LOCUS       AP007168               13103 bp    DNA     linear   PLN 16-DEC-2016
DEFINITION  Aspergillus oryzae RIB40 DNA, SC311.
ACCESSION   AP007168
VERSION     AP007168.1
DBLINK      BioProject:PRJNA20809
            BioSample:SAMD00067075
KEYWORDS    .
SOURCE      Aspergillus oryzae RIB40
  ORGANISM  Aspergillus oryzae RIB40
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Eurotiomycetes; Eurotiomycetidae; Eurotiales; Aspergillaceae;
            Aspergillus.
REFERENCE   1  (bases 1 to 13103)
  AUTHORS   Sawano,T., Tanaka,T., Machida,M. and Yamada,O.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-JUN-2004) to the DDBJ/EMBL/GenBank databases.
            Contact:Toshihiko Sawano
            National Institute of Technology and Evaluation, Genome Analysis
            Center, Department Of Biotechnology; 2-49-10 Nishihara,
            Shibuya-ku, Tokyo 151-0066, Japan
REFERENCE   2
  AUTHORS   Machida,M., Asai,K., Sano,M., Tanaka,T., Kumagai,T., Terai,G.,
            Kusumoto,K., Arima,T., Akita,O., Kashiwagi,Y., Abe,K., Gomi,K.,
            Horiuchi,H., Kitamoto,K., Kobayashi,T., Takeuchi,M., Denning,D.W.,
            Galagan,J.E., Nierman,W.C., Yu,J., Archer,D.B., Bennett,J.W.,
            Bhatnagar,D., Cleveland,T.E., Fedorova,N.D., Gotoh,O.,
            Horikawa,H., Hosoyama,A., Ichinomiya,M., Igarashi,R., Iwashita,K.,
            Juvvadi,P.R., Kato,M., Kato,Y., Kin,T., Kokubun,A., Maeda,H.,
            Maeyama,N., Maruyama,J., Nagasaki,H., Nakajima,T., Oda,K.,
            Okada,K., Paulsen,I., Sakamoto,K., Sawano,T., Takahashi,M.,
            Takase,K., Terabayashi,Y., Wortman,J., Yamada,O., Yamagata,Y.,
            Anazawa,H., Hata,Y., Koide,Y., Komori,T., Koyama,Y., Minetoki,T.,
            Suharnan,S., Tanaka,A., Isono,K., Kuhara,S., Ogasawara,N. and
            Kikuchi,H.
  TITLE     Genome sequencing and analysis of Aspergillus oryzae
  JOURNAL   Nature 438, 1157-1161 (2005)
COMMENT     URL:http://www.bio.nite.go.jp/dogan/Top
FEATURES             Location/Qualifiers
     source          1..13103
                     /db_xref="taxon:510516"
                     /mol_type="genomic DNA"
                     /note="SC311"
                     /note="phrap>=30:1-12378"
                     /organism="Aspergillus oryzae RIB40"
                     /strain="RIB 40"
     CDS             join(4393..4508,4589..6257)
                     /codon_start=1
                     /locus_tag="AO090311000001"
                     /note="predicted protein"
                     /old_locus_tag="AO070176000001"
                     /protein_id="BAE63862.1"
                     /transl_table=1
                     /translation="MVYDWDGKRDICYQMYIKDKKALEEIMEYMKDVYQFAPSKRAFQ
                     TQFKRWGFPSKQNPAHKNLELVARVKQLWERNTSQRDMLRILNEEGFEIKERELMRVR
                     AKNRWLLRVPNGMKSQSNMQTSAQPPEDEGLLALQQEVYKNEGPFNDTETLLTDTASP
                     RPPSPGLSPEVLAKRKERLERLKAESAERWATRKRRRRTRGWAGLPADPPGPPRFPSE
                     TTIDESKKHLNLDNVMYRQIRDQFQRICEDAGFIKKTVAGPEKWQEAKNKLIQESQHL
                     QHVFWEDPNQLDAKALALDVVCTDVTKRMRTLERRMTIAEAKNALGVNPEESRQIRNA
                     FYNTLKADHFTSKLEAGDEHWTKLKEQWIQSSELLQQILAPGPTDTEHTTKLKALEVL
                     CRDVMKRLRDDQTKRDPAPKHSNSQEHTQSPDFGSSHISSAFGGSITNGISTLASQAL
                     ASAPVASSDLGDLQIDPSLLQAANDPSFATANHQDSGHTFGYVDPLLEPSAMQIPVYL
                     RIHAQSSLHGDAKPWIEKLTTRSVAELRQLVNTRYPETFITRIEGTDRDENGHEIYFL
                     IDEDREFDAYLTHMQGRKASFLFSLEQV"
     exon            4393..4508
                     /number=1
     exon            4589..6257
                     /number=2
     CDS             complement(join(7112..7143,7365..9056,9106..9875,
                     9929..10266))
                     /codon_start=1
                     /locus_tag="AO090311000002"
                     /note="WD40 repeat protein"
                     /old_locus_tag="AO070176000002"
                     /protein_id="BAE63863.1"
                     /transl_table=1
                     /translation="MSGSDGSNPSMCLSKRSRASDAAQDKLIRTERERVKRRRTSRDK
                     DEIKQSLRPPMSNPPKAKNDNHQAVRVANSSSLHSIDQNEIALLEPWSLSTPVAGQYT
                     NIDPILTRDEGYLFVGLEAAVHVYSVATSRLFRTLQLKPNQSIIGYSLSSASQEYLYI
                     VTSAGSVSKWDWLAGKQVSHWTIGRKIISASPSYYANKGKEDLALLILRDHKTGKREI
                     VVAHLDEKNLHETVILETSARLDHIKCISDGQAVIAYSGQRVLIGYQSPGQNDPELMQ
                     YTWKEVALPVNISCVDIRCSTTSSRVEGQSVNSKKGPTSIDLALGSSDGSILIYHDIL
                     NLVGKEEHRRGEKTMTPRRLHWHRDLVNVVRWSIDGNYVISGGHESVMVLWQLDTGRK
                     QFLPHLSSPICNIVVSSTGNSYAIKLADNSIIVLSARELQPFATITGLQSYSQINKPR
                     VGVYLRPTPAAAILHPQYCDRLLIAVPASRQVTHEGHRPANSCVLQTYDIHSNNHISR
                     QALARSNATTLKISPEGSQIAAPNVTHLGVSPDGKWMSTVDIWSPNPHDIEALDCNGT
                     GMRSIAAGYQEIFLKFWKWSKSSDLWELVTRIDGPHFSMKGPVPVLDLASRPVSHEFA
                     TIGSNAVLRLWCPSSRQRSGLKMGHGEEQLETWKCRNTVDLKGYISGENFDSVSMASL
                     AFSQDGSVLAVCLQSVHPGSPGIALLVDVQSCTVRYSRAGLYPGDPCVARFLGCHLVI
                     ASTQSVSVWDTVNDIVRTPDNLEVDYSHNDKAYRLLAVDPNTQTFAVTVQHLQSPTAP
                     KKGRKHFVQVYDMQSLSLLGQLPLGRSPYALLPDSRSGDYIVLDVAADVQRLGCSKKT
                     SQALPSQDLVDKVNSGLVGLLGNSVYGSRYRHPSQTLMDSLEAPPPQSKELAGIFNGS
                     PFVLPSASVLFQDVVQALSEKLHGIPDCL"
     exon            complement(7112..7143)
                     /number=1
     exon            complement(7365..9056)
                     /number=2
     exon            complement(9106..9875)
                     /number=3
     exon            complement(9929..10266)
                     /number=4
BASE COUNT         3900 a         2641 c         2505 g         4057 t
ORIGIN      
        1 gtcatcctat cgttattctg ccttgtgtgt ccgccttcga taaggtgcgc tagacaaggg
       61 tctgtaacac ctatctatct ttctaatcta gagtttctat ttggtcaatc ctagctttct
      121 tatataatct agtcatttaa ttcatttatt ctattcagct tttctattca tcctagctag
      181 ccgtaagact attccgcttt agtattaggg cagctgacaa ttgaaaacta tattatattt
      241 ttaaataatt ctatttattt atttaaatta aatatctaga atcctagaat cttttatttt
      301 aatatattaa tagttatagt aatatataaa ataaattttg aatttaaaga tatatttaat
      361 agaattatat atctatttct tttttataat agtaaaaaaa agataatatt atattttaaa
      421 agtaaaatat caactatttt atatatatgt atagattaaa aaaatactct atatttattt
      481 aataaaagaa tgtatttttt aaattatttt tttattaata gttattttat aactattagc
      541 atattattta tttttaaaga ttctttttaa ataactatat agaatagatt taagaagatt
      601 gaatatatta ataatttttt taaaactatt aaatttattt ttttaaaaac taatataatt
      661 aataaaattc aatatttcta ttcagcgcgt gattttaata atttagatac ttttaataat
      721 atagctgata ttttaattct ttaagaaatt taaacgcgta gaaaatacat tgatatatag
      781 ctcgcttatg tacgcagctc gcttaccgat tacattaata gttataacaa gaatcaagtc
      841 tagttttacc aacaatagca gaggtccgag gatactcatg ctttacctag ggcaaattaa
      901 aacttggaag tcaaccatga ttccatgaat aatctacaag aaataattgg ctgcgcatag
      961 cgcaacctct tatggtaagg ggctggagcc agcctgatta gtagtaagcc tttataaaaa
     1021 acctgggccg acggaccaac agtatgcacc tagcatgtac cattctccaa ctactaacct
     1081 agcttgtgct cctagtcctt ctcatatagt agcactgaga gcctaagaga ggatccacca
     1141 gtacagagta gattagaccc aagctccggt ggattatgta cattacagtc agtacttact
     1201 aggtattata tggtgtaggt gagagccaac acgcagagag caactcagga gcaacaatgt
     1261 attctctgat ctttattaac ccactgttga caaatgacaa taattgcaat gaatgattaa
     1321 caagtaatag tgataatcaa ggctgcaaaa ttgccttcag taaccagttc ttggtgcctt
     1381 ttttctgttg tgtaccactg cagcactgcc gccactgtat tgatctatga ttctatgcca
     1441 agtagttttg atcttagaag cttaaaacct aacatattta ctccgtatgg ataatttgca
     1501 attaatatat atccatagaa tagtgtacat gctggttgta tcataatcct ttggaccttt
     1561 attaaaatta ttgatgacta ataaaaaaaa ttatataaca tatatcttaa tgtagatagt
     1621 atacagagta cacggtatgt atatattaaa agtatttaaa aatgatatgt atttactatt
     1681 ctgtaatact agaaaggaat acagacttgt gatatctaac tatttagaaa acaattgttg
     1741 agttataagc ttctaaaatc tacaaacaca attttatata gacaaatcta gctgcattgt
     1801 gtggtgtgca gtgtgcgcga aaaaccaaag gcaaatttgc acacattaat actttgtact
     1861 gtctgccact ttcaaaacag ctctccgcat ccgtcgcgcc ggccctttcc cctcccaact
     1921 tgttaccaac cacttcccgt ggctctccgc ccgcaacaac acgcccccaa aattcataaa
     1981 ctcttgaact tcactgctgt catcttccgc attctcctat tgagccttgt gtcagcgttt
     2041 cgactatcta tactactacc tatactacta tcattcacta cctgttggcc ctctcattct
     2101 tggttacctt gggatggaag taaccagaca tgcctacttc tagaacccac ggtcattgct
     2161 atttgtgtac atgactactg cagtcctaat ctcaactcga aatttccaat tttggtctat
     2221 ctcctacatt caggtgctga ctggttattt tgtggtattt ggccaagctg catcttttgg
     2281 cagacttatt atttcacaca tggtgtgatc tcctgggagg tcattgatat acggacacag
     2341 ggttccgcac acagcagtgt gtgacttttc tcacgggtct ctactacttc attaccgcca
     2401 atgttatggc aacaatgcgc cctgtagcgc aacattaatg gtctctttcc cagtagtctg
     2461 gatagaatag agagaaaccg tgcagcatat tacttatcgt ccgatggcac actttgaaga
     2521 aaacatcgtc cgcgattcaa caccaaacac ccaccaaata gaaaccagaa gctctgagcc
     2581 atcccctaaa tacaagtgcg atgtccatcc tgcttttctg aaaacttcta actccgggcc
     2641 accttccaaa tcgtttcgca atgatacttc agtgctggcc cattcgtgtg ctcgattcaa
     2701 tcatcttcgc ggtttttcct caccatcaaa agtttccacg caatcagcct tgccgaaaat
     2761 acagcaacaa tttcgcattc tcccgggtga gccttcgcag gattctccgc tcctcacgca
     2821 accacgaggg gtagaatttc atcgcttggc agatgtgcct actttgacca cattttacga
     2881 caacattgat gatctgtcac atggagctga gggtcttacc aatcccaagc cgtacattat
     2941 gcctttacta cagaagacat cacaaaaaga tccaccaacc acagccctga gcttatcaca
     3001 ctcatcctta gagcatggcg gtttggggat catcgcgact tgcaagagag ggcgtcagag
     3061 tgacccagtg gtcaccgatt tagctagtcg gaagaacatc cctggtattc accaccgatc
     3121 aactagcggg acttcccaat tttcttctgc gagtagttcc agtgtgaaca agccaggttc
     3181 gcagaatatt cacctgatgc gtcaagcaac tcgctcctat actccaccac caagtcaatc
     3241 acaccaggct tcgttatttg agagcgatgc ctctggcaat agagactcag gtgaggggga
     3301 ccccctaggg tggtcaggct cagacacgtt ctatccgtct gtgcgtgcat cctcggggca
     3361 gacgccgcgt ttatcattac agacgcatga caactcattt actaggcttc ctgggatttc
     3421 ccagaccaat gtagccggtc gttcgtcttt cggttattca agggataacg gcagtacgtt
     3481 agatacagct tcacccatat ccaggtcatc cctggacttc gtgtttcgat ccagaacaaa
     3541 agctagtacg gatcctatct ctcgagcagc tacggtgcaa gctgcgcgtc aggcgttcga
     3601 agagaaagaa gcagccaaaa aacgaaaatt tgaggagcaa cagatgaaag cagaagaaaa
     3661 gcaaataaga cgcagagaga agcaccattg gcgagcctct ctgagagatg aggaaacgcc
     3721 gagcccggct tgggaaaagg tgccacagga cgcaccaaat ctaccttgtg gctccaatcc
     3781 tatctcatcc acaccacaac ccagctcaaa tccagggtcc tggaaatctc aacctaagaa
     3841 cacatgggtg cttttcttaa cgtggctacg aaccaggatt ttcaagttac gaaggaggat
     3901 aacaaattaa ggttgacgtt gtactgttat ggtgttatct agatagcgct atatactagg
     3961 atataggtcc tcccgatgtt tatcttttat tggatgtcaa atgagtgttc tattttcttt
     4021 tacactagat aattggatta ggacagagcg cggccggttt attaagggtg cagaaaataa
     4081 atcgttatca aacctgtcat cgctggtact atataccatc acgtgacaag ccagtggtgc
     4141 aatctgcgct gctgaccttt acctgagtaa aacaggctac ggtattccag acggctcaac
     4201 atacatagta ctgtaccatg aaaactacgg tgtacaagag cgacaaaaga cgcctttagt
     4261 ctcccatacc tcactccacg caacactctt ccctcggatt attacatctt gtaggtacaa
     4321 ggccgtcggg tttacacacc ctgcaggcgc acctccaact tggagggagc gcctccacga
     4381 acatctctca tcatggtata tgattgggat ggaaagcggg acatctgcta tcagatgtat
     4441 atcaaagaca aaaaggcctt ggaggaaatt atggaatata tgaaagatgt atatcaattc
     4501 gcacccaggt gagaaggcac catttccaca taagtactaa gatcgccata gcagcataca
     4561 cggttaaatt aaccagctac tgaattagta aacgtgcatt tcaaacacaa ttcaagcgat
     4621 ggggcttccc ttcaaagcaa aatccagcgc acaagaacct agaactcgtt gcacgcgtca
     4681 agcagctttg ggagcggaat actagccaac gagacatgct ccgaatattg aatgaagaag
     4741 gttttgagat caaagaaagg gagctcatgc gggtacgtgc taaaaatcgc tggttactcc
     4801 gcgttcccaa tgggatgaaa tcacagtcaa acatgcaaac atccgcacaa ccgccagagg
     4861 atgaaggctt gcttgcattg cagcaagaag tttacaagaa tgagggccca ttcaatgaca
     4921 ccgagactct ccttactgac acagcaagcc cacgcccccc gtcgcctggc ttatcgccag
     4981 aagttcttgc caaacgcaag gagcgactag aacgattgaa agcagaaagt gcagaacgct
     5041 gggctaccag aaagcgccgg cgccgtactc gaggatgggc agggctgcca gccgatcccc
     5101 cgggaccccc acgctttccc tcggaaacga ctattgatga gagtaaaaag cacttgaacc
     5161 tagataacgt catgtatcgc caaatcaggg atcagttcca gagaatctgc gaggatgcag
     5221 gcttcatcaa gaaaacagtt gccggacccg aaaaatggca ggaagctaaa aacaaattga
     5281 tacaagaatc gcaacatctt caacatgtat tctgggagga tcctaatcaa cttgatgcaa
     5341 aggcccttgc tcttgatgtt gtctgcacag atgtcactaa gaggatgcga accttggaga
     5401 ggcgaatgac cattgcggaa gctaaaaacg cccttggcgt caatccagag gaaagtcgcc
     5461 aaatacggaa tgcgttttac aatacactga aagcggatca tttcacaagc aagctagagg
     5521 ctggtgatga acactggacg aaattgaagg agcagtggat tcaaagctct gagctgctcc
     5581 aacaaatctt ggctcctggg ccaacggata cagaacacac taccaaatta aaagctctag
     5641 aggttctttg tcgtgatgtc atgaagcgac ttcgtgatga tcaaactaag agggacccag
     5701 cccctaaaca ctctaattcc caggaacata ctcaaagtcc tgactttgga agctcccata
     5761 tcagcagcgc ctttggtggt agtataacta acggaatcag cacacttgct tcacaggccc
     5821 ttgcaagtgc tccagtggct tctagcgatt taggtgactt gcagatagac ccctcactcc
     5881 tgcaggcagc taatgacccc tcgtttgcca cagccaacca tcaggactca gggcatacct
     5941 tcggatatgt ggaccccttg ttagagcctt ctgctatgca gattcctgtg tatcttcgca
     6001 ttcacgctca aagttcattg catggggatg cgaaaccctg gattgaaaag ctgacaacgc
     6061 gatctgttgc tgaactacgc caactagtca acaccagata tccggaaacc ttcattacaa
     6121 ggattgaggg cacagacaga gatgagaatg gacatgaaat atatttcctt atagatgagg
     6181 accgcgaatt tgacgcttac ttgactcaca tgcaagggag aaaggcttcg tttctgttta
     6241 gcctggaaca agtctgaaca gcctttgtgt cagatcttgg ggaccagtag tacattgttt
     6301 tgagagttta acttggtctt caggaaggcc aacgtggaat ctctgagtgt ttatatgtta
     6361 atttccactc gacggtggca gccgcttcga tggggtcttt attaatagga ataaggatga
     6421 tgtattacaa aataatatac ccattggcag tgtcaacagt gctaagctag gtaagacgga
     6481 agctccaacg atctatgatt ttactgcaat ctggtgtaat acatgtgcgt tatcgtagat
     6541 gggtctaaag gcataacgac taccttgttt acggacacaa cgacatcacc ttgaagagct
     6601 gtacgcctat ccctgggggc ttataggctc gcagggtagc acgtggtcac ggtgtataaa
     6661 cttactctgc atattcaagc gaagaaagag aacggaggta agaaaagcga aagaaatgaa
     6721 acaattatag gttatattag tttttgtacg gtcctttcaa cagtattatt atacatagca
     6781 taagatcctg gtgcttgcat tgttaacaag tataactaga tatattatac catttttatt
     6841 tgttcctaag gacacgctca gctaaaaaaa aagtgtggcc ttagattgtt cggttttata
     6901 tggaaaggtc gattcaatat ccaatgctca ccatcctgtt aatgactcag gccagtcaaa
     6961 aatgatatga tcacgaatga gccatcaaca caagacagac atatgttgat aatgtttggt
     7021 tctcatccct agaaagttat aattccccaa attcaaagta cttcccatgt aatcatagcc
     7081 gtggtactag atggccccat atatagcgca gctacaggca gtctgggatt ccgtggagct
     7141 tctctgcaag accccatagc tgtacagaac cgggaattat agaaacataa gtagcactta
     7201 acaaaccaac agggaacttc tcccctcccc ttgacattgt ataaagtggt ttaaggtagc
     7261 aaggtcactg acaatgcagg gtacacgcaa gagccggata gacactagtc aatatcgcaa
     7321 tgtatttccg aggagagata gcttctaaaa cctgaatgac taaccagaga gagcttgcac
     7381 aacatcctgg aacaaaacac tagcagaagg taaaacaaat ggagaaccat taaagatccc
     7441 agccagttct ttgctttgtg gaggtggtgc ttccaagctg tccataagtg tttgtgaagg
     7501 atgccggtat ctgctaccat acacactgtt tccaagtaac cctaccagtc cagaattgac
     7561 cttatccacc aagtcttggg acgggagggc ctgagacgtc ttcttgctgc aaccaagtct
     7621 ttgcacatct gctgccacat ccagcacaat ataatcacct gatcgtgaat caggcagcaa
     7681 ggcatagggg cttctcccta gaggcagctg gccaagcaag gataatgact gcatatcata
     7741 cacctgaaca aagtgcttgc gtcctttttt gggcgcagta ggactttgta gatgctgtac
     7801 agtgacagcg aaagtttgtg tatttggatc cactgctaaa agccggtatg ccttatcatt
     7861 atgggagtaa tccacttcca agttgtccgg tgtccttact atatcattaa ctgtatccca
     7921 aacagataca gactgtgttg aggcgataac aaggtggcac cctaggaacc ttgccacaca
     7981 tggatcccct ggatacaacc cagctctact gtaacggaca gtacaacttt ggacatcaac
     8041 aagaagggca atcccaggac tcccagggtg cactgattgt aggcatacag caagcacaga
     8101 accatcttgc gaaaatgcta gggaagccat gctcacactg tcaaagtttt cgccgctgat
     8161 gtaacctttc aaatcgacag tattccgaca tttccaagtc tcgagctgct cttcaccatg
     8221 ccccatcttc aatccactgc gctgtctact gcttgggcac cacaagcgta aaaccgcgtt
     8281 gcttccaatt gttgcaaatt catggctaac tggccgagat gcaagatcta agaccggaac
     8341 cgggcccttc attgaaaaat ggggcccgtc aatacgcgtc accagttccc acaagtcaga
     8401 cgacttgctc catttccaga acttcagaaa tatctcttga tagcctgcgg caatgctgcg
     8461 cataccagtc ccattgcaat caagagcctc aatatcatgg gggttggggc tccatatatc
     8521 aactgtagac atccacttcc catcaggaga gacacctagg tgagtgacat ttggtgctgc
     8581 aatctgtgaa ccttccggac tgattttcaa agttgtcgca ttactgcgcg cgagagcctg
     8641 acgagatata tgattattgg aatggatatc gtatgtctgg aggacacagg aatttgccgg
     8701 gcggtgacct tcatgggtga cttgacgtga ggctggcacg gctatcaaga gccgatcaca
     8761 atattgtggg tgaagtatgg ctgcagctgg tgtgggtcgt aggtataccc ctaccctagg
     8821 tttgtttatc tgtgagtacg actgcagacc agttatagta gcgaaaggtt gtagctctct
     8881 cgccgacaaa actatgatag agttatcagc tagcttgatg gcatacgagt tgccagttga
     8941 ggagaccact atgttgcaga ttggggaaga aaggtgtgga agaaattgct tccgacctgt
     9001 atccaattgc cataacacca taacagattc gtgacctcca gatataacat aattacctgc
     9061 ataaatgttt agccatttct cgcgaccata ctgcgataaa cataccatca attgaccagc
     9121 gtactacatt aacaaggtcc ctgtgccaat gcagccgtct aggagtcatg gtcttctcgc
     9181 ctctgcggtg ctcttcttta ccaacaaggt ttagaatgtc gtgatatatc aagatagacc
     9241 catccgaact gcctaaggcc aagtcaatgc tggttggacc cttcttgcta ttcacacttt
     9301 gtccttcaac ccgagacgat gtcgtagaac accgaatatc gacacaacta atgttgacag
     9361 gcaaagctac ctctttccag gtatattgca taagttccgg atcattttgg cctggacttt
     9421 ggtatccaat gagtacacgc tggccgctgt atgcaatgac agcttggcca tcagagatgc
     9481 actttatatg gtcaagccga gcgcttgttt cgaggatgac agtttcgtgg aggttcttct
     9541 catctaggtg agcgacaacg atctcccttt tcccagtttt gtgatctcgc agaatcagca
     9601 atgcaagatc ttctttacct ttattagcat aataggacgg gctagctgag ataattttgc
     9661 ggccaatggt ccaatgtgag acttgtttgc cagctagcca atcccacttg ctaacagaac
     9721 cagccgaggt aactatgtaa agatactcct gactggctga ggaaagactg tatccgatga
     9781 tgctctgatt tggcttcaac tgtagtgtcc gaaagagacg agaggttgcg acagaataaa
     9841 catgaacggc tgcctcaagc ccgacaaaaa ggtacctatt tgttggttta gaaaactata
     9901 cgatagtcat ttaaaggaga ggacataccc ctcatcgcgg gtaagtattg ggtctatgtt
     9961 ggtatactgt cccgcaactg gcgtagataa agaccaaggt tcaaggagtg caatctcgtt
    10021 ctggtcgatg ctatgcaatg acgagctatt tgcgacacgt actgcctgat ggttgtcatt
    10081 cttagctttt gggggattgg acattggtgg ccgcaagctt tgcttgattt catccttgtc
    10141 tcgggaagtg cgacgtcgct tgactcgctc tctctcggtg cgaatcaatt tgtcttgcgc
    10201 agcatcgctg gctcgggatc ttttggagag acacatcgaa gggttagaac cgtcagaacc
    10261 cgacattgtt cagaaaatcc cgagatgttg aatagtccgg tgacagtata tctagggaaa
    10321 gggattcatg atctcgtgtt ggttgtttga tagtactgta gtgctgaaag tgcttctaga
    10381 ggacgcgaga cttttttttt tttttggtac tatcctgcat catggagcgg ctgctactaa
    10441 ctagtctctt ctaggttaga ctagcttcct taagtggtaa caagtgggta cttccatact
    10501 ggaatctttt catccattga agaaagtctc agcactagtt ggatgattat cttgaatact
    10561 tccatccatc cttcaagtca atctttccgt aataataggg cacaacagat attacgcgcc
    10621 aactttacac ttaaccacag cgtacggcaa ctgttctctc ggcgtatcct gtttccctag
    10681 cagtctagtc acttcttata agtgaagcac aaccaaagat gattattcct gtccggtgtt
    10741 tttcatgtgg caaggtaagc atcatgccct ttgttagctt cttgctgcgg cttatatagg
    10801 ggtcgattag gtggttgggg atctttggga acgttatcta caattactgg acgagggtgt
    10861 tgcggatggg tatgcgatac actttccctc attatttgta gtatttgcgc ggtttctaat
    10921 cagtggttcc aagtgatgct atggatcaac ttggttgcaa gcggtattgc tgccgtagaa
    10981 tgatcatgac ccatgtggat ttgattgaga aacttcttcg gtaagtgcca accttgaatg
    11041 tgactgactg tctactgaac tatgtcgcct tgtaggtata acccaacaga aagagatcgt
    11101 gcaaaatctc aaatgtaact cgattgaacc ttcactggag ctgatttttc acatcaaatt
    11161 attttccgag atggtgatga cggatgctca acttctgaat ttattggctg tgtgagaaat
    11221 aggccaacac tgaatatccg tcgtctcggg ttttatgggg taattgggcg cattaactgc
    11281 tgctgtaatg ctcggttata tcaagcttgc agtatgctat tggcattctt tgaaagtggc
    11341 cgtccattcc cggtatcgac aactttgggg ctattgaaca ggtccccgat ttgcgaggca
    11401 agatacgctt ttgttacctt ttgaggatat ggaagtttta ggggaaattt gcttctgtct
    11461 tgcaagtctt agcctgtctt gagtgttcgt ctcacccttt tcttcctatc tcttctactt
    11521 ggtcttctag gtaggtgaac cacttaaata ctttttttaa atttatagta atagaagatt
    11581 ttaaatgaaa tctattacct attttaacaa tttttttaca atagttatct ttttataatg
    11641 tttttatata aatattcaat tttaatttta cactaatata aaatttcaga ttttagttat
    11701 attttttaaa gtaaaaaata ttattttttt aaatttattt tctagtatta taatttctag
    11761 ttatttttat ttattaataa atatttattc tattagctta gttaattatt ttttttaata
    11821 ttaaattatt attataatta tattttttat agaatttttt tattattagt atatttacta
    11881 gtaaaaatat agatactata ctttatatat aatcttttta aataataata attatttaaa
    11941 taaagtattt attatttcta atctattatt aaattataat ttttaaatta taagattttt
    12001 aatatattat tttatagcta tagtaatata tactatttta atgaaaactt aattaatttt
    12061 taatttttaa ttatttaatc taagtaagga tttaatattt tttttattat tttttaattt
    12121 ttatattttt ctaatatttg aataatataa agttatttat tatatatata gttattatta
    12181 aaatatatta tttaaaaata atagttatat attaattcta ttatagaata atgatattta
    12241 tattttttta gttaataata taatttttta tcttttttct tattttattt aactcaataa
    12301 atttaaattt tttataatat ttaaatctat ttatactata tagtttatat ataatcaaat
    12361 atttattata ttattaattt aattaataaa aatcttttag ttttataata gcttgaattt
    12421 aatttattat atttaatata gttttaatat taatattttt aattttaatt ataataatac
    12481 tatttttata gtatattaat gaatattata atttattaat ttatattctt attttatttt
    12541 aaaaattttc taatattttt agatatttta aaaaatcttt ttatattaaa attatagcta
    12601 atctattaaa tattatattt tttatttaaa gaattaattt taattaaaat ttaatttaat
    12661 taattaatat ttaaaataga tttattatat taaattaata ttattagaat tatttatttt
    12721 atagattagt atatattata tatatttttc aattaatttt ataatagctt tatattataa
    12781 tttattatta atctatttaa atttattaaa tttattaatt atataatcaa ttaatttatt
    12841 aattttattt ttattaaatt agctatatta ttattttgta gtattctata gattatttta
    12901 attttaatta atatatagct atattattta atttatataa attatataaa ttataaatta
    12961 atttaatata atttatttat tattatttag tttattttct ttatattatt ctattttctt
    13021 attaataaat ctatattaat attaaattat ataaatctag gtttattact agttttcttt
    13081 aaatctttat taattttaaa att
//