /translation="MSTTGENHTDSTSRPSPAPSATGSTGTSGITVRAGSNGQMGFRR
                     QRASRACEVCLFVLMRSTRPVKASAPRHIAALLDGPYHTIYPSGNPGGDGSITQPRSW
                     FYLNILLANIFYFLSCEDMPCSKSVPCTNCVAFSIECKIPTPKRKKNQTKAKESSGEE
                     NPQKETPKDDQSTTDGKDAFGYSSNRMAVDGMPVTSLTESQAAQQATQNGAYAQFMKP
                     KFARAPIKEAGRVAYLGESSNLSLLVQDRHGTTDVVHYPLPPNIRGSRARLADLDNLE
                     LDILHQRGAFLLPPKPLCDELVDAYFKWVAPVVPIVNRSRFMRHYRDPKNPPSLLLLQ
                     VILLAGSRVCTNPQLMDANGSTTPAAMTFYKRAKALYDANYEDDRVTIVQALVLLGWY
                     WEGPEDVTKNVFYWTRVAMVVAQGSGMHRSVESSQLSKPDKRLWKRIWWTLFTRDRSV
                     AVALGRPIGINTDDSDVGMLTEDDFIEDEIDIAAEYPPDPVHVQFFLQYVKLCEIMGL
                     VLAQQYSVASKSRRMNAMDLTHSDMALADWLQNCPKEVCWQRQNHHFWAALLHANY"
     exon            813341..813471
                     /number=1
     exon            813678..813922
                     /number=2
     exon            814064..814160
                     /number=3
     exon            814244..815035
                     /number=4
     exon            815091..815520
                     /number=5
     CDS             join(815649..815755,815817..816779,816888..816930)
                     /codon_start=1
                     /locus_tag="AO090011000322"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000017"
                     /protein_id="BAE64838.1"
                     /transl_table=1
                     /translation="MAYPSRTIAFQAAGMITSIVENLQTHQEIRYTPAFILFSALIMH
                     VYQMRSSVPTVVATCQERINICMQALKDVSKVWLVAKMVRTLFESILGNKVLEERLQK
                     AAGKRHQRIRHDTAQHQPPRKPDPPKRKFDDMDLGLPNGGPTPPVSYERSRPQTPAVT
                     PSREMGQPGLNVPQGSPTGPPAGNSRGNTRPTTPFNAQFSLPATPPDLFLVTRTSPNL
                     SPSLWENFQPDQLFPDGTAIFPELTSPQQTAVDPQLQMSSQLQTQGMDQRHMMPHQMS
                     SRGLPGTQGSPEMISNIPPGLGMQGQQPPQVFGMENQQPWPMAGLEAALHTGVEAASQ
                     DDTWSNSSRSGPTAPTTLNVEDCMNMECICDDDPSS"
     exon            815649..815755
                     /number=1
     exon            815817..816779
                     /number=2
     exon            816888..816930
                     /number=3
     CDS             join(817417..817632,817720..818763,818823..818888)
                     /codon_start=1
                     /locus_tag="AO090011000323"
                     /note="cystathionine beta-lyases/cystathionine
                     gamma-synthases"
                     /old_locus_tag="AO070316000018"
                     /protein_id="BAE64839.1"
                     /transl_table=1
                     /translation="MSASGSGAAPAASSSTNPAKKAFPSVDLEGHNLPPSPAPSSPHT
                     GRRYAIATELVYTDSGDQYNASSVPIYQSATFKQTSGGGGGEYDYTRSGNPTRTHLER
                     HLAKVMSAQRALVVSSGMAALDVITRLLRPGDEVVTGDDLYGGTHRLLKYLSTNGGII
                     VHHVDTTQPEKVREVLNEKTAMVLLETPTNPLIKIVDIPQIATAAHEVNSTCLVAVDN
                     TMMSPMLLNPLELGADIVYESGTKYLSGHHDLMAGVIAVNDLALGERLYFPINASGCG
                     LSPFDSWLLMRGVKTLKVRMDQQQANAQRIAEFLESHGFKVRYPGLRSHPQYDLHHSM
                     ARGAGAVLSFETGDVGVSERIVESAKLWAISVSFGCVNSLISMPCRMSHASIDAKTRQ
                     ERAMPEDLIRLCVGIEDADDLIDDLTRALVQAGAVNLSLDDFQANTTTN"
     exon            817417..817632
                     /number=1
     exon            817720..818763
                     /number=2
     exon            818823..818888
                     /number=3
     CDS             join(819518..819687,819746..820514)
                     /codon_start=1
                     /locus_tag="AO090011000324"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000019"
                     /protein_id="BAE64840.1"
                     /transl_table=1
                     /translation="MPGNAISPDGALSMQAVNERPTSTWNTRRLGSRLGVDIASAATA
                     GALTCPVITVIDRAIIEKASKGIPIRQTITSCFGSMIRHPAGFFLSTPFLLIYTLYTS
                     TYLTANAIDTISSTMRNQPFSSVFAGTAKFLATTTVNMGICVYKDARFARIFGAQSKP
                     TPSSSSTPARTSPPASCHPSGAATVPKVSYALFCLRDSITIFASFNVPTLIAPSIPDY
                     IASTPGMKAAIAQFSCPALMQFASTPMHLLGLDLYNRQPPGGLGWRERVSRIRRDYVP
                     SCFARMGKIVPAYGVGGVANVRLRSAMMEYLERTEK"
     exon            819518..819687
                     /number=1
     exon            819746..820514
                     /number=2
     CDS             complement(join(821480..821986,822083..822238))
                     /codon_start=1
                     /locus_tag="AO090011000325"
                     /note="predicted kinase"
                     /old_locus_tag="AO070316000020"
                     /protein_id="BAE64841.1"
                     /transl_table=1
                     /translation="MPEIIDDKSQHCIPFLLERLKAHQERFGNDPARTPPFFLGLNGV
                     QGAGKTVLVSTLQSTLRSPPYSLPVITLSLDDLYLTHEEQVNLAKSHPANPLLQHRGQ
                     PGTHDLPLAKEVFESLRAGRATAIPQYDKSAYAGQGDRVPESQWEIVNGEGQEKIKVV
                     IFEGWCVGFRALDDQLLREKWDAAVLRKEKGDYDGRLGYVPFEAAKAVNDALKDYDLI
                     TE"
     exon            complement(821480..821986)
                     /number=1
     exon            complement(822083..822238)
                     /number=2
     CDS             join(823260..823415,823484..823820,823879..823968,
                     824020..824407,824460..826191)
                     /codon_start=1
                     /locus_tag="AO090011000326"
                     /note="peroxisomal multifunctional beta-oxidation protein
                     and related enzymes"
                     /old_locus_tag="AO070316000021"
                     /protein_id="BAE64842.1"
                     /transl_table=1
                     /translation="MSELRFDNQTVVVTGAGGGLGKAYATFFASRGANVVVNDLGGSH
                     SGEGKSSKAADVVVEEIRAAGGKAVANYDSVENGEAIIDTAIKNFGRIDILINNAGIL
                     RDVSFKNMKDQDWDLITKVHTYGAYKCARAAWPHFRKQKYGRVINTASAAGLFGNFGQ
                     ANYSAAKLGQVGFTETLAKEGAKYNIIANVIAPIAASRMTATIMPQDVLDILKPEWVV
                     PLVAVLVHPSNTTETGGIYEVGGGHAAKLRWERAKGALLKTDDSLTPGAIARKWNDVN
                     DFSQPEYPTGPADFMTLLEQGLKTPSAPSGQEPDFKGKVALVTGGGNGLGRAYCLLFA
                     KYGASVVVNDLVDPEPVVQEIKKLGGQAVGNKASCEDGDAVVKTAIDAFGRIDILVNN
                     AGILRDKAFTNMNDDLWNPVLNVHLRGTYKVTKAAWPYMLKQKYGRIVNTASTSGIYG
                     NFGQANYAAAKLGILGFSRTLAIEGAKYNIKVNTIAPNAGTNMTRTIMPEEMVQAFKP
                     DYVAPLVVLLSSDIVPGTGTKGLYECGSGWFTSTRWQRSGGHGFPVDVKLTPEEVVKN
                     WKKITNFDDGRADHPEDSQAGSEKVMANMGNRSDAAEGGNDILANIEKAKQATTDGTA
                     FDYADRDVILYNLSLGAKRTDLPFVYENNEHFQALPTFGVVPWFNTTVPYNMDDIVKN
                     FSPMMLLHGEQYMEIRKFPIPTEAKTLTFPKLIDVVDKGAAALVVAGFTTKDAKTGED
                     LFYNESTVFIRGSGGFGGSPKPTAARPKGATAAYKAPQRKPDAVVEEKTSEDQAALYR
                     LNGDRNPLHIDPEFSKVGGFKTPILHGLCSLGVSGKHVYSKFGAYKNIKVRFAGVVLP
                     GQTLRTEMWKEGNTVLFQTTVVETGKPAISGAGVELLEGAKAKL"
     exon            823260..823415
                     /number=1
     exon            823484..823820
                     /number=2
     exon            823879..823968
                     /number=3
     exon            824020..824407
                     /number=4
     exon            824460..826191
                     /number=5
     CDS             826868..829015
                     /codon_start=1
                     /locus_tag="AO090011000327"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000022"
                     /protein_id="BAE64843.1"
                     /transl_table=1
                     /translation="MVLSLPVPSFSKSPTTSTSTAPPLRPNDSNQSTTISEALRNNPF
                     GITSRSLLIPPSAPTTADQNREQEELNNALEILARIFPDVKIEVFRELLVRFDGQSRL
                     HVCVEQLLRHKKEWVAGRWNVPGDDAEAAPVTGSLVIPRNERFRTTEYKLAVRTVLLK
                     EFSGLSKSTVDAVLAEVNFCYVRARPTLRDLSKRTWRATFNSLFPSFKSKKDKEESPL
                     VVWQRHANGEVVPTLKETGCVELDRELHDALLAPLLSAKKVECEDRDRRLAEELNEEE
                     AKAAAALYECECCLSDVTFEQISTCSESMHIICYGCIRRTIQEALFGQGWGKSVDVER
                     STLKCLTPFAHDGCNGSLHPEVVKRAILLDKGGSETYVKFEGRLASEALLKSQLKLIR
                     CPFCSYAEVDSVYHPSAKGITWRFRRDGIISTIILTVMLLDMIPLLVIPVIILYILDP
                     SAVQNFLHNSFLNLCLKVRPKRFTCANPLCQRVSCITCQKPWRDPHVCFEPLLLDLRA
                     TVEAARTAAVKRTCPRCGLSFVKSSGCNKLTCVCGYSMCYLCRKGLSPPSKATQRFRP
                     RQRQQENINPANAAENDDQNLDDEEFDEPEGYKHFCEHFRINPGAHCTECNKCELYQD
                     EDEEAVARRAGEKAEREWRMRQGMASLGVRSLQVNRSFSRPNKSAGDISLSGQGKGLN
                     YWLDEVWREGRWKMEGQAFVDWVVERVVVIDEI"
     exon            826868..829015
                     /number=1
     CDS             complement(join(829519..830685,830730..831233,
                     831240..831681,831752..831827,831900..832899))
                     /codon_start=1
                     /locus_tag="AO090011000328"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000023"
                     /protein_id="BAE64844.1"
                     /transl_table=1
                     /translation="MTGDTYGTTIAHAFSSAKDTAAKMLSGGECGKRLIPHVIDETAR
                     KTPDVECMSTPRSNNRHDGWKPVSWAQVANAVNYAAQMLIMQAEHPAPGTFPTVAYIG
                     LEDPRYPIFVVGAIKAGYKALLISPRNSIEAQMNLFARTDCNILYHELQYASMVQPWA
                     DARSGMEGVAVAPFDEWVAEGVTPALYTKTFAEAEWDPYVVLHTSGSTGLPKPVVVRH
                     GMVAMNDLHRYIPARNGNLAWLSTWTSFPNPRHLLIMPLFHTGGLMIMTVCAFYYNAP
                     IAFREPSRPITGDNVVEWLQNSNSGWTFIPPAILDHMSRSQQAIIELKELHAVGCGGG
                     AIAHDSIDILLSHGIKTINAIACTEYFYFPYYSQPDPAMWPWFIIHKELMGIEWRLID
                     DDTYEQVIVRKDKHPGLQGCFYTFPELDEFSTKDLYRPHPTLADHWTYVGRADDIIVF
                     STGEKLNPVTIEGAVMGHPAVFSAQVVGSKQFHAALMIEPIQYPKSEEEKQHFLDDPT
                     IEKVNAETVAHGRISRDYVFLADPQKPFPRAGKGTIQRSMVEKLYAADIEGFFDNSRD
                     KLVIAVDLDVTSETGFMHLVRDLVQSVFKIRQLDTEEDFFAAGLDSLQAIQLSRALLV
                     SLEKAGIKVSKEAAESRVIYAHPTVTQLAAYAFSLVSANHRQGSPTNGSGYIHDLPAA
                     VPNKPAPADKGQVVVITGTTGALGSYLLDFTLKCSNVSKVICFNRAVNGLERQTVVST
                     SQGLSTDFSRAEFLHVNLAEPGLGLVPEVYSRLADEVDRVIHNAWPVNFNMSVASFEP
                     HVRGVRHLVDFSAQAARKTVPITFISTIGTIEKWTTPEVLVPKKALPDWSLAAIGYGQ
                     SKLVSSTILDHSTKVSGVPSVIVRIGQVVGPRGKKGKWNSQEWLPSLVRSSVYLGLLP
                     DSLSTFSDMGWAPVEDIANVVLEVSGVTSLWTVEEITGYIHAFNPKVTEWSSLIPILR
                     EFYGERIREVVSLEEWIDALDKSQVHPVGMDNNPAVKLLDTYRSAAEGAKMGFKAVPL
                     AITRTESNSFTMRQMEEVSPQLMRNWCEQWQF"
     exon            complement(829519..830685)
                     /number=1
     exon            complement(830730..831233)
                     /number=2
     exon            complement(831240..831681)
                     /number=3
     exon            complement(831752..831827)
                     /number=4
     exon            complement(831900..832899)
                     /number=5
     CDS             complement(join(834440..834750,834831..835131,
                     835215..835457))
                     /codon_start=1
                     /locus_tag="AO090011000329"
                     /note="aquaporin (major intrinsic protein family)"
                     /old_locus_tag="AO070316000024"
                     /protein_id="BAE64845.1"
                     /transl_table=1
                     /translation="MLHVPYTFQNTFVAVVGEFVGTFMFLFFAFAGGQVSNTPKPAEG
                     AAPNTSNLLYLSLSFGFSLLVNVWTFYRVTGGLFNPVVTLALCLCGGMHPVRGVLVFA
                     SQIIAGIASAGVVSCLFPGPLSVGTRLGGGTSISQGLFIEMFLTAHLVFVVIMLAVVK
                     QKSTFLAPVGIGLVLFVNQLVGTYYTGCALNPARALGPDVINRSFPGYHWIYWVGPLL
                     GSLLASGFYGFLSIFHYETVNPGQDFNQWEAAAGPGPWHEEINKHSGAPNHSHLSGDQ
                     PTLHQDNV"
     exon            complement(834440..834750)
                     /number=1
     exon            complement(834831..835131)
                     /number=2
     exon            complement(835215..835457)
                     /number=3
     CDS             join(842267..843789,843980..844004)
                     /codon_start=1
                     /locus_tag="AO090011000330"
                     /note="predicted flavoprotein involved in K+ transport"
                     /old_locus_tag="AO070316000025"
                     /protein_id="BAE64846.1"
                     /transl_table=1
                     /translation="MSLPSYDALVVGAGFGGIYQLYSLLKLGLTVKLVERAEGPGGTW
                     YWNRYPGATSDTPSHLYRYSWDKEDLQSYSWSHNYLERKEVLAYLEHVVERHDLRRHM
                     QFHTEVVSAIWNDDSCTWTVESSQGSFMSRYLITSLGIITEPNWPNIPGRDQFQGSLY
                     HTARWPDQYDLKGKRVGLIGNGSSGVQVITAIAQDVESLVCFQRHPQYIVPAGKRAVS
                     QEERNTINKAYDEIWQKVKQEIGGMGVEEAKTSAMSVVDEERERIYQAAWDDGGAFRF
                     LLGTFNDLILNEASNRAACDFLKKKIDQIVQDPEKRRKLTPSELYARRPVCADGYYEQ
                     FNRENVDVVDIAESPMLEFTRDGIKLADGTVHKLDVVICATGFNAFDGAYRRIDVVGR
                     EGKTLNEYWKDGPTTNMAVATAGFPNLFMIFGPQTPLTNGPPAIEAHVEFITGAISRA
                     EKHRKEQSTLPTPAKIVIESTEEGEAAWGGLCNAISDAALFRTAASYFNGVNVDGKPR
                     LPGLVRM"
     exon            842267..843789
                     /number=1
     exon            843980..844004
                     /number=2
     CDS             join(845399..845556,845616..845886,845952..846294,
                     846367..847298)
                     /codon_start=1
                     /locus_tag="AO090011000331"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070316000026"
                     /protein_id="BAE64847.1"
                     /transl_table=1
                     /translation="MTTHKDSPSIGVNEDPILPAVTTKNQDQQDGVRVAEAVTASWSK
                     KSLIVTYASMWMLYFVNGLNNNLTSNLSAYITSDFSEHSLLTVISVVTSVMGAACVMP
                     IAKVLNLWDRTLGISIMVLIAIMGLIMMAGCNNITTYCAAQAFYTVGFTGTIFCVDVI
                     TSDTSSLRNRGIAYAFTSSPYIITAFAGSPLSNQFHETNWRWAYGTICIILPIVASPL
                     IITWELAKRKADKEGRLQYKPRSTRTWWQSVWYYIIEFDIIGIFFMIGGLILFLTSFN
                     IAGNTKGEWKSAKIIAMMVVGFCVLAAFVAYERWGAPKPFIRFALLSNRTVIGACLLD
                     ITYQVSYYCWASYFTSFLQVVFNTSLTQAGYISAIFDLMDPVWLIGCGYLIRVTGRFK
                     WLLMLAVPLYLLASGLMIYFRAPGHSVGYMCMCQIFLAVGGGTMILIEQIAVLAAAKH
                     EDYASMLALLSVFGNVGGAVGNSVSGAIWTNTLPKKLRELLPAETKDQWADIYESLDV
                     QLSYPVGSPTRTAIQNAYAFSQRNMMIAGTAVMGLSIGWVLMMRNIKVKGNKNVTQVL
                     F"
     exon            845399..845556
                     /number=1
     exon            845616..845886
                     /number=2
     exon            845952..846294
                     /number=3
     exon            846367..847298
                     /number=4
     CDS             join(848076..848262,848324..848725,848784..849112,
                     849171..849508,849560..849707,849767..849871,
                     849930..850142)
                     /codon_start=1
                     /locus_tag="AO090011000332"
                     /note="predicted flavoprotein involved in K+ transport"
                     /old_locus_tag="AO070316000027"
                     /protein_id="BAE64848.1"
                     /transl_table=1
                     /translation="MSDSSSIPTPALPSYSQVACIGAGASAIALGASLKRWYGLEDIR
                     FFERQTDYGGTWHINTYPGCACDVPSALYSFSFAPNAQWSKLMPSQQEIKSYQDGVVA
                     TYDLKQRMTFRTEVKRCVWRDDASRWVLFLLNVETGEESTHECQVLFSATGHFAEPRP
                     CEIPGASSFQGNIIHSARWDHSVSLEGKRVVVVGNGCTAAQIVPAIVKRTKHLTQIIR
                     SQHWIFPATNFTYPKILKWIFEYIPLALKLHRLHIFLLAENGFRMFPMTDRAARLRQK
                     RRIEVEKYMKETAPAKYHDILIPDFEIGCKRRIFDDGYLKSLHSENLSLTTAKILEIV
                     PEGVRTSDGIVAADVIVLATGFKTNQFTPFMEIVGRNGSLDDHWKRYDGPEAYNCSAM
                     SGFPNFFLLFGPNAGTGHTSALMAAENSVNYALRVLKPVFEKGADSVELTQVAEDEYS
                     QRVQEALRNRVWNAGCQSWYQNDKNWNAMAYPWSQAYFWYRSLFPINSHWNVRTRNPK
                     KFRIGKYWTILPIILSLSFLASRTGNTLAIGPTILDFGKNMLSSVRHATISGFKESLI
                     RGAKGLF"
     exon            848076..848262
                     /number=1
     exon            848324..848725
                     /number=2
     exon            848784..849112
                     /number=3
     exon            849171..849508
                     /number=4
     exon            849560..849707
                     /number=5
     exon            849767..849871
                     /number=6
     exon            849930..850142
                     /number=7
     CDS             851118..852122
                     /codon_start=1
                     /locus_tag="AO090011000333"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000028"
                     /protein_id="BAE64849.1"
                     /transl_table=1
                     /translation="MNPIFYLKVYVIRLLTRLFAWLDRRGGPLRPPGPNLTVNIPSIL
                     SESKGSFDVFFYFPPGYDRNDPKGNGFPVVLNFHGGGYCVGHARDDERFIAELTSRGA
                     VVASVNYRRAPESPYPVAIEDSLDALLYIWRNAASLNIDKHRTVLAGSSVGGHLAFTS
                     LLMLWKRMKDKRLQIDPSNLGTVKGIMAFYPVMDMTKSRAERAQSNPAFLALKKKPAS
                     SKKFIGSVFDEAFFWKLKEKPDKGFMYLSPGLAPEDSLKEALPPIISFKLAGLDYLLS
                     EEKEAVRRLGLLGKKVDCEVVEGVSHYWDHMARTPEMKELRDKCLGKAAEEIEQMWQS
                     "
     exon            851118..852122
                     /number=1
     CDS             join(852927..852973,853239..853556,853646..853649)
                     /codon_start=1
                     /locus_tag="AO090011000334"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000029"
                     /protein_id="BAE64850.1"
                     /transl_table=1
                     /translation="MSSIPPDPKTPAEWLKVLTADTPINLKIVPDTICWIYIYASILD
                     QPISVSVDGQEPLLLELGPGTGNVGVKLIVFPDKIDLEYLECYMRAVDEELHASLNTQ
                     LCIARALQWNDTAIASSLCS"
     exon            852927..852973
                     /number=1
     exon            853239..853556
                     /number=2
     exon            853646..853649
                     /number=3
     CDS             complement(join(853805..854141,854204..854248,
                     854301..854414,854451..854640,854696..855489,
                     855543..855676,855731..855877))
                     /codon_start=1
                     /locus_tag="AO090011000335"
                     /note="permeases of the major facilitator superfamily"
                     /old_locus_tag="AO070316000030"
                     /protein_id="BAE64851.1"
                     /transl_table=1
                     /translation="MSEAVLNSEKSPSSSDSSGTAVVETDGESKIPHVFNEQTNYVPK
                     STIITIFLACSTVDLIALMDQTTLASSLSIIGNALHASDKASWISGGYFVTSTCFQLI
                     YGRLSDIWSRKLVLFVGLGIFFIGSLAASLSQTATQLIVFRAFTGVGGGGLMTVAQMI
                     VSDVVPLRERGKYQGILGAVVAIANGIGPVIGGALSSINEDSWRWIFRLNLPLTAITT
                     LCVLFFMPLRKVTGDWKMKLKAIDFIGAFLALGSTAVLLLGLTWGGGEYPWASAHVIA
                     TIVVGFAVAVGFVIWQWKGATYPLVPMHIFKSRIVNGACLTMFINGWNFLVQVYYIPT
                     FYQLVFGYSTVKAGAMLLPVTLMQTVSSTVSGLVVHWVGRYRECILFGWMIWAVGLGL
                     FSTLDESSGLGKQIGYGLLTGVGVGNTLQPLILSCPSALIAVQAGVERKDMAVVTSFR
                     KYVYHNPTSRNLGGTLGLAIAGTIINNLITSSISSLGLTQSETRSFLSSPQNYLSKLP
                     QAEAERARSLLIPAYQKGFRIIFLIGAALAAVAFVLAFWLMPQVTLNRADDEKLKEEG
                     RKRVKGEGKCDEEVNEEERR"
     exon            complement(853805..854141)
                     /number=1
     exon            complement(854204..854248)
                     /number=2
     exon            complement(854301..854414)
                     /number=3
     exon            complement(854451..854640)
                     /number=4
     exon            complement(854696..855489)
                     /number=5
     exon            complement(855543..855676)
                     /number=6
     exon            complement(855731..855877)
                     /number=7
     CDS             join(856882..857074,857127..857956,858009..858545)
                     /codon_start=1
                     /locus_tag="AO090011000336"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000031"
                     /protein_id="BAE64852.1"
                     /transl_table=1
                     /translation="MANLNERNVYFGRDSLKKYFDPDCQPPLPLVELPEHLNPYHQDG
                     VRVYAKMMTMHPANNVKAMPAMNMLEKSVTPGKTNTIIEYSSGSTVISMSMIARVMHG
                     IQDTRAFLSNKTSEAKLQLMQFFGLNITLFGGPSQPEPYDERGGIQSARRMALDSDSV
                     LNPNQYENDNNWQSHIRWTGPQIYKQLPEINVLCAGMGTSGTMTGLGTYFKEAKPSVL
                     RLGVCTAPGDRVPGPRSFALMKPVEFPWKAAVDVIEEVNSSDSFSLSLDLCREGIVCG
                     PSSGFNLQGLFQMLEKRKAAGTLSEIAGPDGSIHCVFLCCDLPYQYIGEYFQKLGADK
                     FHPIQNERLTKVDLYRYDESWERSPVVLFTHFYNTPNVLSECLLSDIKLRPLCCVLDL
                     RTTADFASWHLPGSVNIPLRSLDSHTVKPFSDPGVLEAQWSELEAMFKDPSVITKLDS
                     HHVLVICYNGDTARVATSVLRAKGIEADSLRGGYQALKDHGLWGSSGVESVEKNTYPT
                     TTTTELSVSTN"
     exon            856882..857074
                     /number=1
     exon            857127..857956
                     /number=2
     exon            858009..858545
                     /number=3
     CDS             join(860162..860322,860369..860467,860515..861489,
                     861568..861583)
                     /codon_start=1
                     /locus_tag="AO090011000337"
                     /note="ferric reductase, NADH/NADPH oxidase and related
                     proteins"
                     /old_locus_tag="AO070316000032"
                     /protein_id="BAE64853.1"
                     /transl_table=1
                     /translation="MFVLALIHTFPFIVFNIWKGQMVEKWNTSVVYWTGVAALITQAY
                     LTFMSLPSIRNRYYEFFKATHFLVALLFLLFFFFHCDFRLTSWDYFVAGGAIYLFSLF
                     AAWTRTHLINGRHSATIDLLPCGFVRIRIPTIMSWRPGQHVFIRFFSPQLGLHCLTAH
                     PFTICSLSHDPDKVGKASEIVFYVKPRHGITARLAKIAAKSPVFSQTVLLEGPYGGIS
                     DTASPAEFDTVLVIAGGSGGGFSLAIVEEALRVYGNMPDLQQRNMQVVFATRNSKVAE
                     WYREEIGDRVSMYDVPDKRISVSIHDTSLEQAEKPVSAPGDKEPSNEITDEIEPALSE
                     KGHDVAATNKHMSTVVHGPRPDLPRLINTATSTGSHRMAIFACGPASMLHDVRNAAAE
                     AQKRALRGGAEVYLHTESFSIIRL"
     exon            860162..860322
                     /number=1
     exon            860369..860467
                     /number=2
     exon            860515..861489
                     /number=3
     exon            861568..861583
                     /number=4
     CDS             complement(join(862453..862912,862970..863136,
                     863326..863437,864046..864062))
                     /codon_start=1
                     /locus_tag="AO090011000338"
                     /note="60S ribosomal protein L7"
                     /old_locus_tag="AO070316000033"
                     /protein_id="BAE64854.1"
                     /transl_table=1
                     /translation="MASTATTVPTQDHVLVPETLLKKRKSQEQARAVAREEAEKKKAA
                     SKEKRAAIFKRAESYVKEYRDAEREKIRLARVARKEGNFYVPEEPKLVFVIRIKGINK
                     ISPQPRKILQLLRLLQINNGTFVRLTKATQEMLTIINPYIAYGYPNLKSIRELIYKRG
                     YGKVNKQRVAISDNQIIEENLGKYGIVCVEDLIHEIYTVGPNFKQANNFLWPFKLSNP
                     TGGFHKRKFKHFIEGGDYGNREENINALIRQMN"
     exon            complement(862453..862912)
                     /number=1
     exon            complement(862970..863136)
                     /number=2
     exon            complement(863326..863437)
                     /number=3
     exon            complement(864046..864062)
                     /number=4
     CDS             join(864374..864849,864910..865222)
                     /codon_start=1
                     /locus_tag="AO090011000339"
                     /note="RNA polymerase II transcription factor complex
                     subunit"
                     /old_locus_tag="AO070316000034"
                     /protein_id="BAE64855.1"
                     /transl_table=1
                     /translation="MASRRGVGLGAFANRSQASQSYANHGANLRSTHLSSLQAQLSVF
                     QSLLHTFALEHSSTIKSNPTFRAEFARMCNAIGVDPLAASNVRGKNGRKGMGEGASFW
                     TQIMGGDMNDFYFELAVRIVELCRDTRSENGGLIGVEECRKRVGKGKAIGSGLEVTDD
                     DVLRAVKALEPLGSGFSIVRVGSKQYIRSVPKELNTDQATVLEVIQVLGYVSISMLRV
                     NLNWEKARAQTVIDDLLADGLVWLDAQGEENEYWSPQNLLDDSG"
     exon            864374..864849
                     /number=1
     exon            864910..865222
                     /number=2
     CDS             complement(join(865897..868151,868226..868556))
                     /codon_start=1
                     /locus_tag="AO090011000340"
                     /note="translation initiation factor 3, subunit c
                     (eIF-3c)"
                     /old_locus_tag="AO070316000035"
                     /protein_id="BAE64856.1"
                     /transl_table=1
                     /translation="MSRFFYGSGSDSDSSSDEEELLTDREEEEKSEEESSEEEEETSE
                     EESSDDEGETGANRFLRDASESEESEDEEKVTVVKSAKDKRLEELEGIIKLIENAEKI
                     NDWAVISSEFDKLNRQVVKVTQSGPVPRIYVKAVADLEDFVNETITKQKSAKKMNASN
                     SRGFNAVKQRIKKNNKEYATHIEKYRSDKDGYMEGKEEEAKPAIVAPRLTKVERVVEA
                     PAAATSTDDGFATVGRGGKTLQYTPESILKHLRVIVESRGKKNTDRLEQIKTMEKLLE
                     VAQTPYQRIRVYLTLLSTRFDISSTSSANYMSVDQWKLAEKELAALLSVLETNRDHVV
                     TEGAEEWEDDEKQPQVKPGETLHIPGSIVSHVERLDDELTRSLQHIDPHTAEYIDRLS
                     DEKQLYTNLVRVQAYIEGLVEAEKSDMRQDSLNRVVMRRLEHIYFKPSQVVTILEEGT
                     WKALPSELDSKVTPRGNAGDVTGLVQTLCNYLFTYSDGIIRARAMLCQIYFLALHDQY
                     YRSRDLMLMSHLTENISNFDVNTQILFNRTLVQIGLCAFRAGLIYEAQNTLSEVCGSG
                     RQKELLAQGIILQRYSTVSPEQERLERQRQLPFHMHINLELLECIYLTSSMFLEVPLM
                     AQTSSSPELKRRIISKTFRRMLDYNERQVFTGPAENTRDGVIMSAKFLAAGDWKKAAE
                     MLNSIKIWDLMPQPDKIKEMLSQQIQEEGLRTYLFTYAPFYDSLSISTLSNMFELSEK
                     KIAAIISRMISHEELAAALDQVNDAIVFRKGVELSRLQSQVVTLADKSMNLLEANEKT
                     LEQRTQGMANAFQRDQGAGARGGRGPGRGGQARGGPRLPGGQQGRRPGGQQFSGGALG
                     GAIKA"
     exon            complement(865897..868151)
                     /number=1
     exon            complement(868226..868556)
                     /number=2
     CDS             complement(join(869721..870490,870544..870902,
                     870912..871085,871141..871611,871666..871865,
                     871915..872186,872212..872800))
                     /codon_start=1
                     /locus_tag="AO090011000341"
                     /note="dual-specificity tyrosine-phosphorylation
                     regulated kinase"
                     /old_locus_tag="AO070316000036"
                     /protein_id="BAE64857.1"
                     /transl_table=1
                     /translation="MDSQWQPYQDPLMGRPAQLNNGLTSNPPQLGPKYGGQPQQSQPP
                     VGYTYEAFQTPGIAAKPASTGMNSKSVSMASSPAATPRSRDYVTDADTTMEDADPYNR
                     AKYSARPSHHSRPSSQYFPTEESSAARRYSPMNVLSPSMPYNTSPGKPHNAYAFPPGP
                     NQTRRSPTRVPNYSSPPQPFQSPPCKLTSSCGLMKLAGSRAPRLPPLQPTDMSPEQFY
                     PPSAGSQLSAPFGQDGRSPRSASISGGSQQPGRGPVPKFQKIKSVQELKPRVNAQPPF
                     RRANPEGGFISPLQALTTHLPATYRICNPGFNYESSRNPRRVLTKPSKGVKNDGYDNE
                     DSDYILYVNDILGSEEAGHKNRYLILDVLGQGTFGQVVKCQNLKTQEVVAVKVIKNKT
                     AYFNQSMMEVSVLDLVSCPLLSTRVTCLLLSQLNSRYDKNDDHHLLRLKDTFIHRQHL
                     CLVFEILSVNLYELIKQNQFRGLSTTLVRVFAQQLLNALSLLNKAHLIHCDLKPENIL
                     LKNLESPIIKVIDFGSACDERQTVYTYIQSRFYRSPEVLLGLPYVDIQCSLPPHDVHL
                     RLTYSSAIDMWSLGCIVVELFLGLPLFPGSSEYNQVCRIVEMLGLPPTWMLEMGKQSG
                     EFFEKTQDEFGRKTYRLKGLEQYSREHGTKEQPSKKYFQASTLEEIIRSYPMPRKNMK
                     QAEIERELNNRVAFIDFVRGLLSINPLERWSPQQAKLHPFITQQKFTGPFVPPMNLKY
                     SSLNKTVAPGIQQQQQAEAASKQRAAQAAHAQSAAQTAYSMQLNQFHTPTHAQPPPPM
                     YNGVFTGHQQGAPPPYPTQQPPGYGHQMNLMPGQMPQSQYAPSQSLYAQATTRAGRQR
                     ASTMDPQGGGIPPTIQRVASHLDPNAPIRLQPSPAYYPPPPDGYVDAGAANQRRRGSR
                     AGGTRNRDFIRTLEDGVLGGDGFMGQNQWH"
     exon            complement(869721..870490)
                     /number=1
     exon            complement(870544..870902)
                     /number=2
     exon            complement(870912..871085)
                     /number=3
     exon            complement(871141..871611)
                     /number=4
     exon            complement(871666..871865)
                     /number=5
     exon            complement(871915..872186)
                     /number=6
     exon            complement(872212..872800)
                     /number=7
     CDS             join(874863..875063,875284..875637,875845..878200,
                     878482..878504)
                     /codon_start=1
                     /locus_tag="AO090011000342"
                     /note="transcription-coupled repair protein CSB/RAD26
                     (contains SNF2 family DNA-dependent ATPase domain)"
                     /old_locus_tag="AO070316000037"
                     /protein_id="BAE64858.1"
                     /transl_table=1
                     /translation="MEAEPDSLSQNEHPKDERAMLLGAVSSAIPVHSDQVPATGTDET
                     SRLRELQADVRDQDDLERDISRQPIGTSARVRLHNEIQKLETRNAALANDLKEIQQRI
                     NERHEGQESGGPAMGTGRMPNESRRDYLIRTGKITPFSKMSTGPNEGPLASLHDALID
                     AEDERDEREALEQVRNRSAVSHRNLSPSEDEEDFVPEGTPPRSASRSKAKKTPDDVED
                     FSGLDDGNEKVYQSRLQSWVTRRSAARKRALQGSTDAHEHEEQEEWFMPHPTVPDVDY
                     DNGYRIPGDIYPLLFDYQKTGVQWLWELQQQQVGGIIGDEMGLGKTIQVISFLAGLHY
                     SKKLTKPVIIVCPATVMKQWVNEFHRWWPPFRVSILHTSGSGMVNIRNESSREDALLS
                     QTWDSRRSLGGLKAGRKVVKRVVEEGHVLVTTYSGLQTYTPLLIPVEWGCAVLDEGHK
                     IRNPNTSITIHCKELRTPHRIILSGTPMQNNLTELWSLFDFVFPMRLGTLVNFRNQFE
                     FPIRQGGYANASNLQVQTAAKCAETLKDAISPYLLQRFKIDVAADLPKKSEQVLFCKL
                     TKLQRQAYKSFLGSEEMQSILRGRRQVLYGVDILRKICNHPDLQSHKLTSHKAGYGNP
                     DKSGKMQVVKSLLELWKDTGHKTLLFAQHRIMLDILQKFVESLSGFNYRRMDGTTPIA
                     HRQSMVDEFNNNPDLHVFLLTTKVGGLGVNLTGADRVIIYDPDWNPSTDVQARERAWR
                     LGQKRDVTVYRLMTAGTIEEKIYHRQIFKQFLTNKILKDPKQRQTFQLSDLHDLFSLG
                     EDGQGPTETSKIFKEADITYKEGGSTTTQQTCTGTRVQSHPRNQQDEKKDVSLVEGIA
                     SIENFQGDSEPPSDRDQGPPGANKESRIMEGIFARSGVHSAVEHDQIVNGKRVVRADP
                     KIIEAEAKKVAAEAAEELHRAGEAARSVPIGTPTWTGQFGLAGRPEEPAARPAFGGGW
                     TERSR"
     exon            874863..875063
                     /number=1
     exon            875284..875637
                     /number=2
     exon            875845..878200
                     /number=3
     exon            878482..878504
                     /number=4
     CDS             join(880340..880634,880701..880805,880875..880987)
                     /codon_start=1
                     /locus_tag="AO090011000343"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000038"
                     /protein_id="BAE64859.1"
                     /transl_table=1
                     /translation="MKFFSSLALLVSAVAANPILRTRDTPKNFHLKTTGADNSAHNDL
                     YVYGYHTGAGFNDAVLTSDVGTASPAFLNGTNVQFSLDTPFPWGLVMRPQNNYGAWEP
                     VEINTGYGSGSFSINDDSLEWSEQQGFGGWLVCDWYHNAPQLFYLYKYREPTIPSSCS
                     KVQLAVEPVS"
     exon            880340..880634
                     /number=1
     exon            880701..880805
                     /number=2
     exon            880875..880987
                     /number=3
     CDS             join(882134..882233,882292..882894,882963..883099)
                     /codon_start=1
                     /locus_tag="AO090011000344"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000039"
                     /protein_id="BAE64860.1"
                     /transl_table=1
                     /translation="MRSFALLPVLCLLVLLGMVSAWPHPHGEVVARAETTSAETAADK
                     ATTGAAATTEQSATKTESQSDATETGKKTGKETGTATGTKTGTATGKSTKTGTDASST
                     SIDPRDPVGGISMLTSAGATTYYKIGEYVTFQWKYTSLQVTPSAVNVVASCSKNSETY
                     TIASNMSVSETGKVVWDTKKYQSNATVPLLTATYTLYVYDVNSTLGDTASAGHLGSQI
                     GYNFGMYTPQSYTPLDHYICATCNSALTSTERNAIKFAVGMAAITVASFTWFASGTGA
                     FST"
     exon            882134..882233
                     /number=1
     exon            882292..882894
                     /number=2
     exon            882963..883099
                     /number=3
     CDS             complement(join(884243..884404,884455..885111,
                     885167..885451))
                     /codon_start=1
                     /locus_tag="AO090011000345"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000040"
                     /protein_id="BAE64861.1"
                     /transl_table=1
                     /translation="MASTSQAAPKFPTVPVVVPKVEFPSKPGQPKVSETKPNNSNTNQ
                     TNVIKSEGDNINVNTTSSPAIKQDSDASKQVSESEMQLVSSLAKLQELEAMIHQLRTL
                     LPDRLLEPLVPIVNPKAAAGRAVPRSPQMLYEQLSQAAKAGVAEVTEFQNMWRSPEMN
                     AVWERVDAQIKENGGQLLQPTGVWDRNYGTLLEELVKEENARMEQQRKSEEELERSRI
                     QSTEGGWRAIVDSFIQKNVPGVRVLPTKSETSVTVVLPKAGMTFKVHTIGGSEVNGVP
                     EWQVSSRTMPGQVKTKLESAVSDCLNSRSRQWDLAYLLDMISSYSDVKQTPCVKCGRM
                     TDNAAQLPAVRQQKQQSDPQQPPIWEAYHSSCI"
     exon            complement(884243..884404)
                     /number=1
     exon            complement(884455..885111)
                     /number=2
     exon            complement(885167..885451)
                     /number=3
     CDS             complement(join(886117..886301,886361..886627,
                     886680..887337,887391..887837))
                     /codon_start=1
                     /locus_tag="AO090011000346"
                     /note="cytochrome P450 CYP4/CYP19/CYP26 subfamilies"
                     /old_locus_tag="AO070316000041"
                     /protein_id="BAE64862.1"
                     /transl_table=1
                     /translation="MLAQIAPLFGALCITFLVLQYLQRLYQQRKRAQSLGCQPAAQGP
                     SGIFGIRSFVRLLNEVRHKRWVEYIAGQYGRYGNTYTQKALGKWMVSTIEPENIKALL
                     ATQFNDFGLGTRHREFYPLLGDGIFTLDGPGWSHARGLLRPQFTRDQVADLELMDGHI
                     SRMIDLIPQDGSSFDIQRLFFLLTIDSATHFLFGESVGALESSNSASLLGRSSVGSAQ
                     GFAEAFGTAQDYLTTRSRAMHFYWMVNPKEFREANQRVHEVVDHYVQLAIQSKNNPDK
                     KSDRYIFAEALAADNDDPKVLRDNMLNILVAGRDTTASLLSSAFFYLSRNQDVWKKLR
                     QTIIDEFGDSQNPKGEITQAKLKDIPYLRYVLNEVLRLLPPVPLNFRVAAKDTSLPVG
                     GGPDGRSPVFIPKGQVVAYSVYAMHRRTDLYGPDSHSFRPERWEENGRRGWDYLPFNG
                     GPRICLGQQYALTEASYTLVKLVQRFDTLECADPELKQPAILSTLTMSHDRGVKVRLS
                     SSVPKCWFNQ"
     exon            complement(886117..886301)
                     /number=1
     exon            complement(886361..886627)
                     /number=2
     exon            complement(886680..887337)
                     /number=3
     exon            complement(887391..887837)
                     /number=4
     CDS             complement(join(888218..889493,889577..889791,
                     889850..890068))
                     /codon_start=1
                     /locus_tag="AO090011000347"
                     /note="hydrolytic enzymes of the alpha/beta hydrolase
                     fold"
                     /old_locus_tag="AO070316000042"
                     /protein_id="BAE64863.1"
                     /transl_table=1
                     /translation="MRFDLFLILSSLAILAGPAVGLGLFRGSRYMRELQLAAELNLDP
                     RSLSKKNTVHSVLAKANTQIEKVTTEYITIPIDHNDTSVGTYQNRFWVNDDYYEAGRP
                     IIMYDAGETNAESIAKNHLTSSLSFFRKILEDTHAMGIIWEHSRDTPPEHFKYLTTKQ
                     ALEDIPYFARNFSRPKFAEHDLTPSSTPWVLVGGSYAGIRAAFARNKYPDVIFAAYSS
                     SAPVQAQLNMSIYYDQVYRGLVGHGFENCAKDIHAALGYIDQQLSNNHTAAAIKKLFF
                     GPGADQNSNEGFTAALATIYSYFQNYGLDGPEGTLRELCEHLEVDPTTKEAAGPDGFA
                     PVRGSKHVAERWAAWPAFTPLVNNFMETNCRGLSDPAKPSCKLDMTYYDPDSISWSWQ
                     YCTEWGFYQSSNFGPHSLLSRYQTLEYQQEVCNNQFALAVANGVLPSYPQTEALNKEY
                     GGWNIRPSNTFFTGGEFDPWRTLSMLTTEDIAPEVAPDGITFSTKIPNCGETSEDKVF
                     GYLLKDSEHCYDFQGLSTEGKAARDLFKEALTKWLPCFKPSSSKASMVNVTQAEITKG
                     AVM"
     exon            complement(888218..889493)
                     /number=1
     exon            complement(889577..889791)
                     /number=2
     exon            complement(889850..890068)
                     /number=3
     CDS             join(893073..893328,893384..893485,893546..893667,
                     893723..893792,893841..893916,893964..894015,
                     894067..894278,894329..894550,894623..894869,
                     894942..895082,895145..895201,895276..895305)
                     /codon_start=1
                     /locus_tag="AO090011000349"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000044"
                     /protein_id="BAE64864.1"
                     /transl_table=1
                     /translation="MLSRTILFSTSFLWVRVANAAFGITTSDDSYVIDAGSANPLKFT
                     VSRSSCDITSINYYGSELQYSGTGSHIGSGLGSADVSAVEDGDYIKVTCDTDTLTQYF
                     VVHNGDSVIHMATYTTEEPSVGELRFIARLNSELLPNEEPFGDVSTTSGGEAIEGSDV
                     FLVDGETRSKFYSSQRFIDDQRHCVAGDAHRVCMILNQYETSSGGPFFRDINSNNGGS
                     YNSLYWYMNSGHVQTEDRRQGLHGPYSMYFSRSGTPSTDIDTSFFANLDIKGYVATDG
                     RGTVSGTASGADSSFKWVVHWYNADAQYWTYTSSDGSFTSPAMKPGDYTMVYYQGEYK
                     VAETSVSVTVGSSTSKDISGSVETGDTIFKIGDWDGTPTGFRNAENQLRMHPSDSRMS
                     SWGPLTYTVGSSELTDFPMAAFKGVNDPVTIKFTATSAQTGAATLRIGTTLSFAGGRP
                     QATINDYEGSAPSAPTNLNSRGVTRGAYRGLGEVYDVNIPSGTIVEGENTITISVISG
                     SSGDEFLAPNFIFDCVELFQ"
     exon            893073..893328
                     /number=1
     exon            893384..893485
                     /number=2
     exon            893546..893667
                     /number=3
     exon            893723..893792
                     /number=4
     exon            893841..893916
                     /number=5
     exon            893964..894015
                     /number=6
     exon            894067..894278
                     /number=7
     exon            894329..894550
                     /number=8
     exon            894623..894869
                     /number=9
     exon            894942..895082
                     /number=10
     exon            895145..895201
                     /number=11
     exon            895276..895305
                     /number=12
     CDS             complement(join(896442..897730,897812..898091))
                     /codon_start=1
                     /locus_tag="AO090011000350"
                     /note="atrazine chlorohydrolase/guanine deaminase"
                     /old_locus_tag="AO070316000045"
                     /protein_id="BAE64865.1"
                     /transl_table=1
                     /translation="MAPAYIVFVGVFVHLPRSTSKALAIQQGALWVSVADGRIKGADW
                     TVITESDLRDFLKEKSWVLEDAPRYKSGTRVKIVRAREEHNEFFFPGFIDTHIHAPQY
                     PNNGLFGSTTLLDWLKQYTFPMEASFGSSLSNIPSPRAFRVYNQVVSRTLANGTTFAS
                     YFATIHVSATNLLATLCHKRGQRALIGRVCMDNPNFSEPYYIDPSTEESVELNKEVIS
                     YIHSIDPQGTMIKPIITPRFALTCTPKAMRGLADLASSYEPPLHIQTHISENTQEILD
                     VHCQFPSAKSYADVYDTYGLLTPRTILAHGVHLSPDEQDLIHDRGAKVSHCPASNSAL
                     GSGICPVRKLLDKGITVGLGTDVSGGYSPSILEAVRQACLVSRLLRHVEPASEGDEGK
                     KLVLSVEEALYLATRGGAAAVNMENDIGGFDDGMLFDAQLIHLGRFLPASRYDNGESQ
                     VDVFGWETWEEKIHKWVWSGNDRNVKGVWVGGKLVHGEDAVEGEIRSGWWTWVLSAGV
                     VGVGAVVALRRLRL"
     exon            complement(896442..897730)
                     /number=1
     exon            complement(897812..898091)
                     /number=2
     CDS             complement(join(899098..899153,899218..902356))
                     /codon_start=1
                     /locus_tag="AO090011000351"
                     /note="glycine dehydrogenase (decarboxylating)"
                     /old_locus_tag="AO070316000046"
                     /protein_id="BAE64866.1"
                     /transl_table=1
                     /translation="MAASWCALRGTRQLALRTRLRSAPSPIALRKATPSSPFRATHRA
                     LHTATQQPSRRPVYTSSVADHGDPHPRDLFQPLDTFPRRHIGPSPDAAKEMLATLDPP
                     VASLDEFVKQVLPADILSKKDLKVTDPHAKTNLYRDNVGGGLGETDMLKLLDVYRKQI
                     DVSGKTYIGTGYYGTIVPPVILRNVLENPAWYTSYTPYQPEISQGRLESLLNFQTLTA
                     DLTGLPFANASVLDEATAAAEAMTMSFATMPASKQKKPGKAYVVSHLCHPQTIAVMRS
                     RAEGFGINLVIGDILADDFKLVKEQGDNLIGVLAQYPDTEGGIYDFQALSDNIHGAGG
                     TFSVATDLMALTVLKAPGEFGADIAFGNAQRFGVPMGYGGPHAAFFACVDKYKRKVPG
                     RVVGVSKDRLGNRALRLALQTREQHIRREKATSNICTAQALLANMSAMYAVYHGPTGL
                     KSIAQRIMSMTSTLQAKLAALGYNVPIKTNVADGGAIFDTVTVELPTSQEADAIVAAA
                     REQSIFLRRVNSTKVGISLDETSGRDEVKSILQVFATHASKGEVSIDGELGISPLPAS
                     LERTSEYLTHPVFNTHHSETEMLRYIRHLESKDLSLAHSMIPLGSCTMKLNATTEMIP
                     ISWPEFSQMHPFLPADVAKGYTQMIDDLEQQLADITGMAEVTVQPNSGAQGEFAGLRV
                     IKKYLEAQGESKRNICLIPVSAHGTNPASAAMAGMKVVTIKCDTKTSNLDLEDLKAKC
                     EKHKDELAAVMITYPSTFGVYEPGVKEACEIVHQHGGQVYMDGANMNAQIGLCSPGEI
                     GADVCHLNLHKTFCIPHGGGGPGVGPIGVAEHLRPFLPSHPASEYLQSKRTESSSPPI
                     SAAPWGSASILPITFNYINMMGAKGLTHATKITLLNANYILSRLKEHYPILYTNENGR
                     CAHEFILDVRKFKETCGVEAIDIAKRLQDYGFHAPTMSWPVSNTLMIEPTESESKAEL
                     DRFCDALISIRQEIAEVESGAQPREGNVLKMAPHTQRDLLSNEWNRPYTRETAAYPLP
                     YLVEKKFWPSVTRVDDAYGDQNLFCTCGPVEETD"
     exon            complement(899098..899153)
                     /number=1
     exon            complement(899218..902356)
                     /number=2
     CDS             complement(join(903353..903476,903539..904000,
                     904055..904272,904320..904465,904516..904563,
                     904649..904718,904785..904913,904967..905006,
                     905075..905295))
                     /codon_start=1
                     /locus_tag="AO090011000352"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070316000047"
                     /protein_id="BAE64867.1"
                     /transl_table=1
                     /translation="MSYSSSEKDPGADTRIEDVNQPALNDVDYDEEYTYAEQRKIIHR
                     VDRRLVTITGLAYCVSLMDRTNLSMAAVAGMTKDLGLTIGTRYSVMVLIFFVPYVIFQ
                     PPMTVITRKIGPTYFLGTIVILWGAILVGMGFAKNWKHMVATRALLGILEAGYFPGCV
                     YLLSSWYTRFDVQKRFSVFYLIGCVASALSGILAFGLMQMGGLQDLEGWRWIFIMEGV
                     ITGVIGILTITFLVDFPDKAHKSWRFLNEKECAFIVRRINRDRSDGDVEPFSLKRFLS
                     PALDLKIWGFAMIFFCTTTVTYAIAYFLPIILERGMGFSTAAAQCLIAPPYVFAGIVM
                     YATAWIGDKYRLRGAIVVFNALLCIIGLPIMGFAKGNAARYVGVFFAVAGANSNIPAC
                     MAYQANNVRGQWTRAFSSATLVGFGGIGGIVSSLVFRSQDAPGYRPGMWTTIACNLLM
                     LVIVAAMSLWFRRSNREADRGERVIEGSPEFRYTI"
     exon            complement(903353..903476)
                     /number=1
     exon            complement(903539..904000)
                     /number=2
     exon            complement(904055..904272)
                     /number=3
     exon            complement(904320..904465)
                     /number=4
     exon            complement(904516..904563)
                     /number=5
     exon            complement(904649..904718)
                     /number=6
     exon            complement(904785..904913)
                     /number=7
     exon            complement(904967..905006)
                     /number=8
     exon            complement(905075..905295)
                     /number=9
     CDS             complement(join(907150..907482,907531..907817,
                     907864..907956,908031..908055))
                     /codon_start=1
                     /locus_tag="AO090011000353"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000048"
                     /protein_id="BAE64868.1"
                     /transl_table=1
                     /translation="MPHMKDWNVPILLGTNTDEGTSFGTTGTDTDEECIEQLISSKRW
                     VLNREQATKLLTFYPNDPALGCPYGWGNTTWPNLGLMYKRYESMAGDLTMVGPRRLLA
                     QNMVKYRNEVYSYRWDVPALNTSSTIGVGHFAEIPFVFANPVQNITALGDDPARLELG
                     NLAARMWTSFVVDLDPNGHNGMCLIIIEKLDIGRNLTYAVANIPQWPQYSQETSNFVF
                     RLPKDGSYIETDTYRADGIDYINSIPR"
     exon            complement(907150..907482)
                     /number=1
     exon            complement(907531..907817)
                     /number=2
     exon            complement(907864..907956)
                     /number=3
     exon            complement(908031..908055)
                     /number=4
     CDS             complement(join(908149..908371,908422..908540,
                     908604..908711))
                     /codon_start=1
                     /locus_tag="AO090011000354"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000049"
                     /protein_id="BAE64869.1"
                     /transl_table=1
                     /translation="MSYIVRQGALNDKPVLGVSINYRLAAFGLLDSEEVRASGNNNLA
                     LRDQRNAMRWVKQNIEAFGGDPDKVTIWGESAGAYSVGAHLIANDGDNEGLFRAGGLH
                     PILIDGPVSNSTAIMESGNANGPPWNGTEWYQPMYDRISNKTGYDYL"
     exon            complement(908149..908371)
                     /number=1
     exon            complement(908422..908540)
                     /number=2
     exon            complement(908604..908711)
                     /number=3
     CDS             complement(908770..909318)
                     /codon_start=1
                     /locus_tag="AO090011000355"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000050"
                     /protein_id="BAE64870.1"
                     /transl_table=1
                     /translation="MACHYQKLLWVALTLGVSVSALPGSSKATRADGSPSPPVATIKS
                     NNAQTETVFVGRSLPEFDQELFLGIKYADKPVRFTPSSLKTSYTADDSDSGAYTASMD
                     DLNISQEAVLYNATEYGYECPGYGSDETKLVDMGLIQLNEDCHNLNIIRPKLHPNETQ
                     LLPVMLWIFGGGWQQGATADPR"
     exon            complement(908770..909318)
                     /number=1
     CDS             complement(join(911863..912322,912378..912886,
                     912956..913174))
                     /codon_start=1
                     /locus_tag="AO090011000356"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000051"
                     /protein_id="BAE64871.1"
                     /transl_table=1
                     /translation="MGIPDDILLADAAGRIPSGMSLEYLAESRDCPAIVGIIFLVCFT
                     GVIMIVRLYARIWLVKKLGLDDVLAILTMMIYISFVVLSLVLIDLGSGRHMDYIQYVL
                     AMPTVRQTEVLDFVAHVLYTTALFFCRLSGLAFYHRLAARSSKLHLAIKIAAGFLFAA
                     YLPQLFLIIFHCRPVTGLWPYPWQEEPISYNCLTWGLVYSVNSGVSLTCDVLMFIIPT
                     ILIKELHVSMKRKAQLSLVMFPGVLVIVISAVRVYFVAVGQWADDGSWAYDPMMVIEN
                     AEIAGTLIALSVPALKPVFGNIFTHLTEYTLSTRNRSNMKSQSKPTSGIKSRARDSKR
                     LLSWSKHGYDDYEMMSSETNIPPSGPVQSTEPGSPGNKSIGVTTEVSIFHGQQEADQR
                     HIV"
     exon            complement(911863..912322)
                     /number=1
     exon            complement(912378..912886)
                     /number=2
     exon            complement(912956..913174)
                     /number=3
     CDS             join(914179..914492,914550..916008)
                     /codon_start=1
                     /locus_tag="AO090011000357"
                     /note="amidases"
                     /old_locus_tag="AO070316000052"
                     /protein_id="BAE64872.1"
                     /transl_table=1
                     /translation="MVSKVFGRLLTTGLVLANSVSASTEAAHDDSLVASQVVTNPYEY
                     DFPTLGATGASLFPMRLCNGFKLEEASIDAIQEQLGAGNLTSVELLQCYLERIHQTQP
                     YLNAILQVNPDAFKIAKALDEERAQGKSRGPLHGIPFIVKDNIASKDRLETTAGSWAL
                     LGSVVPRDSYVVHGLRKAGALLLGKAALSEWADMRSNNYSEGFSARGGQCRSAYNLTV
                     NPGGSSSGSGVGVGANLIPFALGTETDGSVINPAQRNSVVGIKPTVGLTSRAGVIPES
                     LHQDTVGTFGKTVRDAVYALDAIYGIDARDNYTLAQKGKTPEGGYAQFLTNKTALKGA
                     TFGIPWKSFWALGDEDQISQLLELVDLIKQAGATVINGTELPHYKTIVSPDGFNWDYG
                     STRGYANESEYSYIKVDFYNNLKDYLSEVENTKVKSVEDLVQYYQDNYGSEGGYPSIH
                     PAFGSGQDGLIASLESKGIMDETYYQALEFCQRTTREEGIDAALKYKNRTLDGLLVPP
                     DVAQSIQVAAQAGYPVITVPAGVGKESGMPFGLAIMNTAFSEPTLIKYASAIEDMQKS
                     TGTKYQRSLPEWRGYLTRNLPVIM"
     exon            914179..914492
                     /number=1
     exon            914550..916008
                     /number=2
     CDS             complement(916341..918020)
                     /codon_start=1
                     /locus_tag="AO090011000358"
                     /note="NADH-dehydrogenase (ubiquinone)"
                     /old_locus_tag="AO070316000053"
                     /protein_id="BAE64873.1"
                     /transl_table=1
                     /translation="MRSVFVNSPVRLGRISRPLLSSTYPVSQSSFVQCKRCLATQADH
                     SAAIPESDRGKERVVILGSGWGGYTLSRKLSSKSFSPVIISPRSYFVFTPLLTDAAGG
                     SLDFSNIVEPVRDPHAKVDFIQAAARAVNLEKKTVLCESTVVTSGVTETPRTHENERE
                     SEEGPDTTSMRPMQEARKWEKGDFFEVPYDKLVIAVGAVSKTFNTPGVRHNAMFFKDI
                     GDARRVRRRVRECFELAVLPTTTPEMRKWLLHFAIVGAGPTGTELAASLRDFIYKDMT
                     ILYPALKDLPRITLYDVAPKVLSMFDESLSKYAMETMKKEGIDIKTSHHVEGLRWGEP
                     GAEPPYEMDPKRCLTITTKEEGEVGIGMCVWVTGNAMNKFVNKALQDVETFPTASTLL
                     KDGTHPPPELTKDTTWHIKKAPKVGALLVDGQLRVQLENADGKIAVYQDVFALGDNAM
                     PETGAPPATAQATTQEAKWLATRLNKGDLQTSQPFSFHNMGTLAYIGDANALMQFPTE
                     DDKPPKYLTGRMAWFVWNSAYLTMSMSWRNKLRIAFRWLLNNIFGRDVSRY"
     exon            complement(916341..918020)
                     /number=1
     CDS             complement(918828..922208)
                     /codon_start=1
                     /locus_tag="AO090011000359"
                     /note="ankyrin"
                     /old_locus_tag="AO070316000054"
                     /protein_id="BAE64874.1"
                     /transl_table=1
                     /translation="MSRSRSSIASDSGDRLEPRLLRAAENDSVEALRRIIELAHENGQ
                     YSDNFLRVGLMRSCERGCIAATQYLLDLLCMNLKDGNSQPSPLAANNRPSPLLRAVER
                     NHVRIVQLLLDYGAPLETTDKDGRTALMTAAWKNHWHVLQLLIARGANVNAKDHRKRN
                     VLHNLAADKHCNWGEDVIALLLKTVCEIDGEAGQDELGRTPLHWACATGKLRFAELLL
                     TRPHGPIANVNAIEFRNKSALHIAIAHDWDNIVHLLLRHGADIDSRSDGGWTPLHNAC
                     DKGAKEIVRILLHAGAKINSQLLNGVTPLHLAAQAGHTEVVKCLLEYPDLKRRIRDNF
                     GCTPFLRAAQFKRKDIVLLLAPFNNVDALSPDARGACEGFEATVVDFGNFRNENRVRK
                     TSVFNLLYGRDPENPHKQAFTTVPMDSKVTDFRWIHLPANNMAWVEGLLTKNFIEEGA
                     HDIESFKGLERSFHYQHRGQRTHSHFMRPMCQRTQRKQRFHEENEESPEEKVENKLPQ
                     IVINGRLQEPPKSPANGGSNKAKKQKTQGGKSERADSDDTSNSSHGKKAKNHTKRGKS
                     KGESMQKSKNDEQHRHPLSLCKDNGHSTTSNVCVFMPYLHFETAERRLKMQEAIQRAE
                     TLNFQPGFTRSPTRDEMLIRAHLASSTASLHVRRTLDQFFYPNIDTQTRDQDQVVYRY
                     QTMGQGRERYGTEPKIFMVDQLWMWIMGTDLIVTCFAQRWEQPKNDPLNVLDGIIEDI
                     NSKTREPVRSVYDLASIITNRCSGVFDRHRMGDDEYQFLDMFESSIGIATDRETVLFN
                     KFNRASAQASDWLKNHRKLSRFARNSQTKKDVTNRDGDKQFEEDEDEVPLFVDNLLDI
                     GQEIDLLAEAKDIRDELNMIRTVLEHQQNVLLDLQDIIFGIYQVQHRSQYDIKRRFKE
                     QQRNIDMHLKDIERMDKQAERIYSSITDLLDLKQKHANAFEARFARDQAAGTTRQGKI
                     MMVFTIVTTVFLPLSFIATFFTMNLEEFPHNADGSEQLPLSYVAEYTFGIGVAISIPL
                     ILLALTVDDIGDGCQEAFRRARRWMFHRKKKPRGRSMIEEPRPRTALGLDNVLSGTKS
                     RRSVDTELAGSLLPISTRGTVRSLGKRSISLRRDEAYR"
     exon            complement(918828..922208)
                     /number=1
     CDS             complement(join(923675..925740,925834..925918))
                     /codon_start=1
                     /locus_tag="AO090011000360"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000055"
                     /protein_id="BAE64875.1"
                     /transl_table=1
                     /translation="MTWSHYPEGNRYVTSYGIFYPLMSTKLEGRPASFRVDSTVFAES
                     PSLNFLARGTDPRTPGSIEQQTRNLSLASPVMGPASPPLTPQDRLPDNDNDSTSSRRM
                     AFVEDDGQDEIQELHLYLPIPLNSDVSNPNSRISQEDTETLLLFRNLFAFLLGQSLIA
                     TPRSPSLFAIFMDVATLLSRFEFTNFDGSNFGETATTSFGNYCDELHLADVRKSREKT
                     IEAIVLGERLRFFPLYLEGFVHGVGKLDELKQLRSPKFGLISAATQKRLERGFIDLDT
                     RLRVLYGKLNDFDFPSAFAGAANSTTSAESKVIRFKAWKAAFMDMRRHTIQYYRQRYG
                     SWPPKARSKKNQFEENGLNRRVLMELYSDFANLYDMLVDRSSLTTRTVDMGADEVAEA
                     DDLNTMTNRALRQVLSEYDRSTPPVQPPIPFDIPQFPSLQPLQRKPMDAKKEAKKNAK
                     KLKDADINAVLMGSYTRESLKPTPFIESFMQFERRCGHGKTINDLIDLRCGQWIFLYC
                     VIQSLPLLVVDVQDVKYTDGVEYFCCIAPRGGAPWIQNDGKVARSWFGVAGGAGVVSL
                     PSDVVINGVEGIYRRSHCWQVAEQWAEKDAILAPPTVEDPYDNESSLSSPYQAQQSSA
                     GSSAEHQQQQPTPLLAPGGNGLTPPPVIPRTNSPALRSRAEHRHSIYPGLEALPLPAG
                     VAPIDPPARPISRFNPNMSFDDILKQVPNQKGKK"
     exon            complement(923675..925740)
                     /number=1
     exon            complement(925834..925918)
                     /number=2
     CDS             join(929257..929733,929840..930225,930284..930734)
                     /codon_start=1
                     /locus_tag="AO090011000361"
                     /note="aromatic amino acid aminotransferase and related
                     proteins"
                     /old_locus_tag="AO070316000056"
                     /protein_id="BAE64876.1"
                     /transl_table=1
                     /translation="MESPEEVNLFRGWPNPALLPTDALAEASATVMASPTIRVPALMY
                     GPDEGYQPLREHLAQWLTAFYQPRHPISSERICITGGASQNLACIFQVFTDPSYTRNV
                     WMAAPTYFLACRIMDDAGFAGRLRAVPHDESGLDLTFLRQELVKAEEKAQAEQRLEPI
                     YKLPRPWAKVYKHLIYATPTFSNPTTLTMSLADREGLVRLAREFDALVVTDDVYDFLQ
                     WSPDPEQPLAQPDKAQIPRVVDVDRYLDGGPKDEWGNVVSNGSFSKLIGPGARTGWAE
                     GTEKFAYGLSQTGSSRSGGAPSQFSAAIIAQLFPTGFIQTYVDQVLRPRYAERYYRLI
                     SAVREHLLPLGVTLPSTSLEAVGGYFVWIQLPPPLQADDLATVALREYKVNVIAGNRF
                     RVQGDPDTRRNSFNRSIRLCFAWEHEEKLAEGVRRLACAIRSALK"
     exon            929257..929733
                     /number=1
     exon            929840..930225
                     /number=2
     exon            930284..930734
                     /number=3
     CDS             join(933269..933509,933559..936170)
                     /codon_start=1
                     /locus_tag="AO090011000362"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000057"
                     /protein_id="BAE64877.1"
                     /transl_table=1
                     /translation="MASLHTTIMLFLAHVLLLLGLPAGMVGAVPLGQETDITTNLAAR
                     AASEYWVGTIKRQGAVAFGNGTDYQVYRNVKDFGAKGDGSTDDTAAINQAISSGNRCG
                     KGCDSSTVTPALVYFPPGTYVVSKPIVQYYYTQIVGDAVNLPVIKAAAGFAGMAVIDA
                     DPYEDDGSNWYTNQNNFFRAIRNLVIDLTAMPQGSGAGIHWQVGQATSLQNIRFEMIK
                     GGGDANKQQGIFMDNGSGGFMSDLTFNGGNYGMFLGNQQFTTRNLTFNDCNTAIFMNW
                     NWAWTFKSLSINNCQVGLNMSNAPQNQTVGSVLILDSQLTNTPTGVVSAFTENSIPIG
                     GGVLILDNVDFSGSKVAVAGITGNTILAGGSVVTNWVQGNGYLPGSAKQKREASVKVI
                     TQTVTETVEVCTADYTDSPSAPTALPSSLGESRTAGLLPTLPLPNIPLLSGLLSGSQS
                     SATQPAGVLSSEVPEPTATPSTPEEAEPSTEVQPTPQPSAPAQSQPETPVESTVAAPL
                     IPSQPSPTVQGSSSVVTGPASSSVAHATNQCSVKTVTKTRLQTALPTHAKPSSLLNGG
                     KVYERSKPLYTSYDASSFVSVKSAGAKGDGSTDDTAAIQKILNSAKEDQIVYFDHGAY
                     IITDTIKVPKNVKITGEVWPVLMAYGQKFGDEKNPIPMLQVGEVGETGSVEITDIALQ
                     TKGPAPGAILMQWNLAESSQGAAGMWDTHFRIGGSAGTELQSDKCAKTPKQTTTPNKE
                     CIAAFMLMHITEKASAYIENSWFWVADHELDLPDHNQINVYNGRGVYIESQGPVWLYG
                     TASEHNQLYNYQVTNAKNVFMGLIQTETPYYQANPNALTPFTPQTNWNDPDFSYCKTD
                     GCRKAWGLRVQNTSDMYVYGAGLYSFFENYGQTCLATESCQENMVEVDCSDVHIYGLS
                     TKASTNMITSNSGAGLVPQDENRSNFCSTIALFQQS"
     exon            933269..933509
                     /number=1
     exon            933559..936170
                     /number=2
     CDS             complement(join(936670..936911,936987..938106))
                     /codon_start=1
                     /locus_tag="AO090011000363"
                     /note="mitochondrial Fe2+ transporter MMT1 and related
                     transporters (cation diffusion facilitator superfamily)"
                     /old_locus_tag="AO070316000058"
                     /protein_id="BAE64878.1"
                     /transl_table=1
                     /translation="MDESHLRQSMSHHPSPFNSPQPPHSHIPSTLSYNEATTTALEPQ
                     ASQHRTGNTSDEEGQPPPRYTRENDPFQLASKIKTDEEIRQIHPQANTARKRDSCGPG
                     GLLRATKNPKKALDTAISSRQLQGFYHSQNENIERMLKPVEEHVRDAREISVNNQLKY
                     KIAVYGSFAANVILSVLQLYGAIASGSLSLFTTMADAVFDPMSNLTLLLCNKAVNRVD
                     PRKFPAGKARIETAGNICFCFLMTAVSFIIIAFSIRELVEGSQSETSDFHLPSVVAVI
                     VAFCTKFALFVYCFALRHQVSQIRILWEDHRNDLFINGFGILTSVGGSKLRWWIDPMG
                     AIILSVLVSCLWLYTAYHEFQLLIGVTADTKMQQLITYISMTHSPFITAIDTVRAYTS
                     GPRLLVEVDVVMDPNDSLRATHDVAEELQMKLESLPDVERAYVHVDYETTHKPEHFLK
                     KEL"
     exon            complement(936670..936911)
                     /number=1
     exon            complement(936987..938106)
                     /number=2
     CDS             complement(939181..940047)
                     /codon_start=1
                     /locus_tag="AO090011000364"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000059"
                     /protein_id="BAE64879.1"
                     /transl_table=1
                     /translation="MKQTGTILALAGLVSMAHGHGFVTSPKARMPGTAFQEACGQQMY
                     NNQQADNYGNVQGELQIASSQNDYDAAKCNAWLCKGYKFDDNKDNVFQYTPGQNVDFT
                     VDIRAPHTGVANVSVVDTASNTVIGEALKSWDVYASTESGVKETDKKFSVTLPSDLGS
                     KCSEAGACVLQWYWFAESIDQTYESCIDFTMSGSGSGSSSGASSGASSAASTAAATAS
                     STATGVAVTATPTTGNNVAAPSGFATSAKPSATSAPSSAASTVTIPTDGTAEEKLNWI
                     ASLLQTLVKYIA"
     exon            complement(939181..940047)
                     /number=1
     CDS             complement(941533..942057)
                     /codon_start=1
                     /locus_tag="AO090011000365"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000060"
                     /protein_id="BAE64880.1"
                     /transl_table=1
                     /translation="MAENELIKEFSDRCRSASHTIQQYIHSTNPPPDEDTLLTLIEAN
                     DELSMSLSRHQRALLNARRALGQSDSQSPSLSETTPLGASSATPPPVPPRDTQNPYIP
                     PAMPPAASSPSGISTPTNNSMGRSEYRSEDFQVQNPFADNFNTTTTGPPEGRTEGTAN
                     DSWYDPYQRPIQRA"
     exon            complement(941533..942057)
                     /number=1
     CDS             complement(join(944329..944475,944528..944715,
                     944913..945126,945376..945378))
                     /codon_start=1
                     /locus_tag="AO090011000367"
                     /note="60S ribosomal protein L22"
                     /old_locus_tag="AO070316000062"
                     /protein_id="BAE64881.1"
                     /transl_table=1
                     /translation="MVRYAAQDIPAAKSARARGSYLRVSFKNTRETAQAINGMKLQRA
                     LTFLDNVTNKLEAVPMRRFAGSTGRCAQGKQFGVSKARWPEKSAKFLIDLLKNAEANA
                     DTKGLDTGNLVVKHIQVNQAPKGRRRTYRAHGRINPYMTNPCHIELILTEGEEVVQKG
                     PVAKEAHLSSRQRGLQVRRAIQA"
     exon            complement(944329..944475)
                     /number=1
     exon            complement(944528..944715)
                     /number=2
     exon            complement(944913..945126)
                     /number=3
     exon            complement(945376..945378)
                     /number=4
     CDS             complement(join(945780..945992,946046..946327,
                     946378..946460,946522..946638,946701..946815,
                     946868..946966,947030..947110))
                     /codon_start=1
                     /locus_tag="AO090011000368"
                     /note="glyoxylate/hydroxypyruvate reductase
                     (D-isomer-specific 2-hydroxy acid dehydrogenase
                     superfamily)"
                     /old_locus_tag="AO070316000063"
                     /protein_id="BAE64882.1"
                     /transl_table=1
                     /translation="MPSALLIGEITHARKEWEELSSILTLTEFPSGTREDFIRNCKEG
                     QYDDVLVIYRSNTSTKFTGPFDAELLAVLPKSLKYICHNGAGYDNIDVKGCTDKGIAV
                     SSTPVAVNHATADVGIFLMIGALRQAYVPLSALRAGQWQGQTTLGRDPQGKVLGILGM
                     GGIGREMANRAKAFGMKIQYHNRSRLSPELEGDATYVSFDELLASSDVLSLNLALNAS
                     TRHIIGEKEFQKMKDGIVIVNTARGALIDEKALVAALDSGKVLSAGLDVYENEPVVEQ
                     GLVNNPKVMLLPHIGTMTYETQKDMELLVLNNLRSAVEKGKMITLVPEQKNVF"
     exon            complement(945780..945992)
                     /number=1
     exon            complement(946046..946327)
                     /number=2
     exon            complement(946378..946460)
                     /number=3
     exon            complement(946522..946638)
                     /number=4
     exon            complement(946701..946815)
                     /number=5
     exon            complement(946868..946966)
                     /number=6
     exon            complement(947030..947110)
                     /number=7
     CDS             join(947781..947849,947901..949040)
                     /codon_start=1
                     /locus_tag="AO090011000369"
                     /note="sorbitol dehydrogenase"
                     /old_locus_tag="AO070316000064"
                     /protein_id="BAE64883.1"
                     /transl_table=1
                     /translation="MATVTDTVACQALVLHGAKDLRMGTKPVTAPTGSEVQVAIRATG
                     LCGSDLHYYNHGRNGDFVVREPFCLGHESSGVVTAVGPEVTTLQVGDRVALEVGLPCR
                     KCVLCKQGRYNICPEMKFRSSAKIFPHLDGTLMELTNHPAEMCHKLPDSVSFAGGALV
                     EPLAVCLHAVRRSHPPSKEEVQLAESLGDQSAALIFGAGAIGLLLAGALATAENFSNI
                     VVADIDPARLAIAESLNLGLKTALIPKADPAHPPPAKDAPHAEQTAYALQNAQRVAAT
                     LKDTIGLTSGFSRIYECTGVPACVQAGIYAAAPGSVLVQIGMGNPIQTLPVGAAALRE
                     VDVIGVFRYDGHAYPAAIALVASGKFNRVEELVVTHRLPLEQGERAFALAGKGVDETG
                     RPVVKVVIES"
     exon            947781..947849
                     /number=1
     exon            947901..949040
                     /number=2
     CDS             complement(join(949389..949660,949718..950151,
                     950211..950269))
                     /codon_start=1
                     /locus_tag="AO090011000370"
                     /note="dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /old_locus_tag="AO070316000065"
                     /protein_id="BAE64884.1"
                     /transl_table=1
                     /translation="MEQQNDISGRLVLITGASGGIGAACARQLAAKGVHLALTYSTNV
                     SSTSSLAEELKSKHSDSYSLRVSIHKVDVSSADEIQRMFEEIDQQHNKRPDILVSNAG
                     YGKRVPQVWDISLEEFDYTINVNLRASFILVKGVVEHMKSQRWGRIVFMSSIAGQGGG
                     INGCHYAASKGGLTGMMKNLSTRLAEYNISVNDVAPAMIGETGMIPSAAAIPEVAAGI
                     PLGRLGLPDEVANVVTMLVTTGYMTGQSLLLGGGLK"
     exon            complement(949389..949660)
                     /number=1
     exon            complement(949718..950151)
                     /number=2
     exon            complement(950211..950269)
                     /number=3
     CDS             complement(950600..951034)
                     /codon_start=1
                     /locus_tag="AO090011000371"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000066"
                     /protein_id="BAE64885.1"
                     /transl_table=1
                     /translation="MPNGEETKVRDLVTRTTDVLKRASAGPDDIGSRYSRLLELLWRP
                     KAATIASPAGTHQSSDFQVQSSTIPHRLPEQSNYMQFSPANDFSWLDLEAVGDYVSGD
                     QLPGANTLAFDSFQNPDPYQTGQDRSQAWQPNWPGDMTNLLF"
     exon            complement(950600..951034)
                     /number=1
     CDS             complement(join(951273..951352,951487..952787,
                     952879..953009))
                     /codon_start=1
                     /locus_tag="AO090011000372"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000067"
                     /protein_id="BAE64886.1"
                     /transl_table=1
                     /translation="MEQEEQSSQPESTPATRPKSRSDHLKRVSRACLHCRQRKSKCDL
                     DSNGNPGVPPCQRCLRDGRECILGSSNRGGRRIRKNKMKNFTPDTTLSGRRESIVESI
                     SPTASDNRQSTNTSYPGPVVFVPPNPTTATSISVDDEDTASIGSVPRNPSDAWQCLTG
                     IAKRGDDGPTPETNTDSLRTTHSAFSFGALQNGTVADFQPNSGIKAYRLVQSRSLDPG
                     TVWQLVARYAENFHPYLPLVPRKYFNRSALDSFATNEKHLLTAVLTIASKDLVERPDI
                     HEYCSKYMHELISGIAAGADCDVEAVEALLLLAEWEPQGLRPRIERVGRGEEDRAAWM
                     HVGLALRSGYFLGLDRTSFRGDPSGDTETEARRRLAWTSCYISDRLISVRIGRAFWSR
                     GPGPMTGLVSQDFPSLQPIKDGDEDYARIFQATLDLTQLYGNVHDVLYSGMRTSNQMM
                     LMGDYVKYVDDFRLAILRWKSLWGSLSCCNFPINGVEVKERSVTKGTSEINIQ"
     exon            complement(951273..951352)
                     /number=1
     exon            complement(951487..952787)
                     /number=2
     exon            complement(952879..953009)
                     /number=3
     CDS             join(954495..954617,954697..954912,955001..955450)
                     /codon_start=1
                     /locus_tag="AO090011000374"
                     /note="dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /old_locus_tag="AO070316000069"
                     /protein_id="BAE64887.1"
                     /transl_table=1
                     /translation="MSASLFSLSGKTAIVTGGTRGIGQAMAFALAEAGADIVLIQRDE
                     SNTSTRDEIISRIGRKAWIHVAELSSRDAIKGVIPALTSQGLKPEILLNCAGIQRRHP
                     SEQFPDEDWDEVIQVNLTSVFTLCREFGAYLLARDASEFPTGRRGSIINVASLLSFQG
                     GITVPAYAASKGGISQLTKALSNEWVSKGINVNAIAPGYIATDMNTALINDSNRNAGI
                     MARIPAGRWGSPDDFKGVIVFLASQASSYVSGEVICVDGGWMGR"
     exon            954495..954617
                     /number=1
     exon            954697..954912
                     /number=2
     exon            955001..955450
                     /number=3
     CDS             join(957161..957180,957892..959545)
                     /codon_start=1
                     /locus_tag="AO090011000376"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000071"
                     /protein_id="BAE64888.1"
                     /transl_table=1
                     /translation="MHVGGCEQQTYWSVEESDTWTNIKKHLLYSPLGRKRHNREIQLS
                     SAINVGTLPSRFQTILILLYLASQVAYCTILDYRVNEKKALVAELRGRSGTLAVLNMV
                     PLFLLAGRNNPLIAILHISFDTYNCLHRWLGRIVVIESVVHTVAWAVNAVDEVSVSDM
                     LKRLCDTPFFTWGLVGTVAMVFLSLHSPSPVRHAFYETFLHLHQLAALLAYVGVWFHL
                     DLDGLPQKPWAIAIAAIWIFDRAARFSRLLYLNISPRKGATKLVVQALPGEACKVTFH
                     LPKHVHINPGSHVYTYIPSVSLWMSHPFSVAWVDPCSSVTNAAEPEKFAKSPTSTGSM
                     SPSLLEKQPVVDLNDYMRESQEPTSVSLIVSARQGMTRKLYNKALIAPNQILHLSGYI
                     EGPYRSHVSNMGSYGTAVLFSAGAGITHHMLYVRDLIIRATEGRVATQKVYLIWSVRS
                     TEHLAWVQEWMDEILRLPGRRDILTIKLFVSKPKSSREIVSPSATVQMFPGRCRPHVV
                     LDEVIPNRVGATIVSVCGPGAFADEVRAAARDNIGKGAVVDFVEEAFTW"
     exon            957161..957180
                     /number=1
     exon            957892..959545
                     /number=2
     CDS             complement(join(960279..961789,961869..962181,
                     962241..963170,963230..963473,963533..964411,
                     964466..965073))
                     /codon_start=1
                     /locus_tag="AO090011000378"
                     /note="pleiotropic drug resistance proteins (PDR1-15),
                     ABC superfamily"
                     /old_locus_tag="AO070316000073"
                     /protein_id="BAE64889.1"
                     /transl_table=1
                     /translation="MSLLGTINPNLNPARAVGAQGDAEGAAPVSGGEPMPIFEGNDSA
                     RTSDTALDKLGKDESKYDEQIAEAEVTRLAQQLTRQSTRFSVSQNAENPFLETKEDST
                     LNPLGPNFKAKNWMKNLLALTSRDPERHPRREAGVSFRNLSVHGYGSPTDYQKDVFNM
                     VLQVGALFRAVTGTGKQKIQILRDFDGLVKSGEMLVVLGRPGSGCSTFLKTLAGEMNG
                     IYMDDKSDLNYQGIPAKQMRRQFRGEAIYNAETDVHFPQLSVGDTLKFAALTRCPRNR
                     FPGVSREQYATHMRDVVMAMLGLTHTINTRVGNDFVRGVSGGERKRVSIAEATLSGSP
                     LQCWDNSTRGLDSANALEFCKTLNLMTKYAGATVAVAIYQASQSAYDVFDKVTVLYEG
                     RQIYFGRTDEAKEFFTTMGFECPERQTTADFLTSLTSPSERIVKKGYEGKVPRTPDEF
                     AAAWKNSEAYAKLIREIEEYNREFPLGGESVQKFVESRRAMQAKNQRVGSPYTVSIYE
                     QVRLCMIRGFQRLKGDSSLTMSQLIGNFIMALIIGSVFYNLQHDTSSFYSRGALLFFA
                     VLLNAFSSALEILTLYAQRPIVEKQARYAMYHPFAEAIASMLCDMPYKITNAIIFNIT
                     LYFMTNLRREPGPFFVFLLFTFVTTMTMSMLFRTIAASSRTLSQALVPAAILILGLVI
                     YTGFTIPTRNMLGWSRWMNYLDPIAYGFESLMVNEFHNTKWKCSSAELIPNYEGASLA
                     NKICSTVGAVAGSEYVYGDDYLEQSFQYYESHKWRNLGIMFAFMVFFLATYLTATEYI
                     SEAKSKGEVLLFRRGHYSRGAADVETHNEVSATEKTNESSDGAGAAIQRQEAIFHWQD
                     VCYDIKIKGEPRRILDHVDGWVKPGTCTALMGVSGAGKTTLLDVLATRVTMGVVTGEM
                     LVDGRLRDQSFQRKTGYVQQQDLHLHTTTVREALRFSAILRQPAHVSRQEKLDYVEEV
                     IKLLGMEAYADAVVGVPGEGLNVEQRKRLTIGVELAAKPQLLLFLDEPTSGLDSQTSW
                     SILDLIDTLTKHGQAILCTIHQPSAMLFQRFDRLLFLAKGGKTVYFGEIGERSSTLAS
                     YFERNGAPKLPVEANPAEWMLEVIGAAPGSHSDIDWPAVWRESPEREAVRNHLAELKS
                     TLSQKSVDSSHSDESSFKEFAAPFSVQLYECLVRVFSQYWRTPVYIYSKAVLCILTSL
                     YIGFSFFHAENSRQGLQNQMFSIFMLMTIFGNLVQQIMPNFVTQRALYEARERPSKAY
                     SWKAFMTANILVELPWNALMSVIIFVCWYYPIGLYRNAEPTDSVHERGALMWLLILSF
                     LLFTSTFAHMMIAGIELAETGGNLANLLFSLCLIFCGVLATPETLPGFWIFMYRVSPF
                     TYLVSGMLATGVGRTTAVCEKVEFLHLTPPANTTCYDYMSDYIGSFGGYLENDNATDS
                     CSFCQISSTDTFLSAVSSYYEDRWRNFGIMWAFIVFNIAAAVFIYWLARVPKGSRSKN
                     "
     exon            complement(960279..961789)
                     /number=1
     exon            complement(961869..962181)
                     /number=2
     exon            complement(962241..963170)
                     /number=3
     exon            complement(963230..963473)
                     /number=4
     exon            complement(963533..964411)
                     /number=5
     exon            complement(964466..965073)
                     /number=6
     CDS             complement(join(968338..969747,969807..969941))
                     /codon_start=1
                     /locus_tag="AO090011000379"
                     /note="predicted regulator of the ubiquitin pathway
                     (contains UAS and UBX domains)"
                     /old_locus_tag="AO070316000074"
                     /protein_id="BAE64890.1"
                     /transl_table=1
                     /translation="MSSSELDISQLSDSERSALDTYIAVTGQEPSEAIPLLRRSQWNV
                     QIAISKFFDGEGPDPVEEARAALNTPPPRPNRQTQNLMTDDLTANFSSAVRAADPAPR
                     VETQPEGQPVYRPPLLLALLFTPINLLYRLLYSSFRLFGALFPFLPRFFNTTASSALH
                     GTRLNTNGRRPLGPKDTAARFIREFEEEYGTNTLPFLENGYNMALEKAHRDLKFLLVV
                     LLAPEHDDTNGWVRDTLLFREVIDFVNDPQNNIIVWGGNVQDSEAYQVANSLRCTKFP
                     FAAAIVHTPNVSSTAMSVVSRISGTTSPSEFIEKLRTAISQHKEPLERIGATRAEQQA
                     SRSLREQQDSAYERSLAIDRERARQRREAEAARQREEQEAAERQAAEEKRLHDLEQWK
                     RWRVQAIPDEPSADVKDAVRVSIRLPSGERVIRKFAPEADLEELYAYVECYDILQESH
                     EKPTDVEKPDGFEHQYGFRLVSPMPRAVYEVSAGGTIREKIGRGGNLLVEPIDDESDE
                     EEEEES"
     exon            complement(968338..969747)
                     /number=1
     exon            complement(969807..969941)
                     /number=2
     CDS             join(970709..970781,971122..971322,971903..972033,
                     972093..972237,972291..972446,972502..973529)
                     /codon_start=1
                     /locus_tag="AO090011000380"
                     /note="poly(A) ribonuclease subunit"
                     /old_locus_tag="AO070316000075"
                     /protein_id="BAE64891.1"
                     /transl_table=1
                     /translation="MASAGKPTLDDSRRATGSPKMKARVTMTYVDCTSSNNSRRRLNV
                     DSPSFTPSLLSSNGSSPTTASVTAKKAATISPKAANAAPFQPRNITSPSNPLSAASAV
                     GPVQANPFAHDTAAAAAALGGAFFAGQSGFQQPVQYHLYAPIGPHSQNTLGYQRNVHD
                     LFLPNDFREELQKKAAATLQTLPNTQLPAQVDYFHSLVPLDLNHQKNATIFGFPSWVY
                     KAQSSKDGNFYALRRLEGFRLTNEKAIRSVQAWKRVCNGSVVTVHDAFTSRSFQDSSL
                     IFVTDYHPLSKTLAEQHLGAGNRFQGRHNTHIPEQVLWGYMTQIANGLKAIHSNGLAA
                     RILDPSKVLVTGKNRIRLNACAIMDVVQYDTQRSIAELQRQDLVNFGQLIVTLGANTP
                     SVMHNPTKAMEHFTRAYSPQLKNSVFWLLNGLQKDQDRNIDIFITGISSQLMSTFDSA
                     LHLDDELTSDLSRELENGRLVRLVTKLNFVNERPEYEHDRQWSENGERYFLKMFRDYV
                     FHQVDAQGDPVVDLGHVLSCLNKLDAGTDEKITLVSRDEQSCFVVSYKDIKKALESSF
                     QALLKPTRRLH"
     exon            970709..970781
                     /number=1
     exon            971122..971322
                     /number=2
     exon            971903..972033
                     /number=3
     exon            972093..972237
                     /number=4
     exon            972291..972446
                     /number=5
     exon            972502..973529
                     /number=6
     CDS             complement(join(973979..974665,974769..975500))
                     /codon_start=1
                     /locus_tag="AO090011000381"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000076"
                     /protein_id="BAE64892.1"
                     /transl_table=1
                     /translation="MKVYLWTVAATATLSSALFIPTSQQALKDLDLNNIDVNDKAALD
                     DYLLQLSLLDAASEIQNSRLDDILPPIFDTVDAEDYDYDYFDDDDYDDAEYFPLDITE
                     LPPFSQLHPPHHPPSDKTIYELITESKYTTILAKLIKEDEELVHLLNSTEANHTFFAP
                     TDDAFKKIPHHDDHKPPKELIRAFIKYHLVPGLWDARTVFHSHTLPTELESRALGDKL
                     PQRLSVRAGWRGLTLNFYSRVVAPDIPGTNGLIHGISSVLIPPPTTKTLLDLVPTKFS
                     TFDLAILKTNLTIPENTGKDTGKGHTIFAPSNTAFSKLGLKINAFLFSPYGQKYLLAL
                     LKYHIVPDRTLYSDVIYTEEGEIRPFGVKGFTHLDLPTLLGDRRLSVDVARFGPYASL
                     KVNGFQRVAVADALGRDGNVHIVDQVLVPPKKVVEGATEWDEWNEELTVEGLKERLAA
                     WVEDDQDDYDEGMELWAHAFDL"
     exon            complement(973979..974665)
                     /number=1
     exon            complement(974769..975500)
                     /number=2
     CDS             979119..981104
                     /codon_start=1
                     /locus_tag="AO090011000382"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000078"
                     /protein_id="BAE64893.1"
                     /transl_table=1
                     /translation="MESRTATAEPSSKRPRSPSGDFPPIASKVPKTHSNHLQINYLAR
                     QYPDNLPLVSIDDTMPAIIHLIGEYDGVLHRHESIAGNLGACPLGPILIKRFERLFDG
                     PPRVLKSHGKDSPNITWLDVVEFAKNKPEQFNLEKTRNGVRVCQFYTKQCRVEISEED
                     FVLIASGMPQKMIPPQPIIEDEEKELGALEILEKNLQQIIQVADQGEFPGKAMCISAG
                     ANRSPRLVSARARQLNHRLKNRRTAIVTRRENDLSLHSQSQSQSQSQQQQQQHRSISP
                     VWRDANGSQHPLNGSSHSNTGSPSTGFVAVNTGRPGGEPTTEDNALSQQFMFSHSNTD
                     NVTIINGTSIKGASPTTRAELMKKFFTTQDRQSRSYEEGTGSQNRQSSRPRPRASDAT
                     EYNMYTPTAATVAIPNTPSSLLPPPKSHHHEKDDGGPFKMEMVARMEELQRGERILPP
                     CDRCRRLHMDCLKNLTACMGCTKKHAKCSWKDVKAEELQESREPREPREPRPDPMARE
                     RPESLTPKESLPTTTAPAPMAPSISSVPTPPSAAVVPEIDRHREIEYNVRRESAPTAG
                     PIPGTPLGKEPSPRRAMSEIRGGSLSHDRHIGINRNTNPAAEDDDPDANQRLMQAILD
                     TVDHHARAAAAAKEGGQPMTEREREQERDRDRKLVKA"
     exon            979119..981104
                     /number=1
     CDS             join(981862..982099,982198..982649)
                     /codon_start=1
                     /locus_tag="AO090011000383"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000079"
                     /protein_id="BAE64894.1"
                     /transl_table=1
                     /translation="MVPTYPSLDDKHSNENATDQANQVNEGRELFAHYIWNAAIVVAE
                     GVEDTYYSRTEPQPEKSNSHELWHVEGESVLELGAGAALPSLICALANAAKVVATDHP
                     ASPALTGPIAFNMSSNLPDPSTAQVSIYPHEWGVFTAPFAQENKGAFTRIIAADCFWQ
                     KSQHESLARSMAWFLAPGGRVWVVSEPHLGRAVVVGFFETVLALGFEIEVVFERDLMS
                     YIESGVEVRRE"
     exon            981862..982099
                     /number=1
     exon            982198..982649
                     /number=2
     CDS             complement(join(983295..983773,983782..984306,
                     984359..984610,984672..984898,984970..985091))
                     /codon_start=1
                     /locus_tag="AO090011000384"
                     /note="translation elongation factor EF-1 alpha/Tu"
                     /old_locus_tag="AO070316000080"
                     /protein_id="BAE64895.1"
                     /transl_table=1
                     /translation="MHDLTRGALTSIGINVETNTTRAFALEISPTATIFYLLTLKLCY
                     STYLITSILKNLFVSFRELQEPIFNRHDAVSQPLNFYFTSSVAKPFLACNREKPHITA
                     VFLGHLDHGKSTTADQLIYQYGRVSGNPIAEYGSMLSLSSDLLCAGARPHDNHSPQEA
                     GPSYKYGWVIEKLRAERKRGITIDISLCTFETPKFVVTVIDAPGHRDYIKNTITGASQ
                     ADCAILVTSATNGEFEAGVDQGGQSRQHLVLAYTLGVRQLIVAVNKMDTPRYTDDCLN
                     EIVKETSDFIKKIGYNPKAVAFVPISGLYGDNLVEESQNMPWFKGWTSETKYGVLKGK
                     TLLDAIDALVTPSHRNATNKPLGLPIRDVKEVPDIGTVLVGHWNYYACMELTTAPTNI
                     TAEVVSIERNDEELHAGHAGEHVSVHIIEVEEEILPGYVAGDPNNDPPASVASFSAQV
                     IILSHSGEISPGYTATVDCLTAHIPCRLSRILHKKDRRTGRPTEQSPDSIKVGDCAIV
                     EMVSTKPMCVEPYSKNPCLGRFIIRK"
     exon            complement(983295..983773)
                     /number=1
     exon            complement(983782..984306)
                     /number=2
     exon            complement(984359..984610)
                     /number=3
     exon            complement(984672..984898)
                     /number=4
     exon            complement(984970..985091)
                     /number=5
     tRNA            complement(986315..986405)
                     /locus_tag="AO090011t00004"
                     /note="tRNAscan-SE"
                     /product="tRNA-His"
     CDS             join(987067..987303,987383..987864,989146..989161)
                     /codon_start=1
                     /locus_tag="AO090011000385"
                     /note="protocatechuate 3,4-dioxygenase beta subunit"
                     /old_locus_tag="AO070316000081"
                     /protein_id="BAE64896.1"
                     /transl_table=1
                     /translation="MDPSQVKIPPMKDLTVDNITENVIRINSLCEDERMKYVLERLVS
                     HLHDFARETRLSSQEWMTGLMFLTEVGKICSDVRQEFILLSDILGLSILVDSIDHPKP
                     PGSTEGTVLGPFHTHEAEVMPHGDSMSHDPKGEPLLVVCTLKDTNGNPISDVKIDIWE
                     TDSTGHYDVQYADRNGPDGRCIMRSDDSGVFWFKAITPVPYPIPHDGPVGKLLKKLHR
                     HPFRPSHMHFMFEKEGYDHLITIKII"
     exon            987067..987303
                     /number=1
     exon            987383..987864
                     /number=2
     exon            989146..989161
                     /number=3
     CDS             join(991725..991779,993137..993304,993366..994219,
                     994270..995376)
                     /codon_start=1
                     /locus_tag="AO090011000386"
                     /note="transcription factor/CCAAT displacement protein
                     CDP1"
                     /old_locus_tag="AO070316000082"
                     /protein_id="BAE64897.1"
                     /transl_table=1
                     /translation="MKDGSLVLSDGSGGRQTKCIDLSNTIAKLDSTASDIVAQQRDAL
                     VQRKDLAQKTKDFRKLDDATKLAEFKGLLKAYQSFIDVLTNQGKASSNAFLQLYSSLS
                     EAPDPYPLLEASVDSLVHSEETVPKLTSERNQLQSNVDRLTSQLDDAEKRLEEERTAR
                     KKLEDNQESKIKEIESSWSAVLSEKSNNWTAKEKSLEEKVENQERLIKELKASYEVSQ
                     RLGQEESSGDGHQQGGATAAELELVSADLEKTSIRLAEVEARNEQLRLELAQVVSHSQ
                     PEQTTSVEEDPAYLRLQSENSSLLRKLDAARFDRESERHSWEAKISQSERHGAKVAAE
                     RDELRTRLDKVADYEDIRRELEMIKSIEFSAGDDDDARDSTDDAAIAANGTSKAGAKN
                     SLEQLLMSRNKKLTDELTILRVSHRDLQGQLETLREDLSTTKEELEKSQKLSTTLEND
                     LLRVQEEAANAFPSSAMSVAGTYTSRHPYSSRRGGTSPTSSIISGFDHSSGSSNTMDA
                     IRAGEPVGGGSGLLPMIQAQRDRFKKKNAELEEELSKMYNSVKSLRQEVSSLQKDNLS
                     LYEKTRYVSTYNRGQGGSSSASAYGNKPSAFSVHLSADTPSGLSLDRYQSAYEAQISP
                     FAAFKGRESVRAYKRMSLPERVVFSLTRIILANRTSRNLFAGYCFAIHILLFAMLYMM
                     STMEIEKHSASLGAAAVAGGAGNIHSSGQQLNGDDWQQEGFHNGR"
     exon            991725..991779
                     /number=1
     exon            993137..993304
                     /number=2
     exon            993366..994219
                     /number=3
     exon            994270..995376
                     /number=4
     CDS             join(996942..997472,997565..997603)
                     /codon_start=1
                     /locus_tag="AO090011000387"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000083"
                     /protein_id="BAE64898.1"
                     /transl_table=1
                     /translation="MGQLLRNSPILRSAIESLLLAYKRHTWLMIRGIGHSVLRELNHW
                     VQETCPNPDKPEDMADLARKCYEERKRNGGVFHMLNEATKQGIMSSKVSEQLCNPLYK
                     IRKHITMCLNLIDARMSLTEDFKHGAVVKPVRVPARHLDRTEWRFSFDSITTHIFRSE
                     SEKQTFYGHVDLFHDHEPATREKKSIHWL"
     exon            996942..997472
                     /number=1
     exon            997565..997603
                     /number=2
     CDS             complement(998312..999142)
                     /codon_start=1
                     /locus_tag="AO090011000389"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000085"
                     /protein_id="BAE64899.1"
                     /transl_table=1
                     /translation="MPMAMCELLLKSANSIRQDLHREIKVYNVPPGERMKIPLVRKKL
                     NLDDIAHRMFSDSQRSKQLSQVLERFVPAPSKLIERLKYYQENVLTQIHPELRLVDYF
                     DKSNRVQYFDKYDRYIATSKPSCYLCSQYMSHRLNYHLRKCDPNDIDLHWRLPDIQAA
                     ESSAHFKEQTDILRKITERVRRDVESFVLDRCSESNESLMDDDISQSFSLSSETTTKS
                     EDLSYGEADECPTPYRFPLGTEGDKPSGCDQYAGGEDEDEDEEDEVVFRGRQGAIFIT
                     "
     exon            complement(998312..999142)
                     /number=1
     CDS             complement(join(999379..999436,999494..999930))
                     /codon_start=1
                     /locus_tag="AO090011000390"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000086"
                     /protein_id="BAE64900.1"
                     /transl_table=1
                     /translation="MAQRPASSPYVCHRPRELRRLYEPLSLLCALQEQMVEQKDIEVV
                     DVGGVGGILHHRRDFLNALVQLAAFEQGCDLAITAGYDHDSVVIAVAGSPDVSDQVIR
                     FLKRLLDMVTGALHAGLCAETWNRDLLKISNYVTGLHNENSFAVSSDPKGMTMASLWF
                     GICN"
     exon            complement(999379..999436)
                     /number=1
     exon            complement(999494..999930)
                     /number=2
     CDS             join(1002015..1002153,1002204..1002292,1002355..1002866,
                     1002895..1002907)
                     /codon_start=1
                     /locus_tag="AO090011000391"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000087"
                     /protein_id="BAE64901.1"
                     /transl_table=1
                     /translation="MAYKDFPNTGNCRRNKVLSQLPSLANPLVLKMSPAAHQIDDCYT
                     IADFEIGKRLFTTHMAVQLVVASPEGREIGSLSQLDALITGYDFEEAIATLVKAGLDV
                     PRTNLVCDETYEDVLYKIIGRTRLGDSKESFPTLLGQLPLLDLSTDGVDLTVTATTQR
                     VANGLNLSPPGSEADNWKYTCRLWEDAQGTGEEPKVTEACISNFPTRFRITIQYCGVE
                     ASGEGRNKKTARHLAARRVCERLNLRLSFSIV"
     exon            1002015..1002153
                     /number=1
     exon            1002204..1002292
                     /number=2
     exon            1002355..1002866
                     /number=3
     exon            1002895..1002907
                     /number=4
     CDS             complement(join(1003451..1005830,1005879..1006883,
                     1006945..1007055,1007144..1007418))
                     /codon_start=1
                     /locus_tag="AO090011000392"
                     /note="dsRNA-specific nuclease Dicer and related
                     ribonucleases"
                     /old_locus_tag="AO070316000088"
                     /protein_id="BAE64902.1"
                     /transl_table=1
                     /translation="MINLPQLIWFLCPTVALCNQHVRTITAHVPPMWCRSFTSNDNVD
                     HWGTVETWNIALASVKVAISTYQVLYDALVHRFVTMDRLSLIIFDEGNKIMREYYHTE
                     PQSHDKQTPYILGLTASPILSNISTLEEIERRLHSPCKTPRQFYAQLLRFTNQPLIVP
                     LVPLRGSMTSPSPSLILERIRGLLQSSYERGSYSRNAKRQLTRFSNQAEIIGRELGPW
                     AATKYIQTSITQFKEHMRMNAEKTHTPSPEREYAMEMLCKLGNIEDYDELVHSDNISP
                     MSQRLLDTLIEEHRKGFRALIFVSLRATVLALKWLIENHPETRRRFRCGTFVGMSRIH
                     QSKTRLGDVHDIRSQMETLQKFRDGVLDLIITTDALEEGMDIPACNTVLNFNCILNLK
                     SFIQRRGRARREQSKFFIFLQDEEDLKNVSLLQFRESELVRKLQDEGRTVLPDSLNHD
                     ERLRDSLAFSSSTGAQMTMGNAISHLYRFCGELPAQPFVSNSPAFSYETDECGQVQAI
                     VRLPSNLDPSLQTFKSLRKWAKKKWAKEDAALQAYKALFHARLINDHFLPLRLSDIIG
                     KDLSPKSHYIISEQLDPWHDVSLLWSRGGELFSHELRIARPQREDIELFMILPVPLRI
                     ETRIPLFLGSGTEYKAVVSSARPVSTDISICQQVTHLILQSIHQCHGTQLNMDYVNII
                     VPERDPAAMSKFLEAHSGRTSLAACLQQRPTVPGSLGLLRHVTKTSRPLRIEVIDGHE
                     CQDPHRDGVNLRIRGKIHPLTRRRNFLYDPKIVTVTPTENQHSTSLVRQGLSELAADD
                     YLVDRLPSIYAEAALLAPSIIHRIGVYLIAEKLRKQIFSNPQAARFERMDLLCIALSP
                     TDDMHRHEFRSMAFIGDAIVKFLITRQLFLHHTLWHEGLLTSVKDSIVSDTGLAAALC
                     HSGFGSYLITTRFNGKRWRPSFVSTTLSKSGPTRRRYVGAATVADMVKALAGAAFLDN
                     GLDQAFICAAAMIPKIKSWTTISLYDGTYSKSRPSKSLGASTIIDLEALLGYTFSDKS
                     LAIESMTHPSCVGLYGTASYRRLSFLGAGIIELVVVRYLHRQKSFTSSKRLQSLKSAV
                     TNNMFLAFLCLTFHWEKQHDIIEVDSMGVPSVIQTRGRVALYHFLRSQSDSLSDKVSS
                     LVEDLTSQLHVIKRDLWENGIYPWARLSVFRGLKVFSDIVQSVFGAIYIDSLASLQQS
                     EALAERLGILPLLEHFISHDVVTDHPKQPAPTQAQNLWQDSPGEGTAHVNQI"
     exon            complement(1003451..1005830)
                     /number=1
     exon            complement(1005879..1006883)
                     /number=2
     exon            complement(1006945..1007055)
                     /number=3
     exon            complement(1007144..1007418)
                     /number=4
     CDS             join(1015035..1015973,1016103..1016150)
                     /codon_start=1
                     /locus_tag="AO090011000396"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000092"
                     /protein_id="BAE64903.1"
                     /transl_table=1
                     /translation="MGRIYQSAELVLVWLGDCSSKLARGLPSLETLAKKTQNELPPLP
                     KFKGPGGELQAAATTAVDLSCRQWFKRIWVLQEYLLARKVNFLYGNNEVSLGALLTAC
                     IWVSHDPGAAMTPELPMKAELREALAHTNDIPNFLLARQAIGQGRRLTLREWLRACRR
                     RYAKDPRDFVFGGLSLICPESLKIDYQRLQLGDYPCVETQAPILPPRAGIHSQKDNRF
                     TAEHPTATFKGPTSSSLIPGGLWDFLRADYAASEVEVLINVAACLLSQKEQHTLDLLS
                     IAARRPWDDFDADVRNWFWPRAHPILPSWVPALGSRGQKHRIMLVQPLQLVY"
     exon            1015035..1015973
                     /number=1
     exon            1016103..1016150
                     /number=2
     CDS             join(1016255..1017265,1017354..1017416)
                     /codon_start=1
                     /locus_tag="AO090011000397"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000093"
                     /protein_id="BAE64904.1"
                     /transl_table=1
                     /translation="MTDEYIDILIRFLETVGGMPRAHLPSGGTSFDAVAISLASSLFF
                     SFPQSTKLNVTKGQNHEGISLSSVNEQHARVWLCEFIESEVRHWVTYLRMTREDYVLA
                     HGVESSGAKWPEEASNERQKKLDSLISAYWQLNEKFDDLPWSRTADEGVAAATAATPS
                     NEVTSNLWDLLETLQSAVDEKSFVWKRKLLISPEAQQYVTAFSLDLKRRSLFITQDGL
                     IGMGPSWLRKGDRVMLVRDASVPYVFRHVDEELRHQLQTMEMREDLLRECSVERKYSL
                     SRQLKRPTLERQISDLNLRISHLQSGTKDGWILIGESYIPGVMLGEVLERGGSEIFGR
                     IAILGYIKKGLFVMQLLSSSSHS"
     exon            1016255..1017265
                     /number=1
     exon            1017354..1017416
                     /number=2
     CDS             complement(join(1019016..1019131,1019435..1019675,
                     1019732..1021591))
                     /codon_start=1
                     /locus_tag="AO090011000398"
                     /note="vacuolar sorting protein VPS1, dynamin, and
                     related proteins"
                     /old_locus_tag="AO070316000094"
                     /protein_id="BAE64905.1"
                     /transl_table=1
                     /translation="MVLKKFFTNSLEELCTKEQLELLDSIDTLRLQGISHYISLPQII
                     VCGDQSSGKSSVLEAISGVSFPVRSNLCTRFPTELVLRKSPQIGVSVSIVPHHSRTEA
                     EQQSLSQFHEQLEGFDGLPRLIDNAKAIMGISTHGKAFSNDLLRVEVSGPDRPHLTIV
                     DLPGLIHSETKQQSAADVKLVQDVVQSYMREPRSIILAVVSAKNDFANQIVLTLAREA
                     DRTGSRTLGVITKPDTLTPGSETEAMFVSLAKNQQVSFRHGWHVLKNQDSEKSNGTLT
                     ERDAEEEHFFAKGVWRDLPLSDVAIKPFRERLSKVLLGQIATELPSLIEEIQVQVGDC
                     QRRLERLGSPRTTIAEQKYYLLHISQSFQNLVRTATDGTYNDPFFNSGQSTSGYSRRI
                     RATIQNLNQEFTERITSGGHYRQITDGDESEAVSRQQVLVTREEYIQHIQNVLKHTRG
                     KELPGTFNPLIIGELFREQSSQWEAIARGHVTTAWNIAKDFVRAVVLHIGDITTAKGL
                     LREIVDPRFDQLLRDLQQRTSELLQPHQQGHPITYNHYFTENLQKARREAWGDGLSTI
                     ICNFFGVSSLEATSLDGPSYNLRHLHDSILQSTESSMSRFAATEALECMLAYYKVALK
                     RFIDGVAIEVIETNLIKPLADIFAPLLVFDMADDLATRIAGESIENKSLRDQLSRKLH
                     ILRKGSETCRMFIGIRGLGDQPIGAPSIEQRDLKRSKKSKKGKTKKKSSRSDDWEL"
     exon            complement(1019016..1019131)
                     /number=1
     exon            complement(1019435..1019675)
                     /number=2
     exon            complement(1019732..1021591)
                     /number=3
     CDS             complement(join(1023694..1023826,1023883..1024409))
                     /codon_start=1
                     /locus_tag="AO090011000400"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000096"
                     /protein_id="BAE64906.1"
                     /transl_table=1
                     /translation="MTPKDKSKDKSFWSSIKALQAAAEDVIYHSKSFKTHEELQHKNT
                     ELENQLKAAHSTVEDHKRQLEEERQKQQTLLTEKAHLSDFLEERVKGWMEKEKELLAQ
                     LQKTREDAETSRDAQLHDLSRKVRNQDEQLRRVRTELGEKDTTIVGLQGRLAQSQQEV
                     EELKRATQLEDFGPDLIQNIKELEVALRDMVQKYFYKDFPTDISQVYSPSLTLCFDTD
                     L"
     exon            complement(1023694..1023826)
                     /number=1
     exon            complement(1023883..1024409)
                     /number=2
     CDS             complement(join(1025735..1026198,1026224..1026358,
                     1026455..1026467))
                     /codon_start=1
                     /locus_tag="AO090011000401"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000097"
                     /protein_id="BAE64907.1"
                     /transl_table=1
                     /translation="MGSSETACSLFNICLGIFLEQDPTIGRVVALDEAHKVCNSARLR
                     DVSNKQAQIFTETLLSAVRLQRHLGTRVIISTQEPTISTDLLNLCSVTIVHRFTSPEW
                     LRTLQKHLAAAACNLFSSKSGFGNNGSEVEEPGDEKESPSAFDIIVRLRVGEALLFAP
                     SAIVKVGTLEDGRVEFHRLGSDFLPIKVRERLTSDGGKSVLSV"
     exon            complement(1025735..1026198)
                     /number=1
     exon            complement(1026224..1026358)
                     /number=2
     exon            complement(1026455..1026467)
                     /number=3
     CDS             complement(join(1030328..1032536,1033640..1033641))
                     /codon_start=1
                     /locus_tag="AO090011000402"
                     /note="acetylcholinesterase/Butyrylcholinesterase"
                     /old_locus_tag="AO070316000098"
                     /protein_id="BAE64908.1"
                     /transl_table=1
                     /translation="MALNMYFQSLAVASLFCLLAIVRSEAPKAPPRIDSLGTLLALKY
                     NYLDPWNNGTAAVLSYEPLSNAEAHARCGAIGESLYPFQDTSELNRTELGYELDYLVH
                     IQDLQPYSTLWVGSSGTSGHACTAYSQKDKAAIPLPCHRKLPTLCTSSAPPTKDKHRE
                     PVKSSRLSVSFDDYNITGYRDARSFRFLGIPFANPPVNELRFAPPQPYTGQKEIDATS
                     LPASCIQSQSGFGTLENSRISEDCLYLNIYTPVLPAQRGKNVTHRPVAVYFYGGGFTK
                     GSTAMIDYDGGNFASRNDIVVVTVNYRVGALGWLATNKLTTGSYGTRDQILALKWVQQ
                     HIITFGGDPSQVTIFGQSAGGQSVIAMLSSSAASGLFSGAVVQSAALDIPWYSRQVYT
                     EIITPKVAKAVGCDDSDELGMLSCLRSVPAAKYLDNSTEFMHASDEIAKAVGDDYLHT
                     KKFQVSSSPLMPIVDDHGSGIIDDQFHTLLATNLLPNAVPIMFTTVTDEAALYVDRYV
                     PHIPLLGNTKVALGLFFNAVYPAGLTESLINSDAFPINSSDPDSLRNTGANALTHSKW
                     FCPQAYLLQHGARTVLPVVYTVQIQHGHVQTTIDTPKVCSPNTNYNATCHTSDVLPVW
                     GTLNSKTQNVNPYYDSRDIRHSQILNDIFSSFFRTRNPNPVPELLKIRGPAYSSSFDV
                     FGTSGYHIPEYRTDDDSLCSLDIAPGHIRNPAKSVGCDVFTKYGYPFQHAEESS"
     exon            complement(1030328..1032536)
                     /number=1
     exon            complement(1033640..1033641)
                     /number=2
     CDS             complement(join(1035262..1035281,1035367..1035446,
                     1035489..1035754))
                     /codon_start=1
                     /locus_tag="AO090011000403"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000099"
                     /protein_id="BAE64909.1"
                     /transl_table=1
                     /translation="MPGFTSHLTLILRRCFTHGDVRMRNLYYYAFYVNVSVTVVEVMS
                     IFYLTYASRNRLPVAATIGIGALQVVFTYTKANKCQRIYAVYEEQWLQRLSGVTKLIW
                     GCAGRVMAMDNWERWKRGF"
     exon            complement(1035262..1035281)
                     /number=1
     exon            complement(1035367..1035446)
                     /number=2
     exon            complement(1035489..1035754)
                     /number=3
     CDS             complement(1035820..1036248)
                     /codon_start=1
                     /locus_tag="AO090011000404"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000100"
                     /protein_id="BAE64910.1"
                     /transl_table=1
                     /translation="MLDSRAFHSFYGPMYGKLTPQEQQRFCFHHVNVVLKGILLVCVS
                     SSIVQVTIGGKEWTDPYYHHSSVTLWETSTFAGYIVVAVSLLDLIYDTSLRLVYMVHH
                     VGVLLAVQGLVFLIVNAPVERAQEMRYLGIMSEIGIFWGK"
     exon            complement(1035820..1036248)
                     /number=1
     CDS             complement(join(1037610..1037737,1037795..1037924,
                     1037977..1038567))
                     /codon_start=1
                     /locus_tag="AO090011000405"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000101"
                     /protein_id="BAE64911.1"
                     /transl_table=1
                     /translation="MALFALGWYHVTAGSLEFVGIRENYYNTLSHAVLLVLVMSEGLL
                     LLSFAAGLWPNQRSLTPDYYDSVLLLACGLVMIVVLIVGYHADEDWHFFLGRLEHSSY
                     TLMVLCGAAASLMISKRKGHHTKRNLIPALIIVVLGILFTSHHQEAMLGKKIHEVLGY
                     TMVVAATFRIVEILVIPDWTVKASTDVQSNLPYVTPMVAVILSFVAFGSSRDLCQAIE
                     GTGFMAPAYVAILYTCGLFYFCFLTALMHRIKDHWYPDGSDGKHEYSSLPEVQSDRFA
                     CNQNWD"
     exon            complement(1037610..1037737)
                     /number=1
     exon            complement(1037795..1037924)
                     /number=2
     exon            complement(1037977..1038567)
                     /number=3
     CDS             join(1039554..1039752,1039838..1039957,1040009..1040571)
                     /codon_start=1
                     /locus_tag="AO090011000406"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000102"
                     /protein_id="BAE64912.1"
                     /transl_table=1
                     /translation="MPNSWHGQHLACHPVIDGVRNLYGYQPSLAAGVFFSILFTILMI
                     FHVVHCIRRKTWWCMVFAIGCLVEVLGWAARTWSAKCPYTKSAFLMQLATLVIGQDNC
                     DMLRTGIYLLLGYIIRIFGRKSSYFRSDCYFWFFTVCDLISLVVQAVGGALASAALSA
                     HRDMSNGTHIMIAGIAFQMASTLAFATCMVDCVLRTIHRPRGTIPKSVSFLFAAMVLS
                     VLCICTRSIYRLAELSQGWTGYLITHEKYFIILDAVMMAIAVGIFVIFHPSLMVSAAA
                     NPPMGRRYRELAPINVK"
     exon            1039554..1039752
                     /number=1
     exon            1039838..1039957
                     /number=2
     exon            1040009..1040571
                     /number=3
     CDS             complement(join(1044546..1044742,1044810..1045095))
                     /codon_start=1
                     /locus_tag="AO090011000408"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000104"
                     /protein_id="BAE64913.1"
                     /transl_table=1
                     /translation="MWWPRATADRLQTCTFWFLWLFTWDDEIDQSTSDLFIHIHKAND
                     FRKESLEYVKFCLGVGDDETAKWDFQNNPPNRPLIRSLDVIGAHLQKVYNHDQIMTFV
                     NEIDYYMGCQQREQKRKLTGRLPIVAEYLETRMGTSAVTSMLALNEYGGALILGLKRR
                     "
     exon            complement(1044546..1044742)
                     /number=1
     exon            complement(1044810..1045095)
                     /number=2
     CDS             join(1047060..1047301,1047355..1047392,1047438..1047701,
                     1047764..1048422,1048476..1048604)
                     /codon_start=1
                     /locus_tag="AO090011000410"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000106"
                     /protein_id="BAE64914.1"
                     /transl_table=1
                     /translation="MQQNMIIPSFWTGTAIIGLVACAYVSYQCLLSPLARFPGPFAAK
                     LSKGWRAYKTANGQWHRKLVDLHRKYGHVVRIAPNELSVGDPSSFRKIYSPAEAGNGF
                     NKAACYSVVQGNRPFDLTGERNEKVHSEQRKLVATAYSMSSMVHFESKVNVVIETVIH
                     KLEARCRKTIDLGHWLQMWAFEPTRPLLNSLKPDVIGSVSFSQPFGYVESGDDEGVFK
                     RIQNAMGSAAWLMHAGWLFRLHQKLIPICGNWLAVNDRNGYFFQVACREVSGRINRGG
                     DDKDIIGQLLETQKIKPQLKDLDISFMMTSNVFAGSDSTSIAFQSIFYLLLTHPAAHD
                     RLMRELREREEKGELSDPVSFQEAESWPYLQAIIYEAMRLYAPAAFVLDRVVPPEGMM
                     IEDKFVPGNTVVGSSAWVIHRNPEIWGPDVDTFRPERWLDDRKDEYSTFLI"
     exon            1047060..1047301
                     /number=1
     exon            1047355..1047392
                     /number=2
     exon            1047438..1047701
                     /number=3
     exon            1047764..1048422
                     /number=4
     exon            1048476..1048604
                     /number=5
     CDS             complement(join(1049375..1049931,1049984..1050071,
                     1050146..1050399,1050462..1050492,1050553..1051044,
                     1051111..1051191))
                     /codon_start=1
                     /locus_tag="AO090011000411"
                     /note="cytochrome P450 CYP4/CYP19/CYP26 subfamilies"
                     /old_locus_tag="AO070316000107"
                     /protein_id="BAE64915.1"
                     /transl_table=1
                     /translation="MNSISALFSAGGFQWILLSLSLAFIVVYSLFYLAVGLYNLYFHP
                     LARYPGPLLGRASSLWYARSLARGTVAQDTLKLHEKYGDVVRIAPDELSFIQPENWSA
                     IYGHQLGKDYRELIKDPRYHDTVKPTPTILTGDWDEHTFYRKILSNSFSEKSLKDQEH
                     ILHHFVDLFVQRLKETSAEGTRELNMTDQWNYLTFDVIGFLTYGEEFHCLTSSKLHDW
                     IEAMLCVAILMSLGQAARHLPFPFDKIYKQWAIPSNVKRQVALHRDLTEVAIPHIPIQ
                     YASAYRLNSRKGDIPYSVLKEHANILTIGGSETTATLLAGATFHLGKNPPVLQKLATE
                     IRTTFVNDGEITVARLSECKYLLATVEECLRIYPPSPANHTRMVPKEGIVLNDQHIPG
                     GIGVGMPMYAAFRASSNFTYPDRFAPERWLGDPMYSKDKKGALQPFSFGPRNCLGRHL
                     AYQEIKLALAKLVYHFDLELNPKCGDWDEQKNFTFWVKPPLWVNLHPVKS"
     exon            complement(1049375..1049931)
                     /number=1
     exon            complement(1049984..1050071)
                     /number=2
     exon            complement(1050146..1050399)
                     /number=3
     exon            complement(1050462..1050492)
                     /number=4
     exon            complement(1050553..1051044)
                     /number=5
     exon            complement(1051111..1051191)
                     /number=6
     CDS             join(1051900..1052331,1052395..1052497,1052557..1052625,
                     1052679..1053287,1053342..1053775)
                     /codon_start=1
                     /locus_tag="AO090011000412"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000108"
                     /protein_id="BAE64916.1"
                     /transl_table=1
                     /translation="MDHFNLAGPESNTSITSLEWLGIKNSFTGSHWAHITGLSELHPT
                     GFLCLIATLIIGIVHLTRGPKPTVLPVVNPPGTFELTANRVKKEWLVDARQIIRRGFE
                     KFPGKPFNMIAADVGLTTVLPPEYASEIRNNPSLSFVAFMAHLFFSELPGFEPTREGM
                     FDNDIGITVVHKYLTVNLARITEPLSREATAALKDIFTDNSEWHDANLKAINLALVAR
                     LSSRIFLGEELCRNEEWLKITVNYTVDVMKAAERLRRVPGPLRRIVHWFLPEAQKCRD
                     EVKRAGKVIRPVLEKRRREKATMESEGKEALQYNDAIEWFEQMAKSQGTSYDPEVVQL
                     FLSTVAIHTTSDLLTVVMADLARNPEIIEPLREEISSVLRDGGWKKTSLTDMKLLDSV
                     LKESLRLKPIAVVSMRRVAMDHLKLSDGTFLPKGTKMAVSSHRMWDPDVYENPEQWDG
                     FRYVNLRETPGQDKHAQFVSTSERHLGFGHGKHACPGRFFASSELKVALCHILMKYDF
                     ELAPGTVVQHRYSGASYYADPAIRVMLRRRNVALPSWFER"
     exon            1051900..1052331
                     /number=1
     exon            1052395..1052497
                     /number=2
     exon            1052557..1052625
                     /number=3
     exon            1052679..1053287
                     /number=4
     exon            1053342..1053775
                     /number=5
     CDS             complement(join(1053886..1054695,1054767..1055238,
                     1055290..1055459))
                     /codon_start=1
                     /locus_tag="AO090011000413"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070316000109"
                     /protein_id="BAE64917.1"
                     /transl_table=1
                     /translation="METPAGKADRPRDHDSEQSQDNVVSWEGEDDPTNPLNWSPLAKW
                     VHVAIISIGTFTIAREKSPLASSIFAPGVVELAHEFHEENQLLTTIVVSIFVLGLAFG
                     PLLAAPISEMYGRWICYTVFNILYTIFTVACGVSTNISMLIVFRFFAGVTGSAPLTIG
                     GGTVADLFPMHQRGLALSFVTLGQAVAPAIGPVAGGFLTQNLGWRWVFWLLTIVNGTI
                     TICQILFTRETYAMTILNRRAKRLRKTTVHSSVTHRSVNFAIFFYSLVRPCKLLLLSP
                     ISLIVALCCAVIYGILYVLVTTFSPVFQDTYHFSIGISGLGYLGLGIGNLVGLWIFSM
                     TSDRYMVAQANRFGSAKPEHRLPMMILSGPVIAAGLFWYGWSVQARIHWMMPIVGSGI
                     VGLGNMFFFMPMVSYLVDSFPTYAASAIAANAVLRSIGGAVLPLAGQRMYDTLGFGWG
                     NSILAFMALVFNPLLIAIYRYGEYIRTRWQVKL"
     exon            complement(1053886..1054695)
                     /number=1
     exon            complement(1054767..1055238)
                     /number=2
     exon            complement(1055290..1055459)
                     /number=3
     CDS             complement(join(1055930..1056126,1056175..1056856,
                     1056925..1057050))
                     /codon_start=1
                     /locus_tag="AO090011000414"
                     /note="glyceraldehyde 3-phosphate dehydrogenase"
                     /old_locus_tag="AO070316000110"
                     /protein_id="BAE64918.1"
                     /transl_table=1
                     /translation="MTAKVGINGFGRIGRIVFRNSFSHENTEVVMVNDPFIEVQYAAY
                     MLKYDSTHGNFEYDVHIDGDSIVVNGKKVKFYAEKDPAKIPWKDAGAEYIIESTGVFT
                     TVEKASAHLQGGAKKVIISAPSADAPMYVMGVNEKTYAGADVVSNASCTTNCLAPLTK
                     VLHERFGVVEGLMTAVHAYTATQKLVDAPSKKDWRGGRAAAQNLIPSSTGAAKAVGKV
                     IPELQGKVTGMSIRVPTSNVSVVDLTCRLEKGASYEEIITAIKEAAQGELKGILDYTE
                     DDVVSSDMKGNPHSSIVDIKAGISLNPNFLKIVSWYDNEWGYSRRVLDLTAYIASVGK
                     "
     exon            complement(1055930..1056126)
                     /number=1
     exon            complement(1056175..1056856)
                     /number=2
     exon            complement(1056925..1057050)
                     /number=3
     CDS             join(1057794..1058010,1058070..1058204,1058266..1058684,
                     1058736..1059074,1059130..1059237,1059304..1059461,
                     1059518..1059707)
                     /codon_start=1
                     /locus_tag="AO090011000415"
                     /note="cytochrome P450"
                     /old_locus_tag="AO070316000111"
                     /protein_id="BAE64919.1"
                     /transl_table=1
                     /translation="MASLTGAAAVLLAFILAYSTALTIYRLFFHPLARFPGPRLAAAT
                     KWYEFYFDIIKSPGGQFFKELSRMHDVYGPIVRVNPDEIHVRDAAWFEVLYAPNPTKR
                     NKYRPSAEMAGLTLGIHGTVDHDLHRRRRMAIAPMFNKQSILSAEHLIKQHIDELTDV
                     FESYLGTNNPINLQTTFLAYTTDVLYHYMFDTDAGYQRDSGAAQQWRHSMDAVAQATP
                     FLKQFPSLLSRVALIPLPMLIWVLKRIQPDVAGLLGTHQLMASIVSKYMASKPEEDQD
                     ELIATKAVKPRTLFHAIEASSLPPHEKAPTRLAQEGLTVLFAGGETGSRLLAHTVYHL
                     LKNPEILEKVRKEILDAAGDSNQLPDMKALEALPWLTASVRESLRLRAATTSRLPLVT
                     EKPLAYADWVIPPNTPVSMSHGDILHNEDIFPDPMKFMPSRWFNASPQQNRLFVPFGK
                     GTRMCVGMNFAYCEIYMSLAVILARFDLELYDTRWERDVHYTRDCFLGEPDPASPGIR
                     VKVVADHKTFTRS"
     exon            1057794..1058010
                     /number=1
     exon            1058070..1058204
                     /number=2
     exon            1058266..1058684
                     /number=3
     exon            1058736..1059074
                     /number=4
     exon            1059130..1059237
                     /number=5
     exon            1059304..1059461
                     /number=6
     exon            1059518..1059707
                     /number=7
     CDS             complement(1059957..1060664)
                     /codon_start=1
                     /locus_tag="AO090011000416"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000112"
                     /protein_id="BAE64920.1"
                     /transl_table=1
                     /translation="MAETWMALPLFNRQNSPESSRDVLSMASPGLLPIDPSPEHDETN
                     KFGPFDLLDNLPGELQLPADLNPARVGPTTHLPDLTDRADPEPRWMQISDLEVVGPGA
                     VTCPFPGCKSTLRFTGSRELRRHYKQHFKRFFCRYPHCPQAGPGLQGPHPSTKRGFAT
                     RKDRARHEAKHDPRIQCPCLDERGERCSRMFSRLDNMRDHVRRIHNNSHYAGQETHGT
                     ADAIPDIDIHHEIEARS"
     exon            complement(1059957..1060664)
                     /number=1
     CDS             join(1062198..1062584,1062646..1063548)
                     /codon_start=1
                     /locus_tag="AO090011000417"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000113"
                     /protein_id="BAE64921.1"
                     /transl_table=1
                     /translation="MISMSVPRKKQEREISLLMHYVDDVFPHQFPIYHSQFVGKREWL
                     LPLLSSTRSVYYATLCLSLLHKEKSSNLDQPGSVSFCQEERLRYYILALRETQQLLQQ
                     LSPVCDLEAMRSCVPSLASALHLISYESSCPVYGDWKVHLQAATSLIPILVGGWNSMI
                     KPIKHTSTLWTGLTLSDFHDLHTEGSLSYEDASALRFLTNALAVTGILSFISTGPTSA
                     LSDYRYLMDATCDMVQCDQFLGCENWVMSAILDVGLLDRWKREEEGNRRLSFRELANR
                     AKRLEDCLENGIRELSAKTSGSSDAVSSITRIYASSTLTYLHSVVSGLNPDLSEIQES
                     VSRTIELLKELSNWHLLACLTWPLCVTGCMAAPDHEAFFHSLAISAEISPHSLRHTWI
                     VLRILKDVGKVRGSLGEQILPTWEQILCIDGAPILLT"
     exon            1062198..1062584
                     /number=1
     exon            1062646..1063548
                     /number=2
     CDS             join(1064223..1064343,1065373..1065701,1065769..1067040)
                     /codon_start=1
                     /locus_tag="AO090011000418"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070316000114"
                     /protein_id="BAE64922.1"
                     /transl_table=1
                     /translation="MPHGAVCLDVATDTIRADDIGIALDFLRWLIFGCKDDMRNLVSM
                     AHGNQSTNETEDISPVNSIIRSKDQTDETKVDNNELYPVGNECDKNDDAPYCSLSERR
                     KISVMLIASFSGIISPISASIYYPALPTIAKDMHVSISLINLTIMTYLILQGISPSFT
                     GSFSDVYGRRLAYMLCFITYIGANIGLALQSDYAALMVLRCVQAAGSSGTIAIGSAVV
                     ADISTRAERGKYIAYATMGTTLGPALGPVLGGLLDHFLGWRWVFWFLVILGGFNFTLI
                     LVACPETCRAVVGNGSIPPAKWNRPLWVILRDSLRPQSHKAGKRVDYETLERSKTRPN
                     PLTSVRIALEKEGGLILIYGALLYAGYMIILSTLTSQLESEYGFNSIQVGLCYLPMGI
                     GSLTSRWSAGPLLDWNFKREAKRQNLPIVKNRQQDIRDFNIERTRLTITIPFVYAGCL
                     FLLAYGWVMRFQTHLAVPLVLLFFSGHLTTGAFSTLSTLIVDIHRQSAATAVAANNLF
                     RCLLAAGATAFAAPLIDRIGIGWTTTFIVGVWIVFSACLWAVYLWGHKWRDELRVKRS
                     EGDGSPA"
     exon            1064223..1064343
                     /number=1
     exon            1065373..1065701
                     /number=2
     exon            1065769..1067040
                     /number=3
     CDS             join(1067384..1067646,1067699..1068467)
                     /codon_start=1
                     /locus_tag="AO090011000419"
                     /note="NADPH:quinone reductase and related Zn-dependent
                     oxidoreductases"
                     /old_locus_tag="AO070316000115"
                     /protein_id="BAE64923.1"
                     /transl_table=1
                     /translation="MSSNRAAYLLEAHKTPLEIQQAPYPTPDPGTIVVRNHAVAINPV
                     DWKLQKFEIFPIKYPFILGEDVAGEVIAIGDGVTNFTIGQRVVGHCKNFTAGDNRYSG
                     FQNFTVLSATLTAPLPPSISYEKAVVLPVSVSTAAAGLFQKDHLNLPHPSLSPQPTGQ
                     TILIWGGSSSVGLSAVQLAHAAGVEVITTASQHNHALLKSLGVSKVYDYRSPTVVDDI
                     VAALENKHVVGAYDCISEDKTQRACAEILERSNAARKVLVYTNDVLTPEGLPASVTAK
                     GIFCLTVEDNEVGPAVWVEYLPKALECGRFKPLPEPLVVGTGLECVQMGIERNMAGLS
                     ATKAVIRLV"
     exon            1067384..1067646
                     /number=1
     exon            1067699..1068467
                     /number=2
     CDS             complement(1069063..1070805)
                     /codon_start=1
                     /locus_tag="AO090011000420"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070316000116"
                     /protein_id="BAE64924.1"
                     /transl_table=1
                     /translation="MEFRGQCLIKGAASAELQFCPVEISFWGGVNPETGQVVDRHHPL
                     CGQSIAGRVLAIPCGRGSCSGSTVMLKLLLNGCAPAALIFEKPEQILTLGVLVGKVLL
                     DCPIPVVVLSSSDFSKICNRHFAAIDGETVLVSDALLPTPKLPADPVEGDFDLSDLDR
                     SILAGEKGQAAKVALEIIRSFAIIQGARSLLDVSQAHIDACIYTGPASLLFAQKFQSM
                     GAKFTLPTTLNSISIDQRRWKELNVDPKLASQAGTLANIYLSMGAQPSFTCAPYALDA
                     APKAGQNIGWSESNAVVFANSVLGAQTQKYPDFIDVCIALTGRAPSAGCHLPEGRRPT
                     MCIRVSDLGSINDSYYPLLGYVIGKLAQHNIPLVCGLEYLQPQLVDLKAFSAAFGTTA
                     SAAMFHVKGVTPEASKFAELEQELPVIDLRHEELVDTWHMLNSAQDLSVDLVSLGNPH
                     FSLEEFDALSKLCAGRKKADDVKVIITTGRDIYEKSKKAGYIDIIEEFGATIITDTCW
                     CMLGEPVIPVTSRNIMTNSAKYAHHAPGMVKRGVHFGSLAECVEAGCTGTFVGVPPGQ
                     ASDAGGQQTCQYRN"
     exon            complement(1069063..1070805)
                     /number=1
     CDS             1071744..1072547
                     /codon_start=1
                     /locus_tag="AO090011000421"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000117"
                     /protein_id="BAE64925.1"
                     /transl_table=1
                     /translation="MEWFPQWLLDLAKKHNAVIASANYRLLPEATSLDIFEDVEDFWT
                     WLHSSEVEELLSSCVNPTKLNLDRIITAGESAGGLLSVCLALAHPDEIRAATASYPCL
                     DMASAHYSAPNPVPLTNPPIPESLIDETLAQVKPGAIRSSALLPDRLDLGLAAIHYGR
                     LTQLYERGIGSSHHRDLRYPLERLDQLDAKIPRGGIAIIQGLQDHIVPAEGNQRFVEK
                     GREVMKGKPSADKIILTLREGTHGLDIPARLEEGWMQEHLEAAVEAWLM"
     exon            1071744..1072547
                     /number=1
     CDS             join(1074003..1075616,1076215..1076340)
                     /codon_start=1
                     /locus_tag="AO090011000422"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000118"
                     /protein_id="BAE64926.1"
                     /transl_table=1
                     /translation="MIYMFHRKASENPEIQNLYERCKQLARTIKSQEITQQSICPELR
                     DYMPSKQTSDRLIQAYLRTFESVYRIVHVPSFLREYDQYWRNPQAASPAFIIMTLLML
                     AIGNSFCQSGDPGKDYVPRSTSSQWIYTAQTWLSSPFEKSRLNIASLQTQCLLLLARQ
                     TNDISSDLVWISAGALLRTAMHMGFHIDPRHIDGISFFDAQLRRRIWNTILEIVVQSS
                     MDAGGLPLIRCDDYDCEAPLNIDDAQMEDAIPKAKPLEDFTETSLQIALRRSLSVRLQ
                     IAQFLNDFRRGTSYDEALQLSKSLISIYRESSALFDAFKNSGKCPTLFQSNLYNLMTQ
                     RFLLALHDPFAIKAKADPKLYYSHKEALLVSMRILAPFSTSTSEDLDYTALLLTGSPS
                     FRDVPTQAAAVVGDDLIERIKEQINTAVSAPYTSYPLSHGDSRRAVEKFVSCALARLE
                     SGETNIKGYLVSACFLAQIEAMECGQPIDEALSRTILAVLQTCSKILGDRVETLSPSK
                     PGIELSTAINEESTLTKFDNQFNWSLADDFIAVHLISTSNLGFGNSLTPIVVLAGASS
                     RFGHTLFHSSFIP"
     exon            1074003..1075616
                     /number=1
     exon            1076215..1076340
                     /number=2
     CDS             1077157..1078473
                     /codon_start=1
                     /locus_tag="AO090011000423"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000119"
                     /protein_id="BAE64927.1"
                     /transl_table=1
                     /translation="MTAQTFRQISNHNLQTFRHNYVSEISGSLGDLGTFLPIAIALAI
                     NGTVSLSSTLIFSGLFNILTGLFFGIPLPVQPMKAIAAVAIARSFNNGTIAAAGIFVG
                     AIIFIFSITGLLHWFADVIPIPVIKGIQVGAGLSLVIASCGNILSSLGWVGPSWADNR
                     IWAIAAFVFLIITNVYRKVPYALAVFILGIIFAIIRSALVADLPSFTFWHPYTVVPTP
                     GQWSVGALDAGIGQIPLTTLNSIVAVVHLAGDLIPNVRTPSITSVGLSVAAMNLVGCW
                     FGAMPVCHGSGGLAAQYRFGARSGSSVILLGLLKLVIGIFFGESLVGLLKRFPSALLG
                     VMVIAAGLELVSVGESLNTTGARDIMKANFGILGDTRQDISPMLSDADRKRRWTVMMV
                     TVGLLVGFKNDAIGFLAGILCHLGYELPGLWEKVRTRWNEGRVRLQ"
     exon            1077157..1078473
                     /number=1
     tRNA            complement(1080246..1080317)
                     /locus_tag="AO090011t00005"
                     /note="tRNAscan-SE"
                     /product="tRNA-Ala"
     CDS             1080595..1082220
                     /codon_start=1
                     /locus_tag="AO090011000424"
                     /note="conserved WD40 repeat-containing protein"
                     /old_locus_tag="AO070316000120"
                     /protein_id="BAE64928.1"
                     /transl_table=1
                     /translation="MAAPVLPLQQVKLPALPSTRLTPEQQYWKTFKNPLLIPSPANGP
                     VNLITQPSAPSSASAFPSLTQPPDVFTVTTGARVQIYSIRTRKLLRTVTRFDDTVRGT
                     DVRPDGRVFVAGDDTGALQVFDVNSRAILKSWREHKQPVWVSKFSPSDPTSLFTASDD
                     RTVRLWDLPSENSVKTFVGHTDYVRSGAFMPGSLASSGLLVSGSYDRTVRLWDPRVES
                     RSAMTFKMAAPIESVLPMPTGTTVLAAADNKIAVLDIVAGKPLHMIQSHQKTVTALAL
                     ASNGERLLSGALDGHMKVFETTGWNMVSGSKYPSPILSLRAITSGPAQEDKHIAVGMQ
                     SGLLSIKTRLSGQQKIKEKERRKEMQALLEGKLEEHDRKVAKQKKLRGSGWEKRFRGR
                     DFIGEGVDIIIEGQDRKRKKEQPWEHDLRKARYSAALDQVLASGDKTAQLTLLTALRH
                     RSALRASLQNRDEVTLQPVLQWVNKSIGEPRLVKLSVEVAMNVLDIYSGNLGQSATID
                     KMVDRLHRRVRDEVEMAHQACQTKGMLDMLKAA"
     exon            1080595..1082220
                     /number=1
     CDS             complement(1082411..1083379)
                     /codon_start=1
                     /locus_tag="AO090011000425"
                     /note="peroxisomal phytanoyl-CoA hydroxylase"
                     /old_locus_tag="AO070316000121"
                     /protein_id="BAE64929.1"
                     /transl_table=1
                     /translation="MEGLTPTQLTTFHEKGYLVLPNHLTTTEITSLLTETHHLLDTFP
                     LDTHPLTQFTTGDDLDTNSKPHVGDTYFLTSGDKIRYFFEPDAISTTPDPTTGKPTLL
                     KPKQQAVNKIGHSLHSLSEPFRAVSLCERNAAIARSLGFKDPRVLQSMVICKQPGIGG
                     AVPPHRDSEFLYTDPPSAVGWWFALQDAGPGNATLGMYPGSHRGKAGGRIKRRFVRRV
                     NGEGEVVGTEFVENDGPGLPRGKEEEEEEGQGPKEEDVEVLEVKAGSLVLIHGNVLHK
                     SEKNTSERSRFAYTFHVIEGAEGWKYDERNWLQPPENGEGFSKLYQ"
     exon            complement(1082411..1083379)
                     /number=1
     CDS             join(1084417..1084458,1084525..1084779,1084852..1084908)
                     /codon_start=1
                     /locus_tag="AO090011000427"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000123"
                     /protein_id="BAE64930.1"
                     /transl_table=1
                     /translation="MAITLDGGIALVTGAASGIGKETVFALAQAGVEGVILADLNLSG
                     AELVAQESTKKWATNSYFRTTAVQADVSDEAAVNNMVDVAVKEFGRIDYCVHAAGVAF
                     PGRQLSISRSTSMIR"
     exon            1084417..1084458
                     /number=1
     exon            1084525..1084779
                     /number=2
     exon            1084852..1084908
                     /number=3
     CDS             join(1084962..1085133,1085213..1085478)
                     /codon_start=1
                     /locus_tag="AO090011000428"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000124"
                     /protein_id="BAE64931.1"
                     /transl_table=1
                     /translation="MAKQEPRMHQSARHGTSRSLGRGSIVVVSSVNGTMVAPGMLSYT
                     ASKHAVAGIAKTAAIDNIKNHIRVNVVAPFYTETPMFEASLKRVPELGAAIKAITPLK
                     RAAAPEEVADPIVFLCSPAASYTNGATLIIDSGTTLTIPRTSL"
     exon            1084962..1085133
                     /number=1
     exon            1085213..1085478
                     /number=2
     CDS             join(1087555..1087813,1087878..1088098)
                     /codon_start=1
                     /locus_tag="AO090011000429"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000125"
                     /protein_id="BAE64932.1"
                     /transl_table=1
                     /translation="MRSAQRQDQLRDEWDVCCFETETAGLINDFPCLVIRGICDYSDG
                     HQNKEWEPYAAITAVAYVKDLLRVIHPETVEGAANVVGSLNDVSRALDKGDLEVSQLT
                     TSVDKIHEEQKNANILERLHLHDFNAEQSEASSESREVTGEWLLVLVGKRKCTGFSP"
     exon            1087555..1087813
                     /number=1
     exon            1087878..1088098
                     /number=2
     CDS             complement(join(1088949..1088961,1089101..1089564,
                     1089626..1089715))
                     /codon_start=1
                     /locus_tag="AO090011000430"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000126"
                     /protein_id="BAE64933.1"
                     /transl_table=1
                     /translation="MKLSFLSLLSAAAGVAVAAPTESTKDHSVPFNNRALGPLKPNPF
                     QGLKYKGDWQVGRYSVQASNIKTTSGNKLLFYPMTNITDVEVRGSVSVDGGKDKFNGK
                     SVKLGCSVKNGNKKQTVPCDIQITGSNLVNQKFVSVKYTDTKALQTVDLDDLYLVDAL
                     FFRIKSAGKDKELTEDITLLVDDFNLHS"
     exon            complement(1088949..1088961)
                     /number=1
     exon            complement(1089101..1089564)
                     /number=2
     exon            complement(1089626..1089715)
                     /number=3
     CDS             join(1093010..1093436,1093484..1093611)
                     /codon_start=1
                     /locus_tag="AO090011000431"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000127"
                     /protein_id="BAE64934.1"
                     /transl_table=1
                     /translation="MRVPDNNIIYTTPLQLAIHAITKFQPSQLAMPPRSRAVEGNVLP
                     LEDQYQKEFYRCLFPILDGHFVLSPEFVVKAGPKGGTIDFLIAEKKWGLELLRERDRL
                     VEHMRRFEQHGQYYSMLKSGEMEQYIVLDFTNTAPKKSRPEYKKKLYHVVFTDNYRHV
                     DVIDGSDLSVVQSFVLLEQSSSNV"
     exon            1093010..1093436
                     /number=1
     exon            1093484..1093611
                     /number=2
     CDS             complement(join(1097727..1097898,1097970..1098277,
                     1098317..1098804,1098860..1099331))
                     /codon_start=1
                     /locus_tag="AO090011000432"
                     /note="cytochrome P450 CYP2 subfamily"
                     /old_locus_tag="AO070316000128"
                     /protein_id="BAE64935.1"
                     /transl_table=1
                     /translation="MVTFWTGRRPTIWICDAWAADELLNKRAAIYASRPRMVVFSELG
                     AGQSNMVNMYYGDRWRLHRKLTHMGVGLQQVRNYRGFQNDESKVVALDLLREPREYVS
                     HFERYATSVVSIIGFGRRVSAYTDPIITEVVAVMQRAAELNVPGKSFPMLMESFPFLA
                     KFPNWMAPWKHGLGNGQGRGRPFFYALAEEAASGPEAKQCYARKLFEEVPKHNLTKME
                     ISSLAGNLFGAGSDTSSSTLVTFVLACCAFPETLPKAWEELDRVVGPHRSPTFEDESD
                     LPYVRAFVKEVLRWRSVAIIGGQPHAPIKDDRYKVRCTSLNSVLGWLIPRNTWVQGNV
                     WAIHHHEREFPEPDRFNPERYFEESPVHRPFPVDKGYMTFGWGRRVCSGQGLAEQGTF
                     ITIARLLWGFDIRKALDRHGNEVPVDIFDFTNGLNMRPNSFECRITPCNQEIRSTIER
                     EGLQALQDLSQYDGETKYRMSTYYNPEKL"
     exon            complement(1097727..1097898)
                     /number=1
     exon            complement(1097970..1098277)
                     /number=2
     exon            complement(1098317..1098804)
                     /number=3
     exon            complement(1098860..1099331)
                     /number=4
     CDS             join(1100451..1100644,1100709..1101370,1101448..1101953,
                     1102013..1102237)
                     /codon_start=1
                     /locus_tag="AO090011000433"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070316000129"
                     /protein_id="BAE64936.1"
                     /transl_table=1
                     /translation="MAEVSISTTTLWQNRKCLFLCSLVSMANLQYGFDLAAIGSLQAM
                     PGFLKVFGYPDPGSEGGMQWTTVQQLITSLLTLGSFVSSLVAGFFSAYLGRRHALWLA
                     CIVNAIACTIQIGAPSAGVLYLGRLLLGFANGFLVTFSNIYTAEASLAHLRGVMVALF
                     AYWVNIGSILGAAVDNKTKERMDRLSYRIPLACLYIVPTFLFVALFFVPESPRWLLHR
                     GKAQAARQALEQLRGTSYATIRASSSGDDSSDEITPSLLELEWAEMVKGVEEEKREQG
                     NVTALDMFRGIDLRRTILCYSMIGCQSASGVWFLIGYQTYFFTVSGITKAFEFSIMNT
                     CFGFLGVNIGMYAIRNWLGRRAILMLGAIACGLCQLASAIAATVSPNSLPTGQALVAF
                     TALFMFFYNGCVGAASYPVATELVSSRLRAWTVGTATSLGYLLAWLVNFCTPYFINPE
                     HLNWGARYGYIWAGSNLACVVFFYFFIPEMKGRSLEELDEIFAARVAARKFRSYQCLI
                     GEAARIAAVHAEGRKQNWEM"
     exon            1100451..1100644
                     /number=1
     exon            1100709..1101370
                     /number=2
     exon            1101448..1101953
                     /number=3
     exon            1102013..1102237
                     /number=4
     CDS             join(1103282..1103477,1103559..1103662,1103723..1103922,
                     1103968..1104128,1104184..1104434,1104488..1104759,
                     1104808..1104837,1104878..1105268)
                     /codon_start=1
                     /locus_tag="AO090011000434"
                     /note="cytochrome P450 CYP2 subfamily"
                     /old_locus_tag="AO070316000130"
                     /protein_id="BAE64937.1"
                     /transl_table=1
                     /translation="MESILLFLTISLVGLYLVGSHLSKKHSLGHLPPGPPRKPIIGNL
                     TDLPSHDVCDWEYWLKHKDLYVYSATTSSSSMTPASHETYSRSALPSGPPDPVGTLSR
                     AGWNKILGTLAYSDPSFKDMRKAIGHQIGSKTAASRFNAVQDLEVRRFLLRVLEDPDN
                     LLQHIRKVAREAGAIVLKIAYGYTIEPHGHDPLVDLADEAMATFGLAILPGTWVVDFI
                     PILKHVPTWFPGAQFARMAKQFRKSAAAFSDVPYAFVKRRLAQRDFEPSFLAGLIRKN
                     EEQPGPGSYEETVIKWAAASFYGGGSDTTVSTMSSFFLVMAQYPHVQRKAQAGIDCVV
                     GPDRLPSFQDRENLPYIYAMVKEILRWHPVLPMGTAHASVMDDTYEGYTFPKGTLMVP
                     NVCWVVQSLGDNSAFTHDPSTYPDPHTFKPERFLSYEGHEPEANPYYLVFGFGRRVCP
                     GRTLADANLYISIAQSVAAFTITKPIRDGKEVDLRAEYQSGAISHPVPYNVTITPRSP
                     RYEELIRAVETEHPWEKSHSEELRLV"
     exon            1103282..1103477
                     /number=1
     exon            1103559..1103662
                     /number=2
     exon            1103723..1103922
                     /number=3
     exon            1103968..1104128
                     /number=4
     exon            1104184..1104434
                     /number=5
     exon            1104488..1104759
                     /number=6
     exon            1104808..1104837
                     /number=7
     exon            1104878..1105268
                     /number=8
     tRNA            complement(1105646..1105717)
                     /locus_tag="AO090011t00006"
                     /note="tRNAscan-SE"
                     /product="tRNA-Ala"
     CDS             join(1106415..1106602,1106745..1107117,1107223..1107225)
                     /codon_start=1
                     /locus_tag="AO090011000435"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000131"
                     /protein_id="BAE64938.1"
                     /transl_table=1
                     /translation="MNPENGDRVLRYAAHISRWRPAVGTERLGRNAEWSGDASGAKCA
                     PDDDDDQELVLQSGYLIEKLNGGQWVQFCMQEQQGSTNQESSPATPSHPKSQRLTQGP
                     APHPIRLLIGRNNVRCGKVSFPYSYYRSDRLIGKSCLVSPPFLHLISSHLFLFLLSLV
                     YQFLPPAGVKPPVVKRVSGTGTIGFFP"
     exon            1106415..1106602
                     /number=1
     exon            1106745..1107117
                     /number=2
     exon            1107223..1107225
                     /number=3
     CDS             join(1107294..1107523,1107612..1110120)
                     /codon_start=1
                     /locus_tag="AO090011000436"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000132"
                     /protein_id="BAE64939.1"
                     /transl_table=1
                     /translation="MASKPPRLSMINHAAGIYADMSVDGPAIGTLVLVIDRAKNLPNR
                     KTMGKQNPYCAARLGKEAKKTETDLRGGQTPRWDQELRFTVHESPDYFRLKVTIFNDD
                     KKTDLIGETWIDLKDLIIPGGSQSDHWHPLQFRGKYAGEVRIEMTYYDTRPEDEAVIE
                     RRLHAAEKVNVQGKPSASSSSLNLRSSPAPISSSSSLSGPRQLKEVKRRPLPSGPPGS
                     GSARPALPEKTASAPPAPTQSPPRPTPEHTHSTPPLPTHDYPHSTPSPVEYTRHSSRH
                     PGPPEVPLDASAYGPPPGVASHSARTYESPDDFQREWSNPSHQAPAPPRRHLQEVPYH
                     SHRERPDSYDTRSHARPRSGYGNAPPTDFRSSRHDRPTSRSGPEMYAPMSGATPPRPS
                     SHHSNHHAFASQEQYVPNEIAHAQQVSRYRQRSPAGIRESQVEYGSHPVETELRYRPH
                     SNSLVKETSPIRPPSSRESLPAEYATMQPRVEDEEEEGPPPPPPVHRSGLVQTSQQLV
                     PSPTPSYQAYSPEFASPRTSNEINLSQPSHMQSDGGRMQDLPPHTNGLSMPPSLVAGF
                     DPAIAEAEADRAEHERRQSRRRSELIEDIIMPPEPTSVIVPYPVEPSPPIMDDRRSLI
                     SRGSAHSSETRLVPRRKSVSPRPPPLGERETSQIPFSPDSFDAFNPNAARAAVLRDPA
                     PAYDTPAEAMDAARRSEREAARDPGPIIGDDGREIDPSDHLPTDTWAPEPERKTKKPG
                     VVVRFKNVPRKRSPAPPPVREYASRSRPLVDGQHRRQSYVPDPAMRTSPGENRGRALS
                     PYRHGRTMSSPNAAPSHRTSVSPSPRGHSPSSLYAPVNTGPPIPAKVPIAQPMNQNYP
                     VMNGNGTPQGFPVAGSHPGMDALSRELNTIDIGSVGCSNQRALRRYVPKVPAGYAA"
     exon            1107294..1107523
                     /number=1
     exon            1107612..1110120
                     /number=2
     CDS             1110785..1111597
                     /codon_start=1
                     /locus_tag="AO090011000437"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000133"
                     /protein_id="BAE64940.1"
                     /transl_table=1
                     /translation="MPPKPKPRKENQPQEEPLPPCEFTFPCPATDDKANNPRRKVISH
                     IFGRNKYATKRFPDHVWVHYCRQHYQRARYRVEWPVMQCELLMVVLGRMERWGGVKGW
                     DVVLRKREVERLKGEDGGEGTSTSTSTSTTECDLITLSSGSGSSSACVGFTTDDGGEH
                     GRRRKPNIVASPVSGWLLREVGSDKSFADLRDLVRRVREDMDSLRGRGVPARRVVFPD
                     IELLPTFQSWVLAPAKKRRRSVRRDVGRGKKGGIGEKVSRVNGKGAVKRVHQ"
     exon            1110785..1111597
                     /number=1
     CDS             complement(join(1111939..1112112,1112171..1112455,
                     1112532..1112602,1112659..1112758))
                     /codon_start=1
                     /locus_tag="AO090011000438"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000134"
                     /protein_id="BAE64941.1"
                     /transl_table=1
                     /translation="MDFHLVPRGEDRNYTGFLTKTIVYTSSLVVFLAWNAAFGLTVSS
                     IVVPKWISYRNDQIWYSYGLHRRCSSVTDACVSFPQQDDCSGRGRYFCSMWRSVGFLM
                     SFAVVLEGMSIVAYLIILSGGKRLRESGWKVLSLLIVLSAVVQAASMSIVAYLYDHDT
                     RFFPGWRLDESWIYCTISWCISLLCAAALIVAGRVLPSEGGYELIPDHS"
     exon            complement(1111939..1112112)
                     /number=1
     exon            complement(1112171..1112455)
                     /number=2
     exon            complement(1112532..1112602)
                     /number=3
     exon            complement(1112659..1112758)
                     /number=4
     CDS             complement(join(1114288..1115376,1115439..1115663,
                     1115722..1117521))
                     /codon_start=1
                     /locus_tag="AO090011000439"
                     /note="RNA-binding protein SART3 (RRM superfamily)"
                     /old_locus_tag="AO070316000135"
                     /protein_id="BAE64942.1"
                     /transl_table=1
                     /translation="MDKLFAMGEDLWAEWIQDESMLAQTVDERIVVMELCQRSVEEEY
                     GSTKLWSIYGEWVLYLYNSAHAEGAQHQWTEEDRMIGREVFSWHMVLDVWQRGAEATR
                     WRTPDSHLVWDRLLDLQVQDITRNPSQEKIGHVRNLFDIRLQTPHATWDQTFQAFSGF
                     VSTYYNANYETIMADTAGRYATSCKEQYSAREEFEIRLRNATEAGDVTQEWTIFTEYI
                     EWEISNNRRNHHSNFELVNAVYQRAVLRFPTDANMWEDFVMFLIDESMHGNANTTTIS
                     TLERATRHCPCSGTLWSQYLLSSEREGQSFSKIADIKHKATSTGLLDVAGMEEVLKVH
                     TAWCSYLRRRAFMPDSTDEDLDVAEVGIRSAIESVQELGEKKYGRSYQGDPLFRLERI
                     YIRYLSESGSWDSARETFKGLMGRRGNSYEFWLTYYEWELISWSKFVQGEATVDAARR
                     TPNPSFATAVLKQAIKRTDLDWPEKIMQTYIAHCEDYEDSDELQLAILETRKAMRAVR
                     ARRERDARELAAQHAQQAASSQQATHPEKRKREEEEANVNGLPAKKARGEEETSAAEA
                     EPAVLQRDRENATVVVKNLPHQISEHKVRQFFRHCGTINSVKMFPGDGNSEVAVIEFN
                     SRDEALVAQTRDQKSLDGFTIEVQIGTCSTLFVTNFPPEADENYIRGLFREYGEIIDV
                     RFPSLKYNTHRRFCYVQFKTAEAAHSATKLDGTTVGKGLTLTAKISDPSRKQDRHGPI
                     YEGREIHVSNVDFKASERDVQELFSKYGTVELVRLPRKVDGGSKGFGYVVFSNKEEAT
                     AALAMDGQEYRSRTLHVKISAPQSTKRSATTIVSQVGKSQSPAAVVNGSKESADADTP
                     SRERAARSLGLMNIPDTVNDARIRALVEPYGKLIKIVLRPDHQGAIVEFADVNHAGRA
                     SLELEGQEIAPGRKLHVGTVPEMLKQSAENKDGRIQPSSKPKEKQGGFLQPTGPIKRP
                     QQPGSRGGRRGGLGVKRAGPHGGHNGEKTMTTTMMTTDSAPSAEGGKTKKSNDDFRAM
                     IQRGREE"
     exon            complement(1114288..1115376)
                     /number=1
     exon            complement(1115439..1115663)
                     /number=2
     exon            complement(1115722..1117521)
                     /number=3
     CDS             1120134..1121168
                     /codon_start=1
                     /locus_tag="AO090011000441"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000137"
                     /protein_id="BAE64943.1"
                     /transl_table=1
                     /translation="MASSHLSELPARTGITYIPRRTLTYTVPRRAQENGDNGNKEPQS
                     KSSAFSSIKNFFFGGKSDAKPTVQRRTAPQKREGSLSADSIFAEDEATPKLIASGRTP
                     AARKQEAEPTEEEEVQTGVEHRNRANMQMVLDPRPEARIRWERKMVVREVRRRGRLSK
                     PEQIMRTERESVSKSHWFKTSVKKLGPLARQIAGKNIDEAMLQMRFSKKKAAKDVLEH
                     LKHAKNVAVVRSGMGLGAAEATIRKPITITLKSGERKTITDPTSIYIEQAWVNRGPYG
                     VDYDHRARGQINLLRPPYTSLSVVLKEEKTRIREWKDREAVSQRKRKTQLWTQLPDRK
                     ISAQNQYYSW"
     exon            1120134..1121168
                     /number=1
     CDS             complement(join(1121596..1121994,1122098..1122578,
                     1122784..1122818))
                     /codon_start=1
                     /locus_tag="AO090011000442"
                     /note="predicted phosphoglycerate mutase"
                     /old_locus_tag="AO070316000138"
                     /protein_id="BAE64944.1"
                     /transl_table=1
                     /translation="MTLRPTPTTSTIGPETQFKLLFLGRHGEGVHNVAERRYGTELWD
                     VCFLSFPFSFLRSFSLFGSAGFHDHDPILAWFTVHSISLILMKRGEKCYWSLQNGDET
                     GTWVDARLTPLGISQAETANQAWRTQIQNNIPSPQSYYVSPLNRCLATASITFKDLGL
                     PHTEPFRPVIKELLRETLGLHTCDSRSSKTAIAEEYPLYRFEEGFAEEDPLYDPELRE
                     SDFARDVRLRELLSDVFAHDASTVVSLTAHSGAITSILEVVGHRRFALMTGAVIPVLV
                     RGVRVEGPSPPVQVEPPTRAPVCPAGWV"
     exon            complement(1121596..1121994)
                     /number=1
     exon            complement(1122098..1122578)
                     /number=2
     exon            complement(1122784..1122818)
                     /number=3
     CDS             complement(join(1123164..1123188,1123305..1123594))
                     /codon_start=1
                     /locus_tag="AO090011000443"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000139"
                     /protein_id="BAE64945.1"
                     /transl_table=1
                     /translation="MNSLPLQSVSTNRSSSGGSQQLRISQTMSTVTSQQVSVGNYCTA
                     LSSYATTVIFKSGLAFAGFWQSIGSAVSSAGGMFGRLAVFASKEHWFARKGMGGVLGI
                     FS"
     exon            complement(1123164..1123188)
                     /number=1
     exon            complement(1123305..1123594)
                     /number=2
     CDS             complement(join(1124115..1124123,1124264..1125088))
                     /codon_start=1
                     /locus_tag="AO090011000444"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000140"
                     /protein_id="BAE64946.1"
                     /transl_table=1
                     /translation="MSADQLLYSMGHSSQGDEFFDFDNFFDIPSDYVDSNPTSVNSIS
                     PKDFDLTYNDLDGSNWDSGLDMCTQFPFTDFVNHEPSFQEYFGDSANAEPVVDPNDIL
                     QLPSTSPSEVFVGSEFDNAWLPGAHGYDDHYYSTIRHMVESQAAVDPSCSSKKEKRRE
                     AAIALHLQRLQDAPLPETDMSSDSNTSFPSPQWSVSHDPACASPATTSLSDSTKSPTP
                     PSADATPGGIELVLDLNMNTPANLPRKQKPRSRAQKENYIKVRKHGACEKHRKQHKRA
                     D"
     exon            complement(1124115..1124123)
                     /number=1
     exon            complement(1124264..1125088)
                     /number=2
     CDS             complement(join(1126661..1126982,1127036..1127380,
                     1127432..1127925))
                     /codon_start=1
                     /locus_tag="AO090011000446"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000142"
                     /protein_id="BAE64947.1"
                     /transl_table=1
                     /translation="MDEFFFRSGTMNTFRTFGLLALLAIFSVAQGANLALDQHSQTLE
                     FPKARRLSAASLPPSLRVREIEMVALKREASFDFIHEVPGDDTEYVFTTTLNVASQHP
                     ILALEALETDIDDMSCSDSTIQLSIDSPTRARALKQELEAVSDFVVVTSHEGCDLEGE
                     RSIHHVTKTSVDLARQVFTLEKVKCDWHDASHSTSVSFSHRHRSRIQRRTYTLHQKRQ
                     QEATSAPTTTRVVGEGSTPSISFPAVPTATTGLPSSVTKSLDKHYVNQKIFPPDTPAA
                     DMFIPQGVTVTCKNCTLQGDIEITRGSFNISGNTIKDTIAFFDDGALEITSNGLFAQV
                     ELGLSLSLSQSLASLNMSLPTIPLTPFEVGIRAQGVIMLYYDGIDNPRYQEL"
     exon            complement(1126661..1126982)
                     /number=1
     exon            complement(1127036..1127380)
                     /number=2
     exon            complement(1127432..1127925)
                     /number=3
     CDS             join(1128938..1128941,1129587..1129794,1129857..1130004,
                     1130083..1130118,1130174..1131220,1131291..1131576,
                     1131650..1131777)
                     /codon_start=1
                     /locus_tag="AO090011000447"
                     /note="acyl-CoA synthetases (AMP-forming)/AMP-acid
                     ligases II"
                     /old_locus_tag="AO070316000143"
                     /protein_id="BAE64948.1"
                     /transl_table=1
                     /translation="MNLASTAPVAARFADPELCSWTTRGTLVLRVERLDRMRLTFTLF
                     YPKPPLLESTIGDHFAQIVSAYGDRTAVICKHQNDRVTYAGLDAKSNALARGLESVGV
                     RTGDRVGVMLGNSMEFSIATYALFKLGAILVPINPSFNATQVVSALTHLEATHMIVST
                     ESNLPRKEPRSNIPILQHLVQDLHKSKLESALVPSLKHIIIVDNSSGRVDISEYRSLT
                     KFSSVTSAAKADEAALPYRDLSPHDVVNIQFTSGTTAMPKAACLTHRSVLNNGSQIGD
                     RMRLTPEDIVCCPPPLFHCFGSVLGYMATATHGSAVVFPTESFNARAALTAVQEERCT
                     ALYGVPTMFIEELTLIDDGEVPNEGFGHLRTGIAAGSSVPAALMQRLHKVLNLTELTI
                     CYGMTETSPVSAMTTTDDPIDKRINTVGRLMPHVEAKIVNPADRSQILPVGVPGELAV
                     SGYLLMKEYWGDPQRTAESMIADEKGKVWMHSGDEATISPDGYVTITGRIKDLIIRGG
                     ENIHPLEIENCILTHAGVMDVSVVGVPDEKYGEVVAAFIIPKEHQDEAAPLTEENIRE
                     WVRGRLSNHLVPKYVFNLEHTTIFPKTASGKIQKFKLKEDAIRTLKERNSLS"
     exon            1128938..1128941
                     /number=1
     exon            1129587..1129794
                     /number=2
     exon            1129857..1130004
                     /number=3
     exon            1130083..1130118
                     /number=4
     exon            1130174..1131220
                     /number=5
     exon            1131291..1131576
                     /number=6
     exon            1131650..1131777
                     /number=7
     CDS             complement(join(1132057..1132152,1132229..1132295,
                     1132443..1133166,1133232..1133541,1133645..1133806))
                     /codon_start=1
                     /locus_tag="AO090011000448"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070316000144"
                     /protein_id="BAE64949.1"
                     /transl_table=1
                     /translation="MTVFQLDRMNIASALTGGFGKDIHIDQSTVNLGNQLMFLGIIVL
                     EIPSNLILQKIGPDKWIPAQVLAFGTIATFQVFLRNRTGFLVVRSLLGLAEAGYIPAS
                     LYTLSIWYEQTELAKRVGIFFFGMFGGNAISPLLGAGILKLDGKHGLKGWQWIFLIEG
                     IFTITTAIIILLLLPQSPSNPRPYLLKRGVKSFSPEDRDILLTRTSRREGESESEIES
                     ESPSKTHHSSPAYKSNIKKALLNYRRWPHFLLAPCVFSTWSPLTTYTPTIMMYVHPLE
                     PPTNTQSRSPLIERERKRTLGFTRLQSNALTAIGATLALPLVFLFSYISDRTTKRGLT
                     VIAAVTCYLIVLIVCRCLLPRVEGKWGKFGIWTVINAFAVCYHPVHNTWLQLNCRCSG
                     ERSIAIAGHGFECGFDGWIADFSGEGFAFVSDWACRYDCLGGWGVGVGDWAGGYLSQI
                     EF"
     exon            complement(1132057..1132152)
                     /number=1
     exon            complement(1132229..1132295)
                     /number=2
     exon            complement(1132443..1133166)
                     /number=3
     exon            complement(1133232..1133541)
                     /number=4
     exon            complement(1133645..1133806)
                     /number=5
     CDS             complement(join(1134560..1134574,1134637..1135140,
                     1135190..1135591,1135645..1137288,1137348..1137526,
                     1137795..1137813))
                     /codon_start=1
                     /locus_tag="AO090011000449"
                     /note="chitin synthase/hyaluronan synthase
                     (glycosyltransferases)"
                     /old_locus_tag="AO070316000145"
                     /protein_id="BAE64950.1"
                     /transl_table=1
                     /translation="MSYNRLGESYGEDDHSHSPMMNPHQTNNRSPSPGRPLNAYQLSD
                     VSYGPQERLHMPSSDLLAEQPTYSVERLPNSYGHNEAYEQHHQQSYPGYEYAVDPEAH
                     HDAYYTQPYQPTVTPHDDYDLGQYPEHQHQHSYSDDRIPMLQQDNPFGPDPYSDEYQV
                     EEQADGHTPSPAPIRRWKTVKEVQLFNGNLVLDCPIAPKLLNQVPHAEPPGRDEFTHM
                     RYSAATCDPNDFFEERFTLRQKLFAKPRHTELFIVVTMYNEDDFLFARTLIGVFKNIE
                     HMCSRTHSKTWGKDAWKKIVVCVISDGRAKINPRTRAVLAALGVYQDGIAKQQVNGKD
                     VTAHIYEYTTQIALELKGTQVQIKGRSAVPVQMIFCLKEKNQKKINSHRWFFQAFGRV
                     LDPNICVLLDAGTKPGKDSIYRLWKAFDVEPMCGGACGEIKVMLSHGKKLLNPLVAGQ
                     NFEYKLSNILDKPMESAFGFISVLPGAFSAYRFVALQNDKNGQGPLERYFLGEKMHGA
                     NAGIFTANMYLAEDRILCFEIVTKRNCRWLLQYVKSSTGETDVPDQMAEFILQRRRWL
                     NGSFFAAVYAIAHFYQIWRSDHSAIRKFALLIEFFYQTINMLFAWFGIGNFFLVFHIL
                     TTYLGQKDLLGTTGKVLGVVFEWLYLATLVTCFVLALGNRPGGSNKFYMTMVYFWIGI
                     MIYLAFACIFVTVKSIQTEVQQDGFTFTDLFTNSTFFTIIVSLGSTYVMWFVASIIFL
                     DPWHMFTSFIQYILLTPTYINVLNIYAFCNTHDITWGTKGDDKAEKLPSANLKPGGKV
                     DVDIPQDDGDLNAQYDTELAKFAEKPPKEVQVISEEERQADYYKGFRSAVVLAWVFCN
                     FALGAVVLSAAGLDRFDQSEKTSEDSNKRSTIYMAVVLWSVAGLSIFKFIGALWYLVV
                     RMFRGV"
     exon            complement(1134560..1134574)
                     /number=1
     exon            complement(1134637..1135140)
                     /number=2
     exon            complement(1135190..1135591)
                     /number=3
     exon            complement(1135645..1137288)
                     /number=4
     exon            complement(1137348..1137526)
                     /number=5
     exon            complement(1137795..1137813)
                     /number=6
     CDS             complement(join(1142051..1142420,1142475..1142560))
                     /codon_start=1
                     /locus_tag="AO090011000450"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000146"
                     /protein_id="BAE64951.1"
                     /transl_table=1
                     /translation="MKSSVSALALLFLGAPQFSLAHPTGTENLNGTEGDSELEKPGYD
                     VLASFPQPAGDLCDDQLKDVNVEFIPTGPGAFRIDNVPPACMTLATLFLDGPDSPDPI
                     PLGKDNLTLLYLASVANIRSAGSASIGFSGMDDDELQRLQAILDANTNH"
     exon            complement(1142051..1142420)
                     /number=1
     exon            complement(1142475..1142560)
                     /number=2
     CDS             join(1143431..1145165,1145226..1145410)
                     /codon_start=1
                     /locus_tag="AO090011000451"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000147"
                     /protein_id="BAE64952.1"
                     /transl_table=1
                     /translation="MVSRQILGVLALALLCLFQSCGALPLESRVSLSASGSEAKLEPR
                     LFGLGKIASLIGKLVGRSKGSGGSVGGSHRKEEPKKEEPKKEEPKKEEPPKEEKKEEP
                     KKEEPKKEEPKKEEPKKEEPPKEEKKEEPKKEEPKKEEPKKEEPKKEEPPKEEKKEEP
                     KKEEPKKEEKKEEAPKDGKAEDKKEEAPKQQSGQGQQPRQQPGDPTQGQQLGQGQSPA
                     QGQPPVQGQAPVQGQAPVQGQTAVQGQLAAQEIAQQVPPQQQSAQQQQPGQGQPKAQD
                     TTQQQGFQQQQPTQQQQPGQGQQAAETAQQQQSTQQQQPGQGQQPGQGQQPQSPTQQT
                     FAPQQASTEPANVHVDNTPTRQDIYGSAVLGAGIGAIPASISAATLKNENELNREQNA
                     HEGELNRQQSLDLANKQNNNNSGGATSPAPPAGPAPPADPAPPANPGNTGYGGAGDTG
                     STGYGNTGNTGSPSYGNPSNAGSPSYGSAGNTANAGTVGTTGNVGNTGYGIPNTAGTT
                     GSTGTVGTTGNAGYPGNTANAGYSASTNQKRGFPQIDQGVHREIQEVHDSCDKDIDGP
                     SYLVTYYAISSDSIRLDDVPPSCIKLAEILSGQPELSSSGPVPTPIGSTSIEYHGLNE
                     QEKESIMNSLHESHI"
     exon            1143431..1145165
                     /number=1
     exon            1145226..1145410
                     /number=2
     CDS             join(1146348..1146502,1146573..1147029)
                     /codon_start=1
                     /locus_tag="AO090011000452"
                     /note="magnesium-dependent phosphatase"
                     /old_locus_tag="AO070316000148"
                     /protein_id="BAE64953.1"
                     /transl_table=1
                     /translation="MTRAEPVTFTDGLPLPRLIAFDLDHTLWPFKVDADVCEPVEARD
                     NNSCVVDRRGKSFAFYPAVSSILSSCKDRSIPLALASRSHAPDLALAMLEALHINLAS
                     SDSTALNTPSVGARNYFDYMQIVSGTKTQHFTRIHHASGIAYEDILFFDDEARNLDVE
                     TELGVTFCLISGGITRDEVDRGVRAWRKRKGIAQKTTDNRSSV"
     exon            1146348..1146502
                     /number=1
     exon            1146573..1147029
                     /number=2
     CDS             complement(1147458..1148951)
                     /codon_start=1
                     /locus_tag="AO090011000453"
                     /note="ADP-heptose synthase, bifunctional sugar
                     kinase/adenylyltransferase"
                     /old_locus_tag="AO070316000149"
                     /protein_id="BAE64954.1"
                     /transl_table=1
                     /translation="MLSEDSATLPYAERPLLVVGDLILDQFIRGTVKRISPEAPVPVV
                     EQQEAAFYPGGAANVACNLAALGAAVVLVGAIGDDEEGRQLMRSLSQSKIDTSLIQVI
                     PGRPTSLKTRIIAEQQQIVRVDREVTTPLGEQHVSRVLEAIQGCLAGSAGLVFSDYNK
                     GFLSPSIVTAIIRQAQSLEKTVIADTKLQVLDHYRGVTALTPNINELQLSTGRLLCSP
                     SDIDVAARELMDKIQAPVLLVTCGQNGIRLYDSDSQQRTHFPGHAETVADVSGAGDTV
                     IAVFTWALTIRRFSVHQAAKLANDAGTLAVGKKGISTINVDELLSLVEVHSINGLDRE
                     LGPSKNRTLEQLLSDIHAVRQSQPSAKIVFTNGCFDMLHAGHVSYLQRAKALGDLLLV
                     GLNSDSSVRQIKGNRRPIVPEAQRVQTLAGLECVDFVVLFDQETPLHLIQAIKPDFLV
                     KGSDYELHQVVGRDFVEANGGRVELLPSNQGISTSKIIQEIMNRYSE"
     exon            complement(1147458..1148951)
                     /number=1
     CDS             join(1149645..1149653,1149707..1150049,1150110..1150607,
                     1150683..1151140)
                     /codon_start=1
                     /locus_tag="AO090011000454"
                     /note="mannose-6-phosphate isomerase"
                     /old_locus_tag="AO070316000150"
                     /protein_id="BAE64955.1"
                     /transl_table=1
                     /translation="MIGIGKGKLGKQSIVAQFAVTTSAVEDKALDENKPYAEFWMGAH
                     PSLPSYDHSTGQSLQDVLRDNPHLLSTHVSQKFRTTLPFLFKVLSIREPLCIQAHPDR
                     DLAHDLHARDPLTYPEIYITSIVDSNHKPEMIVALTPFEALCGFRPLKEIDRFLSSVP
                     PLRNLISDGTAMEVRSTCGSAGDRCDQKSAEIALKRAWSELLTAHPSRVRSCAEDLIR
                     FATSRPSNESFAVEHGNLTDLILQLSEHYPYDVGLFAVLFMNHVCLSPGEALFVRSNE
                     LHAYLSGDGIECMASSANVVRAGFSRKTKDVDTLISMLKYEYLPPFIVRTPTPYLRVA
                     MSSQQSTSVLYESPAEEFNIIKTSLAPRSARANFQAFRGPTVLICTQGSGKIGVADHA
                     ELIECGYVFFVGAGAEIFIQSSSEEPLILFQSFCEIEECNPQL"
     exon            1149645..1149653
                     /number=1
     exon            1149707..1150049
                     /number=2
     exon            1150110..1150607
                     /number=3
     exon            1150683..1151140
                     /number=4
     CDS             join(1151579..1151648,1151719..1152245)
                     /codon_start=1
                     /locus_tag="AO090011000455"
                     /note="protein tyrosine phosphatase"
                     /old_locus_tag="AO070316000151"
                     /protein_id="BAE64956.1"
                     /transl_table=1
                     /translation="MTATKAAPSGHQVNVLFVCLGNICRSPMAEGVFRNMAASHPLIN
                     EIDSAGTGAYHTHEPPDSRTMSTLRQHGIKNYNHAARKVTKEDFLTFDYLMAMDKYNL
                     RDLLDVRESVIASLSKSKKGTRAASGEAGAKVAEVRLFGDFGAGGKLHERVGGGEVVQ
                     DPYYGGVNGFEEVYQQVVRFSKGFLDYLEKNQGGEDDN"
     exon            1151579..1151648
                     /number=1
     exon            1151719..1152245
                     /number=2
     CDS             complement(1152605..1153381)
                     /codon_start=1
                     /locus_tag="AO090011000456"
                     /note="DMQ mono-oxygenase/Ubiquinone biosynthesis protein
                     COQ7/CLK-1/CAT5"
                     /old_locus_tag="AO070316000152"
                     /protein_id="BAE64957.1"
                     /transl_table=1
                     /translation="MKTVAALRRCPLTHSYRPSPLVFDFLAPSTLRQSSRGYKSTAKT
                     PFWGKSHDASPSPDTTPISPKPKYVLSQKQREFLDSALRVNQAGELAATLIYKAQTPQ
                     VVRSHPHLRPLMKHMYDQEAGHFSTFNQMVAKHQVRPTAMYPIWEVAATFLGWSTGAM
                     GREAAMACTEAVETEIGSHYNEQVREILSWQAEAERRGEELDDELKDMLATFRRIRDE
                     ELEHLDHAVENDAKEARPYDPLVSVIRLGCRAAINISEKV"
     exon            complement(1152605..1153381)
                     /number=1
     CDS             join(1153948..1154159,1154258..1155009,1155070..1155209,
                     1155259..1155993)
                     /codon_start=1
                     /locus_tag="AO090011000457"
                     /note="Paf1/RNA polymerase II complex, RTF1 component
                     (involved in regulation of TATA box-binding protein)"
                     /old_locus_tag="AO070316000153"
                     /protein_id="BAE64958.1"
                     /transl_table=1
                     /translation="MADDLDAELLALAGDASDEEASSPPRQKDASPSASPPQSPEESS
                     TMGRKGTAKPVRRGRKSRKDDEEDGEVSAAESHNSLDSASMVESESGSDSEGSDAGAE
                     DDGPIFPYDKLYYSSKDKEEIMAMPEIQREQILSERAQQVDRHNQDLALRRLLASRER
                     EEARQAKKNKRKASMANLEDGQRKSSRQKTTLGGRKVGETSDAIEAYKRQREQKGRRD
                     ELRRREPASKDQTVRPRDRVSDEDAEGESDAEWDDGDRSPSLPKDDPPAELRDIQRAR
                     VGRTNFAQVCFYPGFDDAISGCYARVNIGPNRETGQNEYRLCLIKKFTEGRPYSMEGP
                     NGRSFVTKQYAVLAHGKAEREFPFVACSDSAITEAEFNRYRQTMAVEDCKMATKSTVA
                     EKVVDINRLLNHKFTPEELTEKLRKQGSLDTKSTVFKRMETEKKLKLAKAAGDDAEVE
                     RLESELASMSTPKLAFNATSSKPRADKPSEHERLLELNLRNQRLNTENVRRAQLEERK
                     ASRKAAAAVARGEAQPNPFMRVRTHARTHYDANGNGTTLSETTTRDGTPATGSDTPSK
                     ANTPNGSNPPSGSQKKTTKGGVATIRHRNMDDENIAALDLDLDIEI"
     exon            1153948..1154159
                     /number=1
     exon            1154258..1155009
                     /number=2
     exon            1155070..1155209
                     /number=3
     exon            1155259..1155993
                     /number=4
     CDS             join(1156717..1159427,1159486..1160557)
                     /codon_start=1
                     /locus_tag="AO090011000458"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000154"
                     /protein_id="BAE64959.1"
                     /transl_table=1
                     /translation="MLTPGQKIKAMLAQFDSDSDSDSGKPQPQRSISKLTDTLKNSTV
                     SDQPPSMDLDEEASDEDDDIIMPKGRMAARLQAQNDENNESAFDRVSKSLRNAQQEKR
                     DSKADGAMSEDDDDDDDLPVAGPRRKTNNRVVEEREESDAEESPSRARAFSPLFVSSP
                     TRGNDQEQDGAEDSEQDEVRPKANSRFLALVAQKRKEREEKERIENEKKAAKAKQREQ
                     FSSEILSGEDSEGDDESGRKLSQPARPARKASKKALEEMNRETQRISRSMQLVHQAQT
                     KKKISKESFFARFNFMQPDQQNASGSAPDNSSTTADSQNSSDAEAQKNKNTPHTSPIL
                     GPSEKPSTGNDTNDASKEASTEFPTLEEMIAKAPQHSEQPIVGRMEEQTTDKKPHVAE
                     EKKQKKVLTMPPVRVRLSREQVARNQRDDSDSDDLEIVTSPAKCRRYAAFENVSMRRH
                     QESATMLKLKALAQLTSPPKKSGMNYAELSAHLLHQARQQASKERMERIEELRAKGVI
                     IETADERAALEDELENLVEKARKEANEIAKKEKAAANGEGDDEDDDYEFSGSEEEADE
                     ADEDGDDDDEEEEEEGNEEGEKDGDLLDAEAGEDEESDDDELEVMSSEETSLPTQRRK
                     RPTRVISDDEDEPPVPKTPAKMTNRIKVQSVERPHIPGLPSDDMTMSLTQAFAGTLGD
                     NHSQAGSTIPHSLPDPVDGRQESDSQMIIKDSQEQRHETPDVLAGYAQSEIRVSESPA
                     PRGMSQFSQIPDPTQDAGFVLSPFDPSKRFMSTPASTVETVLINRNQSQNNSPTVERK
                     SKHLRRGRTTELSAIEEQSEGDFEIDASAFDIMKANKKKSSVPFDKKKSKAKDVVEEA
                     AEESDDEYAGLGGASDEDDDVEDAYDRQMIDDNSGETADEKQLAALNALHQRNADEKQ
                     VAKLLKDITTGALRRRRGGDDEFDLDDSDDELLARRREKQREFARMRKALMADEKIGE
                     IAENPKKAAFFKAVEDRDMDDDGLDFLEPEEHPESQGESSSQDVIPDSQPDTTTTGDS
                     NKRKRPLEPSAEDINNRPPPHMRRKPASVMSKKPATLAEIRETLSFLTETPEYDSFHE
                     DATVDDDEEQDKAIDGEAADEQPSNSQSTEEFAVPRHPRRTKGPVVDRLALLRQASSN
                     SATSGSSNTRFAFQTGSGPDPIGFRPPLLRKTTTSSSSTSSSSKSDTSRRVTKPASGA
                     SVAKKGAVNYYTAAREKERERELRARTRNTGTNITALVNKHSSNRLGALGRTGQWD"
     exon            1156717..1159427
                     /number=1
     exon            1159486..1160557
                     /number=2
     CDS             complement(1160841..1161944)
                     /codon_start=1
                     /locus_tag="AO090011000459"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000155"
                     /protein_id="BAE64960.1"
                     /transl_table=1
                     /translation="MSAVNLPALPQSILKKLFNKPSTYYLNPLIQPSSPQKPKKEKTA
                     MTQTHKRTLLLTLDAFETLFHPRPSVPEQYASAAHHFGLPKTAITAERVLSAFKPVFK
                     AQSQARPNYGRDDVIRGCYGGPRQWWGEIIRGTFSRVLAEHYHYNNITTDSDNNNSNS
                     RSQVDLPDGLVGYLLDRFASKEGYALYDDVGPFFSHIRAVKENEGRLGPFERVVVGVV
                     SNSDDRVPAVLKSLGLRVGDCRADEGVDSMRLSGFEERSSSEMTEGSGVNDGVSDIDL
                     VITSYEAGVEKPSPRIFEVARRQAKALTRVEDLGGWTCVHVGDDVDKDYRAAVGAGWD
                     GYFLARGDEARSADADNVIRSLVDLIPMLEAYR"
     exon            complement(1160841..1161944)
                     /number=1
     CDS             1164723..1166180
                     /codon_start=1
                     /locus_tag="AO090011000460"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000156"
                     /protein_id="BAE64961.1"
                     /transl_table=1
                     /translation="MRQWGSSLHHNGMSFFLATVPKGTQLYHGNSSPDPVNGTEWLAF
                     EPEHAMVFARPHHGPPPGKGPHKRSQLPLKLGPKESGEGQDKDQDKPGFLHTYTAAKD
                     LRLLYLDGMSAAKTENGTLDSQDRILLRDALEGRPGMLEGERAELICRMARDNYQGRL
                     DGVIRMEAGFEIILCDFARDLNEIRVSQVKSDRMGPGPRGGKGKGGPDGGMLWYKAIA
                     ARYNGIGSNRVILNYDNFVTAYVYGLDLFRSSGSNSNLLPRLNHLFADELGPIRNDLD
                     HLILNQDPSDASFNWQGVADMVVQRYAHELRYLASGQLSTLQALHEEIENSLGPFVDY
                     SDRNAALEADRCSMQFVPAGAPSGGLASGAVRSVTRSICSTMIEAWNQTDYDTAVAQL
                     QSLIDYLSWTTWKECKGCADNEVCVIPIWPMGTVEDYEHPQCRDASRPNGQGRRYWGG
                     RPGGPGGPGGPEGPDGFRHSSWLQRILHYLQEIIR"
     exon            1164723..1166180
                     /number=1
     CDS             1167219..1168400
                     /codon_start=1
                     /locus_tag="AO090011000461"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000157"
                     /protein_id="BAE64962.1"
                     /transl_table=1
                     /translation="MKATILATIALAACSAASPLGSAPHARGLLGDSSKPCDCESDHD
                     GSSPEVPSGPGSEGPAPVPMPVPVPVPGGEPNGPGGVPTVPGLPGIPGVPGVPGVPGV
                     PGHPNHPEDPEDPEDPEDPEDPEDPEDPEDPEDPEGPSKGGCDDDGCHGTGHLIQDLG
                     PQANDILTIVGEHTEELLLKLSPGVAGLLTGLGLPGLGQPVGHIIKSAATIGELIADL
                     GDSVECLLTVIGQDGGFLLIELEPSIAGLLTGLGLPSIAQPVGSIVGTVGKHLKRDDG
                     LLEDLAPVVNCALKVVGEDSKILLIALSKSVAELLIGLGLGQLAEPVGTVIQSAATVG
                     DLVYDLGDPVECILTIIGEDGGALLVQLSPSIAGLLVGLGLPGVGIPVGQVVKTLGEA
                     L"
     exon            1167219..1168400
                     /number=1
     CDS             join(1168961..1169006,1169070..1169270,1169333..1170410,
                     1171850..1171865)
                     /codon_start=1
                     /locus_tag="AO090011000462"
                     /note="2-polyprenyl-6-methoxyphenol hydroxylase and
                     related FAD-dependent oxidoreductases"
                     /old_locus_tag="AO070316000158"
                     /protein_id="BAE64963.1"
                     /transl_table=1
                     /translation="MAKSPQDLQIAILGAGMGGLTCALALAQEGFKNIDVYESASDLG
                     FVGAGIQLAPNMARVLDRLGVWKGIEAEAVNIEETSVRVGATDAELAHVELQYIKDTY
                     GYPHMVGHRSSLSNGLYQGCLRYPNIKFHFATSAGNVDSFGPRPSFTATPRDSSQAPY
                     RVEADVLLGADGIKSNTRVAMMDKLGIQTGVKDTNQAAYRIMIHKDQIKDDPELLELI
                     NGTKVTRWIGEKRHIIAYPVSNNTIYNLSTVQPDTNFAAATNATYTTRGSKKTMLEVF
                     GDFCPMVQRMLSYVPEGEVCEWKLRVHEPLDTWTHESTALVGDACHPTLPHLAQGAAQ
                     AIEDGAVIAIALSLLPDTTPASIAKALKVYEKVRKDRAYALVELAAASGRALHLGDGA
                     AKEERDKQFAALKKGNGPVPDKWADADVQKIIYGFDCQQETRDKFNEYFAFRAP"
     exon            1168961..1169006
                     /number=1
     exon            1169070..1169270
                     /number=2
     exon            1169333..1170410
                     /number=3
     exon            1171850..1171865
                     /number=4
     CDS             1171944..1172576
                     /codon_start=1
                     /locus_tag="AO090011000463"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000159"
                     /protein_id="BAE64964.1"
                     /transl_table=1
                     /translation="MGLTPSCSIPEPWALERTPVHLLAAVYASALPFAAHDDYLCVLQ
                     TYNAPPADRLWRMAYELISEEIHTPHLAVLQTALLYLHRPLDEARASIADTPFVWSFV
                     GTIVGLAESLGLHIECRMWGIPAWEKRLRRRLWWAIYAEDKWRSLLMGRPPYIHRSEW
                     DVSELDGADFLYHTRGASSSSSGVHQPQDPVPFRYLVDLSGIAEQIYESF"
     exon            1171944..1172576
                     /number=1
     CDS             join(1172961..1173111,1173177..1173430)
                     /codon_start=1
                     /locus_tag="AO090011000464"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000160"
                     /protein_id="BAE64965.1"
                     /transl_table=1
                     /translation="MPEIESFPAVELSDHSTGETTLNSAERCASIVISFTRRLTSSDF
                     TGFWYSWSRIGFATVSNFALLLLVQAPNAERAAKGKQLVDSWLRVLRCQSQSFPMMKL
                     GLTRLDAMHWVGLGQTFVLPQHVQEVIQSSGN"
     exon            1172961..1173111
                     /number=1
     exon            1173177..1173430
                     /number=2
     CDS             complement(1174054..1175121)
                     /codon_start=1
                     /locus_tag="AO090011000466"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000162"
                     /protein_id="BAE64966.1"
                     /transl_table=1
                     /translation="MPTTTTQCMTLSRSTIQPLKSDHVIPKGVHESIRQVLHHEFLIT
                     ERLLRANIREGLVLPIIGLIARFLPAPDLILTTPWTQLALVLLKTFICFICHLYVFEI
                     VNQVLSVDEDIANKPHRPIPAGFLCIPGAYRRWLLSWAICPVIASHLAGPEAAGLFGA
                     YQAWVYFCYVWPKINHWIFRNAFASIGAYNMFRLVDTIVHSEIPSFPVMPKHILLLFS
                     LWVVTTVHMQEFHDAEGDKRMKRRTLPVVVGPKGERLLRAGTAMLVIGSGAVLLIATA
                     SYIQGSSLPSQRWTVAGLVITGFLHNIFACIVGFRCVWHGGVAFDRKTYKRFYMLAAY
                     TMICYLSFWQMTEKISISILA"
     exon            complement(1174054..1175121)
                     /number=1
     CDS             1177909..1178667
                     /codon_start=1
                     /locus_tag="AO090011000467"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000163"
                     /protein_id="BAE64967.1"
                     /transl_table=1
                     /translation="MLSASQAFPSTQPQSSARPTPFATPAPTSPPPKRKPTFVLPRSP
                     SPSQAPEDPSAIPTPFSPSSHTLRRRGRARSSAPSYLPGGMAAEVRSWILELSTKREQ
                     MQMNYRNRTGAGLDLQRYLLVVRIADIRQSTLASSGPLAFVRGQPVTSLDDEEDASGH
                     REGSGMKNILLLGTPRSQSAGVSSQHPDASRVPELVGGNVVGVHRGLVWELDLEDRLA
                     GYGTHSDPERDGHGQSGTTTKWLVCMEWDLISVQ"
     exon            1177909..1178667
                     /number=1
     CDS             complement(join(1178933..1180131,1180181..1181534))
                     /codon_start=1
                     /locus_tag="AO090011000468"
                     /note="protein involved in high osmolarity signaling
                     pathway"
                     /old_locus_tag="AO070316000164"
                     /protein_id="BAE64968.1"
                     /transl_table=1
                     /translation="MPRPMHNTTSLPRNLRDELGIKDTYGDKKRRQNGPATRKDRRRE
                     ERDQKKTKRAPVSKHGGRQRSNRRDDDYDDEDGFEGFDDGSGAESDPAGEEDVFAKLK
                     AAKQAKQQPKPILKKAKAGKSAPEGDSAEEETIRPRQISKAVQEKLDEDEAEIAALEK
                     KLGLKKGKKLPKSFEEDGLGDLLGDLDEGSADEGRKRRREADEWLRNKRMKAQGLAPE
                     SDSEEDGSDLGSEEEMDDLDEDEDMFDDLDEEDDEESEEEKPVPKKRENPYVAPVAET
                     NENRPQKYIPPSLRAASGSESESLVRLRRQAQGHLNKLSEANLVSILGEYEKLYREYP
                     RKEVTTTLINLLFGLICERSALQDTFLILHAGFIAAVYKIVGTDFGAELVQKIVETFD
                     ARGDERGSFEGKESLNLVSLLAQLYNFHVISSTLIFDYIRIFLQDITEENTELLLKII
                     RNSGPQLRQDDPSSLKDIVLLIQPAVAKAGEASLSVRTKFMIDTITDLKNNKLKAGVG
                     SSVTTEHITKMRKILGSLNNSRVIRATEPISISRDDIHNSSKKGKWWLVGASWREDPL
                     VSARQELSNLPADQQNPAAAEEEDSDGEPDFVNLAKAHRMNTDVRRSIFVAIMSATDY
                     QDAHVRLLKLRLKKAQEYEIPRVLTHCSMEEEAYNPYYTLIARRLCGESGRRLKVSFM
                     FTLWNIFKRMGETGDMDEEDDADFDEDEQNQLPMKAIVNLAKMYGSLIADNTLNLGIL
                     KTLNFAYLQPKSKTFVELLLISVIQQSQKQKRGKKHAKKSDDEKDEKALMEIFIRTRE
                     TPQIVKGLIFFLRKVVAKSDVVSGKEQKLVKWGCNVAVDALKVVSKETAGFD"
     exon            complement(1178933..1180131)
                     /number=1
     exon            complement(1180181..1181534)
                     /number=2
     CDS             join(1181900..1181926,1182005..1182361)
                     /codon_start=1
                     /locus_tag="AO090011000469"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000165"
                     /protein_id="BAE64969.1"
                     /transl_table=1
                     /translation="MAPHLGHEEFFSSLSDLLSKTSQKARGSVFLTQKPLIDTTASSE
                     NASSSSRPSILIRATDGNTNAPNPKNNKVEKKTVSKVKLSTIVAPEDLEAFYTRYAEV
                     CKAGMTGLKKRDRKKGKAKAKAAKA"
     exon            1181900..1181926
                     /number=1
     exon            1182005..1182361
                     /number=2
     CDS             complement(1183000..1183851)
                     /codon_start=1
                     /locus_tag="AO090011000470"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000166"
                     /protein_id="BAE64970.1"
                     /transl_table=1
                     /translation="MPEITDLPRRSVSETQQSFQTLLARFEDTPEPPVEPKMPLSSSV
                     DSFHTVASLSSSPAESDSGSTFPSATSTDGTDLGLRESSNNQGHLENLKFEEVDFSAG
                     RTVPEVKCEDCCSPRPPASPRASFSEEEFRRVPGALPDDQMSIASYAGTSKTTDSNPN
                     LNSMSIEFRRRSKASRERELSPMPPQSALALTSPSDKENAASLIQKTCTVVLIPPIQL
                     FIVLIHIAARIVLGPALTSAMGELNHKYEYQVADPQEAVDDFDLPLAPDCPRKQSVSE
                     ANSWDLD"
     exon            complement(1183000..1183851)
                     /number=1
     CDS             join(1184778..1184802,1185102..1185185,1185428..1185534,
                     1185590..1185762,1185816..1186209,1186273..1186641)
                     /codon_start=1
                     /locus_tag="AO090011000471"
                     /note="predicted protein"
                     /old_locus_tag="AO070316000167"
                     /protein_id="BAE64971.1"
                     /transl_table=1
                     /translation="MSVDGGREFFELRRTLKMPNFEPNAVIRGAQLTIVGTVRALRNP
                     ELFKHEHFRQAGFAIAVGIAIELLIQIPIIGVKFLLWILSWMADLESATWDDTLLESL
                     DFLSKSVLQVPFLVMTLMRYITPTLDEIFMESIKWVDSTYVDKHKADDPKTLRAMYYP
                     SLSMYSTKGSVGVSKPKGESALVFVRRYGRKVGMMLGVFLLSLLPIVGRFVMPAASFF
                     SFQQMVGPAPAAAIFGTGLVLPKRYLVTFLHTYYSSRSLMRELLDPYFCRIKYTHEQK
                     RRWFADREGVLFGFAFAFTIVLKTPFIGVLMYGIAQASTAYLVTKITDPPPVPAESEG
                     FAESQVTWKNKHDFLQLSLENIDKINLAAQDKKDGDKADEPDALRRKFT"
     exon            1184778..1184802
                     /number=1
     exon            1185102..1185185
                     /number=2
     exon            1185428..1185534
                     /number=3
     exon            1185590..1185762
                     /number=4
     exon            1185816..1186209
                     /number=5
     exon            1186273..1186641
                     /number=6
     CDS             join(1187086..1187160,1187219..1187237,1187300..1187588,
                     1187662..1187935,1187983..1188561)
                     /codon_start=1
                     /locus_tag="AO090011000472"
                     /note="predicted acetamidase/formamidase"
                     /old_locus_tag="AO070316000168"
                     /protein_id="BAE64972.1"
                     /transl_table=1
                     /translation="MGHKGIRTALKVDLDKPAWEQPGLHNRWHPDVPSCGKIANNEVV
                     KIECLDWTGGQIKNNDSADDVKNVDLTQIHYLSGPFDIETAEPGDVLLVEIQDVQPFQ
                     DQPWGFSGVFHKQNGGGFLDEIYPESAKAIWDFEGIFCSSRHIPHVRFAGLIHPGILG
                     CAPSTEVLAEWNRREGELIAANTTSREVAKPPEPKSAHAGSAEASLKERIAKEGARTI
                     PGRPEHGGNCDIKNLSRGSKVYLPVHVPGAKFSVGDLHFSQGDGEISFCGAIEMAGII
                     TLKFTVMKGGMAKLGMKSPIFHPGPVEPQFGPGRYLTFEGFSVDENGKQHCLDATVAY
                     RQTCLRVIEYLRRYGYSDYQIYLLLSCAPVQGHIAGIVDIPNACTTMGVPMDIFDFDI
                     RPEAEVVKLDMGSCAFARN"
     exon            1187086..1187160
                     /number=1
     exon            1187219..1187237
                     /number=2
     exon            1187300..1187588
                     /number=3
     exon            1187662..1187935
                     /number=4
     exon            1187983..1188561
                     /number=5
     CDS             complement(join(1188892..1190036,1190089..1190281))
                     /codon_start=1
                     /locus_tag="AO090011000473"
                     /note="FAD-dependent oxidoreductase"
                     /old_locus_tag="AO070316000169"
                     /protein_id="BAE64973.1"
                     /transl_table=1
                     /translation="MTSSKLTPTSSILIVGAGTWGCSTALHLARRGYKNVTVLDPHPV
                     PSPIAAGNDINKIMEHREVKASETDPWSIAFSTCTRAALKGWKNDPVFQPYFHETGAI
                     VSGHTASLIKHIQEHEIDSSDAEFIKLNTAEDFRKTMPPGILTGNFPGWKGWLNKTGA
                     GWIHAKKAMFSAYTEAKRLGVTFITGSPEGDVVSLIYENGDVVGARTADGTVHRADHT
                     ILSAGAGSDRLLDFKKQLRPTAWTLCHIRMTPDEAKKYRNLPVLFNVAKGFFMEPDED
                     NHELKICDEHPGYCNFVPDPKHGGEVRSIPFAKHQIPLEAEARARDFLRDTMPHLADR
                     PLSFARICWDADTVDRAFLIDRHPEYRSLLLAVGGSGNGAMQMPTIGGFIADALEGNL
                     QKELKHALRWRPEIAAQRDWKDTQNRFGGPNKVMDFQKVGENEWTKIGDKSRL"
     exon            complement(1188892..1190036)
                     /number=1
     exon            complement(1190089..1190281)
                     /number=2
     CDS             join(1191278..1191335,1191395..1191477,1191528..1191890,
                     1191941..1192096,1192150..1192616,1192688..1192946,
                     1193011..1193253)
                     /codon_start=1
                     /locus_tag="AO090011000474"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070316000170"
                     /protein_id="BAE64974.1"
                     /transl_table=1
                     /translation="MAPSDDILTDVPGTVYLVDTSGNLADAAHANDILLIPQPSCSAA
                     DPLNWPKYKKYWTLCLISAYACVNSFGENNWGASWTTISDETGVSLENMNGGSALNYL
                     MLGFFNIIWIPTAMKFGRKIVYILSLIFVGASGIWGAFYVGTGQYYVMTTISGMGTAA
                     YQALIQLTIFDTFFAHERGRMIAIYIFFQQLGSILGLILGGYISDGIGWRWSMPIVAI
                     ACGVLILLFIFTFDDTMFPRYRFSERTPSEALKGEQGYDASPETQSEKHRKEEPQMSV
                     TPSNGAGEVDMPPRTYTQKIALVHYFKDDQTTWFQYFRRPFYLFAFPNIVLAGVQFAF
                     GCTAGIVSFNTISEIMTEAPYNWSNGSTGLLFLAALIGSFFGMGIGSLSDWLVLFLAR
                     RNKGYKEPEMRLWAYIFPLIFAALGYFIYGWGATAGAHWMTIAVGLCCMIAQQVSATS
                     IATAYAMECFDKISGELVIVLAICSSVINFAISFTVQHFINATNYGWAFTFYGICVVL
                     SMAMGVPMLIWGKSWRRRGKGRYEKFLAETGRQY"
     exon            1191278..1191335
                     /number=1
     exon            1191395..1191477
                     /number=2
     exon            1191528..1191890
                     /number=3
     exon            1191941..1192096
                     /number=4
     exon            1192150..1192616
                     /number=5
     exon            1192688..1192946
                     /number=6
     exon            1193011..1193253
                     /number=7
     CDS             complement(join(1193731..1194671,1194734..1194820,
                     1194963..1195034,1195114..1195129))
                     /codon_start=1
                     /locus_tag="AO090011000475"
                     /note="HSP90 co-chaperone CPR7/Cyclophilin"
                     /old_locus_tag="AO070316000171"
                     /protein_id="BAE64975.1"
                     /transl_table=1
                     /translation="MADSQRRPRVFFDIQIGNEKTGRIALELVLVPKTAENFRALCTG
                     EKGMGKQGKPLHFKGSIFHRVIKQFMIQGGDFTAFNGTGGESIYGEKFPDENFELKHD
                     KPFLLSMANSGPGTNGSQFFITTVPTPHLDGKHVVFGEVINGKSVVRKVENMNTQADK
                     PVKDVTIVECGELTGQDYDDADKQTPDATGDPYEDFPDDHQGEELNAQVCFKIASELK
                     NFGNAAFKSGNLALGLEKYQKGLRYLHEFPEPDENDPKELDGQIKALRFALHSNSSLL
                     ANKLAQYGNGRSWATYALDTANAANAKDADKAKAYYRRAVASSGLKEEDEALKDLQEA
                     EKLAPGDAGITNEIAKVKKAIKDRQAKERATAQKFFS"
     exon            complement(1193731..1194671)
                     /number=1
     exon            complement(1194734..1194820)
                     /number=2
     exon            complement(1194963..1195034)
                     /number=3
     exon            complement(1195114..1195129)
                     /number=4
     CDS             join(1197204..1197458,1197534..1199065,1199209..1199269)
                     /codon_start=1
                     /locus_tag="AO090011000479"
                     /note="CCR4-NOT transcriptional regulation complex, NOT5
                     subunit"
                     /old_locus_tag="AO070316000175"
                     /protein_id="BAE64976.1"
                     /transl_table=1
                     /translation="MTSRKTQQEIDKTFKKVAEGIQSFEGIYEKIRSTSNPTQRDKLE
                     ENLKREIKKLQRYRDQIKSWASGNEVKDKGPLLEQRRAIETCMEQFKAVEKEMKTKAY
                     SKEGLSAASRLDPREKEKVETSDFLSSMVDELQQKIEAMEAEEETLHMQMKKGKKDVA
                     RANRLADLQRITERHKWHVNKLELLLRSLQNGNVEVNQVLDLKESIKYYVEDGHNVDY
                     SGEDETLYDDLNLDGETEAQFGMTGDNDRVSSQDTQSVQEEDLDLRPKPIKSESTAPR
                     RPSAQMKSPLPVLATLHPSTSTSGTSGMKPAPPPTRLPGETLKYASAAAAAAASDKNG
                     VGIAPLPPPPGASPAFPAASLASRPSSTASPSIASVQPVSKPTATTSIASEERSKTPA
                     LSPNVTAASASNTVQSTPATKKAEASATKEPQPTVNGEASKEESREEESIYHLPPGLQ
                     DLIHSFEVTKSRAAAQSSTNPPPSVQRLLTASLNTCPEPADAEKPRHYKPQNPYNTPL
                     YYPQEPLAIFDDPRLYDTGRIDTDTLFYLFYYRQGTYQQFLAAKALKNQSWRFHKQYQ
                     TWFQRHEEPKTITEEFEQGTYRFFDYESTWMNRRKADFKFVYKYLEDEL"
     exon            1197204..1197458
                     /number=1
     exon            1197534..1199065
                     /number=2
     exon            1199209..1199269
                     /number=3
     CDS             1200104..1201786
                     /codon_start=1
                     /locus_tag="AO090011000480"
                     /note="predicted protein"
                     /old_locus_tag="AO080608000001"
                     /protein_id="BAE64977.1"
                     /transl_table=1
                     /translation="MPDSYSDIEIRIVQACTIAQGQKKPNISALARQFNVPYQRLRAR
                     IHGRANLSSRPISTKTLDDSQEKALIRWIRQLDNLYSPPTAGMIEQSANQILQRNITD
                     GQSRTVDKNWVYRFIKRLPEEFKLIQQKPKDKKRLDAEDIGVLQHWYDCLEAFIKNIP
                     PKNIYNFDETGFQLRQGKTQKVVTTMPLRAARGNPSKEVGELISAIECIAADGFTLPP
                     YFIFKGTYHLERWYDADIPEEYRISLSPKGYTTDKISFDWIQHFHRHTKHRISTKKEV
                     RLLFFDGHESHLTYEFLQFCGLHYIIPYCFPPHTTHLVQPLDGQPFQVYKHFYRKRNN
                     ELAQRGAEMDDKSDFLKEIHSIRTMTFKQRTIRDAFEKRGLYPLDSEKVMKSLREALE
                     TAPELEIITTPSPPPSSSSPPSTIRGLRRSISKAQSFINNSPELDQSFVRRLDRVFQS
                     SLETTELAAQLKDDLQQHLRYRKPQDRRKSQKRVKYHGPLTVYDAKRRIADRTEVERL
                     QGLRQIRKTGALEYDKPPQPTNTGDLPSTEAGQVDREGPRLPYWIDTQGDVV"
     exon            1200104..1201786
                     /number=1
     CDS             join(1204055..1204078,1204190..1204287,1204334..1204663,
                     1204730..1204970)
                     /codon_start=1
                     /locus_tag="AO090011000481"
                     /note="predicted protein"
                     /old_locus_tag="AO070267000001"
                     /protein_id="BAE64978.1"
                     /transl_table=1
                     /translation="MLRYSSPMYTSTASSNSTNRRTSEPSCGGMPSHGALLLDQHMAS
                     NDFELYHAQSNASSYSSSYPSSNYSYSSFGSYDSGSFEASSYDSGSYEFTTPPPIYCP
                     PDLNPQFAPQYFSSPVQGTWPTPPAQVSPVEEIPYPPLETHYTPCETAKPVKPYVCEC
                     GRAFTRPADLKRHESSVHNPVFQDCPVQGCIRKDSNGFPRRDHLIEHLRSYHHLNVPK
                     RRAATKRVAKAA"
     exon            1204055..1204078
                     /number=1
     exon            1204190..1204287
                     /number=2
     exon            1204334..1204663
                     /number=3
     exon            1204730..1204970
                     /number=4
     CDS             complement(1206541..1207107)
                     /codon_start=1
                     /locus_tag="AO090011000482"
                     /note="predicted protein"
                     /old_locus_tag="AO070267000002"
                     /protein_id="BAE64979.1"
                     /transl_table=1
                     /translation="MTTRPQAPPPHTTTTTLTPSTTPSQPPSPSPSTPTLTHKSNPNP
                     NPNTLKQIHRIKSHPTLTPHQRRVYLTLLTIPAGRWTTYAALAKHLSSSARAIGTAMR
                     TNPFAPDVPCHRVLSADGGLGGYMGAGPASGHANLERKRLMLEEEGVGFEWVVSAKDR
                     SRMCGSRAGGGEGRWRARGECFVGFSSL"
     exon            complement(1206541..1207107)
                     /number=1
     CDS             complement(join(1207610..1207921,1207973..1208070,
                     1208120..1208348,1208396..1208478,1208525..1208916,
                     1208964..1209117,1209173..1209569))
                     /codon_start=1
                     /locus_tag="AO090011000483"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070267000003"
                     /protein_id="BAE64980.1"
                     /transl_table=1
                     /translation="MCDQIPKWNVVHRLEKRKLLIGINSVAALSILFFGYDQGMMAGV
                     NNSKDYIDLMGFGYTEMKDGYLTPVVTDSLLQGGIVSVYYLGTLFGALLGGWIGDRIG
                     RIKTIAAGALWAILGAALQCSAQNHNWMICSRFINGIGTGILNAIVPVWATETAEHTS
                     RGQFIAIEFTLNIFGVVLAYWLEFGLSFIDGGRSPFRWRFPIAFQIIFLVLLFVVVWF
                     FPESPRWLVKVGREQEARYILGRLRGSSDEDAVRAEAEFRDIQNVAEMEKSMNHSTSY
                     LAMLFGYKTGKLHLGRRVQLVIWLQIMQEWVGIAGVTVYAPTIFSIAGFDSMKSQWIS
                     GLNNVFYMFATLVCVFTLDRIGRRWTLYWGSIAQGIAMFLAGGFSRLAIDARADGNIS
                     RANSFGAAAASMVFIFTSVFGATWLTVPWIYPAEIYPLAVRAKGNAWGVVGWSIGNGW
                     LTLLCPVMFEAIGEKTLYVFAASNVITIPMVWALYPESNQRTLEDMDLLFAAETPWVW
                     DAERTFARLKAENPGYIETANRKNSAVDPEMGKPTDAHEEHASSAS"
     exon            complement(1207610..1207921)
                     /number=1
     exon            complement(1207973..1208070)
                     /number=2
     exon            complement(1208120..1208348)
                     /number=3
     exon            complement(1208396..1208478)
                     /number=4
     exon            complement(1208525..1208916)
                     /number=5
     exon            complement(1208964..1209117)
                     /number=6
     exon            complement(1209173..1209569)
                     /number=7
     CDS             complement(1210784..1211395)
                     /codon_start=1
                     /locus_tag="AO090011000484"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070267000004"
                     /protein_id="BAE64981.1"
                     /transl_table=1
                     /translation="MPSKSEITEFQMPGAVEIISTRPQKLIEIVEPDPTWPESFAIIA
                     RRIADALGNRLLSIEHVGSTSVPGLPAKAVIDVDVLVADPTAEDSYVPALEAAGFQFL
                     LREPGWYEHRLFGFNEPYANIHVFGPNSAEHVRHRLFRDWLRNHEDDRQRYVDTKRQA
                     AAASRLAGETVNEYSDRKQSVIHEILQKAFKEHGYLNEQNSDK"
     exon            complement(1210784..1211395)
                     /number=1
     CDS             join(1212781..1212916,1213015..1213094,1213160..1213642,
                     1213710..1214549)
                     /codon_start=1
                     /locus_tag="AO090011000486"
                     /note="dihydrolipoamide dehydrogenase"
                     /old_locus_tag="AO070267000006"
                     /protein_id="BAE64982.1"
                     /transl_table=1
                     /translation="MFRTLLPRAAPRAALRTARPQSVPSNFVAAPTLSFFSKRGYASE
                     SGEHDLVIIGGGVAGYVAAIKAGQEGLKTVCIEKRGRLGGTCLNVGCIPSKSLLNNSH
                     LYHQILHDTKKRGIEVGDVKLNLEQMMKAKDTSVEGLTKGIEFLLKKNGVDYVKGTGA
                     LVDPNTVKVNLLEGGEQTLRGKNILIATGSEATPFPGLNIDEKRIITSTGALSLQEVP
                     KKMVVIGGGIIGLEMASVWSRLGAEVTVVEFLNQIGGPGMDAEIAKQAQKILSKQGIK
                     FKTGTKVTKGDDSGASVSISVESAKGGKEETLDADVVLVAIGRRPYTEGLGLENVGIE
                     KDERGRLVIDQEYRTKVPHIRVVGDCTFGPMLAHKAEEEAVAAVEYITKGYGHVNYGV
                     IPSVMYTHPEVAWVGQNEAEVKAAGIKYRVGTFPFSANSRAKTNLDTEGQVKFIADAE
                     TDRVLGVHIIGPNAGEMVGEATLAVEYGASCEDIARTCHAHPTLSEAFKEAAMATYSK
                     AIHF"
     exon            1212781..1212916
                     /number=1
     exon            1213015..1213094
                     /number=2
     exon            1213160..1213642
                     /number=3
     exon            1213710..1214549
                     /number=4
     CDS             complement(join(1214905..1215068,1215124..1215800,
                     1215858..1216147,1216196..1216376,1216495..1216856))
                     /codon_start=1
                     /locus_tag="AO090011000487"
                     /note="phosphoglucomutase/phosphomannomutase"