LOCUS       AP007169             1725576 bp    DNA     linear   PLN 16-DEC-2016
DEFINITION  Aspergillus oryzae RIB40 DNA, SC038.
ACCESSION   AP007169
VERSION     AP007169.1
DBLINK      BioProject:PRJNA20809
            BioSample:SAMD00067075
KEYWORDS    .
SOURCE      Aspergillus oryzae RIB40
  ORGANISM  Aspergillus oryzae RIB40
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Eurotiomycetes; Eurotiomycetidae; Eurotiales; Aspergillaceae;
            Aspergillus.
REFERENCE   1  (bases 1 to 1725576)
  AUTHORS   Sawano,T., Tanaka,T., Machida,M. and Yamada,O.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-JUN-2004) to the DDBJ/EMBL/GenBank databases.
            Contact:Toshihiko Sawano
            National Institute of Technology and Evaluation, Genome Analysis
            Center, Department Of Biotechnology; 2-49-10 Nishihara,
            Shibuya-ku, Tokyo 151-0066, Japan
REFERENCE   2
  AUTHORS   Machida,M., Asai,K., Sano,M., Tanaka,T., Kumagai,T., Terai,G.,
            Kusumoto,K., Arima,T., Akita,O., Kashiwagi,Y., Abe,K., Gomi,K.,
            Horiuchi,H., Kitamoto,K., Kobayashi,T., Takeuchi,M., Denning,D.W.,
            Galagan,J.E., Nierman,W.C., Yu,J., Archer,D.B., Bennett,J.W.,
            Bhatnagar,D., Cleveland,T.E., Fedorova,N.D., Gotoh,O.,
            Horikawa,H., Hosoyama,A., Ichinomiya,M., Igarashi,R., Iwashita,K.,
            Juvvadi,P.R., Kato,M., Kato,Y., Kin,T., Kokubun,A., Maeda,H.,
            Maeyama,N., Maruyama,J., Nagasaki,H., Nakajima,T., Oda,K.,
            Okada,K., Paulsen,I., Sakamoto,K., Sawano,T., Takahashi,M.,
            Takase,K., Terabayashi,Y., Wortman,J., Yamada,O., Yamagata,Y.,
            Anazawa,H., Hata,Y., Koide,Y., Komori,T., Koyama,Y., Minetoki,T.,
            Suharnan,S., Tanaka,A., Isono,K., Kuhara,S., Ogasawara,N. and
            Kikuchi,H.
  TITLE     Genome sequencing and analysis of Aspergillus oryzae
  JOURNAL   Nature 438, 1157-1161 (2005)
COMMENT     URL:http://www.bio.nite.go.jp/dogan/Top
FEATURES             Location/Qualifiers
     source          1..1725576
                     /db_xref="taxon:510516"
                     /mol_type="genomic DNA"
                     /note="SC038"
                     /note="phrap>=30:71-1724898"
                     /organism="Aspergillus oryzae RIB40"
                     /strain="RIB 40"
     CDS             complement(join(990..1004,2971..3870,4418..4483))
                     /codon_start=1
                     /locus_tag="AO090038000001"
                     /note="predicted NTPase (NACHT family)"
                     /old_locus_tag="AO070178000001"
                     /protein_id="BAE63864.1"
                     /transl_table=1
                     /translation="MSLLGLTSEILGILDTLQTGISSVAFSPNGQLLVSGSTDRTVRL
                     WDTETGALQQILKGHSGRVLSVVFSPDGRLLSSGSEDNIICLWEVVKGALQRTLTGHS
                     SGIRSVVFSPNGRLLASGSEDRTVRLWDTVTGKLQKTFNGHLNAIQSVIFSPNSYLVV
                     SGSTDKTIRLWDTETGALQQTLVQSGAIRSVAFSPHDQLVASGSRDSIVRFWDLATGA
                     PQQTFNGHSDRIHLVAFSPDGRLLATGSHDQTVRLWNIATGALLQTLNVNGLVQYLEF
                     APDGSYIWTNLGSLDVQFGWENHAPNLTNVDLDILERQWIQLNGSNIYYL"
     exon            complement(990..1004)
                     /number=1
     exon            complement(2971..3870)
                     /number=2
     exon            complement(4418..4483)
                     /number=3
     CDS             complement(join(6444..6566,6585..6803,6865..6875,
                     6938..7007,7027..7212))
                     /codon_start=1
                     /locus_tag="AO090038000002"
                     /note="predicted protein"
                     /old_locus_tag="AO070178000002"
                     /protein_id="BAE63865.1"
                     /transl_table=1
                     /translation="MNRPQQRDPGSTDSYTVAWICALEEEYFCACRMLDEEFTGPEIS
                     EDYDDNTYVYGRIEKHYVPVGMAPIQLPVLPEIWFERSPIYGDVVVVGSRGRVSSTRR
                     LRNFWELFRRCADYSVILGSQTDSQNISSVLMIWKIINDQPLTSFMPSNLRQWIEKLA
                     TKWSAQSAAATVYSMFTTEISRQEILCSRMLSCETNLQTTQS"
     exon            complement(6444..6566)
                     /number=1
     exon            complement(6585..6803)
                     /number=2
     exon            complement(6865..6875)
                     /number=3
     exon            complement(6938..7007)
                     /number=4
     exon            complement(7027..7212)
                     /number=5
     CDS             join(7514..7866,7882..8137)
                     /codon_start=1
                     /locus_tag="AO090038000003"
                     /note="predicted protein"
                     /old_locus_tag="AO070178000003"
                     /protein_id="BAE63866.1"
                     /transl_table=1
                     /translation="MTPRLAHFQLVMIRDMIDSRSLTTSQMADAAGCSKCSIITISSN
                     RADLRDHYLHQLSDFDFRSYHLVFIDEPGCDKRAGFRRTRWSPRGVAPVQVSRFQRGQ
                     RHQILQVYCQDDILMSLTDASIFEVFIEQLLHHCGGWPGPKSVLIMDNASFHHTERIG
                     ELCSNAGVKLLYLPPPYLPDLNPIEESFAELKAFVPHNPPPH"
     exon            7514..7866
                     /number=1
     exon            7882..8137
                     /number=2
     CDS             8226..8693
                     /codon_start=1
                     /locus_tag="AO090038000004"
                     /note="predicted protein"
                     /old_locus_tag="AO070178000004"
                     /protein_id="BAE63867.1"
                     /transl_table=1
                     /translation="MSECKLVKLVLHFSVAAYRGHQEVVKQLLTTDGVDPFTKNFKGE
                     TPLSLAAGNGHEDMVRLLLKVEGSDPDTKDFLGETPLCWAAGNGHETVVKLLLVTGVD
                     PESKDSDGRTPFVVSGRKFTRPVILVPLIFTLSNILHLDSSQLQWQSRSEPLL"
     exon            8226..8693
                     /number=1
     CDS             20261..20740
                     /codon_start=1
                     /locus_tag="AO090038000007"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000132"
                     /protein_id="BAE63868.1"
                     /transl_table=1
                     /translation="MSLRWRDHGVYPPEPRAVFSFRHFPALKHLFLNLDEFHSRFWAG
                     DPAGDPDLLVELMSLHLAGRITNDLHRLEKGLLGLGNALSCGHFPRLEEVLWDQNEQL
                     SSECERRVRPLFAEAGVSFDYNSWPTSSTTLGEGGGLPGPIDNNPPTPPWEQEYEEI"
     exon            20261..20740
                     /number=1
     CDS             complement(21174..22988)
                     /codon_start=1
                     /locus_tag="AO090038000009"
                     /note="beta-galactosidase/beta-glucuronidase"
                     /old_locus_tag="AO070307000130"
                     /protein_id="BAE63869.1"
                     /transl_table=1
                     /translation="MLKPQQTTTRDLISLDGLWKFALASDDNSTQPWTSQLKTSLECP
                     VPASYNDIFADSKIHDHVGWVYYQRDVIVPKGWSEERYLVRCEAATHHGRIYVNENLV
                     ADHVGGYTPFEADITDLVAAGEQFRLTIAVDNELTYQTIPPGKVEILEATGKKVQTYQ
                     HDFYNYAGLARSVWLYSVPQQHIQDITVRTDVQGTTGLIDYNVVASTTQGTIQVAVLD
                     EDGTTVATISGSNGTIHIPSVHLWQPGAAYLYQLHASIIDSSKKTIDTYKLATGIRTV
                     KVQGTQFLINDKPFYFTGFGKHEDTNIRGKGHDDAYMVHDFQLLHWMGANSFRTSHYP
                     YAEEVMEYADRQGIVVIDETPAVGLAFSIGAGAQTSNPPATFSPDRINNKTREAHAQA
                     IRELIHRDKNHPSVVMWSIANEPASNEDGAREYFAPLPKLARQLDPTRPVTFANVGLA
                     TYKADRIADLFDVLCLNRYFGWYTQTAELDEAEAALEEELRGWTEKYDKPVVMTEYGA
                     DTVAGLHSVMVTPWSEEFQVEMLDMYHRVFDRFEAMAGEQVWNFADFQTAVGVSRVDG
                     NKKGVFTRDRKPKAAAHLLRKRWTNLHNGTAEGGKTFQ"
     exon            complement(21174..22988)
                     /number=1
     CDS             complement(join(23754..24096,24124..24276,24333..24367))
                     /codon_start=1
                     /locus_tag="AO090038000010"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000129"
                     /protein_id="BAE63870.1"
                     /transl_table=1
                     /translation="MHKWLLVNFDASCCFVRNRKDLAEALEVNPSYLRNNVSNTGTVV
                     DHRNWQIPLGRRLRSLKVCGLRAHIHNGIQVGIEFAELLRSRLDLSDIIIQPAFALTV
                     FRLLPTSQSSELDSKARKVYETIHQQGDFFLTSAVVDHVYAIRVVNANQAAHVEHVTK
                     VFELLVTLAESFTMSE"
     exon            complement(23754..24096)
                     /number=1
     exon            complement(24124..24276)
                     /number=2
     exon            complement(24333..24367)
                     /number=3
     CDS             complement(join(24765..24997,25430..25503,25781..25794))
                     /codon_start=1
                     /locus_tag="AO090038000011"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000128"
                     /protein_id="BAE63871.1"
                     /transl_table=1
                     /translation="MGISCSAGRDFARHITWLNMDYLYWIIFLGSMVVLSQAISRLLL
                     SRYFAQDDDDDDDGDDGESGLCNTPGAYRTELRGYEGTWILNEGASRRYVNQAISAGS
                     TWVK"
     exon            complement(24765..24997)
                     /number=1
     exon            complement(25430..25503)
                     /number=2
     exon            complement(25781..25794)
                     /number=3
     CDS             join(28398..28487,28549..30069)
                     /codon_start=1
                     /locus_tag="AO090038000012"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070307000127"
                     /protein_id="BAE63872.1"
                     /transl_table=1
                     /translation="MGSSDHSVLSSIRLSLVMVALCLAVFLTGMDQTILATVTPSLTS
                     EFHSIDDLGWWTAAYLTMLSVFQIPYGKLYSLFSIKIVYLSAIGIFEIGSLVCATAPN
                     SIAMIFGRAIAGAGAAGIFTGGIMITTKIIPLDRRASYLGIMSAAFGVAAIVGPFIGG
                     AFTDRSTWRWCFYINLPLGGLSILVCFLLVNTPVDSSIASLSLWDRVRQFDIFGMVSM
                     MGGIVCLLLALQWGGTQYPWNSGRIIALLVVAVLLMVAFVLLQIFVPGSKTIPRSVSR
                     HASVWHAVGYAMCITGGIYVAIVYIPVWVQAVQHKSALDSGIMLTPLIVGYVVFSVIA
                     GVLTSGVGYYNPPMILGTILASVGAGLLSTLSTNTSNGCLIGYQALYGIGVGLGFGQP
                     SYVVQTVLSEADIPIGVTLVTLVQHLSSAIFVAVAQGVFQNTLAHTVRSLAPGVDPAK
                     LTKLGATQLSQFVDDQDMPHVLEAYSTAIARTLYIPMALSCASVLGACLTPWISMKKA
                     KPQPTEKQPTEDKPTKEKDGCTSGVNEA"
     exon            28398..28487
                     /number=1
     exon            28549..30069
                     /number=2
     CDS             complement(join(30134..30474,30552..30963))
                     /codon_start=1
                     /locus_tag="AO090038000013"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000126"
                     /protein_id="BAE63873.1"
                     /transl_table=1
                     /translation="MPLIVSRANLTQDWDELITSYWTSWSSPLQAVGELTFAHLGEGN
                     EAEATALADVKKSLRQAAESDPNIIWLKCYDTESGRIVAGGMYHIHHSNPYRAGAPKV
                     EAKWFPEGSEMRLLAEEFYAQLWAWRGRLMGDRHVCGNALWALPEYRSRGATELIMDE
                     FVRHMDALGMEGYLEATEMGFALYQRYGFVAIARPRMRFSEHKERSTQGRRLIHEVQA
                     HPVWIMWRPAGGEYRDGETVLPWEGRPKRIKL"
     exon            complement(30134..30474)
                     /number=1
     exon            complement(30552..30963)
                     /number=2
     CDS             complement(join(31651..31740,31775..32185))
                     /codon_start=1
                     /locus_tag="AO090038000014"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000125"
                     /protein_id="BAE63874.1"
                     /transl_table=1
                     /translation="MGYPTPYPISDDPKKALAKYNRAYETEAKIEFYFQLFMIAAYGF
                     IKASIILFYRRIFVSNTKSRFAIVSNICLAVTVVWAVTFFLLFLFGCKTKIYLHWAPI
                     QEVREKCGDPLAAESALVISDLITDLAILLLPFPKADDDMQIWMLQMSVRRKIALSCI
                     FGVGLM"
     exon            complement(31651..31740)
                     /number=1
     exon            complement(31775..32185)
                     /number=2
     CDS             join(33004..33480,33617..33649)
                     /codon_start=1
                     /locus_tag="AO090038000015"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000124"
                     /protein_id="BAE63875.1"
                     /transl_table=1
                     /translation="MGHAEEEEYESLSSEHGTQNTWEARERAGFLAWLKPHFLLGLLF
                     LSILFNVLLILGWTSSRDELSAPKQPVWVGSSYRREELKLGFTKEDTMWWNTKYSGSN
                     EREVSDLWHNEIPWESGIIAIDKQEASSLGLPESQSFPWDVTKGIYILNAHHILHCIY
                     PGGDHVRGR"
     exon            33004..33480
                     /number=1
     exon            33617..33649
                     /number=2
     CDS             join(34923..35317,35428..35938)
                     /codon_start=1
                     /locus_tag="AO090038000016"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000123"
                     /protein_id="BAE63876.1"
                     /transl_table=1
                     /translation="MDSVVDVLIAGAGPAGLTAALTLARQLHTAVVFDNKSYRNANIS
                     HMHMIPTWDHRDPAQFRAEARDEVLHHYDTIKIEDVDLKTAEKTSDGLFQLVDANDKV
                     WKGRKLIITTGSENVFPDIPGYAEAWGQRIAGVLAIQSAGNVPMAMHQTESAAQLARK
                     VTIYTNGAEELGAQIFSTLTDKDKTRFTVNNTPIKKLTHTGSSIHLELADGMTKEETF
                     LVHSPNTTVKGPLASQLGLELTPMGDINAAPPMHQTSVRGVFAAGDCITPYKVIAGAI
                     SSGCNAAVAASAQLLAEKHGHQPLF"
     exon            34923..35317
                     /number=1
     exon            35428..35938
                     /number=2
     tRNA            36635..36706
                     /locus_tag="AO090038t00001"
                     /note="tRNAscan-SE"
                     /product="tRNA-Arg"
     CDS             complement(join(38072..38666,38726..39015,39074..39162,
                     39253..39355))
                     /codon_start=1
                     /locus_tag="AO090038000017"
                     /note="G-protein alpha subunit (small G protein
                     superfamily)"
                     /old_locus_tag="AO070307000122"
                     /protein_id="BAE63877.1"
                     /transl_table=1
                     /translation="MESERGIKPTSHCPQLSLGHVSYQAAQPGYKSSQCDQSPEKHTR
                     GTNLAKGPPSRLLEKRQVDGSKVTVLESLSNHLRQLLEVGEGRYDTRDSVDEEYAVMR
                     ETSDSVAQLLESLYVLPVKQGQGRMAEICTDMTDIWGYVQKCGFLDEVKLECIDDGAE
                     YLLNSLDRITEPNYIPTLEDSMWCYTKSTGITMARYTNGPSEVIFCDASGSRGERKKW
                     DRIFDGATKVLYFVDAGSYDQCLTEEHNANRLAEELTLFNSVCSTERLNHVEIVLFIH
                     KMDKLERKLKTMPFDSTEIENWGTFGGDPQSVDDVKDYLYNTFSAIAQKSSRSISVTF
                     TSLRRPEEFGKTILSYASSVVNMV"
     exon            complement(38072..38666)
                     /number=1
     exon            complement(38726..39015)
                     /number=2
     exon            complement(39074..39162)
                     /number=3
     exon            complement(39253..39355)
                     /number=4
     CDS             50377..51150
                     /codon_start=1
                     /locus_tag="AO090038000019"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000120"
                     /protein_id="BAE63878.1"
                     /transl_table=1
                     /translation="MTPYLMLLLDNEGYQAGNEGPIHFISDGDDQGAGFVADYRSTMT
                     GLLMEYLEYLNKWTHDTLGLKLSQQVGYNLPVDMLEAIPSVDIPEIETLSFSNLIDGF
                     RQFSGPANLAGKNVISIELGADFGQAYYQTWTELLQEAQHAFVAGVNQLAIHDATYSH
                     TYDNTTWPGFTSFNYSFAEQHSRHQPGWDVGYKQAMDYLARCQFILQEGIAKVDLVFW
                     DKQIAQDAYPGILYEPTDLQDAGYTYEYLSTENFNLPMA"
     exon            50377..51150
                     /number=1
     CDS             join(51392..51464,51491..52035)
                     /codon_start=1
                     /locus_tag="AO090038000020"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000119"
                     /protein_id="BAE63879.1"
                     /transl_table=1
                     /translation="MEDLLILSKKLALSQGPQLIAMARDSDGYVYVYNDGDFSTGSIS
                     FQATGSPFALDAWTGEETPITEYSVSQGRTNISFSLKSTETRIVKFSASRKSANNESH
                     VIWSSDSVLGYYVDSGKVWAKAAASDSATSVKLSSGKTVTLDQQGQSQISLGNWSVVL
                     EQWLPPDNLYDVETVANKKNVSLSVSGFSLSSWKDLGYQNSSGVA"
     exon            51392..51464
                     /number=1
     exon            51491..52035
                     /number=2
     CDS             56561..57229
                     /codon_start=1
                     /locus_tag="AO090038000022"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000117"
                     /protein_id="BAE63880.1"
                     /transl_table=1
                     /translation="MVEVRQYHLSPTDLIPNSPRPLLHYKNVLAKPNNTHCDPVDVWD
                     LFTRNEWDVQWIFRYSPTQISHYHSQAHECMAVLSGTASIRFGVADTSPDMEENTHGS
                     AWEDGGVLLEAEAGDVFIIPAGVAHKTHNTKPEADFALLSPGTGHGIKADDKKALSEI
                     KLDGFTMMGAYSGGDWDFVATGGDFEKVWSVPKPKYDPVFGASERGLCKTWRGSDTES
                     KAHL"
     exon            56561..57229
                     /number=1
     CDS             58477..59199
                     /codon_start=1
                     /locus_tag="AO090038000024"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000115"
                     /protein_id="BAE63881.1"
                     /transl_table=1
                     /translation="MRISANDPELQNPSRGRVSSQSYHLHIPKGLLDGKGDIDRDSDE
                     DKGGPSKTYAERQKDAMERLSRPKLQCCICFERYESSDIIRLECGDLYCTDCLKSLFM
                     RATKDEQLFPPRCCRQHIPLSLITKQMTTEEKDAFQRAKIEFSTSNRTYCSNTVCGRF
                     IIPSNIFSEQAKCEYCGSSTCAMCKNPFHSDDCPEDAALQEMLKLSTSQGWQRCLSCK
                     AMVELTVGCYHMTYDLLPLLGS"
     exon            58477..59199
                     /number=1
     CDS             complement(join(59874..60725,60803..61137,61199..61347,
                     61395..61642,61703..62088,62164..62173))
                     /codon_start=1
                     /locus_tag="AO090038000025"
                     /note="predicted flavoprotein involved in K+ transport"
                     /old_locus_tag="AO070307000114"
                     /protein_id="BAE63882.1"
                     /transl_table=1
                     /translation="MASNNFPSSLHDEYPQRADLRQMMGQRPLPTIPAGTIDPASMAG
                     DEPVKQARAVLDRLSAALAVDDAIALESCFFASQAYWKDQLALTYHLRTFSGPSVIAA
                     GLLETKNLREIAGGFAVDGGAVFLPATPTLQFIDCGIIFRTGSPGATCKGKVVLLPVK
                     NRDETIEWKIWVLSTFLESLDLQQEDEALLHSPGRELDGLATFDTDVFIIGGGNAAVT
                     VAARLKALGVESVMAERNPRPGDNWASRYDCMRFHIPTSFCDLPYMSYDEELRAPHLL
                     TRDELASQVRRYVETFKLNMITSAQILSTKYDPSTRLWEVKIKTPAGQQTAHSKHLVL
                     ATGISSQEPYLPGVADSDFYQGTSLHSAQYRNAKQLAETGAKSVLVVGSANTAFDVLE
                     DCHAAGLKTTMVVRSPTYIVPVEYLCDNHSLGAYDMGVEIADRLFLTLPSYVDAQLAR
                     GLMTQFAAQEPHRYDALAAAGFPVIDSRDPDMALMHNLLERAGGHYVDVGGTKLLADG
                     KAGVKAGVEPIAYTATGLRFSDGTSVDADAVVWCTGFADKDVRDNAFRILGGQSCSRE
                     ADNGTTHKLGAREIAGRLDATWGLDAEGEVRGLWKRQSRLDNIWVAGGYTQQHRWHSR
                     TIALQIKASLEGVLPPAYMNTPRPVRGSPQKCTLL"
     exon            complement(59874..60725)
                     /number=1
     exon            complement(60803..61137)
                     /number=2
     exon            complement(61199..61347)
                     /number=3
     exon            complement(61395..61642)
                     /number=4
     exon            complement(61703..62088)
                     /number=5
     exon            complement(62164..62173)
                     /number=6
     CDS             join(63114..63318,63365..63384,63439..63546,63606..63994,
                     64069..64564)
                     /codon_start=1
                     /locus_tag="AO090038000026"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000113"
                     /protein_id="BAE63883.1"
                     /transl_table=1
                     /translation="MSPEELDALLAAPALAPPPGVTPNFDNPSRHNDYAWGITTVCMV
                     VATLCLFLRWYVRIWLDRRVRMEDVLTIGAYGAYWGTAYAAYGMIYTPGYYVHTWDLR
                     NRDLIRPLYLILVYGCCYSATLPLIKTAILLDWCRVFVSVNRSRSFFWWGCMAVSFVQ
                     CLWGILCILLLNLQCRPHRSIWEFYVPSKCYSLPDVMLCSASVQVISDVCMFLLPQKM
                     IWSLHMNWQKKMGISIIFGVGILASIAACFRLAHTVTFAKSTDSMYFIGPLLFWACAE
                     MTCGFFIFSVPCLSKLAMESGLRSRLSSALGLSGKTISGPSDQGGNSNSGPRSKPKPW
                     RMSETNYSKIEEGSVVPLTNVSVSQHDPAEGRLSRDGNKSPLGVIRTMDVDVRSTDGA
                     GIKLQDHRVPWEH"
     exon            63114..63318
                     /number=1
     exon            63365..63384
                     /number=2
     exon            63439..63546
                     /number=3
     exon            63606..63994
                     /number=4
     exon            64069..64564
                     /number=5
     CDS             join(65532..65883,65958..66066,66121..66272,66328..66462,
                     66578..66627,66695..67425,67483..67618)
                     /codon_start=1
                     /locus_tag="AO090038000027"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000112"
                     /protein_id="BAE63884.1"
                     /transl_table=1
                     /translation="MFQHLLTAVGILSVATDAQTQPRRRCAYGDDCWPDTQTWNDFNA
                     TVGGRLIRSVPSAAVCHTERYNADKCSVAKDSWLDSFWRTNQTGAYSATVWEMGQTGQ
                     CFINTSASAPCDQGIVPYYMVRATSVEDIKASVKFANEKDLLLVTKNTGHDHLGRSSG
                     KGAFGIWTHNLKGIEFQSSFTPQGAPPDSSGIPAVTLQAGEQWFDVYQAAAKQGVLVV
                     GGSARTVGAAGGYVLGGGHSPFAHYYGLAADNPDYFWAVRGGGGSAWGVVTSVTYKTH
                     PVPQNLTMGLVQLNATSESSFKRVITESVKLLPAVTEAGYTGYGTIENGFAAIFLKPN
                     STIADFNQTFAPFFNLSRVPGIQGVVAAYPSTWDGYLQNVLQDPNIGSNIQDTSRLLT
                     LKVMQEKADDLAEFIVDNKQGAGFNFSKSLGAPKTVIRRSHSSIFVLVGKVNNDERDN
                     TAVHDVWKHSHGLLSVSVDWADTAADREKEAKRQQTVRLSKRLTEIVGSGGGTYVNEA
                     NPYEPDWQNVFWGKKYDRLLAVKQRVDPTTLFVCNRCVGTDIVIQP"
     exon            65532..65883
                     /number=1
     exon            65958..66066
                     /number=2
     exon            66121..66272
                     /number=3
     exon            66328..66462
                     /number=4
     exon            66578..66627
                     /number=5
     exon            66695..67425
                     /number=6
     exon            67483..67618
                     /number=7
     CDS             join(69408..69722,69832..69876)
                     /codon_start=1
                     /locus_tag="AO090038000028"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000111"
                     /protein_id="BAE63885.1"
                     /transl_table=1
                     /translation="MNTVAINIFHWPAKHADIHKINQGKSIESERIDLQFITISRDNT
                     RFSWAMNGGCLVFNKFAIMPFQNSGDDARMDVALFSTFVLLLKPFQSRTLCRVEQAAL
                     AVADPEEWNPGTAENRF"
     exon            69408..69722
                     /number=1
     exon            69832..69876
                     /number=2
     CDS             join(75877..76090,76149..76375)
                     /codon_start=1
                     /locus_tag="AO090038000029"
                     /note="uncharacterized homolog of
                     gamma-carboxymuconolactone decarboxylase subunit"
                     /old_locus_tag="AO070307000110"
                     /protein_id="BAE63886.1"
                     /transl_table=1
                     /translation="MSTDPKINDLHRELLEEGLKMRRAVLGHEYVDRAWNNATPFTRP
                     GQQLITEYAWGNVWQRPGLDRKQRSLLTIGIIIAQKAWLELALHTRGAINNGVSELEI
                     REAVLHSTVYCGTPAGVEAMMVTEKTINEMIERGEYKRPEETGL"
     exon            75877..76090
                     /number=1
     exon            76149..76375
                     /number=2
     CDS             complement(76883..78832)
                     /codon_start=1
                     /locus_tag="AO090038000030"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000109"
                     /protein_id="BAE63887.1"
                     /transl_table=1
                     /translation="MKYSIPATPSGTTHAHVAIVGMGPRGTSALERLCASATDFLAPG
                     ARLTVHVVDPSPPGAGRVWRTAQSSELLMNTVTSQVTLYTDKSVVCSGPIREGPSLYE
                     WATDAKLGLGPDEYPTRAQYGHYLEWVFREVVRNAPTGVEIEVHAARAVSLDDAPDGR
                     QTLTLSTGRTLSGLSAVVLAQGHLPLVADAQLQQLTAYADQNGLRHITPSNPADVDLS
                     SLKPGEPVFLRGLGLNFFDYMALLTTGRGGRFSRTPNGLRYHPSGREPRMYAGSRRGI
                     PYQARGDNAKGAYGRHMPLIFTEEVIDGFRQRADSGNAPNFLKEIWPLVSKEVETVYY
                     EALLRQHGFELGDFRDRFLATAHKSLEEAQVLTDFGITEENRWSWDRISRPYGERTFT
                     AGAWRDWMLEYLREDAKEASLGNVNGPLKAALDVMRDLRNELRLIVDHAGLSGLSHRD
                     HLDRWYTPLNAFLSIGPPRQRIEQMIALIEAGILDVLGPRPQARAEDGAWTVYSPEVP
                     GLKVRVTTLIEARLPEPSLRHTADELLSHLLKTGQCRPHTVDGYETGGLDITLSPYRI
                     IDSQGRAHERRFAVGVPTEGVHWVTAAGARPGVNSVTLSDTDAVARAALSAAVSGNTA
                     VERQTEVKAWPNVEVSEVTVLEVGV"
     exon            complement(76883..78832)
                     /number=1
     CDS             join(81529..81612,81677..81834,81894..82880,82934..83065,
                     83120..83327)
                     /codon_start=1
                     /locus_tag="AO090038000031"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070307000108"
                     /protein_id="BAE63888.1"
                     /transl_table=1
                     /translation="MSLPLWSESSERGSQTDNTVEISDIEAQSNISEKRSEPSRPLSM
                     GEGKAFPPLLPNEDDYIVTFDGPDDPEHPFNWSFTVKLYTSVMVCFGTFISSFASAVF
                     APGTAGVAKAFGVSTEVGILGTTLFVLGFASGPLIWAPSSELIGRRLPLTVGMFGVAV
                     FSIASAVAKDIQTVIICRFFAGLFGASQLSVVPAVLSDLFNNIHRGPAITVYSLAVFV
                     GPFSGPFIGGFISSSFLGWRWTLYIPAFMGFACCSVFVLFLKETYAPCILIPKAEALR
                     QQTSNWGVHAKQEMVKVDFQELLEKYFTRPLRMLVTEPIILVVSLYMSFIYGLVYALL
                     VAYPYVFESVYGMNPGLSGLTFFGLIIGQVLACGFVLSQQSIYVKKLIANKNVPVPEW
                     RLPPAIIGAPIFTVGVFWFSWTGFTSSIHWLAPTASGVLIGFGILCIFLPCFNYLVDS
                     YLPLAASTVAANIILRSSVAAGFPLFAKQMFKNLGVQWAGTLIGCLAAIMIPIPVVFK
                     KYGPRLRGKSKLMP"
     exon            81529..81612
                     /number=1
     exon            81677..81834
                     /number=2
     exon            81894..82880
                     /number=3
     exon            82934..83065
                     /number=4
     exon            83120..83327
                     /number=5
     CDS             83540..85162
                     /codon_start=1
                     /locus_tag="AO090038000032"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000107"
                     /protein_id="BAE63889.1"
                     /transl_table=1
                     /translation="MASNPGPSKRKRSRFACEPCRERKRKCNGESPCSTCSSWGYDCY
                     YQNERRMKPKPTGMMVDLPAIPGPSPEHAGSYTESLEANSGAAFVRKIGLKMDPANAP
                     KLNLFGWNVGRRNPPSGLATGTVLAVPLVDILSLNHMKNLANVYFTKVDPCYGFIDSA
                     MFFRRLEARWQSSAEGDSYDGVLAGVAALGALFSETTINITEAHLVELTRSITDTHIG
                     SAAPSVEVVTAWALRVIYMRMTAPPYPTWIASSTLMHLIEASKLHQTSSCEPYDLDIR
                     QRLIGVAQHQNLWISYDLGLSRVSFPHEAVALPSPRPGDFTVELLGLLPLSTSLGPEN
                     RRQDEEIEEFLLQTLSRNHTQPPSILAQCNLVLCLLRRLHMRNLMTSPATMERVVEQL
                     KRSLGAARRMASDCSPWQHVANVPFQMISILLEMDTSASLELLPEAMETLKLVSATYN
                     TETMREAYGTARLLILLYQRRRRSDTRLLSGLLEDHHEPSTTESPVQPMIPTSDEVSW
                     LEGLVADVPSLHGLDFGQFLQLSPNTPGMWGR"
     exon            83540..85162
                     /number=1
     CDS             86792..87427
                     /codon_start=1
                     /locus_tag="AO090038000033"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000106"
                     /protein_id="BAE63890.1"
                     /transl_table=1
                     /translation="MLDDVPALEDLVTNILEYGQIWKGDGLFDSGLDGENGVILSARH
                     YKKYIQKSTQREGFAIDRVTDKRSSRAQIGKFKTLSMIDRFGRRLSQAFAETAQGEVY
                     FFTRSGLDRTAFPGTTVWRGWEYPALTRNPRVTKIIQVDPFKEGDLGHTIWTPDQGPS
                     RNPPKSGNVAWNKVWGLRYYAPLVSNCVCLPCTGLMGKGQFFELQRFGSGW"
     exon            86792..87427
                     /number=1
     CDS             join(91421..91456,91508..92308)
                     /codon_start=1
                     /locus_tag="AO090038000035"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000104"
                     /protein_id="BAE63891.1"
                     /transl_table=1
                     /translation="MLALRFLIYSKELLVTSYVRTIQPAVQATPAISSAPSVYFGFPE
                     ARILRFPPGPHPPLITPASQVGFSWNHPFDIPSTVYSFSLDARVPLFTACFYIVFVCV
                     LNYLNRRRHYRPWPITRTASFTYIAFAHNILLGLFSAWAFLGVCRTVISSLPPRSSAP
                     YHITDVFCRFDRGQGRLLSDYSPASNTSVPLATLDNDFSGTYQAESLWERGMNYYTWM
                     FYMSMYYEIMNTILLLVKGKKVSFLQTYHHAGVIICTWVVVSTGLHKRLWASPSTQEF
                     TR"
     exon            91421..91456
                     /number=1
     exon            91508..92308
                     /number=2
     CDS             complement(join(92967..93021,93048..94072))
                     /codon_start=1
                     /locus_tag="AO090038000036"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000103"
                     /protein_id="BAE63892.1"
                     /transl_table=1
                     /translation="MQADLGLSPQMITELQKEVNIIIHAASTINLTYSLERVFDHIVQ
                     PSESLAQLALGFTCLDRFVYVSTAFANTHLYKLSSKPQTEINEEIYPLLGEGKLLDDS
                     LLSAQDARDQITKTGSSTEFELHDFPWPYAYGKHLAERLVLNLFIEKGWASKVLILRP
                     SVIGPAEKYPYPGYSVPLSTPSTALATAMIASSVFSVVVPTRCSKPEIEATIDEVPVD
                     VVVDRMVAHVAFNTTGCVHAVGGERGRLSFMDFWGAAMKLRRLPCEPRIIWSSTVDWH
                     SPDLHPVLRLYVILGTAFLFTEEKTNNLWKMLSPDERGDMILFRNTAGKSYELISRRE
                     HIRFLIRFVATGVFVSMSRESSGTL"
     exon            complement(92967..93021)
                     /number=1
     exon            complement(93048..94072)
                     /number=2
     CDS             join(95166..95441,95498..95573,95624..95934,95992..97041)
                     /codon_start=1
                     /locus_tag="AO090038000038"
                     /note="permeases of the major facilitator superfamily"
                     /old_locus_tag="AO070307000101"
                     /protein_id="BAE63893.1"
                     /transl_table=1
                     /translation="MTETDPNPDLLLSSLEASPSKLSTTQIQYAQPIPDSRHGASARR
                     TADERDNGPEGKKLQFWIDRKVTLAFFPLCLLTLMVALEAASLSIALPVVTEELGGSA
                     IEAFWSGTSFVLCSACCQLIFTSLSSAFGRQLLIVIAVIFFLVGTIVSGVATNFTQML
                     VGRSIQGTGGGGIIALSEVSVTDMVPFRLRGAYWGVLGSMWSVGSVIGPIMGGGFSTN
                     SDWRWIFYINIPFAALSIPLIVIYLKIKTKKTTRREKLKNFDTVGLVLFVCSTASFLV
                     ALSWGGVMYVWHSWRVLVPLIIGTIGIIGVMGYETHIPKDPILQVSGIDNHSLLINYI
                     GTVLQGLTLWCILYYLPLYGEAVHGFKPLPAGVAALPLAFAIAPSACASGIIAVVSGR
                     YRILIWIGWAVATLGFGVLCYFNRTTKGAIWISLIAIPGLGLGALVTSIAYAIQACSE
                     SRHLATATALFSFFRAFGQSLGVAIGGVIFQNRMEANLQKYPALAPMAKKISHNAVVL
                     VGKIQTAPASQNKDDLRQAYTDSLRAVWIFCCVCTAVGGILSLFTKEYSIDQTHDTDQ
                     GLEE"
     exon            95166..95441
                     /number=1
     exon            95498..95573
                     /number=2
     exon            95624..95934
                     /number=3
     exon            95992..97041
                     /number=4
     CDS             complement(join(97707..97987,98335..98431))
                     /codon_start=1
                     /locus_tag="AO090038000039"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000100"
                     /protein_id="BAE63894.1"
                     /transl_table=1
                     /translation="MLLVLPSQCTLTAFGKYVSAKQLLSDSDTLMEYINCANDEDDTP
                     LQLTARNGQSAVVELFVYIISLTGCQYPDQSFTPLLLAAIYGQESVVKMLLEQGADEV
                     EWCEWNVEANDLGKRKMASCHPF"
     exon            complement(97707..97987)
                     /number=1
     exon            complement(98335..98431)
                     /number=2
     CDS             complement(join(99818..100505,100568..100818))
                     /codon_start=1
                     /locus_tag="AO090038000040"
                     /note="protocatechuate 3,4-dioxygenase beta subunit"
                     /old_locus_tag="AO070307000099"
                     /protein_id="BAE63895.1"
                     /transl_table=1
                     /translation="MPSNRQFDPNFTPYVINSMGPKTPERTRVLLGALIKHIHDFARE
                     VELTPAEWMLGVEFINSIGKISTPIRNECHRICDVIGLESLVDEIANKIVTEDGVSPT
                     SNVILGPFWSPNAPFRELGDSIIQDPNPNGKVTYMHGVLRDMETGKPIEGAVLDIWQA
                     SANGQYDFQDPNQTENNLRGKFRSNEKGEFWWYCYHPTPYSLPTDGPAGVLLNLMDRS
                     PMRPAHIHLMITHPDYATVINQIYPSDDPHLDIDSVFAVKDDLVVDFKPKTDDPKASL
                     DLEYNVKLALKKHHPNPNSAPPVSSFERFNKGQNKL"
     exon            complement(99818..100505)
                     /number=1
     exon            complement(100568..100818)
                     /number=2
     CDS             complement(join(103174..103352,103426..103561,
                     103616..104103,104156..104206,104235..104652,
                     104715..104898,104948..105093,105143..105246,
                     105287..105371))
                     /codon_start=1
                     /locus_tag="AO090038000042"
                     /note="thiamine pyrophosphate-requiring enzymes
                     [acetolactate synthase, pyruvate dehydrogenase
                     (cytochrome), glyoxylate carboligase, phosphonopyruvate
                     decarboxylase]"
                     /old_locus_tag="AO070307000097"
                     /protein_id="BAE63896.1"
                     /transl_table=1
                     /translation="MYVHYACLTHNRGSDHPAMLEAMIKAKQDITENSSKFPTIITCP
                     SELVALSAALGYAQVTGIPQCVIVHVDCGTLAMGQSIHNASVGRVPVLCFAGLSPFTQ
                     NGELLGSRTEFIHWLQDVPDQAAILRQYCRYSGEIKTGRNIKEMVYRALHFAMSDSKG
                     PVYLTAAREVLEEAIPWGGDTQSNCSQRIARIRSDVLCKALFGLLLTASEVELIGSTL
                     INAKKPLVIAGYLGRNPQAPPLLAELCDKLPISVLESVGSDMSMRTDHEAYLGVTITT
                     HPAVCEADVILILDCDVPWIPTAGKPQKGRRLAPKLSTTVFHLDVDPLKQQMPLFSIN
                     ATRRLKVSCEIALRQLNAYIDKQGIEKTNYATAFEARANRYLRRKENLRALESPSQDG
                     AIRVPYLASRLRHHLPEDTVYLVEAVSNAGLIIQHLNLTQVFYLPDYPIPVNTALARN
                     TRRKRRRWPRVGRRSGIRCQAGQARRIHLCNVSIDDHTVISISVYWIARRYDLPFLLV
                     VLNNGGWNAPKVSALLVHQDGLSSKSNRREYGLDLNISFEPSPDYPGIATAAGTAWGI
                     TVKEQEKLDSAIQEAANVVRGGRCAVIEVS"
     exon            complement(103174..103352)
                     /number=1
     exon            complement(103426..103561)
                     /number=2
     exon            complement(103616..104103)
                     /number=3
     exon            complement(104156..104206)
                     /number=4
     exon            complement(104235..104652)
                     /number=5
     exon            complement(104715..104898)
                     /number=6
     exon            complement(104948..105093)
                     /number=7
     exon            complement(105143..105246)
                     /number=8
     exon            complement(105287..105371)
                     /number=9
     CDS             complement(106617..108044)
                     /codon_start=1
                     /locus_tag="AO090038000043"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000096"
                     /protein_id="BAE63897.1"
                     /transl_table=1
                     /translation="MLFHACNQMGMQYLWVDPLCINQSDETEKMNQINQMDRIYACAL
                     CTLVALAGKDSNYGLPGVTRPRSWAHETVQIGDLTLATRAPSLATCIDCSTWSTRGWT
                     LQEAMLSPRLLYFTEYGTYQEYPDPGVKFESNALCEPVTTYNFPTVDKHWSVVEQYTT
                     RHLTFPSDALCAISAVLRAMHGDEGVYYGLPISQMDQAVVWVPTGNGSNTKRDRFPSG
                     SWVSHDGNIMHPHVLAGLAIWMTPKHGSKSGLSICKPEARIGRSSFGTRNAIDIAAAW
                     LEGCISSQFPIDPWFNSETVYALDARWPTYEAFWVDAFGGFANDNINLIEHCELAPGH
                     ILVYGQVAQFTLDTCKFGKRRDMFIIRSRAGIPSGAIWISAYNETAPMNTTREFIALS
                     IGDGAILGPALDLAFEKRFTENPDLADFELQYLYGNAEILPVLNAMMVERNPESNIAR
                     RLGIGTIFLKEWADADREFKTLVLE"
     exon            complement(106617..108044)
                     /number=1
     CDS             complement(join(110422..110765,110793..111426))
                     /codon_start=1
                     /locus_tag="AO090038000045"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000094"
                     /protein_id="BAE63898.1"
                     /transl_table=1
                     /translation="MKVDQPLNLDDDDFECHSGLPRPISTPTDMSFSLERLKLGIVCR
                     EVIDATSHEHLYGIEISYEKILELDRKFHQALAEIPEFFRLDPTSRRRFASLYQNRPT
                     IAWQRCLLQQGYFSRLCRLHRQFFVRGAREPLYSYSHIVCLQSARKVLEIKKIMDEDE
                     PKFTPPSSVVWSVMHHVFMAAVILLLDVCFNWDDILAEKRKEEVLDACRMLMKEGINA
                     MMGVLQKHWKHEKLAASPNRNSIPNVNAAGPDMPRQPLPSTSGASYTPATTIELDPPG
                     DLPSNLDDTDERQLEDIWSEMLDNGANLDLGDTAWTGLLTELTNATMPG"
     exon            complement(110422..110765)
                     /number=1
     exon            complement(110793..111426)
                     /number=2
     CDS             complement(111539..112675)
                     /codon_start=1
                     /locus_tag="AO090038000046"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000093"
                     /protein_id="BAE63899.1"
                     /transl_table=1
                     /translation="MLHVTRPPGNWPRSNDPRHLSTSPVMKRRIGPELHQKPRKRATR
                     QDPVSCESCRRKKLKCNRQQPCSSCVTRRLPCSYVIAPAAADTHNAGLEDGNQREATV
                     PGQGNTPEIQEMRRADTQSVANPQPSYRSRESLMTADWLENIHMGQRVPTATPKLLRD
                     ELDELRNKDDSVPPGTLLPVSCRSWNASREDPATVNLLSFLPHKHEALALFRYYTNYI
                     DYLYHIIFPKRAEDQIDGIYRAIERGQPPNLNHLALFFSMAASSLFLQLSVESSIHAE
                     LCSREFSFLTGAALIQSNYPVNPTVEGLQAAMVIMHHASNISSHPSVSGLFVHGAVIS
                     QAKNLKLHCIDSPGLREEREANPPDAVELETKRRLWWDIASYDW"
     exon            complement(111539..112675)
                     /number=1
     CDS             join(112882..112922,113234..113450,113502..114263,
                     114320..114417,114474..114627)
                     /codon_start=1
                     /locus_tag="AO090038000047"
                     /note="monocarboxylate transporter"
                     /old_locus_tag="AO070307000092"
                     /protein_id="BAE63900.1"
                     /transl_table=1
                     /translation="MEAERSSVKKKATGPRACLTILGSFTGLFCTVGFMNSFGVFQEY
                     YGKEQLADKSESTIAWLGAISIFCIFFISVFSGRLLDVFGPTFMLCIGSLGTVFSLMM
                     VSLCKEFYQFILAQGILLGVSLALLACPMLALVGQHIKVKRGAALGIVLGGSSLGGVM
                     WPIAINELLQKPNIGFGWTMRIVAFIMIPLLSVSCICCRPPKTSPPPTQRPASDEEVT
                     ITETKASVPKTDYSVLKKPSLQLSCLAFFIIYFGMFSPFFFTTSYAVAEGFSTDLAFY
                     TISIVNGASFFGRVLPGIVADRYGKFNCCIVATFFSGIIALCWTKATSVAGLVMFSLA
                     YGFASGAILSLQQACAAQVATPQTIGLTMGTVMAATSFSAMAGVPISGELAGKYGYLA
                     LSIYSGVSLLVGSVLLAAARFVQSRKLLDVV"
     exon            112882..112922
                     /number=1
     exon            113234..113450
                     /number=2
     exon            113502..114263
                     /number=3
     exon            114320..114417
                     /number=4
     exon            114474..114627
                     /number=5
     CDS             join(119775..120076,120213..120225)
                     /codon_start=1
                     /locus_tag="AO090038000049"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000090"
                     /protein_id="BAE63901.1"
                     /transl_table=1
                     /translation="MKAIFDLVFAIGAQIRGIGNDSNITTSYFLRARAAAFKGMLMSQ
                     TLDTVRVFTLLAFYTLGACNRNAASMFLGIAAKAAVILNLNGTGNDDKLSEEEVCARF
                     TR"
     exon            119775..120076
                     /number=1
     exon            120213..120225
                     /number=2
     CDS             join(120701..120765,122048..122242,122295..122446,
                     122497..123034,123086..123536,123574..123714)
                     /codon_start=1
                     /locus_tag="AO090038000050"
                     /note="glycolate oxidase"
                     /old_locus_tag="AO070307000089"
                     /protein_id="BAE63902.1"
                     /transl_table=1
                     /translation="MVDMCVKAKNCSFTFRNLSLLELQVEQHCTRRSCWIIIDQTVYD
                     ITDFLDEHPGGASILLQYAGNDATKAFQSIHEADILTRHLDQAQILGPVSTALEEKKP
                     ELAAVSETRVRLSSVISILDFEYAASQNLPPAAFAFLKSGSEDEHAAKWNRDSWKTIR
                     FRPRVLRPIDGIDISRCILGTKFAAPFFICPAGGAKLAHPQADLCLTMAAGRHHILHW
                     VCNNSHMSQKDMSDARAPDQTTFWQIYARSDLDTTTQEVKQAINLGYKGFALTVDAVR
                     AGKRERDLRVTLAQREQDGIRVNDDDEEDDNFAREPSVGRPAVHPGFDWVSAMKWLRG
                     MTDLPIAIKGIQCWEDAVLCMEYGAHPWLSNHGGRQLDSAPSAVETLVSIRQHCPEVF
                     DKCEVIVDGGITRGSDIVKALALGAKGVGLGRPFLYSAAFGGAGVSKAIRILKNEVET
                     TMALLGITSLNQLNPSYFHADLKAYRLISPPSHLALRDQCYRHLVVRLKPCFNYRTKR
                     FECRF"
     exon            120701..120765
                     /number=1
     exon            122048..122242
                     /number=2
     exon            122295..122446
                     /number=3
     exon            122497..123034
                     /number=4
     exon            123086..123536
                     /number=5
     exon            123574..123714
                     /number=6
     CDS             join(124676..124972,125034..125620,125678..125990)
                     /codon_start=1
                     /locus_tag="AO090038000051"
                     /note="dienelactone hydrolase and related enzymes"
                     /old_locus_tag="AO070307000088"
                     /protein_id="BAE63903.1"
                     /transl_table=1
                     /translation="MLLPNAKPVKLTDNVTIHAPLSRQGHGPGIIIIRDDTPTSQRNE
                     RSTLDPEPLQKWAEESYTVVQVTVSSDHPAVKEDLHRAIDALSGHDNCDKETGYGGIS
                     VYSPSFVADIVDEIDKYDEIKAIVSYGRLTRTPNKPFLYHLPEQGTKEKSESGVIYRY
                     PEVVSASFIIPSHKDFNASSAAVAHTRCLSFLKKELDGPWFDLEEIWDEHTKYEFDER
                     SVENTMSTMVQEPYVNHIPTMTGGIGREKLTSFYANHFIFSNPEDTKLELVSRTIGID
                     RVVDEFVFCLTHDKPVDWLIPGIPPTGKELRIPFMAVVNIRGDRLYHEHITWDQLTVL
                     FQLGLMPEYLPIPYDLPNRPDSQAGRTLEYRVPGAGAQTADKMVDESSVASNEMFCYA
                     VRERSV"
     exon            124676..124972
                     /number=1
     exon            125034..125620
                     /number=2
     exon            125678..125990
                     /number=3
     CDS             join(127617..127801,129809..129959,130015..130829,
                     130889..131687)
                     /codon_start=1
                     /locus_tag="AO090038000052"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000087"
                     /protein_id="BAE63904.1"
                     /transl_table=1
                     /translation="MSRSMKAPMRALLELRTKCMGRLNVTDSTYTSLSTIRGRRNQSF
                     YSSTEVDSFLEVKNGVKRRPSFLTSSIKMQPEHRSAEVIVIGAGIGGLAAAKTYLELS
                     PLTNLILLEKRPTIGGVWSEENCYEGLKTNNLGGTYEFTDFPMGEKYGIKEDGHIPGS
                     VLHSYLNDFATHFDILRRIDFNTQVLDIEKLGQGWRLNTETTDSSSTVVYTCDKIIVC
                     SGLASTPNPVNIRGIDEFERPVLNHSQLREEGARIAHDPNVETVTVVGASKTGYDVVH
                     MMASNHKRVDWVIRESGGGGVWMSSPWAKFAGAKTKLELLATMRFFTWFSPCIFGDFD
                     GFSWIRKVLHQTRLGRYFVHKFWEGIRMDIIDQNGYRKEECLQHLEPLESLFWSARVG
                     ILNYPSDIHDYLRSGQVKIIRKDIEHLSGPGVVTFADGTSLHTDALIAITGWKLAQSI
                     KYQPEGLESSLGIPCSNTSAEDRSLWRRLDDEADKEILGRFPYLCNPPPAIPYKQDVS
                     PYRLYRGIAPPSLAAKGDNSIAYMKMVHSTSNIIIAECQALWTYAYLNGKISLDKTEV
                     YHQTALLSRYGKQRYPCGFSAWYPEFVYDAIPYADMLLHDLGLKRWRKPTFKKEMFEG
                     YTIHDYRGINQEWLAAQMKATPKRS"
     exon            127617..127801
                     /number=1
     exon            129809..129959
                     /number=2
     exon            130015..130829
                     /number=3
     exon            130889..131687
                     /number=4
     CDS             complement(join(132957..133036,133085..133205,
                     133262..133419,133505..133744,133810..134411,
                     134506..134804,134872..134901))
                     /codon_start=1
                     /locus_tag="AO090038000053"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070307000086"
                     /protein_id="BAE63905.1"
                     /transl_table=1
                     /translation="MADPEMKSAKTEPSNFEDNVEQLAGDYSNIASRDKALNLLANRH
                     IVFDPNSPQAKRVRQKIDMHIMPMIFVIYCLQLMDKNSLSYAAIMGIKQDTNLTPSQY
                     SWLGSLVYFGYLVGDIPVTFLMQRLPISKYFSIMCMIWGIIVALHAVCHDFASLATVR
                     FFLGAIEVSTVPVAILITGTFYTKEEQVTRVAIWYTTSGWAAVFGGFLAWAMYRADSF
                     RWQGLFVLYGAMTFLTGVVLFLFLAASPTEAKWLTEEEKVIALERVRGNKTGTEIWKF
                     NASQLREALHDVRLYLTFLVLISIGMPNGGLTAFGPTIINNFGYDVPTTQLLNVGSGA
                     AQVVGVVLALFVAKWTNRTIAGVFPLVLACVGAAMMLGISSSNNNARYGGYVLAYQFP
                     ICVLSINTFMTAGISGTTKKFAFGCAYQLGYAIGNIIGPQTYRASDAPDYYTAKYTML
                     AFFVVAAILIGIYGVLHHRWNQRNEKHGPAPMPEHSSAIENEEFADLTDFQMRNFKYP
                     L"
     exon            complement(132957..133036)
                     /number=1
     exon            complement(133085..133205)
                     /number=2
     exon            complement(133262..133419)
                     /number=3
     exon            complement(133505..133744)
                     /number=4
     exon            complement(133810..134411)
                     /number=5
     exon            complement(134506..134804)
                     /number=6
     exon            complement(134872..134901)
                     /number=7
     CDS             join(135396..135432,135486..135691,135753..135906,
                     135969..136280,136346..136487,136546..136624)
                     /codon_start=1
                     /locus_tag="AO090038000054"
                     /note="iron/ascorbate family oxidoreductases"
                     /old_locus_tag="AO070307000085"
                     /protein_id="BAE63906.1"
                     /transl_table=1
                     /translation="MAERLVPVISLKDFEQRKDQITAELMEAAEYAGFFTLVDHGILK
                     EEIEAQFSISKTFFDLPAETKGKTPHDPKTNNGWEYMAQLRPSTGTYDQKESLWLRHN
                     SDWPSDDDVPGFQNTTREFMNKCAGISDQVLTCFARGLGFKEDYFKIANDPSQPDCLT
                     QLRLIHYPASENSIGTWRAGSHTDVGCLTLLFQRDGEDGLEICPGRESHSSFASGDVF
                     TPLPAETGPIVVNIGDMLMAWSDDRLKSNFHRVRAKEYGMSPSRYSIAYFNQARRDFV
                     LQGPLKKYPAITVGEYVAQAVAKNFSPSMRAAA"
     exon            135396..135432
                     /number=1
     exon            135486..135691
                     /number=2
     exon            135753..135906
                     /number=3
     exon            135969..136280
                     /number=4
     exon            136346..136487
                     /number=5
     exon            136546..136624
                     /number=6
     CDS             join(140147..140195,140250..141180,141234..141804)
                     /codon_start=1
                     /locus_tag="AO090038000057"
                     /note="aromatic-L-amino-acid/L-histidine decarboxylase"
                     /old_locus_tag="AO070307000082"
                     /protein_id="BAE63907.1"
                     /transl_table=1
                     /translation="MDRDQFRAAAHATVDDIINYFDSVPDRRVCPTVTPGYLRPLIPE
                     QPPTEPEEWSQIQADVDTKIKPGLTHWQHPNFMAFYPATVTYPSILGEMYSAAFNAPA
                     FNWLCSPACTELETIVLDWVAQALNLPKCFMSSSENRGGGVLQVSASDTIATVMVAAR
                     ERRVRELALAEGLKEGTLEYEDRVMDLRPRLVAMGSNQAHSSTAKGALIAGTRYRSAT
                     AKLENNMELTGDDVRAVLEQCEKDNLTPYYITLSMGTTSTCAVDRISEVTAVLREKPS
                     WQRIWVHIDAAYAGSALVADEFQYLAKDLAEGVDSFNFNMHKWLLVNFDASCLFIRNR
                     FDLTDALDITPAYLRNPYSESGQVIDYRNWSISLGRRFRALKIWFVMRSYGLNGLKAH
                     VRKTIRVGDEFTNLVRSRSDLFELITKPAFGLTVFRIKDPRAQANGSAVNRTTAVKPN
                     EKNDALTKEVYELINERGEIFITSTVVSGIYAIRVICANEAAEEKYLRRAFEILVETT
                     DEVLGRSN"
     exon            140147..140195
                     /number=1
     exon            140250..141180
                     /number=2
     exon            141234..141804
                     /number=3
     CDS             join(142129..142148,142196..142433,142485..143249)
                     /codon_start=1
                     /locus_tag="AO090038000058"
                     /note="flavonol reductase/cinnamoyl-CoA reductase"
                     /old_locus_tag="AO070307000081"
                     /protein_id="BAE63908.1"
                     /transl_table=1
                     /translation="MSPAAPKYILVTGATGFIGAHVVDNLLARGLTVRAATRSKQKGE
                     QMKAARPQHASRLEFVEIQDFSQIGVFDDIMEGIDGVIHVASPFTYDTKNNEQELIIP
                     AMNGVKSILSASAKQASVKRVVLTSSFASVVDISRKYEGDFTYTGSHWNPLTYEEAID
                     PATDAVVAYRGSKKFAELEAWKFIEREKPSFDLVTLCPPMTFGPVVHPVNGVAGLNES
                     NAVLWSVASGADPLPTARVSAWIDVRDLAEAHVQALLRSEVGGKRFVPASGEPFSYEL
                     AADIIKGRFEWARETVTGNYKSGKKPVQAYKLDGDAVTRELGVEFRSFKETVVDLVGQ
                     VKETFA"
     exon            142129..142148
                     /number=1
     exon            142196..142433
                     /number=2
     exon            142485..143249
                     /number=3
     CDS             complement(join(144205..144505,144535..144755))
                     /codon_start=1
                     /locus_tag="AO090038000060"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000079"
                     /protein_id="BAE63909.1"
                     /transl_table=1
                     /translation="MYFLLFSGVSSGTSSERVQNVFTSAAFLDNNILMTNNFQSQTIG
                     ISYDMRADGQKLDISRAGIIFVSILLVLTCDSSMDRNSWLLRNATYPGLVIRKDSSVA
                     TRHVDGVKSLDETPSWIGNTANGEMVKLCLGGERPLAKTMSYAGYNIDYVAQTTETSN
                     PDGDQTSATPSLV"
     exon            complement(144205..144505)
                     /number=1
     exon            complement(144535..144755)
                     /number=2
     CDS             complement(join(145451..145867,145922..147124))
                     /codon_start=1
                     /locus_tag="AO090038000061"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000078"
                     /protein_id="BAE63910.1"
                     /transl_table=1
                     /translation="MASVEPIKTFEIRQKGPVETKAERKSIRDLNEEELDKLIEAWRW
                     IQDPARTGEDSFFYLAGLHGEPFRGAGYNNSHWWGGYCHHGNILFPTWHRAYLMAVEK
                     ALRKACPDVSLPYWDESDDETAKKGIPLIFTQKEYKGKPNPLYSYTFSERIVDRLAKF
                     PDADYSKPQGYKTCRYPYSGLCGQDDIAIAQQHNNFLDANFNQEQITGLLNSNVTSWL
                     NLGQFTDIEGKQVKADTRWKIRQCLLTEEYTVFSNTTSAQRWNDEQFHPLESGGKETE
                     AKATSLAVPLESPHNDMHLAIGGVQIPGFNVDQYAGANGDMGENDTASFDPIFYFHHC
                     FIDYLFWTWQTMHKKTDASQITILPEYPGTNSVDSQGPTPGISGNTWLTLDTPLDPFR
                     ENGDKVTSNKLLTLKDLPYTYKAPTSGTGSVFNDVPRLNYPLSPPILRVSGINRASIA
                     GSFALAISQTDHTGKAQVKGIESVLSRWHVQGCANCQTHLSTTAFVPLFELNEDDAKR
                     KHANNELAVHLHTRGNPGGQRVRNVTVGTMR"
     exon            complement(145451..145867)
                     /number=1
     exon            complement(145922..147124)
                     /number=2
     CDS             join(148675..153843,153917..153965,154146..154244,
                     154354..154499,154562..154580,154645..154673,
                     154723..155056,155109..155440)
                     /codon_start=1
                     /locus_tag="AO090038000062"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000077"
                     /protein_id="BAE63911.1"
                     /transl_table=1
                     /translation="MDSRASNLSNLWSEKYGYDFVVATTQASINSDLRVFLSEEDQPV
                     SYTCFCMDCEGEPTKMIGLEELLKLTDGVNPFEIPKATPYKDSRVQKLFCARFAIGIK
                     MQIGLPPGIAPMDLLPIISLGESASNVKFTMCCSDVTVVELKPPGGWVSDGKWNVWSQ
                     PYGDPWYVQTKVNLTMAYLNEQLDTPYLNQHPRIKKRLKEALGNLSGTAFSLQQLLID
                     LDSAFLETAPIFKGVDDSDALAVLQKYFVKIYSDHAKDGLPLVAVTAVAQSADKSSLK
                     LTAFEREVNPPIGSSGGRIEHPTSIQQSATTLNYLCAVNNHTLPGTASFDWNWVLPKD
                     IDNMSGIIAVNRDTFAAHLRDELVALAAPYCIKPRCIITDQPKNWDNPVKFNVQLNPG
                     QTPDTAHASGNEIFISYSKPGYEGRGHNGVTGEVFEELRVVSTYTLNAKFLGQTLTVS
                     QHLCFSATVRYNMLGPSSCNPFDKTLTTTYTISVDENGGLVFIKEPHEVLVDNSQDPD
                     LSGFWGMYGLTDVFHKLKNQVWASVDFGDLKFNKLQNFIFPGAKVFTYKGASFSDYQD
                     LICEITYLDPDQVESTTPTKLLAKQASGSLISYPARSTGRVLALTTSSEMMQNYVQGE
                     IVTATGKFEALQTDDGHALLFAIDDSGVFHVIVEESGVTQTGWQVQDLSSSAIQAYFS
                     ASTDPVVKTFDVGSALDGSICLAVAVTADGTDHLLVSLNNSSSNTQWTSNPQWVRFDF
                     DADGEGSGDIQITGTLFAETMDKQHYLIVDIDRQSQSPAKFIERYYVDPSVSIGTRWV
                     KHDVSVDIQDGNYRSCIGRVKNGYVDGIYTAGSTGGEAQFIYEPVINVFGRGPPAPVR
                     LRLPGENIPSAIATMRNLDNDSPLYGTTDLYAVGGSSLYRFAADRQKRNELPTAVVTS
                     DVLLGTDTLLAMSHDGVTTLWGRNSSDEVFYVSCPANQLDLPGSWSACVPILTNIERM
                     SAYVNQVDGGSTVFTSGGGRLQKLMQGTSSASKIWRAQDITITSPPQTKSLSFNSYTT
                     TIHVTNEHDLPARDVLLTISASSRTPVYMNGVYYVLGNLPTQVHTDAMGSVTVIEATE
                     DINATVFTVSFSGGSGSITINPMDKVFSKLTALNSTDKLQDASFPSQTTAGGVVGAPA
                     STPLVAPSTARRDIEVVAGHMDSLKSAYSNVKEAQSTILASRNHGVVPSTLFLNSGKV
                     SSAGLGHDIAIAAGDLFRWLKSGIDAVINVIYDAASGAWHFIAKIAGMVYRAVLDTVE
                     AVVGAVEWVFNAIKTVIEDIIRFVEFLFEWDDIRRTKDVMHNVVRLWLRHQVDGIPKA
                     KADFDREITSVEQALNQWTGITDWGSLGPATEQTASGSASNPAEGQTSGSQLLAGHFR
                     THASELRILGDSPPFDATDNVIDDLLTALSNEGEVLSTTYTQLKELAKDFSSMNVEDV
                     LKRLAGILGDVVLSSARVVVDALLDVLHDMASAAVTLLDTKIHIPVISDILNAIGVPD
                     LSFLDLFTWIAAVAYTVVYKIGKSEAPFPDNNEVQTIISATSWDQLAGMISGPSMTIS
                     PYMQKCIFIAGHSISGFMCLTGDFVNTFEAEAETGENPFSTPSAIMGVIAAGSQGASD
                     FLVPKDAIENKAVSTISTITTCAVIAAKVVFSGPAQKRFGAPEGSKFKPLAVADGRAT
                     GAIVNSILVIPALVVSGWHFYELITKPAGATRSAAIVGEVSNLASYISRIAYAVADYK
                     QRRLSSTEDLSLYRPAFSSLTNAHGQPILRRLKHGTVCLLLRHQLHLKRAVMTVYGLY
                     GHPVLAIAATTRRGRVICALFLRSLHSIIAHNHQLMGPSDLGGDNSEEAGKKSGGLPT
                     DPLFCSDIPTGNAKTQSQDPIQIDCVGLPADKAVKLGLTNNSRIKWQIFKGEVYARQS
                     IKEPKNTTSRHMSTFKYYSLPGFGEQCREKYGFSDSCIIGDRMIVTGQTGMDPLTLKI
                     SPIFEEEVTQAFQNINDLILLTLKKEGRTIEEGKTGWDYVVKLHAYLVNLSTMRDEAR
                     ETMVRHIKKFCPNHQPLFTMVGVESLPFPEHHIELEVDIWLK"
     exon            148675..153843
                     /number=1
     exon            153917..153965
                     /number=2
     exon            154146..154244
                     /number=3
     exon            154354..154499
                     /number=4
     exon            154562..154580
                     /number=5
     exon            154645..154673
                     /number=6
     exon            154723..155056
                     /number=7
     exon            155109..155440
                     /number=8
     CDS             complement(join(156072..156143,156235..156334,
                     156402..157029,157541..157574))
                     /codon_start=1
                     /locus_tag="AO090038000063"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000076"
                     /protein_id="BAE63912.1"
                     /transl_table=1
                     /translation="MASTTSSAAPQQHYSRNWCKPRLVRHMSITSTFLLLNLSTPPGI
                     GKGLVTAYLAKANTTVIATCREVSEQITKDLFSLSRGHGSNLIIVSLSLDKPQSVINA
                     VSQLQRHHSINKIDIVIANAGICIHYGPLARMEDADLVSHFDVNTLGPIRLFRATLPL
                     LQASSQPKFIYISSELAIITGLERSSSLTSAYGVSKVASNYLVKKIHTEHPDMIAFSI
                     DPGFVQTDMGNRGAQCNGLEKAPMTISESVEGIVNQAEKASKETTSGRFIKHDGEQLP
                     W"
     exon            complement(156072..156143)
                     /number=1
     exon            complement(156235..156334)
                     /number=2
     exon            complement(156402..157029)
                     /number=3
     exon            complement(157541..157574)
                     /number=4
     CDS             join(157792..157836,157909..158394,158454..158643,
                     158701..158873,158933..159001)
                     /codon_start=1
                     /locus_tag="AO090038000064"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000075"
                     /protein_id="BAE63913.1"
                     /transl_table=1
                     /translation="MSPQTIVVIGATGSQGGAVVKELLANRDLYHVRAITRDVTKPAS
                     QKLAALGAEVRSADLNSGSDALAQVFAGADGIFALTDFWQTQSTATEIAQGRAIADAA
                     ARTETLKHFVWSALPDPVKLSNGQLLNIHHWKGKSLVTEYIQKEHPELWAKTTTVLFP
                     NYFENCITTPDRYLPQKDANGAYTLSFPHSPETVMPNVAIADTGKLVHTILQAGSKYF
                     TKTIAFYSEALSESEKLAKIGSQYNVPTKYQKLNSRECQELLESRDGMSPEIALDFTE
                     QLMMFELFGNVYANKEFVQAREIPGLSLQTWSEFLRENDLSKFL"
     exon            157792..157836
                     /number=1
     exon            157909..158394
                     /number=2
     exon            158454..158643
                     /number=3
     exon            158701..158873
                     /number=4
     exon            158933..159001
                     /number=5
     CDS             join(160027..160279,160328..160764)
                     /codon_start=1
                     /locus_tag="AO090038000065"
                     /note="Zn-dependent hydrolases, including glyoxylases"
                     /old_locus_tag="AO070307000074"
                     /protein_id="BAE63914.1"
                     /transl_table=1
                     /translation="MIAGLLYHPDVGLILFDTGSREDVIKSWDKEFLECAPRTWDKDI
                     HSLPAAIKATGAGEIDDVKAVILSHLHLDHTGGLEHFFGTDVEVWCHEAELKDAFWSA
                     ATGIDSGLFLPDYLRADLLNWKTFSEQNVTLWRGVTLHRCPGHTEGSLVLELTFQSSG
                     TVIMTGDLFHVKENYEEGRPTGFLMRDYCEWFRSRDYVRRLVQRTNARVCLGHERGYF
                     DMFERSPKYLE"
     exon            160027..160279
                     /number=1
     exon            160328..160764
                     /number=2
     CDS             complement(join(162747..162856,162909..162987,
                     163068..163418))
                     /codon_start=1
                     /locus_tag="AO090038000066"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000073"
                     /protein_id="BAE63915.1"
                     /transl_table=1
                     /translation="MGVNSAFLHAATIGDATTIENEYLKDKSILTAKDADGRTALHLA
                     ALHKDVKVLELLLNYGIEPSTTDNRGQTALHIAAQQSSLAVVELLLKRRANWSIRDHD
                     GNTPLSYAYQQYSVEILRQQEMDSSPDKCQRARPLGFVELFEANLEPKHSLRKLSISD
                     LQMMTDSPDDQSNLIALFI"
     exon            complement(162747..162856)
                     /number=1
     exon            complement(162909..162987)
                     /number=2
     exon            complement(163068..163418)
                     /number=3
     CDS             165077..165493
                     /codon_start=1
                     /locus_tag="AO090038000067"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000072"
                     /protein_id="BAE63916.1"
                     /transl_table=1
                     /translation="MSALEAGYAKGGNLPRYATRFGTLSEQEIDVSGVRKVVLVPNYT
                     YATTAAQDAYADWFVRWCHLQEEASNYAVEESPDEVAPLLDLRSPKAPRYLAEAVTSS
                     SQGPSDGMAPLIDLGSLEAQQDVDDLASSPRPLLAE"
     exon            165077..165493
                     /number=1
     CDS             complement(join(166545..166914,167132..167211))
                     /codon_start=1
                     /locus_tag="AO090038000068"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000071"
                     /protein_id="BAE63917.1"
                     /transl_table=1
                     /translation="MVKKHLKNIRLASGKTNGQIKLPVAAPLAVPELGRKGFVSRYND
                     PNHPVNNGKISSVLTGSLFGSKSGLIERAATSIKGSHDSKRIARGEPRSEPIKEKWQR
                     YQRKKKPGLAKNVLQQDVLYRLNVNMPTEDELQQSIAQLEHLMQQAG"
     exon            complement(166545..166914)
                     /number=1
     exon            complement(167132..167211)
                     /number=2
     CDS             join(170550..170564,170624..170672,170790..171013,
                     171074..171307)
                     /codon_start=1
                     /locus_tag="AO090038000070"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000069"
                     /protein_id="BAE63918.1"
                     /transl_table=1
                     /translation="MEREHGFLSHDNDHMSSISLGTFHHHDYDYRDDYHWTVNFFYAC
                     SSHTTFPHIKAIMHHSEAKDPELVLRAEIMMIVATMHSRLTTETLLDHLIVPVMLFSF
                     AGCRVRILIAIHDGQNLGIAMSGFMEYSEGSQDLWDMLTRYLGCGINNRLSTEKLLSA
                     YLEEALPWREKCS"
     exon            170550..170564
                     /number=1
     exon            170624..170672
                     /number=2
     exon            170790..171013
                     /number=3
     exon            171074..171307
                     /number=4
     CDS             complement(172098..173075)
                     /codon_start=1
                     /locus_tag="AO090038000072"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000067"
                     /protein_id="BAE63919.1"
                     /transl_table=1
                     /translation="MAKSPSPDAPRVLEKTLTRFPGAGMPEEAVQAASKNLGMIPILL
                     DRVPGQVPIKEVLEQIGTLEYGEEEEEEEEEKGLPALKALLDRQIVSADETVIATVAP
                     NFSTSKYNLIEHKPDAPITQKILVRAASNASSIKLMMEKLKDLITITKEVILATIRDW
                     QGADTIKIIYDRLGSVPITRNVWKKAPIENPEFMTGFLFRLQRDLKPRVVWEDIWQDS
                     HTDAETKATVTMAFLNLAEGQEAIDLLQAYPYDWEQKEDHGFENLIQRLLPNDIPSPE
                     TEQVAAIIVERCSNEVIEKFLNTEHQISITDKVMQAAERNKRANKEALL"
     exon            complement(172098..173075)
                     /number=1
     CDS             complement(join(175782..175994,176298..176435))
                     /codon_start=1
                     /locus_tag="AO090038000073"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000066"
                     /protein_id="BAE63920.1"
                     /transl_table=1
                     /translation="MSVRLVGLKWGVRRSKENAKILPTLKSPDIRSKDNAKILPILTA
                     LDKISLEAYRRSVLAFCRTKYRDSDPVYEDENLSVRPRVSRHQAQAEEIDKYQHDLET
                     KDNPTGFGVFYDRS"
     exon            complement(175782..175994)
                     /number=1
     exon            complement(176298..176435)
                     /number=2
     CDS             complement(join(178604..179088,179138..179231))
                     /codon_start=1
                     /locus_tag="AO090038000075"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000064"
                     /protein_id="BAE63921.1"
                     /transl_table=1
                     /translation="MKTTFLTLLVLFVGLVVASPMFQADDDETVEVSEKGQCDWTDPS
                     CETWDPISCTCQDEGYVSQSEPWDDSPDVSGDKLSSREVKIRTRSTKGVKGFYSGKVK
                     GNWIAVDTDAYQKAKQAIFKQLSADPRVSFGQVDDLSKKFRAKGQSWRWTGKVDKKKL
                     SEQAHTDHGPFGQFKNWQGTRFYDFTFYFRVT"
     exon            complement(178604..179088)
                     /number=1
     exon            complement(179138..179231)
                     /number=2
     CDS             181240..182559
                     /codon_start=1
                     /locus_tag="AO090038000076"
                     /note="imidazolonepropionase and related amidohydrolases"
                     /old_locus_tag="AO070307000063"
                     /protein_id="BAE63922.1"
                     /transl_table=1
                     /translation="MGSIVVEPYRPTPADITINNHKPGDPSKILFKNVCILDSTGRAP
                     CHGNVLIEGERIAAVGDVSDSAARGALVIEGEGKKTLMSGLMDAHTHLSFNDSPTLDG
                     LTSAPLEEHVLSTAQSAKTYLDCGYTMCFGAASAQPRLDIAIKGAIKSGMIPGPRTLA
                     NAPEITTTGGAIVPGISRNADGPHEMRKQVREFIMLGADNIKLSMSGDDIHLTMPSTE
                     TYFTLEETVAAVDEAHNRGKRVCAHARSAQSVKFALQAGVDVIYHASFIDQEGMDMLE
                     QKKDHVWVAPALNFFYTTCTGEATPWGLTAEDAAKKGLTYEVDTACKAMQEMRKRGIR
                     VMPGGDYGFAWAPHGTYARDLKHLVDLFGYTPMESIIAATAWGGEMMGYPDDLGKVAP
                     GYYADMILVDGDPLSDLEILQKQERLHAIIINGHIHKHVVPSQAVYA"
     exon            181240..182559
                     /number=1
     CDS             join(183519..183755,183804..184058)
                     /codon_start=1
                     /locus_tag="AO090038000077"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000062"
                     /protein_id="BAE63923.1"
                     /transl_table=1
                     /translation="MNPFVQRSQAAWHRVGLVSEFPDLQLDNDCSPIAPSCKAFNIPK
                     TNIGPPVEADIDLPGDLKEQVLIFKYKGKIHAIDHQCPHSSFPLSQGSLFDIEDFGIT
                     LSAGLTCPKHGWSFDIFSGQADRGNYKLKLWEVQLRDPQAKDESADSTDQEVWVRRKQ
                     RIG"
     exon            183519..183755
                     /number=1
     exon            183804..184058
                     /number=2
     CDS             complement(join(184733..185162,185232..185815,
                     185894..186000,186059..186233))
                     /codon_start=1
                     /locus_tag="AO090038000078"
                     /note="monocarboxylate transporter"
                     /old_locus_tag="AO070307000061"
                     /protein_id="BAE63924.1"
                     /transl_table=1
                     /translation="MDDTHHSTGASQNAGEKQPTFESAKVNEPQEFPDGGLRAWLVVL
                     GAFFGLLISFGWTNCVGVFQAYYETHQLQSKSPSIVSWIPATSMFMIFITGPVVGRLY
                     DNFGPRYLLLIGAFLHVFGLMMTSISSQYYQFILAQAICSPIGAGMVMYPCFTCVTTW
                     FMKKRALVMGIVASGLSLGGVVLPILVDRLMPQIGFAWTMRTCAFLMLALLIVTNLTV
                     RPRLPSQPKNIGIMAFIRPFKDLPFLLTALASFFYSMGMFIPITFMVTYGKYRGMSVE
                     LAGYLVPIFNAASGIGRILPGYAADKLGNYNVSLCAACLSSIFVLALWLPGQDQATAI
                     AFAALFGLSSGTYTAISPALVAQISDIREIGTRSGTMYACMSVAALTGSPIGGALISA
                     AGGSYWKLQVFTGTMLVMGTIFYIIARMHLAKGKLWMKV"
     exon            complement(184733..185162)
                     /number=1
     exon            complement(185232..185815)
                     /number=2
     exon            complement(185894..186000)
                     /number=3
     exon            complement(186059..186233)
                     /number=4
     CDS             187206..188036
                     /codon_start=1
                     /locus_tag="AO090038000079"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000060"
                     /protein_id="BAE63925.1"
                     /transl_table=1
                     /translation="MLAESHHGADSPKTWDNLEAIASNPHSATEPSFGRQQPARGISM
                     SDPKFILFNDRKASGEASAKTLQHHDPPTTDVPNNVKWRNLQSLLPDIHLARLLFEHY
                     VQTADCLHREIHVPSTRTLLEATYDELSGSMMGLHETIILFLSIFASSAFYVCHSHSH
                     SVSDQLKDASKWYNTWKEAVIFALLQPDAIRSSSLISLQTILIMTYLIWDTEGQSSMF
                     HTLRGIAHSKAIQMKIHRLDAHHPTEDDDVIVTELKRRLWWHLASTDWFVRSFHLNCT
                     "
     exon            187206..188036
                     /number=1
     CDS             188378..189178
                     /codon_start=1
                     /locus_tag="AO090038000080"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000059"
                     /protein_id="BAE63926.1"
                     /transl_table=1
                     /translation="MDEENRNKTAVLAAHHPYIIRQRHVLLFGLYSRLGRLLRPLLIR
                     GGSHPSCSDLVNLGISCAEKLLNIRHTVEPEDLCPSFHSHSIDQHSFGALLLLTIDIM
                     RDKDELRARDRRKNLIRECEMLRGKQRSLGEPTKNMIRALDQLIGIIQKPRLSLPREF
                     VDVNGNHPGPTSTSTPYDSAGLPTQPFSSEETEIPGSQTVPTGKADDPEEHAHMSFTS
                     ADNFPCAHEHPANNPAGQDITELWTELLNSFPYSPGFTWEETFDWTWS"
     exon            188378..189178
                     /number=1
     CDS             complement(join(190569..191531,191588..191737))
                     /codon_start=1
                     /locus_tag="AO090038000081"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000058"
                     /protein_id="BAE63927.1"
                     /transl_table=1
                     /translation="MAILFKLSLPIWALAVVQATSSHCSHKQSSHHTAAYDFHPSQAG
                     IQTAQLIDPLPLPYDFNTSNSEMADSSNSWWMSSYLTGSDNHQYMVLSHVLATDTFGL
                     YRGGIYDITEPAYSLFSEMTTQNLTAHSQDGKFNIRTDDFFFGSALANNSITKLRTVS
                     NRTNLQFDLTYELTAPVLFNAGLGGLFQFGPDQTGEWSMPAGKTSGSLVFNGKKITVD
                     TKRSQTWYDRQWNVGPAPTSHTWTWFQLHINNGESDEKELVSLWMYDSDVKGHRQWAT
                     TQSKAGINIVQSVPTVEPFGNSWTSPHTNATYHQAWKIVLQDSTTLTVKTTYEDQELW
                     AARGFATYEGFVTVNGTDADGKCVTGFGLVEIQGHF"
     exon            complement(190569..191531)
                     /number=1
     exon            complement(191588..191737)
                     /number=2
     CDS             join(193275..193598,193857..193880)
                     /codon_start=1
                     /locus_tag="AO090038000082"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000057"
                     /protein_id="BAE63928.1"
                     /transl_table=1
                     /translation="MDLRRLGSSRDEAEQKLATIKRTLEEVRREPEGVSYLECFRKSN
                     LRRTTIAVFLLCMLSAAGASFAASYSTYYAQTVVYNTEMSFKIQIIQQVLSLIGNVIS
                     WWLIDRDQSITSR"
     exon            193275..193598
                     /number=1
     exon            193857..193880
                     /number=2
     CDS             complement(join(193947..194211,194302..194782,
                     194817..195316,195366..195713,196807..196895))
                     /codon_start=1
                     /locus_tag="AO090038000083"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000056"
                     /protein_id="BAE63929.1"
                     /transl_table=1
                     /translation="MPSRPAPNDHVHGLSGPLVSEVLSDDPMQLFPKPTTLFPAETVQ
                     LTNEVLAAVSSNVRNANISDVFHFADPYTDSTLSKKNPRSCKVMPGDVSWPKNLLWNT
                     LDTLLGKRLIKTVPLAAYGYLEWPEYDADKCANITSQWVVSNLHMDDPVSIMLPRYEG
                     RTCMAPGYNYTNTCELGSYPTYVVNASTVAQIQLAVNFARNLNLRLVVKNTGHDFNGK
                     SSGKGALSIWTHWFKDKAFYPQYKAANGYVGPAIKFGSGVQVGEAYEYAKSLGVSVVG
                     GEAVTVGLGGGYTAGGGHSPLSSMYGMAADQVLAMEDICLTLCCVFVLADGRFIPASS
                     TENSDIFWMLRGSGGSTIGVVTSLIVKALPRLPTTTVTFNFTINDAPNVDAFWKGIEA
                     YFDNFEDFVNAGTYGYYYVGASAVEIGTHHAGSTDYYFRMHSFVAPNMTIAETKALLA
                     PWYNVLDSLNITYTPWYYHADNLIRRRCRGQNRLPQSGAYMSKADLIEPNLQEAFYGA
                     NYPALYALKQKYDPTSLFFALTAVGAEDGEVRTTDPLPYSWNNNGRLCPVSL"
     exon            complement(193947..194211)
                     /number=1
     exon            complement(194302..194782)
                     /number=2
     exon            complement(194817..195316)
                     /number=3
     exon            complement(195366..195713)
                     /number=4
     exon            complement(196807..196895)
                     /number=5
     CDS             join(199155..199334,199387..200156,200216..200589,
                     200640..200668,200711..200971)
                     /codon_start=1
                     /locus_tag="AO090038000084"
                     /note="permeases of the major facilitator superfamily"
                     /old_locus_tag="AO070307000055"
                     /protein_id="BAE63930.1"
                     /transl_table=1
                     /translation="MSPPTPETKNDTDHGHELPSSITSASGPGDEKDLAYATPLRLTM
                     IMCTLSLSTLIAALDLGIVATAIPEITSDFHALDHIGWYSGACFLLVGTTSAPWGKMY
                     KYFSATYIYMTALGLYLVGSVVAAAAPSSIALIIGRALQGWGCAGTLGGSVLIINFTA
                     EPKLRPMLIGLWMGVFMIATTIGPLIGGVFTSEVNWRWCFWVNLPVGGTAMALQFLFL
                     RMPKHIKPTPATWTKILLHLDLPGWTLLFTSVICFLLAMEWGGLAKEWSDGAVIATLT
                     LWVVLSLAFVAVEWFQGDYAMMPLRLLKSRTSWSHLLYAWIANLGNFQILFYLPIYFQ
                     SVHGSSAIMSGVYSLPFMAFYAFGAIVSGILVGKTRLLQPIELVSGLITVLGAALIYC
                     IDTGTPKAWWIGAQVPFGLGIGLGNQVPVTALQGFATPETVAATMGVAFMCQAISGAY
                     FTLSVTAPQLNSSEISYMGVTELKNAFHGEDLALIRQAYMVGIKDVFAFALAGACLTV
                     VLALIVPFEKLPDHEAKKDEDKEAADKAS"
     exon            199155..199334
                     /number=1
     exon            199387..200156
                     /number=2
     exon            200216..200589
                     /number=3
     exon            200640..200668
                     /number=4
     exon            200711..200971
                     /number=5
     CDS             join(202407..202599,202659..203314)
                     /codon_start=1
                     /locus_tag="AO090038000085"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000054"
                     /protein_id="BAE63931.1"
                     /transl_table=1
                     /translation="MVTLSSNLRGYLLRLSQKECTRGKMMYSCIRLQSAIEAAYKGAE
                     RQDVFWPADSQLTSDLSLNTPSINIARLTLSLLEEASIYRLQPALLEFDLLKFQSIMS
                     KGRAFLDYFISVPTSDFANLSFAEWERLIAAIHVITEIISAAASLPGIVAAVGEESRT
                     LTRYLECLANRMEKLSQSGRNPGEHPDMFYLFKSVLDLLCPLPLAATYDQGLPPAVNP
                     EPHHGKKRCPVLSGIRETQFWDAYQTSLPADDIDIDLDMLFTNEFLSELSPEQWMDAS
                     EDTSYT"
     exon            202407..202599
                     /number=1
     exon            202659..203314
                     /number=2
     CDS             complement(join(204782..205600,205652..205972,
                     206024..207780,207832..207920,207973..208034,
                     208098..208410,208468..209813,209868..210873,
                     210932..211269,211325..211952,212115..212530,
                     212581..213177))
                     /codon_start=1
                     /locus_tag="AO090038000086"
                     /note="polyketide synthase modules and related proteins"
                     /old_locus_tag="AO080533000083"
                     /protein_id="BAE63932.1"
                     /transl_table=1
                     /translation="MSPSLEPLAITGMSLKFPGNAVSPESFWKLITEGQMTMRDYPPD
                     RSNIDAFYHPDRDRLDQISTRGANFLNQDISRFDAAFFSINAAEAEAMDPQQRLILET
                     VYHAFENAGMTLSQASWSKTCVYTGSFSHDYTFMQVKDPMALPKFHSTGTGMNMLSNR
                     VSWFFNLTGPSATVDTACYSSLIALDLACKSIWSGDSSMGVAIGSNAIIGLDTSLPLD
                     NLGLLSNESRSYSFDQRGNGYARGEGVGVLVLRPLKDAIDHNDTIRAVIRSSGSNQDG
                     RTQGITQPSMALQQQLILDTYNKADLDLSLTRYVEAHGTGMLGLPLLLRVVRIILLDR
                     KPVIGSVKSTIGHLEGASGVAGVIKTVIALEKGIIPQNTDFQQLNPRIDDAYLRIKVG
                     DKQVPWPTDGLRRASVSSFGFGGSNGHIVLDDAYHSLQASNFQANHNTTVHTSNGLPK
                     EETASPRLFVLSSTDEDGFSRLKDVWRSFFSSLEIATTEKQRFLNNLAYTLSLRRTHH
                     SWRTFAVVHPNDDWSHVVDGLVGPQQTIASPNLAFIFTGQGAQWYAMGRELLDAYPVF
                     RDSIQQAGSYIQTLGCRWDLMGKREITTFPVIGDISSPITEELQKPELESNVNNTEYS
                     QMLCTALQIALVDLLHHTGIVPEAVVGHSSGEIAAAYCAHGITRESAWKIAFYRGLWT
                     SKLEQFSSINGAMLAVGLSREAIAPFLERTSIHYSASRLTIACKNSPQSTTVSGEQQQ
                     IDTLEGYLEQEHIFCRRLKVKVAYHSFQMSEIATHYHQAIGQVEGTNHKGKRPNILSS
                     VTGTWISHSEMQSASYWVQNLVSTVNFSDALTTLCSNTTDVTIKKLDGSHRQSLRMHH
                     LLEVGPHSVLQGPVKDIQKIIEGPAAVYHPVLVREVSALESFLQAAGHLYAAGYPINL
                     SHVNRCTIEQERPMCLPCLPEYPFNHSRSYWHESQISRNQRLPKVKKNDLLGMPDSNW
                     NPLEPRWRHIIWASDLPWIKDHQISGTIIYPGAVMLVMPIEAAKQLASPGRVISGFKL
                     EDISLLASIRIPQGEGGVETNLYMRPDDSMENKYSHLFSFKLCTYVNDCWTENCRGRI
                     HILYQPDEPDPVNGDRLEREDLADSLYSFSKAPDGCGSTVYSDVIYDHMARCGFEYGK
                     TFRQIHALAVGGKGEREVIGDVNNVKVSMQDTIHPTTLDGIIQTMVWSIIQGGTRTVP
                     TSVPTYIASMRVAANCSKCKALKTHTVTETSETGTLLTSIRAFDRDLREVMVSIEGLK
                     FTAITSKAPTESTSPVKDNLCHRFECKPDINLLSNDELHTVCRGAYPDLAIPKDFLIE
                     LDFLVMVRITETLQVISQRDIEPQKPHLKKYIDWMRHHQERLLGGELMFSTEPWKSRF
                     SDTKFIQGLESRVMRKGKQGELLVRVTRHLVEFLNNELDPLAFLYQENLARDFYAEMV
                     RLILSNGLYLEKYVELLAHANPQMKILEVGAGTGCATAALLRILGKSYEHKSMSPKYA
                     HWEYTDISRSFFDEAAKQFASEGSRIAFRTLDIEEDPADQGFEYATYDLLLACMVFHA
                     TSDLARTLTHARRLLKPGGKLILVELTNASAIRAAGVFGLLDGWWLGSEPYRFLGPFV
                     DESQWNSLLLQAGYTGCEIFFPDYDDRICHETAVIISTATQNPSQLTYDRPIDIVYEP
                     NDLAQLDLGRTLARHYTTQTNLARLIPIQDATPDSKATLRVFLLEYQKPVLYDIGEDI
                     YNRLQPLLLSADPMLWVTNGGGKQLSQPKSHLIDGLLRVLSEEDGNRSHYILALDPTE
                     TPKVPHFETIAKLSQRILSATESIDTEYIESNGLLHIPRLTVDPVLNKAIYELEQVAA
                     EMKQKFGSGPPLKLDVYSPCMLNGFKFIEDYAVQQPLGPNEIEIQNRSVGINFRDVLV
                     SLGQLESDDTGLECAGVVVRVGDSCRRIKVGDRVAALYPTAFSTYIRLPETGPVAIIP
                     AGMSYTDAASIPVSFVTSYIALRQAASLQAGESILIHSGAGGTGQAAIQIAQYVGAEI
                     YTTVGSESKKQLIMEVYGIPEDHIFSSRSTGFAKAVMRRTRGKGVNVVLNSLSGEAML
                     ASWKCIATYGRFIEIGKRDILSNNNLPLGMFLRNTMFRGFDLGGVMMDRPDLCLSALD
                     DILSLMSDGTLRPVQPITTYGIGDIEAAFRFMQTGKHQGKLVIDVGMEDMVTTVMNTK
                     PNFTCDGNATYVIAGGLGGIGQSIAAWLVDRGARTLLLLSRSGAKGPEAMKFINSLQS
                     KGARAIALACDICNESSLRKVLEEWQPQLPPIKGCIQAAMVLRDRTFESMSYKDWEAA
                     VKPKAQGSWILHCLLPGGMEFFILLSSLSGIIGTHGQANYAAGNTFQDALARYRVNMG
                     ESAASLDLGLIIYTGAVANNLKLLPRWQSNSVSTPITESELKALVDCYCSPLHGYELD
                     CQPSIGVQPEVRERANWPEKPLFKGMTLDEAHSQDLPSREQTFQLAAAMENARSLQEG
                     SHAVTRALTAKLSSALALDEKDIDPDKHLSKYGVDSLVAVELRTWLDTELKANIAIFD
                     IIGSTVATIAQLAASRSKLQKGYST"
     exon            complement(204782..205600)
                     /number=1
     exon            complement(205652..205972)
                     /number=2
     exon            complement(206024..207780)
                     /number=3
     exon            complement(207832..207920)
                     /number=4
     exon            complement(207973..208034)
                     /number=5
     exon            complement(208098..208410)
                     /number=6
     exon            complement(208468..209813)
                     /number=7
     exon            complement(209868..210873)
                     /number=8
     exon            complement(210932..211269)
                     /number=9
     exon            complement(211325..211952)
                     /number=10
     exon            complement(212115..212530)
                     /number=11
     exon            complement(212581..213177)
                     /number=12
     CDS             join(219084..219176,220093..220147,220214..220753,
                     220806..221317,221372..222115,222173..222759,
                     222817..223134,223200..223500)
                     /codon_start=1
                     /locus_tag="AO090038000088"
                     /note="Na+/K+ ATPase, alpha subunit"
                     /old_locus_tag="AO070307000049"
                     /protein_id="BAE63933.1"
                     /transl_table=1
                     /translation="MPEGSKDSEGHRDNEVRPCRSMAIHAKIRLQAEALHRTKAAQVK
                     SEIATDLSNLDWHTITVEELQKRWQVDASQGLSSEQVQRRLRQYGKNSLAALPHRWFW
                     QIFGYFFKGFGAILLVGCVLVFVSWKPLGQPPSQANLALAIVLLAVFFIQAGFNAWQD
                     WSSSRVMASITAMLPESCLVQRDGSQVTVDGPDIVPGDVVYLKAGNKLPADVRLIEVS
                     NDASFDRSILTGESLPIHGTVDSTDDNYLETHCIGLQGTHCVSGNAKGIVVATADSTV
                     FGGIAKLTNEPKKGLTTLEKEVLRFVLLIVLIMLTMIIVVVIVWATWLRVDHPDWINV
                     PTLIVDCVSVAIAFIPEGLPIALTASLTITANLMRKNKILCKSLKTVETLGAVSVICS
                     DKTGTLTRNKMFVTDCAISSSTLSPESARDRMVMDGKASGVHQLRAVAALCNAAEFDA
                     SSSTLPLVERHIYGDATDQAILRFSESLGPVSELRQAWKMTYELPFNSKNKFMVRTFN
                     AAQPNGYGLALSAAEAVQFRQSDGLLTIKGAPDILIERCTHTIGLDGNVEALDDNMRR
                     KMLEVKDRWSSEGRRVILLARKILPAAEILVHPSSREFESEMMTQAKTGLVLVGLVGI
                     VDPPREEIPDVIKTLRRAGIRIFMVTGDFGLTALAIARQCGIVTTESTVDTVASLHRS
                     THIAEKIPPSTPSPAIVVSGPELMSLDDCQWDQLCRYQEIVFARTTPEQKLRIVREFR
                     ARDEIVGMTGDGVNDAPSLKAADIGIALGSGSDIAIEASDMVLLDSFSAVVEAVQYGR
                     VVFDNLKKTIVYLLPAGSFSEFWPVFTNVMFGLPQVLSSFLMIIICCFTDCAAATVLA
                     YEAPEADVLLRPPRKPKRDRLVNWKLVFHAYGILGMLESVASFAMAYWYLERSGIPFS
                     ALWFKFGAVPSNVDPDYYQARLNEASSIYFINLVVMQWFNLMAVRTRRLSIFQHPPAF
                     NKDTQNLLLFPAIAFALCMAIFWLYVPPFQEVLDTSSVPAEHYFLPAAFGLGILCLDE
                     LRKAAVRRWPKGILARCAW"
     exon            219084..219176
                     /number=1
     exon            220093..220147
                     /number=2
     exon            220214..220753
                     /number=3
     exon            220806..221317
                     /number=4
     exon            221372..222115
                     /number=5
     exon            222173..222759
                     /number=6
     exon            222817..223134
                     /number=7
     exon            223200..223500
                     /number=8
     CDS             224479..225912
                     /codon_start=1
                     /locus_tag="AO090038000089"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000048"
                     /protein_id="BAE63934.1"
                     /transl_table=1
                     /translation="MDPLVSSHQATGEGIILSPGTHSLSESSYAAHPRFLELQEELRS
                     ALFTAVADSTPKQSYLVEAPTEPGLSELRHDVDLFARSPVPKARLISYLKNWITECAP
                     YLDKFDEARHFGVHIPILARESPGLFYAILAFSARQTERKAGLRNCHDSLELYQESIR
                     WVSPGLQAKDPNVLVTACVLAVMELMSVSPQDWRRHVDGCAALFDCFNVNGFSGGHLQ
                     AVFWCYVRMELCGVIVSNGAERTVLPLDKWVPAGSMGGASESIEDNEKRVRELFLDQS
                     RLTPDMHANWAVYLCAKACDLVCRRTRHLELGEFDTTDPRPFQEQWKRLWDELQFWLE
                     QRPSAILPAKSTSMQGDRMFPEIFYAHQAAISSNQLYHTSCILLLEIKPPAILLPSSS
                     HLTSSVWHARRVCGISLTNPHPGNLINAIQPLYIAGKLLTHRREHIAVAKLFRTIEQT
                     TGWGALWRLRDLEAVWGYETNEILSVI"
     exon            224479..225912
                     /number=1
     CDS             complement(join(226319..226755,226827..226971,
                     227030..227145,227200..228065,228121..228245))
                     /codon_start=1
                     /locus_tag="AO090038000090"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070307000047"
                     /protein_id="BAE63935.1"
                     /transl_table=1
                     /translation="MTVDTSSDREANDFQHVQVAKTSMWRSLMNNPKVLFIAFFASFG
                     GFEYGYQQGVLGQSLVMTRFMENFPSVVNSSTATGWLTSILQLGGVVGSLSAGVLGEL
                     YSRKYTMFVACCWVILGSYLYVGATEGNPSLLYAGRFFTGLGVGLFSGVGPLYNAELA
                     APEMRGLLVSFYQFATILGIMISFWVGYGSNYIGGTGETQSDMAWRLPSIVQGIPAVF
                     LACGIWFMPFSPRWLVKQDRDEEALTTLAWIRKLPQDHELVQMEFLEMKAEALFEKRA
                     FAKATPWLAERENKNVFMSQIAQYANCFRTMGNFKRVCTAWLVMFFQQWSGVDAIIYY
                     ASNVFTSLGLTSGTVALLATGVTGVVFLISTMPGMLVIDKVGRKPMLLVGSLVMLLSM
                     VIVGVIVAKFRHDWPSHEAAGWSAVALIWLYIAGFGATWGPCSWTLVSEIFPLSIRAK
                     GASIGAFSNWINNFAIAFFVPPMLEAWAWGTYIFFAVFLGVGIVWVWFFLPETKNASL
                     EEMDRVFKSNTGEQDAEMLREAQREVGLTACIERLSKGPVPVEKDSYGSHLEQV"
     exon            complement(226319..226755)
                     /number=1
     exon            complement(226827..226971)
                     /number=2
     exon            complement(227030..227145)
                     /number=3
     exon            complement(227200..228065)
                     /number=4
     exon            complement(228121..228245)
                     /number=5
     CDS             230575..231021
                     /codon_start=1
                     /locus_tag="AO090038000091"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000046"
                     /protein_id="BAE63936.1"
                     /transl_table=1
                     /translation="MRPILDISGVEADEINSGNCSSFPILIYTSALALLANTIYHISS
                     FLLLIHKPRLLKTLPGPKRFISRIWHAQAIAGIATSNEFKEQWDPILIASLLTVAPEM
                     THKSQQSILLNLLGSITTVTGIKLDSEIDDLRCGWNISQYDEEAVD"
     exon            230575..231021
                     /number=1
     CDS             complement(231079..232122)
                     /codon_start=1
                     /locus_tag="AO090038000092"
                     /note="ribokinase"
                     /old_locus_tag="AO070307000045"
                     /protein_id="BAE63937.1"
                     /transl_table=1
                     /translation="MATKPQICVIGSLNIDFVTYARRCPGPGETLTGSSLSIDAGGKG
                     ANQAVACARAAFTSRTQQDVAVRMIGAVGANDPYYPTLLQPALEKSGVDTTGIEQRSD
                     CQTGSATIIVEEGEQGENRIVVVPGANHDGMNDVDKLLSVVQTQCPAPPQVVVLQGEI
                     PRSTVIGLMQHYNKSENPTNVVLNIAPVYPDGIPLAALSGTAVLIMNETETIQMAESI
                     PDFPVGSQTEADLQPELLAPLFHQVAKIPIVLITLGAKGVFFSTATGRNGSVRGVRVK
                     NVVDTTAAGDTFVGYFSAEFARYAATGQPLEDFDALIEPAVQQANQAAAMCVQRKGAI
                     ESIPFAYEITDRQ"
     exon            complement(231079..232122)
                     /number=1
     CDS             complement(join(233608..233646,233743..233802,
                     233939..234121,234182..234229))
                     /codon_start=1
                     /locus_tag="AO090038000093"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000044"
                     /protein_id="BAE63938.1"
                     /transl_table=1
                     /translation="MKWTAILIALSAVSTQALESRDFDGKVTCGGGLPADYKAIKGGI
                     DYLNGVGGTPVEDPNKCGRVSCSYNSAIYMCNWALLGRSRLQMDGVWRLPMLAFDLEM
                     CLICCLS"
     exon            complement(233608..233646)
                     /number=1
     exon            complement(233743..233802)
                     /number=2
     exon            complement(233939..234121)
                     /number=3
     exon            complement(234182..234229)
                     /number=4
     CDS             join(238385..238424,238473..238688,238753..239417)
                     /codon_start=1
                     /locus_tag="AO090038000096"
                     /note="steroid reductase required for elongation of the
                     very long chain fatty acids"
                     /old_locus_tag="AO070307000041"
                     /protein_id="BAE63939.1"
                     /transl_table=1
                     /translation="MALVTIRVAIHPRGKPIKSLSQKVRIDPHNSTEELYDVLAQMSG
                     LSIFRLRITKKSDSILVARSKESTLEEAGVKDMDVITVKDLGPQISWRAVFITEYLGP
                     VFIPGLFLFQLRPYLYSNHGTIPEPSSFQLLLCALLIIHFVKREYESIFVHRFSKVTM
                     PARKIVLNSAYYCVMSCNMAYWAFRPDTTPSNPVLCCAGLVLFAFGELANLNTHFVLR
                     DLRRPGTPERGVPYGFGFGVVTCPNYLFEIIAWIGIWFVSGLSLSILIFIIIGSVQMA
                     IWARKKEHRYRKEFGGKYKVKRFAMLPGIY"
     exon            238385..238424
                     /number=1
     exon            238473..238688
                     /number=2
     exon            238753..239417
                     /number=3
     CDS             complement(join(239612..239760,239808..240074,
                     240134..241250))
                     /codon_start=1
                     /locus_tag="AO090038000097"
                     /note="cytochrome P450 CYP4/CYP19/CYP26 subfamilies"
                     /old_locus_tag="AO070307000040"
                     /protein_id="BAE63940.1"
                     /transl_table=1
                     /translation="MSPRGKMVQPIETPRQAFLAHPLTVILVGIILSLLVRRLLWNLK
                     QRELERLHGCERLHNEGGCLRYDFLGIAKAIKLGFHFRRRTSLPYTNALFKRYGETYA
                     SNVLGYRLIFTCSAENIKHLLSTAFADFDSSPLRKPLFQPITPDGIFTLDGPGWKKSR
                     DQLRSRLSNLRKIVDLNQCERHFQAFLQHVPPNGQAFDVQACAFALALDMQTLFSLGE
                     SVDALSFCQSREKKQFLEDLLFVKEKIVQDGFRGPLRYLYPKRRFLHCCKRARRYVIA
                     HVSRQLTGCSSMSEKAEGAQPTNAEEEVSLLADQALSILLANDSMSTTLSGLFFCLSQ
                     DERVVKKLTASILDTVGLEPPTWGQLGTLHYVRWVLQEAMRLFPAVVFNARVANKNST
                     LPTGGGTNGNSPVLIRKGEIVVFSTWARHRLGKDFGENPDEFYPERWEHLSGDMIGFI
                     PFNKGPRACPGQHYAMIVLTYIVARIFQTFSTVSNYDTREWTERISMTLENENRVLIG
                     LS"
     exon            complement(239612..239760)
                     /number=1
     exon            complement(239808..240074)
                     /number=2
     exon            complement(240134..241250)
                     /number=3
     CDS             241773..243794
                     /codon_start=1
                     /locus_tag="AO090038000098"
                     /note="squalene cyclase"
                     /old_locus_tag="AO070307000039"
                     /protein_id="BAE63941.1"
                     /transl_table=1
                     /translation="MTTGHRQFDDGLSERERLIHEAGLTLQRSMDYAYNVVRSDGHWC
                     GEMSSNVTITAEYIFLRQALGLDLKTDGAAYCRHILSQQNSDGSWGLAPEYPGDVSTT
                     TEAYLALKMLGLSTDAPAMQQAKAFVLNAGGVAKVRVFTRIFLATFGLFPWKAVPQLP
                     VELILLPSACPINIYKFASWARGTIAPLLIICHHQPVYALPNGVFAENEYLDELWQDS
                     TNKSEPYSPSIWELLSQGDITGLTFSLLDKLLYQLNGLRSIPLLRSYALKQCMKWILE
                     RQEPTGDWAGIFPPMHASVYAFVLEGYKLEDPPVRLGIEALENFAWEDAKGKRVQPCV
                     SPVWDTTLMSIALSDAATPNHQIVDRAIQWIRDRQLLEPRGDWRVYRPRLAPGGFSFE
                     YTNSHYPDIDDSAAIILAQVKHDPISANSSSVIAAATWILGMQNPDGGWAAFDVENDK
                     LFLNKIPFSDMDSLCDTSCADITGRILEAFGLLIRRVPDKDSSQLFQLLPAIRAACRR
                     GIRYLASTQEANGAWFGRWGCNYIYGTSHALCGLAYFLQEDQQVPAMVQPALQWLKSQ
                     QNDDGGWGESLLSYQSPERKEQRSTASQTAWALMGLLAHLPHTDIVIERGIRWLVSSQ
                     RPVETLGSTWPEPVYTGTGFPNHFYLGYDYYRHYFPMMALGRYLRGVQG"
     exon            241773..243794
                     /number=1
     CDS             join(244127..244351,244412..245818)
                     /codon_start=1
                     /locus_tag="AO090038000099"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000038"
                     /protein_id="BAE63942.1"
                     /transl_table=1
                     /translation="MGLLSTFGRPRPVTVPTDRVVHLRYWDDLHYLRSLCHDFTFRFD
                     DVLDASKLEAALDRLMEIGDWGQLGARLRLNDNGKLEYHIPAEYDKSTRPAFGFTTAE
                     YGISINEHPLGARLPTTGQDQSVLSPSCAEFAPLVRHEDSPRELADWIYSDRPQLHVH
                     VAVFEDATLLTVSYLHTLFDAVARTNFFKAWIAVLEGREEEVPPFVPFDQDPLCQLGK
                     EVARENYTHFGRLVAGLSLVLFGLRYLFELLWFRKEEEHPIRVPGHCVERMRETAQQE
                     LAAATPEGAEVPFLSEPDVVSAWWVKTMVTALNPAPSRTVMVMSPFNVWGLFKESFPA
                     GAKGFIGNAFFNSYTVHKAGEVLEDNNLAHLACKNRQALVEHRTKEQVQAMTAIQRQS
                     FMQFPPLVGDSNLLFMTHTNQHKARYFETDFSAAVVATGVPLTERPHALGRPSYINDI
                     EHCRLYPTRNVCRVIGKDAAGDWWLLFKTRSEAWPSIHRQLATLLGIDQAEARDVPNA
                     VDQVAITHNGSSPAKMYSEARGMLLQIRLLWRLLV"
     exon            244127..244351
                     /number=1
     exon            244412..245818
                     /number=2
     CDS             join(246265..246580,246631..247205,247254..247842,
                     247874..249822,249884..249999,250046..250304)
                     /codon_start=1
                     /locus_tag="AO090038000100"
                     /note="multidrug/pheromone exporter, ABC superfamily"
                     /old_locus_tag="AO070307000037"
                     /protein_id="BAE63943.1"
                     /transl_table=1
                     /translation="MSDEEILLGEIPPIASTPCAADIIECQIRTEPSTANLFSVYRYA
                     NAPWLCVLLISVICSVVAGAAMPLVTIVFGALAREFINGEENTPDDVRDRVKHLTLLL
                     LYIAIGSFIATMISTLGLNVVGEHITRRLQWRYLSSVLQQNMAYFDVVGTGELTSQID
                     KDMKLIQTGISQKLGNIISGVSGFIVAIICAFIQNPRFASIMISQPVAMILLVGLMGF
                     WLSVTQQRGLPHSVKLENLAQDVLNAMRSVIAYRSQERYARKYHNTLLQPAALDFRER
                     LIFGVIVAGSFTILHWANGLGFWQADRLFRQGYCTVSEALSILYATVVAGGMLCQALP
                     YVVDVTKASQAANRVFSVIERVSPINSMADTGRIYGPVRGEICFDDVEFAYPSRPERT
                     ILRDISFTVPAGHTVALVGLSGSGKSTIFGLLTRLYNSIGGGIMLDNEPIEEMNIAWL
                     RSQIGYVSQDVNLFRTSIHENIAHGLPKHTIEVCLPVSSRFSSSTSAVKELVIQAAKT
                     AQIHSFITNLPDGYDTVIGSNGSSLSGGQRQRLAIARAIVSQPSILLLDEATSALDSQ
                     GEKEIQEALSKAAYGRTTMIIAHRLSTVQNADAIIVMKDGQILNHGTHSELMVTSALY
                     RDLVEQQALRQNNAVGHSLSLAKSIETKSSNITVNHDTPKRPQDAPGLSPSPESSIKQ
                     VWLLNKPELPYVIAGIIFSALAGMTYPVQAIFFGNGIISIISPGASTGGHSVHFWARL
                     YLIHGIVVFIVYSVRGYCFAVSASQLHLRARSHLFRALLLKKLAFFEDKDHSAGAMVS
                     FLSSGTPKITGVSGTSLGLAVESIVMLTTGITVGCIFGWKLGVAAMAIVPLVAMSSFL
                     QCYIEAQVQKHVKRETNAVAIAHEAFSAIKTVTTLNLQTNIIESFHRESHQDKKSGYW
                     VISAALHACTTSLRILSISFVFWYGGTRLIATGEYTIQQFFICFAATVWGSQSAATLF
                     AHAPDIAGAHAAAARLAELLRPDDSPSQFPVKSQKDSSTSTLVPNTMEDLAMQQISFR
                     YPTRPSQLTLNDITFNARSGSFIALVGATGSGKSSVVNLIERFYAAESGQITLGHNSI
                     ERYDLNHYRGYFALVDQNPSLIGEDLRECLQSDERVVLDEEILIALEDVGLADFVLSL
                     PEGLSTPVMANGSTLSGGQRQRMAIAKALLWGPKIFLLDEATSALDSASEALVQEALQ
                     RAKKGRTVIAIAHRLKTIVDADEILVLDHGHIIERGRHEELMKLGGKYWQMAKLQQLH
                     GEVGR"
     exon            246265..246580
                     /number=1
     exon            246631..247205
                     /number=2
     exon            247254..247842
                     /number=3
     exon            247874..249822
                     /number=4
     exon            249884..249999
                     /number=5
     exon            250046..250304
                     /number=6
     CDS             250822..252063
                     /codon_start=1
                     /locus_tag="AO090038000101"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000036"
                     /protein_id="BAE63944.1"
                     /transl_table=1
                     /translation="MAKIPALLRLCAPHTGSSSSKVSVTIHIAGAGDKQPKVFTTSDK
                     IEGVVTITVVEKTSFDDIKITLEGISKVMTWGGINGPPLVGARQTFMKLHYPIEKSTY
                     QLPSILEPGWCYKFSFTFVVPENLTLTPCEGKTDDAGIKNAHTRLPPSMSKETDTECF
                     SIKYIVRVVILGPIYGKDKPTKRLVHAVRPVKILPSGSMGCPGDLSIKMLSSHKDIRI
                     RHGWRGKCAGRLAVLASPTGPIRPPFCRTDAADHAKTSIKVDLRYSPVGTEPPPRLRK
                     VYSKLNLVTSFHTTPREQHPCFKENKSSNLPSGNHVQSLMLPKFDIASAQWAKVQSPS
                     TSVSSPWQDYQANFNNEEATYTASIVVPISVPMHDDLVPSFHSRFISRMYTLELILSY
                     CTANGPRRSAVKIEVPIEATS"
     exon            250822..252063
                     /number=1
     CDS             join(255161..255275,255457..255833,255883..256083,
                     256134..256427)
                     /codon_start=1
                     /locus_tag="AO090038000103"
                     /note="zinc-binding oxidoreductase"
                     /old_locus_tag="AO070307000034"
                     /protein_id="BAE63945.1"
                     /transl_table=1
                     /translation="MATSTQQQWVLEGSNGFDSLVLQEAPVPKVGDKDVLVRLKDSVV
                     PLGDGAGVVQAIGPQVTRFQVGDRVLPIFHQGHLAGSLDAKSIKTGLGSSLDGTLRPY
                     GAFDEERLVKLPENLSFIEGATLPCAALTAWSALYGLQGKAVAQGDIVLTQGTGGVSL
                     FALQFAKASGAKVIATTSSKEKAELLKQLGADEVINYKEFPEWGEVVRGLTPNNEGVT
                     HIVEVAGPATMKESLKAIKIDGVISMVGFVAGSPAVDQPSLMDTVFHVCTVRGIAVGS
                     RIQFEEMNRAIEANDIHPVVDNRIFKFGEVREAYQYLSDQKHVGKVCIEIQT"
     exon            255161..255275
                     /number=1
     exon            255457..255833
                     /number=2
     exon            255883..256083
                     /number=3
     exon            256134..256427
                     /number=4
     CDS             join(257456..257754,257809..258007)
                     /codon_start=1
                     /locus_tag="AO090038000104"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000033"
                     /protein_id="BAE63946.1"
                     /transl_table=1
                     /translation="MSSGSTNNMLRVSIESQKFPGSYLRMDGRGVTEYSGSGGGAVNV
                     QNHVASYETLIIVNHPDDNTFSIMSSAFPNVYLRMDGSDIKSGDTYAQGAGKVNCQWG
                     SHSWEKFRFENQEDGTKAIASVHFPNAYLRLENVTGQGGPSGAGTVNCQSYIGSYEKF
                     KIHVV"
     exon            257456..257754
                     /number=1
     exon            257809..258007
                     /number=2
     CDS             complement(join(258411..258419,258521..258611,
                     258649..259202))
                     /codon_start=1
                     /locus_tag="AO090038000105"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000032"
                     /protein_id="BAE63947.1"
                     /transl_table=1
                     /translation="MSVGRKSSVSLSLNSLSTPTPSSNPGPVGLSFVNSDIDLLPEDL
                     EHGLWQYQEGLESHTLLHSPSMQSYVSLDDLSMNPYTITGREIDFESNVSADVDLGSS
                     QSALGSDIYPEFQAQDIASENLSWYRQGNIVSHDFGTYQNDPHLNDHLNGRFIRLDSA
                     MQELLRVENHIVDRRMGRRFNPNSTTKKSRPNLRCTWKGCKYKNPFNRSAELERHKT"
     exon            complement(258411..258419)
                     /number=1
     exon            complement(258521..258611)
                     /number=2
     exon            complement(258649..259202)
                     /number=3
     CDS             complement(join(261726..261731,261803..261893,
                     261953..262383))
                     /codon_start=1
                     /locus_tag="AO090038000106"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000031"
                     /protein_id="BAE63948.1"
                     /transl_table=1
                     /translation="MSDASVSTSSSSFYDVSSNGLGHNHTISSPMHNDLGFPVHDVNM
                     EPLPPDSAVIPGSPFYYPPWQLGVPLHDGSIVFRPIVCYDQEMRPNLHMPTGFQSDQI
                     ATAGYSNGHLPSNTPLTLPTLPVEPQSMRVQQETRANNNRESRRNQQLAQRCRWEGCT
                     STRCFNRQADLLRHG"
     exon            complement(261726..261731)
                     /number=1
     exon            complement(261803..261893)
                     /number=2
     exon            complement(261953..262383)
                     /number=3
     CDS             complement(join(263057..263213,263419..263584,
                     263654..263860,263919..264419,264471..264545,
                     264600..265036,265107..265223,265272..265342))
                     /codon_start=1
                     /locus_tag="AO090038000107"
                     /note="predicted flavoprotein involved in K+ transport"
                     /old_locus_tag="AO070307000030"
                     /protein_id="BAE63949.1"
                     /transl_table=1
                     /translation="MDCQDVIPSAFVPRRLKVVVIGAGISGIQFAHDITTRMSDIDLE
                     IYEKNPKVGGTWYENRYPGCACDVPAHGYQYSWAPNPCWSKTYAPAHEIHAYLESVVD
                     KHDLRKFFRFNQRCVSAVWSEERAQWTTTFRDERSDEEAVVRSDVLIYAVGRLNDYQT
                     PSFEGRDKFKGQVFHTARWPEDVDVRGKRIAVLGNGASGIQCVAGIRDEAGEVLNFAA
                     HPTWLGPEPFIENREYDEQEKLKFRRNPQAYHDFRMDIEKVMLPAFAFLWKDTSPSKS
                     LRSRAESYVESKVEDPELQQKLTPDYTPGCRRWTPGEQYLTAVQQPHVHLIEDHVAAL
                     TENGIRTDKGDEYECDMVVCATGFSLYNPRVPVVGRNGITLSDCWGSDGPCESYLAAM
                     VAHFPNFYAFHPPNCPINGSAFPGIERTADYMIRVIHRLQTDCLRSVSVRPEAQRDFN
                     KWVQSQMSSMVWSDSCNSWYGKIIIPWPGTTTHYYAATEIIRWEDFDLMFEDPAQRYM
                     SFGNGVTKDGFKPESIPGLDYNGDALIDYSSMKTRCICSIKKKKKHIIRPHSLPGRRT
                     PFQSFIFKIV"
     exon            complement(263057..263213)
                     /number=1
     exon            complement(263419..263584)
                     /number=2
     exon            complement(263654..263860)
                     /number=3
     exon            complement(263919..264419)
                     /number=4
     exon            complement(264471..264545)
                     /number=5
     exon            complement(264600..265036)
                     /number=6
     exon            complement(265107..265223)
                     /number=7
     exon            complement(265272..265342)
                     /number=8
     CDS             join(266575..267104,267171..267636,267691..267792)
                     /codon_start=1
                     /locus_tag="AO090038000108"
                     /note="alcohol dehydrogenase, class V"
                     /old_locus_tag="AO070307000029"
                     /protein_id="BAE63950.1"
                     /transl_table=1
                     /translation="MTIPDIPTRQRAAVRRGTGESATTTIENIDVPQPGPGQILVKIN
                     WTGLCGSDKSLLHDDWKDFGVNMLPQSQGIAGHEGAGVVVAVGEGMQKRWKVGDRAGI
                     KWIASTCGECEFCLNGVDEVHCEKQINSGFSAPGTFQEYCLVDGRYTSKIPDGVSDEE
                     AGPIMCGGVTAYTACKRSAVKSGQWLVLPGAGGGLGHLAIQYARAMGMRVLAIDGGDE
                     KRDLCEKLGAEAYIDFQKFKAPADLKDEVMRITKHGAHGVVVTAASKTVYEWAPMYLR
                     PGGTMVVVGLPNDPSILAGAPPLVLALRRLNIVGNITGSLRDVEEALDFTARGIVHPI
                     LSKGKLEDLDSWIEKLKAGQVAGRAVLQVAA"
     exon            266575..267104
                     /number=1
     exon            267171..267636
                     /number=2
     exon            267691..267792
                     /number=3
     CDS             join(268224..268291,268351..268468,268763..268858,
                     268921..269227,269393..269460,269572..269644,
                     269691..269809,269864..270817)
                     /codon_start=1
                     /locus_tag="AO090038000109"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070307000028"
                     /protein_id="BAE63951.1"
                     /transl_table=1
                     /translation="MKPTQESATPVVQGRLIGHFHDRPLEEHGSGWSSLWDSNESDLW
                     DRGKPSPALIDLIEQEKDASFVEGDFFKPGWERQISANGDIKFDLVYDYTFLCALHPQ
                     MRPQWAARMSEVVAPDGVLVCLEFPMYKDPTQPGPPWGLNGVHWDLLARGGDGIKNIG
                     EEAEVEEVDQLPGRFRRLQYHKPARSYDAGRGADMLNESEAKMIYGWLWPVFPSGNPR
                     DYSVAARVIVNMPRGLHNPLPASLRIDIAAGECKKATQILESFLTAPYFGNPGKELPG
                     KVLVNAKGLAICTVAKAGFLGSARFGSGLVIARLDDGSWSAPSAISLTGAGFGGQVGF
                     ELTDFVFILDDAGLRSFLRMGSLTLGANISIAFGPVGRNAEFTSNATMEGISTMYAYS
                     KTKGLFGGISIEGGLMVERRHANKKLYKSKVSASQLLGGEIPPPLDATPLLQLLQSSS
                     FQQRGAIPHSQPTTREPTTRGLNPVPQGPELPTGPENQSPAELSPEEVQPTARHFPAE
                     LHWESSLSLPSELPAETIINIPDEPTATPVSAEERPQTRTPASTGVESKPHGTSTPET
                     APLEIRSEPTTDTPAELKRPIVVEPEVCAPSQTV"
     exon            268224..268291
                     /number=1
     exon            268351..268468
                     /number=2
     exon            268763..268858
                     /number=3
     exon            268921..269227
                     /number=4
     exon            269393..269460
                     /number=5
     exon            269572..269644
                     /number=6
     exon            269691..269809
                     /number=7
     exon            269864..270817
                     /number=8
     CDS             complement(join(271926..272003,272068..272245,
                     272345..272367,272432..272578))
                     /codon_start=1
                     /locus_tag="AO090038000110"
                     /note="40S ribosomal protein S17"
                     /old_locus_tag="AO070307000027"
                     /protein_id="BAE63952.1"
                     /transl_table=1
                     /translation="MGRVRTKTVKRSAKVIIERYYPKLTLDFEVNKKLCDEVAIIASK
                     RLRNKIAGYTTHLMKRIQRGPVRGISFKLQEEERERKDQYVPEVSALDFSQHSETGKL
                     DVDQDTKDLLKSIGFDSIPTNVIQVSQQQVSDRPRRFVR"
     exon            complement(271926..272003)
                     /number=1
     exon            complement(272068..272245)
                     /number=2
     exon            complement(272345..272367)
                     /number=3
     exon            complement(272432..272578)
                     /number=4
     CDS             complement(274857..275486)
                     /codon_start=1
                     /locus_tag="AO090038000111"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000026"
                     /protein_id="BAE63953.1"
                     /transl_table=1
                     /translation="MRFFQTLVALPLIAGAVASPLDARATLENCTPEGKQTIDNALSQ
                     AAKMAQAGANLIRSNSDYSANLFQSFFKTNDAQSRNRVAGVLDKIATEATNGNQGVVT
                     YYCTPEGIDCVDTHAFTMTAYGETDGTYGRIRTCPAYFTKFPAWSDSCSVLDQATSSL
                     HEMAHTKGIFGPETYGYDAVHGLSSSAALENAESYAFFSKCKVFQGFHE"
     exon            complement(274857..275486)
                     /number=1
     CDS             complement(join(277523..277748,277809..277972,
                     278028..278527,278600..278636))
                     /codon_start=1
                     /locus_tag="AO090038000112"
                     /note="protein kinase PCTAIRE and related kinases"
                     /old_locus_tag="AO070307000025"
                     /protein_id="BAE63954.1"
                     /transl_table=1
                     /translation="MEKYQKIEKIGEGTYGVVYKARELAHPNRIVALKKVRLETDDEG
                     VPSTTIREISLLKEMNHPNIVRLFNIHTEGYKLYLVFEHLDSDLKKYMDALPVNDGGR
                     GRSLPNGLSMDMGLGEAMIKKFMSQLIEGIYFCHSRRVLHRDLKPQNLLINRDGSLKL
                     ADFGLARAFGVPLRTYTHEVVTLWYRSPEILLGGPQYSTSVDMWSCGAIFAEMCTRKP
                     LFPGDSEIDQIFKIFRLLGTPDEDSWPGVTSFPDYKPSFPKWKRDSDEHLIPGLERHG
                     LRLLDALLEFDPARRMSAKQARSHPYFRHRSS"
     exon            complement(277523..277748)
                     /number=1
     exon            complement(277809..277972)
                     /number=2
     exon            complement(278028..278527)
                     /number=3
     exon            complement(278600..278636)
                     /number=4
     CDS             complement(join(279831..279839,279905..279955,
                     280010..280108,280186..280332))
                     /codon_start=1
                     /locus_tag="AO090038000113"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000024"
                     /protein_id="BAE63955.1"
                     /transl_table=1
                     /translation="MSPNKSYKTGEAFNTALGAGLRSTWAGADAIHGAVNAGVKIQGA
                     VAEHKWTKARVNEQLQRAQHPDGKPRVDHSAQYQAANPTLSNLGNDKNLYNRVNGQR"
     exon            complement(279831..279839)
                     /number=1
     exon            complement(279905..279955)
                     /number=2
     exon            complement(280010..280108)
                     /number=3
     exon            complement(280186..280332)
                     /number=4
     CDS             complement(281683..282732)
                     /codon_start=1
                     /locus_tag="AO090038000115"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000022"
                     /protein_id="BAE63956.1"
                     /transl_table=1
                     /translation="MNNTALYANENGELCGRRDLPIPQPIEGEILIQVLFTGVNRSDI
                     TSVKLLGSRNRVLGNDFCGRVLDVSGLADTAFEPGDIVAGYTIANHDRPLRYGSHQSY
                     ISIPPKNIFKVPENVPPANAAGLMTVVQTANDALLNLHLPLPSMTQGPTDGVFVIAGG
                     ATTVGISTIQLARSIGIKSIIVTASPGRHELLESLGATRCFDYRKDSVVQDIKAAVEE
                     TGLGPVFGLDAAATPDAAKILLDALADRDDTHLASLSPWAGDRFEFVLGGRDYDVIFH
                     PPGAPEPFVSLARPADAAKMWDSLMWVLQHYGKEFKLPVIEVFEGPAEEALEELEKVA
                     DQGKFGKLVLKHPLI"
     exon            complement(281683..282732)
                     /number=1
     CDS             complement(join(289912..290014,290077..290155,
                     290220..290361))
                     /codon_start=1
                     /locus_tag="AO090038000117"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000020"
                     /protein_id="BAE63957.1"
                     /transl_table=1
                     /translation="MRFTTVFAMLAAAMGVVAEEAINIKICNGINEAGDCITANVYIQ
                     HQCYNLNGTPVSNNVRSFTIPSGYRCRFWSSTACNGGGTGDVQSPGSNQNGHPQVNSV
                     KCYAN"
     exon            complement(289912..290014)
                     /number=1
     exon            complement(290077..290155)
                     /number=2
     exon            complement(290220..290361)
                     /number=3
     CDS             294262..296382
                     /codon_start=1
                     /locus_tag="AO090038000118"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000019"
                     /protein_id="BAE63958.1"
                     /transl_table=1
                     /translation="MLSLAFLVYATGTLAAASVQYIQSQDFRIGVDPDTGAVLSIVNP
                     SDNASMSWISGPDNAPWQPLGSRWGLGYADLGDLNRAFWNKPDLTLGDDHMTASYAMD
                     KLNVSVTRWIDTSSKSFQECYSFLNTGDDALNLSDVGSESLGIYLPFNDHYTSTEDVL
                     EHRAHAHIWASGESSSWVKLTRMGLRGPHLGLVLTEGALSGYSVESRNTVTLSNTRGF
                     FLIHPKVPSLQSKETSQICWTMFWHDDWQDFFEQSLKRSDHFIHIEASPWTAVEGDTV
                     NLTVFGRPGDSISFNGVDLPLHRETGLYSTSVQADKAGERQLTFTLRKGDRENNATVV
                     LNTVQDIDQIIANRVKFITTKQQLNASFPDRSKAGAYAVYDNQMEGIASFETASDRNT
                     GRERVGMGVLVARWLLNHSDVDVEKSLRIYYNYVNNKLQDPSGYVYDWPIGSKTASLR
                     LYDWPWVMQLHLAMAKLGNEAVTSHGNYTATPVERLMSTMERFYTEGGETHYSIGLPI
                     FESLTFLKAYGYRDAYQRALQLFTAHGKQIAKIGQNYPSSEVNYEQSIVAPAAIILLE
                     LYRSTGAKSWLEAAHAHFDRLEAFGGRQPDYHLHDIAIRHWDGYWFGKDRMWGDTFPH
                     YWSTLTGIAMHHYANATENKTYKTRAEGILRANLALFTEEGRGHCAFIYPTTVDGRKG
                     HYLDPYANDQEWALAHILQVRENH"
     exon            294262..296382
                     /number=1
     CDS             complement(298055..299104)
                     /codon_start=1
                     /locus_tag="AO090038000119"
                     /note="predicted hydrolases or acyltransferases
                     (alpha/beta hydrolase superfamily)"
                     /old_locus_tag="AO070307000018"
                     /protein_id="BAE63959.1"
                     /transl_table=1
                     /translation="MLLHLLFGLSVAVGLSAAERGLPFDFPFSQTPTRFNIRVDSELV
                     DFAKSRAASYRPSYGISDEWTKEGPPAASMAELSTFWAEHYNWSEVEDRMNKRDHFSV
                     VIPGAAGYTGDIPIHFVHHRSMNDSAIPLLLLHGWSSTHLEWDKIIDPLAQLFHLVTP
                     DLPGYGFSPAPTESGMDARTMGAAYDVLMKELGYGTYGVVGTDVGYFVSSWMMSDVPD
                     SIIGHFLDFMLVPPTQDDIDRYSGNQTTPEENAYLGSFTAFESDHSVYSAVQAQKPLA
                     LSLSMGDSPVGFAGWLWDLKYAGSDGYQYTMEELITEAFTLWIQAPYGAMRSYLETLI
                     VSLGHTTSGSKSWNK"
     exon            complement(298055..299104)
                     /number=1
     CDS             complement(join(299902..300062,300183..300483))
                     /codon_start=1
                     /locus_tag="AO090038000120"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000017"
                     /protein_id="BAE63960.1"
                     /transl_table=1
                     /translation="MPAERRWDQREYRIVESASHNNNARTVIIETTTAGTSVPPHYHS
                     RFSETFELINGSVSVHTGPADTSELAFKSTLTPLEPGKPMTVPLGWYHQFIVGNEIMV
                     LMDLTDAHPLWKVGEMLINVRKERSEAIEQMKEDLLKKYDTPEALARLMAD"
     exon            complement(299902..300062)
                     /number=1
     exon            complement(300183..300483)
                     /number=2
     CDS             join(301504..301546,301614..302148,302232..302334,
                     302415..302486)
                     /codon_start=1
                     /locus_tag="AO090038000121"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000016"
                     /protein_id="BAE63961.1"
                     /transl_table=1
                     /translation="MASTTNVLISGASRGLGKAFVEQYLARPNHTVIGTVRDVKSAAA
                     EELRALPAAEGSKVVLVKVEYTSTTDAVDAVKELEAQGITKLDIVIANAGIAGQQGRI
                     ETIDPKGLAEVYLVNAVGPAVLFLALKPLLDRAQTPKWLAISSGLASLHDLHKYPMFP
                     GFPYNGSKAALNHFTKTIHVESPKIIAFAVAPGFFETDMGRKTAAFFNFENPPFSDIN
                     TNIKSIVGLVDNATRENYSGQFLNFDGQLIEW"
     exon            301504..301546
                     /number=1
     exon            301614..302148
                     /number=2
     exon            302232..302334
                     /number=3
     exon            302415..302486
                     /number=4
     CDS             complement(join(304071..305112,305170..305732))
                     /codon_start=1
                     /locus_tag="AO090038000122"
                     /note="acetylcholinesterase/Butyrylcholinesterase"
                     /old_locus_tag="AO070307000015"
                     /protein_id="BAE63962.1"
                     /transl_table=1
                     /translation="MILSLYFGLATITASLASPVSQPLPTAIIDSGVIVGTTTCLPSS
                     TAVVRQYLGVPFGAPPVRFSPPEPVARWSTFYNATQWGTACIQQIGHSGKELFGMLDL
                     PPPANGEGEDCLNLNVFTPEAASAGSKAVLVWFYGGSYMNGATSVNLYDGTSFAANQD
                     VVVVTVNYRTNFFGFPGGDVPATERNLGFLDQRLALDWVQRNIAGLGGDPSKVTIFGE
                     SAGGGSVDALITAPPDPVPFRAAIMQSGQSSISMPLNGGAEKYAESWKKLAEFAECPS
                     DNTLECLRKAPALELKQFAENASLSFGPVPDGGVALSATPRLDRLYSSEGNSSIARVP
                     ILIGNNADEPKPYIRGVNDTKAYLETLGLGEYVDMILEVYPLGQPGAHNENDRLSLIA
                     TDLLMHCPSKVLADDSSKIGIPSYRYFFNASFPNNEAFPGSGAFHAAEIEFVFGTYPK
                     ENATQFEHEVSQAMQKAWADFAKDPSQGPGWGEGPMIGVFGDGVKAGMSDEGKKALAA
                     VDSAIMDRRCELYKPLYDQLVLSSSS"
     exon            complement(304071..305112)
                     /number=1
     exon            complement(305170..305732)
                     /number=2
     CDS             307151..308062
                     /codon_start=1
                     /locus_tag="AO090038000123"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000014"
                     /protein_id="BAE63963.1"
                     /transl_table=1
                     /translation="MPDEDDSALRHLLQTRGMEDVQSVLKRSESDNKKVPDRKGNQNQ
                     TPDSEGEHPFIQDLNPDLIDPNLFLMSFPEAIKDIPQGPTQPEVAPTLPAASDDSLFQ
                     DCSDDTFVEINTESPTGAQCRVNDSPSRTKGSSNENGARESIAHPRPDTTRLPLSIQQ
                     LLSNEPRCQHDTSTKDDNPSDSEGVEELVTQLSDRMGSLQIGSDGHVRYYGPTSHFNL
                     LRMPTPDNLTIHRTVRQDGPDVLDRLGVNKEIPAGFEEHLINLYFTWHNPLFQVVDRE
                     MYEPARQQWRTKMEETPYYSEALTNAM"
     exon            307151..308062
                     /number=1
     CDS             join(308384..308514,308572..308799,308855..309014)
                     /codon_start=1
                     /locus_tag="AO090038000124"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000013"
                     /protein_id="BAE63964.1"
                     /transl_table=1
                     /translation="MAMRLAFDLGLHIDTAHYVTEGSINAAEAELRRSVFWGTYTVDH
                     LWGFFLGRPVRINMEDVTVDKPGRHQTREQDRKWVPYGLPSPPLACLAAPVPDPVDLL
                     SQHRIQLCEIMTPLGHVLYGCSRVSKRILQGLNENTTDQLLKWKTNLPEVLQIDLDNT
                     DAPVLPHILLLQ"
     exon            308384..308514
                     /number=1
     exon            308572..308799
                     /number=2
     exon            308855..309014
                     /number=3
     CDS             309064..309702
                     /codon_start=1
                     /locus_tag="AO090038000125"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000012"
                     /protein_id="BAE63965.1"
                     /transl_table=1
                     /translation="MQYHQTIIHAHRPWISKRYIQPQPPQGPGHVHARKMCIESAIAI
                     AQLLHLYETQYTFRRMNVQAVSITCSAALMLIFATIASLKREGDQEISAYLSICFRAL
                     EEFGVSWESAKRAQNFLISLQRRWESRVRSYTSAKRAVSQSQSRSQSCFPTSKKPRIS
                     SEPDPGSSESGVLVGEEDVRAFDPVGSGFPIDPDMMVELDWLCTETMRDMSP"
     exon            309064..309702
                     /number=1
     CDS             complement(310155..310829)
                     /codon_start=1
                     /locus_tag="AO090038000126"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000011"
                     /protein_id="BAE63966.1"
                     /transl_table=1
                     /translation="MRFLAFNFRRMPFYHQVVDRLRADPSATFLDAGCCFGQEIRYLV
                     DQGIPGKQLYGCDLEQIFIDLGYKLFRDKDRLEATFVTGDLTADDPAFAGSPLSQTLS
                     GNIDIIFASSLLHLWDYDTQVRAAIRLVQLCRDKPGVMITGRQLGSRLGGHYPIHGVE
                     DNALHYRHNVESLKGFWRDVEIATQTRWKLEATFFVDDAVEQTRKVVPDYDSNATMIC
                     WCVTRE"
     exon            complement(310155..310829)
                     /number=1
     CDS             complement(311569..312318)
                     /codon_start=1
                     /locus_tag="AO090038000128"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000009"
                     /protein_id="BAE63967.1"
                     /transl_table=1
                     /translation="MSTTVTHTTTLTIEIWKNRDPSTTSTLSFKLPEIDQSLRREYIQ
                     LGNVFKGIDDLDNLIFNPQAWTSQEGLGIEPMSLQLHNYSNTWEKGAWNHDTFIGLVE
                     WGVARIKWCYDIETLKITSFVPSPTFLAQLNEQPCVVNAIKRSLSRCVYVITGVAEAS
                     GTNVSVCRFKRCGIIIRSRPFSLFVGQGITQSMSRPLGGPRPIPVGYSLHRLTLGKGK
                     LMAEPVTASSFPKKLLSFDIDFPLSISDQSS"
     exon            complement(311569..312318)
                     /number=1
     CDS             complement(join(312875..313323,313380..313628,
                     313694..313862))
                     /codon_start=1
                     /locus_tag="AO090038000129"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000008"
                     /protein_id="BAE63968.1"
                     /transl_table=1
                     /translation="MTTLQPREGFKLFYYDPSLAAAVIFIICFLATTILHTYQLFRTR
                     TWFFIPFLLGGYFEWIGYVARAVACNQTPNWTLGPYIVQAVLTLVAPALFAASIYMEL
                     GRMIVVLGAEKHSMIRIKWMTKIFVAGDVLSFLMQSAGAGMMGVKSKISENGPHIIVG
                     GLVVQIIFFGFFMISSAVFHMRMNRDPVADGGAGFNWRRLLYALYGASALILIRSIFR
                     LIEYAQGNGGYLVAHEWFMYIFDALLMFGTMLIFHVEHPSELNAWLRGSGVVCRGIIR
                     FERIGGSGMMMS"
     exon            complement(312875..313323)
                     /number=1
     exon            complement(313380..313628)
                     /number=2
     exon            complement(313694..313862)
                     /number=3
     CDS             complement(316555..317232)
                     /codon_start=1
                     /locus_tag="AO090038000130"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000007"
                     /protein_id="BAE63969.1"
                     /transl_table=1
                     /translation="MNLNKAMNLFELFERLGREEDFEEAIQHAKSALLETASSKSLYV
                     GKLNLLGVSLKARWFFNRAPGGLEEAIGLFTKAVEVTPNNDPNLISYLSNLGSSLEGR
                     YDLFRHKGDLEDAIWLSRKAIRATPASHPKLGSRLSNLGSQLQRRYKRTDNINDLEET
                     IRVLHQAVDATPANGSNLSTYLENLIDNLESRYYRREVISDLECAIRLSRKAVNVLPV
                     DHPDFAG"
     exon            complement(316555..317232)
                     /number=1
     CDS             join(318051..318427,318478..318659,318713..318896,
                     318948..319007,319057..319513)
                     /codon_start=1
                     /locus_tag="AO090038000131"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000006"
                     /protein_id="BAE63970.1"
                     /transl_table=1
                     /translation="MKEVLACLYVPTIFSCPGCRKLRNSAKMRYHIVYALTAAASLSA
                     AADIYVSPSGSDTAAGTIDAPLLSIQSAVDKATAGSTIYLREGTYSPTTNIQITKSGT
                     ASAPYVLRAYDGEKVTIDGEELPGTPAELDASLANEDRGILHIQDAEYWEFYDLELIN
                     GPYGVYARDSSNNHYERIITRENYETGFQLEGASSNNSVYYLDSYLNRDPRKNGESAD
                     GFACKEGSGEGNVLRGARLWNNVDDGLDLWEFKSAVTIEDTISYGNGYNRWGFSPFEG
                     DGNGYKLGGGDDADIGPANHVITNCIAFGNSKDGFTDNSQPGDFTLTRNTAWNNAKVG
                     FKFGTAVATLSKNIAAENGESPTSLSEEQISTGNSWDGSESWGNSSFVSVDATLVQGA
                     RNADGTIDPSDFLLPKSGEEIGATTAW"
     exon            318051..318427
                     /number=1
     exon            318478..318659
                     /number=2
     exon            318713..318896
                     /number=3
     exon            318948..319007
                     /number=4
     exon            319057..319513
                     /number=5
     CDS             join(320190..320265,320360..320561,320664..321101,
                     321171..321263,321312..321912)
                     /codon_start=1
                     /locus_tag="AO090038000132"
                     /note="coenzyme F420-dependent N5,N10-methylene
                     tetrahydromethanopterin reductase and related
                     flavin-dependent oxidoreductases"
                     /old_locus_tag="AO070307000005"
                     /protein_id="BAE63971.1"
                     /transl_table=1
                     /translation="MTKTSEKKSWILNAFAMFSPGHLSPGLWKNPQDRAGDFLDLSYW
                     IELAKVLEKGKFHGLFLADHPGIYDVYKGPGNKEPALLSGAQFPIGDPFLLISAMASV
                     TTSLSFGITASTTYETSPYALARKFSTLDHLTQGRVGWNIVTSFLDSAAKAYGMDEQI
                     PHDERYARADEYMELTYKLWEGTWRDGAVVKDPKTGVYSNPNQVRAIEHNGKYFKSTA
                     ASQLPASKQRTPLLFQAGASSAGKRFAAKHSEVMFLPGLEPEKTKAVVDDMRKHLAEI
                     GRPTDSIKFIAGILVIVDETDEKAQAKYEEYLAQSDLEGVATLFGGWTNNDLSKFDDD
                     EDFSFTAVGGIQSLISSWSKTVPNSNGLKWTKRRVLQELALGGAHPRAIGSPSTVADI
                     LQRWVDVADVDGFNFSYAVSPGTFEDMIEYLFPELRRRGVIWDDYEVNGGSARENYFQ
                     DGLGSRLREGHPGREYTWN"
     exon            320190..320265
                     /number=1
     exon            320360..320561
                     /number=2
     exon            320664..321101
                     /number=3
     exon            321171..321263
                     /number=4
     exon            321312..321912
                     /number=5
     CDS             complement(join(322476..322880,322970..323080))
                     /codon_start=1
                     /locus_tag="AO090038000133"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000004"
                     /protein_id="BAE63972.1"
                     /transl_table=1
                     /translation="MQLTKAILALALVVSPILAAPTEVGEGSVNTNVEARAVDTVSCT
                     PDQNQSGVKFEVDVKAAKALAQKIGWTTDSTKSDYPHPFGDKEKLWAHIPLEANKCNS
                     KTRMLEYPVYWTKSKVKEWDPSKKKKEQQKTPIRIVYSNLNGALHYCGTMIHKTVAKD
                     FGGSGDFKLCQ"
     exon            complement(322476..322880)
                     /number=1
     exon            complement(322970..323080)
                     /number=2
     CDS             323921..324451
                     /codon_start=1
                     /locus_tag="AO090038000134"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000003"
                     /protein_id="BAE63973.1"
                     /transl_table=1
                     /translation="MALDSKSFQPLDIKLSGPHDDEEDIFFKDLLLSLVGGEITPNEA
                     ANNLDKWIVEKSNTDLEERKKYPDPWNVPSPENPSWVAPNPSGLITCFFESFARLCSA
                     FPPGHVGQDRLIRFLEALRDMPKHEVPNYLPNDPPEDFYYLLELWPFGGSWLGLTEVF
                     RTEAEGTFFPFTGSFH"
     exon            323921..324451
                     /number=1
     CDS             complement(326422..327243)
                     /codon_start=1
                     /locus_tag="AO090038000135"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000002"
                     /protein_id="BAE63974.1"
                     /transl_table=1
                     /translation="MSREALTFPPSNRTFLEPHLPPNNEPELPKSNLPFTTLTFATSL
                     DSSLALAPGTRTTLSGPQSKAMTHYLRSRHDAILIGVGTAVADNPGLNCRIEGVGGYG
                     GEGLLGQPRPIVIDPRARWDFTEQSKILELVKEGKGRAPFIITSTGTEPAAEKKALLE
                     SYGGKFIPLDLFLEEHGERRLDWTAVLECLRNEGLRSVMIEGGGTVINSLLEPGWAHL
                     VNSVIVTIAPTWLGQGGVVVSPRRRVEGDAVVPAARLRDVKWYPFGEDVVLCGRV"
     exon            complement(326422..327243)
                     /number=1
     CDS             complement(join(327965..328114,328167..328337))
                     /codon_start=1
                     /locus_tag="AO090038000136"
                     /note="predicted protein"
                     /old_locus_tag="AO070307000001"
                     /protein_id="BAE63975.1"
                     /transl_table=1
                     /translation="MGVVLETLHPRPKAFVVGIAIDPSYCGEMEKVWNSYVENVLRPE
                     SENGQWENNAFVALPRTHFVDPKQVTRPPANLGWETEMFRQLDSVFRPEEVDKGNHKV
                     VPEN"
     exon            complement(327965..328114)
                     /number=1
     exon            complement(328167..328337)
                     /number=2
     CDS             332848..336615
                     /codon_start=1
                     /locus_tag="AO090038000137"
                     /note="reverse transcriptase"
                     /old_locus_tag="AO080603000001"
                     /protein_id="BAE63976.1"
                     /transl_table=1
                     /translation="MNKTLRVIQLNVRKQGAVHESLMNDEETQNTVALAIQEPQARRI
                     QGRLLTTPMGHHKWTKMVPSTWREGRWAVRSMLWINKEVEAEQVPIESPDLTAAVIRL
                     PERLIFMASVYVEGGNASALDDACNHLLDAITKVRRDTGVVVEILIMGDFNRHDQLWG
                     GDDVSLGRQGEADPIIDLMNECALSSLLRRGTKTWHGGGHSGDCESTIDLVLASENLA
                     DSVIKCAILGTEHGSDHCAIETVFDAPWSLPKHQGRLLLKNAPWKEINTRIANTLAAT
                     PSEGTVQQKTDRLMSAVSEAVHALTPKSKPSSHAKRWWTADLTQLRQIHTYWRNHARS
                     ERRAGRKVPYLETMAQGAAKQYHDAIRQQKKKHWNQFLADNDNIWKAERYLKSGEDAA
                     FGKIPQLLRADGTTTTDHKEQAEELLAKFFPPLPDNIDDEGTRPQRAPVEMPAITMEE
                     IERQLMAAKSWKAPGEDGMPAIVWKMTWPTVKYRVLDLFQASLEGGTLPRQWRHAKII
                     PLKKPNKENYTIAKSWRPISLLATLGKVLESVVAERISHAVETHGLLPTSHFGARKQR
                     SAEQALVLLQEQIYAAWRGRRVLSLISFDVKGAYNGVCKERLLQRMKARGIPEDLLRW
                     VEAFCSERTATIQINGQLSEVHSLPQAGLPQGSPLSPILFLFFNADLVQRQIDSQGGA
                     IAFVDDFTAWVTGPTAQSNREGIEGIIKEALHWERRSGATFEAEKTAIIHFTPKTSKL
                     DREPFTIKGQAVEPKDHVKILGVLMDTSLKYKEHIARAASKGLEAVMELRRLRGLSPS
                     TARQLFTSTVTPVVDYASNVWMHAFKNKATGPINRVQRVGAQAIVGTFLTVATSVAEA
                     EAHIATAQHRFWRRAVKMWTDLHTLPDTNPLRRNTARIKKFRRFHRSPLYQVADALKN
                     IEMETLETINPFTLAPWEARMQTDGEAMPDPQAIPGGSIQIAISSSARNGFVGFGVAI
                     EKQPPQYRKLKLKTFSVTLGARSEQNPFSAELAAIAHTLNRLVGLKGFRFRLLTSNKA
                     TALTIQNPRQQSGQEFVCQMYKLINRLRRKGNHIKILWVPASEDNKLLGLAKEQARAA
                     THEDAIPQAQVSRMKSTTLNLARSQAATTKALPEDVGRHIKRVDAALPGKHTRQLYDG
                     LSWKEATVLAQLRTGMARLNGYLYRINVAQTDQCACGQARETVEHFLFRCRKWTTQRI
                     ALLQCTRTHRGNLSLCLGGKSPSNDQQWVPNLEAVRASIRFAMTTGRLDAV"
     exon            332848..336615
                     /number=1
     CDS             complement(join(338720..339071,339121..339275,
                     339319..339918))
                     /codon_start=1
                     /locus_tag="AO090038000138"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000001"
                     /protein_id="BAE63977.1"
                     /transl_table=1
                     /translation="MMDLQYFLELVDLKHRHGSNLRVYHSYWKNSTTAQNFFFWLDYG
                     EGKDLDLPQCPRDKLERQQVRYLSREERMNYLVRVDEAGLFRWAKNNERVWTDNRRFK
                     DSLKGVVHIDEDAPQFQGNTEAGDPDSFLTSSSSSVSSLSSSDYDSDSDMCVREAKET
                     YVNEDYKAVKKLKKVVHVSPSTVLSSIRGKSLKKEDMWIFRVQVADTSFRLYIGIKQS
                     GAFQHSSFLRGARISAAGLIKVRNGQLRSLAPLSGHYRPPAANFRAFIHSLQDRGVDM
                     SHVSISKSYAVLAGIEGYTRTKHKVRALHEKVDDVKQKLLQGHHNGEKDQDPARRQND
                     DHFKPRPLVGDKRNKIEKGHLELPLRTKPANEVE"
     exon            complement(338720..339071)
                     /number=1
     exon            complement(339121..339275)
                     /number=2
     exon            complement(339319..339918)
                     /number=3
     CDS             join(342019..342112,342169..343514,343565..343870)
                     /codon_start=1
                     /locus_tag="AO090038000139"
                     /note="thiamine pyrophosphate-requiring enzyme"
                     /old_locus_tag="AO070331000002"
                     /protein_id="BAE63978.1"
                     /transl_table=1
                     /translation="MSSSKSEDYKVGAYIGYRMEELGVSDYFVVPGDTNLTLLDSLLE
                     NPRLRMVECCNELNTGYAADGYARASECKTAVAVIPYIVGGLSILNAISGACSERLKV
                     IVISGCPPTSVLTSSKPTHHTPSPTNKDVALHAFQGVTAASVRVNTAESATDVIDNAI
                     IKCIQQSLPVYIELPNDIAGAPCPFPIPFTRKVEEATQLNRNGEALEAVTDLWNSSHR
                     PVLLLGSQARVSLPRDIVQRLSEKLGCPVLCQPDGRWLSESHPQYWCTFWPGLLNPEG
                     EKLVLDSDLWLAIGVSWSDLHTHSIDPKEENHRLIALQHDGVELPEDKVISPVNLREL
                     VSAMIDSNIIRRSESLPSSKPSHPAGIQTEIKTSDDALTVRSLLSGVQAMLQENSKLV
                     VDTGDTWFAASHVELPDGVDIYMQLPYASIGWSVPATLGAQVAHPHGRVVLMVGDGAF
                     QMTAQEISTMVRMKLNPIIFLFNNLGYKTETAVHEGSYNYIANWDYTKLATSFLDKPH
                     AHPPSPYATDKPGDDEMPVFAEKVRTQADLLRAMERVSAESDKLAFLECCIQPDNMTP
                     ELRALGEKVSKGVSK"
     exon            342019..342112
                     /number=1
     exon            342169..343514
                     /number=2
     exon            343565..343870
                     /number=3
     CDS             join(344475..344758,344824..345486,345742..345781)
                     /codon_start=1
                     /locus_tag="AO090038000140"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000003"
                     /protein_id="BAE63979.1"
                     /transl_table=1
                     /translation="MSDVQESDCEDIHCPPGRDYNTFMQETAGIRQLYEAGVPFFTKE
                     QLQDLSRQLKQAETSDKPEILIKGLEGTEETFEVKTGVTRAGSEPGTEWVLKAPAIEY
                     RTFGFLTSYRAYQMDGFSDLSLRVLHYMELRDEVTKELLPRFRYVVDSVDIITNSFTS
                     CIQAWEASESYAQLQKTVESRENFPLITKIVALALGSMQPRSLDNWDHRSEYQHALAL
                     TLRDIVGKRQGETSGNVQCYVQDPAYTEVDKSILKTYDITILEDPDAFVEIDGSTIVL
                     TFAPDVPVRQIVADIARPAMMIWNTCEEERWVHNGREQFILETRNSSQCMHT"
     exon            344475..344758
                     /number=1
     exon            344824..345486
                     /number=2
     exon            345742..345781
                     /number=3
     CDS             complement(346564..347400)
                     /codon_start=1
                     /locus_tag="AO090038000141"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000004"
                     /protein_id="BAE63980.1"
                     /transl_table=1
                     /translation="MASVVTDFVQEYKSKRWIYARNAATTGRICAEMLQAEFLPGVVT
                     HRTKDPSSLERKLRQRERLRKRLYPSKEDVQDEISDLAGVRIALCFPRDRERVQDALS
                     QRFDIELKKSYGEVNTNSIARDTSSNIHQRPGYCATHCWVYLRESEPQARDGSRRRRV
                     EIQIVSMLRHAWAQFEHDAVYKAQSKMNLEDRQLLHSLSSAIHRGEWLLNCMSENEAV
                     RHTSTDLLFEMVYEVGCLVADVAKQESRARGTTKPLEEFLRNLKMARPKRSSGLISKA
                     RL"
     exon            complement(346564..347400)
                     /number=1
     CDS             complement(join(350218..350422,350485..350654,
                     350720..350742,350811..351724,351773..352119,
                     352167..352277,352460..352627))
                     /codon_start=1
                     /locus_tag="AO090038000144"
                     /note="inorganic phosphate transporter"
                     /old_locus_tag="AO070331000007"
                     /protein_id="BAE63981.1"
                     /transl_table=1
                     /translation="MSASAPYDHGADILFGVPRIQSGHLCYVHNSTFARTLFCDPQVS
                     FQAFTTFIKTIPPAQRRNFIISQLESARRREWLWVVVVAGVGFFADAYCIFSVNMVVP
                     MISEVYWGSLDAKPDRVHNYEVGLSIITLAGALVGQVLFGIAADIWGRRKMYGLELVV
                     LIFSTLGMSMASSGKFDSMSIIGVLLFWRFFMGLGVGADYPLSAIICSELAPTRIRGR
                     MLAAVFLCQSLGEAAAAVVALIAVAGFRHSLPNDPEIRECTGSCVQNLDSIWRLIVGL
                     GAVPAFIAIWFRLTIIESPRYTTDVLQNSLQAAADVSQFYQSAEISSASSLGHESLHP
                     VGETISLSPTQTREYGFMPSVISRQPSSVELENASSPPLHFWRDLRSFLKQKRNLRTL
                     VATSLCWFCLDLPFYGLGLMNVDIINTIWYGNHIPSAGVYESLLRVSYQSIVVVSSGA
                     IVGSCIAVLTIDRIGRRNLQLLGFCLLFILNVIIGASFRYLSTHGDSSALVVLYVLTQ
                     IFFNFGPNTTTYIVPAELFPTRFRATCHGISAASGKLGSILAQCFLGYVDFGNGATWR
                     NVPDWLGYALLCLSFFMLMGLIATLWIPETRDKEGNNKSLERITEDMQAKDVPSVDEE
                     DNGSIHTQATTSLPGPDWRSD"
     exon            complement(350218..350422)
                     /number=1
     exon            complement(350485..350654)
                     /number=2
     exon            complement(350720..350742)
                     /number=3
     exon            complement(350811..351724)
                     /number=4
     exon            complement(351773..352119)
                     /number=5
     exon            complement(352167..352277)
                     /number=6
     exon            complement(352460..352627)
                     /number=7
     CDS             join(353408..353913,353968..354741,354807..355138,
                     355260..355305,355370..355409)
                     /codon_start=1
                     /locus_tag="AO090038000145"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000008"
                     /protein_id="BAE63982.1"
                     /transl_table=1
                     /translation="MAQVGIGDIITGVKFVWTIYESVWDGPSSAAGDFNSFCQEFRSI
                     KLLLERIQRVKESKSTDVPDLGAFYNETIQECAKLVNKHKLLAQDKPSTGNSRRGSIG
                     KKVSVWFEKVTWPLERSEAERLRHKLERCLKVATLKSTEETRDATLGLIRTAENNQLE
                     NLEMLKSIKTMTAQISLLLRRCIIDGPIDTEAYDTHYPSQRGHRLRPAGLKPENILSG
                     IPEDGEMASVDSQGYQKVLDRIREISERLGNLTRRLDTHSNHGQTVDPPRSISRKYML
                     NPDGTGAETPTVDAMVRFLHQVSDDVRDALETVGYGHELVPKYDASHRHQALVKTGQS
                     INDTAEEWEQFRHWLDFQLVHAFNTNSIDMKPLHPSQPLLLDLTPPPECLSPSISITR
                     TRSVESDLSIGSPQSTISIPIPDRKVPLTNHPVQVEFPDPNIPNRALFRTLICTAVAC
                     LNIQTHEPEAIEAVDIYGGVKVTQAVIRGSTTVKSSMLPYIPSSRVPPSSSASCSIWF
                     QGSHKVKIEEQQSVIRYSISPIYKCRDRSGKSPLGRIITPIQRRQNVSPSKVCRYAR"
     exon            353408..353913
                     /number=1
     exon            353968..354741
                     /number=2
     exon            354807..355138
                     /number=3
     exon            355260..355305
                     /number=4
     exon            355370..355409
                     /number=5
     CDS             complement(join(356506..356636,356875..357277))
                     /codon_start=1
                     /locus_tag="AO090038000146"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000009"
                     /protein_id="BAE63983.1"
                     /transl_table=1
                     /translation="MISKSLTAGIEVSRMTDPQHASQLSSILINAFSHDEIFKIECPD
                     ESSINDMKTETESTIEAIVQNTGPGGASVWTAQTESGQIVGYAQWKHAVCLPDQDTEQ
                     YECSGSLLSAPELYGNLSAMKRAVLMKSTPFHLPLTTESGTRESSIEIFCMALEPKTV
                     PPHARHSPNGTRGPMNV"
     exon            complement(356506..356636)
                     /number=1
     exon            complement(356875..357277)
                     /number=2
     CDS             complement(join(358144..359285,359363..359422,
                     359483..359540,359659..359745))
                     /codon_start=1
                     /locus_tag="AO090038000147"
                     /note="vesicular amine transporter"
                     /old_locus_tag="AO070331000010"
                     /protein_id="BAE63984.1"
                     /transl_table=1
                     /translation="MVDQMTRTLLQVRSSKAFLVFAVCFAISTIVPFAPTALHEKAGL
                     PLDDVPRWTSILLTLYGAANTVVSPICGYITDRVQSRQRPFLIGLLKLATATALLCVG
                     KHLSLWIIGRLLQGASAAVVSTVGIAILVDNFDGEAALGQTLGYVAMATIVGTTAGPL
                     LGGVLYEHGGYYAPFGLAFGLLVLDFIFRLMMVDSRVIVEHSNSGHPTTSDEESWTDK
                     SILDKKQTSVESRVPEPLHDNSRSIGSTLILLRSPRMLTALLVYLIISTSMTSFDSVL
                     PIFVHNTFAWAQTAQGLIFICLMVPQVMSPLYGYTIDRWPRLRRYQAALALLGAVPIL
                     VCFRYVTQNTLEHKVLLCALLALIGTCFAILEPPIMVEISSIVEQIQSKHPGIFGKGG
                     ATAFAYGLSNCAFAAGAMVGPFLGGWVRDTYGWATMGWVLALPLGASSLLVLGFFR"
     exon            complement(358144..359285)
                     /number=1
     exon            complement(359363..359422)
                     /number=2
     exon            complement(359483..359540)
                     /number=3
     exon            complement(359659..359745)
                     /number=4
     CDS             complement(360199..361920)
                     /codon_start=1
                     /locus_tag="AO090038000148"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000011"
                     /protein_id="BAE63985.1"
                     /transl_table=1
                     /translation="MRICVLQSSYQGSESMLKGLDTDLPNPGAFTSQHTFENRFIRKD
                     TAKEEIDSCVKEGFDFYLNFLWGTLDDDVAGIQASQYFESLGVPSAGIRSWERSRTKN
                     DFYKEARKRGAPRVPGTDRFPLFVKPANGCASQMIDERSVCHDEGELREALRRINVQL
                     YESRLNRGRSLGVPDFKAYADGFDPVTRSEDIVVQEYIPGKEYVVSVIELGDSAVALN
                     PCIVKTKDLSANEKFLTFDLKFDSETRFELIEKKDNPALYDRLQTTALEAFKTGMFHG
                     SHMGCDVDLRVRPDGEVFAIEVNPQPAAFLVNCNFQDLPIISSFPGGHQAVINVFIAN
                     YMLQNNHSISSKVAATYDGLASDYDNLQSGTRMPQIVRGIVEKFDFQGNIFDLACGTG
                     IFGRLLSECKPGSHRRAHTGSLVGFDISSMMVETCRSTGIYDAVYIDRMQTCLLNNLD
                     YGDVDHIVCLSAIHFLSPEEFTFVLVLCFLMARKSITIGVDEIPDGYNESLQALGHHH
                     MYSTNHVANMELFGEPRGWRLATRHREFAWKSFTTQHEVWTTYYRFEKVGNDDCGTKL
                     LEAKRKV"
     exon            complement(360199..361920)
                     /number=1
     CDS             join(363339..363527,363580..363644,363730..363928,
                     364009..364549,364682..365313,365375..366226)
                     /codon_start=1
                     /locus_tag="AO090038000149"
                     /note="non-ribosomal peptide synthetase modules and
                     related proteins"
                     /old_locus_tag="AO080533000146"
                     /protein_id="BAE63986.1"
                     /transl_table=1
                     /translation="MGMHHAIYGERSLILLLEQVAKVYSGKPIESRPAVTPFIEYLIR
                     LDPASGSRLLAKHLRDALNLFSNKVSDYRLNHAKGSPCNRPIDQCAGPSITTMPFRVK
                     VCPQRCAQDALSDIQHLSADWVAHGHYGFPNLKNLSPEYSAAYQLHNLLRNGYPPVVE
                     CFLDTAAVNFKANFDSGALHCHQVTKILSQFAHILSCILVPPHCALEEIYTMGPEDTT
                     CLKNWNQIRSEPGEDCIHDVIEIHATALPDEPANSSWDGDLTYEQLSSLSSKLAELLV
                     EQSFGPEVVVPIYTERSRWTAVAMLAVLKAGGAFLLLDPAHSNSRIEAIYRTVEAPLI
                     ASVKPCNAAYMVFTSGSTGTPKGVVIEHSLFATNALTRSRSQVLPAKARVLQRASPAF
                     DASIAEILFTLVAGGCVCVPREVDRHTNIVEYVRHFAVNVLYLTPSVARGLKLDQLPY
                     LKALILVGEPMNEVDIATWAGHVDLVNAYGLSECSIETSFLQPVPISTDHRNIGIAPC
                     ASCWTVDPENHNTLLPIVAVCELLVEGPIVGRGYIRGGQPHGIYKTDDLVQYAPQLNG
                     FLLYHGRTDTQVKLRGQRIQLGEVEHCIYRCAGNTLKTAIVELVTVDDKPSALVAFLL
                     TAEDGTTGVPNSGDILRSSTPQFRPLVQDVRRSLENQVSSYMTPARFLPLSYVPKSLT
                     GKTDRKYLRETAGRLPLTPTDEVTGIIVQRAPVSEPERILQEVVGDVLQLNMNAVGLD
                     SNLFHLGGNSLAAIKLISRLRRLGWHNLRRTDFHQHPVLSHLALKLGESAQLQTPPEG
                     ESASSTRVSWEPLESFRAMREFLGHDR"
     exon            363339..363527
                     /number=1
     exon            363580..363644
                     /number=2
     exon            363730..363928
                     /number=3
     exon            364009..364549
                     /number=4
     exon            364682..365313
                     /number=5
     exon            365375..366226
                     /number=6
     CDS             complement(366607..368868)
                     /codon_start=1
                     /locus_tag="AO090038000150"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000015"
                     /protein_id="BAE63987.1"
                     /transl_table=1
                     /translation="MGLAHTVGAMFDQGSDPLEPSEGREWDNALTVAAKNGHLDIVEF
                     LLGKDLAINKRSITYLMENIDHKNHGKAKLEAIVNLMWDLGLLFDKSKRPDTVVDNGA
                     IIGIMRNYSSGLQLMSWLLDRRHEACIPITDDVLFFAMFIMSSEEMIRLLFEKCNEDI
                     HIGPSFFARLDKVRDGLPYSYCGLDVALMHRATELAVDDWIVAHCAHHASSKAMDLLL
                     RTRPDIRVIEETLIAAASNPFGADMIRLLFDQREPGTQISERILLAAAVNHKCPEILK
                     FLLDKLDPAALMTQRMILTVAEEIMDSFTFRYLWDLEKTFQVVIEELSPNTVLTEKVR
                     EGLVMKGSAMVRLVLDRQQAGFVVSEKMMEIAAASWEDDSVELLELLMTNGGGEVPIT
                     EAIVCAAAGNKFRGSSVMEYLFQVQGDSLSITENVLVAATECPQALEIILNKCPEVRI
                     TDRVFVAACRNEGAMQMLLSRRQDGLPIEAMKTEIGKYYYGSFGVFMLLVDRHLADVD
                     AWAVETFASRPRSLEVLQSEKPDVLITERALVRAAEDRDSVRLLLKSENNYDPVTEEV
                     MMAAARSKYLSKEILTSILHRVESAPLTANVLKEAMLHQNDDTVELILARGRDLNLKA
                     SWEEIWHDVDIPGRKKGRATVVFGELTDFELTESMLQDYAYDKEQKDDDGADSFDYLI
                     GALCYCKGPIPATEGVGVIVLERCSNRVAEEFLQYRPNLPITDKLFQAVERNPKADKQ
                     GLLSLLARKRGSE"
     exon            complement(366607..368868)
                     /number=1
     CDS             complement(join(368947..369550,369616..369838,
                     369861..370095))
                     /codon_start=1
                     /locus_tag="AO090038000151"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000016"
                     /protein_id="BAE63988.1"
                     /transl_table=1
                     /translation="MTWSVQNLVRSLIRQLSRKPLAQSISKMWESNSGRGRQPGWKEL
                     RDTLDDVLSTTPGETFLVLDALDECPERSGRNEKDLSERHKNKLHILATSRTEQDIRE
                     TLERFPTVDLEAKLAEDVETFVRTEISNGRLLKFRHMQNRILDHLLGTRERRFRWADL
                     QITRLADSTTDKQIKDALQTIPATLVETYREVLDRIEEKDINIAREILLLLCLAPVPL
                     DIQTIADAVSLLSPDLIVKICTTAPVIISEDGAIRLAHFSVKEYLVVSKDVGNDHRFR
                     FTEPKGHHDLAIKTIDHLLSQNEVLTEKVAMSQSFLVYAAKHWDTHVAAAGDVLDIQG
                     KVDRLFTEPTAYFNWLCIA"
     exon            complement(368947..369550)
                     /number=1
     exon            complement(369616..369838)
                     /number=2
     exon            complement(369861..370095)
                     /number=3
     CDS             join(374908..375187,375633..376685,376764..377336,
                     377455..377507)
                     /codon_start=1
                     /locus_tag="AO090038000153"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000018"
                     /protein_id="BAE63989.1"
                     /transl_table=1
                     /translation="MGCFGLRKLVRKKSSLENNNHRVYTVVHRWEAVNPPVHEKEPTK
                     EKALNVVDDAPSEEILARDESLWNRAYQQLDQGLVNRYEDLLAKEREQIKSIRHNIES
                     TQKLPPLGQRHLEINIEALNIQRQLYEKGLSDDECKCRQLFWLASNDVGSSQESYKSG
                     VPDRLVGTGGWLLEQPHLHQWLENDKGLLVVSADSGCGKSVLAKHLIDNVLPESCPSA
                     TICYFFFKDQVQNTQKQALCALLHQLFTSKPALIKLAMKSFSENGDNLVDMLPALWDI
                     LARVLKDPGMGRTVFVLDALDECKESELTDLADKIKSIQKDAEISTRFLLTSRAYGNI
                     MWEFRELNDESPHIHIPGESQSDKFTQEVDIVIKHRVGLLARKKHLNATIQSHLEERL
                     MQMDHRTYLWVQLVFDYLEKHSFRKVKDGIDDISNLSDQLPTSVNDAYVKALKMNIAL
                     HLDLERDELQLESDKDFQVSLRKLCGSLLTVNEKKVVFVHQTAREFLVQENGFSLGSQ
                     RSPIDMKEAHRVLAVSCITYINKFMPRVVQTHPADSTSLDLNRAFSNYSAKNWLHHLE
                     AAGLRDGEGLEPYLARICDPKSDAYASWSALTYLVENLPVNKHDERNALWMAASFSMT
                     SVVRRLFQHEEIDRSSNEISNCFFIRRA"
     exon            374908..375187
                     /number=1
     exon            375633..376685
                     /number=2
     exon            376764..377336
                     /number=3
     exon            377455..377507
                     /number=4
     CDS             join(378861..379075,379194..379282,379371..379387)
                     /codon_start=1
                     /locus_tag="AO090038000154"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000019"
                     /protein_id="BAE63990.1"
                     /transl_table=1
                     /translation="MNPVMKSETSAAVPQSQTEGYGEFSPFLYIYFCHNRIKVAPDRD
                     SSFQHLLGAADIDNEDQHGSQSAIALRMSALGHFGASTHILYWELGSVLGATLVQKEA
                     FTRE"
     exon            378861..379075
                     /number=1
     exon            379194..379282
                     /number=2
     exon            379371..379387
                     /number=3
     CDS             join(381080..381274,381421..381504,381570..382008,
                     382135..382484)
                     /codon_start=1
                     /locus_tag="AO090038000155"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000020"
                     /protein_id="BAE63991.1"
                     /transl_table=1
                     /translation="MAEVRERSLSPERIAYLAQSRIPEIIFCNTALLAIATAGLLVRL
                     FVRIRYLTGINLDDLLCLTSWFNSSVTKYGFGKHIGTVQDFGDRAMFLKLDFVTMLSY
                     VLALGAIKISFCLLYLHIFPGKKFRMACWWLLAILVAETIEEVLVVIFQCWPVHKAWD
                     ATGLVEGKCVDMTLFYYANFGIKLATDVALFAMPIPKVLRLKMEVGKRVGLVMMFSLG
                     LLYVALLRAGSARRPNQYGYQWVLVDAMNWSCVEVAVAIFIACIPSFKTFISYRSPTL
                     QRLLGFASKDDFTSPSKMYGSSTRRTYNGFSTVGQSSIKLKPVTGHSRADVEASHNGS
                     QERIIHAGIQVTTDVSVKETV"
     exon            381080..381274
                     /number=1
     exon            381421..381504
                     /number=2
     exon            381570..382008
                     /number=3
     exon            382135..382484
                     /number=4
     CDS             complement(join(384596..384991,385062..385181))
                     /codon_start=1
                     /locus_tag="AO090038000156"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000021"
                     /protein_id="BAE63992.1"
                     /transl_table=1
                     /translation="MVAINYSVLFTIQTVLFGGPGANVETDTGISTLANPRTYADLKC
                     TVNDKPVTIGTDAVNYVHHHFPHPGNDDDPRRYPHQFFNKDEITWGNERCNKPEGGEQ
                     PVLLEFPILLDKSQKKAIQELYNYKQLKPRPEPGPCRIVTRKKGDDLCGVMCHIEYGK
                     KNAKPGFKRCT"
     exon            complement(384596..384991)
                     /number=1
     exon            complement(385062..385181)
                     /number=2
     CDS             388691..389386
                     /codon_start=1
                     /locus_tag="AO090038000158"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000023"
                     /protein_id="BAE63993.1"
                     /transl_table=1
                     /translation="MLIFVALCCFACTVSAVKFYGDTPSVAIYTTAMNRLAEPVEDNL
                     SIGSVFVTSDLASKNGSDYLADNGIFDTTLVDFVTQRKGLYAAPVSSTGLDVRAPKDQ
                     LNCENNPVVDKISPANQKHICNAVKSLVGGGVAAVSALIDNTVCSERSTGQPVKCHTI
                     VAFIGTAGVTMTTSEVGDYCSEYLSANDKKCGSQGVTGDTGNKRAYVAVVNTQADDTS
                     CSGLRGKCTEIPV"
     exon            388691..389386
                     /number=1
     CDS             complement(join(389968..389992,390022..391356,
                     391409..391902))
                     /codon_start=1
                     /locus_tag="AO090038000159"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000024"
                     /protein_id="BAE63994.1"
                     /transl_table=1
                     /translation="MQSNEGQSHRPTNGKAANVQAASSNPVVTESTTIKQAGITSHVG
                     HDPVSNPLALLVAASGAIQSESVSNTPISTVESTDEGPTPYLTSIGNLIERSTYVSLG
                     LQLSSESLQSGLDALFAAPTSNPKCTDYFRPPDDGPPRDVSPDLDPVELGLISMEEAY
                     HLFPIYFIRLHPVNGILDPKLHTVEYVRSQSALLFTWMLALTAQFDHGSAAIAKRLRL
                     HGEKLSRHVHASGLKSVEIVQGYYISLLSATPARTLSEERSWLYTMYAFGVAAELGLD
                     QTSPTYTYNNDGNIIPKRTPGPPTRHDIEDQTRRERLTRNRERTWLRILLWERANSGA
                     SGRMNAIPETDLTRNIERWWMHPLADSTDKHTVAFILLRRHLAVLHAEVQRQTLMPHS
                     NPHWVRDRIDVTLEPWRKTWIYAIAPSSEPLPDVHLHHVYLHNRLWTLSFALQASISN
                     NRDLNAIRDDCFQAAVHCCEVAVRDLQQIGEPLYCMLAPTWAMISYAAILALKLFPFV
                     HQPRSEGEIELLALLAQVALQLERAGTTPSHRFGIAAILGQQLLMILRTRAAGLASIT
                     TIADSDHDDNNSGVRNTSCPLSREHLSNISSATGMTQDTDVLGPDRYDGNG"
     exon            complement(389968..389992)
                     /number=1
     exon            complement(390022..391356)
                     /number=2
     exon            complement(391409..391902)
                     /number=3
     CDS             join(392763..392914,393172..393647,393701..393824,
                     393886..394160,394584..394600)
                     /codon_start=1
                     /locus_tag="AO090038000160"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000025"
                     /protein_id="BAE63995.1"
                     /transl_table=1
                     /translation="MQTISVDVLVCGGGMSGMACAAFAAESGAKVLVVEKQAVVGGSS
                     NYSAGMLADKETGIGFPIKIPQLHLHHQQRIRDSTGSQIFTNTAVVKLLQKQPGVPGS
                     PIVGAIIRRGPVDGAGAVYYEVKAQHVVLATGGFQGNAGLTSMHLGQGGDNIFVRSNR
                     GSVGDGLTLATAVGAGTSRGMNTYYGHLLAAPLRSEDVDPKNFLSLAQYQSKYCLLIN
                     EHGRRFADETTGDEIVNQYLAKQEKRRGFLIFNDRTRRQHCISAPFPNAGEIDRLEKA
                     REHGCNVASAPSLDGLAEILNQWGVDGSQALRTIEQYDRFIRLGDKTSTLDAPVGKAG
                     KPPVSLVEELIKK"
     exon            392763..392914
                     /number=1
     exon            393172..393647
                     /number=2
     exon            393701..393824
                     /number=3
     exon            393886..394160
                     /number=4
     exon            394584..394600
                     /number=5
     CDS             complement(join(398811..398929,399007..399349))
                     /codon_start=1
                     /locus_tag="AO090038000161"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000026"
                     /protein_id="BAE63996.1"
                     /transl_table=1
                     /translation="MPSSQNTSCDEATSLLQETPGSPDQVYRGKKAPSDSHWITTVIL
                     LCGGAVLFDLSNNLGSVAEVAILEDIVCRDYYATTTANPILPSLERCKIDPVQTEIAL
                     LNGWRETFETIPAILLALPYGMLADKIGYRPVALLAFLGNAMSSNWSRVVC"
     exon            complement(398811..398929)
                     /number=1
     exon            complement(399007..399349)
                     /number=2
     CDS             join(399677..399895,399960..400995,401057..402226,
                     402282..403533,403607..403690,403753..404380)
                     /codon_start=1
                     /locus_tag="AO090038000162"
                     /note="multidrug resistance-associated
                     protein/mitoxantrone resistance protein, ABC superfamily"
                     /old_locus_tag="AO070331000027"
                     /protein_id="BAE63997.1"
                     /transl_table=1
                     /translation="MADQACDRADNAFGPKVRGCRDETDFTLFFEQSFFSLLPSICFL
                     VCSLYRYLKLVKKERVLKSSLDGLMFAKLTAIATLGCLQVALIVLYALPGGELTRVSI
                     ASGVLGFLATLTLAVMSYQEHHRSIRPSILLGVYLTISTLLDGSQARTLWLRGNHRPI
                     AIVFFAMVVLKLITLVIESIQKRHLLRGPYSHYPSDALGSMYNRGVFWWLNSLLLQGS
                     SHLFQQGDLPPLDPKLASETVGYQMESAWQGCSKTSRYSLAWVALRVACRPLLCVICP
                     RICLIGFNIAQPLLIYRVISFLDDPTNDQTRFIGRALIGAALLVYSGIALSTASYQHQ
                     IYRYITLIRGGLLSLIYNQTLRLSAGTLTDHSAATLMSEDFDRIAVGFEHSDVVWASP
                     IEVALAIYILYREIGLACFAPVIIVVGCAGSAYSLSKRAKVAQQHWMNALQDRISSTS
                     FFLSNIKGIRISGLSEPSSTKIDNLRIHELNKSKRFRQNATTRMTIGVLPETIGPAAA
                     FIVYVLIARRSGQGILDPAKAFSALSLVSLLSKPILNFLYAFPILVASLSSYDRIQNY
                     LLMNQGRLNSALASLEQSKPRERDLYPVKVPVLDTVQLQTLDQPDRRKPSNSLIKINN
                     ASFSFKTDDKPTFQGVSINIKRDSAYILIGPVGSGKSAFLLALLGELKLTEGTMLKAP
                     ECGIAYCSQEPWLPNLSIRSIIQGPSDFDEIWYAEVINVCCLETDIASLPQQDMTVIG
                     IKGMRLSGGQRRRISLARAVYSRKQLLLLDDITSGLDTVTENLVIQRLLGQKGICRKY
                     GLTVVLATHKVHFKHMVDTIIEVNPDSSTVNVQRSYQIPETPEIYEDDPMIQLDVCPG
                     NPQPDIPEEQATRVSEAPSDVSRRIGDASLYLLYAKEMGLASVIMVISTSIGFCFFSR
                     FPNIWLKWWSEAESREPSKRNVRYIVGYAAFGVSATVCFLLLYWIFLVESIPRTSIRL
                     HRRLLKAVTAAPLSSLILVDTGFILNRFSQDMSLLDMRLPGAMIQTLDGLLDAIAEGV
                     LIAQSSPWTALTFFPLLAILYAIQKFYLRTSRQIRHLDLEAKSPLFTSIIETCDGITT
                     IRAFAWQETFRQLNMSLIDESQKPFYLMYSIQCWLTLVLNLLVMGILVVLVALAVELR
                     NTSGGALGVALNNVSAISATLAYVIQAWTSLETSIGALARLKSFQSETPSEHLPNECH
                     DPGSTWPSTGMIQFIDVTTQYRADLKPVLHDINIKIPSGAKVGICGRSGSGKSSLIMS
                     LLRLNEITKGNIFIDDVDITQIPRETIRRQLAVLPQDPLILSGSIRLNLDPLQKHTDE
                     AITSALSRVGMLKSLLSKGFDLDSLVRKDTFSSGQQQLISIARTLLNPSPILLLDEAT
                     SMMDMQTEATIMNLVREQFGNRTVVAVAHRLHTIVDFDLVFVMYQGTIVESGTPAELL
                     QNREGWFTNLWMKQVQDGAQHVDEPA"
     exon            399677..399895
                     /number=1
     exon            399960..400995
                     /number=2
     exon            401057..402226
                     /number=3
     exon            402282..403533
                     /number=4
     exon            403607..403690
                     /number=5
     exon            403753..404380
                     /number=6
     CDS             join(405652..405718,406101..406234,406296..406901,
                     408737..408751)
                     /codon_start=1
                     /locus_tag="AO090038000164"
                     /note="cis-prenyltransferase"
                     /old_locus_tag="AO070331000029"
                     /protein_id="BAE63998.1"
                     /transl_table=1
                     /translation="MGDILGDDKLKRHRGLYSARTAAINIIRRGPVPQHIAFIMDGNR
                     RYAKGHGIPTAKGHYLGAEAMSNVVEACFLSGVKGVTVYAFSLENFKRPKEEIVQLMN
                     LFKFQIYELCKPGGLAERFQVSIRVLGQLDLLDEDLKALLRQIMVDTRNRTGGFINCC
                     VAYTSRDEIVTAMSRAVRSSQLKHSSADITDEVLTRYMYTADDPAVDVLVRTSGVSRL
                     SDFLLWQCHEDTDIQIVDAMWPEFGIYHLFLVIVRWQRKQMNIGQANIQTAVELG"
     exon            405652..405718
                     /number=1
     exon            406101..406234
                     /number=2
     exon            406296..406901
                     /number=3
     exon            408737..408751
                     /number=4
     tRNA            414187..414258
                     /locus_tag="AO090038t00002"
                     /note="tRNAscan-SE"
                     /product="tRNA-Ala"
     CDS             417177..418805
                     /codon_start=1
                     /locus_tag="AO090038000167"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070331000032"
                     /protein_id="BAE63999.1"
                     /transl_table=1
                     /translation="MWTTTSGLSGRSLRLSITFAAVVGFSLFGYNQGMMAGLLNGDEF
                     VDSFPILKMPDNPTAGEKHYIDVIRGAVTSCYELGCFFGALFSMFLGDKLGRTRLIFM
                     GASILIIGALLTTVCFTGHWEVGQFVIGRVVSGIGNGMNTATIPVWQSECSGAHNRGF
                     LVCFEGAMIAGGTFIAYWVVFGMSHAADSVQWRFPVALQIFFALVVAAGAMMLPDSPS
                     WFVMRGLDKEACEVLGKLKGTSPDSDQVLHDFNFLKQDMESSKNTQSNWKTVFTFGKT
                     QEFQRLLIGCSGQFFQQFTGCNAAIYYSTLLFQENLGMEKYLSLIMGGVFATVYVLAT
                     IPSFFMIEKVGRRNLYLVGFLGQGLSFVITFACLIKETEENSKGAAVGIFLFITFFAF
                     TLLPLPWIYPPEINPLRTRTVGASASTCTNWICNFAVVMFTPLFAGQSPWGVYLFFAL
                     FNFLGLIFGFFFYVETAGRELEEVDIIYAKAHVEGKMAWRVANTMPKLSFEEITQQSR
                     ELGLDTNDHGVHEKTELGLSSDSGQETEEVHEKH"
     exon            417177..418805
                     /number=1
     CDS             join(419832..419852,420121..420630)
                     /codon_start=1
                     /locus_tag="AO090038000169"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000034"
                     /protein_id="BAE64000.1"
                     /transl_table=1
                     /translation="MALREIKMPSSTAQPSGVLLVGSIPFTTTEEVLSKVCSALPGRL
                     RSIPDGETNVRNNYIGWQLDCFPKETRNSILGVATAEVPPDHRGTFSLESVKPTQFDA
                     AALESYKTFIKLRDKGAIPQGVRFQVSLPSPLNSIKAHVKADFQPQLEPLYEHRILES
                     LATIIEGIPAEDLAIQ"
     exon            419832..419852
                     /number=1
     exon            420121..420630
                     /number=2
     CDS             join(423711..424052,424104..424244,424297..424567,
                     424620..424769,424818..425140)
                     /codon_start=1
                     /locus_tag="AO090038000171"
                     /note="amidases"
                     /old_locus_tag="AO070331000036"
                     /protein_id="BAE64001.1"
                     /transl_table=1
                     /translation="MVNVLWKHQGDCSTIVYSCIYHFVTMPSASWEDLAADKRARLEK
                     SIPDEWKFKSVPIEGSVIDLPEKSGILSPSEIKITNSSATELVAQLANGTLKSVDVTL
                     AFCKRAALAHQLVNCAHDFFPELALAQARELDRYFETHKKPVGPLHGLPISLKDQLRV
                     KGTETCMAYISWLGKRDTSDSILTALLRKAGAVFLVKTSVPQTLMVCETVNNIIGRTS
                     NPRNLNLSCGGSSGGEGAMIAMRGGAIGIGTDIGGSIRVPAAFNSLYGIRPSHGRLPY
                     GGMTNSMEGQETIHSVVGPIAHSAQDVRLFLQSVLKEEPWKYDSKVIPLPWREAEENA
                     AQAKIAEKSLNFAFYDFDGVVSISRSSSFAIMPDSWIRYVLTLRLLVALRSSGLRSRR
                     TDIPWHPGHPTSMHLP"
     exon            423711..424052
                     /number=1
     exon            424104..424244
                     /number=2
     exon            424297..424567
                     /number=3
     exon            424620..424769
                     /number=4
     exon            424818..425140
                     /number=5
     CDS             join(425287..425699,425791..425863)
                     /codon_start=1
                     /locus_tag="AO090038000172"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000037"
                     /protein_id="BAE64002.1"
                     /transl_table=1
                     /translation="MNPNLPKADLNEVWDAQLQKWRYQCEYLDKWREWEERTGKELDA
                     IIAPVAATAAVRHNQFRYYGYATVFNVLDYTSVVVPVTYADKAVDHRLADYQPVSDMD
                     KAVYAEYDPEVYHGAPVAVQIIGRRLSEERTLAIADIPFTRPRRVFRHSKQLIRTYWL
                     F"
     exon            425287..425699
                     /number=1
     exon            425791..425863
                     /number=2
     CDS             426685..427764
                     /codon_start=1
                     /locus_tag="AO090038000173"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000038"
                     /protein_id="BAE64003.1"
                     /transl_table=1
                     /translation="MSKALRLAMSLSRSYPWVANPFIVSAPMRVMSGPALAVAVSRAG
                     GLGFLGPAVKTQDMLVDLEKVSTLVEEARKSSSAFSSTTNVLPVGVGFQLWSDDLATA
                     VSGIQKFKPCAAWLFAPKGGQEDYDHWSRSIRDASSQTQIWIQIGTLAEAKGLLKGSE
                     RPDVIVVQGSEAGGHGRHKDGLGLITLLPEVVDALAGSQIPIFAAGGIADGRGAAAAL
                     CLGADGVVMGTRFLASEEARISRGYQGEIVRATDGAASTTRTLLYNHLRGTMGWPEPY
                     MPRTIINKSFIEHQAGRSFDELKVEHDQALKAGDSGWGPEGRLATYAGASIGLIHNVK
                     DAATIVHDVREQVLERLGPEGRSKI"
     exon            426685..427764
                     /number=1
     CDS             428649..429614
                     /codon_start=1
                     /locus_tag="AO090038000174"
                     /note="threonine dehydratase"
                     /old_locus_tag="AO070331000039"
                     /protein_id="BAE64004.1"
                     /transl_table=1
                     /translation="MQNSVYETAASAVQARNRIRSHIYQTPLIPSRVQGKSNNARVLF
                     KAENFQLTGSFKIRGAMSKMSGQPANGRLITASSGNHGIGAACAAQALSKDLTVVLPD
                     SVVPAKLEKIKSYGVNVILHGAETGLAEQYAQRLAASQSYTYISPYNDPDIVAGQGTI
                     GLEILEQCEEVDNIFVAMGGGGLISGIGAVAKAFSPRTKVYGVSAINSKALAESMAAG
                     HVVETEHRDTLADAVAGGIDTDTITLPLAMSVVDHVVECDEDEIKAAMKTMAFDENMN
                     VEGSAALALAGFSKVAGQLANQTSVIVLCGANFDQNVFRNAVLDI"
     exon            428649..429614
                     /number=1
     CDS             complement(join(429788..429854,429908..430238,
                     430296..430420,430478..430758))
                     /codon_start=1
                     /locus_tag="AO090038000175"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000040"
                     /protein_id="BAE64005.1"
                     /transl_table=1
                     /translation="MVHLSRALAALSFSASALALPALSSRAQAASEHCGDYDYVILQD
                     TPWIVYNMLYNANQIVGTQCTNYDQVTTSNSGTKEVIWSSVTDIEYVESTNNVPKGYS
                     FVGLTQNLETKLSAIDSIPSTYSWTRTNTTAYKGNVCFDFMTNDVKGDSTSSSSRELM
                     LWLQYEGGQLPIGWTNGAVATIDDLFGTSWKLYEDVNEDTGITVSTLMPETQFEGSFT
                     GDLKDWLLALSKLGRFTESTYVNVGNAGTEFFYGNSVMNATLGLQINLA"
     exon            complement(429788..429854)
                     /number=1
     exon            complement(429908..430238)
                     /number=2
     exon            complement(430296..430420)
                     /number=3
     exon            complement(430478..430758)
                     /number=4
     CDS             join(432567..432602,432671..432788,432849..433270,
                     433333..433428,433489..434161,434218..434831)
                     /codon_start=1
                     /locus_tag="AO090038000176"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000041"
                     /protein_id="BAE64006.1"
                     /transl_table=1
                     /translation="MRHPQGPDFFYRLETPIVVHDLDDSTQKQDHICQWGIGWKTTLI
                     LCGSFSLALALAVTHALVFHYLDGKLENDPNIPSQTHVTAASTIVANIIGFCIRICLA
                     AAFTQYFWHLVRASPMRLETLEFLYTMRGSPTSFFSMTVLQKGWLLAIITMVLWAVPI
                     AMSFPSSSMTVRSTTMTHEVPQTQVPGMDLSETWGGNTTIMKDDELALFVSNNWREEN
                     DTDYVEVLRAEPLTLAGMGIQIKPVMYQLATQTIVNGEPRTMSSPCGLNCSYKISFVG
                     PYLSCNNTDFDKVSPPLNRSAVVLYALESNWTVTPDADSSFASTLKSFEMKNAEVYNW
                     VRNDSTNTVQLEYTSHVLTCSPRRAKYHVVQRFHNGEQSSTVTVGDVHDLVPMDEKLY
                     FSKNNMTQAVVDAIRDRNIMALIMAMTKGISGNVGALVSSAETVEPISQGAAFSTQLV
                     RDNLLVQSTRLFNGFSDTWEGSLTTSYTLFTVSEEILNSMLANVTLSAINHFQLWPTL
                     VNVTQQDVRTQYVWSRPLNLLLPYFLSLGVALPLAILGYWSLRQNGVPATDNGFLQVA
                     MTTRGNYKLDQLAMGGCLGGNHNESAELKNLEVQFGELIQPNRSRLDIEPNHLGSPTA
                     DVRLAGFAPKDEVAPLLVGKRYGKLCEN"
     exon            432567..432602
                     /number=1
     exon            432671..432788
                     /number=2
     exon            432849..433270
                     /number=3
     exon            433333..433428
                     /number=4
     exon            433489..434161
                     /number=5
     exon            434218..434831
                     /number=6
     CDS             join(435845..437080,437955..437963)
                     /codon_start=1
                     /locus_tag="AO090038000177"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000042"
                     /protein_id="BAE64007.1"
                     /transl_table=1
                     /translation="MISLLAPRGLRPAWIGITAIAAAAILTLFFLYSPRLQTTTSRVV
                     VPDPANHIVTDPSYVDNNTTTKNVSPVVSDASLTNRLAQYFIDYPLHPPYKEHFGELG
                     QRSQVLRDWLTLADHSPESTGKNLLLNATERVAVSLYPFLEKPKGQNATDKPVSDLRA
                     SFEPGSAGVVIPTSNNTLRFAAHLVGTMRSVLNSTLPIQIVYAGDEDLSPDDRTRLSR
                     IVESGPPLEFLDILTVFDDSTLQLQTGGWAIKAFAALGSHFERVILADADAVFFQPPE
                     VLLDHEAFVRTGALLFHDRLLWKNVFPERNEWYRSQIRQPSAALDKSLVWTEDYAEEG
                     DSGLVVLDKSRTDILVALFHICWQNSYDVREEVTYKITYGDKETWWLGLELTGATYEF
                     SGHYGGIVGWEQVDSRGRHKPE"
     exon            435845..437080
                     /number=1
     exon            437955..437963
                     /number=2
     CDS             complement(445791..447641)
                     /codon_start=1
                     /locus_tag="AO090038000180"
                     /note="TPR repeat"
                     /old_locus_tag="AO070331000045"
                     /protein_id="BAE64008.1"
                     /transl_table=1
                     /translation="MVDFSNTVSAASTPAQPRDYAHRPDIPLQDLMHVLSSYSLARFS
                     ATMDAITIHPLIHYWAQQRLPLERKRQFSEEALRLIARALRLTEQSYSAQKYALFESR
                     VSSHLHAALKNVQNLSGSLEPGNSYDPPSDISLPHTLSVVYAITEGWLLWLWAAILDI
                     KLFFLTMLYEEEQAENDIWWLAYKLTIVLRSHTLHKNTEQLFRWQFAEARRVLHPKHP
                     RALYIAGDIAWIVLLQGRIQESRKWYEWVLTSRQRVQGEQHYATLGAVMGIATILDKD
                     GSHDEALQLRIMAYEGRAASLGIENSLTLNSAYAIGQQLSNEGKYEDAVKWFQLVFYA
                     RNTTLGSDHADTLRSACHISHSLVLLDRHSEALEWDQIAWKERNKTLGPDHEDTLQSA
                     HDIGYILSLLDRYSEALAWSQVAWKERHRTLGPDHEDTLQSAQNVGQSLFLMDRHSEA
                     LEWDQISWKGRNKTLGPDHEDTLQSAHDIGYVLFVMGRYSEALEWSQLAWRGRNKTLG
                     PDHQDTLQSALNIGEILLPLHRYGEALEWHQIAWVGRNKTLGPDHEDTLASSHNIGES
                     YKALGQYDEAMKWFNLALQGSQRVLGMDHEETRVTMRSIEDLEQKRGRNK"
     exon            complement(445791..447641)
                     /number=1
     CDS             complement(join(447725..447743,447791..447980,
                     448037..448583,448647..448727))
                     /codon_start=1
                     /locus_tag="AO090038000181"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000046"
                     /protein_id="BAE64009.1"
                     /transl_table=1
                     /translation="MSAKSPKRPRQALNKQAELSIPLQLPMEDCQDMQQCIVALYGPG
                     GIGKTQTAAEYAYHYQRCYTSVFWIDGASEHTIRQSFSVAAGQILKSWRRLNHNETAY
                     QIFAKDFGVEDSKTSSTPTADQAVKGVIDWLSQLENNDWLLIFDNIDDLDSFDIRSYM
                     PSSLHGNILITSRRADVSGYWRSVEVEKMSDKEAKSLLAKSSGFSGDMNEEVSLELLQ
                     LLGHFPLAIEQAGAYISVQHKFLPHESGLYSQALQRYIHEYHLNAERLLKHKRPHLTA
                     EN"
     exon            complement(447725..447743)
                     /number=1
     exon            complement(447791..447980)
                     /number=2
     exon            complement(448037..448583)
                     /number=3
     exon            complement(448647..448727)
                     /number=4
     CDS             complement(450036..450608)
                     /codon_start=1
                     /locus_tag="AO090038000182"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000047"
                     /protein_id="BAE64010.1"
                     /transl_table=1
                     /translation="MGFLRSYAFLTPHRLDFILAKESHLIPDDIDWIAWSKFIHKFRE
                     LGDEQVAQRYHYGQLRLSRLNWAVRIVRPQHANTLWFYHLPHWSITSYLSQATVPLLF
                     IFASVSVVLSAMQVALSVPSDKGFLQRLEDAGLPQMELTFWAFSISILLLSALIWVLL
                     LGVPLGALAWQLSWGFRKREREKGDRLLSA"
     exon            complement(450036..450608)
                     /number=1
     CDS             complement(join(452138..452837,453020..453279,
                     453463..453675))
                     /codon_start=1
                     /locus_tag="AO090038000183"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000048"
                     /protein_id="BAE64011.1"
                     /transl_table=1
                     /translation="MFSLTSLPSSGVHYVVPASTSHVSGPSMSPFQRRGPMKIHNILC
                     LPSTRTTTRNMGTVPLQRQAVSGLFANDVVLHWDIPGPTSLWRRCEAARLGRVWSTTI
                     AETKSPRRTTWNVKLTAIISFRGLWTVCRFLKSGVRECRPQDISMIGLNRRTPLMIYP
                     LQYREEPDPAVQKAADENWVHISGDEWLAANPFYVPKLREILGRAMDTGPSFSPQDGA
                     FEPLISMDKNTSDPFARLPQEILDMIIDNLSTKDIASLRLVSRKFYQLHVSLWYRLIQ
                     EDMPWLWEVWSDEKPYFWATVTEGDIQQNKGETRIEFGEEKIMTHTINVDEHLAKWAM
                     PIPAPRRTNWFLLYTDVKRHWSKLRGLWNRRRIWNYQQGLISSLKMHILSSDDHTA"
     exon            complement(452138..452837)
                     /number=1
     exon            complement(453020..453279)
                     /number=2
     exon            complement(453463..453675)
                     /number=3
     CDS             complement(join(454119..454126,454259..455061,
                     455909..457052,457107..457587))
                     /codon_start=1
                     /locus_tag="AO090038000184"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000049"
                     /protein_id="BAE64012.1"
                     /transl_table=1
                     /translation="MDEYCSLYKEIQSLTALTSLIFQRPPDGMDYGEFGKEKSPPKEP
                     EQGTDEELDKLPDETDFEDDVTTGVSTTTLILLKQRSLDRLAEVLARFKTQKTGRHGR
                     GKKKDAHLDAKHVTSVAMVENSTLQRVTFLCSKNEGLKGEDEVFLERLCELLTSILKN
                     GQRQTCQSEVFDLIFEHNTPRVEYYSGVIQDAFKRASGLKVPDTLTEDTIKDMVDQKL
                     EARLWEGLIINIDGRQREVSQELPDCLSDKDLDKAVIETCDRIRSLFKVSNSHSTRND
                     ELRDFLESFYAIIRNPRQRPALKNLLKQALHGSEKLFTKAWDALLFLARTFHAAVTLV
                     ELASKLKLKLFNSFRFVPVSACMFKTKTYAPLGKDLPLKVLGALPCQPEGNGWVKLLQ
                     DQRTINEYTNILRLPRSIHAEVQLMGYLETSLSKNNDQVFPYIGCSKKCCFFCEVFRA
                     LHGKFSARGTHETVFPRWGLPQGIAVTSKLEWLAPLMAKLAVFLRAMLRRVLSEPYPL
                     PHRELCKQSSAALSTAQAEQQGESIYSERPSMFRFNDGCRLNTAQAEVFKLFVTIRGS
                     ICQIPDTNSSTWINFGFCYCTSFQQRQELSLKYLLLAASNASFDDIVSAYETTTMAEL
                     MTKHGIDLSDLSQKGVRLQRPSGMVYSVFRLMIGVSHALSGRFCSCFRMQPDQPCHHY
                     FEPHFDSECDVAYGFHLTNSWERWQLLNFYRHLFNLPEFDPRAMAAAKESPERGALEW
                     YIDTLVPDMRPRIFDMDRAGSILFPNFNAGISVTIQGAEESSHLPCHCRVHDVLGPPG
                     LCYGKGDDILDKA"
     exon            complement(454119..454126)
                     /number=1
     exon            complement(454259..455061)
                     /number=2
     exon            complement(455909..457052)
                     /number=3
     exon            complement(457107..457587)
                     /number=4
     CDS             complement(459712..460224)
                     /codon_start=1
                     /locus_tag="AO090038000185"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000050"
                     /protein_id="BAE64013.1"
                     /transl_table=1
                     /translation="MSRRKNGPIVEYLNNISAWHHISAQIVDYIQHPYRGLRAKSKRV
                     DDLGNGSVLSSREAGYPLPVALIARYQLTTVDAFACEISIDDPYSQMTHQQWMESLWR
                     GCVGPDIVVYIQDHEIPEMGQSQDLVYSARLHDTLGIVIPRARGSSKERVLRHVVWAI
                     DSIVMSTRCQ"
     exon            complement(459712..460224)
                     /number=1
     CDS             complement(join(465817..467706,467748..468923,
                     468985..469055,469121..469400))
                     /codon_start=1
                     /locus_tag="AO090038000187"
                     /note="cation transport ATPase"
                     /old_locus_tag="AO070331000052"
                     /protein_id="BAE64014.1"
                     /transl_table=1
                     /translation="MVCESDPRNTCSSGCCGEQDKGIKTRDASVPHTSDRGPTESRGS
                     TEKLQEEDPNKPSCCKDKPSPCCDVSCLDRIALRECHKEQILSSNEASPTPDSQLPNS
                     RWKTMRAAPSFGADQESCCAPPRRFSLGKDRRSADSCCAGSITRPKTHHSASIEGRGE
                     SCSSGCCGPPKAPTVVKQCPSTSKGKAADSGSSCSKPETPESTGGHTSVTNGEFRNII
                     TYSKGCCDKPNMFLVPTAEQCSSPEKGNSCRRACSPSCRSKSKQASSAWSGEKPDKPA
                     CSSPCGSKPEVPSNTFPGAKPVRPEPGTRSTGCCGKPVTSPCTSTEETPTDFIEVIPG
                     TATPELEKGFTGQEHVVLSISGMTCTGCETKLKRTLGTLQSVQSLKTSLLLSRAELDL
                     DVSAQSFDEVLKYLERTTEFKYERATDRGFRLDVIVPNASEFMKQAWPRGVTEMTLVD
                     DGIIGVSFDARIIGARDLVEHGWGSPLSLASPRPDPTLQAGVKHVHHMGYMTILSIIL
                     TGIAYGSASLALATIVQTVIAGPFYPKALKALIFSRIIEMDLLIVLSTSAAYVFSVVS
                     FGYVIAGQRLSTGEFFETSTLLVTLIMVGRYFAALARQKAVESISLRSLQAPTAILTD
                     DSAANEKEIDVRLLQYGDIFKVAPDSQIPTDGTVIGGSSEVDESMITGESIPVDKSLG
                     SAVVAGSVNGSGILIVKLTRLPVDNTISIIAGMVDQAKLSKAKVQDIADRVASYFVPV
                     IVALTIITFVIWIAVGIAVRKQSGSRATTEAITYAITVLIVSCPCAIGLAVPMVIVIA
                     SGVAAERGIIFKGADSIELACKASHVVFDKTGTLTQGKLTVAIEHIDNASNTMSLLLG
                     LVGSNKHPISAAVTAHLKAKGISPSTVPDTKLLTGKGVEGFAPGLILRAGNSRWLNLS
                     SDPLVRSILEKGYTAFCFTINDNLAAVFGLEDSLRPDAREIVTKLQERGIFVHLLSGD
                     DDGAVRSVARQLGIPAQNIRSRCTPGDKQAYIQALHNPLDQGSHKTRPTTIFVGDGTN
                     DAVALATSTIGVHMNQETGTDVAKSAADVVLMLPSLLSILTMINISKKAVWRIKFNFG
                     WSFVYNLFAILLGAGAFVDARIPPEFAGLGELVSVLPVVFAAVLLRWARV"
     exon            complement(465817..467706)
                     /number=1
     exon            complement(467748..468923)
                     /number=2
     exon            complement(468985..469055)
                     /number=3
     exon            complement(469121..469400)
                     /number=4
     CDS             complement(join(474940..475839,475923..476177,
                     476236..476589))
                     /codon_start=1
                     /locus_tag="AO090038000188"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000053"
                     /protein_id="BAE64015.1"
                     /transl_table=1
                     /translation="MKIPAPQQLQQLHVSLDGGHYEPVTTFDPAKATYLQDQEALQEN
                     LLRLCSVNGWHKSSRAACSPRPVLVSSEHQRRWRELHEALVLAITDIVERWLTDPEAR
                     FPERMPLEPEEEDLLRWIDEQVPHNLPQYRDCRGSWRPDFLVEEENSEDGSGPVENFR
                     ISEINARFSFNGFMFATCGQQAIHDMGICDNGNGLVGATDPAKILKGLLRLFQPGLPL
                     HLLKGDEAGVDIHMLVDFLDRYLGITHRFIMPADLRLLHEPQAKGGYKLCCVVKNPDS
                     CDPATLIYHDGDILEEIHQVGLELHQREIRALEPEMLRQISLRCFNDMRTILLVHDKR
                     MLGIVKQELENLVARNVLTLSQAKILDKGIPETILPGSLDLDQAIARCKEMPELKDEY
                     ILKPIRSGKGDGIVFGEDLNSEEWISRLEGLWSAQLIPGGGTCIVQRKVKQLLYDVVL
                     RPTGVKTRYPLIGTYHSINGEFLGVGVWRSSPDRICAISHGGAWTVSVMRDE"
     exon            complement(474940..475839)
                     /number=1
     exon            complement(475923..476177)
                     /number=2
     exon            complement(476236..476589)
                     /number=3
     CDS             complement(join(477544..477686,477748..478287,
                     478361..478756,478819..479013,480942..481017))
                     /codon_start=1
                     /locus_tag="AO090038000189"
                     /note="ornithine decarboxylase"
                     /old_locus_tag="AO070331000054"
                     /protein_id="BAE64016.1"
                     /transl_table=1
                     /translation="MGEDLNNNLTGVEDEVHGTGWTLGGIPKMMVTDMASDALVDSII
                     TERIRKLDQNPVDIQHDLPFLVADTRRIFQQHERWLQCLPNIAPFYAVKCNSNIRLLR
                     YLARLGVGFDCASWGEMKLVLNLGVDPSRIIFAHPCKAVSALQMASRSGVPRTTFDNV
                     DELEKIKDNAPNLRLLLRIFADDDTALVSLGNKFGAPLDTTKALLLKAKDLGLVVDGV
                     SFHVGSGASNADTFVTAVQNAKHVFQQGKQLGFDMHVLDVGGGFQDSNFEPMALSLQR
                     AIEKEFPPSTQVMAEPGRYYARSFYTAACKVVARRKQIGQDKLSQSDMLYLNDGIYGC
                     FMNAVAENEIYRPILFKQETTSSTEREAGEHRYSVWGPTCDGLDCIAKEATMGCEVKV
                     GDWVKFENMGAYTTATSTQFNGFPNRYDIIYVDDHSPPRCDREVMASTKRIRSEAVL"
     exon            complement(477544..477686)
                     /number=1
     exon            complement(477748..478287)
                     /number=2
     exon            complement(478361..478756)
                     /number=3
     exon            complement(478819..479013)
                     /number=4
     exon            complement(480942..481017)
                     /number=5
     CDS             483498..485246
                     /codon_start=1
                     /locus_tag="AO090038000191"
                     /note="predicted hydrolases or acyltransferases
                     (alpha/beta hydrolase superfamily)"
                     /old_locus_tag="AO070331000056"
                     /protein_id="BAE64017.1"
                     /transl_table=1
                     /translation="MPGPWSTKLYLLGYLQIAPALASIQWSPCTSNPSLDCATLTVPL
                     EYADPENGALAYIPLARYNATVPASQRKGSLLTNPGGPGSAGTDFLLNGAGEGMVNIT
                     GGFYDIVSWDPRGTGSARPLLQCFDSAGEEADASAALPAAAEIEYSQFRNQSYMPSYY
                     AALKDYDNTIAELAGACADHDSPALYTSSTAYVVRDIAAIIDALEGTDNATLNYWGFS
                     YGTILGAEFIQTYPERVGKIIFDGVFDSAANAQPYTSQLPYDELYVRDSINDLATSCT
                     QAGIEGCALNKAPGNRTTPRNSTTDIATRLANLQASLYRNPIDVSDGSFSITVGMFSF
                     FMYSFLRLPSSWPAVALAVSALEEGNADPVASLLTDAAGPETNAIAPDTGSFAGWPIQ
                     CTDNAPSNHTKLPEVAQLVLNISLAEKTPWLNADLSTLSFCRNFPDTRPRVPNLGASK
                     LTNGETNAILTKQNTSVLIINALHDPTTPINSAVRLHRWLPTSSQLAVRRGPGHTTIS
                     LGSLGLVNTIREYLLDGTLPATTEVYDVSQEIFSSEIDAGTITPDPVFNGTYSDSEKM
                     LLESTYNIYLAFVSLP"
     exon            483498..485246
                     /number=1
     CDS             488038..489183
                     /codon_start=1
                     /locus_tag="AO090038000193"
                     /note="FAD-dependent oxidoreductase"
                     /old_locus_tag="AO070331000058"
                     /protein_id="BAE64018.1"
                     /transl_table=1
                     /translation="MEQYDVAVVGLGVLGSAAAYQAAQRGKKVIAFEQFEFGHVHGAS
                     HDTSRIIRTSNPLPEYVKLARSAYKDWAELEEATGQKLLTITGGLVFVPREKASPFES
                     LINTLKVTNLPHEILNATEVKKRWPQFDIPDTVDAVYTADTGIAHASKTVAAMQYLAR
                     SKGAILKENTPVDRVVPKKEGGVTIQTPKGEFHAAKVILTTDAWTNKLLAPLGVHIPL
                     SVMQEQVTYFKPTDTAAFQPDRFPVWIWGGDPAFYGFPCYGEPTIKAGRDWSNNLMTP
                     EQRTYVQSPQLFEQLSSFMKSFIPDKERQPLRTVTCQYTITPDRQFIISPLDNNKDII
                     VGLGAAHAFKFAPAFGRALAELAIDGRTKEDVSKFGIPKSACCRSKL"
     exon            488038..489183
                     /number=1
     CDS             complement(489332..490174)
                     /codon_start=1
                     /locus_tag="AO090038000194"
                     /note="formate/nitrite family of transporters"
                     /old_locus_tag="AO070331000059"
                     /protein_id="BAE64019.1"
                     /transl_table=1
                     /translation="MDPTFDPTKETLNLLVSSGVAKARLPWPDLLLKSFLAGAFLSIG
                     ALFSLIVAGGSPSLRAENPGLATLLSSFAFPTGFVILTIVNTELFTANVFVLILTTFM
                     RRTTWLDLVRNLVLSYIFNLAGCLFVAGFLCWWSDTLSTDTLKGFAVTQAEGRVNVQW
                     SVNFLRGVGCNWLVGLAIFLSISCKDKVSKIYAIWIPIWTFVAVGYQHCIANFFLVPI
                     GMFYGTNFGVGKFIYQSVIPVTLGDIVGGAVLDGVFIWFLYGHRIMKKRPGGEPNAGD
                     HLPS"
     exon            complement(489332..490174)
                     /number=1
     CDS             join(491927..492990,493127..493166,493234..493302,
                     493333..493437)
                     /codon_start=1
                     /locus_tag="AO090038000195"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000060"
                     /protein_id="BAE64020.1"
                     /transl_table=1
                     /translation="MISHVFFAWYLLLLSIFDGGVVARRGGGGNYDSGSNSDSSSDGD
                     SDNGSGGGDDSSSPSGCGSGASNALSNTYLVPRHAWNWTSQSGAYSTDSPTIYDGSYF
                     QGEGYLSYNITNGNKCQSTKQLRLLGYAWIGPQPPYPAGSENPFIIGFKAWESTKAVS
                     EIHTSYTQIIWEGDSCASEPDLFGIVTTRGSASRTEASDTMIMNVSTSPAAPGAVDFN
                     ASTVTDLSPRISDSEGLFRLRAQSCASHDTDMRWPATTVMQGSVTNTTLGLEFSGSVD
                     MNSTQYQFYAGRDENLKVNFTVTFSGQFDSVNSTHALNVQQANQSLAWVPNSAVNIVP
                     GSWGYILAGAAGIQILALNIWDHSPRDCAQHKNVHGSYYKYPSKSYVIKLRRLHLQPL
                     ALDPGLDLCNMVGRVDNQSSFKTGPSAKCELLA"
     exon            491927..492990
                     /number=1
     exon            493127..493166
                     /number=2
     exon            493234..493302
                     /number=3
     exon            493333..493437
                     /number=4
     CDS             complement(495332..495736)
                     /codon_start=1
                     /locus_tag="AO090038000196"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000061"
                     /protein_id="BAE64021.1"
                     /transl_table=1
                     /translation="MAFSNRTWVVTSRYCDIGDGVDSLEGHIHSLWYMYYELGRNITP
                     ESSEHEGLVLDILRIQGMGPLTRPARGVSGIDIARTVDGTLWNDLPFMVGDMINCWIN
                     HSASMSGTHRLNFAKYMMALESHSDDRNLTRS"
     exon            complement(495332..495736)
                     /number=1
     CDS             complement(join(498976..499144,499196..499301,
                     499357..499522,499585..500403,500475..500696))
                     /codon_start=1
                     /locus_tag="AO090038000197"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000062"
                     /protein_id="BAE64022.1"
                     /transl_table=1
                     /translation="MNLPLIWIGLFTAVSYLVIRSIYRLYFHPLSNFPGPKLAAVTHL
                     YEFYYDVVKGGKFIWEMQRMHDQYGMYCTTIHIKDPYYFDPIYTSKGQAKDPYIVRTF
                     ATPLSTAATVEHDRHRYRRDLVNPFFSKRSVMGVDYIVQDKVDKVCKRLTQVHERGTV
                     VSLDDLFAALTADVISHYAYGESLGFLDTENLKNEFRDAVASAGLLCHFARFFFVVSM
                     VAETMPALVEWMQPSSKGLWEAKRMIEQMARSSLEKDHEKNANSRKTIFDALCAESVR
                     PEERTVARVRDEAMVVFGAGTETTARVLATGSYYLYRDKPRLEKLRAEIETVMPDSTD
                     HVSLTQLESLPYLTAVINESLRMAHSVTMRLPRISPTPLAYKDYIIPPGVSHLDAMEL
                     LRSNTSRSDTDSFNPERWLEASSKGERLTKFLVPFSKGSRICLGMNLAYSELYQMFAT
                     LVRCFDLEIQTPPESVRITRDFIIGLPDDADYLKVHSLVTNAL"
     exon            complement(498976..499144)
                     /number=1
     exon            complement(499196..499301)
                     /number=2
     exon            complement(499357..499522)
                     /number=3
     exon            complement(499585..500403)
                     /number=4
     exon            complement(500475..500696)
                     /number=5
     CDS             join(502074..502092,502162..502508)
                     /codon_start=1
                     /locus_tag="AO090038000199"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000064"
                     /protein_id="BAE64023.1"
                     /transl_table=1
                     /translation="MGRWGWRLFEGDQDLDAACCLAESLGIQTDDWEHSMSSMVHQTD
                     MLADEGTRAFYRTEEYKRELENEIVPYVRANFDIDNFGDRFFRCFLCQGEWPNVPPCK
                     IQNYHLRRIDDEGWGQDQG"
     exon            502074..502092
                     /number=1
     exon            502162..502508
                     /number=2
     CDS             join(509338..509965,510145..510371)
                     /codon_start=1
                     /locus_tag="AO090038000201"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000066"
                     /protein_id="BAE64024.1"
                     /transl_table=1
                     /translation="MYYLKIIFAALTVTTAIAHPGPDQPVPHAEIQRRNELAKKCASQ
                     AANFNQRRISKRALQKRWEGSGHNVTYEITTGAPYYETIQNDTCVLSPEVTRGPYVWP
                     RSQTLRQDMSEDQPGVPLWLDVGVLDMATCEPLPNVLLDFWHCNATGSYSSFTHLSPN
                     IEFRELLTEKNLTDYAIGVTDLHTDDTTFLRGMWPTDENGVMEIKTIFPAVSQKIMGL
                     EPYVFHTEIDRITNAQDAIYQNGTKGGFNPVVSIVPADGKDISKGMIGYITMGVDTAA
                     IETFEYDH"
     exon            509338..509965
                     /number=1
     exon            510145..510371
                     /number=2
     CDS             join(511742..511779,511868..512032,512105..512194,
                     512204..512357,512562..512612,512646..512819)
                     /codon_start=1
                     /locus_tag="AO090038000202"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000067"
                     /protein_id="BAE64025.1"
                     /transl_table=1
                     /translation="MVGQKSRNTWQNVPRSELFTAQCAALLKSLDAGHNITKLTRSFN
                     VVCFTIYWTQYRFQNQNSLESGARISYTVLITGSLYNVSKLTVQQIPRKYYIKTKRKI
                     ALDTDSAKKNYYKFVCTWLYFNNSNNIIFSDEFLVQRNSVILFNRYSSGMRFQQNHTT
                     IYIFRQILEWLLYLPDLNSIENLWYLFKKKLKELYPELFQNGVSEIDIERFRQSIQTV
                     WDSLD"
     exon            511742..511779
                     /number=1
     exon            511868..512032
                     /number=2
     exon            512105..512194
                     /number=3
     exon            512204..512357
                     /number=4
     exon            512562..512612
                     /number=5
     exon            512646..512819
                     /number=6
     CDS             join(528522..528713,528809..528919)
                     /codon_start=1
                     /locus_tag="AO090038000204"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000069"
                     /protein_id="BAE64026.1"
                     /transl_table=1
                     /translation="MSSLVIGTAPEGLDLSADRIAQNDGTVAAVMAIATVFVGLRFWA
                     RTTNKSANLAYDDWFVLVALVSSPPATYLKVPLKLTKSVLRRRIWDRQTYMGGGGK"
     exon            528522..528713
                     /number=1
     exon            528809..528919
                     /number=2
     CDS             join(528975..529378,529440..529744,529802..529932)
                     /codon_start=1
                     /locus_tag="AO090038000205"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000070"
                     /protein_id="BAE64027.1"
                     /transl_table=1
                     /translation="MSLMVNVQIIFAYVVLYSTTVPMVKLSVLLLYRRIFRLTWTLYF
                     CGFLSIGYAISVSTTISVACVPSSFFWTQWVYPLSGGYCRINLYQFYLWNGVANLFTD
                     VIILCLPMPIVWSLQMPKGQKWAISGIFLLGGFVCVATIVRICAITKMKDSVDITWVI
                     GDAMIWSNVEPCIGIVSACLPTLRPLLRQIPQLRLWGMFGSSGLSRDYKMTGEGTSGI
                     SGTPLQSTGNRSGYRASNGRASTHPREEGVIPSNGSTASGQELNAMQIRVKQNFDWRE
                     ENP"
     exon            528975..529378
                     /number=1
     exon            529440..529744
                     /number=2
     exon            529802..529932
                     /number=3
     CDS             complement(join(530249..530423,530477..530643,
                     530696..530806,530857..531707,531763..531961))
                     /codon_start=1
                     /locus_tag="AO090038000206"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000071"
                     /protein_id="BAE64028.1"
                     /transl_table=1
                     /translation="MALLVILGIGFVTYLVFLSIYRLYFHPLSHIPGPKLAAITHGYE
                     FYHNIIRGGLFIWELERLHEVYGPIIRINPREVHIKDPDYYDDIYASSARKREKDPVL
                     VAQFGLEGSGFSAIDQETHHQRRAPVAKFFSKRAIENQEHLIRDSLNKLVGHFQEACR
                     AHTVVSLDAAFAALTSDVIHQYAYGFNPNNLDKEGFNAKVRDGINGLFQLAHLLYFFP
                     ILQTLMNVMPLPLLQVLNPPAFALASQKKELYEQGAAALEKANSKAGSGTLIDTLAAP
                     SMPEHMRSAHRLMNEGFALVIGGTETTARSLALGAWHLFTREDIRNKLREELKQVMPT
                     PDSQPTWNDLEKLPYMSGVISESLRLSTGIANRSSRVAPTEALVYKDYTIPPGTPVSE
                     TNYFTLMDPEIFSDPHAFDPERWIRAAAKGQRLDRYLVNFSKGSRMCVGLNLAYAELF
                     LVIATIVRRFDIELYETPKSNIDFARDFGTPYPDKGNFSVRALVTGVISE"
     exon            complement(530249..530423)
                     /number=1
     exon            complement(530477..530643)
                     /number=2
     exon            complement(530696..530806)
                     /number=3
     exon            complement(530857..531707)
                     /number=4
     exon            complement(531763..531961)
                     /number=5
     CDS             complement(538390..539427)
                     /codon_start=1
                     /locus_tag="AO090038000208"
                     /note="predicted NTPase (NACHT family)"
                     /old_locus_tag="AO070331000073"
                     /protein_id="BAE64029.1"
                     /transl_table=1
                     /translation="MRNKCQEEKNELRRQCAEDAKEESKACEDRVKVIQEQLTECRDK
                     NLQDTRWVSNPGLLGTEVKAKAVAFSPKNERMAVGELSPQRVVVWDMKTRQPLAGWET
                     GAGAGMPMSVALSPDGTKVLCGTYEGAVKMWDVSTSSEQIFQEPKGRVSRVNRVAFSP
                     DGRQVAAGLADGKVLIWDVSTNTQITTQGHSGAVQALEFSPTSGKLVSGSKDKTIRFW
                     DPRTGRKDNEISHPGGGLNAIAFSPDGKSLASGSDDSSVRVWNAETLAQRRLLPAHTG
                     PINDLAFSADGRQLASVSDDGTLRIWSLADDYVLSSHQQRKAEAVAFSPDGKYLASVV
                     ALEGLLLWTRN"
     exon            complement(538390..539427)
                     /number=1
     CDS             complement(541424..542305)
                     /codon_start=1
                     /locus_tag="AO090038000209"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000074"
                     /protein_id="BAE64030.1"
                     /transl_table=1
                     /translation="MRFQYLFLTLGATLSAAAQDRGQCYSIGQMYPSTDRVSGRSECC
                     PDGTEYNGNICEALPTCFNPDEYFDTVDRVCRAKKDCGDGNYFYIRERKCKPIPPCLD
                     DEFFDGQYCVRKPQCQDGYYFEKTGCVPKPRCEDDEWFDGRNCVEKPQDCGAGKHWDF
                     KANQCVPNPPCDADSYWTGTGCAKRPRCRNPHHFFDGVDCVPCPNPDEYWNGNACVSR
                     PVCAEDEYYDGNNCKKIPKCGQGQYWNRKKNICDQVQHCSLGEWFNGESCEAISYPPY
                     GGRLCLISCDKLRSGTP"
     exon            complement(541424..542305)
                     /number=1
     CDS             complement(join(549651..550529,550596..551076,
                     551126..551562,551617..551922,551976..552833,
                     552883..552908,552989..553055,553107..555259,
                     555331..556282,556340..556452,556512..556635,
                     556694..557647,557709..557882,557937..557990))
                     /codon_start=1
                     /locus_tag="AO090038000210"
                     /note="polyketide synthase modules and related proteins"
                     /old_locus_tag="AO080533000208"
                     /protein_id="BAE64031.1"
                     /transl_table=1
                     /translation="MSATSVDMSAMESKPDSVVELDSQLSSIMNNVAAARLPETSESK
                     KNEATAERSFCRDTKPCEPIAVVGMAMRLPGGVPETRYNVDSFYQQAKPNAIRTKKGY
                     FLQEDPTEFDTGFFGITNYEASRLDPQQRLLLEVVWECMENAGQVNWKGRDIGCWVGV
                     FGEDWMDLCAKNIQYTDRLHALGAGDYALANRISYEYDLTGPRLETPEDRPFWLRLPM
                     LTLRSMTVQTGCSSSLVGLHEACRAISTGDCSSAIVAGTSLILSPTMTTTMSENMVLS
                     PDGICKTFDAGADGYGRGEAINAVYLKPLKDAIAAGDRVRAVIRSTATNCDGRTVGIT
                     TPGAPTQKQLIKRAYQKAGISEITDTAFFECHGSGTVVGDTAELSVVADLFKDKGVYI
                     GAAKPNFGHSEGASGITGIIKAVLALEKNVIPPNIHFKEPNPKVPFKEAMLQVPLEPI
                     PWPQDRHPRVSVNCFGIGGSNAHAILDSAASYGLVEDWTPSQQENSQSFLFLVSAASP
                     TSLSQRVNDLTEYAKQTVPRFQDLAYTLAIKREHLQHRTFFVGEADGTITKSERTARQ
                     FDSTQLVFVFTGQGAQWPTMGKGLLESFPMFQQDIQRMDRVIHGLEQPPDWSIEGMFS
                     ILDIEDLKLLLTKCGRVDELVAGEDCCRIHEAELSQTLCTAVQIGIVNLLARWGAKPD
                     AVVGHSSGEIAAAYAAGTMSLESAIVVAYYRGQAVKMARAGAMAAIGLMAEEVKRYLV
                     EGVGIACENSPQSTTISGDSEKVGEVIGKIQSDNPDTFCRQLRVDKAYHSGHMEEVGA
                     FYEETIKSKIHTNSNMVPFWSTVTGSLLKGPDDLSAEYWRQNLESPVLFRQAMEAILQ
                     HEQQSGQVFVEIGAHSALSGPIRQIMQTGNISKATYVPTLIRKRKANVCLMEAMGCLW
                     AHGVPTVDLQGLVGQGRVLTSVPPYPWDHRAKLLNESRLVHNWRFRAFPHHELLGSRM
                     FGATDLEPMWSNLLRPDDVPWLFDHELTKKIVFPAAGFVAMIGEAIRQIDGSESYSLH
                     HVLLKAPMLLEEGHTVEVVTSLRPVKVSDFLDSHWYEFTISAYDGEDWVKHCQGQACA
                     SFGKNMESKKISPLSRKVCSETWYRLMATHGLRYGQRFKGLQDITSDPKQKMATATMI
                     EDHTAHESHYTLHPNIIDQCLQIMSVAMCSGMAAVLDQLAVPSFFELICVSSGNGKLA
                     VEADAHKTSTNITTGNSILVSGESPILAIEGAAFFSLTDSGETSQHGFPLVTHTKWAP
                     DLDLLPPNELLSFRPVGRDGDLYADMILCALSEAHYRIKDKVPATEHLRKYKDLIAGW
                     VEHMRNCLSPAPPHARRFLELDTQQRMRLIDELSEKVRTQDPDGLAIISMVKTVLLHI
                     SDIIVGSESPLHILVDEDRLADVYYQPSLWGCWHELLNLLMHSNPRAKILEIGAGTGG
                     STTVLLDHLRSPDGVPMYGSYVFSDISPGFLHSAKEKYKDRKNMEYRVLDISKDPAPQ
                     GFECGSFDVIVASNVIHATECLNTTLQNVRKLLAPGELPIFDFIMGVLPGWWIGEKDG
                     RGARPYISPAEWNTELLKAGFTGVDAAEFDDEGMSRLMVNILSRSPCHPPQATDVTIV
                     HRAEIGEWENSVAQNFVAAGYTVRWMAFDEVTCPATSGIVFLLDRPGPFLHDISAEEH
                     ERLKRYLGENREATMLWVTSTCQTVCHDPRYSLVFGLARTLRRELELNLNTLEVDSYS
                     SLASDSIIPVYKQVERHKDCHIIPDSEYILQDGKINIARFHWTNLATELCHMPSDESP
                     KKLSMTSCGVLDTMYWKSVDLPTAGKDEVIVDVKFAALNFKDIMVSMGVLGQIEDLGI
                     EGSGVVVQTGSDVQHIHNGDRVLFVASGSLQTRRVIPARMCLKVPECLSLEDAATMPA
                     VFATTIYALLHLARLKKNQVRPLPSIDALDLLPFKYARWWGQMYAYIYLPPRALLKVS
                     QIYATVGNENKAQHLMDTYGIHRDHIFNSRDASFLQDLMRCTGNRGADVVLNSLGGNL
                     LHTSWRCVAPYGKMLELGKRDFLGHGMLSMDLFKSNRAFFGVDLNQFLEECPDEFNDV
                     IFERFLEMVEKRQISPIQPRTIFEASDIISAFRYMQQGVHMGKILIKMPESPGDLPQV
                     KDKKAIVFNPDVSYLLVGGLGGIGQAVARWMACHGARSLVIFSRSAGQSDDHQIFIRE
                     LDAIGCHVHTVSGDVTHLPDVQRVVEGCARPIGGVMNLSLALSDHLYLEMSHDQWTVP
                     NRVKILGTWNLHSVLQNVALDFFVVFSSMSGQVGNPGQANYAAASTFLDAFVQYRHTN
                     GMPASVLDIGCVEGIGILKQAPHVVQRMRAISVRFIEESELMDSLHLAILRSHPELSN
                     KKGPESASLGIGLCPIKSFSQVQDLPFWRTLDARARAIPNYDSFQQSDSNGEPDNLQE
                     LMDEVEANPATLKNPEVEKRIRGEVGHLISTYISNHEDMTDEEINNITIDSLMSIEIR
                     NWTRRRLHVDVAIPEISKAGTVGRLGTLVVEKLKAKYAAQLEGST"
     exon            complement(549651..550529)
                     /number=1
     exon            complement(550596..551076)
                     /number=2
     exon            complement(551126..551562)
                     /number=3
     exon            complement(551617..551922)
                     /number=4
     exon            complement(551976..552833)
                     /number=5
     exon            complement(552883..552908)
                     /number=6
     exon            complement(552989..553055)
                     /number=7
     exon            complement(553107..555259)
                     /number=8
     exon            complement(555331..556282)
                     /number=9
     exon            complement(556340..556452)
                     /number=10
     exon            complement(556512..556635)
                     /number=11
     exon            complement(556694..557647)
                     /number=12
     exon            complement(557709..557882)
                     /number=13
     exon            complement(557937..557990)
                     /number=14
     CDS             complement(join(560509..560697,560760..561104))
                     /codon_start=1
                     /locus_tag="AO090038000212"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000077"
                     /protein_id="BAE64032.1"
                     /transl_table=1
                     /translation="MRPRFSATLILLLGMMGNFGSLLEAKDAPTIIQGMQNLNEKTHV
                     ARQSLEGFDGSFIKGLLLARDLFETTKAAEASRKAFEDADPLSYDDVPDILENYHTVR
                     KTIDDALKAVPAKVDSIDSMGVRMFATGLLRNFAADRTAYEKATKAKIPVENHTSIQG
                     PIDSLANSFDDAISLFI"
     exon            complement(560509..560697)
                     /number=1
     exon            complement(560760..561104)
                     /number=2
     CDS             join(561878..562027,562077..562120,562176..563474,
                     565018..565045)
                     /codon_start=1
                     /locus_tag="AO090038000213"
                     /note="predicted flavoprotein involved in K+ transport"
                     /old_locus_tag="AO070331000078"
                     /protein_id="BAE64033.1"
                     /transl_table=1
                     /translation="MTSKDRLSNSDYFPVIIIGAGLSGIAAGCQLKTKLGLGRFRIYD
                     RNDGIGGTWWIHRYPGVACDVPASLYSYSFAQNPSWSTLKPSGEEIAAYIQATSDKFG
                     LSSHIQLNTEVSSLIWDEQKEEWEVSLHQIPSAHGKSPNCSARRSKCSVRAKIVISAT
                     GKFAVPQTDSIRVPGIETFTGSVLHTARWDANVNLQDKHVVVIGAGCSAAQLVPALLR
                     QYNVRSVTQLVRTAPWVSPTLLSSRQLRVWETYTPWLMQKIPGLSQAVRLVMFLIAEI
                     SFFRIFKAGQHYSRERYESKLRRYMERNSPSQYREILTPHYELGCKRLVHDAGWFKAL
                     WDPRLHITDLRLGRVEKSAVTLTDMRGDYQFAHSHESKIPADVIIMATGYDTSSLLHN
                     IHVIGSGSATLHDYWTSEGIQAYQGLAVPGFKNLFLLLGPNSSSGHTSVMIGVENSIY
                     YILKLIKPILDSEVSCWDIKKESSRVWTESVQKASQESVWVTGRCHSCLYLSERAF"
     exon            561878..562027
                     /number=1
     exon            562077..562120
                     /number=2
     exon            562176..563474
                     /number=3
     exon            565018..565045
                     /number=4
     CDS             complement(join(565654..566679,566768..566806))
                     /codon_start=1
                     /locus_tag="AO090038000214"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000079"
                     /protein_id="BAE64034.1"
                     /transl_table=1
                     /translation="MMLSVLGIVPVLLSLSTNDHEFEAIPDDQLVKFQLFAQYSAAAY
                     CDHNNDDGILGSIRCIEGVCPLVEAANAQTIAEFNEEDIRGFVAVDDTHRLLIVSFRG
                     SNSVRNWIKNFQFWKIDEPGPRGFWDKLFGSDKPQSGNDICSCGIHSGFYRSWQLLKP
                     DVMDALTRAREAHNDYHVVVTGHSLGAAIATIAGAYLRTMQIPCDIYSYGSPRVGDAR
                     FAEFVSAQQGLTARITHGYDPVPSLPPMSLFGIYDLGYRHIWPEYWISGVSLNGTDTI
                     KVCRGLENLSCNGTRQTGFSFEIEDHRNYLGHITACGPKFTYRDMDESWSAEDLDRLR
                     MLAGNDTFFATHYISNGTGV"
     exon            complement(565654..566679)
                     /number=1
     exon            complement(566768..566806)
                     /number=2
     CDS             join(570601..571240,571382..571386)
                     /codon_start=1
                     /locus_tag="AO090038000215"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000080"
                     /protein_id="BAE64035.1"
                     /transl_table=1
                     /translation="MRAFIILPLVTSILAAPTQTLVRRQPDSVIPSAPSGVNVGVKAM
                     AAPAPSAPPQAPAPGGQSGGGSAAGGGLGDLANLIGQGVQGITKLISTIAGAAGGGGG
                     ESGGGGQSSGGGGGNLGDLTNLVGEGVKGLSSLAGAAGDAGSGLGDITSLISNAAGGL
                     GSIGNLLGGLGGLGGLLRRDLDPDLVARAIENMELPDSDDDECIIEKLGGLLPG"
     exon            570601..571240
                     /number=1
     exon            571382..571386
                     /number=2
     CDS             573204..574385
                     /codon_start=1
                     /locus_tag="AO090038000218"
                     /note="hydroxymethylglutaryl-CoA reductase"
                     /old_locus_tag="AO070331000083"
                     /protein_id="BAE64036.1"
                     /transl_table=1
                     /translation="MSKAQPIKRRPDGRSKFDLNIDSPQLQHLTRHIDEAEHVRIENC
                     IGFVQVPVGIAGPLRITGPETTGEYYAPLATCEPTLVASCSRGCKVFNACGGLQFEVL
                     SEAMSRAPMFLFASPAHAVAFARAVPSFRNEFARWAESTSRYVRLQELQASVIGSSVH
                     LFCSYFCGNAAGQNMVSKATQHACEMLRAHRCAKQFQIQDFLIEGQLASDKKPSWGNV
                     QRARGVEALAWGTITNAACQEILGCSTERLYRTQMALKEGGIRNGQFGCNINTANIIA
                     AIFVSTGQDAGSVAEASWSHLTSEYDYESKELKMTIYFPSLPVGTVGGGTLYPSQKEC
                     LDMLGCAEPSGKRRLAGMIAAFAVALDASTSAAIANDTFTMSHMKLARGEIFGPRASK
                     L"
     exon            573204..574385
                     /number=1
     CDS             join(575821..576038,576088..576247)
                     /codon_start=1
                     /locus_tag="AO090038000219"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000084"
                     /protein_id="BAE64037.1"
                     /transl_table=1
                     /translation="MEPSVSDFKLVGLAAGFTLGFGFLTVWNAIKQTSEIEKPYKSPF
                     VILIWIEILSNVVIGVMGWLVLEGIVPVIANTVPPVHLYWRFYYSAGPSRSNVVCKSS
                     LTASTSWWKRRRQRGKSNGALLA"
     exon            575821..576038
                     /number=1
     exon            576088..576247
                     /number=2
     CDS             join(576642..576964,576975..577020,577088..577138)
                     /codon_start=1
                     /locus_tag="AO090038000220"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000085"
                     /protein_id="BAE64038.1"
                     /transl_table=1
                     /translation="MFLPNPMVYIQFHPVTYIVKLNIELKMASLIRKLARDSNINNEI
                     HEASMNLRTRFNPQSHYIKCDDEVREKRNLRHMQFAQLRQQGFESEDMKILKTTSVRV
                     VTSPRPIIYLRCHRCQRMEDELYTRAEFGDCGLVQMA"
     exon            576642..576964
                     /number=1
     exon            576975..577020
                     /number=2
     exon            577088..577138
                     /number=3
     CDS             join(578794..579251,579351..579606)
                     /codon_start=1
                     /locus_tag="AO090038000221"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000086"
                     /protein_id="BAE64039.1"
                     /transl_table=1
                     /translation="MASQTSPQKDSLGHFQSKVRHPKGPERDNALTDRLFLHSETQLR
                     SRLKKWGVTKLSRRRSQNKFIMSHCEDLSNESCFKSPVYSGDDMAHSASTSHSTTKDD
                     FYTPERGDTMHETQTASGIIPHDSFHSSASAMSANTPSWEYHHISPGYHSRFIHPALD
                     YYNPAMEHPKAELTSSQWPMTMSYGMLPENVTHDSAARIYTTAPSGMFMHQPDLVTPF
                     PPQSDWFHPPECQLVYQPS"
     exon            578794..579251
                     /number=1
     exon            579351..579606
                     /number=2
     CDS             complement(join(581828..584106,584163..584331))
                     /codon_start=1
                     /locus_tag="AO090038000223"
                     /note="beta-glucosidase-related glycosidases"
                     /old_locus_tag="AO070331000088"
                     /protein_id="BAE64040.1"
                     /transl_table=1
                     /translation="MASIAHLVVSGLLAATAVNGQNYGGSGRSDDAFSYVQPRNTTIL
                     GQYGHSPAVLPSPNATGAGGWEEALAKAQQFVAQLTLEEKADMVTGQPGPCVGNIVAI
                     PRLGFKGLCLQDGPLAIRVADYASVFSAGVTAASTWDKDILYERGVAMGEEFKGKGAH
                     VALGPVAGPLGRSGYGGRNWEGFAADPYLTGVAMERTIQGYQDAGVQACAKHFIGNEQ
                     ETQRNPNYNPNGTLTDVIQEAISSNIDDRTIHELYLWPFANAARAKVASVMCSYQRLN
                     GSYACQNSKVLNGLLKEELGFQGYVQSDWGGTHSGVSSIEGGLDMNMPGGLGQYGQTP
                     EAGSFFGKNVTFAVNNGTVDISRVDDMIVRIMTPYYWLGQDQGYPEIDPSSADLNTFS
                     PRSTWLREFNLTGERSRDVRGDHGELIRRHGAEATILLKNENKALPLKAPKSIAVFGN
                     DAGDTTEGAVNKATFEFGTLAAGGGSGTGRFTYLVTPLEALKARGKQDNTLVQWWLNN
                     TLIADSDVTSLWVPTPPDACLVFLKTWAEEGSDREYLSVDWNGNEVVDSVASKCNNTI
                     VVTHSSGINELPFANHPNVTAIVAAHYPGQESGNSIVDILYGDVNPSGKLPYTIAKNG
                     SDYNAPPTTAVETTGADDWQAWFDEKLEIDYRYFDAHNISVLYEFGFGLSYTTFSLSD
                     IKTEPLAESISSVPEQLPIQPGGNPALWESVYNVSVTVTNTGDVKGATVPQLYVTFPD
                     SAPAGTPPKQLRGFDKVSLAPGESQTVGFELMRRDLSYWDVVSQEWLIPEGEFTIRVG
                     FSSRDLSQETKITPVTA"
     exon            complement(581828..584106)
                     /number=1
     exon            complement(584163..584331)
                     /number=2
     CDS             join(587641..587703,587757..587843,587942..588158,
                     588207..588376,588428..588592,588645..589086,
                     589137..589654)
                     /codon_start=1
                     /locus_tag="AO090038000224"
                     /note="pyridoxalphosphate-dependent enzyme/predicted
                     threonine synthase"
                     /old_locus_tag="AO070331000089"
                     /protein_id="BAE64041.1"
                     /transl_table=1
                     /translation="MTSTAPTESQKFLSTRGGDYGLSFETVVLKGLAADGGLFLPHEI
                     PTANDWQSWKDLSYAELAFKIVSLYISPSEIPPEDLKGIIERSYSTFRAEDVVPLTHL
                     QDDNLYLLELFHGPSYSFKDCALQFLGNLFEYLLVRKNQGKVGKGALFKASGVWRSSR
                     TDQLADRHHLTVVGATSGDTGSAAIYGLRGKKDVSVVILHPKGRVSPIQEAQMTTCTD
                     RNVHNLAVTGTFDDCQDIVKAMFNDPDSNQALKLGAVNSINFSRILAQIVFYFYAYFQ
                     LARKSPTFKVGDKVRFVTPTGNFGNILAGYFATKMGLPADKLVVATNENDILHRFWTT
                     GRYEKNPVQEQQADGTVKAEACKETPSPAMDILVSSNFERLMWFLAKEQAAAAGLDDA
                     SSKKRAGEEVLAWYQSLKATGGFGPVDKDLLENGRSTFDSDRVSNSETVETIKSCYQE
                     TKYVLDPHSAVAVTVAKRSLAKNGSNVHHISLSTAHPAKFSEVVESALKGEAGFNFDE
                     QVLPDEFKAFAQKETRVTTVENSWEKVREIVKRQAEEDIKAESSA"
     exon            587641..587703
                     /number=1
     exon            587757..587843
                     /number=2
     exon            587942..588158
                     /number=3
     exon            588207..588376
                     /number=4
     exon            588428..588592
                     /number=5
     exon            588645..589086
                     /number=6
     exon            589137..589654
                     /number=7
     CDS             join(592955..593106,593530..593746)
                     /codon_start=1
                     /locus_tag="AO090038000225"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000090"
                     /protein_id="BAE64042.1"
                     /transl_table=1
                     /translation="MRRLKKKRSDSQRGLTLRFQNTSHARHAPPEAIQSKLTPMMMMM
                     NILRRITRLLASQNSNECTITLAKPGTKYQDYLTDPTSYGNGKEVSVKMQEYGPYNMT
                     IADEVRPFAKVHLAFTLVSQ"
     exon            592955..593106
                     /number=1
     exon            593530..593746
                     /number=2
     CDS             complement(594908..596107)
                     /codon_start=1
                     /locus_tag="AO090038000226"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000091"
                     /protein_id="BAE64043.1"
                     /transl_table=1
                     /translation="MASIEIDESTISNQTTQYVYLSRDPAPALAIPPGKDLLNYTAKI
                     ESIFIYEPNTESETCYTFGGSLSLGPGSIAGVVGNGEQFFLQYCVGSDQSRYMLPLVK
                     ASGGYKLHRDVTSEALRDDTILDRMLEEPDNNLADHFATTMFAKGGKKDKAKGAAALT
                     IQTRGSSGDQEHEIKKAIKMLNFIDSMISVYTANKLYQEGNKRGKPISAIDETSLYMK
                     VTAEAYFDAINNKQLAAVIQKKSMASAKFSQTCNRADVHPQFIKQFAQDIKQFDQAEY
                     ATLDKILTEQVRQILDGNIQVNNTLSFTLLVKQPLLKSVPGLKEQIVEPTLRFFYITS
                     TGRTWTEVVKNGKSQSSVQKVQLDFQYIPQVGTINPDLFKPLKKVYGKKIISQDADDS
                     FIQQYTV"
     exon            complement(594908..596107)
                     /number=1
     CDS             596778..597782
                     /codon_start=1
                     /locus_tag="AO090038000227"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000092"
                     /protein_id="BAE64044.1"
                     /transl_table=1
                     /translation="MASTKNLREFLETASKEPKEQVVAGQVPMPPVLLFAPRHHAEDR
                     LHTELLEMTGKIFLELGESLVKKRTYNQIDTADQVLQAMVDVANAAQTAIASEGSVSK
                     LVDVRPSPNMSINRDIPREDLHRELLDVLFSHLIHDKRTLRDLDYLLQKFVNAFSQLP
                     TDAEGKHIVFTFFVNEVDRNNIGTEQSPIYEDVQSIMLNTIRMPTEVYRDLVTKNEKP
                     LKTPATNATSSKNGPERHAPTREQEAPRYSTEQRTSFLDMLRNALGAPDASESDNEPE
                     PPEDKVTLKMDYRIITAKIKPKKFKKAQQDIDDSMRRVVKLGAKEYGERVTKVLYVLK
                     "
     exon            596778..597782
                     /number=1
     CDS             complement(join(598053..598204,598284..598361,
                     598414..598479,598533..599451))
                     /codon_start=1
                     /locus_tag="AO090038000228"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000093"
                     /protein_id="BAE64045.1"
                     /transl_table=1
                     /translation="MFGTPLLLLLPLTTSVLSKTSDAEYNKICPRGDDLVTLPSGNKI
                     RYLCDDCLIDPVAEPRSAKTIEECADICSTEDCKATIWDNGRCFSSKLTYIGPSPGNS
                     PGCIWMTSQTCLDSKDDCAKCVNDKEECENQKRKCEDALAKCKPGDDECEKKARKCQN
                     DLATCEDDKAKAEKKERKCQDDLTTCEDGKNDLEKEKRKCETALASCKPGDEECEKKA
                     RKCRDDLITCEDDKDRSEKKERKCQKELLTCEDEKNECEKNERKCQADLQDSQKKASD
                     LQKSVDQCGNDLDKCKNSGSSWGKTDGEIKCKSGSLTTATLNGNKWYTLCGFIINDVK
                     GGVRGLTLKQCVESCSEDDKLTITTLSCVLPEPQAHIPFKHTVNWTGATPIYRSLYTQ
                     LQYDESYCTLGT"
     exon            complement(598053..598204)
                     /number=1
     exon            complement(598284..598361)
                     /number=2
     exon            complement(598414..598479)
                     /number=3
     exon            complement(598533..599451)
                     /number=4
     CDS             join(600222..600308,600373..600514,600568..601213,
                     601271..601568)
                     /codon_start=1
                     /locus_tag="AO090038000229"
                     /note="aspartyl protease"
                     /old_locus_tag="AO070331000094"
                     /protein_id="BAE64046.1"
                     /transl_table=1
                     /translation="MKPILLAVPLLLSYTAAEIHRVPLEKELLVFGSDDDDTRTSSQR
                     YIGSNTHQKALQDHGPDILGHDIPVKNHRNTQYFSTIRIGTPPQKFKVVLDTGSANLW
                     VPSSKCKTISCKKHKKYKSALSDTYHNNGSEFEIYYGSGGMTGHVSEDIFTIGDLKVQ
                     EQLFGEATKVSGFSNVKADGILGLGFASISVNSIPPPFYNMLDQNLLDEPVFAFYLSD
                     TYKGRTSEITFGGVDEQHYSGEIVKIPLRRKAYWEVEFSGLFFGDHFADVEDTGAILN
                     TGSSLIGLPSGLFETVNKEIGATRDYQGRYILDCDKRSFMPSLTFVLGEYNFTIDPKD
                     YSLQEQNFCMSALVPMDFPGPTGPLVVLGDAFLRRWYSVYDFGNGAIGLAQAKRKE"
     exon            600222..600308
                     /number=1
     exon            600373..600514
                     /number=2
     exon            600568..601213
                     /number=3
     exon            601271..601568
                     /number=4
     CDS             join(602932..605006,605241..605328)
                     /codon_start=1
                     /locus_tag="AO090038000230"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000095"
                     /protein_id="BAE64047.1"
                     /transl_table=1
                     /translation="MLCALLLSAGMLVGPVATQEAEPEQVRLSPPSLSRLGSMPLSPP
                     RSITLKDLRVMKDQYGNEQCCPPGTILVGGQCILPHSNVCPEGTVQEGNVCVGKPLCP
                     PKFHYDGQKCISDHPPRCQTGSRFNGKDCVSTGDPFCPEGSTFNGHSCVSTTPPTCPS
                     GAQLKDNICVTKQSPTCPRGMQFDGEQGCVSTEPPSCPEGAQFSEGLCISVVPPSCER
                     PFVLQGNTCIHSSKPECPTGATFDGTVCVSVTPPSCKTGVFDGGVCKDKQPPICPPRT
                     TLKGSSCTVETGASCPAGQSLSIFQDQVRCCPDGFSWDGSFCVLKREGDNCPPGSHFD
                     GTKCVFTPTVQPICPPRTTWNGKDCILSVPPRCSSGFTFVSGNCVSKDTPECPEGTTF
                     DGHKCVSPTPPRCPGDTTLKGRDCMSSDPPLCPPRTTFNGHSCVLNVPPTCPPGSTLT
                     GHSCRFPDVPDCSGGSFTGGHCVVPVPPKCPPSFIFNGKECIHENRPRCPQNYVYDGK
                     NCVSSDPPDCGSDAIFDGTNCVDITPPKCPDGTSYDGHGCSGGKPPKCPEGMTFNGRD
                     CIDGKPPRCPKDTTFNGEKCVSNEKPECPTGTTFDGSKCVNERPPDCPENTSFNGHAC
                     VSTIPPVCSDGTVFDGSKCVTKNPPVCPPGTRLENGMCVITTDPICAEGTTFNGKMCT
                     TATQAECYQMHENWMLTAGWPCAYALLCQIVTKAESHR"
     exon            602932..605006
                     /number=1
     exon            605241..605328
                     /number=2
     CDS             complement(607045..607638)
                     /codon_start=1
                     /locus_tag="AO090038000231"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000096"
                     /protein_id="BAE64048.1"
                     /transl_table=1
                     /translation="MKFSVLSILTLGLTAGALAAPANMERDLPTITGVLSGIGPKVDA
                     LDSAIQAYTGGDVTKVQQASDSLVDAINAGTTKVSGTSNLSGGDALGLPGPVNDLKQK
                     ITTAVTHLSSKKSQIVQAGKGAQTYNDLIQQKTAAKKLSDTIVSKVPENLQNLASGIA
                     GGISDAIEKGVQDFQDQAGKAGKRDVEGAEAVAAIEV"
     exon            complement(607045..607638)
                     /number=1
     CDS             join(609073..609203,609278..609348,609409..609469,
                     609526..609546,609622..609660,609720..609747)
                     /codon_start=1
                     /locus_tag="AO090038000232"
                     /note="FKBP-type peptidyl-prolyl cis-trans isomerase"
                     /old_locus_tag="AO070331000097"
                     /protein_id="BAE64049.1"
                     /transl_table=1
                     /translation="MGVERKIITRGSGPSPASGDKVSIHYTGWIYDPKKANKGFQGKQ
                     FDSSRSPGRGPLVVNIGQGKVIKGWDEGVMQMSLGEKSTLTITPDYGYGDKAAGKIPA
                     NSTLIFEVELLKIN"
     exon            609073..609203
                     /number=1
     exon            609278..609348
                     /number=2
     exon            609409..609469
                     /number=3
     exon            609526..609546
                     /number=4
     exon            609622..609660
                     /number=5
     exon            609720..609747
                     /number=6
     CDS             complement(610317..611936)
                     /codon_start=1
                     /locus_tag="AO090038000233"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070331000098"
                     /protein_id="BAE64050.1"
                     /transl_table=1
                     /translation="MTPEKAAMSEHIENDNPARHDDIDLPNSSEAHTAIAKEREMTLW
                     QALRLYPKAVAWSLLFSCAIIMEGYDVVLIGSFLAFPAFNEKYGGLMSDGTYGLEARW
                     QAGVNNAMACGQIIGLFLNGLVSERLGYRKTLMACLAATVGFVFILFFAPNIQTLVVG
                     ELFMGIPLGVYQTLVVTYASEVCPVALRAYLTTYVNLCWVLGQLLASGVLKGLAERTD
                     QWAYRIPFALQWIWPIPIFIGVFLAPESPWWLVRQDRREDAVKALKRLTSANADFNAE
                     ETVAMIVYTDALERRAETGTSYLDCFKKSDLRRTEISCCAWAAQSLCGAGLMGYSTVF
                     YQRAGLAVSQSFTMSLVQYALGVVGTFVSWTLMSYFGRRTLYVGGLFILAIVLFVIGF
                     VSIAPSTPAISWATGSMLLVYTFIYDSSIGPVCFALVSEIPSSRLRTKTVVLARNVYN
                     ILNLVTGIIIPYMLNVDAWNWRGKSGFFWGALCVCCLTWSFFRLPEPKGRSYAELDLL
                     FERGVKTREFATAKTGLEDLQGEGKDDMVKV"
     exon            complement(610317..611936)
                     /number=1
     CDS             613092..614816
                     /codon_start=1
                     /locus_tag="AO090038000234"
                     /note="alpha-amylase"
                     /old_locus_tag="AO070331000099"
                     /protein_id="BAE64051.1"
                     /transl_table=1
                     /translation="MSPAPVGEKWWKNSIIYQIYPASFKDSNNDGIGDIPGIISSLDY
                     ITSLGVDVIWISPMYDSPQYDMGYDVSDYESVYPPYGTVQDMEVLIDECHRRGLRIIL
                     DLVVNHTSHEHKWFKESRSSKASPKRDWYIWKPAKYDANGNRKPPNNWRSIFGGSAWE
                     WDEGSEEYYLHLFCKEQPDLNWENQETRRAIYDSAMEFWLQKGVDGFRVDTVNMYSKH
                     PEYPDAPVIDPKSETQMSPALFCNGPRIHEYLSEMNEVLAKYDAMTVGELPNTHTVDG
                     ILRYVSAAQNQLNMVFQFDIVDLGQGKDYKFLTTLPGWTLPELKTAVKGTQVIMKGTD
                     GWSTVFTENHDQGRSVSRFGSEKTPELRVTSAKMLAMMQGTLSGTQFIYQGQEIGMVN
                     APESWTIDEYKDVDSTNYYQMVQKISNNDPLELETAMKSLQRFARDHARLPMQWSSET
                     HGGFSSSEKTWMRVHDNYPEINVKVQEKDDSSVLSFWKQVIQLRKEYADLFVFGDFEI
                     LDEANEKVFTYIKRGQKQSALIVLNFSDDTLKFKQPAGVQDAKVLLRNVEGDLNELQP
                     FEGRVLLF"
     exon            613092..614816
                     /number=1
     CDS             615048..616445
                     /codon_start=1
                     /locus_tag="AO090038000235"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000100"
                     /protein_id="BAE64052.1"
                     /transl_table=1
                     /translation="MEDHPRPRVHKACDACGRRKVRCNGQQRCQQCEHMGLVCTYTDN
                     RLARSRKHALRRGEVISKHKIESSSNVLLAPALSPVSTSYFESLIPEYMHFVYPFNPI
                     MTEDEVQDAVSKMDSDRENAAFVYAFAAATIDLAQSNRPTSSASTHITQLVNQAIETQ
                     PPMFLGFRPSILRTMTNVFIQMCFMSLGQYDLGFIYLREAITMIHLLRIEDKTALANL
                     NPTERARRQRLYWLCFIHERFMSIVHFSPATLSPHASFPEADPTLAPGISQGWTQVIK
                     TFLILEPTFINLWIGDRSQVSAKWVEKKYQELDDARWELEVSMLSETQQADLVITRQW
                     MRTLLWQMAMSNWLLSSRAPCPSLSLELPLRLSGQLRQFLTKISQNTIRVHGSSILTK
                     LVEIINTIADVVIHLPQATLEQTTSRIGDIVFMKSVVFSFHNLQQVSKDILLEKFCLI
                     RDRFPGIEAACQLTF"
     exon            615048..616445
                     /number=1
     CDS             join(622605..624552,624893..624909)
                     /codon_start=1
                     /locus_tag="AO090038000238"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000103"
                     /protein_id="BAE64053.1"
                     /transl_table=1
                     /translation="MADMNLEKFLLFQLHQYGITELLQEAANLANALDYLHNRLQAGD
                     QVYFYHRDLKPSKILIYSTSPSSEYHRVGRWKITDFDLSVVKKPEGHLAVRGFVTRTT
                     DQQSWIPGPYQAPEVCVNDGADFRSNIWSFGCILVRLLSSKLDGARGLMWLDELRCKD
                     VDKVSAYEHDYFYRGDPPNLNPHIKEWINDLPRRTDGYNEEFLSCCRDFLLSTLKVDK
                     YERSSAESVARQLQQLTKLLMPRPGPLFDPEVYPNDSVYDESSRHLLHTSGISGQVVT
                     EDPTFCGYTPGPQPVTGSKSASECCPHNPKHKAHVAQPADRWDWVEKLQTFGYNAQEI
                     NDILLERARDAPWIYFEPEKFYIPLMSTTHHIRRCCHFLGERRQQGSTSDSMDTLQTG
                     IDLAVDSYETVKAVEELCGICGISPKTRITTDWLGSASFTEGNTAMAVTYSLPTDKCH
                     ETRASTIIGRISGALKSFQDAASLLQLRGLCCDSFTVIRHGGWRSELDGVAAGEVVSL
                     GFHLVANLAQALEQSMGKNTPSPRQILSASSAILRLICPEFEVAHGRSDMGASLHLGA
                     LAVQFLCLGFMSYVQAHIGPLEPFFLDTPISRVVLLGLDEDNKYPKLVAKLVDITCLG
                     DMTRGPVWMFFRHRNSEGNQDFKRPYHSDK"
     exon            622605..624552
                     /number=1
     exon            624893..624909
                     /number=2
     CDS             625026..625802
                     /codon_start=1
                     /locus_tag="AO090038000239"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000104"
                     /protein_id="BAE64054.1"
                     /transl_table=1
                     /translation="MTEPWGVQVSYCTGVARRVLLRTTVAHLLRTFFNSPDEHIDEFE
                     RQLRESSRSVQAIHSWIKGLPQKSGQQILGIIRTILNTLKPTGLDPTGKYLCVAWPFD
                     GDTTRCLKVPLGGRNSWVKILEDSHDTATFAYITMECLEAKHVQCKAAREARHEDICL
                     LETTVTRAVRDRPDPWSLKHEEVYFFAKLDSSFWVKVQREHKDGPASLVEMMPLDNLS
                     HDLRQWFRSQEKQQQGRLRECPKARDESETVYVSSARRNH"
     exon            625026..625802
                     /number=1
     CDS             join(627917..628954,629007..629078)
                     /codon_start=1
                     /locus_tag="AO090038000240"
                     /note="zinc-binding oxidoreductase"
                     /old_locus_tag="AO070331000105"
                     /protein_id="BAE64055.1"
                     /transl_table=1
                     /translation="MAHPLPRSMKAWTFTRAGSAEQVLQLSQQHPIPTLRTNTDVLIR
                     ITHVSLHPGTTIMMNLAPSIFRNTPCIAETDFSGLIISAGKGVPVTPSPDNEHRCFPP
                     GTPVFGSIPVGQHLKGAGALAEYLVVDMNCIARKPANVSFAQAAGLPVSGTTALTLMD
                     AADIRPADRVLINAPCGGIGHLVTQLVSHIVAEEGHIVGRCSAASFDVAKTLGCHDVV
                     SYNNSGESSTATDMEVYGEQPFDKIIDARGSQALWYSSPAILKSGADNTYTSVGPVLE
                     SYTYLSMFACLLKMGFNRFLPVWAGGVDRKYRQVTAMVNPDKLERLRKLCEAGQLGVL
                     IGDTWSFEDAVQAFRVMASRHARGKLVICVAEPSA"
     exon            627917..628954
                     /number=1
     exon            629007..629078
                     /number=2
     CDS             complement(join(632145..632768,632825..633054,
                     633273..633442,633492..633595,633657..633692))
                     /codon_start=1
                     /locus_tag="AO090038000241"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000106"
                     /protein_id="BAE64056.1"
                     /transl_table=1
                     /translation="MAPKKIIIDTDPGIDDILGLLLALSATPEEVEVLLISLTFGNIE
                     VRSCLRNVVSMFHILEREMQWRREQGRPEGFGALRAAPPVVAVGAEDPLEDQKMLADY
                     FLEPVPTGNPSRPSFIPSKRRAHEEILRVLRENDPDTVTLVAVGPLTNLALASAADPE
                     TFLRVKEVVVMGGAVNEPGNVTPAAEFNAYADAFAAARVYALTSPSPKTTIPTNSSLP
                     DYPTNLSKQLTLRIFPLDITLRHGVSRGQFRKAVTPHLEKGSPLAEWVSAFMAHTFHT
                     VEKLHTGRVGDDVELSLHDPVCVWYAITAEDEKWKPSATSPEDIRIETTGQWTRGLCV
                     VDRRNRHRIEGDEEHSSDHGLWLSSRAGNRVWRMDASPVEDNFGAVLLERLFT"
     exon            complement(632145..632768)
                     /number=1
     exon            complement(632825..633054)
                     /number=2
     exon            complement(633273..633442)
                     /number=3
     exon            complement(633492..633595)
                     /number=4
     exon            complement(633657..633692)
                     /number=5
     CDS             join(635235..635358,635394..635575)
                     /codon_start=1
                     /locus_tag="AO090038000242"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000107"
                     /protein_id="BAE64057.1"
                     /transl_table=1
                     /translation="MNNMYKDQVPSKSSAIRLGGSGEKQMEGAGVGAQTIELIFAIRK
                     VTPSSQACPLLPLVRPFPLPPSPPPFLFTLPYISLFPPFSSDRNSSRPLSIPPPRFG"
     exon            635235..635358
                     /number=1
     exon            635394..635575
                     /number=2
     CDS             636200..637417
                     /codon_start=1
                     /locus_tag="AO090038000243"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000108"
                     /protein_id="BAE64058.1"
                     /transl_table=1
                     /translation="MMNPYLSWAILLVVAGGLGWYYNGPVPKTKAPIKPIVEKAESAV
                     SAKKPKKKTKKSPEPSPAPAKAEEKPVQTPKIEEVEVADEEIDKKEMAKRFAAVKNGV
                     PLKESSKEGNSGSKAQKKKNKKGSSSQPASNNERSASRVSTRTSSTTGAEADDDLSPA
                     GSPQVNASTSAAGYVSDMLEAPAPAASVLRVTGSLDSDSQKKKQKPQSFKQVETKKQR
                     QQRLKNEARKQQVQEAEEERRKLLEKQLHTARESERREAAKSKPATQPNAWQTQSVNK
                     VTNGNVTNGIHKTAPGPKVDLLDTFEPEKSSAAASSKEWDQGLPSEEEQMRILGAENG
                     EDQWTTVSSKKIKKKGGKADDSEVSAVEDQPTPVAPAPAPVEPKVKITPTYLPDVLRS
                     GKKGHPLDSDWAA"
     exon            636200..637417
                     /number=1
     CDS             join(638858..639024,639157..639269,639352..639845,
                     639898..639962,640026..640098)
                     /codon_start=1
                     /locus_tag="AO090038000244"
                     /note="putative cargo transport protein ERV29"
                     /old_locus_tag="AO070331000109"
                     /protein_id="BAE64059.1"
                     /transl_table=1
                     /translation="MAQIRGTAGYNLGHQNPFGGPGRADATSDPSPLDAIREQTSKIE
                     DWLDTLADPVKPYLPAIGRFLIVVTFIEDSLRIITQWSDQLLYLREYRKIPWGITHTF
                     LILNVLAMSICSFLVIARKHTEIAVAGLLGVVVTQGLGYGLIFDLNFFLRNLSVIGGL
                     LMVLSDSWVRKKFVPAGLPQLDEKDRKMYVQFAGRVLLIFLFVGFVFSGQWSFWRILV
                     SLFGLVACVMVIVGFKAKWSAIILVVLLSVFNILVNNFWTLHPHHPHKDFAKYDFFQI
                     LSIVGGLLLLVNMGPGQLSMDEKKKVY"
     exon            638858..639024
                     /number=1
     exon            639157..639269
                     /number=2
     exon            639352..639845
                     /number=3
     exon            639898..639962
                     /number=4
     exon            640026..640098
                     /number=5
     CDS             complement(641117..642325)
                     /codon_start=1
                     /locus_tag="AO090038000245"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000110"
                     /protein_id="BAE64060.1"
                     /transl_table=1
                     /translation="MWLWRGAQSAVFYYATCTPCAEKVDRRKRMKEAEAARSRREKEK
                     NEEIIADQPRPFPQPTAFSTNPGWAEEIALGPGPPARRGGNRSAHRRTDSWNTDGISA
                     NSCHDVRASQKKDKSSLMQPIEERWNRMRYQREDEPLWGEEMEVKGSSVGLSGSGKAN
                     AHEPSKYYIARVPPVNDLHPPIVSGPKSRAETRWMLQPVPSARVMAGKDRFPTQKSNT
                     IDPSLTREKSTNKTSERTPLPPLSTQNGEKKPARVRPPFAHFDDDDDDDDDDDPRPLK
                     TPEPKDSREYRSPSSLSYGRDESNFVIASSLRSRSDSSSLASIDSDDIESPRVSIQSP
                     QTPISRPMSKEADDGSKLFRPHVSKTLSNLHREDKKVELLHLEISDHHEEVGLGDLEQ
                     IRPWRWSMDI"
     exon            complement(641117..642325)
                     /number=1
     CDS             complement(join(645155..646432,646485..646598))
                     /codon_start=1
                     /locus_tag="AO090038000247"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000112"
                     /protein_id="BAE64061.1"
                     /transl_table=1
                     /translation="MPPPPPPPPPPGGMGGPPPPPPPGALPSRPSGAEAKGRGALLSD
                     IHKGARLKKTVTNDRSAPQIAGGGAKSSGPPIADAPPVPSMPKPPGSAPPVPGQAANR
                     LRSDSGAGSGGDSSAALPAAPQLGGLFAGGMPKLRSRGGVDTGANRDSPYRSESQGSS
                     APKPPVSPAPKPPGARPPPLPSSESPPAPPVNPLVAGLKKPPPRPASRPSSTVSNASA
                     RSASDAPPPRAPPPLPGSAKPPPPPPVSSRKPSTPAPPPPPAPPSTIPAAPPPPPPPP
                     TARPPPPAPARSTPPPPPPPPPPAASAPQPPNGTAAASIAVQAARNAFGHSQQTPSAP
                     PPPPPASSAPSAPPPPPPSAPPSAPPSAPPSAPPSQPPSRPLSHEPLASQLPDRSTLD
                     PSAYTLSNGGPSSGSSPLSSAVQGLIRVEDVRFKFQSEGLLPKPRPFVGGPRRYRAGR
                     GSSVPLDLSALSG"
     exon            complement(645155..646432)
                     /number=1
     exon            complement(646485..646598)
                     /number=2
     CDS             646969..648231
                     /codon_start=1
                     /locus_tag="AO090038000248"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000113"
                     /protein_id="BAE64062.1"
                     /transl_table=1
                     /translation="MKGITLRGQRASIYQPLICQFCRSSASPAPRSRTHFTRSFASTS
                     PFISNRDVGLWKARKNLKSNWATTQIIPSRFASNTSETTIPRDLEDALRQITHDSAEL
                     RQLDSVPSNEAILGLLQRCEKIAEALVHQEQDTTKKGDNEISNLLDLEEKSATKKLTK
                     SPKIADPRLANALSEITYELLTDEKVFISPEALACYTKIQSLLKRAEHFPEIFHLYAH
                     KPVPEENSSPVKFHKANPKDINSAIPTELANMALDVAIEQRNLSLVLAIIDNTFCAPA
                     FARAKVFKKAAVPLGGLAAAPAACYAIASWAATLQNTMDPSTATGIAFAASLAYVGGV
                     SSVGILAITTANDQMERVTWLPGVPLRHRWLREEERAALDRVALQWGFKDIYMRGEEE
                     GEEWENLREFIGMRGMILDKTDLMPGMQ"
     exon            646969..648231
                     /number=1
     CDS             complement(join(648490..648752,648814..649007,
                     649114..649291,649366..649384))
                     /codon_start=1
                     /locus_tag="AO090038000249"
                     /note="60S ribosomal protein L10A"
                     /old_locus_tag="AO070331000114"
                     /protein_id="BAE64063.1"
                     /transl_table=1
                     /translation="MSKITVAGVRQNIQQLLDYSQNEKKRNFLETVELQIGLKNYDPQ
                     RDKRFSGTIKLPSVPRPNMTICILGDQHDLDRAKHHGIDAMSTEDLKKLNKNKKLIKK
                     LARKYDAFLASDGLIKQIPRLLGPGLSKAGKFPTPISHAEDMANKVTDVKSTIKFQLK
                     KVLCLGVAVGNVGMTEDELIANVMLAINYLVSLLKKGWQNVGSLVLKASMSPPKRLY"
     exon            complement(648490..648752)
                     /number=1
     exon            complement(648814..649007)
                     /number=2
     exon            complement(649114..649291)
                     /number=3
     exon            complement(649366..649384)
                     /number=4
     CDS             join(652544..652605,652748..652964,653024..653056)
                     /codon_start=1
                     /locus_tag="AO090038000250"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000115"
                     /protein_id="BAE64064.1"
                     /transl_table=1
                     /translation="MDYLRGNLLRSVDALFPPSFRLQTPKEYYSSFNANSNLQEKFHN
                     IDDEGQFRAYLGYLQDVQTRNFMLDFGNDDAWCAVDLEEEDIATLLRGVKPRFFGTRW
                     M"
     exon            652544..652605
                     /number=1
     exon            652748..652964
                     /number=2
     exon            653024..653056
                     /number=3
     CDS             join(653240..653486,653541..653654,653705..654030,
                     654184..654483,654537..654863)
                     /codon_start=1
                     /locus_tag="AO090038000251"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000116"
                     /protein_id="BAE64065.1"
                     /transl_table=1
                     /translation="MMCTDPVARPSQSTSPLTDGLREKNDERLPRVLRKNDLEEAQEL
                     KDLSDPAEIQAAASFRGLTFAHVTNQIWHFCSVDYGPRYTCIGYNSLFVVPNVESPNG
                     QGLPDGRRLWSWLILCDDGTVISIQENPYPGLSKPSERELKSVLGIIRRNVQLIFSGV
                     SKRHSAQSESDSLVTIRVRPAHGDGPEQASIKQEDGPSLLFYYIFDDWVSSYALVAKR
                     EHQYGVLLDRLSYELIMMRILQRQRHLRDEAKSNRPPLPIGPMFGESEVTDLRQPTLQ
                     SSLSFSSNADTSVGVQLSSPAVARFERLLDRIKLYCLSEIDTCLTEKESLTFLNFNLI
                     ALKDSQAVEKLTRITILLAKVTILFLPVSLMTAYFSTELKNVKGVYTINQYWVSFGVI
                     MFLSIVLLTLFGYLSDTVEGKTIYQSLSRTFVRSSKHKISNRKEE"
     exon            653240..653486
                     /number=1
     exon            653541..653654
                     /number=2
     exon            653705..654030
                     /number=3
     exon            654184..654483
                     /number=4
     exon            654537..654863
                     /number=5
     CDS             656329..657048
                     /codon_start=1
                     /locus_tag="AO090038000253"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000118"
                     /protein_id="BAE64066.1"
                     /transl_table=1
                     /translation="MSTPTVEELLGIINEKDKHMACLQTALRATKETFARQLQDVQRK
                     ATDEKATLYQQLQAALKDVNQLKEDLSRSQKSCLEEVRNLRKQFEFRKQDSNHKLRAL
                     ETQQLSSAGNGHENCWNMTSTRSFTQKPPHQAHHLNGQASSLNVLDARGEFPLYSAAA
                     GGYYDEVKRLLEQGANPSMRTLFQWTALHWAVGNGHAKIAQLLLDYGADINAISDTGS
                     TPLDMARNDTMKGILRQRGAR"
     exon            656329..657048
                     /number=1
     CDS             join(659745..659892,660010..660254,660321..660386,
                     660452..660544)
                     /codon_start=1
                     /locus_tag="AO090038000254"
                     /note="GTP-binding ADP-ribosylation factor Arf1"
                     /old_locus_tag="AO070331000119"
                     /protein_id="BAE64067.1"
                     /transl_table=1
                     /translation="MGLTFSKLFDRLWGKKEMRILMVGLDAAGKTTILYKLKLGEIVT
                     TIPTIGFNVETVEYKNIQFTVWDVGGQDKIRPLWRHYFQNTQGIIFVVDSNDRDRIVE
                     AREELQRMLNEDELRDALLLVFANKQDLPNAMSPAEITQQLGLQSLTRRAWYIQSTCA
                     TTGDGLYEGLEWLADALRKAGRD"
     exon            659745..659892
                     /number=1
     exon            660010..660254
                     /number=2
     exon            660321..660386
                     /number=3
     exon            660452..660544
                     /number=4
     CDS             664443..666860
                     /codon_start=1
                     /locus_tag="AO090038000255"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000120"
                     /protein_id="BAE64068.1"
                     /transl_table=1
                     /translation="MTGKTRRHASAYNSRDAVVDVEKQPFRQKHHRRHSHSSFDSDSG
                     DDSVTSSAASYQPMLDGPARRRPRPVTGFYRVPNRIMRRLCFGLLVALVLFILTLFRF
                     TIRSSVTQVPLEIPKTTPKPPQWESFPFLKRYHGGLRSLVPRKGQVPEYPGDNPDVMG
                     LGGDAEANATNLQARDEALPVLSSVFDPYPNYTSPAYIAKYGEKRECFLDVRETMRIP
                     LVHHYPGVPRGFPEAVMGSNEVIGIQDDVCFDRFGRLAPYGLGYSVRKGGIGAGLEGH
                     REGAEHVWDEFPPVDFRKVDWAAAQNRCLVANGHRFKDLPQPRSNRFLSMPIGVRDLS
                     NKPLEADPVEPEQPQAGTGRLPRTAVIIRTWHDFHYTPEDILYLRSLISELSLLSGGE
                     YTIHFLVHVKDENLQIWSDDETYERVLKDALPEEFRGMGTLWSERQMSLLYPGLEETW
                     TRGLPIHGVYRSSHMPTQYFAQQHPEYDYYWNWEMDARYTGHWYHLFDKVSSWARAQP
                     RKELWERNARFYVPDVHGTWEDFKHMVRVQTEIGTNSPNNLWSAPRPGQDQSPGDKAR
                     LHQQGDKAIWGPERPDERDILEVEGEGIPPTTMDKDRYDWGVDEEADLIVFNPLYDPE
                     GTSWLLRDDVTGYNKENSMPPRRAAIITASRLSRKLLHTMHQEMIHKRHSMFSEMWPA
                     TTALHHGFKAVYVPHSVYIDRRWPTKYLESVFNAGRNGASGGARTSVFGDREHNFRGT
                     TWFYSAGFSPNLWRRWLGYKVDNDGGELAELAGEGRMCLPPMLLHPVKDVEMIIDDGA
                     NEVDPPL"
     exon            664443..666860
                     /number=1
     CDS             complement(join(667197..667911,667970..668538,
                     668569..668675,668735..669344))
                     /codon_start=1
                     /locus_tag="AO090038000256"
                     /note="predicted flavoprotein involved in K+ transport"
                     /old_locus_tag="AO070331000121"
                     /protein_id="BAE64069.1"
                     /transl_table=1
                     /translation="MSLAQNHYVIKLPVTPSRTRSLEPRAIAQQWIANLDVLLNRGDF
                     SQLPELFHQESWWRDMLALAWDLRTIQNCNNIEDYLRQNQPRSQLSAFRLQHEGKFQP
                     TFDRPVEGLSWISSMFFFETRVGRGTGVLRLTQNDAGAWKAYSIYTSLQEFKDFEEPL
                     GSKRPEGTIETMPGGLSQGNWLERRQRQLEFMDEEPTTLVVGAGQAGLNMGARLQSLG
                     VSCLIVDRNERIGDNWRKRYRSKNPANKTLLQTLVTHDPAEFTHMAYLPFPKNWPQFT
                     PKDKLGDWFEAYASIMELNVWLQTSIKSAVYDDAKAQWSVVVTRGDGSERTLHPRHLI
                     WCTGHSGEPKVPTFPGQPQFKGQVYHGSQHNDASKHDVRGKKVVVVGTGNSGHDIAQN
                     FYENGAQVTMLQRSGTYVITAEKGVFMMHEGLHEDNGPPTEEADIMSESLPYPVQFAL
                     AVHFTKRAYAAERDILEGLQKAGFELDFGVDGAGISRAYMTRGGGYYIDVGCSPLIAD
                     GKIKVKRSPKGITGFNEHSLILEDGSSLEADIVVLATGYDNMRTTVRKILGDTVADRC
                     KDVWDLDEEGEVNAVRSLAHLTLTVYPFLYPTIHSVSILSAQLAILTVIQMWRPSGHP
                     GFWFHGGNLALCRIYSKFLALQIKAIEAGLVSQGQDQTQPKL"
     exon            complement(667197..667911)
                     /number=1
     exon            complement(667970..668538)
                     /number=2
     exon            complement(668569..668675)
                     /number=3
     exon            complement(668735..669344)
                     /number=4
     CDS             join(670221..670236,670886..671256)
                     /codon_start=1
                     /locus_tag="AO090038000258"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000123"
                     /protein_id="BAE64070.1"
                     /transl_table=1
                     /translation="MHCGMDYHIHDNPVPKDGNCYATGGHLDPYKRGDQPPCNTTVPQ
                     TCQVGDISGKHGPVWTADGNFEVLYRDFFLSNVEDTIAFFGNRSVVVHLPDNKRINCG
                     NFHLVSDGEEKKKKKKKEEAKEDQGC"
     exon            670221..670236
                     /number=1
     exon            670886..671256
                     /number=2
     CDS             complement(join(671873..672127,672205..674703))
                     /codon_start=1
                     /locus_tag="AO090038000259"
                     /note="pentafunctional AROM protein"
                     /old_locus_tag="AO070331000124"
                     /protein_id="BAE64071.1"
                     /transl_table=1
                     /translation="MSILVRPPKRKLSEIEGLEERNRLSYSGRYPSATPSSHLSSERN
                     SGKDVGYPIITAYPLAEPAEATRESSSRELNSSRASPVSFDGPFQVQRKFAPNVSIVL
                     VGIRGTGKSSLAVILAATSGRRLIDADRYFQQVTGRSRASFKKERGITEYRQQEARVM
                     ENMLSEHKEGWVIACGPGSMERSGQMLLREYAKTHPVIHIIRDPESIQAYLQAWDTDK
                     VRRFLELSGPIYRACSNLEFFNVSETGHGDLTLGKNGQHHSQLELEVDQRSQTFTPFL
                     TLKRLQRDFVRFIAFATGNATDLSNQHASFPLSTQPVETRVFTYAVSVPISTLFTRDL
                     NIEDLESTADAFELKIDVTEGPSSRLGLESTLADRISQTMATIRRNIVVPLIYHVESD
                     VGLVGSASPHNEPLHCSSTAYLNLMHHGLRLAPDFITVDLSYDDGVLSQIIAAKGSSK
                     VIGHFASVQYVEQGWDGPVYLELYERAKRLGCDIVRLTQPASSMDDNHAVQRFRHRIQ
                     ALPGPQLPLIAYNSGSLGRLSCCFNPILTPVINEALLPETQTKNLPCLTLREAQEALY
                     ASFALDPMQFFVFGANVTYSLSPAMHNAAYKACGMPHVYSLHQSPSLRGLNELVANPN
                     FGGTSVSLPYKTEAIPLLHSMSPHARAIGAVNTLIPIRDLEDSALVSKGSSLYLEKSR
                     AGPIKGLHGDNTDWIGICNCLRRGLSPANAIRPSSTGLVIGSGGMARAAVYSMIHLGV
                     QNIFVWNRTFASAEKLAYHYNRQNLPTHSNNAPTTHSTVHVLRSLQDTWPANYNPPTV
                     ICSCIPAHSIGGQPAPNFRIPSQWLGSPTGGVVVELAYKPLDTPLVKQMRALSHRGWV
                     ALDGLDVLPEQGFAQFELFTGRRAPRRLMRTIVLQEYKAEEGQDDQNAIQSRLESLDG
                     QPT"
     exon            complement(671873..672127)
                     /number=1
     exon            complement(672205..674703)
                     /number=2
     CDS             675845..678472
                     /codon_start=1
                     /locus_tag="AO090038000260"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000125"
                     /protein_id="BAE64072.1"
                     /transl_table=1
                     /translation="MSSDMRQASGSSKAKRRLIDADDDNRPNTAADEHASNPKRQRVS
                     RACDSCRSKKDKCDGVQPVCSTCASLSRPCTYKANPKKRGLPTGYIRTLELLWGLVFC
                     KIKGSEDVVRALLKAANMPSHLSTMGKEAEGSDTLLFSWKNSAVLRDVERMLSLLEQP
                     EDEQDKELRAPGDNDSPQDAEGSSVLSSDTLEWYIPEGLGDGRESSLAAGPSPIKTPT
                     IGATAKSHLTRNTRDSGTQTPSPNDATEDPRILVTHPPSLSQSILHSSDSISKYPPRL
                     PSNTWALIDIYFTYTQCWFPILEKHDILRTAFRHSEDDIPVPATSAGSGNHAALWAVL
                     ALASIQEASITATRQLPQAPSDRPNPKQLYATAKSLIPGEEGAYDIGHVQALLILSLI
                     KLGQQEWAAAWVLVGQAVRISQCLRLDRPPSTQSINGDGLKSSGRAKHVFLGCFVLET
                     IVAMQTDQTPSLRKSDLMKIGPINEDGLEEWHPWEDQTGLRPVGLSRGNFHRGPLHAL
                     STFNRLVSLICILNDLCCFKQSMTSSASQLDVLERQLQIYISALPKSYRVDVQANSAK
                     PASPHIFGLEMMYEGVVATLSLQFAVQKNDTNVQEAVHKGRATESSKKLLLLLQTYME
                     TYSLSATFPTFGMVLSLSAPQEAETRNSPLLFDLDSGLKQKLRSFTSHLATVWLVQEK
                     ATSGVRMTMTPSVPSMSATQRPRSLTNPTSADQNSFHLSEIPIPGNATRRAGAIDSTH
                     LDISAADPLLSNSWMRTASNAEDNAALSLPTPASSVNINRGVTETLQQASQPREPTSH
                     RQHASISSSTRPINGAASLPDLNSFQPLQYQTPYSEQNTNIGSFLDMDRYGSLHRPRI
                     APDLDALFDELASLDGTEK"
     exon            675845..678472
                     /number=1
     CDS             complement(join(679136..679153,679260..679562))
                     /codon_start=1
                     /locus_tag="AO090038000261"
                     /note="3-dehydroquinate dehydratase II"
                     /old_locus_tag="AO070331000126"
                     /protein_id="BAE64073.1"
                     /transl_table=1
                     /translation="MGKSILLINGPNLNLLGTREPHIYGSTTLADVEASSKAHAASLG
                     ATLETYQSNHEGAIVDRIQAARGNVDGIVINPGAYTHTSVAIRDALVGVDIPFIELHW
                     NMWL"
     exon            complement(679136..679153)
                     /number=1
     exon            complement(679260..679562)
                     /number=2
     CDS             join(680845..681025,681089..681140,681195..681283,
                     681334..681772,681843..681974,682029..682137)
                     /codon_start=1
                     /locus_tag="AO090038000262"
                     /note="inositol monophosphatase"
                     /old_locus_tag="AO070331000127"
                     /protein_id="BAE64074.1"
                     /transl_table=1
                     /translation="MTVMQFDQEQLDEIYAFAVDLGRKAGQLLLESIEKRIAGEGSQS
                     VEEKENAVDIVTQTDEDVEVFIKTAINEKYPTHKFLGEETYAKGQSRDYLIDEQPTWC
                     IDPLDGTVNFTHIFPMFCVSIGFIVNHKPVIGVIYAPFQDQLFSSCINRGAWLNEKRR
                     LPLIHKPSIPPMPPNAPSKCVFSCEWGKDRRDIPDGNMHRKIESFVNMAAEIGGRNGK
                     GGMVHGVRSLGSATLDLAYTAMGSFDIWWEGGCWEWDVAAGIAILLEAGGLVTTANPP
                     ADPETAPIEDVRLGSRLYLAIRPAGPSATETGRQTQERTVREVWKRVRQLEYTRPGA"
     exon            680845..681025
                     /number=1
     exon            681089..681140
                     /number=2
     exon            681195..681283
                     /number=3
     exon            681334..681772
                     /number=4
     exon            681843..681974
                     /number=5
     exon            682029..682137
                     /number=6
     CDS             complement(682314..683363)
                     /codon_start=1
                     /locus_tag="AO090038000263"
                     /note="shikimate 5-dehydrogenase"
                     /old_locus_tag="AO070331000128"
                     /protein_id="BAE64075.1"
                     /transl_table=1
                     /translation="MAAPQIVNDTRPEEPITCPAELDGVAYLYGHPLLNSLSPPLHKT
                     VYSTLGLNWAQIPLSSVYGTSATYPPPYTLSPPIDKYLAAIKANPKFVGSSVTMPHKV
                     AIMPHLDDLTEDARQAGACNTIFLREEQDGSRSYVGTNTDCIGIREALLQNSPSAEIF
                     QNKPALIVGGGGTARSAIYVLRKWLGASKIYIVNRDASEVATILNEDKERNPTSTQAP
                     LIHVTDPAVAASLEAPVAIVSGIPNYPPKTPEEINARQVLQAFLGEAPSSDEFKGVIL
                     EMCYHPVPWTEIAELASTSGWRVILGSEALIWQGLEQARLWTGQDVVAVPGVVEKVKD
                     MVAQSLAERSSKSNL"
     exon            complement(682314..683363)
                     /number=1
     CDS             join(684745..685281,685346..686059,686129..686491)
                     /codon_start=1
                     /locus_tag="AO090038000264"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070331000129"
                     /protein_id="BAE64076.1"
                     /transl_table=1
                     /translation="MSILSLVEDRPTPKEVYNWKIYLLAAVASCTSCMIGYDSAFIGT
                     TISLQSFKDEFDWDSMSAAHQDLVSSNIVSLYQAGAFFGAFFAYPIGHFWGRKWGLMV
                     SALIFTLGAGIMLGTNGDRGFGLLYGGRVLAGLGVGAGSNITPIYISELSPPAIRGRL
                     VGVYELGWQIGGLVGFWICYGVDETLPPSHKQWIIPFAVQLIPSGLLIIGALFLKESP
                     RWLFLRGRREEAIKNLCWIRQLPEDHVYMIEEIGAIDQTLEHQRATIGLGFWKPFAAA
                     WTNKKILYRLFLGSMLFFWQNGSGINAINYYSPTVFKSIGVTGSNTSLFTTGIFGVVK
                     TVVTFIWLLWLIDRVGRRLLLLIGAAGGSICLWIVGAYIKIARPSERENKQMDGGGIA
                     AMFFFYLWTVFYTPSWNGTPWVINSEMFDPNIRSLAQACAAGSNWLWNFLISRFTPQM
                     FAKMDYGVYFFFASLMILSIIFVFFLIPETKGIPLESMDRLFETQPIWRAHGTLLKQI
                     REDEERFRHDLEDSGFVKSTDRQVEVVDA"
     exon            684745..685281
                     /number=1
     exon            685346..686059
                     /number=2
     exon            686129..686491
                     /number=3
     CDS             complement(686745..688034)
                     /codon_start=1
                     /locus_tag="AO090038000265"
                     /note="predicted dehydrogenases and related proteins"
                     /old_locus_tag="AO070331000130"
                     /protein_id="BAE64077.1"
                     /transl_table=1
                     /translation="MGRLRSFLGNEVSLGPEFIPKSCGMARFVNNLLFNKYIIYTCFL
                     FPYLLTPIHLPSDSSNSTSKMVLRVVVVGAGLIGPRHAKSVISNPDTELVALIDPLPN
                     AARVAQELQTSYYPTVEAMLQAIPKPDAAIVCTPNHTHVPVSRQLLASGIHVLVEKPV
                     SDSIENGLTLLQFGQRSENAHLKLLVGHHRRFNPYVLKTKQILDAGSLGQVIAINGLW
                     TLFKPEEYFAPPGDWRRARSSGGVVPINLVHDIDIMHHLFGPIVRVHAEKTLSQRPNP
                     PHEAEEGAALTLRFASGVVGTFLVCDATPSPHNFEAGTGENPLIPKCSSGADFYRIFG
                     SDASLSVPDMTRWSYDGRPDKSWNQPLTVEKFDVEEATPFDLQLAHFVDVIQGKAEPS
                     CSGEEGLRALLVCQAVRKALETGETIELDQTILEGNR"
     exon            complement(686745..688034)
                     /number=1
     CDS             688497..689597
                     /codon_start=1
                     /locus_tag="AO090038000266"
                     /note="sugar phosphate isomerases/epimerases"
                     /old_locus_tag="AO070331000131"
                     /protein_id="BAE64078.1"
                     /transl_table=1
                     /translation="MPNRLGIGSMSLGRPGIHDLPTKLHQASQFGYKGIELFFDDLDH
                     LAKLLFDGDHILAAHHVRQLCVSLGLSIICLQPFWHYEGLLDRTEHERLLTEKLPKWF
                     ELARILDTDLIQIPSNFLPADAQTGQPRTTGDMSVIVSDLQKIADLGLQQSPPFRFVY
                     EALAWGNHINKWEDSWEVVERVNRPNFGICLDTFNIAGRVYADPTSPTGKTPNAEADL
                     QASIARLRTRIDLSKVFYVQIVDGERLSTPLDESHPFYVKGQPSRMNWSRNARLFAFE
                     EDRGGYLPVLDVAKAFFDIGFEGWVSLELFNRSLADPDPSTPRNHAKRGFESWKKLVA
                     ALKLNTGDASMVHGLDGTISPSTSALPVQHRL"
     exon            688497..689597
                     /number=1
     CDS             join(690242..690636,690711..690730,690938..691438,
                     691497..692100,692359..692378,692413..693933,
                     694035..694093)
                     /codon_start=1
                     /locus_tag="AO090038000267"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000132"
                     /protein_id="BAE64079.1"
                     /transl_table=1
                     /translation="MCQTKMRDRLKHIFRSPLSLRRGQRPPSDSADHLQKSGCITALP
                     LDTPADSSTLPVADFWQKVLHRLSMEDQVLIQKHTTTRSTPCIVSDTPVLLLEEVKQK
                     RELFESRRWNVSLNGYTFRLSDIANKVMTWYQNVVSVIEVYVLILQFLRTAILAYERS
                     TKTSTSATFWTLDYINDYNARFEAIIPRIDYEAQNCERCYSRLDRVISIDQVKRLKRV
                     LEDMERVKAHQNEFRNMNSTFQNIWRFLDDGKREDVLRWTSDIPFEDHHSVARTGRTA
                     NTGGWLFKQRVFQDWQISDDSMIFWLHGIPGAGKTKLVSRVIDEFLQVQGQKLVYFYC
                     NRNEGLRRKPKEILRSFVKQLSITDDQTVIHESLLQVYMDKRQRGFSSTDLSLEESEA
                     LLAQLISIYPKTILVLDALDESEEGSRQGLISYFSRLVEQIQNLKIFITSRRDEDIAC
                     RLKSKANVGINATDSQDDIAKFVSQKIDEDEKNRATPISVELKYDIVRIILDKSQGIR
                     CPRFPSPYVDIRFILESCSNLLVMDSRQFCHLSHLSVNEYFENLWGIAICHANAAKIC
                     LTLMLVANNQYSQESSMYNVMIDNFLAYATQHWFLHIRRYEYYIRNTGDKIDPRLSQL
                     VERFLGRVEESGPAYRSWCERCEHLPGFPIEDLKPFCNPVLAVCRFGFYRIPLTLWES
                     KCINTNQTNKAGNSLLVLTVFSENEYAVQKLLSLGADINGQLDGLLCSGSALGAAASI
                     GNRDIIKLLLSAGAQINQKHAGGIYGGALVASVANPEGRKATQLLLDSGAEINQELDC
                     GIFGSALAAAAARGAGGYNSTISQSLLRAGANVNQALTSGNYGSALAAAASTPIGHET
                     IKLLLASGANVNQRLIWGKYGSALAAASFGSPANTSLLLDAGADVNQLLTSGLYGSAL
                     AAAAYSQAKHSVQLLLNAGADVNQKLTAGLYGSALAAAVAKQGADEEIVQLLLDAGAD
                     VNQKLSSGLYSNVLEAARARTRRELYEILLGVVIGKNQRNFGYTSLEAVAMPIRTQLF
                     LNHCLSNLI"
     exon            690242..690636
                     /number=1
     exon            690711..690730
                     /number=2
     exon            690938..691438
                     /number=3
     exon            691497..692100
                     /number=4
     exon            692359..692378
                     /number=5
     exon            692413..693933
                     /number=6
     exon            694035..694093
                     /number=7
     CDS             complement(join(695863..696037,696092..696441,
                     696510..696650))
                     /codon_start=1
                     /locus_tag="AO090038000268"
                     /note="ethanolamine kinase"
                     /old_locus_tag="AO070331000133"
                     /protein_id="BAE64080.1"
                     /transl_table=1
                     /translation="MWAVLQKWILALPSATDEQRKRRLGLQKELEWAVSELDDGNGIG
                     EDGLVFAHCDLLCANVIAVPSSDAPVTSAGEPTTTVQFIDYEYATPSPAAFDIANHFA
                     EWGGYDCDYNMMPTCAVRRQFLTEYVRSYTQHKGLPESSQKQIIDRLYEDVDRFRGIP
                     GLYWGIWALIQAQISQIDFDYASYAETRLGEYYAWRRELDGSRAKAGEEMPLRERRWA
                     QEV"
     exon            complement(695863..696037)
                     /number=1
     exon            complement(696092..696441)
                     /number=2
     exon            complement(696510..696650)
                     /number=3
     CDS             complement(join(696972..697145,697219..697401))
                     /codon_start=1
                     /locus_tag="AO090038000269"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000134"
                     /protein_id="BAE64081.1"
                     /transl_table=1
                     /translation="MGSTSEPNGCPLTALRYIAQSYNHADSQASALRLVLTLNPHWEG
                     PENNIEFVRFTDGITNTLLKIINRKPGLTEEQIDNEAVLMRAYGNHTEILIDRESKTD
                     SGHTPFLLFAHCANAE"
     exon            complement(696972..697145)
                     /number=1
     exon            complement(697219..697401)
                     /number=2
     CDS             complement(join(699430..699742,699824..700358,
                     700469..700571))
                     /codon_start=1
                     /locus_tag="AO090038000270"
                     /note="Zn2+-binding protein Melusin/RAR1, contains CHORD
                     domain"
                     /old_locus_tag="AO070331000135"
                     /protein_id="BAE64082.1"
                     /transl_table=1
                     /translation="MSKCVHKGCGKVFTDPEEPCVYHPGPPVFHEGQKGWKCCKPRVL
                     TFDEFLEIPPCTTGKHSTVDDTPVEPPKKTDPAAPEIVAPQPVTAPVADSGVPRPTYS
                     PAIAPPSNAATPAPEESESDDPSLEIPANATCRRKGCGANYNSSVSREEEKCVHHPGQ
                     PIFHEGSKGWSCCKKRVLDFDDFLKIEGCKEKRGHLFVGKGKPAGEEKVESVRNDFYQ
                     TPHSVNVSLYLKKIDKNQAKVEFSEKSIDLDLPTTDNKRYKDTYQLFAPINPEKSQFK
                     VLGTKMELTLSKADGTSWPVLRSDDKWSGERIQIGQAGRV"
     exon            complement(699430..699742)
                     /number=1
     exon            complement(699824..700358)
                     /number=2
     exon            complement(700469..700571)
                     /number=3
     CDS             complement(join(701748..701963,702447..703731,
                     703780..703790))
                     /codon_start=1
                     /locus_tag="AO090038000271"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000136"
                     /protein_id="BAE64083.1"
                     /transl_table=1
                     /translation="MPPPSHSRQRMTSQALPELEVLIISTPNNEGRLRSRGVRQSPDI
                     TQGDVVEVSSIDSDQSYHTAVLPQEEGLHLDDGGAQALQVVRLQRAVEERTGRAKDED
                     LTGDAPLLAQIPMFTNGVIQPSISGSNGEDPPVQLSQETADHLVLSYLTREYANLPIL
                     DLLQFQSAYETTRTEQDIAAAPSSFHGILNTIFSLSGLSTPDVNDEDVSSLFSRGQRM
                     SRDMENSGSLCERIQSHILQSQYLYATGNSRLAWMFIGFAIRMAQVLGLHFKIGGQDT
                     RGRRDRELARRLWHSAMILERMIALKLGLPPQTSNPLKVPLPTHWDTDYTDFISGKTS
                     VVTADRPSLIEFLTACARLYSHVEDILAWEDELRMQPNSCALKKLLSFDFKILLKVDT
                     LLYDWQASLPTYLQNDAVGGIWDDPVVCRQRNILRARYLYDLSDVIRRPDIAHPSTGP
                     VAVLDENIRNRLLERTENGSPALSWNRRQSVEDTRGYYGWIESLPIDLAGPLE"
     exon            complement(701748..701963)
                     /number=1
     exon            complement(702447..703731)
                     /number=2
     exon            complement(703780..703790)
                     /number=3
     CDS             complement(join(705229..706082,706150..706297))
                     /codon_start=1
                     /locus_tag="AO090038000273"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000138"
                     /protein_id="BAE64084.1"
                     /transl_table=1
                     /translation="MRSGFHKPGAIPFLALLVFSLLSLLSLAKEWDFYNLRFGYIGYH
                     HNDVRQPSRVRDGPLDVRSRIRTPGSQCKSWTINGYCLPDLDRVHRPRRSVPDTPRSS
                     FEAATAFDPDSIAYLTEEPSTFARGVRAFKSLFIKQTGDSQISKPLATGSASSVASAP
                     SSLTSNVSNLAVISAPPTAEALLPKSYGSNITATTQEAPSQSLQYPRSHLCELWQQAC
                     HATRVYLGNWTFLRERLPSRSEKTTEETLQTSEQTDQDIEEQVAPKGLPSNGSNAALS
                     TLSPSSSQSPAKATDIPDLPVAAEERSKGIGQGPNSQPARGSCMAIVIGLVVGVMWF"
     exon            complement(705229..706082)
                     /number=1
     exon            complement(706150..706297)
                     /number=2
     CDS             complement(join(712972..714794,714845..715031))
                     /codon_start=1
                     /locus_tag="AO090038000274"
                     /note="acid sphingomyelinase and PHM5 phosphate
                     metabolism protein"
                     /old_locus_tag="AO070331000139"
                     /protein_id="BAE64085.1"
                     /transl_table=1
                     /translation="MLPILLFPIVSTLIGSVLAIPISDQQPLGNQLWHSNGDLYSIDK
                     PPDSSSSRGLTGRFLHITDLHPDSHYKTGRSVDEDDACHWGKGPAGYFGAEGSECDSP
                     FTLINETFRWIEKNLKGDIDFVIWTGDSARHDNDERIPRTEEEVSAMNEIIASKFIDT
                     FKEGSSRTPSIPIVPTLGNNDFMPHNIFNDGPNRWTKKFVDIWAKFIPEHQRHTFVEG
                     GWFTSEVVPNRLAVISLNTMYFFDSNSAVDGCSAKSQPGFEHMEWLRVQLELLRSRHM
                     KAILIGHVPPARSGSKRSWDETCWQKYTLWVQQYRDIIVGTAYGHMNIDHFMLQDSHK
                     VDILDASKDSASLAISADTSPLVSIQSRQSYLVDLREDWSKMPSPPPGMSALHELFED
                     SSTEHTEDADPEVLVANKKKRKFLKKIGGPWAERYSVSLVSASVVPNYFPSLRVVEYN
                     ISGLVDATTWAESRDQDTAVASPSSDVIDDDDDDDDAFIEKKKKGKKKKKQPHFKVPK
                     PPSSSAPPGPAYSNQPFTWLGYTQYFANLSKINEHMTNSWEVAGDSINPTDTEVNEVR
                     ETSHNDNAFVFEVEYDTRNDPIYKMKDLTVRSFFELATRIAKESSKKNDFLADSTNVD
                     DYDDDDFERQKKKKKKKHQNKVWRTFFERAFVGYLDSDDLDDLSE"
     exon            complement(712972..714794)
                     /number=1
     exon            complement(714845..715031)
                     /number=2
     CDS             complement(join(719296..719313,719395..719766))
                     /codon_start=1
                     /locus_tag="AO090038000276"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000141"
                     /protein_id="BAE64086.1"
                     /transl_table=1
                     /translation="MSTASATRDGLRTLKRYPSMFMELSTSPNRKCPKILWRWKVWMK
                     TQYALETLQQLIVSRLLVRRLSEALAQVKDEQSYIVVRERVHRNTAESTNARVKWWSI
                     FQLAVLIGEGIFQVWWLKRFFEVKRVV"
     exon            complement(719296..719313)
                     /number=1
     exon            complement(719395..719766)
                     /number=2
     CDS             join(721138..721488,721914..721922)
                     /codon_start=1
                     /locus_tag="AO090038000278"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000143"
                     /protein_id="BAE64087.1"
                     /transl_table=1
                     /translation="MKRKVHDHYFSIANGEYMQRGKVTPEAPGSTKWSAQDDITLQDL
                     RNCNIPWKYISAAMNNKPIEELKERWLNLRDGITQEIVAKPRRETNQMHFVCELPGKV
                     GRNVSFSDPLATNDNVG"
     exon            721138..721488
                     /number=1
     exon            721914..721922
                     /number=2
     CDS             join(723123..723382,723445..723702,723762..724158)
                     /codon_start=1
                     /locus_tag="AO090038000279"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000144"
                     /protein_id="BAE64088.1"
                     /transl_table=1
                     /translation="MRTAGLLSLLLAAIPAVTAERGTLGLALGNKNPDGTCKSTSDYE
                     ADFDALKSLTTLVRTYSANDCNTAVNIVPAAKNKQFKVVLGVWADYDESFNNDFNVLK
                     QIVPGNEDVIPSITVGSETLYRKGLTAQQLLDKIRTVQNAFPKVNVGTVDSWNIFNDG
                     TADPIIQGGVTYFLANGFAYWQGTDIDHATETYWNDTRLAKEHIERIAGNNQDKIIFG
                     NGETGWPTDGGSDYGNAKASTQNAERYWKDAVCAMLTWGVDVFYFEAFDESWKPKSIG
                     DNGEEKDETHWGLFTADRKAKFDLSCPN"
     exon            723123..723382
                     /number=1
     exon            723445..723702
                     /number=2
     exon            723762..724158
                     /number=3
     CDS             725820..732545
                     /codon_start=1
                     /locus_tag="AO090038000280"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000145"
                     /protein_id="BAE64089.1"
                     /transl_table=1
                     /translation="MPLDLDPSVSFANSAHSPPLHSIDTSRLRDDSLLAAPLTSSFTS
                     PGASSLSTTGSPGRRNSFKGTSITSNPPSTLPTLPKYRAAWDSSTSSPENRKAESSIY
                     YTTAWGSPYAAPSPRRLSWSLSQHAGIGRGSRDSSPTSMRSGIYNGSETNNPELVLTS
                     APEEPTTHLHDSIRNRSPGRDIFGRRGGKSIKDFTQDWINQYLSGQPRTERSNWLSDD
                     SGSEAPSFFTAQNHFADDLSDDWLGFEQDKREEDLLRTPTLADFANRGAGTGNGEGSA
                     ARQRTKEYLHRRAETLRQEDFWGFAYDKDPQTITMADTKEVQLPTEPGAKALPSVEKP
                     LPPPPADALNENPLAMENTTNAEAKAVKTPVSDKPAQRIRKKVAWRGKACFVGLPPED
                     KRGSEESGHRLLTVEDVNRRLKSWEEKGYDVRGFSVGASEDYLNTELGGLSRPTWPDA
                     TEVQEEWNSRSYTVCFPNKAVWDAYVNFLQEEKLRALGVFLGDDEVQPSVSPASAAMS
                     QMAPFPGLVSSPPIPTASAASNPLSLSHPFSPQLSQSTNARNGMGSLTSPASQFGVQT
                     PFLGVDQNLLPGYHIPFQPTPPAQGSLTPQSFFNARQAGAASTLAGTLPNLTSILSPV
                     SPLNEQNAFHPGLNEQSGLPKETFGDNMGYDMQDNMTEGQLLRPIRTPTENPDNFHAS
                     TVEIAHPTPRGHSRGHNLSETLQKGLDQYAQSEYHLEESINRQLDEGDREPHGFNSSD
                     ILKSRWALPENTNHDIQHLPQHVHQYYGEAYPGDNAQEGSDIDTNPSLSGTPHGPLAN
                     HIPWHEPKPSAGSYGGGHRSKLSSSTLNVDAKEFDPTAPSSQAFQYQDNSFQFPAAGH
                     PMFAFGSGAGFKQPAGSFNVTAPSFTPGSFNVAAPVFNPTNNHYSADPEQSSGGRTKI
                     FDDVDLSQAQKLTKKSKAIPIVRPDDNEANQYNEEAAENENGRSAAPTDRHKRARRSL
                     EGPDGEAQISVSHALSENINAQATQSSNTTHVSAGGKENTSPDKDGVNSVEREVVPAQ
                     DRKPQERKDTPVSEASTWMPSDTKDESADARADTLEQNQAATTQPGPEEAGDEKTDPK
                     QPLAVEAGTPFIVPKEKEQPMEETTDTRLNGSVLSADAKPFEFKPSVPDFIPVVVEQP
                     KTSPEDVVKKGDIMASQNAVASSPAAHKEDVVPIEPTQSGTDPSGDELRTGAPQSERG
                     VGRESEEESMDDAELNAVMEQLNEDSDVGIERLSTPHPTNRFPESVLGPSKEKRHVHA
                     EIRSEAPSPSPGRGQMSQALNVPKLDFDAQSQFSATPSKNFASTIHSPIRQLVSRNDH
                     ISDWDSVISSGEDEKLANRSRFFDRRIHELVGSVVEERLSPLERALIAIENSISTITF
                     GGSQNKWSWSASVEGEESDADDEEEYEEDASYRERSPARQRGRKFDKLKNVVLEALAS
                     RDAQHAAEKPANSEFAQLQQSVTDLQALTLKKLSQDSTTDLREMIEEVVSAQFSQQKP
                     RASEAEEIGADSLMLQIDGLKEMLRVSDERAEEEYKKRREAQDSVVELQHLLKVSEDN
                     AARHSEAAESAETRLLQFKEEKIPYFEQVQSRSDALEQEHAKLKLTLAEISSKNISLE
                     GTLDEYRFSSDHWKQESEQSKAQIEEMKTENKDLRVTIDHMKSRIEDGLSVRQNLSEK
                     FDRLQDEMATVTRDITRDQASWRKRQEEHVARYNELQAAYNREVKLREKLEVDISELE
                     QQEREAAKLKFIFGQSQQENARLEELVANLRIENHDLEIKAARFEREFNEARESSRVE
                     IQRTRSSLETDVEAANSQVNIVRAELEAQILRLQGQLDSVRLDSDTAQQRYEMLLEEA
                     NETKASAVASMANTHELAMEEQRKLHERILNDLRERHARALHNASEDRQRAESHLTER
                     LELSEDKAKHLQDRVHHLEERLEIAQSAARAAAEAAQAAQAAKAAPVASSSAHSTSPS
                     LSFSEGTMVPEKISPQALRESILVLQDQLQQRETRIEELEQEVASFDKDAPNKLKEKD
                     TEITWLRELLGVRIDDLQDIIRTLSQPSFDHNTVRDAAIRLKANLQMQQQEKERASSG
                     QSFPSFPSLSELTVSPRSLPLAAAAAWGNWRRGRETPNTGTSEQTPSKPSNATAFLSG
                     LLTPPGSNARQATPNATAPVTRGWRQPSESRPLRGYDTTPRQTSARASRMQELPRTPP
                     LLRRSSYDHDAEPTDYGEGSWAEENESTADGLVSASPKETGDGPFGPQIAS"
     exon            725820..732545
                     /number=1
     CDS             complement(733264..734952)
                     /codon_start=1
                     /locus_tag="AO090038000281"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000146"
                     /protein_id="BAE64090.1"
                     /transl_table=1
                     /translation="MAAYLPLEIIQSILLHLDVETYVAARQACRSWRYAASAPYMFRK
                     ALQQVPVSLPPTITTLTQDQWTTYLAQITRLNLLHCRQNIQKSVTQRELPLECSPTTV
                     VGSSSDGRKLVTLKGGRVTVYERANLTSPWEYSRGITLCSQWTSVARAMLEGGTAGCM
                     SINQRYAKQSIAVSSQGDLIAVGLGRTIQIYSLHKDQNLLSPAEYVLGQDNSLASTTR
                     GHYEDTDGVVDTLEFADDDTLLRVSIHKETTIHQPTRVRYLGCPDLAHSQPDLNYWRA
                     NINRIYLDSAALSVALAGQDEYRLIFRGLRLLPPSFPATQQQEQEDQQTSPPTPRYFV
                     ASLQSGVIHSYCIGLATPLTSNSAQTVKVHRLLPSAYFRPGDGITGSRTEELPPLNPP
                     LPSSRCDEQHITYNLLDTVPRWNAANLPSATFSSPLLSISTDHKILALYEPSGNYSPA
                     IVSGGSLYLYCLENCHPVYQPGPQRFKQPTQKTSLPHQRATGPEDKSSVDARYPPPDI
                     VPSWPFLLDKVPVDIDSLEVKRPTHDDGVVNSKSCAYTVTAHSGGQVLEWRMSA"
     exon            complement(733264..734952)
                     /number=1
     CDS             complement(join(735902..736672,736765..737568))
                     /codon_start=1
                     /locus_tag="AO090038000282"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000147"
                     /protein_id="BAE64091.1"
                     /transl_table=1
                     /translation="MGRLSYPQELDSPSRQLVLELARDLEQLRVHNTELKKVKAYERR
                     SFYESLDRIDSELEAQHNEALDKVAKLHDQVLEEAEETLRVHQRAVEEENRRKEEEAR
                     KEAERIEREKAERLRREQEEAARREAERKAAEEARKKAEAEAERQRRAAQEEKERKEQ
                     ERLEEENRKRQAEAHKAEQEAARLKAEAAQKSREEQQKKVGGARLTEEEINVQARYVE
                     LHQHLKKFRQYLKDEGKSNMVVKQNMGDMRRSIKKCVGQLREGKGTNKGQLQEIRATL
                     EKAASIPEPSVDIRQFMAFPPEDIANSDDNKVPALLIYALNIFSKSLISSLITEASIN
                     PGHAEPVGIVAAQIFSTDAFIYKGHHMVDILWAKYRVVCPALWGFYGNEKTEAGRRAL
                     GWWREAPGGPFISEQVHMDRMTALGAGFAALTLRNFGKTPRKNPFPNHMFWLAMHKIL
                     MIPPSEIQETHVILLSAMLKSSAERIVGFFGHIGLALMRKAIVDLPSSVPRQSMGVNQ
                     LKLLKDLYKREKNIII"
     exon            complement(735902..736672)
                     /number=1
     exon            complement(736765..737568)
                     /number=2
     CDS             join(740930..741026,741101..743712,743775..744134,
                     744234..745240,745295..745334)
                     /codon_start=1
                     /locus_tag="AO090038000283"
                     /note="exoribonuclease R"
                     /old_locus_tag="AO070331000148"
                     /protein_id="BAE64092.1"
                     /transl_table=1
                     /translation="MDQQGQSGVPGPAGRKLHIAHRRSPSELTPLMMEQLAIQQQIEL
                     LQQQQQQIAATHQQYVNMGLLQPQQLGQVSAFSPSLQGGASMGGVSPQINAFQFPQIP
                     QQQLGVPMNSPGQHSHRRNQSALPGLGLGPPPAPSSGASGYSDYNQPQGNQPKNDNGG
                     HGRGRGGPPGGGHQRRHSLALPEAKKAAELAQQKRTASGFQFPAPGAGAESSDNAAGS
                     DDKSTASTTPGPQGLGLHRAGNIRAGGHGRSQSMAVGSNRGSLSGRGAGGFQFPSSND
                     SENPRRGSAHARTSSRNFDGNWRQPNNQNQGQDQQKSFAQQGSGFQPGHRARASMNQS
                     IGSIGSFQYPGQPQLIQLPQGQVVMAPPQMFGGGQQLNPLQLAQLQALQQNGQLNGQG
                     LGLQASQHAPPQLSAQQQQQQQQQQRKTLFTPYLPQANLPALLSNGQLVAGILRVNKK
                     NRSDAYVTSPDLDADIFICGSKDRNRALEGDYVAVELLDVDEVWSQKREKEEKKKRKD
                     ITDARANNNAGTDKLSRSDSGANGDRQEVGPDGSIRRRGSLRQRPTQKKNDDVEVEGQ
                     SLLLVEEDEISDEQKPLFAGHVVAVIERIAGQMFSGTLGLLRPSSQATKEKQEAERLA
                     RDGPHGRSQHERQQDKPKIVWFKPTDKRVPLIAIPTEQAPRDFVEKHQDYANRIFVAC
                     IKRWPITSLHPFGTLVEQLGEMGDLKVETEALLRDNNFGSDEFSDAVLKSIGWEDWSV
                     ASQGEALLASRRDFRQETTFSIVPSGTKELENAYHFRPLGDGKVEIGIHVTDIAHFVK
                     GNSLVDREAKKRGTAVYLVDRLVNMLPRRISTELCSLLPGEDRLTVSVVLKANPETGA
                     IDDDVWIGKGIIKSAGRLSYEEVDAVVQGASDLSVPEIKADTLRALYAVASKFREARF
                     GNRVAHIPPLRLLHQMDDENVPVEYNIFNSSPVRDIVEELSHKADFFVARKLVAALPE
                     KAFLRRQPSPNVRRLHLFIDRMNRLGFDLDPTSSGTLQSSLCKVQDDDLRKGMETLFV
                     KAMQRAKYYVASSVQDEQRHHYTLNLPVYTHFTNPSRRYADIIVHRQLEAILSNGAIE
                     FSDDIETLNKAADVCNNKKDSAHNAQEQSVQIEACRNMDKKRQEIGGDLISEGIVLCV
                     YESAFDVLIPEFGFEKRVHCDQLPLKKAEFRKDSRVLELYWEKGVPSSAYIPEDERPK
                     PANSRAAQAAAAAREAEAARERAREREEAMRKQTETGTISTNDVDALFDDDDDDVSEV
                     TEMAAGVSLNSSADRSTQSMPPSPTRNGHLQQSPHRTRSDPKIATISGDAPEAKLTNK
                     EKYLQLFKLREEDGEYIQDVTEMTRVPIILKTDLSKSPPCLTIRSVNPYAL"
     exon            740930..741026
                     /number=1
     exon            741101..743712
                     /number=2
     exon            743775..744134
                     /number=3
     exon            744234..745240
                     /number=4
     exon            745295..745334
                     /number=5
     CDS             complement(746197..747087)
                     /codon_start=1
                     /locus_tag="AO090038000284"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000149"
                     /protein_id="BAE64093.1"
                     /transl_table=1
                     /translation="MTSIHAPVPTDLKSAAAEAKTKGEDAGTTIPEQEEPRLLRSRKG
                     TRVQSVTMKKKTTRKNGERASSRSQRQSNSPGPETPAEEQQSEIHREADSTISDDESE
                     NLSNASKENDPALSPSPVKFAPPSPRKNALGKRPLSVLTLPLDTDPFAMDPDDSDLEG
                     MTASEKNIAANNYGGSPERDPFPQRKSPKLSVRSKGVNSSGRIREEVKIFEDASEPLD
                     FDRCHSGDGKENHGSLAGPKGLGVASRQALPTCPPTSLAPSSTSAPSSSKTSKAVSGT
                     RKVSGSNMKKAKPRIGIRRL"
     exon            complement(746197..747087)
                     /number=1
     CDS             complement(join(747150..747590,748504..748521))
                     /codon_start=1
                     /locus_tag="AO090038000285"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000150"
                     /protein_id="BAE64094.1"
                     /transl_table=1
                     /translation="MTDAMHVSSLKRLAADHAALHDDLPPNYLFPSEDSSSDDLTQLT
                     TLLAGPQGTPYSQGLWRVHLKMPDDYPKSPPKATFKTRIWHPNVEELTGAVCVDTLKR
                     DWKATLTLKDVLVVSMHRRCEGYNRTEANELRRAYRRFHACSFIPTRILR"
     exon            complement(747150..747590)
                     /number=1
     exon            complement(748504..748521)
                     /number=2
     CDS             complement(join(749444..749893,749956..750018))
                     /codon_start=1
                     /locus_tag="AO090038000286"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000151"
                     /protein_id="BAE64095.1"
                     /transl_table=1
                     /translation="MRATFILAAFAAVAAAQTSSAVESPSDVETTGVAETGSATATAT
                     ATGGAETGSTVIPTVTSQPVIPSGTATEAPTTPTGSGAESSGAVTGSSSAGSSTLVTK
                     SSSAAKSSSATATETSTKTKSTDESTSTKGSSSKSSAAASSTSEGAAVPMATAGPLGL
                     IAGAAIAALL"
     exon            complement(749444..749893)
                     /number=1
     exon            complement(749956..750018)
                     /number=2
     CDS             complement(join(755116..755345,755402..755778,
                     756030..756069,756158..756197))
                     /codon_start=1
                     /locus_tag="AO090038000287"
                     /note="elongation factor 1 beta/delta chain"
                     /old_locus_tag="AO070331000152"
                     /protein_id="BAE64096.1"
                     /transl_table=1
                     /translation="MGFTDFVSEAGLTVANNWFATRSYVIGDAPSQADVVTFKAFSGA
                     PDAEKYPHVARWYKHIASYEAEFGSLPGDASKAYTTYGPEATELPTNPKDKPADEDDD
                     MDLFGSDDEEEDPEVARKHAENLAAYKAKKEAKGPKPAAKSIVTLDVKPWDDETNLEE
                     MEANVRAIEKDGLVWSASKWVPIGFGIKKLQINLVVEDEKVSLDELQEQIQEDEDHVQ
                     STDIAAMQKL"
     exon            complement(755116..755345)
                     /number=1
     exon            complement(755402..755778)
                     /number=2
     exon            complement(756030..756069)
                     /number=3
     exon            complement(756158..756197)
                     /number=4
     CDS             756588..759023
                     /codon_start=1
                     /locus_tag="AO090038000288"
                     /note="chaperone HSP104 and related ATP-dependent Clp
                     proteases"
                     /old_locus_tag="AO070331000153"
                     /protein_id="BAE64097.1"
                     /transl_table=1
                     /translation="MASRLQLARGRLLRSPALSSPNRIFHPTQQIRLPPHTRVLPSVI
                     TKTSLFQPVSPARNYASGRPHPPGGTHRMNLGGEPEKSALEQFGVDLTAKAKAGKLDP
                     VIGRDAEIHRTIQVLSRRTKNNPVLIGAAGTGKTAVLEGLAQRIVQGDVPESIKDKRV
                     ISLDLGALIAGAKFRGDFEERLKSVLKEVEEAQGGVILFIDELHTLLGLGKAEGSIDA
                     SNLLKPALSRGELQCCGATTLNEYRLIEKDVALARRFQPIMVGEPSVPATISILRGIK
                     NKYEVHHGVRITDGSLVAAATYSNRYITDRFLPDKAIDLVDEAASALRLQQESKPDVI
                     RELDRDITTIQIELESLRKETDVSSRERREKLQEDLKAKQEEAAKLTETWEKEKAEIE
                     TLKRTKEDLERARFELEQAQREGNFAKAGELRYSTIPSLEAKLPKEGEEQVAGSQSLI
                     HDSVTADDIANVVSRTTGIPVNKLMAGEVEKLIRMEDTLRQSVRGQDEALSAVANAVR
                     MQRAGLSGENRPLASFMFLGPTGVGKTELCKKMAEFLFSTETAVVRFDMSEFQEKHTI
                     SRLIGSPAGYVGYDDAGQLTEAVRRKPYAVLLFDEFEKAHRDISALLLQVLDEGFLTD
                     AQGHKVDFRNTLIVLTSNLGADILVGSDPLHTLKQTDNDEISPDTKKAVMDVVQHAYP
                     PEFLNRIDEFIIFKRLSREALRDIVDIRLKELQSRLDDRRMTLQVDSEIKDWLCEKGY
                     DPRYGARPLNRLIAKEIGNRLADKIIRGEVTSGQTAHVSFNADKSGLEVTAEGTKTED
                     ATNATYPTETENP"
     exon            756588..759023
                     /number=1
     CDS             join(760924..761005,761109..761153,761178..761408,
                     761473..761563,761688..761706)
                     /codon_start=1
                     /locus_tag="AO090038000290"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000155"
                     /protein_id="BAE64098.1"
                     /transl_table=1
                     /translation="MCTLTFPDSSSFGSGSTIQSWTNDPRDNRELDKLKDSYDGLSNI
                     ASTIPENLDIDVNVIYFPQLGFNIAIPLNERAEAAFTGSDDDWELIFVTENRAYFKDF
                     RMREMDEKLGDIYGLICEIEIVYELAQKVLQYEKVLLEASDICGHIDSIKGGR"
     exon            760924..761005
                     /number=1
     exon            761109..761153
                     /number=2
     exon            761178..761408
                     /number=3
     exon            761473..761563
                     /number=4
     exon            761688..761706
                     /number=5
     CDS             complement(join(763271..765039,765097..765277))
                     /codon_start=1
                     /locus_tag="AO090038000291"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000156"
                     /protein_id="BAE64099.1"
                     /transl_table=1
                     /translation="MGKRKASGRPAARKESAPERTKFSIEERFDDSEDEFQTGRDHVL
                     LEEEPEAKRRRKVIQEEEMLQPSDEEILGYESVDEDDLDDDEDMDEEHDYGEEDEIDD
                     EELLRPRTKRGGAAGSDSEDEDEDGIAAWGSSKKDLYNADQIETEADALEEEEEAKRL
                     QQKHLQAMNEADFGFDETEWVESGKGQEDGEGDAGEVTEVLPQLEITDDMSTDEKLKI
                     LKSRYPEFEPLAKDFINLQTTHRTLAEAAKAAKTTKDEVPEVAPVAVIKFRALSAYLG
                     TFTMYLMLLTSSRDASGNPAPLSPAQLRSHPVMGALVKFRKLWESVKDLTAPEVSDVE
                     EDMDSEGEESDAPVSKKQSENKEVQVPKKKKEKVSKAQRAAEAAQAEAEARRAQRLRE
                     TEANLADLSNLVTKSGKKKSTQKAKQSSKAADDSDFGDEDALTAKEAEEKANQKRSLR
                     FYTSQLAQKANKRTAAGRDAGGDADIPYRERLRDRQARLNAEAEKRGRQKPKESEQLG
                     GDSDDEDHRVANELRGDQGGSDDDDYYDMIAARSKQRKDDKKARAEAYAAAAREGGEV
                     AIQEEIGPDGKRAITYQIEKNKGLAAKRSKDSRNPRVKKRKKFEEKKKKLGSIRQLYK
                     GGEGRGGYGGELTGIKKNLVKSVKL"
     exon            complement(763271..765039)
                     /number=1
     exon            complement(765097..765277)
                     /number=2
     CDS             join(765763..765840,765908..766053,766115..766925)
                     /codon_start=1
                     /locus_tag="AO090038000292"
                     /note="predicted 3-ketosphinganine reductase"
                     /old_locus_tag="AO070331000157"
                     /protein_id="BAE64100.1"
                     /transl_table=1
                     /translation="MVSRIFPGLKMLGFGPQQNEFVVEGRTVVITGGSEGMGKAVACQ
                     LAAKGANVVLVARTVKKLQDALDDVKVNRYVQKFHYISADLTNAAQCEQIIEEVTEWN
                     YGLPPDVVWCCAGYCNPGFFVDTPVQTLRDQMDTVYWTAANTAHATLRKWLVPVPPSQ
                     QTTNPRRHLIFTCSTLAFVPIAGYGPYSPAKAAIRSLSDTLNQEIEMYNGTRQSKSQI
                     NATPADVKVHTVFPMGILSPGFDNEQKLKPELTKQLEAADKPQTPNEVARIAIAALER
                     GEYLITTMFVGHVMKGSAMGGSPRNSTVRDTLTSWLSSLAFLQVVPDLRKQAWNWGMK
                     NGIPSSRTSE"
     exon            765763..765840
                     /number=1
     exon            765908..766053
                     /number=2
     exon            766115..766925
                     /number=3
     CDS             join(767769..768248,768306..768353)
                     /codon_start=1
                     /locus_tag="AO090038000293"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000158"
                     /protein_id="BAE64101.1"
                     /transl_table=1
                     /translation="MDALLSLPVLSLFLVPTISSYSTSLNIIFFYMTWTTLVLSHPPL
                     RVELFGTAAVRLLFFLLPSLLFFLFDILTPSAAVVVKAQGEAGLPSGSKRGKVRMKDL
                     KVAGWAILNILLGFAAQAAIEEVRTELIGMRSALRVSMKLPMPWEMVKDLLRGLLARE
                     RTIMKHRKAKEKALE"
     exon            767769..768248
                     /number=1
     exon            768306..768353
                     /number=2
     CDS             join(768547..768805,768913..768980)
                     /codon_start=1
                     /locus_tag="AO090038000294"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000159"
                     /protein_id="BAE64102.1"
                     /transl_table=1
                     /translation="MPAMFFRFHMLTYLLYLTVISIEETFAFSGYSVMPTSFFLGGIA
                     RRMDMHLLSGAEGNFGPWGILDWICGTTVGGDEDEEELEEALRLLMQCAVRIYGSCSR
                     RLGYVP"
     exon            768547..768805
                     /number=1
     exon            768913..768980
                     /number=2
     CDS             complement(join(769638..769781,769894..770229,
                     770477..770575))
                     /codon_start=1
                     /locus_tag="AO090038000295"
                     /note="60s ribosomal protein L6"
                     /old_locus_tag="AO070331000160"
                     /protein_id="BAE64103.1"
                     /transl_table=1
                     /translation="MSETKQFGKGQRTVPAQKAQKWYPVDDESQPKKVRKAVRPTKLR
                     ESLQPGTILILLAGRFRGKRVVLLKHLDQGVLLVTGPFKINGVPLRRVNARYVIATST
                     RIDISGVDAQTVEKVSTPDYFTKEKKAEKKTEEAFFKQGEKPEVASARASDQKAIDQS
                     ILASVKKENFLGSYLASTFSLRNGDKPHEMKW"
     exon            complement(769638..769781)
                     /number=1
     exon            complement(769894..770229)
                     /number=2
     exon            complement(770477..770575)
                     /number=3
     CDS             join(771041..771091,771193..771752,771938..772481)
                     /codon_start=1
                     /locus_tag="AO090038000296"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000161"
                     /protein_id="BAE64104.1"
                     /transl_table=1
                     /translation="MSITPIITFKAGICDLETSGDNSTVKPKPTPGYIYLYSEDELVH
                     FCWRPRTAPHTEPELDLVMVPSDGTFTPYKPAGNANPTNGRIYVLKFSSSSQRYLFWL
                     QSKSQHEGEDPSWFSPRDLKLGDIVNTLLQGEDVDVEHEIANLPRGPSDGDDETMEDV
                     EGVDHNPNHNHGGNSGGAGPDATGGDIREEGEESREGGADGGRAAAADSDPSSVVQSF
                     LQSLQRNSSQSQDPDKPFTTLQDLLPPAATLPFLEAADDKTVDNLLSFLPPALLLLAQ
                     DVEDVSSIDDPELTEAVMASLDLSQKKNILRKVLHSPQFSQSLASLTVAIRDGGLPSI
                     SEALKIPVENGGFMRRGGVPLGGGDAVEAFLQGVRNHVKDSDKENQMETD"
     exon            771041..771091
                     /number=1
     exon            771193..771752
                     /number=2
     exon            771938..772481
                     /number=3
     CDS             join(773451..775016,775069..778075,778141..778904,
                     778994..779929)
                     /codon_start=1
                     /locus_tag="AO090038000297"
                     /note="voltage-gated Ca2+ channels, alpha1 subunits"
                     /old_locus_tag="AO070331000162"
                     /protein_id="BAE64105.1"
                     /transl_table=1
                     /translation="MASNSHDRGTNDDSHPTEHSIPLQDLSGSLSHGTTATVGSSFRP
                     GRSLTRRGSNYERLAVDSPVEGPTATQNARQRRGSDAAPVDNPEAFAQAMSSVGLSFD
                     GPTSPRTSARYSRDETGSDFDIVHLDSFGQQEAAHYLSPNTFTDTTPLTDTRNVQPIS
                     GAASSSLSLPLDDRSSARTVHFPTSNAGSHLGDDLEGGFSGRRRGGSSATDRARSLSP
                     SASGSALQRASSMMKSMSQRVVNLSNEPEVVEQSILREESQRSARLDAPPSLPSLPGY
                     AHDAPSTSSLDTQAKWRDHNNPLRGKALGILGPSNPIRVKLCDLLVHSFTEPFILVVI
                     VIQMILLTIETARPEFTRSERWGGNPMDYPYFVIFIIYTLELIAKILVSGLILNPAEY
                     STIDRSLGFRKAFMEKGKNLITPQRQFSTRRPSTVPEQPQASIIRTFTGGLNQLDRQI
                     ADDPVQKRRVRLAHRAFLRHSFNRLDFVAVFAYWIAFFLAIEGVESRQQLYVFRMLSC
                     LRLLRLLALTNGTSVILRSLKKAAPLLAHVAFLIGFFWLLFAIVGIQSFKSSFRRTCQ
                     WIGKDGQESFTLNDPNGSLQFCGGYINETTGKEHPWIPVSDNSQSPPSAKGYLCPAGS
                     ICIENEMPYKGTMNFDNILNSLELVFVIMSSNTFTDLLYYTTDTDYLAAALFFVCGFI
                     ILSLWLVNLLVAVITHTFQVIREESKRSAFAVQKLDNVEKENLDQRKRSTLKRFYDKT
                     EWLWVCVITFDLVVQALRTSTMSPGRENLINNTETIVTLILLAEIIMRFASDWRKFHK
                     KRRNWVDLGLVIITCIIQLPPIRDSGRTYTVLTMFQILRVYRVVLAIPITRDLITVVF
                     RNTVGLLNLIGFLFMITFIASIFATQLFRGSIPEDEDVDINFNNIYNSFLGMYQILSS
                     ENWTEILYNLTTYTYPYSTAWISATFLILWFIVANFIVLNMFIAVIQESFDVSEDEKR
                     LQQVRAFLKQKHLNGSSQGNLSLSKILRLGRNSDRYKEPLDYGPAALEMLLKDAVVQE
                     FLDEQHAPAEHQRGESGPAETTTTEETGQPGIFSRMWTAISTSIMRKEPNPFYTNLNK
                     YSRANEELDPREMAKEVVSATEQRKRAQREYLMRHPNYNKSLFIFAPDNPIRRLCQRI
                     VGPGRGHQRIEGVDPYKPVWYAFSAFVYAAIIAMVLIACITTPIYQRENYPTRRLWFV
                     YTDMGFAILFTLEALIKVIADGFFWTPNAYFRGSWGFIDGVVLITLWINVGGAMFEDW
                     AVSRSVGAVKALRALRLLNVSDSAKDTFHSVIIVGGWKVIEAAAVSMSFLIPFAIYGV
                     NLFAGQMVTCNDDNVTGSLDECINEYSSSPYNWEVLAPRAASNPFYDFDNFFDSLFIL
                     FQIVSQEGWTDVQAKAMSITGVGMQPQSSTAPENGLFFVVFNLLGAVFVLTLFVSVFM
                     RNYTEQTGVAYLTAEQRSWLELRKLLKQVSPSKRSFDKKSHKWKMWCYRIAVKKHGRW
                     ARCVSTILVLHILLLVLEYYPEPFIFEFCREVLFLIFNFFYAANLIIRLFGLGWHRFS
                     RSSWDLYSLLVIPGTIVMTILNFLSDRQVIVELSKLFLVAVTLLIIPRNNQLDQLFKT
                     AAASLTAIGNLLATWLVLFLVFAIAMNQTFGLTKFGGEENNNINFRDIPRSLILLFRM
                     SCGEGWNQVMEDFATMVPPICTTNDDFLHDDCGSAAWARTLFIAWNIISMYIFVSLFV
                     SLIFESFSYVYQRSSGLYAISREEIRRFKQAWATYDPDGTGYISKEQFPRLLGELSGV
                     FSMRIYDDEFTIGRILEECRVDRRDSLIAHRRVVDGVDLEKMAKILRRIPVDDVRERR
                     QRLNTFYEEVKVSADPVRGISFHSCLMILAHYNVINDSKSLKLEEFLRRRARLQRVEE
                     AVRRQTVIGFFDTLYWSREFRRQVERSRSARMTAVPNFTVPEIFVDDGSQDDHPHEEV
                     RATVPEAGDDHGESSSQPMLSPLSPTRGEGGPSSQPGHLPRIDTALAGRMSATHSPTE
                     WSSISPSLSPNRPRANTTSSYGDGPDLHDELSLAPERSRQNSAMSAQDVMQSLDDSIW
                     GESIRRSFTQRRRRDS"
     exon            773451..775016
                     /number=1
     exon            775069..778075
                     /number=2
     exon            778141..778904
                     /number=3
     exon            778994..779929
                     /number=4
     CDS             join(781391..781878,781982..782045)
                     /codon_start=1
                     /locus_tag="AO090038000299"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000164"
                     /protein_id="BAE64106.1"
                     /transl_table=1
                     /translation="MRPNLNSTPGLSLHTSFQPPQDRVCSDGYSTASPLSSTTNSPTS
                     SPTSPFRRFNRGYRPTSGSRSDASDAGSRSQSPFRLSSVFRRPSLVFIRHRPSKVDLA
                     LSEERTRCDEDAIERQGLDLMEPRPVDPVGIPMDLNANIFSSVAGDRSSGQSQASQVS
                     QPRLFLDSTFAIIATREAIWYIN"
     exon            781391..781878
                     /number=1
     exon            781982..782045
                     /number=2
     CDS             complement(join(782963..783417,783484..784270,
                     784288..784353))
                     /codon_start=1
                     /locus_tag="AO090038000300"
                     /note="proteins containing SET domain"
                     /old_locus_tag="AO070331000165"
                     /protein_id="BAE64107.1"
                     /transl_table=1
                     /translation="MILFSTSRESLLRPQWNPLRLQNNLPNGSTIATTKLQSSTPSPS
                     PVIKEQSLPARAISVVVPSPSSQLKKEIESAKWASSSQSCTPELKGVLEKFYPTNAHV
                     ERGRKGAYPAARKVNRAAIPLPTGTPGPILQKRPEALDQQYRTLERKLSTIKGPKITF
                     APADGPKLAKVTANFQFINSYKLHKGVSPAPAEFIGGCSCGKHCDPERCPCSEKEDDS
                     TENIIPYQRAKDRPDLLVLTPEFLRRTAMIFECGAQCACDKSCWNRVVQRGRTVELEI
                     FYTGNRGFGLRSPRYIREGQFIDCYLGEVITKQHADIREETAVKNGHSYLFGLDFSPE
                     VDEEDIYVVDGQRFGCATRFMNHSCKPNCRMFTVTNTIGDERLYNLAFFALKDIPPMT
                     ELTFDYNPGTERSEKVDSSVVACLCGEDNCRGQLWPSKRKGTK"
     exon            complement(782963..783417)
                     /number=1
     exon            complement(783484..784270)
                     /number=2
     exon            complement(784288..784353)
                     /number=3
     CDS             complement(join(788680..789470,789801..790646,
                     790691..791318,791376..792002))
                     /codon_start=1
                     /locus_tag="AO090038000301"
                     /note="serine/threonine protein kinase"
                     /old_locus_tag="AO070331000166"
                     /protein_id="BAE64108.1"
                     /transl_table=1
                     /translation="MSTTAPSSASPSVVRSHSTTSRPPSYRPVVSSDNPHRTRSVAVR
                     PATAHQSSPQHHHHHSQHYHSHSHSKSQSYDRRPPSNQAVFDNIARRDLEHPVSTRRS
                     NSRERSQERPSTAYRAEPPSNKHHRNLSVQGHQRDSIDMAAAGPVMAEGVAGPQQIAS
                     GSRLHPGTMPSKRRTTITTPSGQWALGKTLGAGSMGKVKVGKNIETGEQVAVKIVPRQ
                     STEEHRSSRDAERADRSKEIRTAREAAIVSLVNHPYICGMRDVVRTNYHWYMLFELVN
                     GGQMLDYIISHGKLKEKQARKFARQIAGALDYCHRNSIVHRDLKIENILISKTGDIKI
                     IDFGLSNLFSPRSLLKTFCGSLYFAAPELLQARQYTGPEVDVWSFGIVLYVLVCGKVP
                     FDDQSMPKLHAKIKQGVFEFPQGLSAVTELGIMAECRSIISRMLVTDPKQRASLAEIM
                     NHPWMNKGYSGPPENYLPHREPLQLPLDPEVIEKMTGFDFGSPEYITAQLTKILESED
                     YQHAVRTSIREHPAPNHGEKKRGMFDFYKRRNSTSRDTLSAPSAEAVQLGNDPLNAYS
                     PLLSVYYLVKEKLEKERAEKSPGALGVPHSAGDAMLQMPDLPAPEAAHTNQYQVPGEK
                     DNTRRARPRARTHGDDDLAEGVKNLNLAPGQGSPAPTASQPETPVKKESTAAGILRRF
                     STRRTKDRGRDPDRGRVSNQTPQKETRTGRTHASRTMSLGHARRESIQARRARRDAAR
                     EANVPEETDADISGAGTALESANEGEDLSKPVYLKGLFSVSTTSSKPLPVIRADIIRV
                     LRQLSVDYDEIKGGFSCCHTPSIEIDKVVDVGPPSPDRQGHVSNHRRRISFGGFLGHD
                     DGKEEIRHTPRSQRRTRAPDHSFVTNSEASEEYLAARDNNVVVGERVMGETTTRVQSD
                     TGENLVLRFEILIVKVPLFSLHGIQFKKVSGGMWQYREMAKKILDALKL"
     exon            complement(788680..789470)
                     /number=1
     exon            complement(789801..790646)
                     /number=2
     exon            complement(790691..791318)
                     /number=3
     exon            complement(791376..792002)
                     /number=4
     CDS             join(794298..794503,794537..796494,796648..796695,
                     796844..797000,797085..797104,797263..797384,
                     797465..797542,797727..798461,798524..798661)
                     /codon_start=1
                     /locus_tag="AO090038000302"
                     /note="predicted RNA binding protein, contains G-patch
                     domain"
                     /old_locus_tag="AO070331000167"
                     /protein_id="BAE64109.1"
                     /transl_table=1
                     /translation="MSGKRARAAFEADLQTQESPYAFYGTPLPPLDAGVRDDGSYVPI
                     WKQEVTDDRGRKRLHGAFTGGFSAGALKVVASFRYFNTVGSKEGWTPSTFVSSRQSRA
                     KDARQQRVEDFMDEEDIREAEESRNLHITDEFSGFGSTDVDANRRGGLMDLFRSGGET
                     MGVKLLKRMGWKEGQGVGPKVRRRAHLGDDAAYSSGSTDKTYLFAPENSRMVSFTHKT
                     DHKGLGFEGESRLGSQKAGGDGSDEDADPFFAQRLTGQGISKRSAQKGPRRGAFGVGV
                     LNDTGSDDEDPYSLGPQISYNRVIGKDKKKKKKLLEDVKPKVASNPLLTNKPVFISKK
                     AIAGRNSTGFRKCHDGRLPLDGFVLADGVSSLTISAQEKKYAPPEVPKDWKCSKTPSK
                     ERDASKYVSTAEAAKASSLDPTSRAALLGEAQLPGKSIFDWMTPEARERIVKITGKTD
                     LPPALGEKAPEGYEMSEAQKRKDLWDLVPKLDKQVAVQALTRAASGWMPYSEDPDKRS
                     RYRTFLQVRAGLRESLPDRVSGSSTDEWVAELHEFARAAEVFKPMSGAMASRFTSASS
                     GPKGSSDEAESSADSLLQNPAKKPEDPAVAAAKIGMFGPMTRSNISFYPTRLLCKRLN
                     VKPPDHVQSNPSDPAKPSDTAPGGRFQSAGYQTTGPKELVPQEVMDQLLLEAGTSSGA
                     VEKPKPIVVEPERNEALEAERPGEEIFKAIFGSDDEDDEKGWMTNTSTADPRDKHNSP
                     NQRSIELIERYRVKKERERESGKNSSHVVVSFLFFTANHPLGNPSVRFFKIENLFFAT
                     SLNLSFQLLISPIPNTSCDGSRPWAIKFPKSLSHTISAQGISGILELFTLLFLAEWSP
                     VFNIYKMGCCLSTSRDNRSAYATQTATEERRPEASSRGVSSTTAAAIPSNSARVVIRS
                     SPDHLPLNENFNAPIRRHVWYSKRRLWNRAQLDQERKEFFETRVTGKPEIWAALSAAI
                     SLMHTGDLTTAQSIIDAAGVTVPTGDLCQGAYDEQGVLYRLPQCIVSDPENLVKSNLG
                     EDDFDTDDGKLSLDEESGDELIADDAERRRDEKGKVSERDLIRVKARLSDRGGPDMVV
                     TVGKTQNVAYIARKLQQEAEIPKTQRVKIAYLGKILKEHVPLVDQGWKQGNVINALVV
                     ARPSPSC"
     exon            794298..794503
                     /number=1
     exon            794537..796494
                     /number=2
     exon            796648..796695
                     /number=3
     exon            796844..797000
                     /number=4
     exon            797085..797104
                     /number=5
     exon            797263..797384
                     /number=6
     exon            797465..797542
                     /number=7
     exon            797727..798461
                     /number=8
     exon            798524..798661
                     /number=9
     tRNA            complement(799222..799292)
                     /locus_tag="AO090038t00003"
                     /note="tRNAscan-SE"
                     /product="tRNA-Gly"
     CDS             complement(join(799650..799873,799921..800546,
                     800601..801010,801059..802489,802541..802730,
                     802814..802873,802933..803016,803084..803654,
                     803752..803829,803887..804763))
                     /codon_start=1
                     /locus_tag="AO090038000303"
                     /note="pleiotropic drug resistance proteins (PDR1-15),
                     ABC superfamily"
                     /old_locus_tag="AO070331000168"
                     /protein_id="BAE64110.1"
                     /transl_table=1
                     /translation="MTEEKRTGSSRSSSIHEDVTDMRQQYKRRGSKFDDASVFESINP
                     ENRAELTRIASNFPLQRRATGSQESEARLQRKDTLEDIGLDHPSLDPTSGQFDQYKWT
                     RMRLKLMDKEGIPRPPSTGVVFQNLNVSGSGSALQYQSTVGSILLEPFRPSGWLSFAK
                     KSPEKHILRNFDGLLKSGEMLIVLGRPGSGCSTFLKTLCGQLHGLKLRKSSEIQYNGV
                     SMEKMHKEFKGEVLYNQEVDKHFPHLTVGQTLEFAAAARTPENRLLGLKRQQFAKHIT
                     KVAMAVFGLLHTYNTKVGDDYIRGVSGGERKRVRLVCPIYRDFSGAPMGAWDNSTRGL
                     DSASALEFVKALRLSSNLVGTSHAVAIYQASQAIYDVFDKAIVLYEGREIYFGPCDEA
                     RDYFTGMGWHCPPRQTTGDFLTAVTNPQERQARDGMENKVPRTPDDFEKYWKKSPQYA
                     ALQQEIDEYHMEYPVGGEAEQSFGEMKRVKQAKHVRPESPYIISIPMQVKLCTIRAYQ
                     RLWNDKPSTLTTVLGRIFMALIIGSMYFGTPTASAGFYSKGAALFFAVLMNALISITE
                     INSLYDQRPIVEKQASYAFVHPFTEAFGGIVSDIPVKFVSAVIFNIIFYFLAGLRYEP
                     SQFFIFFLFTFLSTLAMSGIFRTLAAATKTLAQAMAMAGVLVLAIVIYTGFVIPVPQM
                     HDIPWFSWIRWINPIFYTFESMIANEFHGRQFICSQFVPAYPSLSGDSFICSVRGAVA
                     GERTVSGDAFIESQYTYTYTHEWRNLGILIGFWIFFSVIYLLATEINSQTSSKAEFLV
                     FRRGHVPAHMRDLDKTQGDSGSTEVAQSHKEKETENAASVIPKQRSIFTWRNVCYDIP
                     VKGGQRRLLDHVSGWVKPGTLTALMGVSGAGKTTLLDVLAKRVSIGVVTGDMLVDGKT
                     LDNSFQRKTGYVQQQDLHLATTTVREALRFSALLRQPKSVSRKEKYDYVEEVIEMLNM
                     QDFAGAIVGTPGEGLNVEQRKLLTIGVELAAKPELLIFLDEPTSGLDSQSSWSIVAFL
                     RKLADHGQAVLSTIHQPSALLFQQFDRLLFLAKGGKTVYFGEIGDQSRTLLDYFEGNG
                     ARACGPEENPAEYMLEIIGAGASGKASKDWSAVWNESPESSNVQKEIDRIYQERASAS
                     NGSDDTHHGKPAEYAMPFMYQLWYVTHRVFQQYWREPAYVWAKILLATLSSLFIGFTF
                     FKPNSSQQGFQDILFSAFMLTSIFSTLVQQIMPKFVVQRSLYEVRERPSKAYSWAAFL
                     IANVIVEIPYQILAGVISWACYYYPIYGANQASQRQGLMLLFIVQFYIFTSTFATFII
                     SALPDAETGGTIATLLFIMATTFNGVMQPPNALPGFWIFMYRVSPLTYLIAGMTATGL
                     HGRAIRCDTAELSVFNPPSGSTCGDYLAPYLQSAPGVLYNPSATQGCEYCQLRNADQY
                     LASSNIYYSERWRNYGLGWAYIGFNVMGTVALYYLFRVKHYNPTSLVRGVANGAKLVC
                     RVFKRRSGTTPRGREAENGRLV"
     exon            complement(799650..799873)
                     /number=1
     exon            complement(799921..800546)
                     /number=2
     exon            complement(800601..801010)
                     /number=3
     exon            complement(801059..802489)
                     /number=4
     exon            complement(802541..802730)
                     /number=5
     exon            complement(802814..802873)
                     /number=6
     exon            complement(802933..803016)
                     /number=7
     exon            complement(803084..803654)
                     /number=8
     exon            complement(803752..803829)
                     /number=9
     exon            complement(803887..804763)
                     /number=10
     CDS             join(805873..805921,806007..806114,806202..806983)
                     /codon_start=1
                     /locus_tag="AO090038000305"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000170"
                     /protein_id="BAE64111.1"
                     /transl_table=1
                     /translation="MTDLQKTPFVRELASSDKKIRDKATDSLTLFLRSRSDLSLIELL
                     KLWKGLFFCFYHSDRPLTQQALARNLSYSLVPTIPRSAVHRFLRAFWITIGRDFHSLD
                     RLRLDKYLLLIRFYVGVAFEIFLKGAQQKAAQDKDSNKKRKREAEQNGKSKKRSKGKK
                     QSEAVEEEEEEQNDETKWAELESYISIMEEGPLCPLNFDPDQPPTDEKKDYVAMPHGP
                     DGLRYHIMDIWIDEVEKVLEFEEGSDGVRKPKGDVPIELILRPIEKLRADSPYKPVRT
                     RAKETLEDERLIEWGFRTRKVDSDEEDSDEEWGGFD"
     exon            805873..805921
                     /number=1
     exon            806007..806114
                     /number=2
     exon            806202..806983
                     /number=3
     CDS             complement(join(807399..808740,808974..809119))
                     /codon_start=1
                     /locus_tag="AO090038000306"
                     /note="sphingosine kinase, involved in sphingolipid
                     metabolism"
                     /old_locus_tag="AO070331000171"
                     /protein_id="BAE64112.1"
                     /transl_table=1
                     /translation="MTSPSNGPSSNHADQPDSQRLLQHDSTLTVAQSVSLSIGGDSLL
                     VVGTCSIWLTVPITAKTTHSIGLYNILDADLSPAGLTITYAQAATKGSISVAALEYPI
                     SEKEKANAQTWVSRLLDLAYGEAQRYKRLKVLINPFGGKGAASKIYHKHAAPVFAAAR
                     CVVDVQQTTHRGHATEIVEQIDIDAYDAIVCCSGDGLPYEVFNGLGKKPNAGEALAKV
                     AVAMVPCGSGNAMAWNLCGTGNVSVAALAIVKGLRTPMDLVSLTQGNTRTLSFLSQSF
                     GVIAESDLGTDNIRWMGAHRFTYGFLVRIMQRTVYPCDLAIKVEIDDKRAIKDHYNTY
                     AHNPAPRRSPEETAGQSKGLPELRYGTVQDDLPKDWEVVPGEEMGNFYAGKMAIVSKD
                     TNFFPASVPNDGLMDIVTINGTLPRTTTLKMMTAIPENEFFDMPDVKIRKAAAYRLVP
                     RQKEGYISVDGESIPFEALQAEVHKGLGTVLSKSGHLYEAEGPRP"
     exon            complement(807399..808740)
                     /number=1
     exon            complement(808974..809119)
                     /number=2
     CDS             complement(join(810179..810321,810385..811993,
                     812043..812432,812483..812903,812964..813268))
                     /codon_start=1
                     /locus_tag="AO090038000308"
                     /note="vesicle coat complex COPI, beta subunit"
                     /old_locus_tag="AO070331000173"
                     /protein_id="BAE64113.1"
                     /transl_table=1
                     /translation="MASFLENAYSLVHLDNTADQPSIQDLKVQLEKGNDETKMETMRT
                     IITIMLNGDPMHQLLMHIIRFVMPSKSKPLKKLLYFYYEICPKLDANGKLKQEMILVC
                     NGIRNDLQHPNEYIRGNTLRFLCKLREPELIEPLLSSARSCLEHRHAYVRKNAVWAVA
                     SIFQHSEALIPDAPELIQAFLDTETDGTCKRNAFAALMSISHQKALEYLASTFDSIPN
                     TDELLQLAELEFIRKDAVQNAQNKARYLKLIFDLLDASTSTVIYEAATSLTALTSNPV
                     AVKAAAQKLIELCIREADNNVKLIVLDRVDQLRIRNEGVLEDLTMEILRVLSSPDIDV
                     RRKALGIALEMVSSKNVEEIVMLLKKELAKTVDEQYEKNSEYRQLLIQSIHNCAIKFS
                     EIAASVVDLLMDFIADFNNNSAVDVISFVKEVVEKFPNLRASIVDRLVSTLSEVRAGK
                     VYRGVLWVVGEYSLEEKDIREAWKKIRASLGEIPILASEQRLLDETPEDSALKEQVNG
                     HAKPSAPTGSRKVLADGTYATESALTSQSAAAARLEAVKAAQKPPLRQLILDGDYYLA
                     TVLSSTLTKLVMRHSEVSEDAARTNALRAEAMLIMISIIRVGQSHFVKAPIDEDSVDR
                     IMCCVRSLAEFSERKELETTFLEDTRKAFRAMVQVEDKKRAAKEAVEKAKSAVQIDDA
                     IPIRQFSKKNALEGAEEIELDLAKATGGDSTVETVSSKLSRVVQLTGFSDPVYAEAYV
                     TVHQFDIVLDVLLVNQTLETLQNLSVEFATLGDLKVVERPATHNLGPRDFLNVQATVK
                     VSSTDTGVIFGNIVYDGASSTESHVVILNDIHADIMDYIQPAHCTETQFRTMWTEFEW
                     ENKVNINSKAKSLREFLKQLMDSTNMACLTPEASLKGDCRFLSANLYARSVFGEDALA
                     NLSIEKEGDDGPITGFVRIRSRSQGLALSLGSLKGLKASTA"
     exon            complement(810179..810321)
                     /number=1
     exon            complement(810385..811993)
                     /number=2
     exon            complement(812043..812432)
                     /number=3
     exon            complement(812483..812903)
                     /number=4
     exon            complement(812964..813268)
                     /number=5
     CDS             join(813698..813741,813798..813835,813888..813983,
                     814046..814109,814164..814251,814318..814443,
                     814506..814520)
                     /codon_start=1
                     /locus_tag="AO090038000309"
                     /note="exon-exon junction complex, Magoh component"
                     /old_locus_tag="AO070331000174"
                     /protein_id="BAE64114.1"
                     /transl_table=1
                     /translation="MSTQNQNEPFYLRYYSGHSGRFGHEFLEFDFRSLGDGRSAAVRY
                     ANNSNYRNDSLIRKEMCVSSSMIQEIKRIIKESEIMKEDDSKWPQKNKDGRQELEIRL
                     GNEHISFETAKIGSLVDVTESADPEGLRVFYYLVQDLKAFIFSLISLHFKIKPI"
     exon            813698..813741
                     /number=1
     exon            813798..813835
                     /number=2
     exon            813888..813983
                     /number=3
     exon            814046..814109
                     /number=4
     exon            814164..814251
                     /number=5
     exon            814318..814443
                     /number=6
     exon            814506..814520
                     /number=7
     CDS             815176..815610
                     /codon_start=1
                     /locus_tag="AO090038000310"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000175"
                     /protein_id="BAE64115.1"
                     /transl_table=1
                     /translation="MPTPSDNTPSLNATSIAEEISTRTTCPPEIERLSSWRDSPESTV
                     AESDAPDNALSPTIASAQSVLTRSDDAITRTNPDALKASAVPGASAKSMEKSDEDAAA
                     GRLSPAGESPRSSNQSSSVTTPSTSALLSYEFSNIRVCDSRN"
     exon            815176..815610
                     /number=1
     CDS             join(815981..816225,816294..816360)
                     /codon_start=1
                     /locus_tag="AO090038000311"
                     /note="vacuolar import and degradation protein"
                     /old_locus_tag="AO070331000176"
                     /protein_id="BAE64116.1"
                     /transl_table=1
                     /translation="MHHWARFPAWRPLAKQAKRPDFTYRNFAQREHIFMRWKEYFLVP
                     DHRVRTISGASFEGFYYICFNQVEGTVTGIYFHAKSEKYQQLELKHVPDHGCTPAIEF
                     R"
     exon            815981..816225
                     /number=1
     exon            816294..816360
                     /number=2
     CDS             complement(join(817368..818476,818729..819086))
                     /codon_start=1
                     /locus_tag="AO090038000312"
                     /note="serine/threonine protein kinase"
                     /old_locus_tag="AO070331000177"
                     /protein_id="BAE64117.1"
                     /transl_table=1
                     /translation="MTIEQRANLGRVNVELNKIKKISFKLSMTIMDSVAIIRNQLKER
                     GVENHDLIQACYAFATEFGKRSSNVDPNRRAMNTARLVELSLDWVSFICDDCDAADRK
                     TFKWAVSALEFAMAITSNRRVDEDAKRQALGRVLEGSNEADRSLAVLSSSATNVTLRW
                     QQGQFIGGGTFGSVYAAINLDSNYLMAVKEIRLQDPQLIPKIAQQIRDEMGVLEVLDH
                     PNIVSYHGIEVHRDKVYIFMEYCSGGSLASLLEHGRVEDETVIMVYALQLLEGLAYLH
                     QAGIVHRDIKPENILLDHNGIIKYVDFGAAKIIARQGRTVVPMDAFASAGHKEAIVPK
                     DAQIANQRGKNQKTMTGTPMYMSPEVIRGDSNKLIHRQGAVDIWSLGCVILEMATGRR
                     PWSALDNEWAIMYNIAQGNQPQLPTHDQLSDMGIDFLRRCFECDPLKRPTAAELLQHE
                     WIVSIRQQVVLEPPTPSSDHSGSISSSTSGSRQNSTYL"
     exon            complement(817368..818476)
                     /number=1
     exon            complement(818729..819086)
                     /number=2
     CDS             complement(join(819712..821576,822108..822156))
                     /codon_start=1
                     /locus_tag="AO090038000313"
                     /note="MAPKKK (MAP kinase kinase kinase) SSK2 and related
                     serine/threonine protein kinases"
                     /old_locus_tag="AO070331000178"
                     /protein_id="BAE64118.1"
                     /transl_table=1
                     /translation="MNHSTTAVRLETSFVIDPYLIHQKLLLINSAIQSMRNVEAHQDR
                     GFETMEHPDMNNNDSDGSGSSDELLQQSYARSNSNFTDAFDGQVQTPATTISSSPPPS
                     GLPSWVSSTASRPRGSSIGNPAVLEKAPPGDGLPVSDVRPQRPAGPARTPSNTYAPQR
                     RPPQYISFQNDRQRSSSTKRNSRRDPNAQYRAQEKAYVQRIRADPQAWYSHFDEARDM
                     SIVGDSDLEEPSPSSEVPFEDDAYDPDIQLFLTDDNQPTLEELKNPKNQERLEWHSML
                     ASVLKGDVVKQEKQRLLGSTDTKRSSAQNNAIWLGVRARTCGRSIAMQRKLIEEARSG
                     LGPIIEEIIKFEIKGETEIGKPPIKQVEDIVEQIERCELLYSTQKELEAAHPRVASEE
                     FISSREAVLAWHNTTILINTELAILQKWVGNDELDFSKTRAKSVNRDLTDESSFLDRI
                     MKEDGLKTLQGKHNMLHGVSEVIQKAKNTLIENANSFAKRHLPPYIEELLTLINFPSR
                     LIQEIIRVRLSYAKNMRDPAQQSPILVDQMISQFQILMRVAVDLKQRYLDIAKPEPGW
                     DLPPCIDENFDSVVLDALKYYFRLLNWKLNANKNTFKEAEILEQDWEFSNHIGRQLEG
                     GDIEVAEQFRYSV"
     exon            complement(819712..821576)
                     /number=1
     exon            complement(822108..822156)
                     /number=2
     CDS             join(823940..824026,824078..824142,824207..824461,
                     824523..825197,825251..825482,825541..825663)
                     /codon_start=1
                     /locus_tag="AO090038000314"
                     /note="ammonia permease"
                     /old_locus_tag="AO070331000179"
                     /protein_id="BAE64119.1"
                     /transl_table=1
                     /translation="MAEYPVAYNGSATGTGGDSLTEDLNIYYSSGDIAWVIVSTALVL
                     LMIPGVGFFYSGLARRKSALSLLWLSIMSVGIVSFQWFFWGYSLAFSHTAGKYIGDLS
                     NFGFKGVLGAPSVGSAKVPDLLFAVFQGMFACITVALAVGAVAERGRMLPCMVFSFVW
                     STIIYDPIACWTWNSSGWVANLGGLDYAGGTPVHIASGCTALAYSLMLGKRRGHGTHE
                     LNYRPHNVTHVVIGTVFLWVGWFGFNAGSALSANLRAVMAAVVTNLAAAVGGVTWCIL
                     DYRLERKWSTVGFCSGVIAGLVAITPASGFVTPWASFIFGVVGAVACNYATKLKYVIK
                     VDDALDIFAVHGIGGLVGNLLTGLFAADYIAHLDGSTTIDGGWINHNYIQLAYQLADS
                     VTGMAYSFFGSCIILFIINLIPGLSLRAPEEDEIMGIDDAEIGEFAYDYVEITRDVIS
                     AANSESGENASKRSLTPTGNETTIEAKA"
     exon            823940..824026
                     /number=1
     exon            824078..824142
                     /number=2
     exon            824207..824461
                     /number=3
     exon            824523..825197
                     /number=4
     exon            825251..825482
                     /number=5
     exon            825541..825663
                     /number=6
     CDS             complement(join(826956..827301,827362..827552))
                     /codon_start=1
                     /locus_tag="AO090038000315"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000180"
                     /protein_id="BAE64120.1"
                     /transl_table=1
                     /translation="MKATTIGTLLLAAGTALAVPGKRAQKAVAISGFSASQNDQQGFV
                     TFSFSDPNYNKAPIDANVLWERPGNPPSDARTSDGAYLVQFPDGVDDISTFTLQVQRE
                     NSTSKVSFTVDDADEDTNWHCSNVNGTTNGKKCHYNGNIVFNPPSPSSSPSASPSASP
                     SASASASASPTPSAEPSS"
     exon            complement(826956..827301)
                     /number=1
     exon            complement(827362..827552)
                     /number=2
     CDS             join(829021..829448,829513..830098)
                     /codon_start=1
                     /locus_tag="AO090038000316"
                     /note="voltage-gated shaker-like K+ channel, subunit
                     beta/KCNAB"
                     /old_locus_tag="AO070331000181"
                     /protein_id="BAE64121.1"
                     /transl_table=1
                     /translation="MPCSPRLLEQKTPVTPIGYGAMSLSAYYTNTPEPDSKRLAFLDH
                     VYATGQRFWDTANNYGDNEELIGKWLALNPDKRKDIVLATKFGQVGGGPGRNDAAYAR
                     ECCERSLEKLQTSYIDLYYVHRVDTAVPIEKTVEGLVGLVREGKVRHIGLSEVSPQTL
                     RRAHAVHPIAAIQMEYSLFALDVEKPKTDLLNTTKELGVALVAYSPLSRGLLSGRLKS
                     PDDLEEGDFRRGIPRFFPENFHKNLELAEKLHTIAARNGITVGQLALAWLLAQGDNVI
                     PIPGTKSIDYFNENMGALEVELGMQDLREIRAAAEKADVRGHRYAVETSPNSYFADTP
                     PLE"
     exon            829021..829448
                     /number=1
     exon            829513..830098
                     /number=2
     CDS             complement(join(830384..830420,830474..830833,
                     830895..831685,831748..831802,831884..831925,
                     832037..832062,832132..832155,832285..832296))
                     /codon_start=1
                     /locus_tag="AO090038000317"
                     /note="beta tubulin"
                     /old_locus_tag="AO070331000182"
                     /protein_id="BAE64122.1"
                     /transl_table=1
                     /translation="MREIVHLQTGQCGNQIGAAFWQTISGEHGLDGSGVYNGSSDLQL
                     ERMNVYFNEASGNKYVPRAVLVDLEPGTMDAVRAGPFGQLFRPDNFVFGQSGAGNNWA
                     KGHYTEGAELVDQVVDVVRREAEGCDCLQGFQITHSLGGGTGAGMGTLLISKIREEFP
                     DRMMATFSVVPSPKVSDTVVEPYNATLSVHQLVEHSDETFCIDNEALYDICMRTLKLS
                     NPSYGDLNHLVSAVMSGVTTCLRFPGQLNSDLRKLAVNMVPFPRLHFFMVGFAPLTSR
                     GAHSFRAVSVPELTQQMFDPKNMMAASDFRNGRYLTCSAIFRGKVSMKEVEDQMRNIQ
                     SKNQTYFVEWIPNNIQTALCSIPPRGLKMSSTFIGNSTSIQELFKRVGDQFTAMFRRK
                     AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDASISEGEEEYLEEEEPLEHEE"
     exon            complement(830384..830420)
                     /number=1
     exon            complement(830474..830833)
                     /number=2
     exon            complement(830895..831685)
                     /number=3
     exon            complement(831748..831802)
                     /number=4
     exon            complement(831884..831925)
                     /number=5
     exon            complement(832037..832062)
                     /number=6
     exon            complement(832132..832155)
                     /number=7
     exon            complement(832285..832296)
                     /number=8
     CDS             complement(join(832900..833115,833193..833348,
                     833416..833985,834403..834721,835968..836047))
                     /codon_start=1
                     /locus_tag="AO090038000318"
                     /note="transcription elongation factor TAT-SF1"
                     /old_locus_tag="AO070331000183"
                     /protein_id="BAE64123.1"
                     /transl_table=1
                     /translation="MQDAPIPSTAESRRPSVASNTTTAPFWSNPAYQSFPRNSRTSIY
                     CLSSTINLIIHIDPVLLYFSAFQESRTLAIAAMVSPSPEGASSNFPQDPSEFDSDPRI
                     SFSKLDDKFILETDDGQEFEYDTALKRWIPTGNGQKPKKQRVNTAVYVTSIPLDADFE
                     EIRYVFSKCGVIAEEIDSGRPRIKMYMDDDGKFKGEALVVFFRPESVNLAIQMLDDSD
                     FRLGVTGPQGPMRVQPADFSYKSQQEAPTKTSAKDKRKIIQRTQRLNKYETYKYEWSF
                     GRRDLLMWWNSKLADWDDDEPSALPETNSKFEKVVILKHMFTLKELDDDPAAILDIKE
                     DIRDECSKLGEVTNVVLYDKETDGVVSVKFQDPEAARNCVKLMDGRYFAGTRVEAYIS
                     DGSERFKKSNEKRAALEDLAERGLDADEDEEEKQRLVEFGTWLESSHTVENTAK"
     exon            complement(832900..833115)
                     /number=1
     exon            complement(833193..833348)
                     /number=2
     exon            complement(833416..833985)
                     /number=3
     exon            complement(834403..834721)
                     /number=4
     exon            complement(835968..836047)
                     /number=5
     CDS             837260..838165
                     /codon_start=1
                     /locus_tag="AO090038000319"
                     /note="phosphoesterases"
                     /old_locus_tag="AO070331000184"
                     /protein_id="BAE64124.1"
                     /transl_table=1
                     /translation="MPLFGKQGNSLDELLNRPRPSAWQQFMKQPCIFLARKLYTWQST
                     IAAQPVKDPVSVVCISDTHNCQPSLPDGDILIHAGDLTQSGPLKEIQATLDWLRAQPH
                     TTKIVIAGNHDLCLDHNFHRPKVEEETPDWGDIVYLQNSEVSITCSNGRHLRVYGSPY
                     SPRQGNWAFQYPRSEDFWGNRVPANIDILITHGPPRAHLDLLNLGCTYLLQTLWRVRP
                     RLHVFGHVHEGAGTEWLQFDALQSAYERTVVSGGGIWNLIYTMKEFVGKFFRPATEAK
                     CLLINASIVGGLRDHERRQPVKLFI"
     exon            837260..838165
                     /number=1
     CDS             complement(join(839190..839589,839641..840014))
                     /codon_start=1
                     /locus_tag="AO090038000320"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000185"
                     /protein_id="BAE64125.1"
                     /transl_table=1
                     /translation="MLYTLGLFALEPIRFIEKYEWRKLTDLEKCAIGTFWKSVGDGLA
                     ISYEAFPSHKTGFRDGLQWLEEITAWSEEYEAKYMVPHATNRETADQTTAVLLYMVPK
                     PFQQIGLHFVSFMMDDRLRRAMLYDPPPASYAKLFSSLLSVRRFVLRYLSLPRPYFLR
                     FTAFTEQPDRNDRIFITQWDAAPYYVAPTFRNRWGPVAWLTWAMGRPLPGDEGDKYYP
                     RGYYTPDVGPKYFEGKGRASLEEYVQDLKSSRTGRCPFI"
     exon            complement(839190..839589)
                     /number=1
     exon            complement(839641..840014)
                     /number=2
     CDS             complement(join(841957..842094,842159..842921,
                     842993..843216,843307..843696))
                     /codon_start=1
                     /locus_tag="AO090038000321"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000186"
                     /protein_id="BAE64126.1"
                     /transl_table=1
                     /translation="MSEAEKARISPSLQSVTQEDLEDQTPLNGSHRSRYQRWAGSIKG
                     LEARGIEPIPVEERLKTSPSASFHMLLMWFSMGMALNNMVVGSLGTLVMKLSFADAAL
                     CAIFGNLLGGMAVGYMSTWGPRSGNRTLIVARYFMGYYPSKVCCSLNVLTNLGYGMMN
                     CMIGGQLLSKISGGAVSVVVGIIIVALASLVMATFGMQIFQYYERYAWFPQLLVLCII
                     TGSAGPQFDFQSPSVGSSGEVNAKRLAFFSLCLSVALAWAPLAADYYVYYPPTIRRWR
                     TWSMTTMGGCLAMIITLLLGVGLGSGVAKNPKWAETYDGTPASLLMAGYGRLGGFGKF
                     CAFINVVTVVSSNAPGSYSMAMNFQMLGNVWSKIPRPVFTVTTTVIYTACAIGGRDFL
                     YEIFKSFLPLIGYWIIIWFTIVAEEDLLFRRSKGYDWSAWNCRQKLPVGVAAALAFLV
                     GWAGAIVGMDQVYYTGPIGKAVNGGCDLGIWLGFGFTALAFPPLRMLELRVLGR"
     exon            complement(841957..842094)
                     /number=1
     exon            complement(842159..842921)
                     /number=2
     exon            complement(842993..843216)
                     /number=3
     exon            complement(843307..843696)
                     /number=4
     CDS             complement(join(845800..845827,846216..849940))
                     /codon_start=1
                     /locus_tag="AO090038000322"
                     /note="calcium transporting ATPase"
                     /old_locus_tag="AO070331000187"
                     /protein_id="BAE64127.1"
                     /transl_table=1
                     /translation="MNDSVSHSNYLAVPGTRSRGNSLESEDTHQSSSTYGGDTYVPTA
                     SHGSRADLTKNMVINDEDALKPDPGREDEFTVENNKFAFSPGQLNKLLNPKNLGAFHA
                     LGGLRGLEKGLRTDINSGLSMDETALDGTVSFEDATSIASEESTQGSFSQPPRQPTRS
                     GTEPAKQPDNGYTDRKRVFGNNKLPERKPKSILELAWIAYNDKVLILLTVAAIISLAL
                     GIYQSVTAKNGEPKVEWVEGVAIIVAIVIVVVVGAANDWQKERQFVKLNKKKDDRQVK
                     VVRSGKTLEIPIQDVLVGDVMHLEPGDVIPVDGIFINGHDVKCDESSATGESDVLRKT
                     AANEVFRAIEQHENLSKQDPFIVSGAKVSEGVGTFMVTSVGVHSTYGKTMMSLQDEGQ
                     TTPLQSKLNVLAEYIAKLGLAAGLLLFVVLFIKFLAQLKTYDGADEKGQAFLRIFIVA
                     VTVIVVAVPEGLPLAVTLALAFATTRMLKDNNLVRLLRACETMGNATTICSDKTGTLT
                     ENKMTAVAATLGTSFRFVKDAGASSNGTDENGDATEVSNALSPSEFAKSLSAPVKQLL
                     LDSIVLNSTAFEGEQEGAMTFIGSKTETALLGFARTYLALGSLSEARANAEIAQMVPF
                     DSGRKCMAVVIKMGPGKYRMLVKGAAEILAAKSTRIISDPTKDLSNRPMSGDDKETLN
                     TTIDRYAAKSLRAISLVYRDFSQWPPEGVRKQEKDSGLGDFDAVFKDMTMFAVFGIQD
                     PLRAGVTESVQQCQKAGVFVRMVTGDNINTAKAIAGECGIFTPGGIAIEGPKFRQLSS
                     AQIHQIIPRLQVLARSSPDDKKILVTHLKKLGETVAVTGDGTNDAQALKTADVGFSMG
                     IAGTEVAKEASDIILMDDNFTSIIKAMAWGRTVNDAVKKFLQFQITVNITAVLLTFIS
                     AVASDTEESVLTAVQLLWVNLIMDTFAALALATDPPSPHVLDRRPEPKSAPLITLTMW
                     KMILGQSIYQMAVTLVLNFAGGHFGYEGQVLSTVVFNAFVWMQIFNQWNSRRLDNGFN
                     IFEGMLRNWWFLGIQFIIMGGQVLIVFVGGHAFSVTRINGAQWGVCLIIGVISLPIAV
                     IIRLIPDALIEKLIPTFFSRKKAPELLVSDEDRFEWNPALTEIRDQLKFLKRVRGGRL
                     RHLKHKLQHPEEFLPRSRSGSRSSRSRENSVPGTPVNEHSSTPSQPPTPESRSRKRAR
                     SRSNSAFGPATAMAGIVAGSIAGWSPIERAPTEGEPFNSGSAVLSR"
     exon            complement(845800..845827)
                     /number=1
     exon            complement(846216..849940)
                     /number=2
     CDS             join(853899..854198,854267..854308)
                     /codon_start=1
                     /locus_tag="AO090038000323"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000188"
                     /protein_id="BAE64128.1"
                     /transl_table=1
                     /translation="MDSGRYVSWKGFGKKQTASRPTFACFTEQLSIEMLPFTRTRNER
                     IKRPSSSGNLDCNIFIQFIRSLGPSIRILRRGRNRIARSMENPSTALFDGAIHCNDSS
                     LLDNLSLLSKA"
     exon            853899..854198
                     /number=1
     exon            854267..854308
                     /number=2
     CDS             complement(join(854861..855383,855452..855528))
                     /codon_start=1
                     /locus_tag="AO090038000324"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000189"
                     /protein_id="BAE64129.1"
                     /transl_table=1
                     /translation="MRDLEELILAFNALEWFAVVCEKLDKNKRRRDSGTIKNLKDELQ
                     ESLDEVSVHVDALLDEWLMGAEDGKASLGNMRRRMLTPVARTETEQAELEEIRKTYIP
                     ELFLDYHNALYYAGHVLTSELLVQCMNLAMQVSENEYLTSAFVASRRMAELVDALALS
                     SKAMVNTQAKPGKKLLGGESLGIWNVDVPDEDNGLPEAQ"
     exon            complement(854861..855383)
                     /number=1
     exon            complement(855452..855528)
                     /number=2
     CDS             complement(855800..857887)
                     /codon_start=1
                     /locus_tag="AO090038000325"
                     /note="nuclear pore complex, rNup107 component (sc Nup84)"
                     /old_locus_tag="AO070331000190"
                     /protein_id="BAE64130.1"
                     /transl_table=1
                     /translation="MTTPELFTSAGAQQALHPLRRTADRVTRQIEAFAEKLDRFKQKE
                     NRDSEFENYQAAYQLVKSYQNLANDSIEDISKQNTLKRAKMGWNTSRTNGTAAQDPKT
                     QEELQRLQLEANTWQLLLNLISINDPPSRASAKQAQETAFQNLHRYSTDREIWEQFVG
                     ADHYALECVIIMKWLEHTSKSASQDIDSIISELEAQAQRGQGMWTHGWLYTKETIKGQ
                     KRLRAWPQPLEPNDPAVAASLLVSEKSESMITQLDPDAVTRQKQKLQKQDQFHERATW
                     MTCWKMLRQGESWTKIREWAESCLENWRAVSLCGSSVDASSSRGERTPVDDGTTRMMN
                     WRSQTTWRNACSALARSQGTEDFERAVYALLCGETEAAFKVCQSWDDYLYVYFNSVVL
                     SRYQGFCKQFQRKLNHSPTVPVAFVPEPVGYADVNKFVLYTKGNDRVGVEARNPYRTI
                     QAAILGKGYDSFFHSLAKAVSQAAASKGDLSFVPDLPPAAVDDSLLIAAEDGDALRIA
                     THLYIIANSLGYVRSDTQFSTNASINVIGYIANLEEARIYDIIPLYASLLPTYQAHSV
                     LGQILIEVVDPRERRQQVRLMENHGIDVEAVLRDQWQWVSASVSSVEHSSTLKRYPKV
                     VRRKDGLPEVVPVKKDYIGTDVSGTEERVIRSLEWLRHVDGQWGRICQLGALLYRKFY
                     GMSLCLQLPRTWY"
     exon            complement(855800..857887)
                     /number=1
     CDS             complement(860749..861330)
                     /codon_start=1
                     /locus_tag="AO090038000328"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000193"
                     /protein_id="BAE64131.1"
                     /transl_table=1
                     /translation="MSISEATTTELQSSLRELSLSNNSPVKDIARPAVKTATAKAATA
                     KKKAPVVADSWEDEADESEPDINSPGCASSSLSPSVTTAEGPLDPPPTPISPQTSQTW
                     SSVPVYPDVGSASSRTSNSRSPSRRPEKQTAVAGRMIAGALGLRAPKRTEEQRAYDRA
                     VKEKEIKRRNQEREAAAKAKEEEERAKASVWDD"
     exon            complement(860749..861330)
                     /number=1
     CDS             complement(join(862442..862967,863026..863540))
                     /codon_start=1
                     /locus_tag="AO090038000329"
                     /note="zinc-binding oxidoreductase"
                     /old_locus_tag="AO070331000194"
                     /protein_id="BAE64132.1"
                     /transl_table=1
                     /translation="MKAIVLNGTNATVVYSQPIPKLRDDYLLIKTVAVALNPTDCKAI
                     SQGRGAKDGLAGCDFAGIVEEIGPVVTKRWNKGDRVCGCTHGANSRNPDDGSFTEFIV
                     VKGDVCMRMLDGMSFEEAAGIGVSAITCGQGLFQNLGLNLPLNPVQKKEYILIYGGST
                     SAGTLAIQYAKLAGYSVLTTCSPRNVDLVRSRGAEAVFDYNDPSCGEQIHRYTKGELQ
                     LVWDTIGSDQGVHACMAALSTKPGCRYGTILLNDIPRQDVACTRSIMMTFRGEPFDLY
                     GKHFPPSAEDFEFAKMFTQLTETLLAENKLRPHPIRVCEGGLQGVLDGVGLVQQGNVS
                     GVKLVYRVADTP"
     exon            complement(862442..862967)
                     /number=1
     exon            complement(863026..863540)
                     /number=2
     CDS             join(864607..864778,864838..864845,864899..865012,
                     865061..865204,865261..865643,865700..865910,
                     865961..866574,866635..866666,866717..867009,
                     867059..867154)
                     /codon_start=1
                     /locus_tag="AO090038000330"
                     /note="succinyl-CoA synthetase, alpha subunit"
                     /old_locus_tag="AO070331000195"
                     /protein_id="BAE64133.1"
                     /transl_table=1
                     /translation="MTNLRSLPARARGVPFSRLSARQTNGFSTSSRSYSYADTLPNLK
                     IGAHTRVLFQGFTGRQATANVKESLAWGTKIVGGVKPGVEGEHLGLPVFPSVKAAQEK
                     AKPDASAIYVPGNQTAKAIEEAIEAEIPLVVAVAEHVPIHDVLRIHSMLQTQSKTRLV
                     GANCPGIISAIGKCRVGFQPLPCFSPGKIGIVAKSGTLSYETVASTSRAGLGQSLCIS
                     MGGDVLAGTNFVDALKIFENDPDTEGIILVGEIGGTAEIDAAEWIKDYNRRTANPKPI
                     MGLVGGLHAPAGRIMGHAGAWTAVGEPGAHAKYQALERAGAVMVNHPEKFGEGMKTLL
                     NSRPRVQNTTSTNTPNQKRGLHTMRRVTLQKNQRPPVSKQSRSLFIKQFQALDMLKEK
                     SIPINETEPSESDIFLNLTVDRTALSPCVIASTSADFAPSHTSKFPFPYFNTDFSSSD
                     SPIIKSIASHLHLPETTHETLAELVQALWQIFKEKEAYLLEVRVNPSTEGLEVRGARF
                     GFDDAAFRSSGRQKEVHSLRNPAEEVHEEVEAEKDGIVYVKLQGEGSIGTLVNGAGLA
                     MNTVDALTIHGGHCANFLDTGGKATSETVKSSFRIITSDPRVKAIFVNIFGGLTRCDM
                     IAEGIIMAFRDLDMSVPVVVRLRGTNEEEGQKMIAESGLPLHAFDSFEGAAKKVISLA
                     GGKPSN"
     exon            864607..864778
                     /number=1
     exon            864838..864845
                     /number=2
     exon            864899..865012
                     /number=3
     exon            865061..865204
                     /number=4
     exon            865261..865643
                     /number=5
     exon            865700..865910
                     /number=6
     exon            865961..866574
                     /number=7
     exon            866635..866666
                     /number=8
     exon            866717..867009
                     /number=9
     exon            867059..867154
                     /number=10
     CDS             complement(join(867417..867478,867551..869603,
                     869651..871249,871315..871500))
                     /codon_start=1
                     /locus_tag="AO090038000331"
                     /note="WD40 repeat"
                     /old_locus_tag="AO070331000196"
                     /protein_id="BAE64134.1"
                     /transl_table=1
                     /translation="MRDIATADDWKEMLTEIKRTDKSIEDILGDWSKKTVQEIHAEIT
                     SMKREVERQLNIVLDTINTQAAQDQLDILHPVTRAAFGSYEQARETCLVGTQVPLLQL
                     IQDWSNDAQGEPILWLQGMAGTGKSTIARTVASAFYNGTSLLGQETLPNDACLGGSFF
                     FDHRDEDCRDPRKLFPTLARDLVDVLPEIQQSLCDGIRSHHATHAGSLDGQWKHLIFN
                     PLKMLKTTLPVTILFVLDALDECQAGTREDQDDISDILALLSQVRELTTVRVRVLITS
                     RPGIHMRYRFNEIPEGIRDETVYKIRRLDGDGVKADDITRLIEYKLSEVRRRNDLPRD
                     WPGKERVDKLAEKADGLFIYAATVCRFLAMANRKTIEDRLGKIFDGDVGLDGMYTRIL
                     QVVLTGEVDNDQAMSDLFKQVVGSIIVLSRPLSIRALSRLVEVELSDTRWLMEHLYSV
                     LEMPQGDHGPIQLLHLSFRDFLLASQRCNDNRFWIDEKQAHRNLYQYCLKIMSNILRR
                     NICCLEDPDTHIADMKPSVVHEFLPEQVQYACSHWVDHLQRSDIVASDDTVLYDFLRT
                     HFVHWLEAMAVMGRIPIAIMILNNLTTLQLETNAKLRRLVHDARRFAVSFRSVYEKAP
                     LQIYASALLFAPQESIIRREFEEEIPAWISEKPSAHQYWSPLLHTIPKPSRDPITQLK
                     FSPDSRLMAVVSSYMYSHVCRLWDTSTWVCVKSFEDQGNIRDAAFSPDSKQLATVSEA
                     GSVRLWNTHTGRSTFLESASSAVTFVVFSSNGEKLAAKSHGDIKAWDLVSERLLLEIP
                     DERSEIVSISPDCRFIASWNNLAVIVWDVSQRAVLHTHERRGVHTIEFSPEGNLLIAS
                     NDGTVEFWDCTENILRSYTNIGYKSLVAGFSPDSKNIVSLSTNGQINVWDWTTNEFKS
                     NIHHISDSVDYSLYCGKVSFPRFGELAASLVADGPEDIWTFIPGVLTEIYRFSGRMMD
                     ALAFSPDGKIIAASACWTEEITIWNGSSKVSEALGDIHEDTITGLSFAPNGTVVASAA
                     KDGTIRFWEAQSGTHMKCLRGVDDPEFQKIRFSTDSQTMICRTYNGQCVIWNIPTWKV
                     LKRLELGKDTSKLQNMALSHDGQLVATGCFDERKDTSHIELWNLTSTEPLLALTEEGD
                     TKDNEISPLGSFIASTYYGSSSFQLRHTQTGNLIHSMDHGDRGPVIAFSPSESMIASA
                     EHSIKLWDTSTGTCLGQRSIDGCVESMVFSEDGTYVRTNEGQFQVASILGANPDLCHD
                     KMVGEGVYVHNNWIMEGASKSSSVMVIGLSADERETV"
     exon            complement(867417..867478)
                     /number=1
     exon            complement(867551..869603)
                     /number=2
     exon            complement(869651..871249)
                     /number=3
     exon            complement(871315..871500)
                     /number=4
     CDS             complement(join(871774..871812,871901..872674))
                     /codon_start=1
                     /locus_tag="AO090038000332"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000197"
                     /protein_id="BAE64135.1"
                     /transl_table=1
                     /translation="MSKNHRLWPLLSFRHSREKADTDTDPAGLIASHGHDTRSETPDD
                     HLQTSDSRRRRSISWLRISNRNKNKDAETKPTKLDQEEANTQPYLSQTEYKDEPDTSE
                     GKLSGSAGSIMSAQGTPIKEEEGGQAEANIARLGEKVMKDLWSEAYKKLHSDNASLVE
                     SYETVLLAPETDHMGGRSSTTQEKTDRQKRIQDLVFCRLQDMEQGRFDIPKRSRQGVI
                     GDYVRRTVHGILYAKDFVTAAISAEPHAALAWAGVVMVLPMLWQDSSSSQIF"
     exon            complement(871774..871812)
                     /number=1
     exon            complement(871901..872674)
                     /number=2
     CDS             join(874875..874882,874961..875588)
                     /codon_start=1
                     /locus_tag="AO090038000333"
                     /note="adenosine 5'-phosphosulfate kinase"
                     /old_locus_tag="AO070331000198"
                     /protein_id="BAE64136.1"
                     /transl_table=1
                     /translation="MSTNITFHASALTRSERSELRNQRGLTIWLTGLSASGKSTIAVE
                     LEHQLLRDRGVHAYRLDGDNIRFGLNKDLGFSEKDRNENIRRIAEVAKLFADSASIAI
                     TSFISPYRADRDTARKLHEVPTPGEETGLPFVEVFIDVPIEVAEQRDPKGLYKLARAG
                     KISEFTGISAPYEEPEKPEVHIHNHDLPVQDAVKQIVDYLDAQGYLPPKKE"
     exon            874875..874882
                     /number=1
     exon            874961..875588
                     /number=2
     CDS             complement(join(875827..876009,876061..876553,
                     876604..876695,876749..876843,876905..877205))
                     /codon_start=1
                     /locus_tag="AO090038000334"
                     /note="vacuolar H+-ATPase V1 sector, subunit C"
                     /old_locus_tag="AO070331000199"
                     /protein_id="BAE64137.1"
                     /transl_table=1
                     /translation="MSKPTKYLLVSFPTSITPSHHRDDALDAVSATVAPENGSVAPFP
                     IPEFKIGTLDALVQQADELAKLETACQVVVSKVGDALKNILEGDEAQISKMKAVNDKP
                     VDQYLRTFTWNKVKYRADKSLGELIDLLQKEAASIDNDIRSKYSQYNQVKTTLATLQR
                     KQTGNLATKSLASVVDPRSVVQNSEYLETHLVAVPAQQVKEFLKTYETVSPMVVPRSA
                     TFVASDDEFTLYAVTTFKKHSLEFVHKAREHKWIPREFKYVEGGKEEERREVERVGGD
                     ERKLWGETLRLGRTAWSEAVMVWIHVLVLRVFVETVLRYGLPLDFVCTLIRTPGSKQA
                     DKAKHNLDEKYSYLAGNAFGRDKKGRVKKDDPSEVHEGGGEYTAYVYYEFELN"
     exon            complement(875827..876009)
                     /number=1
     exon            complement(876061..876553)
                     /number=2
     exon            complement(876604..876695)
                     /number=3
     exon            complement(876749..876843)
                     /number=4
     exon            complement(876905..877205)
                     /number=5
     CDS             complement(join(877804..877836,877895..878622,
                     878681..878837))
                     /codon_start=1
                     /locus_tag="AO090038000335"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000200"
                     /protein_id="BAE64138.1"
                     /transl_table=1
                     /translation="MPRVPSSAFFRAVPTTTKLCLKSNGPIKTQWLVHHPWKVSLPRN
                     LSQRLYSSEAASPVPPQTSKPRSRLRRFVGFTSIALIAFTAGLVYQTQKTVSRMMTVT
                     LRTDEETLTAFVPADQFSQEVDEYIRNHPVAVELRENPAFTESRPHLKIPAELRDRHL
                     TAGTLSGPDRIVVPPHVFSEKDGKSLVSIFYLGSAISGHLGIVHGGLLATLLDEGMAR
                     CCFPALPNKVGVTANLNIDYRRPAMAESYAVLRAETVKVEGRKAWVEARIETLPKEGE
                     EPAVLVEAKALFIEPKQAAAMSSLYNITN"
     exon            complement(877804..877836)
                     /number=1
     exon            complement(877895..878622)
                     /number=2
     exon            complement(878681..878837)
                     /number=3
     CDS             join(879806..879962,880013..880677,880708..881069,
                     881171..881711,881767..881867,881919..882510)
                     /codon_start=1
                     /locus_tag="AO090038000337"
                     /note="putative alpha-1,2-mannosidase"
                     /old_locus_tag="AO070331000202"
                     /protein_id="BAE64139.1"
                     /transl_table=1
                     /translation="MASSVLWSILIATPLALGYTNPRSISIPEDYDVLQYVDPLIGSS
                     NGGINLPVGNVFAGASLPYGMAKAVADTDSVNNQGGFAYDGSNITGFSSLHDSGTGGQ
                     PSLGNFPIFPYASCKDDDVNGCVYPKKLRKTRYDPGSVSASPGYFALTMASGIQVDMT
                     VSHHASLFRFRFPADRETKPLILLDLSDLSDTRQDNGTIDVDADTGRMVGHARFLPSF
                     GSGSYTPYFCIDFRSVSGVRDNGIFVNSRASTDVKNLTISRSINGYPLPVCSGTEPGG
                     AFVRFNSLADRTVLARVGLSFISSEQACSNAESEIPNFDFNATHSAAVDSWTKKLAPI
                     RVSRNGVNSSFLSTFYSGIYRTMINPQDYTGENPLWKSTEPYFDSFYWYAHHLSVEIF
                     SDINIWAGFQTAACRSAKVRNCSPIIRSGLTGLGYTQGGSNADVVLADAYLKGISDGI
                     DWQAGYSAVQKDAEEEPYDWSNEGRGGLDSWKSLNYIPVEDFDYKGFGTMTRSISRTL
                     EYSYDDFTIAQMARGLGKMDDAEQYEATSRFWQNLFRDDQASFINGTDTGFKGFFQPK
                     YLNGTWGYQDPITCSNIDTSGRACSLQNNAAETFEDSIWEYQFFVPHDMAALITRLGG
                     PSQFIRRLDYLHDTGITYIGNEPSFLTVFQYHYGSRPGKSTSRAHFYVPKYFNANPTG
                     LPGNDDSGAMGSFVAMTMMGLFPNPGQNVYLISAPFFESVRIASPLTGRTATIRAVNF
                     DPEYKNIYIQSATLDGKPYSKNWVGHDFFTEGRELVLVLGRNESHWGTGKEDLPPSLS
                     TRGALFD"
     exon            879806..879962
                     /number=1
     exon            880013..880677
                     /number=2
     exon            880708..881069
                     /number=3
     exon            881171..881711
                     /number=4
     exon            881767..881867
                     /number=5
     exon            881919..882510
                     /number=6
     CDS             complement(join(882982..884035,884097..884259,
                     884461..884488))
                     /codon_start=1
                     /locus_tag="AO090038000338"
                     /note="aminomethyl transferase"
                     /old_locus_tag="AO070331000203"
                     /protein_id="BAE64140.1"
                     /transl_table=1
                     /translation="MSAVRPLRRGPLRQTQLYDLHLARGAKMVPFAGFDMPLQYSDLS
                     HVESHKWTREKASLFDVSHMVQHELSGPGAIELLMKVTPSSLDKLGHNQSTLSCLLEE
                     GTGGIIDDTVITRRTDETFYFVTNAGRRDEDLAFLEAEISAYKQAHGADSIKWTILED
                     RALVALQGPLAAEVLQSYVHGSGPETDLSTLYFGNCRELYLTLPDGSRTPHPLLISRT
                     GYTGEDGFEISIPTAGSPSLPAQVTELLLTNADQVRLAGLAARDSLRLEAGMCLYGHD
                     ISTAQTPPGASLGWVVGKDRRDPATANFNGASAILPQLASPAKTLSQRRVGFTVEKGS
                     PAREGAVIVDINDESRTPVGIITSGLPSPTLGGTNIAMGYVKQGLHKKGTEVGILVRN
                     KLRKATVTSMPWVESKFYRGKA"
     exon            complement(882982..884035)
                     /number=1
     exon            complement(884097..884259)
                     /number=2
     exon            complement(884461..884488)
                     /number=3
     CDS             complement(join(885029..885109,885166..886089,
                     886148..886274,886328..886470,886533..886751))
                     /codon_start=1
                     /locus_tag="AO090038000339"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000204"
                     /protein_id="BAE64141.1"
                     /transl_table=1
                     /translation="MAAPHTSKALDGRGDEDSQSFASERADSPDKVKDLENQRQPGVQ
                     SDSDTDDVGRQIEMEAGNSIKYRTCSWQKTAALLFSEYICLAIMSFPWSYSVLGLVPG
                     LILTVVIAGIVLYTSLIIWRFCLRHPHVRDVCDIGQHLFWGSNIAWYLTAVMFLLNNT
                     FIQGLHCLVGAEWLNTVSSHGTCTIVFSLITAIVSFVCSLPRTFSTLSKIATFSALFT
                     FISVILAVIFTAIEDHPAGYTPAKGDPIVTAVPVAGTTFVSGVNAFLNISYTFIGQIT
                     LPSFIAEMKEPKDFWKSVTAVTVAEIIVFSLVGSIVYAYTGNQYITSPAFGSISNEVY
                     KKVSFSFMVPTLIFLGVLYASVSARFLFFRLFEGTRHKGNHTVVGWAAWAGILAVLWI
                     GAFIIAEVIPFFSDLLSIMSALFDSFFGFIFWGVAYLRMRREDYGPNFYKNRGIRGWI
                     GFIVNVGLIFVGLFFLGPGTYAAVDSVVLNYQAGTVGSPFSCADNGL"
     exon            complement(885029..885109)
                     /number=1
     exon            complement(885166..886089)
                     /number=2
     exon            complement(886148..886274)
                     /number=3
     exon            complement(886328..886470)
                     /number=4
     exon            complement(886533..886751)
                     /number=5
     CDS             complement(join(889189..890079,890142..890679,
                     890733..891856,891907..892719))
                     /codon_start=1
                     /locus_tag="AO090038000341"
                     /note="CAATT-binding transcription factor/60S ribosomal
                     subunit biogenesis protein"
                     /old_locus_tag="AO070331000206"
                     /protein_id="BAE64142.1"
                     /transl_table=1
                     /translation="MAKGKGKRSSGVTAVAPEGGANDSNAGANAVPQFEESAFAGLRQ
                     KIEQRLKDQNAAKQKPKNNKKDAPNDTPKKNNESTPKFDTKRNDTDKNKGKKRDRNGE
                     VIAREDKNASGKDKSSKSKEADQSDALRQEILALGGTEEDYDMLAGVDSESEVEDAKN
                     TSKGSGSKSEEDALRKELSGILAAAGQVVPDDIADDEEDEAGQDEEEEDDEEDVEDDE
                     VDLDSGDENDSEEADQESSDEDVPPTPAAKEPTKNEKAKNSAEPPLPKEYSKLAVPPR
                     SDWFMTELPPISAKHANGLPRHLVDRVYNYAVSLLEEESNLYSEAQKTLASSSHKFYT
                     TIMSTGTLSDKISALTLAIQESPVHNTKSLENLIALGKKRSRAQAVEVLRTLKDMFAQ
                     GTLLPNDRRLRSFANQPSLMAAFQGAGSKWSEGDALPNGLQKRHLIVWAFEHFLKEQY
                     FEVLKILEVWCNDEIEFSRSRAVSYVFELLKEKPEQETNLLRLLVNKLGDTAKKIASR
                     ASYLLLQLEQTHPLMKPTIIKAVEEVLFRPGQSQHAKYYAIITLNQTVLSTREEQVAA
                     QLLDIYFALFVAFLKPTKKNKYQSNKKHGKNGKLNRKAQKALKEEEKGQAQHEEMQEK
                     LTSGVLTGVNRAYPFTSSDSERLSKHVDTLFRITHSSNFNTSIQALMLIQQLTSSHQI
                     AADRFYRTLYESLLDPRLATSSKQALYLNLLFKALKSDVNARRVKAFVKRIIQVLGLH
                     QPAFICGVMYLIRELEKTFSSLNSLYDQPEDNESDEEEVFRDVPDEDDETQEQPEAQP
                     KKPSSRYDPRKRDPEHSNADKTCLWELLPYLSHFHPSVSVNAAQLLEHKTMSGKPDMT
                     IHTLMHFLDRFVYKTPKASAATRGASIMQPLAGSDAQDRLVSGTKQTQELPLNSEAFW
                     KKKSDEVAAEDVFFHEYFNRVEKDKDKSRKKAKDPVEHAEEDGELSDAESEIWKALVD
                     SKPEVEGADSDDDLDLDDLESAYDQSEDEEAEQSEDEGVIFNDESDVDMDDFEEETFE
                     TKKPATKSKAKKAEDTFDEDDDFDMDVSDDEAFLDSDEDLPSDVELGGGVELPKEDDK
                     PDQKKKRRKLKHLPTFASVDDYAALLAGEDEGM"
     exon            complement(889189..890079)
                     /number=1
     exon            complement(890142..890679)
                     /number=2
     exon            complement(890733..891856)
                     /number=3
     exon            complement(891907..892719)
                     /number=4
     CDS             join(893116..893355,893403..893493,893551..893630,
                     893686..893815,893869..895226)
                     /codon_start=1
                     /locus_tag="AO090038000342"
                     /note="Prolyl-tRNA synthetase"
                     /old_locus_tag="AO070331000207"
                     /protein_id="BAE64143.1"
                     /transl_table=1
                     /translation="MQLPCRTLRIYLPQDLFINIDRLMAELGCLISGFLREASQRKIF
                     RVKKVILKRNYSRGQQLTTGLEDVNDLLVRGGFLRQAYSGIFHMLPLGLRVQDKLERL
                     IDKHMRSVGASKVSLSSISSQELWERSGRLGEGSEVFKFHDRKESRFLLAPTHEEEIT
                     TLVGSLAKSYRDLPLRVYQISRKYRDEPRPRQGLLRGREFIMKDLYTFDCTVEEALET
                     YTSVKAAYTRLFNDLKIPYLVAAADSGNMGGNLSHEFHVPSSKGEDTVISCTSCDTVY
                     NDELADGKIHELGDNESHQASPGFDTGDMSPEATPTISTGLWMSISKDKRTLLRGWYP
                     KFSMQGETQEPVEREVNSHAVKSVANAAGIDLDLSVENPLEQWATNVKSNKASGPYRV
                     VDMYDSQVRVYKRPPLSDLLDQAGCKVEDIDYSMLDRFPGTNNGLSLVKVQDGDKCAK
                     CAQGRVKTQVAVELGHTFHLGTRYSEVLQASVMVDQSSSGSSEHQVVPMQMGCHGIGV
                     SRMITAVADSLADSKGLNWPRAVAPFEVIVVPAKGLEEEAEKIYDTLTSDPASPVDVI
                     LDDRDKQMGWKLGDADLIGYPIIVVVGKGWKKEQTLEVQCRQLDNLRENVPLEQLSTF
                     IRSLLERL"
     exon            893116..893355
                     /number=1
     exon            893403..893493
                     /number=2
     exon            893551..893630
                     /number=3
     exon            893686..893815
                     /number=4
     exon            893869..895226
                     /number=5
     CDS             join(896215..896317,896419..896627,896693..896956)
                     /codon_start=1
                     /locus_tag="AO090038000343"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000208"
                     /protein_id="BAE64144.1"
                     /transl_table=1
                     /translation="MSAQGQVVRTGVNVFVFNNQGQFVMGLRKGSHGEGTWGLPGGHI
                     DFFEESLEACAKREIDEETGLDIFDIELLTVTNDVFKEAGKHYTTNFFAAKLVGGTGD
                     PQLNEPKKCFKWKWFTWEEVEDLYKAQDAAEKAAKEATEKGDEIPEYKGPKLFLPTVN
                     LFRQRAKLHPLKAYNAILESEEKPVVGPASN"
     exon            896215..896317
                     /number=1
     exon            896419..896627
                     /number=2
     exon            896693..896956
                     /number=3
     CDS             join(897848..897893,897965..898281)
                     /codon_start=1
                     /locus_tag="AO090038000344"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000209"
                     /protein_id="BAE64145.1"
                     /transl_table=1
                     /translation="MAPQDSPASDAPPGSVNINSLSVPQLRALQTRLSSELEHLTSSH
                     AKLRAAQSKFRDCVRSINEGVVGSEKRGTDGRDDILVPLTSSLYVKGKLADREKVLVD
                     VGTGFYVEKVSLCPLYKG"
     exon            897848..897893
                     /number=1
     exon            897965..898281
                     /number=2
     CDS             complement(join(898946..899405,899421..899660,
                     899711..899961))
                     /codon_start=1
                     /locus_tag="AO090038000345"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000210"
                     /protein_id="BAE64146.1"
                     /transl_table=1
                     /translation="MSTDLLEPYESTSCSLKNAEPAYSVNFEFLGSNNALLRLEAEFA
                     RSPGAQEFEVTQRRWLRPRKSGQSSDRRPPLQIGVIDFERADWQLEIKSLEFYETSSI
                     DAALKSFSHSIGFRRSTTIGDISAKPERKVVFPSSAPVSRFVEKTAIRYRLKSTKYIL
                     EIASRLKTDASQGQAPAPALVTGETCDVPSTSWGASIFDSNWDNLMGEQANLSVGHSA
                     RHSPELHTFFPPKTISDSNDKNEGFWEFISLVKRVAEVLSPAQPRSSLENTARKIQLS
                     TESSMVPTATKSQPPSNESSPKLDVKGLAGMLDADLGTLF"
     exon            complement(898946..899405)
                     /number=1
     exon            complement(899421..899660)
                     /number=2
     exon            complement(899711..899961)
                     /number=3
     CDS             complement(900023..900781)
                     /codon_start=1
                     /locus_tag="AO090038000346"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000211"
                     /protein_id="BAE64147.1"
                     /transl_table=1
                     /translation="MGVELKERRENMLLLLRKEPESPSDFPEQVSISRYKLLFAFLID
                     LLSKLFFLWPSDGPSIKESLGEQLEALDIIRAKFGCHLYLPKNAPDYICALGPNHDTM
                     RQIAQLLRTKWSETVANSHVRSKVYISEPPKILRDKIVVENNTFFAKAFLHGKVVKSL
                     QSEQWQNRRTLIQTKNKAHISSALSRSLRGVSFVRGHLRMRVNLGSFVLDEYRMPKNE
                     KAGYSFEEFREMVLHEQTKGRLIPGYGLPIIYLS"
     exon            complement(900023..900781)
                     /number=1
     CDS             join(901828..901928,902179..902239,902339..902359,
                     902415..903431)
                     /codon_start=1
                     /locus_tag="AO090038000347"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000212"
                     /protein_id="BAE64148.1"
                     /transl_table=1
                     /translation="MSFTKEKLATELKLSDSDSFKGRAEAESKLMRVGRLVALVPNED
                     GSRHSVLFETKFRPIALIVLRLLIGQGRSNGALNPKWGKVDCAPLDALWIHFQPSFVC
                     CSIAAVHPFRQQLICPFLRKKMAIDAADENDTLETRRRSARKQAQQWMTKGGLVRDDS
                     DDELGDEDLPWEWIYAVDTAENKEDTVTDAPEDTPRSNRRRTSRANAKNRRPIIGARM
                     GSFECKLGQVVLLKSPEPGKDWVGIITEFMEEEDEAEGETIKSANIMWFASPDEFMST
                     RNKRRADALPNEQYLTADFNVNPITSINGKATVMSKDVFFAKYPNGAPPKGKEQLSDY
                     NKCIVCRRGVNQLQGRYTEEFVWEDVYREDRIFDLIAMIKDGLKKAKKRKQGDDDVRS
                     NRLCSKV"
     exon            901828..901928
                     /number=1
     exon            902179..902239
                     /number=2
     exon            902339..902359
                     /number=3
     exon            902415..903431
                     /number=4
     CDS             903634..905112
                     /codon_start=1
                     /locus_tag="AO090038000348"
                     /note="origin recognition complex, subunit 1, and related
                     proteins"
                     /old_locus_tag="AO070331000213"
                     /protein_id="BAE64149.1"
                     /transl_table=1
                     /translation="MFYRIVVKKPLEFTPLGTRILSPSHFASPYRQARTLLHVSTVPT
                     SLPCRKAEFDTVYNHLSAAIMEGTGTCIYISGTPGTGKTATVREVVAQLNAAVLAEEM
                     DDFIFVEINGMKVTDPHQSYSLLWEALKGDRVSPSHALDLLEREFSHPSPRRVSCVVL
                     MDELDQLVTKNQSVMYNFFNWPALRHSRLIVLAVANTMDLPERTLSNKISSRLGLTRI
                     TFPGYKHTDLMEIISTRLANIPGNIVDADAIQFASRKVAAVSGDARRALDICRRAVEI
                     AEQASEAAKLEPILEDGNADDTESMPPTPSKTPARKERSTNRQSAPPKAQPPQRQGRV
                     TIATIKQAIQEATSTPLQQSLRCLPLSAKLFLAALLARVKRTGITESTFGDVLDEAKR
                     IADAAVAVAGAAGAGIKEYLLSGGSGARVRALGFAAMELMNSGVLALEHGPATKGPLG
                     SAAIPSRGDRSGKVRLRVAAEDVRAAFREDIEAKGLGLGTDQ"
     exon            903634..905112
                     /number=1
     CDS             complement(905528..906886)
                     /codon_start=1
                     /locus_tag="AO090038000349"
                     /note="pleiotropic regulator 1"
                     /old_locus_tag="AO070331000214"
                     /protein_id="BAE64150.1"
                     /transl_table=1
                     /translation="MDVIPSTTPEEAVRRSAKRTAELFGADYLMVTPSTGDGSIGVSY
                     RRKVEYEHVKELPPVLAEKQAKAAAGRTKRPKIQAQAKAPVDGSGASMALVKKAQGPA
                     AGGLGNEDQPRSLIQRPSATRQQRPDWHAPWKLMRVISGHLGWVRSLAVEPNNEWFAS
                     GAGDRTIKIWNLATGALRLTLTGHISTVRGLAVSPRHPYLFSCGEDKMVKCWDLETNK
                     VIRHYHGHLSGVYTLALHPRLDLLVTGGRDGVARVWDMRTRSNIHVLSGHKGTVADVK
                     CQEADPQIITGSLDATVRLWDLAAGKSMGVLTHHKKGVRNLAIHPREFTFASASTGSI
                     KQWKCPEGDFMQNFEGHNAVINSLAVNEDNVLFSGGDNGSMSFWDWKTGYRFQSIDTM
                     AQPGSLDAEAGIMASTFDRTGLRLITGEADKTIKVWKPDDEATPESHPVTWAPTLGRQ
                     RY"
     exon            complement(905528..906886)
                     /number=1
     CDS             join(907352..907375,907777..907899,907961..908335)
                     /codon_start=1
                     /locus_tag="AO090038000350"
                     /note="26S proteasome regulatory complex, subunit PSMD10"
                     /old_locus_tag="AO070331000215"
                     /protein_id="BAE64151.1"
                     /transl_table=1
                     /translation="MRPLEREGDGSGWTPLMIAASLKNAEGDPIIDLLLKKGADVNAK
                     SNSGQNALHFATSKANLSTVRTLIANKCSARVKDKRGQLALHRAAAIGSSPIIKVLLQ
                     DGKSPVNATDMDGLTALHHAISEGHGEAAITLLKAGAETDKKDADGNLAIDMAPDTSV
                     SSSFFLRKPSFRH"
     exon            907352..907375
                     /number=1
     exon            907777..907899
                     /number=2
     exon            907961..908335
                     /number=3
     CDS             complement(join(908599..909540,909607..911102,
                     911163..911310))
                     /codon_start=1
                     /locus_tag="AO090038000351"
                     /note="transcription factor TMF, TATA element modulatory
                     factor"
                     /old_locus_tag="AO070331000216"
                     /protein_id="BAE64152.1"
                     /transl_table=1
                     /translation="MAQQKWKVGSFLQQAVAGVESKLDMILADEEQRQQIQPKQNTAT
                     KNQPGNLSRSSSNARKNDRLQERLARAVVKSNTNANSASQSSSRVPSPVTSPVTSNGA
                     RSSMDIESNLGRSSLNLEESAQNVAPADELSSIAASRTSHDSSSPRNSKDIVPSRASN
                     EDSESQKANSEKSTEVVQENGVEPELQETEADKPHSSEDLAQDAANGPSDIIEPSSTD
                     VDKTIAQLQAEHKAAESRWQAEMYEHIERIDALQSKLKYLTKEAAESAKKAAAAEAPG
                     SMERQLREKDEKIALLFEEGQKLSKSEMDHRTAIKKLRQQLAENTKVQTENHKRTEKL
                     ERDLANAEARAKRAEAAEKRANESLTSQSKSSRDLETVTAERDALSQTVQELKGQLAR
                     AVARAEAAEAKAQSDALEQEKRHAAKLEEELASIKAERDESEESLKTEIRDLKSTIEQ
                     EKERARVLEVELKNEQSVLESKMESLRSRAEEASSGVAGDAQAKLLRQIETLQTQYAV
                     ASENWQALEGSLLARLANVEKERDEAARREGDLRRKVREANLKAKRAEEDLEEAKEVE
                     HDLESKLEERMQELQKLEQKLQKATDDLVSAQKDFDEQKKVCDATWAQKLEEERVKWR
                     EQVVPPAIFTQQQRTESPVAYSRRPSTLEPVGSFSDLRSSRRSSTLPMTSPEVGTPTR
                     QNSFPTSTSALLSPPANSASFSQFTDTPSISFEPDEYSARPRTPSAFGGALTQNSRGI
                     NDIISESTVGAGPSVQLVERMSATVRRLESERAATKDELARIVSQRDEARQQVVDLMR
                     ESEEKRTVDARVQELEKRHAELEERYETTLELLGEKSEQVEELQADIAEVKKIYRELV
                     DSTMK"
     exon            complement(908599..909540)
                     /number=1
     exon            complement(909607..911102)
                     /number=2
     exon            complement(911163..911310)
                     /number=3
     CDS             join(911896..912199,912274..912793,912856..913462)
                     /codon_start=1
                     /locus_tag="AO090038000352"
                     /note="vacuolar H+-ATPase V1 sector, subunit H"
                     /old_locus_tag="AO070331000217"
                     /protein_id="BAE64153.1"
                     /transl_table=1
                     /translation="MSTMPLEPPMYLSSLQNNIRARPIPWEGAVRAGNITDDHLKKIK
                     AVDKVRKDQRRQTVEGDISGYVTLLSGSADAKSVLDSASRRTDIVQYILVLAADLIND
                     VPALSSALIAHPDPYKPFLPLLRHSTNAEDPIPLLTSTFLTNLVSISLASSSKSAARD
                     EEALPQLYTYLSSLTQNQDSGLQDIGVQELSALLRTSRSREIFWKQRGETVTPLIEIL
                     RAATGGKDTSSSTVAGSSRAIEPGLSGGVGLQLLYRVLLVIWQLSFEGALIGDDLQAD
                     HEFLQLYTYLLRLSPKEKTTRLLLATLNNLLSSNRTTLLPVAVFVRLPALLSNLSGRH
                     LTDPDLLEDLKTLSDMLDEYTKTQTTFDQYAAELQSGHLRWSPPHRNPTFWKDNARRI
                     LDDANLPRKLAEIISKEWDNDKQVLAIACNDVGHLVKELPGRRAQLEKLGLKARVMEL
                     MADKDESVRWESLRAVGEWLRYTFDD"
     exon            911896..912199
                     /number=1
     exon            912274..912793
                     /number=2
     exon            912856..913462
                     /number=3
     CDS             join(914868..915813,915845..915858)
                     /codon_start=1
                     /locus_tag="AO090038000353"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000218"
                     /protein_id="BAE64154.1"
                     /transl_table=1
                     /translation="MALSLEHFRAELQDPDVKGSDALLATARTLCLAEIHSGAIHPNS
                     WRAHIEGARALMDACDNRGALSPRSSDGFRRYLDRWYRSIVSLTALTGNGPPIGDVAG
                     QPILSTINQHDSPDYLDDYWGFTVNLAAVFRGIGAAAWRSHPSQQCGGVAQEDEFSVH
                     HEAAVLESSVRRLMDQEADSQPAFYPGVVEGLSSEYIRQFILCNEAFQHSALIQIHRR
                     LRKTPASSPEVQASVKRILECTAQIGPSAGLSPWTMLTTPLFIAGCEAGDEDREKVRQ
                     LLSCLHDTIRVPNVLQSLRFLEQYWTSQIDENEGWNQFLDCTR"
     exon            914868..915813
                     /number=1
     exon            915845..915858
                     /number=2
     CDS             join(919380..920087,920151..921685,921746..921827)
                     /codon_start=1
                     /locus_tag="AO090038000354"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000219"
                     /protein_id="BAE64155.1"
                     /transl_table=1
                     /translation="MQKRATTMPLHHPSNRPPPLHIDSSGRSISGVVDAKNPKTPGHK
                     ISSFFGWRGTITTSPGAESSSTEVSDLGHSPLPSPMPPSLPSAVTPSTTVPFDASKGF
                     PPRNPSLSSASILETGPSTAHVAELENELREISSELAGSIRREMELEDLVERLQSELP
                     LDNGNQRTSDYFSDSGTSSIRLVYDGRIDDVEKYRRASEQERAQLKVDLTQRWQEERA
                     RRAAADSHVQILESQVHQLRRERVDLSDLSSRTKELEGALEATRRKLAEERQIKDNFE
                     DLLTAMRVELEQIRNERDHLRDHMVPELKNSAASSSDATEVQRLLEELEALKIENAAL
                     AQLQGGRFATISEDNETPSSKRNSAGGLSRSSSLARMHSKPTIRTGLSRSNSLSQSSP
                     VTPKGVDTRESMADRVESVEAQRDALHHALRRLLDRQAYEAREYEKRIRAMELELVHA
                     QQIGSPRKLGYEREVRNLREEVNHLRQRAEEALDQKWQCEKGLAGLKMDLDRAEQETT
                     SLRVLLQEHDITVPEGLGADQEGFAEVLATSSSLESAYKQLQAEREQAEASAVQSPQE
                     EHGQLAASVSRTESLSQHVQKQLERNNALRNRLADAIGKGEKEQQLSVVRINEMQARL
                     KELEDTLLIAQQHAEEEMARHEEEIQKLNESHNAQLSRMKNGARSPAGLSPMPPSSPF
                     VARSPRLDKTTSGDGISLNQAVKPEALERRVKELERLLRDADMEMGEVVSRMNRAQIE
                     VAELQSDRDEALRQTRKLQAEIQAEREAFKALQG"
     exon            919380..920087
                     /number=1
     exon            920151..921685
                     /number=2
     exon            921746..921827
                     /number=3
     CDS             join(922419..922434,922495..923006)
                     /codon_start=1
                     /locus_tag="AO090038000355"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000220"
                     /protein_id="BAE64156.1"
                     /transl_table=1
                     /translation="MDFLPESIISLIQDNPTIQQLTSSSIAFQVNNARTTYLDPYISH
                     LKSTYLDPYIIQPLASMLASSMPDLVSVLILALIFIISLKVLDYARRVVMFWVTLALR
                     LVWWGFILGAIWYAYNAGLEKTGRDLGWFYGVVKGFAEKFQDGFEGGQRSSSATGGWG
                     GYASGRDFQVPIGRG"
     exon            922419..922434
                     /number=1
     exon            922495..923006
                     /number=2
     CDS             complement(923546..924217)
                     /codon_start=1
                     /locus_tag="AO090038000356"
                     /note="putative transcription factor FET5"
                     /old_locus_tag="AO070331000221"
                     /protein_id="BAE64157.1"
                     /transl_table=1
                     /translation="MGLGPNGGLIYCFEFLLQNLDFLSEALDPLSEEYLIIFDMPGQI
                     ELYTHIPLLPSLVQFLSRAGPLNINLCAAYLLESTFVVDKAKFFAGTLSAMSAMLMLE
                     MPHVNILTKMDQVRDMVTRKELKRFTNVDVQLLQDDDADAMGDPSSKETLLSGGSFKQ
                     LNRAVGQLIDDFSMVSFLKLDVQDEDSVAAVLSHIDDATQFHEAQEPREPNDEQEVNY
                     EDADI"
     exon            complement(923546..924217)
                     /number=1
     CDS             join(924926..925011,925102..925159,925292..925319,
                     925396..926396)
                     /codon_start=1
                     /locus_tag="AO090038000357"
                     /note="S-adenosylmethionine synthetase"
                     /old_locus_tag="AO070331000222"
                     /protein_id="BAE64158.1"
                     /transl_table=1
                     /translation="MGSVANLPKSGTFLFTSESVGEGHPDKIADQVSDAILDACLAED
                     PLSKVACETATKTGMVMVFGEITTKAQLDYQKVIRGAIQDIGYDSSEKGFDYKTCNVL
                     VAIEQQSPDIAQGLHYDEALEKLGAGDQGIMFGYATDETPELLPLTVILSHKLNKAMT
                     DARKNGTIPWLRPDTKTQVTIEYAHDNGAVKPLRVDTVVISAQHSDDLSTEEIRVALK
                     EKIIKQVIPAELLDDRTVYHLQPSGRFVIGGPQGDAGLTGRKIIVDTYGGWGAHGGGA
                     FSGKDYSKVDRSAAYVARWVAKSLVNAGLARRALVQLSYAIGVAEPLSVFVETYGTSQ
                     KSSEELVQIVRNNFDLRPGVIVKELDLAKPIYFQTAKNGHFTNQEFSWEKPKTLKF"
     exon            924926..925011
                     /number=1
     exon            925102..925159
                     /number=2
     exon            925292..925319
                     /number=3
     exon            925396..926396
                     /number=4
     CDS             join(927318..927458,927521..928249,928293..930182)
                     /codon_start=1
                     /locus_tag="AO090038000358"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000223"
                     /protein_id="BAE64159.1"
                     /transl_table=1
                     /translation="MASHVSSSALDPFSVKPLQEDVTNPRSKKRKTCHLENDWTKQTI
                     SIRAHAASLSDEPYVLEPIAIIPRCRLPLSWLDFSPAVLSDIQPGSLFVANIPVLEND
                     LRLEPVVLAVRLASDGGLYVIERVKKGIYALSKLARGVEEGDIIVAVKGWSPSEVKQA
                     PRCMSPIQEGGDWWLMAQIDDPVTDPHFPTKRSKFDVSVVFGAVDHDVRMQDVSPPVD
                     SGESRSQSVAPQVCLERGVSSDVFMPIAADSQEHGGGDGVGTESMKIESLQSPQEILD
                     NLREQYLQALYISKTSVAYFAKGPLARCRTAFQSSESGSAQPSELIEFYREAVLTAKK
                     MDLKYRETLPSTLKDVVLTISDDESTLKRKRKTKKKKLGKNGLYPTEEQFIRTWWKGR
                     ALADQGVSTETSRDAELKKHVADLRLRETQLQILLILETMALEAVMADEAKSTGDGSD
                     KTEVSKPKKIQDLKVMLELHLDRLCIWHAVSFDGVAVSDQNKGYGDNESGGKKVESDA
                     VRDFCTEVIIPFYASRLPDKCKSITKKLGVPSVLSPFPKKAQPKNMPRAEPGAAVERQ
                     PSQKHPRRTLQRVLTDEQTASKGRRQSLSRFNTMPSQPERESIEPLLPSLSANVRGGI
                     QKAKRVDNREVDLNAVARQHETKLRKMQMLMDQKKELDAAINALRKPNRELVAKDIAE
                     DAEKRRTGSARKPKNPVRNPFGEGVQVAATPKGSRKRDVIVGMPPLPRGMSMHSSTQP
                     KASSFFGGDGSPVVPASTARPKSFSIASSSRDTNAIQETPTRRPTQLLGSFDGPATSV
                     ADSPLSSGNLFRVPRRPIPRSTDVAPTTPVASRRTKSRPDIVTEPTSSLVMETPPRQN
                     LTVPLIQADGPTEVAADTPAKVLGTPVKGSTRLSVPTSTAVPVTPEKSIYAHLGWDDD
                     DDLGL"
     exon            927318..927458
                     /number=1
     exon            927521..928249
                     /number=2
     exon            928293..930182
                     /number=3
     CDS             complement(join(931614..931642,931713..931833,
                     931993..932574))
                     /codon_start=1
                     /locus_tag="AO090038000359"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000224"
                     /protein_id="BAE64160.1"
                     /transl_table=1
                     /translation="MAVATIDIMPKQASSSPLSSNNPSMNKRWPPLADKTSLPYKLTT
                     LSRQKLAREATAPDPDIRRCLGHFRLHVISMEWAQKDMTTRINSFELEDDESEEEEED
                     SKRDDGQEKDSDASDSTEEEKEDSETKAKDGTATDAPSDKEPVQVTFTVSFDQSAPTP
                     PSPSDEKEQGLLEKGRNCLEKTKHLWQSPAQCIPAGSASAAGSELQGVHKEPHHRLSI
                     KHVSNRKSCSDEHVTTFMIQTHPPK"
     exon            complement(931614..931642)
                     /number=1
     exon            complement(931713..931833)
                     /number=2
     exon            complement(931993..932574)
                     /number=3
     CDS             join(934841..935300,935927..935946)
                     /codon_start=1
                     /locus_tag="AO090038000361"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000226"
                     /protein_id="BAE64161.1"
                     /transl_table=1
                     /translation="MDLRTSSHIPSDALVQFYTAVRITVAVVFFTIAREPPAFLTQVG
                     PPLSAVTTTLSPCFIIFLVPYYLRLATRRIPRDAPTYVDESVCTDVEEDERTEVDMSE
                     IDISSDETVIHDPNWEEEEDGSKVEKYENSGILFQELAGEAARDEGDTTEEGLRCLG"
     exon            934841..935300
                     /number=1
     exon            935927..935946
                     /number=2
     CDS             join(940999..941071,941651..943587)
                     /codon_start=1
                     /locus_tag="AO090038000362"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000227"
                     /protein_id="BAE64162.1"
                     /transl_table=1
                     /translation="MNGIGGDLVDGSGTINPAALNTNSGPSDHLPAGADEHGRRKRGR
                     PPKTPRPSTTAIGDQATNIHMQTPRMQAQPLPHQAGVNVSPPQASPPDKTTPTKSTLV
                     KALPTVRDHTTDQLNEEGDEYIPKEFDEAGEKKVNAMGYLTGNREYKCRTFRVPHRGT
                     KLFMLATECARVLGYRDSYLLFNKNRSLHKIIATQIEKDDLIQQDILPYSYRSRQIAI
                     VTARSMFRQFGSRVIVNGRRVRDDYWEGKARKQGFTEDDLAGEKRPGGAKARDAAAAE
                     AASAASLLPALAHGDVIYSNALEAMPNSLPMGPPSSVSLAPLPMIHMATTTDDPRLRE
                     YNSMPRTRQELTGQPYQDRTQPSSAAEILNQASHTADFNKILSSQRSYRQKGLEDFYS
                     KQREIPASAAQSQPGQLDSTPSASQPLQSPQIASAPMMNTTQPQQAMLPHQTPMIPGQ
                     PGLQQAVAHPQPPVGQSPARTGPAVRPDLMHQRSNPSLSAGTPQPSGPYGYPSQPQQM
                     WGQPPPQPQPSPLSAAGPQAVGIPQYASQLHAQQQHSPSPLAQHPSQSPRNQPRPPAP
                     QMPQSFPLHHPQAPQQQPMASMGFPGGTAAPYAAMTAARGMYPSTQGPGGQQFMAGAP
                     QQPGLAMGMSAGGAMPGWAPTPGGPMQPGHPQPGQSGAPLGWSGY"
     exon            940999..941071
                     /number=1
     exon            941651..943587
                     /number=2
     CDS             complement(944560..945312)
                     /codon_start=1
                     /locus_tag="AO090038000364"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000229"
                     /protein_id="BAE64163.1"
                     /transl_table=1
                     /translation="MPNLHLANTNQCYWSLLDGNGTATWRDAELTDAGVKQAQVAHDF
                     WQKELDTQQIHPPDSYFVSPLTRTLRTANITFSGLSLPHKSTPFRPLIKEYLREGISI
                     HTCDQRRNRTYIHDLFPTWPIERGFTEIDELWNGVTAETNAAQDLRSKSALDSIFQAN
                     NSGLFVSVTSHSGEISSILRVVKHRTFKLNTGAVIPVLVRAETVPEAPTTTSVSWTAS
                     AHCTAPPVTSVDSCVCPSTAVPVTTPLVTVSV"
     exon            complement(944560..945312)
                     /number=1
     CDS             complement(join(946541..948343,948407..948736))
                     /codon_start=1
                     /locus_tag="AO090038000365"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000230"
                     /protein_id="BAE64164.1"
                     /transl_table=1
                     /translation="MNYLHHPYAYAGHAAVPMEQPIAYDPTMAHPSMMHPMEGYIYPH
                     PPFDMIDFYHQPIMDYEEYAENLSRPRLTKEQVETLEAQFQAHPKPSSNVKRQLAAQT
                     NLSLPRVANWFQNRRAKAKQQKRQEEFERMQKAKTEAEEAARIKIENAEKSESNPDVK
                     EETDKETPKQSSDQTMSDDRTKTPASNSRSKHHKTKSESAREATFASLQRALNAAVAA
                     REHYSPDEQGQPATIHEGSVSPTTTYSGMNNHGDSRAAQSSSTTPFSEWENAKETAMS
                     WSASQSPQEHLGYSAAESLTVPELDGSHQNVQHSDTLQFHSSQNEEWSGQVQGTKSFP
                     GYHSSNDAEASYSAAQYTLHPESSLSRRGSSDDLADSLEGIGIHAAGLPIRTDRSSWK
                     EAGKELDLAARRKRPRPAAIGTSRSSSMLAGSAASMSPTTRLPSYGSAPGVRQSKSAQ
                     CLNSRYAGVRKASAAQRSPLNLSSFAEAGALGTSKPEMSSMLSPAVTTGGLAPPTPLT
                     PDDLHHFIPNTPSDGGYCLSAQPTSQLFPTTQPMQINIASPPATPMAMDMLSTYQYHS
                     VAPPMSAPAHYTSFPDYVTCEGAPLTGRSWTGANSMPSPEAAFQNRVPITQADVSSLS
                     YGQALEQGRQPADSLSAAGSPPLMYTTDADMHTSSGSFHGDAKPTEFYIREFPEQQEA
                     HRFVAQQLPQKPKAYTFNNQTPSDWRGN"
     exon            complement(946541..948343)
                     /number=1
     exon            complement(948407..948736)
                     /number=2
     CDS             complement(join(955907..956318,956664..956710,
                     956761..956808))
                     /codon_start=1
                     /locus_tag="AO090038000367"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000232"
                     /protein_id="BAE64165.1"
                     /transl_table=1
                     /translation="MASFQISTELSSIRLMAKSSAFLPAIVKHWHKYLLSQLDDAGAC
                     WGVVTSGTRALVDGWLGVMNLTHPKMLVVAEDVELGKPDPRCYLLGRKRLGLEHSSSL
                     VVLEDAPSGIRAGKAAGFKVIALTTTHSLEQLQEAGADWIVEDLRSLSVKGVVDGRIL
                     LEIRDAYQ"
     exon            complement(955907..956318)
                     /number=1
     exon            complement(956664..956710)
                     /number=2
     exon            complement(956761..956808)
                     /number=3
     CDS             join(957252..957264,957324..957418,957486..959012)
                     /codon_start=1
                     /locus_tag="AO090038000368"
                     /note="GTPase"
                     /old_locus_tag="AO070331000233"
                     /protein_id="BAE64166.1"
                     /transl_table=1
                     /translation="MVKLGKNSKRTPVRLRHKIEKASAAKQRKQRKLAKKNPEWRSKI
                     KKDPGIPNLFPHKAQLLHEMEERKRLKAEEQERIRDEARARKKAQKESQQQGDDAEDV
                     MENDIDLEGDSDDEDMDEDVDESSNPMAALLASARARAAEYEDQHESDDDDEMDEDED
                     EDMDGMDEDEEEGGAALGDSAPQLVSQTHSKESSRRQFDKVFKQVVDAADVVLYVLDA
                     RDPEGTRSKDVEREIMAAAGGNKRMILILNKIDLIPPPVLKNWLVHLRRYFPTLPLKA
                     SNGTANAHSFDHKQLTVKGTSETLFKALKSYAHSKNLKRSISVGVIGYPNVGKSSVIN
                     ALTARLNKGSSNACPTGAEAGVTTNLREVKLDNKLKLIDSPGIVFPNAEKKKSKKKQV
                     EERARLVLLNAIPPKQIEDPVPAVSLLLKRLSTSEDLKSKLLQLYGIPALFNAGDQTH
                     DFLIHVARKRGRLGKHGVPNIEAAAMTVINDWRDGRIQGWVDAPVLPVVAATDDASAP
                     AAAASGVDTKQVVTEWAKEFKIEGLWGDGADAEMAE"
     exon            957252..957264
                     /number=1
     exon            957324..957418
                     /number=2
     exon            957486..959012
                     /number=3
     CDS             join(959868..960017,960146..960955)
                     /codon_start=1
                     /locus_tag="AO090038000369"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000234"
                     /protein_id="BAE64167.1"
                     /transl_table=1
                     /translation="MPPRKSTSETVEDPASPSQAQTQSPPTQSQPIQATEQQLKARAE
                     GGVSIEDYLLPRSLTLRLAKSVLPPNTSIQKDAVLAIQKAATVFVSYLSSQYYPPSPP
                     FSFSFLCVALYWMGEVLFGLVGVYDAKCGFYSANEATLKRTVAPSDVFSAISELEFDG
                     FRSRLEKELDAFTELKAGKRKAKKGDTEVTAAEGVKGSAASEGGGGASRGAKRVKRVE
                     GEEAASSRPEEGDDGDETQDEAEQVDEQEHESEAEEDDEGEEEEEEEEEEPGEEEDID
                     RVEDLDRDSRARRLMDPDAAGDESDSDDDAGPSSQLRGDLGLG"
     exon            959868..960017
                     /number=1
     exon            960146..960955
                     /number=2
     CDS             complement(join(961433..962814,962883..963216))
                     /codon_start=1
                     /locus_tag="AO090038000370"
                     /note="sirtuin 5 and related class III sirtuins (SIR2
                     family)"
                     /old_locus_tag="AO070331000235"
                     /protein_id="BAE64168.1"
                     /transl_table=1
                     /translation="MDDGFSDVSELSSPPASPTPPPGFYPSPPPSQEADESSGTRSQD
                     RDDLPPAKKRRRVAAPKERRTQRLDLSSSAGLSYTEQQAQIDLLTKTIRRHRKIVVIA
                     GAGISTSAGIPDFRSTDGLFKSLQKKHNLKASGKLLFDAAVYQDETLTASFQDMVRSL
                     SEEAAKTSPTAFHHMLARISQENRLTRLYTQNIDGIETSMPPLATQIPLNVKAPWPRT
                     IQLHGSLEKMVCQKCRHLGDFDGDMFDRPDAPECPECARNNQFRIETGQRSHGIGKMR
                     PRIVLYNEHNPDEEAITSVMNADVRSRPDALIVVGTSLKIPGVRRLVKSLCSVIRSRR
                     NGVTMWINNEPPAGKEFEDCWDLMVKGDCEEVARLAALKRWDDHSENVFDECNASEVE
                     RVKNEHGVSIVIETPKKRQKTQTGFLTPSSSHDEEASKVPKKGGSRSNPASRGRSLQE
                     VLKASKTAESKKPAAKKSAPRRKIKKDEPAKNTRITTFSKVTKAQKVATDTEKAVKLE
                     KEENKPMHPLPPGAARNNGPMIPQLAQKGEETPQRSSRWRQPDTISPKSVPKGMSQLL
                     NQPAA"
     exon            complement(961433..962814)
                     /number=1
     exon            complement(962883..963216)
                     /number=2
     CDS             join(965343..965497,965562..965907,965966..966679,
                     966791..966817)
                     /codon_start=1
                     /locus_tag="AO090038000373"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000238"
                     /protein_id="BAE64169.1"
                     /transl_table=1
                     /translation="MPMIMDDGINVDDLFGESASLELGLPATAPTSNSTKGLAQRLDE
                     MRLLGCCQKIAWSKQGCIAYISQDTLRVNLRHLECRPSDGKWVLSDDTPLHPVAEAHG
                     GQPLVHLCWNEIGSELAVVDSSGRVSIYNIAISLNSLAGQRQAAFDPVDDATQIVGMM
                     WLNIQRSVHAFNVAAMVQGRRAYSPFRRRPIGPFHPAGKAALLCVTRSGIIRLLYQNP
                     DNKWAEISAELKNASYSDRLLTHAAIVATQNGILIATYSACQKIYFYRVQINWTPPQW
                     DPSQLKQAPNQFPVPSFRFMHSKVEAPCIIPSASRNGEATNDGMPSSTNPLYCLTRLD
                     IVLAAHDNSAGMTTNPWIIAVFSIPPHATPDHSQQQSPCSVIVRWQLESAPQVLHPKF
                     DEVNAKKNNAQIKSRLSMETS"
     exon            965343..965497
                     /number=1
     exon            965562..965907
                     /number=2
     exon            965966..966679
                     /number=3
     exon            966791..966817
                     /number=4
     CDS             join(966865..967123,967175..967285,967338..967799,
                     967875..968578)
                     /codon_start=1
                     /locus_tag="AO090038000374"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000239"
                     /protein_id="BAE64170.1"
                     /transl_table=1
                     /translation="MAVLNGTDDTNTLTSLAHAGFQYPPDSAGSFPSRYRGGTKFDTS
                     IAGLHISFSPSGCNAVTLDGEGQAQLRVMEHSYGAENGLYDENKFSAAVASLTLAFCR
                     GCGSEFNTDDILLILKRQASPDAQISFINEVYRALGVNCNYTQENDKLMSHQYLPKCL
                     SVQAALGFIDKYKSRNFASNVPWTILQLRHASVLYALFLQYLKGGVQAEPPDAGKIST
                     CGKYAELFLTVRFDADAIRILLGNTKWALDLLHYVLNDLLDLADDLESLLSDQEAFAQ
                     KLKTISSLPLIILLSSMSRAFLRFICRGLRGIQAGYATAPLTGDAGVYYAEIYRTLDT
                     SPVRIDVYEKLLAGVDSTVRHVYHGAGFGDNERPGPEKELLVNGRIPPVLVTAVSTIL
                     RQTVPALKPDIDRMAIYMGDYSWLGLGSDRRAELYRRTRDVDIIKKIPFRSTASAGSD
                     ETQSGKHNPSQVRRRCVRCCEIMCGAYPPRPQLSSRMMYKLGYVRYCICGGGWTLESD
                     FHR"
     exon            966865..967123
                     /number=1
     exon            967175..967285
                     /number=2
     exon            967338..967799
                     /number=3
     exon            967875..968578
                     /number=4
     CDS             join(969206..969557,970185..970225)
                     /codon_start=1
                     /locus_tag="AO090038000375"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000240"
                     /protein_id="BAE64171.1"
                     /transl_table=1
                     /translation="MTASYLNSELALGEVDLALLLSLGLEGGLVLGKAATEITGKLGA
                     KVEREVLLVLVEQAELSALVGVDDGVDTSNRLADVVAVTNSQSAFSGLLPFSRCGCPK
                     RILRCRCSPSSFRSRFGGFLGRLKIFLA"
     exon            969206..969557
                     /number=1
     exon            970185..970225
                     /number=2
     CDS             join(970330..970395,970479..970592,970653..971156)
                     /codon_start=1
                     /locus_tag="AO090038000376"
                     /note="SNARE protein GS28"
                     /old_locus_tag="AO070331000241"
                     /protein_id="BAE64172.1"
                     /transl_table=1
                     /translation="MAASTGTGWAQLRQQARSLETQTESLFHSYSQYASMTKLPPDPS
                     EEEIRLESQLKELLEKRQSLVSQLARLLDSEATLTSSALKQNNLARHREVLQDHRREL
                     QRLTSAIAESRDRANLLTNVRSDIDAYRASNPAAAEADYMLEERGRIDQSHNVIDGVL
                     SQAYAINENFGLQRETLASINRRIVGAASQVPGMNALIGKIGSKRRRDALILGAFIGF
                     CFLMLLFFR"
     exon            970330..970395
                     /number=1
     exon            970479..970592
                     /number=2
     exon            970653..971156
                     /number=3
     CDS             complement(join(971510..972203,972272..972687))
                     /codon_start=1
                     /locus_tag="AO090038000377"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000242"
                     /protein_id="BAE64173.1"
                     /transl_table=1
                     /translation="MWKRSMLLSSFTEATLLQGGRCLSCQFRNAAAISTIRLKPALRY
                     YASSSNNDKAAKTAVPNPTANNKVQFKQNPSPLSGPSAAPQPGDDDFVPPTLDRPIGS
                     VIPPQEGQNTGIDSRTLRQRRDDFVNYDRHLERRKELTRQVAKPYFREWSNLRHHEGK
                     TFYSGPRLFKRDKALYFPNMHGTTLASPKEPQDTTTQLRGRISVVTLFSSVWAETQVA
                     TFTGPEQNPGLHEALKSGGDMVQKVDINLEENALKAWLVRRFMWRMRNKLPEQQHRRY
                     FLVRKGVTEGVKESIGMMNSKVGYVYLLDENCRIRWAGSGPAEEHELEALNNGIRKLI
                     QEKKVSMESELPASEWGRKSQNESAAQKPRVVMRP"
     exon            complement(971510..972203)
                     /number=1
     exon            complement(972272..972687)
                     /number=2
     CDS             join(973007..973251,973341..973659,973710..974078,
                     974131..975312)
                     /codon_start=1
                     /locus_tag="AO090038000378"
                     /note="DNA polymerase IV (family X)"
                     /old_locus_tag="AO070331000243"
                     /protein_id="BAE64174.1"
                     /transl_table=1
                     /translation="MVQSISDKETFFQGLERLDALLDDSGDDAEGLSQIIALAEDYVE
                     PVHQDEPALSDSPVQKLGALGATSALQSPSLDVTVQRNRRQEKTIIYYQNSSGTASNL
                     QGPRILSVISFASFEPHHIVFIMLTGLSVFFPNSDVSPLRRLRIQRAQEYGALWARTW
                     GDNVTHVIVDKGLAFQEVLKHLCLETFPKPNIALLDESYPSECIKFRTVLSTSHVRFR
                     INGMPVVSKAKEVSQQNEPSDESLPLKPAGRQKRQLETQSQSSESEDDSEYPPDTQRV
                     NDFSDEAHKEVVSEPLRERDALDDMIDEAKAVNDLPLDPLDSFDDEHVTEEADLGTSE
                     ESDCQPNTRKRKRSSGRDNEGNNDWQQKFACVQKHDPKSNSENPNRRTIDVLQQMLDY
                     YARTDDHWRTLAYRKVISALRRQPKKILTKSQALAIPGVGPRLADKIEEIVCTNRLRR
                     LENTNLTREDIILQEFLGVYGAGISQASRWLAQGYRSLEDLRTKASLTPQQEIGVDHY
                     HDFSQRIPRKEVETHGEIVKRVVQKADPGMQVIIAGSYRRGAADCGDIDLLITKPDAT
                     IEQIRALMIDAVVPKLFKRGFLQASLAITSRGDGSKWHGASLAPGGQIWRRIDLLFVP
                     GSEIGAALIYFTGNDIFNRSMRLLASKKGMRLNQRGLYTDVLRGPQRVKLNTGRLLEG
                     RDERRIFEILGVPWRPPEHRIC"
     exon            973007..973251
                     /number=1
     exon            973341..973659
                     /number=2
     exon            973710..974078
                     /number=3
     exon            974131..975312
                     /number=4
     CDS             join(976443..976947,977042..977547,977608..977719,
                     977788..978155,978211..978600,978657..978846,
                     978932..979086)
                     /codon_start=1
                     /locus_tag="AO090038000379"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000244"
                     /protein_id="BAE64175.1"
                     /transl_table=1
                     /translation="MGRKPNQLILEFFIRGQKLEDASNRYQHTCKACGEKFPKGRIDS
                     LTNHLVKKCQAIPLRDRQRVLLRLHELPDLADGDQNKDPNVAGQNKGKGSDLPFTTRQ
                     NFDGLNVLAEASRQVGASDQTKRGGPAYTQSVTVGGKTVVVDPALEAEGFQGHPQAEH
                     VEEDVKPPGTPQGSNATLPSLPNASQDQPPSASPPLAEASLTPDPTSNARQSQLSMIA
                     ASASEMVPQGMPLDHDIVDGLPKVGAWNQQLSTQEQLLFDSLHEHDPTLTAATQRAAA
                     FPRPIAMNPNSQAKGFVNEFGNSTKPAKPKVRGRFSAARRREVQEVRKRGACIRCRML
                     KKPCSGDSPCTTCASVESARLWKHPCIRTRIAEEFELYNANLHATLAYHDVSGIRNQV
                     KFEHYAGRIEVTHFEESMVYVTFSALQGHKPSTSTLDPQLQGLGDDTQFQGPLHELYL
                     LDSDADDLPGKLEMYIKKTASFFYEREASEVMRPTLLLASELSQQKKDILLERVLELW
                     VATHILVDSDLRWRTFCNPTLPPTSMHALAQPSDDGRMPIDEVTNAESYALLCSQLRA
                     ATEKRASQLSKSVMNDLERRLLQRQQSGWFETFLVALILLNCVERTCWLFRSWEDEAF
                     AQRWPLDKRPPYYASQGDRFSDILHMLLKMRSLPPKATPRPDNGILKAVDGSDMNAAR
                     WFDMIKVSRGCLRSQRLSLPRSPLRSKTVATYERLHMICAGPQTVTDETKRTNDFEKI
                     D"
     exon            976443..976947
                     /number=1
     exon            977042..977547
                     /number=2
     exon            977608..977719
                     /number=3
     exon            977788..978155
                     /number=4
     exon            978211..978600
                     /number=5
     exon            978657..978846
                     /number=6
     exon            978932..979086
                     /number=7
     CDS             complement(join(980281..980830,980903..981135,
                     981189..981203))
                     /codon_start=1
                     /locus_tag="AO090038000380"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000245"
                     /protein_id="BAE64176.1"
                     /transl_table=1
                     /translation="MSGMTCSYAEKYFLLDFAKTSGGYEPIGFPLQLSEASHIIKMAL
                     AGESRPSSSSPLADEIVFFEDSVLMQTIANIISYATKSYAYVKSYNDTKHKGYHAIVV
                     ATDGPHICANNIVPQLLTSANPIQTLCAHNPKGPVLIYSEDPSNEYLKDLTTACERYN
                     VHILLLSTNIFDNQAFDTSFFDQPASMLTLPCKESTNSQSAKRPIPSVGPSMPQNNQD
                     LIKPENNEMTVTLRDVLLHTPVQSPKDNGSPHSRDKYATDTERDTVE"
     exon            complement(980281..980830)
                     /number=1
     exon            complement(980903..981135)
                     /number=2
     exon            complement(981189..981203)
                     /number=3
     CDS             complement(join(981692..981809,981883..982088))
                     /codon_start=1
                     /locus_tag="AO090038000381"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000246"
                     /protein_id="BAE64177.1"
                     /transl_table=1
                     /translation="MAPQPSRRLLIFQEARNPQNTAEVVYLPVNKLGLPICGPGPELP
                     SILELPLRILKAFTDIFNQPKYKGWAVMGAGPYHDTSEEGKYYAVVLEQVQGHLQSPD
                     SIVAV"
     exon            complement(981692..981809)
                     /number=1
     exon            complement(981883..982088)
                     /number=2
     CDS             complement(join(982829..982865,982937..983306,
                     983422..984781,984850..985248))
                     /codon_start=1
                     /locus_tag="AO090038000382"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000247"
                     /protein_id="BAE64178.1"
                     /transl_table=1
                     /translation="MSSTSSVSGFGPTLEVTHNRRMAGSPASQRTTEDTEAKDAGGRS
                     SSSSSTISGASESSSSEGAKNQQSGQRASQEGRAADQDHLLEAVRIMKENSIGRMVAT
                     TEEGGPDDELSSVILSSEAERILENAKKRLTLMEGNLTRARSSMRASPSLSASPTPSP
                     GPQAMGLGQPVGGLYQSISRADRRASTRPRATYTSSQDTSNNRHSRVYSETRLPSVDQ
                     SSLPTVEPDLSRSLSALGSSSVSNFNNDERTFRYDPSRAYLTHRASVSKPHSARASPS
                     NLQEDCSGSPSGLGISAEDTEDHTLGAEDLHSVYPVSDPPSRSQSQLHVRDLQDQMKG
                     LHIKISSLKVKAQEDNLRRRSLQSLRTPSPFTAADQYFTNTMELRDSQLRPNAGRSPD
                     PTQEPQRSGEYKHARDGNEAVTSHSGSEIPNANAKPPQPKVIEPVDEDGRSVIESLYE
                     DAEEGEYNSDDSSDIDREALSEILREPLEEYDDLDAFPAVPNSDSRPHEEREDAFDYE
                     NFILHSALGNYSARLRRTSNVSTSSVETTRPIHDRPHVRHSRTNSGASLSTVASYETA
                     TEGDHDDLESVLYWDRKFNDGSESEMGTPRAVRRQPNSRSNEEEYLSTPRQSMTGSAT
                     PTSLVSSLVSTVRAASSPHPKSVANGNMGINEDDTRLLEQLFKSLGDVCMDLQTITTS
                     SDPDPKRVRQLRRRLDAARRVLDGELDTWSQRPRVDGAF"
     exon            complement(982829..982865)
                     /number=1
     exon            complement(982937..983306)
                     /number=2
     exon            complement(983422..984781)
                     /number=3
     exon            complement(984850..985248)
                     /number=4
     CDS             complement(join(987201..988915,988979..989360))
                     /codon_start=1
                     /locus_tag="AO090038000383"
                     /note="puf family RNA-binding protein"
                     /old_locus_tag="AO070331000248"
                     /protein_id="BAE64179.1"
                     /transl_table=1
                     /translation="MVGVKRPVDAGDERKGKRTKTKTPTVPTKKAKAAPEKKSSSKSV
                     AKKSSKPEKKDKKASKKKVIEEEEDDDDFDLDDVEDSEIDDLDDLEDEDVEMNDGGDN
                     DDEDEDDSDNEEEPKKVADNAEAAKNKTSSRESHAKQKALLQERKAAKPNADMIQRSK
                     QLWERLRRKSHVPLEERKKLIAELFDIITGRVRDFVFKHDSVRVIQTALKYANIEQRK
                     QIARELKGHYNELAQSRYAKFLIGKLIVHGDTEIRDLIIPEFYGHAKRLIRHPEASWI
                     LDDVYRQVATKEQKAKLLREWYGAEFSIFKEEKGKVPTAELSEILKENPEKRGPIMHF
                     LHELVNQLIQKRTTGFTMLHDAMLQYFLNTKPGSSEANEFIELLKGDEEGDLVKNLAF
                     TPSGSRLMCLSLAYANAKDRKLLMRFYKDTIKLMAGDLYGHMVLLTAYEVIDDTKLTA
                     KMIYPELLNQGGDAEARNEELLYQVTDLTGRIAILFPFAGDRTKWLLPEIDQAVLKEV
                     REIRQETSKKDPSVRRQELIKAASPTLLEFIAARADSLLETSFGCQFLAEVLFDADGD
                     KSEALSAVAVAAKTRSDTKDLPFVGRLLKSLVQGGRFNSVEKVVEKVQPPLNFHGLLY
                     EQIQEEIMSWATGSNVFVVVALTESDEFEKKAELLKTLKKGKKALQQAAAESGKDGKK
                     KSSPTSSGAKLLLEKI"
     exon            complement(987201..988915)
                     /number=1
     exon            complement(988979..989360)
                     /number=2
     CDS             join(991610..991616,991701..991765,991840..992547)
                     /codon_start=1
                     /locus_tag="AO090038000385"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000250"
                     /protein_id="BAE64180.1"
                     /transl_table=1
                     /translation="MKDSIAASDFDTISRSYLNVAYSSLDSNSSQSIYIALCPPFYFL
                     LHNHLQLSSIPPSNISYLQALLSPYQVTLPCSTKNLLTKYFATTKMVRLLALAVLAAA
                     TVEVASAVALSTPQSPAEITIWRRDDLAVTTAAATATETPTEDTDGENIPNDDATTGD
                     DDEVSTDGLKWRRKGKCRSDLDCDLGYLCGSGRCILGCLADKDCRRGQTCLGGQCRTA
                     GGANPPSCKPYKQLCGANEECCSGVCRLGWRLTRECKHSKH"
     exon            991610..991616
                     /number=1
     exon            991701..991765
                     /number=2
     exon            991840..992547
                     /number=3
     CDS             join(995576..995662,995760..995839,995938..996005,
                     996074..996885)
                     /codon_start=1
                     /locus_tag="AO090038000386"
                     /note="DNA repair protein RAD51/RHP55"
                     /old_locus_tag="AO070331000251"
                     /protein_id="BAE64181.1"
                     /transl_table=1
                     /translation="MTADMDTQNEYDDSGLPGPGAPTPLSALEGVAGLTGRDIKLFVD
                     AGYHTVESIAYTPKRLLEQIKGISEQKATKVLVEAAKLVPMGFTTATEMHARRSELIS
                     ITTGSKQLDTLLGGGIETGSITEIFGEFRTGKSQICHTLAVTCQLPFDMGGGEGKCLY
                     IDTEGTFRPVRLLAVAQRYGLVGEEVLDNVAYARAYNSDHQLQLLNQASQMMCETRFS
                     LLVVDSATALYRTDFNGRGELSTRQTHLAKFMRTLQRLADEFGIAVVITNQVVAQVDG
                     GPSAMFNPDPKKPIGGNIIAHASTTRLSLKKGRGETRVCKIYDSPCLPESDCLFAINE
                     DGIGDPSPKDLENN"
     exon            995576..995662
                     /number=1
     exon            995760..995839
                     /number=2
     exon            995938..996005
                     /number=3
     exon            996074..996885
                     /number=4
     CDS             join(997345..997984,998054..1000195,1000249..1001399)
                     /codon_start=1
                     /locus_tag="AO090038000387"
                     /note="predicted protein"
                     /old_locus_tag="AO070331000252"
                     /protein_id="BAE64182.1"
                     /transl_table=1
                     /translation="MAKIYKDTKVDLRPYSSNAVVNIQIPTHASTQSRARFSISSSVG
                     ADEPIAKDEEEFSRRHLSSQGSIYFRKRTVYPRSFLWRVVNDSKVLEIQCVDLTKGGI
                     EHSVYNNTIRLDFQEEILPSCVDFADLEDHEVLSVFVITASKQLYTLSLRPEFFRRTS
                     AIDNNVLDWCKSYVPAPMSFSYPHRLHASSPLELFISLDNGALLRLTRRSGDDGSNWS
                     PLTFDERTWGASIRGLVRWHAQPSIKYKGRNLDTNLANAIATTSDQTYAFAVCLNHTL
                     KIWNLATNKLAATTDLLGREVQEPDSLSYTLNPADSSFIRVFNVERALDGAYRYYVIT
                     YSPFEDGRFKFWAVKGGLTSPLVIEDLFPDARLRPLDPDSTGNVFWSIIDFQLKPAEE
                     GKGMELWVLWRNSGVYQLYTLHFNFETLVRDWDTNWVSTAIDTRGQEPPPPMAFSDVV
                     DPTEKWLKFLLQPNKYSPEVLETSLAVYQEALRPLSSPSVLKKSASLTERLCSTIAAT
                     VSLRKFAEDEMDFARYRTDTDAKWRQFWQIAEDIDKRRFEPVSLLYDFYYETPWLLLS
                     DSCAVIRECSSTELLLHNSGAELRAEGHKIADRWRHRNLDEEIGNMVEQASRLMRVAS
                     GFRKRFPAELNAACQNALEAELFTDPSSSVQDRMDAFRDRCDFGEQISNKTYDGLLAA
                     MDGYLNIYNLPNNVFYTIIDTIPLGFPGKDSDLLATHFGVKVTVNGVQEAILYTRQLL
                     IDLLVLVVFVDGEVQQEDTSEFDAVDLFGSLITLLREYEMMAWLSSNTRKCLDRPTNV
                     SDDQSASQFSLKDSPSKTTGSRMATILEDLFASDIKPRQTIGLPQSYTLTLGIHDVLS
                     WVTRQGEVAFPNALVYIQCDLIAKNNIDLAWDFLRFQPSTSWATYVKGRLYVAMSEFD
                     TAALYFRKAAYLLSCGKPLGNLHEMSSTLLDIVSVDSFHNGLPKYFQHILTIFEQARS
                     FSHVADFARLALQALASENHNDQDPEYNILRTDLLSRLFYSSLQNCQFDQAYSALSRY
                     KDFALQKSALSSLVTSILVASGPGTAGLQQILHFPTALIPNIASHVDDILASLARKQT
                     TFSSLLDTGSSTPDYQRILQAYRIARGDYRGAAEIAYRNVQRLRNARDAPSSHLVLSK
                     NRDIDGTQPAEEDDLESKEIRTELLSLINLLGCVEKSEAYILVEKEDSSVPAAPFADR
                     RRSLQADDDGNVFMEEADVNSPTPYGSKRRLSSSATAIVPSGRRDSRSSVSTVGSHAP
                     RRRVIVTLDHLRREYQSELDRVSRIERGDWEFGVLDAIEADNDDTMRL"
     exon            997345..997984
                     /number=1
     exon            998054..1000195
                     /number=2
     exon            1000249..1001399
                     /number=3
     CDS             complement(join(1002310..1002541,1002600..1002974,
                     1003031..1003111,1003171..1003283))
                     /codon_start=1
                     /locus_tag="AO090038000388"
                     /note="multidrug resistance-associated
                     protein/mitoxantrone resistance protein, ABC superfamily"
                     /old_locus_tag="AO070331000253"
                     /protein_id="BAE64183.1"
                     /transl_table=1
                     /translation="MFSENVPSENLPTENDSLPPDWPSQGNIVFDSVSAEYRASEPVL
                     RDVSLSIQAGEKVGICGRTGSGKTSLLMSVFRMVELSSGGIQIDGVDISKVPRQEVRS
                     RINGVAQSPLLIRGSVRENIDPTGCHTDKSIMEALRAVQLFSKVQENGGLGTEVDELF
                     LSHGQKQLFCLARAILRQGNILVLDEATSSVDTVTDEIMQRVIRERFSNHTILTVAHK
                     LETILDYDKIIVLDAGRIVESGSPYALLASDTSHFSKLYASSMMEEAE"
     exon            complement(1002310..1002541)
                     /number=1
     exon            complement(1002600..1002974)
                     /number=2
     exon            complement(1003031..1003111)
                     /number=3
     exon            complement(1003171..1003283)
                     /number=4
     CDS             complement(join(1004092..1004131,1004185..1004308,
                     1004373..1004399,1004439..1004714,1004794..1004956,
                     1005017..1005798,1005849..1006082,1006140..1006419,
                     1006482..1006703,1006719..1007278,1007402..1007423))
                     /codon_start=1
                     /locus_tag="AO090038000389"
                     /note="multidrug resistance-associated
                     protein/mitoxantrone resistance protein, ABC superfamily"
                     /old_locus_tag="AO070223000001"
                     /protein_id="BAE64184.1"
                     /transl_table=1
                     /translation="MAVMGKTSIIHLVLIALWALPAANRTQASIAANAVLTVGILFLG
                     VLSYAEHNYSVRPSLLLGIYLSITLLFDIAKTRTLWLRELAEINRIIAILTSVAVGVK
                     ALLLLLETVEKRRILKNVYAKYPPEATGGIFNRFLFWWLNPLFKTGFSKLLSVEDLYT
                     LDKQLASKTLHNSLETMWNNGSKPQMTDQFILQQPGNKNSLLLVTFRTFKWQLLSAVL
                     PRACLAALNICQPLLLHRSLSFSVEPETNATTNIGYGLIGAYILVYLGMAVTMGQYQH
                     MTYRAITMVRGAVISMVYRKATTLSVEDADPASSLTLMSADIERIVQGWQTIHDIWGN
                     ALEIGLAIFLLEQQLGVAAVVAVGVAVVALAGSLISLVFVMSRQAMWLEAIERRISST
                     TSMLASMKGIKMLGLSDLLMTCIHNLRLDELRISRNFRKLLVWNMAFAWTTRIFAPIF
                     AFGAFVGISHKNGNDAALNTSTTYTSLSLFALLADPLLNLVMALMTFLGSVGSFQRIQ
                     EFLEKKGHVDSRDKSRPLQLEPVQESKQLAFVEDSETLTDGSSSAKSEKEPTALSENM
                     VTIKNGAFGWDTQKEPLLKSLTITIPRQTFTMLVGPSGCGKSTLLKAILGEVPCLDGT
                     IILSSERIAYCDQTPWHMNGSIKQSIVAMSGLDEDWYVSVTRACALVEDFKQLPRGDQ
                     TIIGSKGIALSGGQSQRIALARAVYARKDIIVLDDVFSSLDATTEEHIFQCLVGTHGL
                     LRSIGSTIVLSSSSVKRVPFADHIIVLGNEGHVIEQGSFKALDLTGGYISSFALGLPE
                     QNKAAEKTSNSGKSDVQVSSVEQDEDSEVDGPGAGGDISIYLYYVKSIGFVFCISFPS
                     IWMNWWASSNEAEPGKHTGYYLGIYAMLGAVGMLCLIVGCCGPLQANDHYYGA"
     exon            complement(1004092..1004131)
                     /number=1
     exon            complement(1004185..1004308)
                     /number=2
     exon            complement(1004373..1004399)
                     /number=3
     exon            complement(1004439..1004714)
                     /number=4
     exon            complement(1004794..1004956)
                     /number=5
     exon            complement(1005017..1005798)
                     /number=6
     exon            complement(1005849..1006082)
                     /number=7
     exon            complement(1006140..1006419)
                     /number=8
     exon            complement(1006482..1006703)
                     /number=9
     exon            complement(1006719..1007278)
                     /number=10
     exon            complement(1007402..1007423)
                     /number=11
     CDS             join(1011974..1012447,1012531..1012947,1013060..1013371,
                     1013426..1022561,1022612..1022991,1023049..1023693,
                     1023753..1027988)
                     /codon_start=1
                     /locus_tag="AO090038000390"
                     /note="non-ribosomal peptide synthetase modules and
                     related proteins"
                     /old_locus_tag="AO080534000002"
                     /protein_id="BAE64185.1"
                     /transl_table=1
                     /translation="MAHSTQCFLPKFSPLSEGPKGPMSMRMRMSSPETTQLISAWHEG
                     QLDALLQTTWALVLYRYTGSGDICFGFQQPTAGDFATHSSDSASICTCRLSVSEDDSI
                     RGLLEKAKGQSDLVNSAEKCGTPSVVNKSFRLYNTMLMIQNCRETIRTSTDIPVQPCR
                     IRLHVKVLREDIDIFMEWWNNDMSTEHIISMSNYFQQTLTRVLVADDMIVSKLRGIVG
                     SDWDRIYKFNAVTPETHDRCIHEIIHEQALLQPESEAVCAWDGSLSYRELDLLASQLA
                     YYLQVQGVGPEVRVALCFDKSCLQKWNIVAMLAVLKAGGAFVPLDPTHPAARLQSLVR
                     SVQARIMLCSRNHAEDLRVVVEHLIPLDNDTWEERSIPRGDVSLLTEVKGYNAAYVIF
                     TSGSTGEPKGTLMEHKAYVSSAMAHAPRLRVFSNSRLLQFAAHTFDASLVEILTVLLV
                     GACTCVPSEEARLNNITKVINDMRVNHATLTPSFVDFISISDVPRLETLVLAGEAMSQ
                     SHLETWSKINLVNGFGPTETAVTAAVNSNVTRSSDSRDIGLPTGIRCWIVDPDDHNQL
                     VPVGCVGEMLAEGPSLARGYVNNQQKTAEVFIYDPSWAKGQGGDPGRRFYKTGDLVRY
                     NSEAGSLTYIGRKDTQVKFHGQRIELGEIEDNLNTDSNIKHSLVFLPKSGFSEGRIVA
                     VLSLPIFDDISDPEPAPLRLLDDSKKNSIISQIRDRLSARLPAYMIPTVWLCVEALPM
                     LVSGKLDRKATANWVGSLENDPNIQLAKLDPMPDDSSTRSGNATEEQLASIWSRVLNV
                     PRNHISLNESFLSLGGDSIAGLTCVGFCAKQGIGITVQDILRSKSIRDLATRAKDIQQ
                     PASYEETIEKPFSLSPIQKLHFMVRQEGQGHFNQSVLTRLNQQVDEHDLRRCIEILIS
                     RHSMLRSRLTDLGPEGLQQRITEDIAGSYRWRLHDVNCQGQIEHAIADSQSSINAFTG
                     PVIAVDMFIGNGEEFVLSLVAHHLVVDIVSWRIILEDLEELLLNPDEATSQTGSLPFQ
                     TWCQLQANKCQEPNIALDNLPPPDLAYWGMEECPMTYGDVDCETFQVDAESTHTLLMD
                     CHQCLQTEPIDVFLASLLHSFQKTFSDRPLPVIYNEGHGREVWDSGIDISRTVGWFTI
                     LHPITLQHIAEDDPVKTLIGVKDLRRRVTDNGRQDFARRLVGDAKDRGHPSPMEISFN
                     YVGQHRDLQRQDGLFQLMNQMAGETGRGGGAADFGEKTPRFALFEISAMAVQGQLRFT
                     FSFNRYMKHQQSIRDWISNFHNLLKHLGPKLQSHAPKPTLSDFPMLSLTYEELETMFS
                     SRLPSAGIESPEQVEDIYPCSRMQQGILLSRSRDEGFYSVHDTFEVKGSRGEPDLNRL
                     VFAWQQVVMHHPMLRTIFVDKLTSRELFCQVVLKTIDSQPSIIRCIDENGVLAAFDEQ
                     GPMTYVGYRPPHRFTICQTTTGKLFCRLEINHVSMDGSSISIIARDLQLAYAGKLETH
                     RRPMFKNFLHYLREQDDSTEYWCSYLSDYMPCHFPVLNDGVCSENQLRSIRLNVNFYN
                     ELLDACERAGVTLSTAISTAWGLTLGQFCGSDDVCFSYLASLRDMPVEDIDSIVGPVI
                     TLLACRMKIPGDGLLTDILHQVQNDYMEQLSHRNTSLIDIQHALKLSDTTLFNTGVSY
                     RKLPPHNANAEEVQLVEVGSIYDPAEFPVYVNVEVADDDAHIDLNYWTTALSVGQAEN
                     VASIFLKALENIAHYKDTKLSTIGDIDFLSEQFCTKLCEWNAKLPARPERCAHEIIRQ
                     QALSLPLSAPAICSWDANLTYSDVEHLSTRLAQYLIGLGVKPEVFVTLFFEKSAWYVI
                     AQVAVLKAGGAFVSLDPSHPESRLQGLIEDVGAHVMLCSVKHTEKASRLCNTVFAVCE
                     ATIDGLTVPATIMPASIPSIHNAAYAIFTSGTTGKPKVSVIEHISLGIAASTFTEIFR
                     MGPRARVLQFSNYIFDVNISETVITLMTGGCICVPSEEERLNDLSGAINRMGVNMCTM
                     TPSSISTLKPEAVPSLRTIITGGEKMTKSHVDRWADRCVINAYGPSEATVASTASVKA
                     DGGRRLTEDYNSIGTAFAGRAWIVDPKNYHRLLPIGAIGELVLEGCNVGRGYLNNAEK
                     TEEVFITDARWTEHSGLKEIFKNKERMYRTGDLVRYNADGSLCFISRKDTQIKLNGQR
                     VELEEVEQQCVGHLPANTQVAVEVVTPEAKTVAKCLAVFFTTDDHDKNESDLLFPMNE
                     TTVSIVKKLHSSLKESLPTVMIPKLFFPVRRLPIATTGKLDRKGLRTMVEPLPKEKLM
                     QYTTFNSSSRQIAEDGAEGKLRALWEEALGLAPGSVGAGDSFFGIGGDSLSAMKLVSS
                     ADSQGIALTVADIYANPILADMAKICKSSEAAADTATIEPFCLLPSSMRKEALREVAD
                     QCHVSEGSISDIYPCSPVQEGLITLSTKQQGAYIARPIFKLTDEVNLERFRGAWQRTV
                     DELDILRTRIVHTDSMGFLQAVLDKEHISWTTATTMEEIMDDTPELPNHSGGLLTAYA
                     IVQPGDSSSRYFIWTIHHALYDGWSVPLVLKRVEELYKDPSATGSTLPYKLFISHLQD
                     KDLSESDNFWRSQLADISCSPFPHSKASTLDAVRVGNRHHSSVEIGQTPASKDLTLPE
                     LIRAAWAIVISVHTGSNDVCFGETLMGRNISLRGITEVAGPVLTTVPTRVQVDNELLV
                     TQFLQNIRTLTTAMIPHQHSGLQRIRKLNDNTSFACDFQNLLVIQTEEEVMNGDLWVP
                     ENNQTSDEFFTHPLTVECKISGSKLVLTVHHDEIVLDSWQTERLTSQFTHVIQQLLTV
                     SEKDIRKVGDLDVASPQDKQEILSWNQRQPARVDRCVHDIIREKGAAQPEAAAICAWD
                     GQLSYREMYGYASSFAAYLNTRGVGPEALVPICLDKSVWAIVTILGILIAGGAFVPLD
                     PAHPTSRHKEILEEIEARVILCSPQYRNRYAGSVKTVVPVSQETIRAYSALTRKTPSP
                     NRATPSNMAYAIFTSGSTGRPKGIIIDHRALASSVTAFSPIVHLNENSRAFQFASLTF
                     DAAVMEVLATLMHGGCICIPSEEERLNDVVGAIRRMDVSWAFLTPSIASIIEPSSVPS
                     LKVLACGGEKLSREVVMKWAHRVKLINGYGPTETTIFAVLNNVTPSTDPACIGYGIPS
                     TLTWVVDPENHNRLSPLGAIGELALEGAALAREYLKSPEKTADAFVNEPTWIRDFPSS
                     LPSPRRIYKTGDLVRYNSDGSIEYISRKDHQVKIHGLRMELGEIEHRLCEDRRVRHAV
                     VILPISGLIQKRLVAVLSLESLNSGNGLNSDGACELISQDQMDAAYSELQEIQKSLES
                     QLPIYMVPQTWAVIKKLPMLVSGKLDRKKITAWVEKIDESTYDRIMQDYDNIKRGNTE
                     HKDEEDNDSSINLLRDIFTQVLNIPSSKIDPSRSFVSLGGDSITGMAVISRARKHGLN
                     LTLHNILQSKSITELALTSTVIVQAVKHEEKSGELFNLSPIQSLFMQTTDEFQGKARF
                     NQSMTVRLTKRTKPDTVKNAIKAVIDRHSMFRARFSKSSDGNWKQTITKDIDSSYRLR
                     THSINNAGEMLPEIAESQQCLDIQNGPIFAADLFEVRGHEQVLFVVANHLCVDMVSWR
                     IVLQDMQEFIETGTLSSDKPLSFQGWCDLQFENSKRENGVINRPFSIEPPNLTYWGMT
                     NSQNLYGHVKMESFTLNEEATAFLLGRCHEALRTETVEILLSAVIHSFSRVFTDRNVP
                     MIYNEGHGREAWDASIDLSRTVGWFTTMCPLHRLDIIDTLKRVKDTRRKIANDSRSYF
                     AQSLLHPTGSDSKSFPVPLEVVFNYLGQLQQLERNDSLFQHYGGAFDAETFEVTGDMG
                     PQTPRFALFEISAIIIKDRLHVSFTYNRNMQHKSRIQNWVSECRKALEEEVLSLKDYS
                     PAPTLSDYPLLPTTYAGLDDLVKKTLPRAGVESWNRVEDIYPCSPVQEGILLSQLRDP
                     HGYMFHGIFEVRSLQGKRIDSALLRKAWAMVVNRHPALRTLFIDSNYKGGTFDQLVIK
                     ASGDDVLEFECDESLAFAKLDQVKLHDINATRRIKLPQHLTICTTASERVLMKIEMNH
                     AIVDGGSVDVLFRDLALAYNNQLPAGSGPRYSDYIKYTRSQVHDKALKHWKQYLAGVR
                     PCHLSFSTKPSGDRQLGSHLMSFNRFGELQKFCEHNSVTLANLTLSAWAVVLRSFTGS
                     DDICFGYPSAGRDSPVPGIHDAVGIFINMVCCRVKFISGQTLQDVSKLVQSDYIGNLP
                     YQNCSLAQIQHELGQQGQSLFNTTLSIQNRSAPEDSGDKTISFEMQRAYDPTEYPVTV
                     NVETTKGREGIMLRYWTDTVSDSQAKDLADAIAKVFTCFIESPSRLVSELKLAPSQGP
                     SVTSNSALVDLDVLNSDALRKLIDIRVNEIITRMLKEGALAIPTVHELHIKASEGSFA
                     TKRMPRERDLSDSMLTLTNYSRASTDTRESTDLEKRLWTLWSSALGLSPNIVNRKGSF
                     FKLGGDSITAMKMVGAAREEGLSLSVADVFGNPVFEDMLAIVVAKDTPKLFETHTEIT
                     QLSEKVPETPVVITRAVSPDEISVLRPMPIDDSSLQSSICSKIGVFRGGIADVLPVTD
                     FQAMSITASLFKSRWMLNYFFLDGKGPLDIRRLRESFLRVVDAFDILRTVFVCFHGQF
                     FQVVLRKMRPEIVVHETEMSLDEYTESLQQRDREQEPRQGEQYVQFYVVKKKNTDHHR
                     ILIRMSHTQFDGVCLPRIMSAIKMGYEGSPIPPTSSFSNYMRMLPGSITPEHYQHWST
                     LLQGSKMTDIIRRQTPNNFQHIGSFTAQKKAIEISATVIGDVTLATVMQSAWAMTLAK
                     LSAQSDVVFGLTISGRNATIPGIESTVGPCLNMIPVRVKFGDRWTGLDIFRYLQDQQV
                     ANMPYESLGFREIIRNCTDWPDSTFFTTSVFHQNVEYEGHMQLDDNMYRMGGVGVVDN
                     FTDITVVSKPTGDGKLDITLAYSQRSAITTPSATKILDMLCETAHSLITNPQITLPSP
                     STLRSLPCQVIDDLPRPTEEHFLTSNLNSRSISELLVHSDILNKTWQHVLPNKNPETP
                     RPPFQLNSSFFGLGGDIFSMGQLVWCLEQEGLQVRLEELLEHPTFLGHLAVLALHNAK
                     QENLVERTRTVESRARVPSVSVKGRKSANWNPLGKAVTLARRFTTKWSSKA"
     exon            1011974..1012447
                     /number=1
     exon            1012531..1012947
                     /number=2
     exon            1013060..1013371
                     /number=3
     exon            1013426..1022561
                     /number=4
     exon            1022612..1022991
                     /number=5
     exon            1023049..1023693
                     /number=6
     exon            1023753..1027988
                     /number=7
     CDS             complement(join(1028556..1029410,1029469..1029800,
                     1029861..1029952,1030008..1030029,1030092..1030408,
                     1031453..1031799))
                     /codon_start=1
                     /locus_tag="AO090038000391"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070223000005"
                     /protein_id="BAE64186.1"
                     /transl_table=1
                     /translation="MRAMRKHDEARQLLKESVLNHDKSLFTGHLKDNWIHPVAHFEMA
                     ANLWMERPGYIAVHDAPATEGKITNGEEGTQLERKQVQECKEYLEKAARWESYELDAR
                     IGLKVTAAMEAVRNSLDDDGNSLELRHTNYDERPNATLEKQSTAASALSVFEQRAQSV
                     VSRIRSREPGQTARFTHPLTHTKTSTDVIVDFDGPDDPYRPLNWSFRKKAITTLLYGL
                     TTMGATWASSIYSTGTRQVDAEFGVGEEVGTLGTALLLFGFGLGPLVWAPLSEVYGRK
                     PAVLAPYFIAAVFSFGTATAKDLQTVMITRFFTGFFGSAPVTNTGGVLSDIWTAEQRG
                     AAIVGYAMAVVGGPVLGPIVGGAIVQSYLGWRWTEYLTGIMMMFFLAMDVLFLDESYP
                     PVLLVYKAQRLRFESGNWALHARHEEWDVTFKELGNKYLTRPFQLLTTPICFLVALYA
                     SFVYGIIYLSLAAFPVEFQEVRGWNQVVGALPFLGYLVGILFGAAVNLLNQKFYVRRF
                     KANNNFPVPEARLPPMMLGSVFFAAGMFVFGWTGQPDIHWIGPVIGAVMMGFGFFTIF
                     QAALNYLIDTFQKVSASAVAANTFLRSVFAGCFPLFASIMFRKLGVPWASSVLGFVSV
                     ALIPIPYLFYIFGKRIRAAGKWSRASVYGD"
     exon            complement(1028556..1029410)
                     /number=1
     exon            complement(1029469..1029800)
                     /number=2
     exon            complement(1029861..1029952)
                     /number=3
     exon            complement(1030008..1030029)
                     /number=4
     exon            complement(1030092..1030408)
                     /number=5
     exon            complement(1031453..1031799)
                     /number=6
     CDS             complement(1032299..1033174)
                     /codon_start=1
                     /locus_tag="AO090038000392"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070223000006"
                     /protein_id="BAE64187.1"
                     /transl_table=1
                     /translation="MAQLMSAVVGVLNESLTESIKGFYKMRKAYITLDGILKMEQAYM
                     QSISGGVSPADQGEASKPSPTATVEAKGLSQRLSDLSVSQDSTKSGESTELSTPNPSD
                     MLSHDPDSDIFKNQIDVFVHSGSNFCFGILLLVISMVPPAFSKLLSIIGFYGDKERGL
                     RMLWQASKFNNLIGALAAFAILGYYNGFVRYCDIMPDPVPGDQGDVQGYPQKRLEALL
                     AQMRQRFPKSQLWLLEESRMEGANKNLERSLELLCGEERSPLKQVEALRVFERSLNAM
                     YLHKYELCAEAFLEV"
     exon            complement(1032299..1033174)
                     /number=1
     CDS             complement(join(1035900..1036666,1036727..1037147,
                     1037220..1037285))
                     /codon_start=1
                     /locus_tag="AO090038000395"
                     /note="3-phosphoglycerate kinase"
                     /old_locus_tag="AO070223000009"
                     /protein_id="BAE64188.1"
                     /transl_table=1
                     /translation="MSLSNKLAITDVDLKDKRVLIRVDFNVPLDADKKITNNQRIVGA
                     LPTIKYAIENGAKAVVLMSHLGRPDGKANPKYSLKPVATELEKLLSKSVIFAENCVGK
                     ETEEIVNKATGGQIILLENLRFHAEEEGSSKDAEGKKVKADKEKVEEFRKGLTALGDV
                     YINDAFGTAHRAHSSMVGVDLPQKASGFLVKKELEYFAKALESPQRPFLAILGGAKVS
                     DKIQLIDNLLPKVNSLIITGAMAFTFKKTLENVKIGNSLFDEAGSKIVGDIVEKAKKN
                     NVKIVLPVDYVTADKFAADAKTGYATDADGIPDGYMGLDVGEKSVELYKKTIAEAKTI
                     LWNGPPGVFELEPFANATKKTLDAAVAAAQSGSIVIIGGGDTATVAAKYGAEAKLSHV
                     STGGGASLELLEGKVLPGVDALSSK"
     exon            complement(1035900..1036666)
                     /number=1
     exon            complement(1036727..1037147)
                     /number=2
     exon            complement(1037220..1037285)
                     /number=3
     CDS             complement(join(1038115..1038186,1038261..1038427,
                     1038481..1038823,1038887..1038912,1038973..1039063,
                     1039175..1039240))
                     /codon_start=1
                     /locus_tag="AO090038000396"
                     /note="peroxisomal membrane protein MPV17 and related
                     proteins"
                     /old_locus_tag="AO070223000010"
                     /protein_id="BAE64189.1"
                     /transl_table=1
                     /translation="MFSASRRKILDGLNRRYIYGRLPLLHSIIFLIEMAVAMRLAAKF
                     NSYYAEKPVLTTMVTNAVLGGVADTVAQLITAFKARPGRPNYDPGDLISIEIHDLDKE
                     KPPALGELGHARHLPPPFDFERLTRFMSYGFFMAPIQFKWFGFLSRAFPLTKKNPTIP
                     ALKRVAVDQFLFAPFGLVCFFTFMTLAEGGGRRALTRKFQDVYLPTLKANFVLWPAVQ
                     VLNFRVVPIQFQIPFVSSIGIAWTAYLSLTNSSEED"
     exon            complement(1038115..1038186)
                     /number=1
     exon            complement(1038261..1038427)
                     /number=2
     exon            complement(1038481..1038823)
                     /number=3
     exon            complement(1038887..1038912)
                     /number=4
     exon            complement(1038973..1039063)
                     /number=5
     exon            complement(1039175..1039240)
                     /number=6
     CDS             complement(join(1039930..1040113,1040182..1041304,
                     1041356..1041628,1041689..1041863))
                     /codon_start=1
                     /locus_tag="AO090038000397"
                     /note="predicted protein"
                     /old_locus_tag="AO070223000011"
                     /protein_id="BAE64190.1"
                     /transl_table=1
                     /translation="MPSLEIPGEFLRHSVLDTVVPHASDIDLEAALTSALEGGADDLS
                     SVLSFIPQRSLLFFDEFCNARIVLRLSNCSQASLKYHLEHLEVKLDVFAIDPAETVAE
                     NPTPTRDLIFSGVVKRDEEPLVVVNEFEGETGSGNHVYVIWSIETFLKRPRIRIQHPS
                     LLFIASVSLNPSESRQQESRDDDYLPPLIPASINILQPLSSDNAFPQKDPFLPASRLL
                     RVVPAQYSEDPIYNVQQQSGHPIRVVPAASARIRYSRLNSYSGRPTTVASLDFEVTPF
                     LNCEVVFDKAELHMSDGTIETLSDASGLVPPISCRPRDDVTLIYKLTPEYGPDPNPST
                     TVMVSILDIRLEAIIKLSPNCSPRILMQWRTNVDFSMALNPTFGGPSQALQRTNRPAS
                     LPMTPNQSNTATGGPPSRSSFRERAYSVADMGVTVSFSGPASVVVGKPFAWNVFIVNR
                     SATSRKFALNAIPRRKRADPRSHVARPSSSSLTSRREDQVAEAVTDDNIVHAMQKSVA
                     GQEAELVCLSTDLRVGPLLPGTCFATELKLLPLAVGALHLEAVRLVEVNTNETTDIKD
                     LPDILSFDRNGIPPQDKK"
     exon            complement(1039930..1040113)
                     /number=1
     exon            complement(1040182..1041304)
                     /number=2
     exon            complement(1041356..1041628)
                     /number=3
     exon            complement(1041689..1041863)
                     /number=4
     CDS             join(1042153..1042290,1042348..1042502,1042578..1043631,
                     1043688..1044734)
                     /codon_start=1
                     /locus_tag="AO090038000398"
                     /note="spliceosomal protein FBP11/Splicing factor PRP40"
                     /old_locus_tag="AO070223000012"
                     /protein_id="BAE64191.1"
                     /transl_table=1
                     /translation="MNPMNGPGAPALWQEARNADGRVYYYNVQTKATQWNKPVELMTP
                     VERALANQPWKEYTADGGRKYWYNTETKQSTWEIPDVYKNALAQAQTAQPPPAAGPTF
                     VAGGVSSFSSYPQQRERDDYDRGYGDRRGGYGSGDANGLVAAPMLGATTEPEYSSVEE
                     AENAFMKMLRRHNVQPDWSWEQTIRATVKDPQYRALKDPKDRKAAFEKYAVEVRMQEK
                     DRAKERFAKLRADFNTMLKRHPEIKHYSRWKTIRPIIEGETIFRSTDDEDERRQLFEE
                     YILELKKEHAEKESVKRKAAMDELVNILKSLELEPYTRWSEAHAIIQSNDQVQNDDKF
                     KSLSKSDILTVFENHIKSLERAFNDARQQQKAAKARKERHAREQFTELLKELRSQGKI
                     KAGSKWMNIYPLIKEDPRYLGILGNSGSSPLDLFWDVVEEEERSLRGPRNDVLDVLDD
                     KRFDVTPKTTFEEFNTVVLADRRTANLDQEILQLIFQRIQDKAIRRTEEEKHAADRHQ
                     RRAVDALRSRIKRLEPPVRPTDTWDQVRPRVEKYEEYKAIDSDELRQSAFDKVIRRLK
                     EKEEDTDRDRDRDRGSRRDHYDRSDRDHRSYRGERRGASSRLSRTPEPDAYEADRRKA
                     QADRERSYRKVSGLSPVRERREERDRERDRDRDRYRERDRDRERDRDRDRDWERERST
                     RSLSHYDRERRDREEERERLYRTRGDPRGSRDELDYGADTRSTVSNDRRRRRDSDTES
                     VASRSAKRYRRDSRERERSGGPKREKDRRERTPAVEEAKKEEKAVHSGSEEGEIEED"
     exon            1042153..1042290
                     /number=1
     exon            1042348..1042502
                     /number=2
     exon            1042578..1043631
                     /number=3
     exon            1043688..1044734
                     /number=4
     CDS             complement(join(1046044..1046067,1046125..1047196,
                     1047253..1047349,1047405..1047566,1047624..1048098,
                     1048179..1048203,1048273..1048292))
                     /codon_start=1
                     /locus_tag="AO090038000399"
                     /note="RNAse L inhibitor, ABC superfamily"
                     /old_locus_tag="AO070223000013"
                     /protein_id="BAE64192.1"
                     /transl_table=1
                     /translation="MSDKLTRIAIVNSDKCKPKVHDTHLFSIFIYRVILIYSQKCRQE
                     CKKSCPVVRTGKLCIEVTPESKIAFISERLCIGCGICPKKCPFGAIHIINLPTNLETQ
                     VTHRYSANSFKLHRLPMPRPGQVLGLVGTNGIGKSTALKILSGKLKPNLGRYDNPPDW
                     EEILKYFRGSELQNYFTKVLEDDLKAVVKPQYVDQIPRAVKGPVQNVGDLIKARAQMD
                     NMEHILDVLELRQVRGRDIGHLSGGELQRFAIGLVCVQKADVYMFDEPSSYLDVKQRL
                     AAARTIRELLRPDDYVIVVEHDLAVLDYLSDFVCVLYGRPAVYGVVTLPSSVREGINI
                     FLDGHIPTENLRFREESLTFRLAEAGDEFLVNRDRAFTYPSMEKTLGNFHLKIDAGNF
                     TDSEIVVMMGENGTGKTTFCKMLAGAEKPDNGVTVPKLNISMKPQKITPKFQGTVRQL
                     FFKRIKAAFLSPQFQTDVYKPLKIDDFIDQEVQNLSGGELQRVAIVLALGIPADIYLI
                     DEPSAYLDSEQRIVAARVIKRFIMHTKKTAFIVEHDFIMSTYLADRVIVFDGKPSIDA
                     HANAPESLVTGCNSFLQSLDVTFRRDPNSYRPRINKYQSQMDQEQKLSGNYFFLEEES
                     "
     exon            complement(1046044..1046067)
                     /number=1
     exon            complement(1046125..1047196)
                     /number=2
     exon            complement(1047253..1047349)
                     /number=3
     exon            complement(1047405..1047566)
                     /number=4
     exon            complement(1047624..1048098)
                     /number=5
     exon            complement(1048179..1048203)
                     /number=6
     exon            complement(1048273..1048292)
                     /number=7
     CDS             join(1049535..1053823,1053876..1054002)
                     /codon_start=1
                     /locus_tag="AO090038000400"
                     /note="chromodomain-helicase DNA-binding protein"
                     /old_locus_tag="AO070223000014"
                     /protein_id="BAE64193.1"
                     /transl_table=1
                     /translation="MFDSVDNHVVSDSSPDPDAADESFNADSPDAEGYEDDSAMEDNA
                     KDSSQSSSENSSSSESGRGTKRKSSSVNESDYIRQNPDLYGLRRSGRARTTRQVAQSL
                     SDSDSDAVAPRSKRRRPVASQQTSKRPSRSATQSSFSEDSETSESEYGGSRSRTSKTK
                     RRRQQASASAPSHAEVRFSTRNAARVSTYNEDDDDSMFEDDPDELMQNYWVNAVEDDR
                     PAVDIVLNHRLKAGVDSSNTDLDRHDFEFYIKWQGKSHYHATWETAESLANCRSTRRL
                     DNYIRKVLYEDIRLRQDEDVAPEDREKWNLDRERDVDAIEDYKQVERVIATREGDEGT
                     EYLVKWKRLFYDSCTWENEELVSEIAQCEIDRFLNRSSRPPVSDKSESNPASRKSFEA
                     IKGTPSFLRNGELKEFQVKGVNFMAFNWVKNRNVVLADEMGLGKTVQTVSFINWLRHV
                     RRQQGPFVVVVPLSTMPSWAETFDNWTPDLNYVVYNGNEAARTVLREHELMIDGNPRR
                     PKFNVLLTTYEYVLLDSSFLSQFKWQFMAIDEAHRLKNRESQLYAKLLEFRSPARLLI
                     TGTPIQNNLAELSALLDFLNPGLVDIDADMDLNAEAASQKLAELTKAIQPFMLRRTKS
                     KVESDLPPKVEKIIRVELSDVQLEYYKNILTKNYAALNDGAKGQKQSLLNIMMELKKA
                     SNHPFMFPNAEAKILDGSTRREDVLRAMITSSGKMMLLDQLLAKLKRDGHRVLIFSQM
                     VKMLDLLGEYMEFRGYTYQRLDGTIPAASRRLAIEHYNAPGSSDFAFILSTRAGGLGI
                     NLMTADTVVLFDSDWNPQADLQAMARAHRIGQTRPVSVYRLVSKDTVEEEVIERARNK
                     LLLEFITIQRGVTDKEASEIQNKMARNGISITEPNSTEDISRILKRRGQRMFEQTGNQ
                     EKLEQLDIDSVLANAELHQTEQAEDIQADGGEEFLKAFDYVDIKVDDLTWDDIIPKEQ
                     LEEIKAEEKKKADERYLAEVIEQNRPRKRNVPGDERDSREERKAKRQARAQVSLDDGD
                     ESDSNTQLDPKRPLIEKEYRHLLRAFLRYGDIDDREEDVIREARLLDRDRETVKGALR
                     EITEKASSLVREDIEKMEALEHAGKMPTKKEKKAVLFDLHGVKRLNAYTIVERPVEMR
                     ILKEATNAVSDFKNFRVPEATKAADYSCPWGAREDGMLCIGIIRHGYGAWAQIRDDPD
                     LALGDKFFLEEHRVERKNERLNAEDKSTKSPGAVHLVRRADYLLSVLKDKVTNGSSVN
                     AKRAVENHHRNNRKGSRPHASASVSASPAPSIPRKGHREMDRSRHRSHTHGARDSVER
                     HHTPNYDSRPRSFHESERARHRTSDASSEDVRRRKNSENGYSAGKEDVARLFFKPIRE
                     DLRKVSAVTKENYPNKAERASELRNLLRKIGEFIDGTLKGQSSVHSLETRLWHFVADN
                     HWPNKEAGGAKLQEMYRKLMAAQKVAAAAPASNGS"
     exon            1049535..1053823
                     /number=1
     exon            1053876..1054002
                     /number=2
     CDS             complement(join(1055129..1055748,1055834..1056365))
                     /codon_start=1
                     /locus_tag="AO090038000401"
                     /note="Zn-finger"
                     /old_locus_tag="AO070223000015"
                     /protein_id="BAE64194.1"
                     /transl_table=1
                     /translation="MTESPGSPLSSIASDDMSDREELKQGFSPSASNMPPSKRRRTGI
                     ASWDRNTPVSTTFQDEIPPASPSSSISSDTSGDIPNSPGTLALIGGSQDDDYSGQGND
                     QVTVCRWEGCDAGDLGNMDDLVQHIHNEHVGSRQKKYSCEWSDCTRKGQTHASGYALR
                     AHMRSHTREKPFYCALPECDRSFTRSDALAKHMRTVHETEALRPSDPVPKHHNAPSAA
                     GTPAGTPGSKLQRIKLKLSQPPKEDPEQQLNEKMNEENKYLDCYLNDWEEHGYHRELG
                     FQPYESKLPPQQLYRLLRRQIHWAEKETVELRDEWERVLPKRKHAFLEKEAIFEDVCD
                     AELRLFSLLMGSDAAAPSSSAAATNGAKKQPETADTEMTLNPESESVAA"
     exon            complement(1055129..1055748)
                     /number=1
     exon            complement(1055834..1056365)
                     /number=2
     CDS             complement(join(1057123..1057600,1057719..1058151,
                     1058307..1058358))
                     /codon_start=1
                     /locus_tag="AO090038000402"
                     /note="voltage-gated shaker-like K+ channel, subunit
                     beta/KCNAB"
                     /old_locus_tag="AO070223000016"
                     /protein_id="BAE64195.1"
                     /transl_table=1
                     /translation="MPSLVGRDVGHTGYGLMRMTWVPQPPPQEQCFEALNTALAHGSN
                     FWNAGELYGTPEYNSLHLLHSYFAQHPENADKVVLSIKGGLKPGQLVPDGSEANIRRS
                     VDECLRVLDGKKKIDIFECARQDPKTTVEQTVTVLAQLVKEGKIGGIGLSEVDAETIR
                     RAHKVHPIAAVEVEMSLFDLTILQNDVAKVCAELNIPIVAYSPLGRGVLAGAFTTAAD
                     IPDGDFRKTLPKFQDEAMKQNIKLVNEVNDLAARKGVAPVQIALAWVLTLSGKPGMPT
                     IIPIPGGTTSAKVAQNLQAPRLTDAEMAEIDAILKRNEIVGTRY"
     exon            complement(1057123..1057600)
                     /number=1
     exon            complement(1057719..1058151)
                     /number=2
     exon            complement(1058307..1058358)
                     /number=3
     CDS             1071527..1072327
                     /codon_start=1
                     /locus_tag="AO090038000403"
                     /note="predicted protein"
                     /old_locus_tag="AO070214000014"
                     /protein_id="BAE64196.1"
                     /transl_table=1
                     /translation="MASCKAGFVSILNNDDNPSFTVRSSPRLCRHHSTSSYPYPSEPR
                     REASNSYYRYGYAHSDSFPVNRQQFDSVSDAAQPTSPGSSDCSYDYMSAGSSYYYQPN
                     RQEPHSYQAPTTGTAMTTAEKRLSANSVSDPPSPPASISGSRDAMATKVNRKNKYPCP
                     FAASHNCSATFTTSGHAARHGKKHTGEKSVHCPICNKAFTRKDNMKQHIRTHRTHSED
                     RPTGVTEKDTDASNRWRVRRDSPLYNHHRSSSQSQMDGNAYDSMRTMR"
     exon            1071527..1072327
                     /number=1
     CDS             join(1074091..1074219,1074257..1074449,1074523..1075123,
                     1075187..1075388,1075526..1075534)
                     /codon_start=1
                     /locus_tag="AO090038000404"
                     /note="predicted protein"
                     /old_locus_tag="AO070214000013"
                     /protein_id="BAE64197.1"
                     /transl_table=1
                     /translation="MAYYDESHYHSPRDRYARPSSVYSQDYYSGDGPYSSSRHEAGVE
                     IMATNMDMVYPRSLAAPGFPPSKKVCTGPTPWVAVVHIMMIPTIIIRAIVVVRNVMIT
                     KIHVCSDRYRRSQRSPSSSRSPPPRRRRKSLSEQAMEALGIGSSASSASKHHEHRRGR
                     SHGHHSRSYSYSPSPTRSRSRHRRDRSEQRIAQAMKAALTAGAVEAYRVRKEPGDWTG
                     AKGKRILTAALTAGGTDGIVDRDPSKHSKRHIIESTLAGLAANHFVNGPRSRSRSKSR
                     GREKSKSKLPDLAAAGALAAAGKEAYSRFRSRRRSKSVSDYINRGMEALGLENKDKDK
                     DDRRRHHDRPSRRDDYSDYDSDSEYGSRHHGSSRRTRHSRDYR"
     exon            1074091..1074219
                     /number=1
     exon            1074257..1074449
                     /number=2
     exon            1074523..1075123
                     /number=3
     exon            1075187..1075388
                     /number=4
     exon            1075526..1075534
                     /number=5
     CDS             complement(1077137..1079224)
                     /codon_start=1
                     /locus_tag="AO090038000405"
                     /note="predicted protein"
                     /old_locus_tag="AO070214000012"
                     /protein_id="BAE64198.1"
                     /transl_table=1
                     /translation="MIVPKPPVKLEDHCSVIYDNTLYTYSANGFASISLERNATWTQL
                     PMGEPVSKAACVTGGLDGNEDQQALYVIGGTPSKGESSGLQRYSFKDKKWKTIDSVSG
                     NMANRTSHKAVYLKSSSALLIYGGHQRDETDASSDTFAINTQEPYNLSAYSAENASPA
                     YDPVLLTWNDKEAALVGGLTTPDQVHLFDPIQGWHSSDVTIPAPLSNDVQCALVNGTD
                     GSKILEAFDMSASPNNVTSITLLNSDGAPAHKGNSSESSSTKRGITLDDYPTYDDSLA
                     PTTTRKDYSLAQGDDGLVVISSGSGSDTLAIFNQTSNSWVNATKLFYGDQTSQQILGT
                     TTTTPTATASGSSETSGAPASDDSSSSDVGTIIGATLGGIVGIAAILIVILFILKHKK
                     DAKKRAAQAQDGGDKDRLSFQDRGVEPLTRSAYPMAKSPAPLAASSVDSLAIFSGHVG
                     EEKTPKPAGAPPSFDHKPSPLSTIQSSRELSSGEFDKAIEAQDSLPGNHPGDRRTSEG
                     WGRYFQDNSAAPLMVPPAAVPARPDSTATTATAWPMKTLAPLNTNFLEAPKPLGCVVS
                     GSPTTEHATSPKNGQSITIPESQSARISSASDITIESDDGYEHPGSRAQQSWLGRPPS
                     STYSRSYYNPSYYNPSTSDVPSLVAPLRDNRMNTRGSSVLIPDTVEPVPPRDTRNNNI
                     NSDMSWLNLNAER"
     exon            complement(1077137..1079224)
                     /number=1
     CDS             complement(join(1079549..1079656,1079935..1080095,
                     1080172..1080219,1080261..1080387))
                     /codon_start=1
                     /locus_tag="AO090038000406"
                     /note="predicted protein"
                     /old_locus_tag="AO070214000011"
                     /protein_id="BAE64199.1"
                     /transl_table=1
                     /translation="MELHREGNTSNEKKESLCVNAIEKKQENNEITDGVRLGSAVSGV
                     EEPLACLPQAASSSQRAGTRAGSILDVDGVIHSIHGLLSSLLQFLSPRTYLDDVEFNL
                     IVPRENITIRVAILFFRSTTIPFRGISWVLTPVKPNRSWSQSLLL"
     exon            complement(1079549..1079656)
                     /number=1
     exon            complement(1079935..1080095)
                     /number=2
     exon            complement(1080172..1080219)
                     /number=3
     exon            complement(1080261..1080387)
                     /number=4
     CDS             complement(1088809..1089402)
                     /codon_start=1
                     /locus_tag="AO090038000410"
                     /note="predicted protein"
                     /old_locus_tag="AO070214000007"
                     /protein_id="BAE64200.1"
                     /transl_table=1
                     /translation="MQSTRLELVHLTIDHLPGYFSVKSDMEVVKWSSPGPLTSIQEAE
                     EELLRDLSEDNRETFAILLRDDLDPKTIEEWQGPEAKDGSNALVPGGFVGFIGVYDLH
                     HVAQVFYTIHRSAWGLGIATEALLAFTELFWILHPDHYRLLGRCDTENPASGRVLEKS
                     GFEYYDFICADEFQPWMVPHARDSLRFVLAKPGYTFD"
     exon            complement(1088809..1089402)
                     /number=1
     CDS             complement(join(1090570..1090800,1090857..1092638))
                     /codon_start=1
                     /locus_tag="AO090038000411"
                     /note="cell cycle control protein (crooked neck)"
                     /old_locus_tag="AO070214000006"
                     /protein_id="BAE64201.1"
                     /transl_table=1
                     /translation="MESSRGPPRVKNKAAAPIQISAEQLLREAVDRQEPALQAPTQRF
                     ADLEELHEYQGRKRKEFEDYVRRNRINMNNWMRYAAWELEQKEFRRARSIFERALDVL
                     PTSVPLWIRYIEAEMRNRNINHARNLLDRAVTILPRVDKLWYKYVYMEETLGNIPGTR
                     QVFERWMSWEPEEGAWSAYIKLEKRYNEFERARNIFQRFTIVHPEPRNWIKWARFEEE
                     YGTSDLVREVYGAGIEALGEDFMDEKLFIAYAKFEAKMKEYERARAIYKYALDRLPRS
                     KSVTLHRAYTTFEKQFGDREGVEDVILSKRRVQYEEQLKENPRNYDIWFDFTRLEETS
                     GDPERVRDTYERAIAQIPPSQEKRHWRRYIYLWIFYAIWEEMEAKDVERARQIYNECL
                     KLIPHKKFTFAKIWLMKAQFEIRQMELQTARKTLGQAIGMCPKDKLFRGYIDLERQLF
                     EFVRCRTLFEKQIEWNPSNSQSWIQFAELERGLDDSDRARAIFELGIEQPTLDMPELV
                     WKSYIDFEEYEGEYDRVRQLYERLLEKTDHVKVWINYARFEINIPEDEEEEEEEEERP
                     VSDEAKRRARAVFNRAHKVFKEKDLKEERVELLNAWRSFEHTHGSPEDIDKIERQMPR
                     RVKKRRKLDDDRYEEYMDYVFPADDQSAANLSKLLQRAHAWKSGQA"
     exon            complement(1090570..1090800)
                     /number=1
     exon            complement(1090857..1092638)
                     /number=2
     CDS             1093032..1094597
                     /codon_start=1
                     /locus_tag="AO090038000412"
                     /note="mRNA splicing factor PRP31"
                     /old_locus_tag="AO070214000005"
                     /protein_id="BAE64202.1"
                     /transl_table=1
                     /translation="MSTAEELLRDFESDDEDFQAGEGVEEDVDEEQQHLQKAGSEVTN
                     EFEVALSTGDELTRLHKLLRDHYSVRFPELETLVTSPIDYAKTVAILKNGPLNDIKAL
                     SSSADNMVGEPLKSILDGPSLMVVSVEGTTTRGREMTESELKVVLDTCERILKLDRER
                     RALTESIQSRITQIAPNLAALIGPETAAQFLNQTGGLRELAKIPACNLGAQGNKRTEG
                     LGFATNIGVRSRGFLYNSPLIQEVPDDLKRQAIRIVSAKMVLATRADVSNFSPDGSLG
                     EDLKQQCFTRLEKLTEPPPNSGVKALPAPDDKPARKRGGRRARKAKEAVAMTDMRKAQ
                     NRMAFGKEEAEVGYGTGEGTVGLGMLGQQNDGRIRSTQIDNRTRAKLSKSNKGWGTAT
                     PASGTASSLRAFSSGVGGTASVLQAKGLRSSGIGTSLGGSGTASTIAFTPVQGLELVD
                     PKVQAELSRKRKAEEDRWFKSGTFTQVGGSQSNNNSSQKDNGGFKVPPIPPQKKVDTG
                     EGKMGPPPLPLKR"
     exon            1093032..1094597
                     /number=1
     CDS             join(1095487..1096051,1096113..1096288)
                     /codon_start=1
                     /locus_tag="AO090038000413"
                     /note="predicted protein"
                     /old_locus_tag="AO070214000004"
                     /protein_id="BAE64203.1"
                     /transl_table=1
                     /translation="MAPVEIGQPVFGVDSPKPTSQSPSLYDHTLITTDFDALKFHAAA
                     SLQLQFGHAHETAALQSDLLITSPYNDPKHLLDLKTLDTPNQLLAKALTILRPIRDDY
                     ATAPYTESFNWQAVFNFLRDLAQTNGYRWETQHFYVVVFRSRLQADIDKQRLHDLDAY
                     SHQEAVASGGLLKYWFGTKDGERRNLATCLWRSRNDARLGGTGPWHKKARGAARDMYE
                     DITFTTLKLVIEDDVRSWRITDWTEEDE"
     exon            1095487..1096051
                     /number=1
     exon            1096113..1096288
                     /number=2
     CDS             join(1097533..1097794,1097847..1098182,1098237..1098312,
                     1098369..1098555,1098611..1098879,1098965..1099101,
                     1099166..1099418,1099475..1099730)
                     /codon_start=1
                     /locus_tag="AO090038000414"
                     /note="amino acid transporters"
                     /old_locus_tag="AO070214000003"
                     /protein_id="BAE64204.1"
                     /transl_table=1
                     /translation="MGLPFWGDREKDAGISVREHNASQESTIQDGSVKYTAAEGINST
                     SVTYQDASGAPVETDSPLGYSVSFWTSLCLNINQMVGTGIFSTPATILKGVGSVGLSM
                     IYWFIGYLLAQSTLAVYLELASYFPSRSGSEVVYLEQAFPKPDYFFPTTFAVKHVVFS
                     FGSSNAIVFAEYIFGIAGSGYTNWQLKGVAVAAYTVATLIVSSSTKWSLRVVVWFGFI
                     KIATLVLISIAGLVVLGGHTKVEDPMINWHDAWKGTSSASAYGATNAMIKLIFSYSGY
                     TNAFSVVNEIKNPIKTLRWSAPFSLLLVTSLYILVNVAYFSAASREEILNSKQIAAGV
                     FFQKIFGTNGASRALNVLICISAFGNLMAVMVSYSRMLRETGRQGVLPWPKFWTSTKP
                     FGTPLGPYLVQWSITVIMILAPPAGDAFNFVVDLSVYPSSIFNFLLVVGLLLIRRRRS
                     KLNLPRPEYKSWAIAIGFALLANLYLLAAPWYPPTGGANGGDVSFWYGTYLVVGIGLL
                     VACGVYYYVWIKLLPKYKGYEFRQTVLEFDDGSVAHNLVKVPVAELARWDVEHDAVGR
                     LRHRTTYQSSTATDEDKSSEQKNVS"
     exon            1097533..1097794
                     /number=1
     exon            1097847..1098182
                     /number=2
     exon            1098237..1098312
                     /number=3
     exon            1098369..1098555
                     /number=4
     exon            1098611..1098879
                     /number=5
     exon            1098965..1099101
                     /number=6
     exon            1099166..1099418
                     /number=7
     exon            1099475..1099730
                     /number=8
     CDS             join(1100582..1100951,1101018..1102783)
                     /codon_start=1
                     /locus_tag="AO090038000415"
                     /note="predicted protein"
                     /old_locus_tag="AO070214000002"
                     /protein_id="BAE64205.1"
                     /transl_table=1
                     /translation="MRPIPQIIYLIVLLASQLVTADEYIESRALSLCSNSLEFTATYF
                     NVKFTPKNRTIALSFNGRSSISGKVIAELIITVYGYTAMTKVLNPCDMDLEGLCPVRA
                     GEIPVMNTNIKIPDSVISQIPGIAYTVPDLDASVRVFINSSDTGRSITCLEAELSNGK
                     TVYQPGVGWTTAIISGLGLAASAVTSALGHSKAAIHIATNVLSLFGFMQSQAMFGMSS
                     VHMPPIVQLWTQNFQWSMGIVRVGFLETLCTWYQRSTGGRPSTLIVNHSKKSIQILKK
                     RFHGTLLKRAGKSGADTHKSIVIRGIQRVGYKAGIESTNIFLTGLIFFVFFATLAMIC
                     VAIFSVIRKSLVKSGKIKNDEVKWNFIPKGILFRVILIGYPQICILCLWEFTQHDSPA
                     EVILAAVMLLTTTVAIGFATQKVVRLAKQSVKLYGNAAYTLYTDPACLNKWGFLYVQY
                     QAKAYYFIMPALVYVIVKSMFISLSQAAPVVQTIALVIIEALMLISVSILRPWMNKKT
                     DIYNISIAAINFVNAIFLLIFSNVFSQPGILTGVMGVVFFAYNAVFSLVLLVLMLIAS
                     IYAVLSKNPDIRYQPMRDDRESFIRSQSQHQLGTELDALGAAARGEKHSNHDNSIPSL
                     VDPMDRHGHGNEPNGEDRLEANQPSSDILGSEALGYQNNRRKHIPHCRKFYRPGRCKP
                     PTNPDVILPTDVSRACSTSSPWNRGAGYD"
     exon            1100582..1100951
                     /number=1
     exon            1101018..1102783
                     /number=2
     CDS             join(1104952..1105582,1105634..1105848,1105906..1105998,
                     1106049..1106087)
                     /codon_start=1
                     /locus_tag="AO090038000416"
                     /note="predicted protein"
                     /old_locus_tag="AO070214000001"
                     /protein_id="BAE64206.1"
                     /transl_table=1
                     /translation="MPGVLAETTLSVSDGPLTSENAAYLRPSDPNLPVEELRKRYDED
                     GYLFLKQVLPREDILEACKAYFEYLAPTGVLQEGTEPVEGVFNRTKSIDDYPGIGAGH
                     VGGNGRPGGDSAAQFVDKAIEAHYKDWYTKNVVNHPALYDFIAKFTGWGNDTLTFKRT
                     LLRNNIPGSKPIGVHYDQIFLRYGEPTAVTAWVPIGDIKINGGGLIYLENGDSIGQKI
                     EDDFTAKALKAGLTQEEAKSAFNSNMMSTGLLSEFPAEFAKENNRRWLVSAYEAGDVV
                     LHKPHVIHASTINNDEDNVIRLATDLRFCDSSKPYDKRWMNYYRFNDGV"
     exon            1104952..1105582
                     /number=1
     exon            1105634..1105848
                     /number=2
     exon            1105906..1105998
                     /number=3
     exon            1106049..1106087
                     /number=4
     CDS             join(1107787..1107825,1107885..1108144,1108196..1108797,
                     1108850..1109298)
                     /codon_start=1
                     /locus_tag="AO090038000417"
                     /note="S-adenosylhomocysteine hydrolase"
                     /old_locus_tag="AO070332000001"
                     /protein_id="BAE64207.1"
                     /transl_table=1
                     /translation="MAAPAHQFKVADISLAAFGRREIELAEIEMPGLMAIRRRYAADQ
                     PLAGARIAGCLHMTIQTAVLIETLVALGAEVTWTSCNIFSTQDHAAAAIAAAGVPVFA
                     WKGETDEEYNWCLEQQLSAFKDGKKLNLILDDGGDLTSLVHEKYPEQLKDCYGLSEET
                     TTGVHHLYKMMKENKLLVPAINVNDSVTKSKFDNLYGCRESLIDGIKRATDVMIAGKV
                     AVVAGYGDVGKGCAQALHSMGARVLVTEIDPINALQAAVQGFEVTTMEKAAPLGQIFV
                     TTTGCRDILVGKHFEVMRNDAIVCNIGHFDIEIDVAWLKANAKSVQNIKPQVDRYLMA
                     NGRHIILLAEGRLVNLGCATGHSSFVMSCSFSNQVLAQIALYKAEDAEFGKKYVEFGT
                     TGKKPVGVYVLPKVLDEQVALCHLEHVNAELSKLTPVQAEYLGLPAEGPYKADHYRY"
     exon            1107787..1107825
                     /number=1
     exon            1107885..1108144
                     /number=2
     exon            1108196..1108797
                     /number=3
     exon            1108850..1109298
                     /number=4
     CDS             complement(join(1110219..1110356,1110418..1110699))
                     /codon_start=1
                     /locus_tag="AO090038000418"
                     /note="predicted protein"
                     /old_locus_tag="AO070332000002"
                     /protein_id="BAE64208.1"
                     /transl_table=1
                     /translation="MKIQTLCSLAAVGLAFAKPIHNLEERADVADVLKCAGDTVQKGL
                     SVALDNVSQSNIKLEGLDGLISCITNAAAEVTDIATITQDPLGWLHSLDCTEQFLGGA
                     EGLAELGHNVQQVENLLSVVAAQTVGGIVKCGSSKSI"
     exon            complement(1110219..1110356)
                     /number=1
     exon            complement(1110418..1110699)
                     /number=2
     CDS             complement(join(1111523..1111627,1111687..1111941))
                     /codon_start=1
                     /locus_tag="AO090038000419"
                     /note="predicted protein"
                     /old_locus_tag="AO070332000003"
                     /protein_id="BAE64209.1"
                     /transl_table=1
                     /translation="MKFQTLFSLATVGLAFATPVHNLEARDDYTNCVINLAKEAVSNG
                     CGSLPVCRVLPHFVQCMQNGLEQLDSGFFVITGFPTLLVGCTTDAQKALTENEFRELS
                     DALSPLVEESVAQCSAQ"
     exon            complement(1111523..1111627)
                     /number=1
     exon            complement(1111687..1111941)
                     /number=2
     CDS             complement(join(1113046..1113168,1113233..1113493))
                     /codon_start=1
                     /locus_tag="AO090038000420"
                     /note="predicted protein"
                     /old_locus_tag="AO070332000004"
                     /protein_id="BAE64210.1"
                     /transl_table=1
                     /translation="MKFQTLCSLATLGLAFANPIQNRGQDFTDCVTGVVKKGVTQGCA
                     TLPKACGVLDEFTACTTDATAQVTDITDLDQRRSEWLASLNSCGQTLWDGLKNAGVSE
                     VELNTLQVSFLEMTSESLTSCSKSA"
     exon            complement(1113046..1113168)
                     /number=1
     exon            complement(1113233..1113493)
                     /number=2
     CDS             1114789..1116069
                     /codon_start=1
                     /locus_tag="AO090038000421"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070332000005"
                     /protein_id="BAE64211.1"
                     /transl_table=1
                     /translation="MNNKMQSPTILLLGTFDTKTPELTYTHQTLLTQTPQPNILVLDV
                     SHHPPPTTTTSVTDLNITHTIPQKDLPGQRAEYIKAASEHATTIVADLYKENKIHGII
                     SIGGSCGTNIATAAMRNALPVGFPKLMVSTMASGDVKPYVEETDVTMMYSVVDIAGRN
                     WILEGILRNAACAIFGMAGGYYKSLLKSQSHREGGNGGSRGKKRVGITMFGVTTPGVD
                     RIRAHLEDVYGFEVYVFHATGAGGKAMERLIREGQLDAVVDLTTSEVVDEVMGGVLSA
                     GPERLVAAARAGIPQVVSVGACDMVNFGPRNTIPERYEGRLIYEHNPTVTLVRPNAEE
                     TVAVAKFIAEKLRSCAVKPELIRLVLPTGGISMIDTPGQPFYDPEVDEVLFLTLEKEL
                     DGTGISILRDPRAINDPEFAVSVADMLGDLVKSL"
     exon            1114789..1116069
                     /number=1
     CDS             complement(join(1117816..1117989,1118106..1118802,
                     1118931..1118965,1119116..1119152,1119329..1120083))
                     /codon_start=1
                     /locus_tag="AO090038000422"
                     /note="predicted protein"
                     /old_locus_tag="AO070332000006"
                     /protein_id="BAE64212.1"
                     /transl_table=1
                     /translation="MSQIRLTGAIWSPVDGQTPKSIPESAGRQTYPTSGALEPRGELH
                     PDLSRDDSLSSISDVTRLLSCDDLASVPLNSDAYYTVSTPCSLHVVNIITFHVQFSHE
                     LYRFFMYRLLKHFLRSEMDTLRTFFDWIWPIDTQHRPLQPVQEPMRLETPQICLGHLF
                     SKDIYGDDVGIPLYYFNIVQGRDNAVKVIITTSKAGAAGAAYYQAVCGFSTVAIFAIC
                     QRALRRCREADPIFSFRRALTVSDADRFLDQDPVLVLSFRFLVLPLGYAVPACHSLLR
                     SSYPFSFWYDSQHQVKADEINKPLTNHKQCTTISIILGAYVTHLQPQQNKNTNKQTKN
                     SIAWARTTTLYLPLPISLSATTTILPILTPILLFLARFLSNQSTTGANTPTFRNRFIT
                     SVISYLLTILPSGLATLALTYLFAPDLLVCQLNNQWQSYYHNKDSRAIRAIQDSLHCC
                     GFRSVKDRAWPFKDRTHDDDACVEQIGYARACLGPWEQEDKGAAWMVLWAAVLILVVK
                     VGWGEQIQIDLSGFLVQRIRRRVRSMQTRMEMWVMIGLLISCRSRASRRMMMFGADK"
     exon            complement(1117816..1117989)
                     /number=1
     exon            complement(1118106..1118802)
                     /number=2
     exon            complement(1118931..1118965)
                     /number=3
     exon            complement(1119116..1119152)
                     /number=4
     exon            complement(1119329..1120083)
                     /number=5
     CDS             join(1121803..1121890,1121965..1122110,1122257..1122862)
                     /codon_start=1
                     /locus_tag="AO090038000424"
                     /note="predicted TIM-barrel enzyme, possibly a
                     dioxygenase"
                     /old_locus_tag="AO070332000008"
                     /protein_id="BAE64213.1"
                     /transl_table=1
                     /translation="MPRPTTRQEVLDRLRKTVADGKIIVGAGAGIGLTAKFIEKGGAD
                     LILVYNSGRFRMAGRGSLAGMMPYSDANQVVVEMASEVLPIVENTPVLAGVCGTDPFR
                     DMRTFLTELRRLGFIGVQNFPTVGLIDGKFRQNLEETGMGYDREVEMIRIAHEMDLVT
                     TPYAFTVDEGERMARAGADIIVVHVGLTTSGTIGAQTALSLDDCVTIIQEIRDAVVKI
                     NPEIIVLCHGGPLAGPKDAEYVLKRTKGVHGFYGASSMERLPVEMAIQENAEAFKKLQ
                     VNV"
     exon            1121803..1121890
                     /number=1
     exon            1121965..1122110
                     /number=2
     exon            1122257..1122862
                     /number=3
     CDS             join(1123903..1124080,1124143..1126427)
                     /codon_start=1
                     /locus_tag="AO090038000425"
                     /note="beta-glucosidase-related glycosidases"
                     /old_locus_tag="AO070332000009"
                     /protein_id="BAE64214.1"
                     /transl_table=1
                     /translation="MLSPQALFGALVLLSAPSAVVADTCKAPINHPGEPFSFVQPLNT
                     TILTPYGHSPPAYPSPNTTGNGGWETALVKAKQWVNKLTLEEKTWMATGQPGPCVGNV
                     LPIPRLNFSGICLQNGPQCVQQGDYSSVFVSSVSAAASWDRKLLYERAYALAEEHKAK
                     GSHVILGPIGGPLGRSPYDGRTWEGFAADPYLTGVCMEETINGMQDAGVQANAKHFIA
                     NEQETQRNPTYAPDANATTYIQDSVSANIDDRTLHEIYMWPFANAVRARVASAMCSYN
                     RLNGSHSCQNSYLLNHLLKGELGFQGYVMSDWGATHSGVASIESGMDMTMPGGFTLYG
                     ELWTEGSFFGKNLTEAVQNGTVPMSRLDDMIVRIMTPYFWLGQEKNYPSVDASVGPLN
                     VDSAPDTWLYDWKFTGATNRDVRANHSAMIREHGGQSTVLLKNERNALPLRKPRNIVV
                     AGNDAGPLTQGPDLQADFEYGVLAGSSGSGSCRFSYLSTPLDAINARARKDGSLVQSY
                     LNNTLLTTSALTSPLWIPQQPDVCLVFLKSFSAEGEDRTSLELDWNGNAVVEAVATHC
                     NNTIVITNSGGANVMPFADHPNVTAILAQHYAGEETGNAIADVLYGDVNPSAKLPYVI
                     AYNESDYNAPLTTAVQTNGTYDWQSWFDEELEVGYRYFDAHNISVRYEFGFGLSYTTF
                     DLKDLKAKGSAAANLTALPAKRPTEPGGNPALWETVYTLEAEVSNTGDVDGYAVPQLY
                     LQFPTSTPAGTPPSQLRGFDKIWLEAGEKKTVTFDLMRRDVSYWDVVAQDWRIPAGAF
                     TFKAGFSSRDFRANSVATLVKA"
     exon            1123903..1124080
                     /number=1
     exon            1124143..1126427
                     /number=2
     CDS             join(1127100..1127151,1127203..1128041)
                     /codon_start=1
                     /locus_tag="AO090038000426"
                     /note="dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /old_locus_tag="AO070332000010"
                     /protein_id="BAE64215.1"
                     /transl_table=1
                     /translation="MSRPLEGKFGIVTGGSRGIGEAIARNLASKGCSLLLNYTSASSQ
                     SRTETLCSELANQHSIKCVSVQADLLHTEEAVTTILNAAKENFTSETTGTLQVDILIN
                     NAGVSKDRFLNDEEKGPMDREYFNWHYTINVLAPLLLTQAVAPFLPTDRSGRIVNISS
                     VSSSIGFTGQTVYGGTKAALEAMTRTWARELADRATVNSVNPGPVIGDMYFATGEEFW
                     KQMQGWLDNTPLSKVVDGEEKMKSLTDEQRYLIKEKMGGRRPAFTSEIAGVVGMLCTQ
                     DGFWCTGSVVCANGGMKMGL"
     exon            1127100..1127151
                     /number=1
     exon            1127203..1128041
                     /number=2
     CDS             join(1128323..1128570,1128634..1128970)
                     /codon_start=1
                     /locus_tag="AO090038000427"
                     /note="predicted protein"
                     /old_locus_tag="AO070332000011"
                     /protein_id="BAE64216.1"
                     /transl_table=1
                     /translation="MPPLRTFSLRLLRPSRTITATPIRNLRPLSTCLPKHPSPVRITT
                     TKPLSLSPPQLTTQARWGSTQTSSGKSQADLMVEELQELYETAKDEFEIATDSTNGTT
                     IYAASDRESARDALNQLSAVFALYTTEMPSYDESHQPQQTQPDDSGSQMVSTYFDPGD
                     IAPEVRQEVKRRVGQRVRELANAVEALEERAKDD"
     exon            1128323..1128570
                     /number=1
     exon            1128634..1128970
                     /number=2
     CDS             complement(join(1129806..1129951,1129997..1130857,
                     1130957..1131296))
                     /codon_start=1
                     /locus_tag="AO090038000428"
                     /note="predicted protein"
                     /old_locus_tag="AO070332000012"
                     /protein_id="BAE64217.1"
                     /transl_table=1
                     /translation="MASHTKKDDYCLECHWESFHIDGKESENQSNAPATSQWDCSGEG
                     HDASLDHCHVDDACCDMDDCSITCPSVCDGLVDCEETACTDTHCNDGCDDTHCENAET
                     LCFDEHCFGNNVGQSQGDQLPKPTGNITSDMVAPQPSMDSLFPQHSIPVAHCHSHSFP
                     HFHFHDSSKDAHGNMMHQPFPAQNGVNPADVFHMLGMCPDLSACQNFHVHENTNCDHV
                     DKPNTDAGSNSFACFHIPPNVNLNDLMKSPVHIHSNPSRGPCRTHHRCRTHAHAHVHP
                     YGHYSPYSRQSRSSVSSQLISSPGDTPPPLEGGTPSVLTSPVTPTESEVHICKWTTTS
                     GGAKTFCGAQFSDPCTLQEHLIAQHMSTINGAKGTGYYCCWEGCHRPDEPFSQKSKLQ
                     GHFLTHSNWKTRTSDARSVANFSLDRQPWNAMNEVTGERSPTSALNAGRLLQTVVN"
     exon            complement(1129806..1129951)
                     /number=1
     exon            complement(1129997..1130857)
                     /number=2
     exon            complement(1130957..1131296)
                     /number=3
     CDS             join(1132728..1132958,1133036..1133197)
                     /codon_start=1
                     /locus_tag="AO090038000429"
                     /note="predicted protein"
                     /old_locus_tag="AO070332000013"
                     /protein_id="BAE64218.1"
                     /transl_table=1
                     /translation="MGNICSRSKNQPEAFSSPGRVLGSANPPPGDTGKSSSGPRAPLP
                     ANASTGRTLGGAGAPGAGADTADARANAAIAAQKRAESTTAGNKGKLGSKLAAQKAQT
                     QAQTLGEASRNERSARDADNAAEARRWE"
     exon            1132728..1132958
                     /number=1
     exon            1133036..1133197
                     /number=2
     CDS             complement(join(1133474..1133748,1133810..1136200,
                     1136258..1136687,1136751..1137071,1137130..1137273))
                     /codon_start=1
                     /locus_tag="AO090038000430"
                     /note="RNA helicase"
                     /old_locus_tag="AO070332000014"
                     /protein_id="BAE64219.1"
                     /transl_table=1
                     /translation="MARHGDTRSPSPVGSTYSSSRRSRRDDDRYERSRRDDGRSYRRS
                     RSPEKRYRDRERDRDSYRRRDRSLDRRADYRDEDTYRPSRRDRSRDRRRSRDRDDDRD
                     YRRRSRDRDFRSRRDDSRDRARRRTDDSADLKHKSRRDDSRERARDSVPRSREASKPS
                     TPAANTGPTDDEKRAERLAKLEAWKQKQAAEKERKQREAAAAGGTRSILDEIDRKSGL
                     SPAVGSPQSSATPIDAAPASYTGKFDPKAIAKNAAPAPAVKSVLGDDIAVPPSAKTSA
                     TFPSTKTEVQANKPSATSSKASSLKVKGNVGSFGLGTKQAADTEKASATKTLGFGEEE
                     STRRKLERLPTPPLDDAKDSNKEEDVTAEDEDDDVDMQDGDTEEENAAAARAAAERRE
                     ERLQNEARDSQSNGDVQMSDASNQKAPDKMEVDAQEEEEVDPLDAFMSELAESAPPKK
                     TAGAKFAKAKPQQPEALFGDENDMDMTAVGDGDADDFLAIANKAKKKKDIPTVDHKKV
                     EYEPFRKKFYTEPSDLAAMSEEEAASLRLELDGIKVRGVEVPRPVSKWSQCGLGVQTL
                     DVIDRLGYSAPTSIQAQAIPAIMSGRDVIGVAKTGSGKTIAFLIPMFRHIKDQRPLEN
                     MEGPVGLIMTPTRELATQIHKDCKPFLKALNLRAVCAYGGAPIKDQIADLKRGAEIIV
                     CTPGRMIDLLAANAGRVTNLRRVTYVVLDEADRMFDMGFEPQVMKILANVRPDKQTVL
                     FSATFPRNMEALARKTLNKPVEIVVGGRSVVAPEITQIVEVRSEDKKFIRLLELLGNL
                     YSTDENEDARALIFVERQEGADTLLRELMRKGYPCMSIHGGKDQIDRDSTIEDFKAGI
                     FPVLIATSVAARGLDVKQLKLVVNYDAPNHLEDYVHRAGRTGRAGNTGTAVTFLTEDQ
                     ERYSVDIAKALKQSGQSVPEPVQKMVDSFLEKVKAGKEKASASGFGGKGLERLDQERD
                     AARMRERKTYKTGDEGEEEEEKEEKNEKAEEQFNKVLSSVQSAAAPSLPGVPKGIDLD
                     GKITVHKTEKDANGSKNPLDKVGSAVADIHARLSRAGVMRSGVPIDNRGPDAGAFHAT
                     LEINDFPQKARWAVTNRTNVAKILEATGTSITTKGSFYATGKEPGPGENPKLYILVEG
                     ETELSVTNAMRELMRLLKEGTIAAADSDARAPVGGRYNVL"
     exon            complement(1133474..1133748)
                     /number=1
     exon            complement(1133810..1136200)
                     /number=2
     exon            complement(1136258..1136687)
                     /number=3
     exon            complement(1136751..1137071)
                     /number=4
     exon            complement(1137130..1137273)
                     /number=5
     CDS             join(1137773..1138336,1138396..1138698,1138793..1138873,
                     1138900..1138917)
                     /codon_start=1
                     /locus_tag="AO090038000431"
                     /note="predicted protein"
                     /old_locus_tag="AO070332000015"
                     /protein_id="BAE64220.1"
                     /transl_table=1
                     /translation="MPLNLARRGGGILRKLHLSDAFSRPVRVAVAQSHVRRVSLITRG
                     QALRPICRVLPSTSVFSQRLLKTYATTSDSKSEKKKSTKSTKAGKGTKKTTKKAKKSS
                     TAKPKPKPRKQLTEKQKEAKKTRELRDQIKALKATALEAPKRLPERVANLSIIEKLQE
                     TRKTHNNTQEAFKAATELAKTISEEERARFAAVAESNRNSNESTYDQWIKSHTPLQIK
                     EANLARSRLTKLTNKRYPPLRDDRLVKRPSSSYVFFFIERTGQGDFKHMAAKDIATRV
                     AEEWKGLTESEKENVISASIKRYTAWKRHMFESPPSKSLSPKEQR"
     exon            1137773..1138336
                     /number=1
     exon            1138396..1138698
                     /number=2
     exon            1138793..1138873
                     /number=3
     exon            1138900..1138917
                     /number=4
     CDS             complement(join(1142942..1143035,1143077..1143152,
                     1143228..1143562,1143569..1143868,1143881..1144150,
                     1144187..1144465,1144478..1144676,1144695..1144737,
                     1144798..1144934,1144959..1145011,1145048..1145263,
                     1145276..1145489,1145508..1145554,1145576..1145798,
                     1145847..1146194,1146225..1146557,1146582..1146662,
                     1146708..1147340,1147455..1147710))
                     /codon_start=1
                     /locus_tag="AO090038000432"
                     /note="predicted protein"
                     /old_locus_tag="AO070332000016"
                     /protein_id="BAE64221.1"
                     /transl_table=1
                     /translation="MRAALSGISNCSSGGGDGNPVSSISTGGRRDVCLGACSPCLLLD
                     FVLVGGGGAPKIKFENAPARLSAGSRCLSFSGSSDLSGSSSAPHISQDVLPGARSTRG
                     RSFLAARSGATGSGGGVGGPPAASSGASATGASAGGAGGGSGTGTDLLLFLIFFMGFS
                     GSGAGGSAGSNAGSGSGSGTLTGAGSGSGSGSCSGSGSSARTGSGSGSGSGTGWGSTA
                     LAFFFFFSTLGGGTGSGSGSGSGAGCGSTALAFFFFFSALGRSTGSGSGTGSGSGSAT
                     GTTSSGGAGSGTGSGSAGSSVFDFFLSFFLAFLDNTTGSGSTSGCFSGSGCTSGSGSA
                     GGSGAGGGRSSKSSSKASGKLPGTVSRKILLSITGSGSGSGSGSGSCGGSGGSSTGGG
                     TSFAFDFSVDFPLDFSFFFSSRALMRSATEFLVDDLVFDVTTGSTSATGASAASAAPA
                     SLGASPTSISRSSCSGWGSGSFIGFSADFFLVALGIPIAAAPKLAQNPLAGFDGVSSA
                     TRPFFLEGIVLNSSQRGSSGILSKASGSSDNPREGGVGAGGGGAQMPQLSSIGSSVTG
                     SGITSGSGVGSRTGSGSGSCTGSSATGTTCGGHSKSLPGIGKPFFINDFSRFFRSLEE
                     SGSSGSEGVLDSGSCSGSGSSGTGSKTGSGSGSASGTGSGAGSGTGSSANGSGGGGGG
                     QSKSLPGIGRPFFINDFSRFFRSLDERSSHGSSGNNGALGSDSGCCSGSGSGSSSSAA
                     SGSGTGSCIDSSATGSGGGGGGQSKSLPGTGRPFLMSDFSRFFFGSSGSDGALGSDSN
                     SSCGSGSGSGSGSGSSAGSGSGAGSSVTASGGGAGGQSKSLPGIGKPFLSGSSGSDKA
                     FDSGSGSGSGSGSGSGSGSSTGSGSGSGSGSSTTGSGGGGGGQAKSLPGIGRPFFVSD
                     FSRFFRSLDERSSQGSSGSFASGTGCGSGSPAGSGSGSGSGSSTGSGSGACSGSGAGS
                     TTGSGTSSTIGSAAGSSNTGSGGGGGGHGKSLPGTGRPFLINDFSRFFIGSSGSLASD
                     AGCGSGSATGSSSGVGSGSGAAAGSGSGSATGSGSGAGSSAAGAGAGAGGGHSKSFPG
                     IGRPFFIKDFSRFFLSFDERLSHGSSGSLASGAGSDSGSAAGSGSKAGSGSGSAAGSG
                     SGSGVGSCSVSGWSSDSGSFVGSSTGAAGAFGGHSKSLPGMGRPFLTRDFSRFFRSLD
                     DSVSQLFGSSGNLGSGSGSGSAGAGGSGSGSGSSTGSGSAAPLPFFFFFSFVGTFQPV
                     QSSSSFFSSGTGSGAGSATTGGFSTTGSSSSRIAPSFFFLSFFLVETPQPQSSSSAIS
                     GSGGGGAPKPKPNPTEAFNGSAEPNDHGVETPFTPRIPTLIPTAKFQASASRFASKGV
                     "
     exon            complement(1142942..1143035)
                     /number=1
     exon            complement(1143077..1143152)
                     /number=2
     exon            complement(1143228..1143562)
                     /number=3
     exon            complement(1143569..1143868)
                     /number=4
     exon            complement(1143881..1144150)
                     /number=5
     exon            complement(1144187..1144465)
                     /number=6
     exon            complement(1144478..1144676)
                     /number=7
     exon            complement(1144695..1144737)
                     /number=8
     exon            complement(1144798..1144934)
                     /number=9
     exon            complement(1144959..1145011)
                     /number=10
     exon            complement(1145048..1145263)
                     /number=11
     exon            complement(1145276..1145489)
                     /number=12
     exon            complement(1145508..1145554)
                     /number=13
     exon            complement(1145576..1145798)
                     /number=14
     exon            complement(1145847..1146194)
                     /number=15
     exon            complement(1146225..1146557)
                     /number=16
     exon            complement(1146582..1146662)
                     /number=17
     exon            complement(1146708..1147340)
                     /number=18
     exon            complement(1147455..1147710)
                     /number=19
     CDS             1148068..1149396
                     /codon_start=1
                     /locus_tag="AO090038000433"
                     /note="predicted protein"
                     /old_locus_tag="AO070332000017"
                     /protein_id="BAE64222.1"
                     /transl_table=1
                     /translation="MVDADPAQTSPDIVSGPDDMAFVEAPRERRLRRSNTAPKKQETG
                     GLMGLIGTLRQHIRPELPERQKSRSYKDEDAKYMTEPEREDARRQRRDERRRRAMRPD
                     PDREGYATDAGPAMAVPEIQIEDVDARREARRARRASRQGDVDPYQDNEFQEAEERRA
                     RRRERQRAREREMQEMQLREEEERAQRRREEKMARRAAREERRAREEQEAREAEAQAQ
                     EAREVEAREARAAERRERRRQEREAGIYENPSYDPRSRKRHSYMDDRAARDFYMQGGD
                     PDRAYRSRRHGDDGEHARRRRSRAPEETRPLPMMPGQRKDKTSSWVNSQASDPPEPPP
                     VVPTMLDMPPAPGEPMDGAHSISSDEEARRDLRRKARRRARYPGLTDQEIEEERLRKR
                     EARRSERGQKSSSGSADYERDRGMRYDRYDQPPPSSGGKLPNWFKKLTSF"
     exon            1148068..1149396
                     /number=1
     CDS             complement(join(1149771..1150588,1150652..1150838,
                     1150972..1151001))
                     /codon_start=1
                     /locus_tag="AO090038000434"
                     /note="predicted protein"
                     /old_locus_tag="AO070332000018"
                     /protein_id="BAE64223.1"
                     /transl_table=1
                     /translation="MDNSSLDIWVAGALAAVTVDFLVYPMDTLKTRIQSPNYNHLYKD
                     ATGAIKRDVLFRGLYQGVWSVVLATVPSSGAFFTTYESSKHILTLSSIQSQSQSQSSS
                     QNPLPFTHPLPTPLIHALSSSLGEMVSCAILTPAEVLKQNAQVLDMNSPTPTSTKTPR
                     QGATIQVLAKFRHRPWKLWSGYTALVGRNLPFTGLHFPIFEGVRGWLVSWRGRERRNG
                     DRNGGKNGGKNGNGVFERAVLTGIAAGVSGTVASVVTTPIDVVKTRVMLGAGGEELKG
                     TEKTVRKVKGTLAVGREVWKEEGLRGLFRGGALRSVWSAFGMSIYLGIYEGGRMYLEK
                     RRKEDEGGVL"
     exon            complement(1149771..1150588)
                     /number=1
     exon            complement(1150652..1150838)
                     /number=2
     exon            complement(1150972..1151001)
                     /number=3
     CDS             complement(join(1151450..1152029,1152124..1152593,
                     1152668..1152707,1152768..1152775))
                     /codon_start=1
                     /locus_tag="AO090038000435"
                     /note="translation initiation factor 3, subunit h
                     (eIF-3h)"
                     /old_locus_tag="AO070332000019"
                     /protein_id="BAE64224.1"
                     /transl_table=1
                     /translation="MAEKEVPLTAVKVDALVVMKIIKHSSQSFPTTATGSIVGMDVDG
                     TLEITNSFPFPVVEMPADSHFDNAAPNPAAAAPRAKANVAYQAEMIRMLREVNVDANN
                     VGWYTSANMGNFVNMNVIENQFFYQKEMNERTVALVHDVSRSAQGSLSLRAFRLSSKF
                     MTAFKENKFTSEELQKSSLRHQDIFVELPVEIHNSHLITTFIHQLQCPSQSTPTDLPP
                     SLAALEKSSFVKDSVLAPNFDNLSLSIDPFLEKNCDLLLDSIETHHTETNNFQYYQRS
                     LAREQAKITAWQAKRKAENASRAALKQPLLPEDEYQRLFKLPQEPSRLETMLNTRQVE
                     QYSRQIDSFVSATTGKMFAVKGNLLPGETAK"
     exon            complement(1151450..1152029)
                     /number=1
     exon            complement(1152124..1152593)
                     /number=2
     exon            complement(1152668..1152707)
                     /number=3
     exon            complement(1152768..1152775)
                     /number=4
     CDS             complement(join(1153179..1153215,1154890..1155260,
                     1155318..1155563,1155983..1156042))
                     /codon_start=1
                     /locus_tag="AO090038000436"
                     /note="casein kinase II, beta subunit"
                     /old_locus_tag="AO070332000020"
                     /protein_id="BAE64225.1"
                     /transl_table=1
                     /translation="MMEDFNSETDSDYTSYWRDWFISSRGNEYFCEIDEEYLTDRFNL
                     TGLNTEVPYYQYALDLVTDVFDLDADDDLREQIEKSARHLYGLVHARYIVTTRGLTKM
                     VDKYKKGDFGKCPRVMCEGQPLLPMGQHDIPNMSTVRLYCPKCEDLYNPKSSRHASID
                     GAYFGASFPSMLFQVYPGLVPEKSTSRYEPRIYGFKVHAAAALARWQDQYREDMKSRL
                     RDAGMEVNSQGCIIGKRGQ"
     exon            complement(1153179..1153215)
                     /number=1
     exon            complement(1154890..1155260)
                     /number=2
     exon            complement(1155318..1155563)
                     /number=3
     exon            complement(1155983..1156042)
                     /number=4
     CDS             join(1158756..1158921,1159014..1159321,1159440..1159556)
                     /codon_start=1
                     /locus_tag="AO090038000438"
                     /note="predicted protein"
                     /old_locus_tag="AO070332000022"
                     /protein_id="BAE64226.1"
                     /transl_table=1
                     /translation="MSNFEGILWNSKIAFLNQRIFPLQVYNSDASPMPIPVASFPPTT
                     LGFYYLKEGKHYEVIQATAEDDDSFADTELEYTEQELEHAISSNAWGVLVVLGGRIGI
                     DCDALHDRVIQFHAQKNASSKRDASDLSGTNKWAAKIHHPLPVRVQPASESQREADCL
                     NGSCNLQGEPCGHDPEGGSDNSLFYGDTEIAISTSQ"
     exon            1158756..1158921
                     /number=1
     exon            1159014..1159321
                     /number=2
     exon            1159440..1159556
                     /number=3
     CDS             complement(join(1159782..1159826,1159886..1160127,
                     1160185..1160442,1160506..1160643,1160725..1160978,
                     1161037..1161393,1162047..1162237))
                     /codon_start=1
                     /locus_tag="AO090038000439"
                     /note="cellobiohydrolase A (1,4-beta-cellobiosidase A)"
                     /old_locus_tag="AO070332000023"
                     /protein_id="BAE64227.1"
                     /transl_table=1
                     /translation="MATRPVEPSTFNCMISCRNYSASWHHLTDSSFQLHTQVTDRVCL
                     NICISDGDQQSLKPVTTVPSPEFGTPTHHLQSSVNSKLSYLFIMHTLNMQALVALSPL
                     LFSAATALPQASVTPSPSSSVPASSGPAPTATAGGNPFEGYDLYVNPYYKSEVESLAI
                     PSMTGSLAEKASAAANVPSFHWLDTTDKVPQMGEFLEDIKTKNAAGANPPTAGIFVVY
                     DLPDRDCAALASNGEFLISDGGVEKYKAYIDSIREQVEKYSDTQIILVIEPDSLANLV
                     TNLNVQKCANAQDAYLECTNYALTQLNLPNVAMYLDAGHAGWLGWPANIGPAAELYAS
                     VYKNASSPAAVRGLATNVANYNAFSIDSCPSYTQGSTVCDEKTYINNFAPQLKSAGFD
                     AHFIVDTGRNGNQPTGQSQWGDWCNVKNTGFGVRPTTDTGDELVDAFVWVKPGGESDG
                     TSDTSAERYDAHCGYADALTPAPEAGTWFQAYFEQLVENANPSL"
     exon            complement(1159782..1159826)
                     /number=1
     exon            complement(1159886..1160127)
                     /number=2
     exon            complement(1160185..1160442)
                     /number=3
     exon            complement(1160506..1160643)
                     /number=4
     exon            complement(1160725..1160978)
                     /number=5
     exon            complement(1161037..1161393)
                     /number=6
     exon            complement(1162047..1162237)
                     /number=7
     CDS             1163201..1163653
                     /codon_start=1
                     /locus_tag="AO090038000440"
                     /note="predicted protein"
                     /old_locus_tag="AO070332000024"
                     /protein_id="BAE64228.1"
                     /transl_table=1
                     /translation="MNEIKTLFPSPRTIYHRITKKYSTCDIPYLPTVKESSQTSQNPS
                     TKMTTAAPKVNSSLGETGQDAATQLFELLHSKNPQMTLKWNPESQRFTLTGFSHLKES
                     EIKRIIDQKSYLGYEPKLAGRTSGGDVIIRFDPIKRNDPSILWKENEY"
     exon            1163201..1163653
                     /number=1
     CDS             complement(join(1164517..1165834,1165893..1165945))
                     /codon_start=1
                     /locus_tag="AO090038000441"
                     /note="predicted protein"
                     /old_locus_tag="AO070332000025"
                     /protein_id="BAE64229.1"
                     /transl_table=1
                     /translation="MPPSSGHLLLPKFWRAARFAYEKACKTIRTKFPEQVQHGSLRFQ
                     PAFARITPNQPINRAAAIRQARRRHYSTRARAFVSYLRTGLQGDRAAYKTSRVASNIS
                     RLTTQAPFASTLRPNLTGGTLGRTAGGYTIGAGRIGGARYFSHGPAAPAQVIQNVSMG
                     VRAFFLSGQKVRFDGIDEVSGNKKYKAVSALQDQAERKMTGIPRTAPGSFVDFQLSPT
                     ITAFGLQKKFDPSGAFASDTINSDGLLDFLSADFARALKDLAAVLNDLKRLSTLGDLP
                     ILLHDKSTLRVRFPGCDAVTVERLCDEVGVQRGKIMQDEDFDARTGADLALLFPFAPS
                     VPASPETVDYLFSKGPYEPQAPEEVDWQAMMSSETNSEASPEFRGNPGSKLSFEDVTL
                     FGENPWQQSSSSSGYSSINISELGDRAYFNEISSTGLPESASEYEGSDGLHRFLAECN
                     RAPPIS"
     exon            complement(1164517..1165834)
                     /number=1
     exon            complement(1165893..1165945)
                     /number=2
     CDS             complement(join(1166518..1167262,1167327..1167455,
                     1167531..1167553))
                     /codon_start=1
                     /locus_tag="AO090038000442"
                     /note="aldo/keto reductase family proteins"
                     /old_locus_tag="AO070332000026"
                     /protein_id="BAE64230.1"
                     /transl_table=1
                     /translation="MASLQHTKKTYTLNTGDKIPAIGLGTWQSKPNEVREAVKNALLK
                     GYRHIDTALAYGNEAEVGQGIKDSGVPREEIWITTKLDNTWHHRVSEGIESSLKDLGV
                     SYVDLYLVHWPSSTDPNDKSKHLPDWDFIKTWQEMQKLPATGKVRNIGVSNFGIKNLE
                     KLLNDPSTKIVPAVNQIELHPNNPSPKLVAYNTSKGIHSTGYSCLGSTNSPLYKDPTL
                     LQLAEKKGKTPQQCLLQWGIQKGWSVIPKSVSKERIDTNFELDGWNLTDEEVNQLDNL
                     KDRRKVCGDSWLPIKVFFGDDE"
     exon            complement(1166518..1167262)
                     /number=1
     exon            complement(1167327..1167455)
                     /number=2
     exon            complement(1167531..1167553)
                     /number=3
     CDS             complement(1168542..1168949)
                     /codon_start=1
                     /locus_tag="AO090038000443"
                     /note="predicted protein"
                     /old_locus_tag="AO070332000027"
                     /protein_id="BAE64231.1"
                     /transl_table=1
                     /translation="MALLSKEMQIEASENTQSTTDMLKLLWNLAPHVEAFPEMFINVA
                     DRHYLESPELEFMFARVKDAKKCQEFLNAMMLTMSLDKRSGYIAILDLMLESNFEIEA
                     TNKLVMSTFNAHIEQSCRPSSSTKWISNCHRRW"
     exon            complement(1168542..1168949)
                     /number=1
     CDS             complement(join(1170017..1170315,1170373..1170501,
                     1170558..1171238,1172708..1172720))
                     /codon_start=1
                     /locus_tag="AO090038000444"
                     /note="endo-beta-mannanase"
                     /old_locus_tag="AO070332000028"
                     /protein_id="BAE64232.1"
                     /transl_table=1
                     /translation="MKVRSSKSTPLPSSSSASPSPRPTGSGSFAKADGLQFSIDGETK
                     YFAGTNAYWLPFQMNDADIDSVFDHLEQAGLKILRVWGFNDVNTAPSPGTVYFQLHDK
                     EKGTSTINTGKDGLQRLDYVVAAAEKHGVKLIIPFVNSWDDYGGYNAYVKAYGGSKTE
                     WFTNEKIQSVYQAYIKAVVSRYRDSPAIFAWELGNEPRCSGCSTDVIHGWATKISAYI
                     KSLDPNHMVALGDEGMGLTIGSDQSYPYGTSEGNDFEKNLAIPDIDFGTLHLYTTDWG
                     IKDNAWGNGWVENHAKACKAAGKPCLFEEYGMKGNHCTDELKWQKTSLSSGTAADLIW
                     QYGQQLSTGESPKDAYSIFYGTDEWKCAVMDHMENVNKN"
     exon            complement(1170017..1170315)
                     /number=1
     exon            complement(1170373..1170501)
                     /number=2
     exon            complement(1170558..1171238)
                     /number=3
     exon            complement(1172708..1172720)
                     /number=4
     CDS             join(1172806..1173008,1173058..1173152,1173271..1173405,
                     1173473..1173573)
                     /codon_start=1
                     /locus_tag="AO090038000445"
                     /note="predicted protein"
                     /old_locus_tag="AO070332000029"
                     /protein_id="BAE64233.1"
                     /transl_table=1
                     /translation="MKFFIPCIAAIFATGVLAAPTPDASLNVPLDKRDDRGQYTVSGL
                     GSRKKAIIDAGGNSLDLAIAMLEIETMNTAHYPYGDGKTYDAANFGLFKQNWGLLRKS
                     SDVYADVASRWDCQNYYGYDKWFAGHRNGASGLANPYTEDINTYKSAVHWIQQQIDSN
                     EKYKYDDTRFWVNVRAI"
     exon            1172806..1173008
                     /number=1
     exon            1173058..1173152
                     /number=2
     exon            1173271..1173405
                     /number=3
     exon            1173473..1173573
                     /number=4
     CDS             complement(join(1177582..1178619,1178992..1179750,
                     1179812..1181797,1181877..1182110))
                     /codon_start=1
                     /locus_tag="AO090038000448"
                     /note="predicted NTPase (NACHT family)"
                     /old_locus_tag="AO070332000032"
                     /protein_id="BAE64234.1"
                     /transl_table=1
                     /translation="MRDLVHTVIETTKKRYDEYQRKGLKIKRPNIEDVNVRDSALNIV
                     SATLSFQDIIGAAVCCDPTGYAGKVWGIISVGLTDLQASIFQASGLLTDVLSRCAFIE
                     IHCLTSNTTDPETKDMLRNAIVRVYFAVLQYSSSVVSIQHSGAGRQFRLSVIALADQP
                     LTALKTAIGEEEKHLERWVQFDQQLLWKQKAEQTLAQIDDVLSGIQDLSREMELCKLT
                     IAEGAAFDSYMNQHEVECLPGTRTDLLKQVTDWSLSTQGECIFWLSGMAGTGKSTVSR
                     TVCKLLQEQGLLGASFFFKRGKSDCGRAEKFFATIVRQIIIQEPRLIPSIRRAIQRDP
                     SISTKSLGEQFNKLLLEPLLAVKEDPAGISVLAIVVDALDECDPENDIGLLLRLLPRI
                     STQSPIRLRVFLTSRPEIPIREGFDNVSENDHRSIGLHGVVESSIRHDILLFMNDRFE
                     EMRQKFSLPQGWPGESTIRDLVNIATPLFIAAATMCRFIADRRWNPEQRLALVLGSGS
                     TKNAPKSYISKLEHTYLPVFEQILHSRDDDDDEDEKEQLVQEYRVIVGTIIILANPLG
                     LTSLAKLLNMPSNDVSRRLDFLHSVLSIPDDEDTPIQLFHQSFRDFLLHPKVRTKTKF
                     WIDEEHIHRETLFRCIEVMTRENGGLSKNICQLSSDATLRSDINDEVIRDHFSAELRY
                     SCHYWSYHLQQGRYQITDHDEIHKFVQKHLLHWLEAMSVLGLAPEIVRGIRTLQSAVQ
                     PHSGRIVSKFLHDAHRFILKNSWVANNAPLQLYAAALAFAPANSVVRDIFQSEIPRCF
                     IKLPSVEENWNAELLSLDIKDVNAVAFSPDSRLIASASMSKQVKLWDSVTGLLLHTLD
                     QVFYTGGLTFSPNGAHVACSSWDDTIQDDTVQLWDIDTGALYKSFPQPTSPVVNLTFS
                     PDNKLLVLATSEDTIDICDLASERVIRTLEGHSDRVNALAISSDSKLIASGSNDNSVR
                     IWKIDTGALLQTLEHSGPIRSLSPNRKLLGSVSSDHKVLLWDATTGSLLHTFEGYSRK
                     SGTFSFSPDSKLVAFRPQSDSTCVQLWDVETAQLYRTLEDHLDSIDRVMFSPNCQQLA
                     SIEEGGTITIWNIQTGERMFSLESRGSWVCVAFSRSGAKLATGSYDTVRVWDANTGVL
                     QLELKEHKTIVTAVAFLPDEKLISSGSNDGKLCFWDLSKGELSQTLHSSGAINQIVFS
                     ADGRLMASGTLSQTFRLWDRETGHSIYASDYHASHYRDGIANLRFSSDNTYLEADFGR
                     LRIPCNEKNNSISTRRPNIILGEQWLHIGEERVLWLPVEYRPKTSAYYDGTFAIGSES
                     GLVSFISVDMSVDANGHS"
     exon            complement(1177582..1178619)
                     /number=1
     exon            complement(1178992..1179750)
                     /number=2
     exon            complement(1179812..1181797)
                     /number=3
     exon            complement(1181877..1182110)
                     /number=4
     CDS             complement(join(1183472..1187274,1187358..1188051))
                     /codon_start=1
                     /locus_tag="AO090038000449"
                     /note="pleiotropic drug resistance proteins (PDR1-15),
                     ABC superfamily"
                     /old_locus_tag="AO070332000033"
                     /protein_id="BAE64235.1"
                     /transl_table=1
                     /translation="MSFLGTVNPNIPQQQSVVSHNNALRSHGDTDDDTPVYETPSTAA
                     TQYGDREKSEEALTLQEDNEEKMEARVGDLARRLTRQSTRVSAKGALENPFFVEDPES
                     TLNPDSPNFKPRDWLKMLLAIRSRDPEQYPDRTAGVAFKNLNVHGFGSPTDYQKDVLN
                     SILEIGTIVRKLMGIKMQKIQILREFDGLVKSGEMLVVLGRPGSGCSTFLKTISGEMN
                     GIQMSDDSTLNYQGIPAKLMHHAFKGEAIYSAETDVHFPQLSVGDTLKFAALARAPRN
                     RLEGVSRQQYAEHMRDVVMTMLGLSHTINTRVGNDYVRGVSGGERKRVSIAEATLSQA
                     PLQCWDNSTRGLDSANALEFCKNLALMSKYAGTAACVAIYQASQNAYDVFDKVTVLYE
                     GRQIYFGRTTEAKQFFVDMGFECPDRQTTADFLTSLTSPSERKVRPGFENRVPRTPDE
                     FAAAWKRSDARAKLIIEIEEFEKQYPIGGASYQSFIDARKAMQAKHQRVKSPYTISIW
                     EQISLCVVRGFQRLKGDSSLTVTALVGNFIIALIVASVFFNLQDNTASFYSRGALLFY
                     AVLLNAFSSALEILTLYAQRPIVEKQARYAFYHPFAEAVASMLCDTPYKLVNSITFNL
                     PLYFMTNLRRDAGAWWTFWLFSVVTTYTMSMIFRTIAATSRSLSQALVPAAILILGMV
                     IYTGFVIPTRNMLGWSRWMNYINPISYAFESFMVNEFHDRHFECSQIVPSGGIYESMP
                     MQNRICSTVGADTGSTIVQGSVYLEQSFQYVKGHLWRNLGIMIGFLVFFAFTYLASTE
                     YISEQKSKGEVLLFRRGHQPKVALDKTDSESPEPGGAPKTDESAPQASAGIQRQTAIF
                     QWKDVCYDIKIKGQPRRILDHVDGWVKPGTCTALMGVSGAGKTTLLDVLATRVTMGVI
                     TGEMLVDGRPRDQSFQRKTGYVQQQDLHLATSTVREALRFSAILRQPAHVSHQEKLDY
                     VEEVIRLLGMEAYADAVVGVPGEGLNVEQRKRLTIGVELAAKPQLLLFLDEPTSGLDS
                     QTSWSILDLIDTLTQHGQAILCTIHQPSAMLFQRFDRLLFLAKGGRTIYFGEIGQNSS
                     TLSSYFERNGAQPLSPGENPAEWMLDVIGAAPGSHSDIDWPKVWRESPEHAKVKEHLD
                     ELKSTLSVKPAENSDSEAFKEYAAPFYIQLWECLIRVFAQYYRTPSYIWSKTALSILT
                     SIYIGFSFFHAKNSIQGMQNQMFSVFMLMTIFGNLVQQIMPHFVTQRSLYEVRERPSK
                     TYSWQAFMTANILVELPWNTLMAALMFFCWYYPIGLYNNAKPTDAVTERGGLMFLLIW
                     VFLLFTSTFAHMVIAGIELAETGGNIATLLFSLCLIFCGVLATPENMPGFWIFMYRVS
                     PFTYLISAMLSTGLSGTDVQCEAVELLHFNPPANQSCQQYMAAYIQGAQGYLQNPEAT
                     TGCAFCTISKTDTYLAAISSNFDDAWRNFGLMWVYIAFNIGAAVFIYWLARVPKGKRA
                     SGAT"
     exon            complement(1183472..1187274)
                     /number=1
     exon            complement(1187358..1188051)
                     /number=2
     CDS             join(1189796..1189830,1189891..1190248,1190305..1190480,
                     1190585..1191106,1191157..1191378,1191697..1191793)
                     /codon_start=1
                     /locus_tag="AO090038000450"
                     /note="predicted protein"
                     /old_locus_tag="AO070332000034"
                     /protein_id="BAE64236.1"
                     /transl_table=1
                     /translation="MEWISQKVGNLSPLHGAFPSRVFCSLPTKDEIVSLVQSYIEDFN
                     MLFPIFQRSELLSLFNQKSLDMRVQTPSQWACINAVLATAYMIRPQEASGTDHHQKSW
                     LFIQNALEMVNELCFGPPDLLGLQALLLLVTFLLGTSAENPCGFLVSAAIRICHELGL
                     GKTEGGSPLCSEGIQHKRTLFWIAYCLDRDVTLPMEAPTDSKYSMPTSDLSGSFNAFR
                     STCQLAIIKGQLYKDLYSPAAEDRPLSQVIASVGVLDEKLQEWKRSIPPEYQPEKAVA
                     DGHRSKISPVLLLLHYSYFHCVIAIHRRVVARGLSTGTDLLEKDDFTSSPASLSNPRV
                     LLSTSLCTKAARASINLTKYLSQDNTPLFGSLIYYPVIASMTLSWSIIRNPQDAYRGY
                     NLKLIDRTEDFLSSQAFCKAFEGIRRLVKQCAEYRSIAEAAVKATMWIGLSFAFGPLT
                     SPRRYYDGNLYEYTQCTRI"
     exon            1189796..1189830
                     /number=1
     exon            1189891..1190248
                     /number=2
     exon            1190305..1190480
                     /number=3
     exon            1190585..1191106
                     /number=4
     exon            1191157..1191378
                     /number=5
     exon            1191697..1191793
                     /number=6
     CDS             join(1192642..1192716,1192916..1193473,1193691..1194242)
                     /codon_start=1
                     /locus_tag="AO090038000451"
                     /note="predicted GTP-binding protein (ODN superfamily)"
                     /old_locus_tag="AO070332000035"
                     /protein_id="BAE64237.1"
                     /transl_table=1
                     /translation="MPPKKAVVQEKVLLGRPGNNLKSGIVGLANVGKSTLFQAITKSN
                     LGNPANFPYATIDPEEARVIVPDDRFDWLCEHYKPKSQVPANLTVYDIAGLTRGASTG
                     AGLGNAFLSHIRAVDAIFQVVRCFDDAEIIHVEGDVDPARDLDIISEELRVKDIEFVE
                     KALEGLTKQTKRGGQSLEMKKLREEEATVAKVLEHLKSGKDVRKADWGPKEVEVINPL
                     QLLTAKPVVYLVNLSEKDYIRQKNKRLPDVLEWVKKNSPGDPIIPFSACFEERLTRFE
                     TEKEAIEECKNLNTKSALPKVITTMRTSLNLASFFTTGADEVRQWTIRKGIKAPSAAG
                     VIHTDFEKTFIQAIVYNYSTLREYGDEAAVKAAGKVMTKGKDYVVEDGDILLIKAGAA
                     RG"
     exon            1192642..1192716
                     /number=1
     exon            1192916..1193473
                     /number=2
     exon            1193691..1194242
                     /number=3
     CDS             join(1194472..1194485,1194729..1194869,1195108..1195498)
                     /codon_start=1
                     /locus_tag="AO090038000452"
                     /note="predicted RNA-binding protein with PUA domain"
                     /old_locus_tag="AO070332000036"
                     /protein_id="BAE64238.1"
                     /transl_table=1
                     /translation="MFKKDIPPSNRSKVKSSVQRGLRQRFVEAYPGFEPYIDDILPKK
                     AQLDAVKLPEKCTLYTIDSTPLFYQPQDGPPIPHLKLIHQYPTALPTVQIDRGAIRFV
                     LAGAALMAPGLTSPGGRLPEKENALEAGQVVAVLAEGKETACLVGTLKMGTEDMKSKG
                     KGVVMEDGHYLGDGLWRMHLD"
     exon            1194472..1194485
                     /number=1
     exon            1194729..1194869
                     /number=2
     exon            1195108..1195498
                     /number=3
     CDS             complement(1195782..1196507)
                     /codon_start=1
                     /locus_tag="AO090038000453"
                     /note="WD40 repeat protein"
                     /old_locus_tag="AO070332000037"
                     /protein_id="BAE64239.1"
                     /transl_table=1
                     /translation="MPAALSLCQHFSHLSYFPHALEILLHHVLDDEVDNVSRDSKIDD
                     PSQKHDPLLPSVISFLQTSLPARVYLDIVVQCTRKTELRSWRTLFNYLPPPRDLFEQA
                     LRLDSLKTAVGYLLVLQAFEDDDGHEAPIEDYVVRLLVLASQKGEWELCAELARFLIA
                     LDGSGEMLRRAIDRTGLRNGGLPGAGLNGSGTSMKGLGLAITPSWSSLSAASSISPRQ
                     SISRQGSNTSRTPDRMDSVDEVS"
     exon            complement(1195782..1196507)
                     /number=1
     CDS             join(1198161..1198184,1199573..1200558,1200617..1200680)
                     /codon_start=1
                     /locus_tag="AO090038000454"
                     /note="TPR repeat-containing protein"
                     /old_locus_tag="AO070332000038"
                     /protein_id="BAE64240.1"
                     /transl_table=1
                     /translation="MSPLAQFTAPTESKKRLALAIIDFLGSSLKDGTLTADDAESIEI
                     AQSCIADTFKVDPSDEAAVKDAVGGQSLANIYSVYEKLRNKGDSAGAGAQTSSSQKPQ
                     AGAPTAESDKLKSEGNAAMARKDYNSAIDLYTKALSIAPSNPIYLSNRAAAYSASGQH
                     EKAAEDAELATAVDPKYSKAWSRLGLARFDLADFHGAKEAYEKGIEAEGNGGSEAMKR
                     GLETSKRKIAESTRGAEPPADAVDDAAGASRGAGGMPDLSSLAGLMGGGRGGGGGMPD
                     LSSLMNNPMFSSMAQNLMSNPDMLNNLMSNPQLRQMADNFGRGGGMPDMSSLMSDPNI
                     ADMARNLMGGGGAGGAGGAGRGQ"
     exon            1198161..1198184
                     /number=1
     exon            1199573..1200558
                     /number=2
     exon            1200617..1200680
                     /number=3
     CDS             complement(join(1201477..1202152,1202214..1203047,
                     1204252..1204298))
                     /codon_start=1
                     /locus_tag="AO090038000455"
                     /note="mitochondrial import inner membrane translocase,
                     subunit TIM44"
                     /old_locus_tag="AO070332000039"
                     /protein_id="BAE64241.1"
                     /transl_table=1
                     /translation="MVSRHWTSNHSILRRILSATARAATLRSQVPSLRTAASQRSSIQ
                     AYSYSTSPTARLSLSSNTERANRPVSQILSPYAALPLTRSFHVSSSRWQQQEQKKEKQ
                     SEESKEESKEEKDEGKSDEEKKNAPPPPPHGDKTPWQVFRETLQSEFKASKEWNESTK
                     ALASSAHQFTENENIKKARAAYEAAQGAAATKTGAALKTTGQALGKGASWTWNTPVVK
                     GLRKGVNATGSGIEKVTRPVRETEAYKNVKDAIDDGSSSRYGGYIDKEERRRLRKKRE
                     ELELKAGKRIEPMVEDPNAGTNITLHKDSAWKESWRDFKDSNPMMQKLFAFKETYNES
                     ENPLISTARSISDRVAGFFAENETAQVIKKFREMDPNFQMEEFLREMREYILPEVLDA
                     YVKGDVETLKLWLSDAQFSVYAALAKQYTTAGLKSDGRILDVRGVEVMNARMLDPGDI
                     PVFVVTCRSQEVHVYKNVKTGELAAGMEDKVQLVTYAIGLTRIPEDVNNPETRGWRLI
                     ELQKAARDYI"
     exon            complement(1201477..1202152)
                     /number=1
     exon            complement(1202214..1203047)
                     /number=2
     exon            complement(1204252..1204298)
                     /number=3
     CDS             join(1204962..1205039,1205102..1205351,1205405..1208997)
                     /codon_start=1
                     /locus_tag="AO090038000456"
                     /note="predicted protein"
                     /old_locus_tag="AO070332000040"
                     /protein_id="BAE64242.1"
                     /transl_table=1
                     /translation="MHPLNPFLRAFFRSTVPGQCIPTENHVLLVPVTESLIGSRDRES
                     SLFYSDLVVSEEFLGSHALRIPVTNGTVGTKDDTNVRDSRGKAKQVTTVNGRTVIIKE
                     NSVYSNKGFKSLTQAQLLSDALYYTPNNGSQPWLIYYISRPLIGSFEPGKIISAVVPG
                     TLPKRSISASSAKSGESVSSPAKKEIKTFAELLSHFPMIARQMQPGLERLFREFGKEL
                     GKPLPPPPSRSPVLSEDFDWKRDRDEPAIDETASVRSSSSRFKDGLPFNSEEYFEDDE
                     DLMRRSLETAVTAAIDLFRLVDKQQLSFLGATTDLTGPLVERLIERYVAEQVHESLLF
                     PRLCSFRQPEDMELDTRIRQMESIDVSQVGIVVEGGREGKRELLQRLGRAVEEFRKML
                     DAKCPHDMLNILLETVKILSYPGNYDKVDPQASEKQNASVTVNADVLVSLLLVVVIRS
                     QTKHLQARLLYMQHFIYVDDVDSGEMGYALSTFEAVLTYLVTDSAGLRRSSIRNKRLW
                     NATKSGRIADMRAILEPDGSQESIDDIPYEPEGSRVLFRTDEDNEHHRPPLTLPILGG
                     RNESNGEIAVHDTPADTPPLAHVFPFQAWTSSSPPEEIRRPVKKVSMDVRSLSESSAI
                     SFASRTTTMGSMTSTIEGDSSIETLTKTQDPAGHSIPMMAVENRQPEALKYLLTLEEY
                     YPLEDILDDTNTDGTTLLNAAVQLAHTEMVDIILDYLFNTADEQTIVSYLRKSDIHGR
                     TVAHYLFSTPSVMHRLETLLPWRQRDKHGQTPLFALCRSYDHPDYSSMVKEALTAAQK
                     SQGDGRPLRLDDHIDAKGNTLLHIVSDPDITIKILQECDCDPNATNDKRFTPLMMASK
                     YGRIDQVRILFMDPRVDVHLKEARGLTAVELAKDDEVRNRIDDLILISNPPSATDDPS
                     GRVTTVVRSFFVEDATVRFVLKSGAPNPPPNSAESTLAPTTTYTVTTCKRTFTDFENL
                     AKWLSIEHPASYMPLLSDFRSPFQIHSKPSRSVLHDMQAKLDRFLKILLSHPTFSTHE
                     MLWEFFLVPELQPEMMADRSRRKAQVLYESIADDYEPVTQEGMRETEQFVTHAQEMVR
                     AVHANTRSLIRRGYALHNSASDIADALGLCSSAISTLKEPTNALPQNHVDAFCRYASH
                     LSTSSSDSSPFLQFLNTVTSIDNTTSAILESLSRPLNVISTLTSTSRSLSRSRSSLVS
                     SSLPRKFNLNFPGLEESRQKSVRDLENKIQESETQIARLSREITWNKDVVVSELAGWT
                     TWREKVGRDAIRAFAKATLVREKERGKRLERCLRSVRQSDDRAA"
     exon            1204962..1205039
                     /number=1
     exon            1205102..1205351
                     /number=2
     exon            1205405..1208997
                     /number=3
     CDS             join(1209668..1210331,1210452..1210627)
                     /codon_start=1
                     /locus_tag="AO090038000457"
                     /note="predicted protein"
                     /old_locus_tag="AO070332000041"
                     /protein_id="BAE64243.1"
                     /transl_table=1
                     /translation="MSQMAILSWRWDGDLHSSQNIASAVHLAKAMSIKYLFVDQISID
                     QTLDGDALIERVLAFSTMYKTITVIVAYDKADEDFEKTVYRPWIFSEMRLYRYNPGQI
                     IYVRHSNQGSKRNYDIFTVIPPILGDLWSYDFGKHLGLNWAATILETITRVLCEDIEM
                     TSIYDFKFIMPPYARVLSTAYETMSRNDYLLTAVLLCGSHERPSVRLCLDINEMDYKR
                     YRFSSQQCWTQKGSFSKRLGLLIPRFLKEYTLEKEARPSCLMRPGEETVPLPTVRIIS
                     VTL"
     exon            1209668..1210331
                     /number=1
     exon            1210452..1210627
                     /number=2
     CDS             complement(join(1211737..1211775,1212101..1212790,
                     1213623..1213646))
                     /codon_start=1
                     /locus_tag="AO090038000458"
                     /note="predicted protein"
                     /old_locus_tag="AO070332000042"
                     /protein_id="BAE64244.1"
                     /transl_table=1
                     /translation="MSGLHMYNAPSTRIDELLKRSAEESPKPTTTHNNLVPHWSYEKN
                     SLAAACVFSGITVLGIIFLSVLTIRKIRRSWKRHKREKQDYAAFKNRIEVNKNNRDLN
                     ACFITESKSSRESMMYSRDNSPSGGYVVEQTGGSVTRVYREGNNVSSHTFDSICASPE
                     KRSPPREIKRTPGGRADSRTPSGKGRAGLIPRPIVVVPSPLRHVYSQKATPVMQPTSP
                     STLDSEQSLMPPASAHDTKPIRWASRTNIFFP"
     exon            complement(1211737..1211775)
                     /number=1
     exon            complement(1212101..1212790)
                     /number=2
     exon            complement(1213623..1213646)
                     /number=3
     CDS             join(1213902..1214093,1214163..1214245,1214314..1214368)
                     /codon_start=1
                     /locus_tag="AO090038000459"
                     /note="predicted protein"
                     /old_locus_tag="AO070332000043"
                     /protein_id="BAE64245.1"
                     /transl_table=1
                     /translation="MRFSSRVLLRSQIRSNQHKVSLFNNKIFHSTMPLVVPQVNAGDK
                     NEWLNKLAGKTITEGTSDVTSFAKKDLPQSHRIVKPGDMMTMDYKPERLNVHLDEQGT
                     VHDVHFG"
     exon            1213902..1214093
                     /number=1
     exon            1214163..1214245
                     /number=2
     exon            1214314..1214368
                     /number=3
     CDS             join(1216268..1216271,1216691..1216836,1217366..1217475,
                     1217542..1217733,1217783..1218026,1218076..1218332,
                     1218437..1219100)
                     /codon_start=1
                     /locus_tag="AO090038000460"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070332000044"
                     /protein_id="BAE64246.1"
                     /transl_table=1
                     /translation="MQSAGDAWERRRRLGFEAEATPRDLPSIRARACTSISRLRKPHH
                     DGPPQTAIKPILTVTTLDDLGVIAEVIASHSFEDKFAANDTQTGLVVSMFTAGAFFGS
                     AFAGPSGDILGRRKTISLGCVIFCLGGGLQTGAQTVAYLYSGRFLAGLGVGFLTMIIP
                     LYQAEICHPDIRGRVTSLQQFMLGVGSLCAAWISYGTYIGFAPTNNAQWQVPLGLQVV
                     PAVFLGLLIMFFPESPRWLIDHGEHEKGLQTLAKLHAHGDENDPWVRAEYNQIQESIT
                     FEHENEAKSYLELFSSRSSFRRLFLCCALQASVQMTGVSAIQYYSVTIYEQIGIKGDE
                     TLRYQAINSVIALVAQFLCMMFIDRFGRRRSLIFGNLGNCLTFIIACILLARFPPEVN
                     NTGAHWGFIIMTWLYNFSFSCTCGPLSWIIPAEVFDTRTRSKGVSIATMTSYAFNTMI
                     GQVTPIAMENVRYRYYFVFIICNFTNAVFFWLLLPETKKLPLEEMNYLFSNSPWIVLG
                     TKKEDYLPHDLEHKVHEQEVKQEVYAQHKE"
     exon            1216268..1216271
                     /number=1
     exon            1216691..1216836
                     /number=2
     exon            1217366..1217475
                     /number=3
     exon            1217542..1217733
                     /number=4
     exon            1217783..1218026
                     /number=5
     exon            1218076..1218332
                     /number=6
     exon            1218437..1219100
                     /number=7
     CDS             complement(join(1219579..1220084,1220267..1220432))
                     /codon_start=1
                     /locus_tag="AO090038000461"
                     /note="predicted protein"
                     /old_locus_tag="AO070332000045"
                     /protein_id="BAE64247.1"
                     /transl_table=1
                     /translation="MSSGFVSAGTDQEPVERDDEWLRVQQELEEERRRKAELGKQADG
                     KSLYEVLQQNKNSIMESTRAQEAAVKKETAEQLEAFRRHREEAEKVALEEGTADVTPA
                     AEGEDWKIPARKRRRDKKDLLFPGKKRKSTAEVAGETLSTGEQKVNQKDREPGKVDKQ
                     SVSIPAEAVKAEKSQPSVSAASSVNPVRPGNAKVAVPEQTEKKPAAKPAPIALGLSGY
                     SSDSE"
     exon            complement(1219579..1220084)
                     /number=1
     exon            complement(1220267..1220432)
                     /number=2
     CDS             complement(1221032..1222240)
                     /codon_start=1
                     /locus_tag="AO090038000462"
                     /note="predicted protein"
                     /old_locus_tag="AO070332000046"
                     /protein_id="BAE64248.1"
                     /transl_table=1
                     /translation="MLSRSSRFATSCTRQHLYRQTRTPLRNARARYSTSTESGSSGTS
                     PAVVGGIAGGAVTFLAGYVWYQFSGAKTIVQTANQTEAYFKEAKKKVAEKTPEPDEAF
                     GWLRDTAKNYASFIPGAKGYVDTAFDDLERIRRNQGKEFDEIVRDAYNDLREVSKKGK
                     LDVDTAVKVRDVLQKHFKRLYELAGDSAEDILDNHPELKEKLGGSFDRLKEMGSAYGP
                     QAQEEVDKTWKQIKDIVSAGISTDTVEKIQKVAKEKEEKLRKLGDEAWKRGLDEAQPY
                     LEKSPKIKEFIEKNTDALKKGNYSKIWDMVKESSSSGNTEDLEKYVKDLAGKAKESGF
                     GNLDKLSNMVPGGSQILSQLQSLQNAAEKKGPEAEKLLKETINDLQGVLSEKVKKAEQ
                     LAEETKSESK"
     exon            complement(1221032..1222240)
                     /number=1
     CDS             complement(join(1223310..1223417,1223494..1223784))
                     /codon_start=1
                     /locus_tag="AO090038000463"
                     /note="predicted protein"
                     /old_locus_tag="AO070332000047"
                     /protein_id="BAE64249.1"
                     /transl_table=1
                     /translation="MSFYTNTRQEDNEQYDVSFEIGGRQIDGFPTPCSNLRAGGLVYL
                     RGHPCEITDIHTSPASRSVVQIVGFDIHTGQFMDDQYPLRETVFVPRINNHTPSSSGR
                     SQVSRASSRGSGSQMVPRSRQSSNAGQYLK"
     exon            complement(1223310..1223417)
                     /number=1
     exon            complement(1223494..1223784)
                     /number=2
     CDS             complement(1225407..1225811)
                     /codon_start=1
                     /locus_tag="AO090038000464"
                     /note="predicted protein"
                     /old_locus_tag="AO070332000048"
                     /protein_id="BAE64250.1"
                     /transl_table=1
                     /translation="MNWNEIQDSMEAMSGILMDVDRIDVLELLIVDKQHEHYLACMAA
                     RIHLKIPWYNVLREPGKPLLLHGIEQLERLPWLGCLRIVGHMGLLLRFPEDRAYLEGF
                     AKGKKPAGLGDKNEHKPVVQVLMPEGMDSDES"
     exon            complement(1225407..1225811)
                     /number=1
     CDS             join(1233162..1233386,1233481..1233675)
                     /codon_start=1
                     /locus_tag="AO090038000465"
                     /note="predicted protein"
                     /old_locus_tag="AO070332000050"
                     /protein_id="BAE64251.1"
                     /transl_table=1
                     /translation="MCESPPAGFPFPTAEVQSILLVLSERYPEKIAEVVERLYRGLWG
                     DGDSGIVTTDGFMGVLGDVFGEVVAGEILCSSQDSETKLRLTENTQKAVDTGAFGLPW
                     IECVNAQGEKECFWGVDHMERVVEFLGFERADSKWGF"
     exon            1233162..1233386
                     /number=1
     exon            1233481..1233675
                     /number=2
     CDS             complement(join(1234680..1235592,1235821..1238146,
                     1238205..1238250))
                     /codon_start=1
                     /locus_tag="AO090038000466"
                     /note="karyopherin (importin) beta 3"
                     /old_locus_tag="AO070332000051"
                     /protein_id="BAE64252.1"
                     /transl_table=1
                     /translation="MDQQRFLQQLQIVLNPAQGNVKEATGILQREFYNKPDSLVFLIQ
                     VATGHEDANLKQLAAVEARSLVNKHWVSVQASQKPQIREQLLRSTLGEGSSLVRHSIA
                     RVISAVAKVDLNDGEWAELPNFLIQAGNTGNKDERAVAIYILFTILETLGEGFEEKFQ
                     DLFNLFGKTIADPESEEVRTNTLLALGRLAMHLDSEEDVGPVKAFQQLIPSMVAVLKE
                     SIDQTQEDRVMQAFEVFQTILGCDPALLTVHLKDLVVFMNEISANTEVEEDTRTQAIS
                     FLMQCVQYRKLKVQAMRVGEQLTRTALHIVTELGDTSVLDDDITPARSALGLLDMLAQ
                     SLPPSQVVVPLLHSLGQYFNNSNPDYRRAGIMALGMCVEGAPDFISTQMKEIFPMVLQ
                     LLGDPEPKVRQASLHAVARLADDLAEDLSQEHERLMPLLFQNLASAMQEYKGEEDGPT
                     IDIMKAGISAIDAVVDGLDEKDVAPYQGELVPILHKLFKHPDFRIKGLAAGALGSLAS
                     SAGDSFLPFFDESMHLLQEFATVKDSEEELDLRASVTDAMGEMAAAAGAERYQPYVEP
                     LMRATEEALHLGHSRLKESTYIFWGAMSKVYAEHFSAFLDGVVKGLFACIEQDETDLE
                     VSFGEAAKDLVGQEVTVGGRKVKVASADDDDEPVGEDGEIEDVDLEDEDGWDDITATT
                     PLSLEKEIAVEVIGDLVTHTKSAYLPYFEKTIEMVLPLAEHPYEGVRKSTISTLHRSY
                     AMLFAIAEENGQMAKWKPGLPLQVEPAKEVKKFGEILMTCTIRMWTEEDDRATVADIN
                     RNMAENLRYCGPSLISNETTLHNVITMVTDIITKKHPCQLEFSPEDDSLDAGEESSEF
                     DWVVVDTGLDVVSGMAAALGESFAELWKVFEKTIIRYAGSTESLERATAVGVLAECIN
                     GMGAAVTPYTSAFMKLLVHRLGDEDPQTRSNAAYAVGRLVEHSTAPEIVKEFPTILGR
                     LEACLHMDVSRLQDNATGCLSRMILKHRDSVPLKDVLPALIKLLPLKNDYEENDPLYR
                     MICQLYKWEDPTIRELTPQFLPIFQSVLCGDEDQLEDERRAELVELVKWLNQMQPGAA
                     PWAEQL"
     exon            complement(1234680..1235592)
                     /number=1
     exon            complement(1235821..1238146)
                     /number=2
     exon            complement(1238205..1238250)
                     /number=3
     CDS             complement(join(1238956..1239059,1239128..1242502,
                     1244184..1244196))
                     /codon_start=1
                     /locus_tag="AO090038000467"
                     /note="cholesterol transport protein (Niemann-Pick C
                     disease protein)"
                     /old_locus_tag="AO070332000052"
                     /protein_id="BAE64253.1"
                     /transl_table=1
                     /translation="MLTLENFFNIFCTFTCSPDQSLFLNVTETEPSSSGKSLVTELDN
                     IWSEEYQSGFYESCKNVKNGASGGKAMDFIGGGAKDYTHFLKFLGDKKLLGSPFQINF
                     KTEPAGPDPQGMHPLPIKPKACNDSDEAFRCSCVDCPDVCPQLPAVETDKQCHVGLLP
                     CLSFAVILIYSVFLLFVVALSSYFTYKERRHRKPERVRLLQDPTPSDDEDEGDIVHAG
                     GYLEQPKGVYKLNSVLDSVFSQIGGTCARFPAVTIVSSIIAVGLLSLGWLRFAVETDP
                     VRLWVSPTSAAFQEKQYFDANFGPFYRAEQAFLVNDSGPVLTYDTLSWWFDVESRVRR
                     MISLDRGIILDDICFKPTGDVCVVQSVTGYFGGSMYNLDPDTWKERVRHCAESPGDVN
                     CLPEFGQPLKPEMILGGYEESGDVFDARALIATWVVNNHAQGTENEANAIDWEDSFKG
                     ILGVVQEEAKERGLRVSFSAEISVEQELNKSSNTDAKIVVISYIIMFIYASLALGSVT
                     VTWKSLLTNPANALVQSKFTLGIVGIAIVLMSVSASVGLFSATGVKATLIIAEVIPFL
                     VLAVGVDNIFLIVHEFERINVSHPDEEIDERLARAAGRIGPSIFLSSLTETVAFALGA
                     FVGMPAVKNFAVYAAGAVFINAVLQITMFISVLALNQRRVESLRADCFPCITVRKAHS
                     GMSEDQVFDDQDGESFLQKIIRKVYATFLLNRKVKAVVVIVFLGLFTAGLALIPEVRL
                     GLDQRIALPSDSYLIQYFDDLNNYFLSGPPVYFVTRNVNVTARSHQQQLCGRFTTCEE
                     FSLPFVLEQESKRPEVSYISGSTASWIDDFFYWLNPQQDCCKEHGQLCFEDRNPAWNI
                     SLYGMPEGEEFVHYAKKWIEAPTDASCPLGGKAPYSTALVLDSKRIMTNASHFRTTHT
                     PLRTQDDFINSYKSARRIAQGISAEHGIDVFPYSKTYIFFDQYISIVQLTGILLGSAV
                     AIIFLLTSVILGSVATGAVVTATVVMTVVDIIGSMAISGVSLNAVSLVNLVICVGIGV
                     EFCAHIARAFMFPSRVILDKVPTKFRGKDARAWTALVNVGGSVFSGITVTKLLGVCVL
                     AFTRSKIFEIYYFRVWLALILFAATHALIFLPVALSYFGGEGYADPGSDGGLEENLAS
                     RGYRSLLVDDDYDSDGY"
     exon            complement(1238956..1239059)
                     /number=1
     exon            complement(1239128..1242502)
                     /number=2
     exon            complement(1244184..1244196)
                     /number=3
     CDS             join(1244870..1245401,1245454..1245539)
                     /codon_start=1
                     /locus_tag="AO090038000468"
                     /note="predicted protein"
                     /old_locus_tag="AO070332000053"
                     /protein_id="BAE64254.1"
                     /transl_table=1
                     /translation="MDDDVPKVPEVFCLSEYPDPEHKPLKTTVMMINWFKKWLVPVEE
                     CPGQIYPMIRMVRALLTHYFPEEKGWEVVMGDYGEEVVIYTVKCHDGNDLIDHLMVLI
                     LPDDDHHIIKSIQQFKNICRSRFGITPQDESDPALMWGAIFKGSKALFYQYEKGGEIR
                     SLIDPDVVDGPYSIEDHYVKCLGKNWKDTKILIGLTAQHHRVHRE"
     exon            1244870..1245401
                     /number=1
     exon            1245454..1245539
                     /number=2
     CDS             join(1247512..1247560,1248252..1248350,1249248..1249402,
                     1249470..1249883,1249941..1250070,1250141..1250386,
                     1250483..1250530,1250577..1251145)
                     /codon_start=1
                     /locus_tag="AO090038000469"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070332000054"
                     /protein_id="BAE64255.1"
                     /transl_table=1
                     /translation="MARLQNWWTTWDEIHDRLAPLEDTTSYRPGAAFPGDKDTSAVSM
                     PSSDKGRHDEVEAGPSIMSKMSSNRADEHYKLVKLSEQETLVEFKEGSSANPNNWDFN
                     KKVYNVLIALFVVLNSGVSSSLPSNAVPAIMEDFDQPGDGQKVLPTAIFLIGYVVGPL
                     AFSPLSETIGRKPVLTWTFTVFVLATLACALAPNWPSLLVFRAICGTMGAAPQTVIGG
                     VYADMFSDLRSRGRVMAFYMSAASFGPIVGPIISGCSVQYGWRWTFRIDLIFAGISWI
                     GLMFMSETFAPVILKQRAARLRKESGCNSYLSRQELQNGGFRYSTTQIITRPITMLVF
                     EPIILFTALYISLAYSLVFFYFQAYPIIFEGTYNFDVQTTSLTYIPNRKKKVGIGAAS
                     SGLISLYYDTIYEKAKKAGKSWTTSPELHRLPISCIAGPCLTISLFWLGWTANRNIHW
                     IAPVLSGLLFGVGYQMIFISLLTYVTDAYKIYSASALAASVIMRSIVGALFPLAADPL
                     YSTLGVGWATSVLGFASLACIPIPFALLYAGPWIRKRSPFCQRLLEEDSLKERAERSA
                     GDV"
     exon            1247512..1247560
                     /number=1
     exon            1248252..1248350
                     /number=2
     exon            1249248..1249402
                     /number=3
     exon            1249470..1249883
                     /number=4
     exon            1249941..1250070
                     /number=5
     exon            1250141..1250386
                     /number=6
     exon            1250483..1250530
                     /number=7
     exon            1250577..1251145
                     /number=8
     tRNA            1251907..1251995
                     /locus_tag="AO090038t00004"
                     /note="tRNAscan-SE"
                     /product="tRNA-Asp"
     CDS             1253635..1255131
                     /codon_start=1
                     /locus_tag="AO090038000470"
                     /note="predicted flavoprotein involved in K+ transport"
                     /old_locus_tag="AO070332000055"
                     /protein_id="BAE64256.1"
                     /transl_table=1
                     /translation="MEPTKKYDIIIVGAGMAGINTAYRIQTMLPNYSYAVLEARGAAG
                     GTWDLFQYPGVRLDTGIHTFGFPWQPYHTSKNMLDGSSIFEYINSTARAYKIEDHILF
                     NHRLKTLNWDSQQSQWNLTAACQDQEPRFIAEFVIFATGYYDYDRPLPAEIPGLSDYK
                     GVVVHPQFWPEKLDYAGKKIAVIGSGSTAISLVPKLAETASAVTMIQRSPSYIVSLPN
                     GSGDSWMNRLLPVMVLHKLRRYVWMAVMLGAYNFCRTFPQSARSIVLWLTAKQLPDHV
                     PLSPHFEPRYKVWDERLLACPDGDFFQSLHTNKVNIETANIQTVTESAVSLDNGRTVD
                     ADIIVTATGLKMQVGGGTHFELDNAPCNTADKVMWKGMMQQDIPNSFFVLGHLTDASW
                     TLGADATALFICRMIKHMEKENIRAATPRLHGSAGQPRQLWNLSSNYMLREQGNVPRA
                     GEIPPWQPRTNYILDSLDARYGSFDTCMEFSGEYRDDVGSMTEITEEK"
     exon            1253635..1255131
                     /number=1
     CDS             complement(join(1255252..1255316,1257240..1257872,
                     1257934..1258067,1258132..1258267,1258330..1260253))
                     /codon_start=1
                     /locus_tag="AO090038000471"
                     /note="maltase glucoamylase and related hydrolases,
                     glycosyl hydrolase family 31"
                     /old_locus_tag="AO070332000056"
                     /protein_id="BAE64257.1"
                     /transl_table=1
                     /translation="MHLKKLLTSAAALSGSVFAQSKDGVEDLDGPGDDLYVKDLSGCP
                     GYKATKHWQTRSGFYADLTLAGPACNVFGTDLPDLKLEVEYQTSDRLHVKILDTNNTV
                     YQVPDSVFPRPGFGEWCSPKDSKLKFDFQADPFSFTVSRTDTGEVLFDTTGNKLVFES
                     QYVYLKTHLPQNPHLYGLGEHSDAFMLNTTNYTRTIYTRDAYGTPQGENLYGAHPIYF
                     DHRQTGTHGVFLLNSNGMDIFIDNNSTQFLEYNIIGGVLDFYFIAGPTPRDVAIQYAE
                     ITQTPLMTPYWGLGYHQCKYGYQDVYEVAAVVANYSTNNIPLETIWTDIDYMDRRRIF
                     TIDPERFPADLYKDLVDTIHARDQHYIVMVDPAVYYKESNPALDEGLKYDIFMKENNG
                     SEYQGVVWAGPSHFPDWFHPDSQQYWSEQFLAFFDGTNGPDIDALWIDMNEPANFYNH
                     PYPGNNTTPENFAEVDGDPPAAPAVRDGPDAPIPGFPASLQPNWVQGNATEKRSTAAV
                     VKRQRSQSRRNLGAGHWKSPKGKFDARAGWQHGKQTGSGCGPNECKGLPNRHLIRPPY
                     MIQNGAGPTLADSTADTDLVQSGGYVQYDTHNLYGAMMSSHSHNAMRARRPDDRALVI
                     TRSTFAGSGKDVSHWLGDNVSGWLWYQLSISQILQFASLYQIPVVGPDVCGFGGNVTE
                     TLCARWATLGSFYTFFRNHAEIYANSQEFYRWPTVAQAARNGISIRYQLLDYIYTAIY
                     KQNQTGTPALNPLFFNYPNDPNTYPIDLQFFYGDGILVSPVTEENSTSVTFYLPDDIF
                     YEWGTGKPVRGQGEYVSLDNIDYTDITIHYKGGIVYPQRIESANTTTALRQKGFNIVV
                     APGLDGRAEGSLYLDDGVSVVQDTVSEIDFVYENGKLTMTGSFEYEAGVGIETITVLG
                     VESKPEGDDVEYDAENKKLVKHVDVPLTASIISYTVYEAVTTGQSMCIT"
     exon            complement(1255252..1255316)
                     /number=1
     exon            complement(1257240..1257872)
                     /number=2
     exon            complement(1257934..1258067)
                     /number=3
     exon            complement(1258132..1258267)
                     /number=4
     exon            complement(1258330..1260253)
                     /number=5
     CDS             complement(1261378..1261827)
                     /codon_start=1
                     /locus_tag="AO090038000472"
                     /note="predicted protein"
                     /old_locus_tag="AO070332000057"
                     /protein_id="BAE64258.1"
                     /transl_table=1
                     /translation="MVDGYLPKLTREEAAIVKRRLPIGDSDMVPEEERTLCQDRIDYS
                     HHADPNIAGFPGVTQAYIAIASEFADLFSPAVACCTVMGKVGIVPAKTRVGDRIAVFR
                     SGRVPFILREKETLRDHYEVIGECYIDGMMHGEYIKQSAQYQDIKLV"
     exon            complement(1261378..1261827)
                     /number=1
     CDS             complement(join(1262509..1263381,1263539..1263835,
                     1263896..1264522))
                     /codon_start=1
                     /locus_tag="AO090038000473"
                     /note="predicted protein"
                     /old_locus_tag="AO070332000058"
                     /protein_id="BAE64259.1"
                     /transl_table=1
                     /translation="MPLVGQTSDDAVTLSRTEPSRPSMSRRETRVSMSYKEGFIEQWQ
                     QISARSPPHSGDSSPLDPPPIHDSPWRERSTAQSTSASQSSPERRSPVSETYSRCSNV
                     PSGEIAEDQISVIGSWELDHQDGRSIAQVTDSHYQHRAPKSPTTPHIIFCPTMNELPE
                     VDFEGRNIKGRTTLPARLQVLDIGVQTIFIARNSTTLIDYEPAFLGEVFVSEFLRHVL
                     GSAYNPEEHWTSPLRSRRGYAPFTAPNNSPLSSFYIDARAGQAMTDFLITMLVKQAEN
                     WKFFPPDYHIDVQTTVDDISASFTWNMFNFDMARPQARKWRVQGSSQHQDRIYILIRV
                     SNIYEDPMVRMFVDPWNMIEEEELLIKTPSNLVANIHSDARPGIELIDFQNKKSPQPD
                     SFVSQISLYTALAISGQRSTVKSNVYVWKPLKEPARQIRLLHLLPGTGIEDLRGDLMI
                     AAITDRVKYDAISYTWGSALQPFTLHTTEGNIPITTSLYVALMRMRKHKEAIWLWVDA
                     VCINQKDDIEKAAQISMMPDIFRSATRVYAWIGEEEDGSSEVIQTIKQIAKQRLEPTM
                     PSANRYQDIPPLGRTFWNNLGRLLERKWFRRI"
     exon            complement(1262509..1263381)
                     /number=1
     exon            complement(1263539..1263835)
                     /number=2
     exon            complement(1263896..1264522)
                     /number=3
     CDS             complement(join(1264690..1264723,1264807..1265058,
                     1265112..1265425))
                     /codon_start=1
                     /locus_tag="AO090038000474"
                     /note="predicted protein"
                     /old_locus_tag="AO070332000059"
                     /protein_id="BAE64260.1"
                     /transl_table=1
                     /translation="MVLRTFHIFPTRRGEAQLRLQACEQHDDWFIADQPHLFETFHRH
                     LNMLAFDAEDTARMVRFFDALHINDRLLSTAAICRPRPGLAFTVREDYKSLLLSRAES
                     ISRLARNYGSQPPEISRLLGDIEVRSVDEVHVEWTIRSPSQETIEHYADRRLALIVKE
                     KNRTQLYIRHRDADARNVQFEISEQLAQLSRGDFASHKL"
     exon            complement(1264690..1264723)
                     /number=1
     exon            complement(1264807..1265058)
                     /number=2
     exon            complement(1265112..1265425)
                     /number=3
     CDS             complement(join(1268090..1268145,1268601..1270455))
                     /codon_start=1
                     /locus_tag="AO090038000475"
                     /note="predicted protein"
                     /old_locus_tag="AO070332000060"
                     /protein_id="BAE64261.1"
                     /transl_table=1
                     /translation="MDSFKYEPLDLDGPAFRLVRLCHGDGPDIHCELFQAWLYPEQSA
                     ISYETLSYTWGSTEIVERVQMNGKILGVTLNLYLALQHLRLQDEDRILWVDGICIDQA
                     NHKERGHQVRHMGDIYKQAERVIFWLGHPTYDTNVVLDSLHQLQKESTGYACRAWELT
                     DPRWADLWSSVQPRLKDKYPDLRTRQRQGLEELLSRPWFRRVWILQEVANARAGLVCC
                     GQKSVSTHIFPLAPLLIDIIPNTQSQAVLDIMPGPSRNGTWWNMNQDLYTLLQKFSAS
                     EARLPRDRVFALLGLSSDARDTDMLRPDYENSEKDVIHDVVYFLFDEHIYHSQRSRFN
                     TLQDLIMNLEALNTLFLQYYMESPYLEDLEKVLERRCFGISEANITAAAHATRIAMST
                     GLGDKAGRDNGVDIGTIKVWDHLKNLEHVLQRRGYNIEVMADLLATIIKNADCWPATV
                     NFFLHQRCNEFKITDPVLIALLNPPENVEEAAMTHVQEQQYQAQTTENMLRSTYVSGA
                     PFGLQFIKLLLQQRGKGIQITDEVLCAAIPNTSSGVQFIQLLLQEQGNETIITDKALC
                     RAASNKYNGVDIMEILLEQKGNEIIITEKVLCAAASNKYNGVDIMEVLLRRKGCCCIR
                     EVAPTTPSRSEF"
     exon            complement(1268090..1268145)
                     /number=1
     exon            complement(1268601..1270455)
                     /number=2
     CDS             join(1271227..1271720,1271754..1271766)
                     /codon_start=1
                     /locus_tag="AO090038000476"
                     /note="predicted protein"
                     /old_locus_tag="AO070332000061"
                     /protein_id="BAE64262.1"
                     /transl_table=1
                     /translation="MDNLPRSTGICAHCQTPATKRCSGCRGAAEYDKVTPEPTFYCSS
                     ACQTQHWGEHKVKCKQLQARKSLSRAATLLQAILYRIRLHAHIFQFATAHIDGSKVTL
                     DDIQNDKSKAYQPLKAVWMNIKSGDYQRVFDAIIMMNACAEAVMFLYGFIRPILSGRG
                     VTKALPLL"
     exon            1271227..1271720
                     /number=1
     exon            1271754..1271766
                     /number=2
     CDS             join(1271897..1271916,1271995..1272286)
                     /codon_start=1
                     /locus_tag="AO090038000477"
                     /note="predicted protein"
                     /old_locus_tag="AO070332000062"
                     /protein_id="BAE64263.1"
                     /transl_table=1
                     /translation="MDPSGAHLGYHRGEMSRFNGYGLDVSDMVLLDLTSALDEKIPAL
                     ANVYGGMLNLILQGSDATFQKAKNELLDQLSICVNRCLDEIYAPERVAKKSRMARKTD
                     A"
     exon            1271897..1271916
                     /number=1
     exon            1271995..1272286
                     /number=2
     CDS             complement(join(1277780..1277891,1277996..1278870))
                     /codon_start=1
                     /locus_tag="AO090038000479"
                     /note="predicted protein"
                     /old_locus_tag="AO070332000064"
                     /protein_id="BAE64264.1"
                     /transl_table=1
                     /translation="MPFYTLAVNYDPTSSSSNLGSLGVHKTRTLIITPDRETSDSLFR
                     IIQDNPSGVNPQAPFKHVQRISPQMWSWTAQDNNSSKDQLAKLIIAINNRTAVITNDQ
                     SGNPLKRLQGRVTLHALPDWDSQTLTPIIPNIETADYISGNLFCIRNRRSPDKYWAKP
                     PGDYHWIRLSSIIRTRFRIRAVGKPDGTVMIPDDHVEISVVRLDDNNNEQEFPLGYQD
                     FSGRLAEVAKEQRIRIWFESFLAGGISLDYRGSENETNNAGAEQNDSGWKPTDDELTY
                     PLYPVFYDESQRGGEIFIYLHGTSLSFFLSFFLSFFLYKDRVKKSIKFTIIT"
     exon            complement(1277780..1277891)
                     /number=1
     exon            complement(1277996..1278870)
                     /number=2
     CDS             complement(join(1280504..1280584,1280635..1281363))
                     /codon_start=1
                     /locus_tag="AO090038000480"
                     /note="predicted protein"
                     /old_locus_tag="AO070332000065"
                     /protein_id="BAE64265.1"
                     /transl_table=1
                     /translation="MIKSTISTLLATAALVSSTCLTPDPSSCSCDMPTAAKNSRTECC
                     PNPHASGIEKVGNIDFEYACGKYPRLYDIAAGLPAATADLCATLCAANPSCAAAGWNP
                     SSRLCHLSTDTSGDTTYRVNSLLLTKTNFISPAHQCEEEVQEAVTKAQETCTREKDAL
                     KGELAQCKAASDPACWGNGGANLCTDSCTQQDLLVNGKKFQKKCDFQIDSFVGQELFQ
                     PIRDCIQQCSQQSDCVGVQGNPAGTSCWVYNDQWSIQAPRREPGWTLLLVA"
     exon            complement(1280504..1280584)
                     /number=1
     exon            complement(1280635..1281363)
                     /number=2
     CDS             join(1281991..1282633,1282693..1282758,1283525..1283548,
                     1283683..1283861,1283960..1284011,1284143..1284218,
                     1284287..1286549)
                     /codon_start=1
                     /locus_tag="AO090038000481"
                     /note="predicted protein"
                     /old_locus_tag="AO070332000066"
                     /protein_id="BAE64266.1"
                     /transl_table=1
                     /translation="MKTERTVILPWLLSASLALAQTFVPRAGPDPALGQAEYDRFCPS
                     QNGTIKTLSPSSSVVVHCDAIPRLPVLGDREWTASMEDCGLWCENMGTACMASFWDPR
                     DGACYWSGAQAVEPRTKYVSLVQMTSLDSCDKEKEQCFKAKAQCLNDKAACLKAKGEC
                     EKREQTCLRDKKNCEGREQTCLRDKKNCEAREASLRRDLQARNREIARFRERTPCNAV
                     HGQGRIVGNRIFKILCNHQWLKPHEFATHHSGHETLSNRRKRQHIYGEYLQMPLVDTV
                     LCNWNYRIGKLCCSYLLSIIGLAVWQAASPYKRLFCATNLLHDTQVGITLPLGIAYIL
                     SWQLPKENNAITWSVGTRVLQATTWPSLIGADSTASKRVSWLVFCLGWAITVGHVLVS
                     IAGIITPLGLHDRIKPAASTSVPFVYVPDRSPYGLGTPPRPDAPFSRSCGGSGWVVCP
                     GSNGTDAYFLVNKTIHDIIPNNGTYSARLPYNLTQIFSSATSGTNNTVSGPFDIQYRQ
                     VFPTAMTQVDNGEPYIVGSYRVMDSLILHDKIEAIEGLIVDSTRGGLGYRNHTVPANL
                     PTGGRWTEDITWLQPLIECVNTNLSIRYTLNYTDYNGNRVESHNVRLKDNGGFFNLPL
                     KGPRYNITDIQANPDLHTRATQLAFFHNNMLMWALGLASSNISGPRNVTSRTEYPLVI
                     NGTTSGDQHNAYRPDSIQIPGSDGLFINSDLNTTNDLWSFQDTTLMCRGLLSQYTLDP
                     LDNATVGIDCGLLQAAPRRLDGADPRVYDAGSEWEQDMYMCASAVEASIKTVEFTLNG
                     TSTLEDLTVSSVKDKVYKSQDAQPLWAIEITGQPNTVAAPLWGLISHEYAAAENLITI
                     KSEKLLLPPSYPYSATVVNARDSLAASYAPMAAQHVALGESFLGQITSRWTLDVPIAD
                     YTGKSNFALSRRWQQLSAGGEQGAATNLKLILTDILATATIGSQTPIGLSGSDTGRLG
                     GSLPSGDKMVRIEPFQRKIEYNLAYAVPAFITLALWVVVLVAFSIALIGSRFSFSKLR
                     QQLNLSSVGRLYTNLVYPDVCEVGAKTETWIEQAGGLKFQLDRKGESDPEDPSAESQL
                     IEEQQSHETSSE"
     exon            1281991..1282633
                     /number=1
     exon            1282693..1282758
                     /number=2
     exon            1283525..1283548
                     /number=3
     exon            1283683..1283861
                     /number=4
     exon            1283960..1284011
                     /number=5
     exon            1284143..1284218
                     /number=6
     exon            1284287..1286549
                     /number=7
     CDS             complement(join(1286971..1287019,1287204..1287520))
                     /codon_start=1
                     /locus_tag="AO090038000482"
                     /note="predicted protein"
                     /old_locus_tag="AO070332000067"
                     /protein_id="BAE64267.1"
                     /transl_table=1
                     /translation="MDVLYNDCDRALEPELATLMQPHALRAFETPATAPAWAESAFDG
                     RRAYVRTLDDCCNPSSLQDLWLEKSQVEWEVVDLKTGHMPFVSQPRALAEHIIKFIDG
                     FMAKWPHCWLLGPPLKFII"
     exon            complement(1286971..1287019)
                     /number=1
     exon            complement(1287204..1287520)
                     /number=2
     CDS             complement(join(1287613..1287653,1287735..1288047))
                     /codon_start=1
                     /locus_tag="AO090038000483"
                     /note="predicted protein"
                     /old_locus_tag="AO070332000068"
                     /protein_id="BAE64268.1"
                     /transl_table=1
                     /translation="MSSANLPVIVIVPGAFGTPQGFEKLLPYLAQAGYATHPGSYPSC
                     NPSDPAQESAPQDIAFLRDNVLLPLLNEQGKDIVIIAHSYGGVVAGGAARGLAKGTRT
                     AQGGAYPPFIKVDKV"
     exon            complement(1287613..1287653)
                     /number=1
     exon            complement(1287735..1288047)
                     /number=2
     CDS             complement(join(1289826..1290477,1290543..1291240,
                     1291300..1291395,1291456..1291621,1291683..1291921))
                     /codon_start=1
                     /locus_tag="AO090038000485"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070332000070"
                     /protein_id="BAE64269.1"
                     /transl_table=1
                     /translation="MDRAAEVSKVADDSISPHASHTTSNTATLDKSGNKIVEQSTSAD
                     DVEKQSDTQSLQAGVRRAEILRKGWTKKGLYTAFVGLFIATLAINFGDYSTQVYVPYT
                     TSAFKQHSAMSAARVVMNITRIAAYPIIAKLGDVFGRAEMFILSIAASTLGYVIYAAC
                     EDIAQYMVAGIFEAIGSTGYALTQQVFVADVTNLINRGIWSTLPDSLTTVPTLYLGTI
                     VAQRMLDHSTWRWGWGMWAIITPVCAVPLIATMLVYQRRAPIKVPIAKAMGWKETDTW
                     YQRAYRLLWVELDLPGGVLLLLGLSLLLVPIALTGSNNSNAWHKGNFIAMLVLGVVFL
                     MSFVIWDARFAKKPFVPYRMIKQRTVAAACLLGALDFFHYSVFSVFFTSYLQVAGHFN
                     AGNATRIDNSLRVAFQVSGIFAAFFMKYTKRSQIWVLVGVPLCILGMGILLYLVDMGD
                     GKTGNEAAFVTAKSLIGIGRGFYQTAAQVSVQAVVSRQEVSVVTAVFFASMSIGGAIG
                     TSVAGAIWRSNLPRKLSEYLPDEAKGQAKSIFGSIVVAQKYPVGGSVRMAIDRSYRES
                     QRLLAIAAISALAPMVVIMFFLKNVHLDERQTAKEEGEREMGEQKKGDAE"
     exon            complement(1289826..1290477)
                     /number=1
     exon            complement(1290543..1291240)
                     /number=2
     exon            complement(1291300..1291395)
                     /number=3
     exon            complement(1291456..1291621)
                     /number=4
     exon            complement(1291683..1291921)
                     /number=5
     CDS             join(1292727..1292884,1292945..1293286,1293343..1293346)
                     /codon_start=1
                     /locus_tag="AO090038000486"
                     /note="predicted protein"
                     /old_locus_tag="AO070332000071"
                     /protein_id="BAE64270.1"
                     /transl_table=1
                     /translation="MRREWKFTPSEGGSGRNMAAWEVLTGTEATYLVEVSWPLSWRET
                     NVSAVANVIFAVDGNAMFLTATDVARRQASLNPNKPGTIVVGIGYPLKASVYSPQRSS
                     DLTPPCDHYTPPEGPDGNPRPEPYGGADRFLSFINNIVRPFVASSIFPNVKFARTALF
                     GHSYGGL"
     exon            1292727..1292884
                     /number=1
     exon            1292945..1293286
                     /number=2
     exon            1293343..1293346
                     /number=3
     CDS             complement(join(1293710..1294140,1294186..1294886,
                     1294937..1295021,1295027..1295317,1295383..1295743))
                     /codon_start=1
                     /locus_tag="AO090038000487"
                     /note="acyl-CoA synthetases (AMP-forming)/AMP-acid
                     ligases II"
                     /old_locus_tag="AO070332000072"
                     /protein_id="BAE64271.1"
                     /transl_table=1
                     /translation="METNGMQRAFVTGPTEPPICPKTFAQFIDEQAATYGQRPSIVSP
                     WQGISLSYHELAERSKHVARALLGMGLAHGDCVGIMAGSSCQHIELLMGGARIGCAVV
                     SLHTTYTPEELKRTVRRTSCRLVFISSRIGRRDLSTHVNVMKNCMSSGALPELNAVLT
                     IGQNDYKGYSQGLQTYEALFSEYKEGVTNPDIDATFLLKLAEKAVTTDDVIRMDFTSV
                     LEHLPRVSPVNQSIGTTGTPKAAMLTAINLLGGGFIVGERLSLTPKDIICSPAPLFHS
                     FTLIAGVFASLTHGSSVILPSDHFDPHTVVAAIQKQAPTVLLGVPTMFLAELEIMAKE
                     PADMSLRAAVVGGSVVTSALRKNICTTMKTKEVYSVYGMTETGATFIGSLDGLEESTG
                     MVGYVMPHICAKVLNRSGQIARPMEKGELYTSGFTLQKGYFGEEEKTLETMTQDQDGK
                     IWMRTGDEAVIDESGCCRITGRIKDIIIRGQLGGENISPLEVESRLASHPSIGEASVL
                     GLPDAKYGEVVGCFLKSAPNVERLADEEVQGWVRETLAWHKTPAYIFWIGDPGVADDF
                     PRTGTGKHQKHIMKKIGERLIAVRRNGVCEPRLMCESFRSVTTHSSVGNNSLINCV"
     exon            complement(1293710..1294140)
                     /number=1
     exon            complement(1294186..1294886)
                     /number=2
     exon            complement(1294937..1295021)
                     /number=3
     exon            complement(1295027..1295317)
                     /number=4
     exon            complement(1295383..1295743)
                     /number=5
     CDS             join(1296235..1296347,1296456..1297042,1297116..1297174)
                     /codon_start=1
                     /locus_tag="AO090038000488"
                     /note="predicted protein"
                     /old_locus_tag="AO070332000073"
                     /protein_id="BAE64272.1"
                     /transl_table=1
                     /translation="MAPPVVSVVGTGLQYPPHKLGPEFVPKLVSNCYTDNVAVLPSNH
                     PLWFQDHILTNTECDDLFKKYGIPLAQDAATQAIEDWGGNLMDITHVVAMTCTSASSP
                     GFDCTLSRRLGLSKHVRRTLLSGVTCAGSVAALRTAYDLLRGATQEGKPARALVIAAE
                     TMTVYVRGWLETIVKESIPNIGPTLFGDGACALVLSNGIGVKEGEREPIWNIHGAQST
                     LLDRPGCVGIRWMPSGRSEDDQVSLAILIWEPHH"
     exon            1296235..1296347
                     /number=1
     exon            1296456..1297042
                     /number=2
     exon            1297116..1297174
                     /number=3
     CDS             join(1298041..1298209,1298294..1299270,1299508..1299540)
                     /codon_start=1
                     /locus_tag="AO090038000489"
                     /note="predicted protein"
                     /old_locus_tag="AO070332000074"
                     /protein_id="BAE64273.1"
                     /transl_table=1
                     /translation="MSITDIFSVDIALRTGQNNTHESYLYSHLTGDKIHGVVTVRSHC
                     DIRVDGIEVSFIAYRQFQDLKYLIDDSSFPPGKLFKERHRYQFEFTFEVPDHLSPDVC
                     NHKITSPTIRQAHLRPPPSFGDPSVSGLGGKLKDDYAPPTCKILYTIQAALFRNIPVI
                     DKRDILLVHKIKLRVKPAVDEWPPLDLLSSVNDYCLEADHAVLDSRTKEEYGQLTVTL
                     EPPKSFRLPLRDPHSLISSTVNLFLHYKVTGEQSDLPQLQSFRGKLVATTFYTASYYE
                     DVPSKQKDFFGRPKNYSETHFPPFSYSIASLDWVPAEENCYVATLLVPITLPRLNFIP
                     SFHTCLTSRVYALDLRLVVPGASPFYLRAPVHIYAQRDPSALPSYIATIWQSAEYQYY
                     "
     exon            1298041..1298209
                     /number=1
     exon            1298294..1299270
                     /number=2
     exon            1299508..1299540
                     /number=3
     CDS             complement(join(1300689..1301168,1301228..1301557,
                     1301629..1302026,1302080..1302162,1302218..1302307,
                     1302448..1302518,1302574..1302651,1304372..1304377))
                     /codon_start=1
                     /locus_tag="AO090038000490"
                     /note="amino acid transporters"
                     /old_locus_tag="AO070332000075"
                     /protein_id="BAE64274.1"
                     /transl_table=1
                     /translation="MKEVEGQPSYQNKDDVYLARMGKRPVLQRNFGLMSMVGFSCTIL
                     ITWEAVTTGGPAGSVYGYLFVWAGVTATFVVVSELVSMAPTSGGQYHWCSMMAPKSVM
                     KVSSYITGWLTVIGWQATYATGLYLNGNFIEALVILTNPDYTPAPWRKTLYSWATAVF
                     AATMNIIGGKLLPRFEGTILILHILGFFAILIPLTYMAEHKPASEVFTYFINEGHWPT
                     QGLSFFIGIIGPVFAFAGGDAAVHMVEEMTNATVAVPWSLMLTVLINGTLGFSMLIAL
                     YFCLGDIETSLKSPTGVPFLSIFYQATESTAGTAAAGSVIQAMCCCTTVGMLASASRQ
                     FWSFSRDRGIPGWRVWSKVTPRTAIPTYTVLLTSTIGCLLNLINIGSDVAFNSLVSMS
                     TSGLYLSYMIAASLLLYRRCTGEISQPKRNSEQTMVNTAGAKLVWGPFHIPGIWGIGI
                     NIFSLVYMFIATFFSFWPPINEVNSESMNYSVVGTGGTVFLSLGYYLVRARGVYEGPV
                     IEI"
     exon            complement(1300689..1301168)
                     /number=1
     exon            complement(1301228..1301557)
                     /number=2
     exon            complement(1301629..1302026)
                     /number=3
     exon            complement(1302080..1302162)
                     /number=4
     exon            complement(1302218..1302307)
                     /number=5
     exon            complement(1302448..1302518)
                     /number=6
     exon            complement(1302574..1302651)
                     /number=7
     exon            complement(1304372..1304377)
                     /number=8
     CDS             complement(1307566..1308930)
                     /codon_start=1
                     /locus_tag="AO090038000491"
                     /note="TPR repeat"
                     /old_locus_tag="AO070332000076"
                     /protein_id="BAE64275.1"