LOCUS       AP007167             1824958 bp    DNA     linear   PLN 16-DEC-2016
DEFINITION  Aspergillus oryzae RIB40 DNA, SC020.
ACCESSION   AP007167
VERSION     AP007167.1
DBLINK      BioProject:PRJNA20809
            BioSample:SAMD00067075
KEYWORDS    .
SOURCE      Aspergillus oryzae RIB40
  ORGANISM  Aspergillus oryzae RIB40
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Eurotiomycetes; Eurotiomycetidae; Eurotiales; Aspergillaceae;
            Aspergillus.
REFERENCE   1  (bases 1 to 1824958)
  AUTHORS   Sawano,T., Tanaka,T., Machida,M. and Yamada,O.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-JUN-2004) to the DDBJ/EMBL/GenBank databases.
            Contact:Toshihiko Sawano
            National Institute of Technology and Evaluation, Genome Analysis
            Center, Department Of Biotechnology; 2-49-10 Nishihara,
            Shibuya-ku, Tokyo 151-0066, Japan
REFERENCE   2
  AUTHORS   Machida,M., Asai,K., Sano,M., Tanaka,T., Kumagai,T., Terai,G.,
            Kusumoto,K., Arima,T., Akita,O., Kashiwagi,Y., Abe,K., Gomi,K.,
            Horiuchi,H., Kitamoto,K., Kobayashi,T., Takeuchi,M., Denning,D.W.,
            Galagan,J.E., Nierman,W.C., Yu,J., Archer,D.B., Bennett,J.W.,
            Bhatnagar,D., Cleveland,T.E., Fedorova,N.D., Gotoh,O.,
            Horikawa,H., Hosoyama,A., Ichinomiya,M., Igarashi,R., Iwashita,K.,
            Juvvadi,P.R., Kato,M., Kato,Y., Kin,T., Kokubun,A., Maeda,H.,
            Maeyama,N., Maruyama,J., Nagasaki,H., Nakajima,T., Oda,K.,
            Okada,K., Paulsen,I., Sakamoto,K., Sawano,T., Takahashi,M.,
            Takase,K., Terabayashi,Y., Wortman,J., Yamada,O., Yamagata,Y.,
            Anazawa,H., Hata,Y., Koide,Y., Komori,T., Koyama,Y., Minetoki,T.,
            Suharnan,S., Tanaka,A., Isono,K., Kuhara,S., Ogasawara,N. and
            Kikuchi,H.
  TITLE     Genome sequencing and analysis of Aspergillus oryzae
  JOURNAL   Nature 438, 1157-1161 (2005)
COMMENT     URL:http://www.bio.nite.go.jp/dogan/Top
FEATURES             Location/Qualifiers
     source          1..1824958
                     /db_xref="taxon:510516"
                     /mol_type="genomic DNA"
                     /note="SC020"
                     /note="phrap>=30:54-1824958"
                     /organism="Aspergillus oryzae RIB40"
                     /strain="RIB 40"
     CDS             join(2431..2484,2585..2677,2743..2954,3013..3078,
                     3126..3300)
                     /codon_start=1
                     /locus_tag="AO090020000001"
                     /note="predicted protein"
                     /old_locus_tag="AO070265000050"
                     /protein_id="BAE63251.1"
                     /transl_table=1
                     /translation="MLVPLQYFSPFELYSPAAINSTLDLCRNFCQTLFESRVHENEPT
                     DSVLRGEDIRFLYHIVSSSHEAKSSGDRNGLFVKRMLVTSGDVVQHTPESKRGRSFER
                     GITRFCCSGLLGTLRHISQAIFNQAEQQTSQLRHSLRGELRNCYFSRRKASSKHFRFR
                     SGIPSAQLQYELVVQFVYYLDENPLFWTDIFDQHRHDSD"
     exon            2431..2484
                     /number=1
     exon            2585..2677
                     /number=2
     exon            2743..2954
                     /number=3
     exon            3013..3078
                     /number=4
     exon            3126..3300
                     /number=5
     CDS             complement(join(4360..4534,4588..5591,5642..5795,
                     5859..6271))
                     /codon_start=1
                     /locus_tag="AO090020000002"
                     /note="predicted protein"
                     /old_locus_tag="AO070265000049"
                     /protein_id="BAE63252.1"
                     /transl_table=1
                     /translation="MVLSLENLPEEILHTILCYSHPCSAAALQQTAHRFEHATNEPLL
                     WRFYCQVHFKYWDSKHDILQKLSAPACAVNWKALYVTRHLTECTASYLLDSILAGQTG
                     RIEKFHALINLGYDVKDTLIRNISPELETDDHLARRYYGKVLLTCLHRSIALPVWAKL
                     RNGGNVTLERALGAFDLFIPESGYGSLDEITNKLDEIVGRLSSLYPSIHMSTPREKAR
                     TIAVYLKSNNLTGIQPDREYHCIEHNFLGVALNDPNHNSLPLVSAAIYCYVAQRLGLN
                     ARPCGFPFHVHVIVKPPPGLDINGNMLAPGVCGDPIYMDPFRSDRETPVTNLQSQLNY
                     LGASTVEQSTFLGESRTSEIVLRCSKNILNSVQRMSQYPDVHLEPVDTVSAKYAALWS
                     TMLLSDPSRPAEFRHHLPWLMELFATEFPSDIYLVEQYVVPMFRGLLEYEHILESLHV
                     MRAVDEIPKQVKRRYSGRCDVKYRIGQVFRHRRYNYIAIITGWDTECDAGEQWMRRMG
                     IDRLQGGRHQSFYHVIVQDRSVRYVAEENIELLAPNITELPTTLTAIAGRHFKRWDEE
                     TRTFVSNIKDEYPDD"
     exon            complement(4360..4534)
                     /number=1
     exon            complement(4588..5591)
                     /number=2
     exon            complement(5642..5795)
                     /number=3
     exon            complement(5859..6271)
                     /number=4
     CDS             join(6745..6866,6950..8450)
                     /codon_start=1
                     /locus_tag="AO090020000003"
                     /note="molecular chaperone (DnaJ superfamily)"
                     /old_locus_tag="AO070265000048"
                     /protein_id="BAE63253.1"
                     /transl_table=1
                     /translation="MGQTHSSNSHEGAGSDVNQPEEKKVDYYELLQVERNASGEERAL
                     ELHPDRNYGNVEAATRLFAEIQTAYEVLSDAQERAWYDSHRDVFLGNDGKPEGADYSY
                     DTRMTTSDEILKLFSKFSPRMEFTDAPTGFYGALRETFAQLALEETMACRWENVACVK
                     YPTFGNCNADPEEVVRPFYAAWGSFATKKSFAWKNVYRYSEAPDRRVRRLMEKENKRL
                     REDAIREFNEAVRSLVAFVKKRDPRYKSNTQSESQRQEFLRQSAAAQATRSRAANQAK
                     LRDHVMQDWAKAETLGDESSDTSEDEVEYFECVVCHKTFKSHNQFEVHERSKKHIKAV
                     KQLRWEMRAQNEELGLKGNVSDPEEPHWENSAYSIPQDGPVHNMESSVQQPRDGETRN
                     GIGTDKYTSSDTRVDTKPDEGSLPHTDCHRDSIPDLSEADYVPRECVERRLGSQPTLI
                     QRTGEMESPDNLSQRFSATEIEDSQTSPPKVGKAKQKRAKKAQRAMNQLQHIKCATCY
                     AIFPSRSQLFIHIHEFDHAQPSNMGDVQRRGQ"
     exon            6745..6866
                     /number=1
     exon            6950..8450
                     /number=2
     CDS             complement(join(8685..9141,9202..10664))
                     /codon_start=1
                     /locus_tag="AO090020000004"
                     /note="predicted protein"
                     /old_locus_tag="AO070265000047"
                     /protein_id="BAE63254.1"
                     /transl_table=1
                     /translation="MQQEARNTEGRNLWRTGSNLRHQGVRFVSASNPQRDENNEGEAR
                     EEDALRPEENNKQPLIGGVESKEDAQELKNESATCNASFFIDLSGESAGHTGLADPIT
                     ALSLSERDSSSEDEIVFHGRRRLEERPRIIVEGHAMKADKTNHHSPKELESPHEARLP
                     APDYRVCPVSDGTSTYELPQRTPPIAESIEQTKTVMPCTEKVTQEASEIEDDDILADY
                     IANMAEHYCADIQSSLAGAIMHEPEHGAEMQPQNYTAHAAIHDSIRRPGKGKYSRRDI
                     LSECKRKMITPSELMLKLVDDESGVDVTNGAVSLYPLDDAASASNHVPHSPQASDSDE
                     GNNLDTDLDVEGHRALECEVQGHPAISQQNHKNPQYDIFVSATAFADALEIDPYYGLD
                     IMDFNRPSLRKKQRGKHRNPDLVLSDSELELELENAWRNDREKKKGRKQKREELRTQG
                     LLGRGAHDPDLRSKYTNGMGFNDLKMEIRIFLLSSRTSLALPPMTKHRRKLIHDLANA
                     LSLNSQSRGKGSSRFPILHKTSRTPRYTQKTISYIDQIFSKGRFNHGATKSWDQNITK
                     SAKPPRGRPDSSVSYMDGDIVGASAPEIGAENKGRAILERMGWSTGTALGATNNKGIL
                     LPVAHVVKNSKAGLG"
     exon            complement(8685..9141)
                     /number=1
     exon            complement(9202..10664)
                     /number=2
     CDS             join(11876..12032,12242..12400,12496..12664,12719..12946,
                     13017..13374)
                     /codon_start=1
                     /locus_tag="AO090020000005"
                     /note="cysteine protease required for autophagy -
                     Apg4p/Aut2p"
                     /old_locus_tag="AO070265000046"
                     /protein_id="BAE63255.1"
                     /transl_table=1
                     /translation="MNSVDIGRCRKRIVQYIWDPEPRNDEEPDASIWCLGVEYAPQPQ
                     KITANTTPDNDEANHPMTLTVRIRTQLMDPQGFTSDTGWGCMIRSGQSLLANAMLTLC
                     LGRDWRRGDKAEEEARLLSLFADHPDAPLSIHRFVKYGAESCGKHPGEWFGPSATARC
                     IEALSAQCGNIAPRVYVTNDTSDVYEDSFLRVARSGSGSIQPTLILLGTRLGIDNVTP
                     VYWDGLKAVLQLPQSVGIAGGRPSASHYFIGTQGPHFFYLDPHTTRPAVPYSIDGRLL
                     SKTEISTYHTRRLRRIHIQDMDPSMLIGFLVRNEDDWEDWKGRVGSVVGKQIIHVFKG
                     EEATYNQGRRGALDEVEALDDA"
     exon            11876..12032
                     /number=1
     exon            12242..12400
                     /number=2
     exon            12496..12664
                     /number=3
     exon            12719..12946
                     /number=4
     exon            13017..13374
                     /number=5
     CDS             complement(join(13711..13801,13850..13937,13989..14289))
                     /codon_start=1
                     /locus_tag="AO090020000006"
                     /note="histone H2B"
                     /old_locus_tag="AO070265000045"
                     /protein_id="BAE63256.1"
                     /transl_table=1
                     /translation="MAPKAAEKKPSTGGKAPAGGKAPAEKKEAGKKTAAAASGDKKKR
                     GKTRKETYSSYIYKGVWQRYPSSESRKLTINLVLKQVHPDTGISTRAMSILNSFVNDI
                     FERVATEASKLAAYNKKSTISSREIQTSVRLILPGELAKHAVSEGTKAVTKYSSSAK"
     exon            complement(13711..13801)
                     /number=1
     exon            complement(13850..13937)
                     /number=2
     exon            complement(13989..14289)
                     /number=3
     CDS             join(14951..15003,15059..15147,15199..15402,15457..15512)
                     /codon_start=1
                     /locus_tag="AO090020000007"
                     /note="histone 2A"
                     /old_locus_tag="AO070265000044"
                     /protein_id="BAE63257.1"
                     /transl_table=1
                     /translation="MTGGKSGGKASGSKNAQSRSSKAGLAFPVGRVHRLLRKGNYAQR
                     VGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGHV
                     TIAQGGVLPNIHQNLLPKKTPKSGKGPSQEL"
     exon            14951..15003
                     /number=1
     exon            15059..15147
                     /number=2
     exon            15199..15402
                     /number=3
     exon            15457..15512
                     /number=4
     CDS             join(17011..17189,17257..17315,17366..17437,17487..17542,
                     17606..17938,18016..18408,18469..18528,18585..18639,
                     18686..18753,18811..18882,18946..18990)
                     /codon_start=1
                     /locus_tag="AO090020000008"
                     /note="dihydrolipoamide succinyltransferase
                     (2-oxoglutarate dehydrogenase, E2 subunit)"
                     /old_locus_tag="AO070265000043"
                     /protein_id="BAE63258.1"
                     /transl_table=1
                     /translation="MAFRLPFHRLPEQNLRVIPRYAQSPRNISLGTRRNLTSAALRSC
                     VRNTKRPASCIPQVLGANVFRSSFAPLGGYQVRTYADTIVKVPQMAESITEGTLKQFS
                     KQVGDYVERDEEIATIETDKIDVSVNAPEAGTIKELLVNEEDTVTVGQELAKLELGGA
                     PETKTEEATEKPKEPASTEEPKAPEPEQPKSAKDSEKPAASEPGSSKQPQPAASKPDI
                     PDDAKPSPGNREERRVKMNRMRLRIAERLKQSQNTAASLTTFNEVDMSSLMEFRKLYK
                     DDVLKKTGVKLGFMSAFSRACVLAMKDIPAVNASIEGPNGGDTIVYRDYVDISVAVAT
                     EKGLVTPVVRNAETMDLVGIEKAIADLGKKARDNKLTIEDMAGGSFTISNGGVFGSLM
                     GTPIINLPQTAVLGLHAIKEKPVAVNGKIEIRPMMYLALTYDHRLLDGREAVTFLVKV
                     KEYIEDPRRMLLG"
     exon            17011..17189
                     /number=1
     exon            17257..17315
                     /number=2
     exon            17366..17437
                     /number=3
     exon            17487..17542
                     /number=4
     exon            17606..17938
                     /number=5
     exon            18016..18408
                     /number=6
     exon            18469..18528
                     /number=7
     exon            18585..18639
                     /number=8
     exon            18686..18753
                     /number=9
     exon            18811..18882
                     /number=10
     exon            18946..18990
                     /number=11
     CDS             join(20634..20735,20939..21556)
                     /codon_start=1
                     /locus_tag="AO090020000009"
                     /note="protein-L-isoaspartate(D-aspartate)
                     O-methyltransferase"
                     /old_locus_tag="AO070265000042"
                     /protein_id="BAE63259.1"
                     /transl_table=1
                     /translation="MAWYCSGSTNAELVDNLFKAGLVKNERVKNAMLGVDRAHYAPSR
                     PYSDSPQPIGYGATISAPHMHVHACEYLIDFLRPGSRVLDIGSGSGYLTHVLANLVTD
                     PSIPDELDGHVIGIDHIPELVDLANKNMHKSDQGCKLLDTGKVKFITADGRLGWPEGA
                     PYDAIHVGAAAEKLHPVLIAQLHAPGRMFIPVDTECDGSPHGFGGGQYIWVVDKREDG
                     SVHKEKVFQVSYVPLTDPPKK"
     exon            20634..20735
                     /number=1
     exon            20939..21556
                     /number=2
     CDS             complement(join(21793..22383,22449..23429))
                     /codon_start=1
                     /locus_tag="AO090020000010"
                     /note="dsRNA-activated protein kinase inhibitor P58,
                     contains TPR and DnaJ domains"
                     /old_locus_tag="AO070265000041"
                     /protein_id="BAE63260.1"
                     /transl_table=1
                     /translation="MILLSLESLTVFLAVSSASYGLQPSQISSDTPLSSLIASAKTHL
                     AGGSPRDALLYFDAAVSRDPTNYITVFQRGAAYLSLGKNSQASDDFDRVLQLKPDFES
                     ALLQRARLRANTADWEGALKDLEKAGKKSSLEYNEIQEARDAAALAQNAEKHGDWEAC
                     VNQANVAVLKASASLSLRQTRAHCRFERGDVEEGINDLAHVLHISPSLVGPHLQMSYM
                     LFYSLGDQERGISQIRRCLHFDPDSKPCNALYRKEKKFLKQLRKLQDTMSSRKFSNAI
                     NLLVGVGDESGLLDDLKGEVREAKEAGHIHPAAPNNLYSSLVERTCEAYREAHMPKRA
                     SPYCSETLDMNPYSLPALLFQSQLALDEERFNDAINTLNTAKEHHPGSRDVQSLLQKA
                     HVLLKRSKQRDYYKVLGVSRDADDRTIKRAYRQLTKQHHPDKAKSQGVTKEEAEKKMA
                     AINEAYEILSDPELKARYDSGDDPNDPESHRGNPFQGNPFGPGGGQHFFFQQGGPQFK
                     FSGQGFNFPGGFPFR"
     exon            complement(21793..22383)
                     /number=1
     exon            complement(22449..23429)
                     /number=2
     CDS             join(24057..24123,24543..24631,24708..25718)
                     /codon_start=1
                     /locus_tag="AO090020000011"
                     /note="mitochondrial polypeptide chain release factor"
                     /old_locus_tag="AO070265000040"
                     /protein_id="BAE63261.1"
                     /transl_table=1
                     /translation="MQHPTLTSDPFFHLFHRFFITVSSSFDGRIAKRVGELAPIANVL
                     DEWDRANESISELNALLFDPDTDLELKSLAIEDLETVKAALPTISENLKKALVPRHPF
                     AALPCLLEIRPGAGGDEAGLFAFELLRMYTAFCSRRGFRSNVIKLEVGDGPAEDRLNE
                     AVMEVEADGAYEILRTESGVHRVQRVPATETKGRTHTSAVSVMVLPSFPETGGAMDNA
                     LNFDDPNSDYYVDPQEVRSEKMRAGGAGGQHVNKTESAIRLTHMPTGIVVSMQDSRSQ
                     HANRKKAWQILRARLAEARQEAREQKFVELRRGVLGGVARMGRGDKIRTYNYGQSRCT
                     DHRSSITIHNLNDVLDGGEGLETVMESVRSWLIDQEVAALVADELAKDKEASRP"
     exon            24057..24123
                     /number=1
     exon            24543..24631
                     /number=2
     exon            24708..25718
                     /number=3
     CDS             complement(join(25925..25982,26047..26196,26255..26290,
                     26376..26633,26725..26872,26932..27135,27201..27276,
                     28582..28602))
                     /codon_start=1
                     /locus_tag="AO090020000012"
                     /note="mitochondrial tricarboxylate/dicarboxylate carrier
                     proteins"
                     /old_locus_tag="AO070265000039"
                     /protein_id="BAE63262.1"
                     /transl_table=1
                     /translation="MITVTTSNTNTRNQPSSLRSIIAGSTAGAIEIAITYPAECMVYA
                     LGCFKSAYSTCPVAKTRSQLNRKLPDGKKLPWPPFGKQWYAGCTTLIIGNSLKAGIRF
                     VAFDRFKSLLQDENGKISGPRTVIAGFGAGFTESLLAVTPFESIKTQLIDDRKSANPR
                     MRGFLHGSKLIFQERGIRGFFQGFVPTTARQAANSATRFSSYTMLKQLAESYVAPGEK
                     LGTASTFAIGGMAGFITVYVTQPLDTVKTRMQSLEASKNYKNSFVCASRIFKDEGLFT
                     FWSGAVPRLARLILSGGIVFTMYEKTMDALDSLDSKRQYI"
     exon            complement(25925..25982)
                     /number=1
     exon            complement(26047..26196)
                     /number=2
     exon            complement(26255..26290)
                     /number=3
     exon            complement(26376..26633)
                     /number=4
     exon            complement(26725..26872)
                     /number=5
     exon            complement(26932..27135)
                     /number=6
     exon            complement(27201..27276)
                     /number=7
     exon            complement(28582..28602)
                     /number=8
     CDS             complement(join(28832..29653,29706..30302,30357..30429,
                     30492..30535))
                     /codon_start=1
                     /locus_tag="AO090020000013"
                     /note="ATP-dependent RNA helicase"
                     /old_locus_tag="AO070265000038"
                     /protein_id="BAE63263.1"
                     /transl_table=1
                     /translation="MAEALASQLNNTTLGEASSDTRWKDQLKAPAKDARPQTEDVTAT
                     KGLEFEDFYIKRELMMGIFEAGFEKPSPIQEETIPVALTGRDILARAKNGTGKTAAFV
                     IPTLERINPKSTKTQALILVPTRELALQTSHVCKTLGKHLGINVMVTTGGTGLMDDII
                     RLNDAVHILVGTPGRVLDLASKGVADLSECPTFVMDEADKLLSPEFTPVIEQLLSFHP
                     KDRQVMLFSATFPLIVKSFKDKHMRNPYEINLMDELTLRGITQYYAFVEEKQKVHCLN
                     TLFSKLQINQSIIFCNSTNRVELLAKKITELGYSCFYSHARMLQQHRNRVFHDFRNGV
                     CRNLVCSDLLTRGIDIQAVNVVINFDFPKNAETYLHRIGRSGRFGHLGLAINLINWDD
                     RFNLYKIEQELGTEIQPIPQNIDKKLYVYESPETIPRPIANASQAQLATSGNQTQNMG
                     ERRHNNHSNGGHYQFGRGRGSYRGGRSQGQRRNMQNEMNKFGTSQNQQQSGKSQPAQV
                     SPN"
     exon            complement(28832..29653)
                     /number=1
     exon            complement(29706..30302)
                     /number=2
     exon            complement(30357..30429)
                     /number=3
     exon            complement(30492..30535)
                     /number=4
     CDS             complement(join(32309..32357,32410..32507,32578..32626,
                     32679..32818,32874..33032,33113..33215,33268..33924,
                     33980..34282,34304..34377,34450..35013,35064..35291,
                     35310..35865,35896..36326,36378..36476))
                     /codon_start=1
                     /locus_tag="AO090020000014"
                     /note="DNA repair protein RAD18 (SMC family protein)"
                     /old_locus_tag="AO070265000037"
                     /protein_id="BAE63264.1"
                     /transl_table=1
                     /translation="MSSLKRPQRPLEQGEWDEGDDNRLSSSSSACHLRKRIRTSKSPA
                     SYEGTGVSDSESEGRIHHSITQALEYDEDELELRATQLIQEKYSFAGDEPNVPAEHGI
                     LERVECYNFMCHDHFYVELGPLINFIVGKNGSGKSAVLTAITLCLGGKASATNRGQSL
                     KSFIKEGKEYVRLSLYWSATIVVRIKNQGDGAYMPDDYGKSIVIERHFTKAGTSGFKI
                     KAENGRIVSTKKAELDAIIDFFTLQFDNPMNVLSQDMARQFLSSSSPAEKYKFFVKGV
                     QLEQLDQDYRLIEESADQIEEKLRGREQDIMILKHRKVAANQKLDMSDQHESLRNRVR
                     NVRSQMAWAQVEEQERVRSPDIMGLQAGMRSSLEIELAKVDEKIATAEAGLGSFDAAI
                     RVAEEETEAAAECVRQGTTKLEQAQSEKVEITARWDEQMTERHDLQAQQRQIRDYLKA
                     AEARINETQQKIEEENQRLVNLSGGSYTRKQEQLERAKVEAAHASTQYVEHQRNADRL
                     YRDLEVAGKEVESLAVPLNRTKADVEQAEKLLWSLSKEGGPKNTGFHDKMPSLLRTIQ
                     QEEGFTEKPVGPIGRHVTLLKPEWSSILENSFGTTLNSFVVTSKRDMEILSRIMRNVN
                     WYEMMGILIHQNTSLIISLIRLYGCFRASYIRLIYSNLQIDNELVRRQLIINHGIEQM
                     LLIEKLEEASSVLFDGQKPRNVKRCYCIDQTDRRRGIHLSYNRAGEPSQAPVPAYSGS
                     PRMKSDLASQIRVQRDVVADLRRKLSDQEERFRSARSRLEGCKQARVRHGKSTNELRV
                     ILQRKEDHVEELTDVLDKERVEDDHLDVLRATLQEAEEEKRINEGSLKDSMEAMEAMM
                     KGLKAIKQQLASKDADIAASTEELHITQSEVLRAQDKRRKIINDKNIAVERLDDIRRE
                     KERINEKREEVSARVIDFSEKASLVSPRVPIPEGETAASLDKKLDRLNRDIQRYNQQL
                     GASRDEIAAEAAKASAAYDRALKQVEEFRLLAGILIETLKHRKKRWVIFRSHISSRAK
                     AQFTYLLSERSFRGRLLTDHESKLLDLQVEPDITKDSTGRGAKTLSGGEKSFSQVCLL
                     LALWEAMGSPVRCLDEFDVYMDHINRKMAIDMLMLAARRSVGVQFILITPGSRAEISL
                     APDVRVKDAFPLDWQNLNEDKRD"
     exon            complement(32309..32357)
                     /number=1
     exon            complement(32410..32507)
                     /number=2
     exon            complement(32578..32626)
                     /number=3
     exon            complement(32679..32818)
                     /number=4
     exon            complement(32874..33032)
                     /number=5
     exon            complement(33113..33215)
                     /number=6
     exon            complement(33268..33924)
                     /number=7
     exon            complement(33980..34282)
                     /number=8
     exon            complement(34304..34377)
                     /number=9
     exon            complement(34450..35013)
                     /number=10
     exon            complement(35064..35291)
                     /number=11
     exon            complement(35310..35865)
                     /number=12
     exon            complement(35896..36326)
                     /number=13
     exon            complement(36378..36476)
                     /number=14
     CDS             complement(join(37316..37502,37559..38676,38737..38804,
                     38862..38893,39014..39045))
                     /codon_start=1
                     /locus_tag="AO090020000015"
                     /note="metalloexopeptidases"
                     /old_locus_tag="AO070265000036"
                     /protein_id="BAE63265.1"
                     /transl_table=1
                     /translation="MAPQLEPFFKQVDGLAESFIERLRKAVAIPSVSAQDENRKDVFR
                     MAQFLASELEALGAEVHQRPLGKQPGKEHLDLPPVVIARYGNDKNKRTILVYGHYDVQ
                     PALKEDGWATEPFQLTVDNQGRMYGRGSTDDKGPVLGWLNVIEAHRKAGVELPVNLLC
                     CFEGMEEYGSEGLEEFIQAESKGFFKDADAVCISDNYWLGTEKPCLTYGLRGCNYYSV
                     GVTGPAQDLHSGVFGGSAHEPMTDLVHVMSKLVDTHGNILIPGIMDLVEPLTEEEKAL
                     YPNISYTMDDLHQSLGSKTSIHPTKERTLMARWRYPSLSLHGIEGAYSAPGAKTVIPA
                     KVIGKFSIRTVPNMESEDVNKLVFDYIKAEFAKLNSKNTLDVWLQHDGKWWVASPKHW
                     NFTAAGKAVKQVFGVEPDMTREGGSIPVTLSFEQATGKNVLLLPMGSSTDAAHSINEK
                     LDKRNYIEGVKLLGAYLHYVAEEPMVAA"
     exon            complement(37316..37502)
                     /number=1
     exon            complement(37559..38676)
                     /number=2
     exon            complement(38737..38804)
                     /number=3
     exon            complement(38862..38893)
                     /number=4
     exon            complement(39014..39045)
                     /number=5
     CDS             complement(39601..40203)
                     /codon_start=1
                     /locus_tag="AO090020000016"
                     /note="predicted protein"
                     /old_locus_tag="AO070265000035"
                     /protein_id="BAE63266.1"
                     /transl_table=1
                     /translation="MATCLTAPKRPFLALPSFVPSSCPSITLQTRRHQSSYRRTKQRL
                     RVKPDASFGVSSTQFHDQIIHNPPSSAPSVYHTPTKFLPLDDVRRTLRGASMNNGNSA
                     QLPSVFKTSVEKRYHLNPSDIEEIRRLRLSDPMTWSRWKLAKRFDCSPMFIAMVCEAG
                     PQKKEIQKQVLEAVQSRWGTKRRMAREDRQLRKESWGRDE"
     exon            complement(39601..40203)
                     /number=1
     CDS             complement(join(42511..42630,42701..42743,42804..42987,
                     43044..44280))
                     /codon_start=1
                     /locus_tag="AO090020000019"
                     /note="cystathionine beta-lyases/cystathionine
                     gamma-synthases"
                     /old_locus_tag="AO070265000032"
                     /protein_id="BAE63267.1"
                     /transl_table=1
                     /translation="MLFPSAKTAHICRSFILSKSSADDSHSVRVVDFVPSPRTKAESA
                     NITSFLSSVIYPKELGSIAKQVWQHTGNGVSSRRGEFCHSALRDGFLVEKQSTMTETV
                     AQRICKGPRRYQGKDTVNGSFRAGGIHPSPTDSPMVTDGVRDGREHIQFIEERFGRNL
                     NTSLADQAKRAVRRRIAGVLKADVELIEALKKTSGEGRVAGLTESDVFLFPTGMSSIF
                     NSHQMLLAARGAMKSICFGFPYIDTLKTLEKWGPGCLFYGNGSSEDIDDLEARLDSGE
                     KFLAVFTEFPGNPLLKSPDLKRIRSLSDKYDFAVVVDETVGNFLNINVLPYADIVVSS
                     LTKIFSGDSNVMGGSAVLNPHGRYYSSLKDTFARDYEDNLWAEDAIFLERNSRDFVSR
                     IEKINSTTEEITEMLKGSSLVKNVFYPKCNPSRPLYEAFRHSNGGYGGLFSVTFYSTA
                     QAVAFFDHLEVLKGPSLGTNFTLSSPYTLLAHYGELGWASSFGVEFDLVRISVGLEDV
                     SDLRYRFQRALEAVAKVKT"
     exon            complement(42511..42630)
                     /number=1
     exon            complement(42701..42743)
                     /number=2
     exon            complement(42804..42987)
                     /number=3
     exon            complement(43044..44280)
                     /number=4
     CDS             45860..49192
                     /codon_start=1
                     /locus_tag="AO090020000020"
                     /note="nucleolar RNA-associated protein (NRAP)"
                     /old_locus_tag="AO070265000031"
                     /protein_id="BAE63268.1"
                     /transl_table=1
                     /translation="MSAHTAKRRKLSPSPQITQRAGQSNASNLNGLLKMARNESSSMD
                     GLIRRKKSDRSAELALASGVYKSNLFKLQLDELLTESRPNYDKHVSKLQDTLHRLKEV
                     IDNIPERPPKPAVEAEKEFRSTHGILVPYPEPRPGKDTKYTVSYSKPTNVNVVGSFVL
                     RTGVRASEPYTVDLAVTMPSSVFQEKDYVNYRFFHKRAYYIACLAAGIKDVENLDFDI
                     KFAQQDGDSLRPLILLEPTDSAKNGSQSMRSQIRIFTAIEDTLFPIVRTLPMKNNVRQ
                     GSPDQPEPRAPTPFYNAALRSEATVAPFHKLLHSTAQICDSFRDACILGRIWLRQRGF
                     GSSFQQGGFGGFEWTVLMSLLFEGGGFNGKPILLKSYSSYQLFKGTIQFLAGRNLLTP
                     LLLFASDISSPTGTPMVYDGKRGLNILYKMSPWSYSLLRHEANITLRILNESRDDNFD
                     KVFIYKVNEPMLRFDRLITLPISESGTVLRTIHNHNAIYEVLKKALGDRVNLIYLFSH
                     GAEPWSVERKFSRKAASAAIHVGLNLNPENAMRVVDHGPFAEQKEEAETFRSFWGEKA
                     ELRRFRDGTIRESLVWSDQPPSPSIVYQLLVYILRRHFNYEEDEIGYIGDEFDEKLRN
                     SGNGIFLYSNPAFQLVTDAFNSLERSFQRMDEVPLTVRQLALASPLSRYSALRVQSAS
                     GLIRDPVDIVLQFESSSRWPDDLVAIQMTKVAFLIKIGDSLVSSAAASSCKVGLENES
                     NRTLNNAFLDISHTSGVIFRLRIHHDREQLLLERQLKEKGASLQVKQEAAYTLSAYKR
                     LFIQSPRLTQAIRTLCTRFPLLSPTIRLVKHWFNCHLFTGHVNEEVIELVVARVFTQP
                     YPWDTPSSVMVGFLRTLHFLSRWDWQQDPLIVDLCGELDQDTIKAVRTRFSGWRSIDP
                     AMNTVALFVASDIDPDGVTWTHYEMPPKVVAARMSMLAKGAVKLVRENGPTLDVSDLF
                     HTSLAPYDFIINLRLKSLHDRPTSLLKYKNLNELDNKAQTAQLKVVKSFVRDLQACFS
                     PNILFFHGDEHCDVLAGLWNPQTTKPKNWSLKLTYSSSPSILDGTKKEDGEVMINRDA
                     ILNEISRLGHGLVDSIEVFGTE"
     exon            45860..49192
                     /number=1
     CDS             complement(join(49397..49595,49659..52634,52687..52835,
                     52888..53328))
                     /codon_start=1
                     /locus_tag="AO090020000021"
                     /note="predicted protein"
                     /old_locus_tag="AO070265000030"
                     /protein_id="BAE63269.1"
                     /transl_table=1
                     /translation="MNDTPRLRSAFPQTPQTSQKSRAFYTSPSRSKQRDAGLRQSPSE
                     ALPTARDASLPLIPVELIDAPSQRLYIVAFYVALNAWRLYESWKASDDLDATWLFLKW
                     ACIDGVFLFGLQALRIPWLEWAFPTTLAIFLIHVVGNVFLMFRIPIPVGAWVSGIVKL
                     AYDRELSISERSVKPGDIIHNASLILGKQIVHILPEGSAVLNPDQTPLCIDSEKTTIN
                     LPIRINQTDPILIELFRLDFTSGGNETITISSKQLKQMKRQAGKKNQGSGTDLHLDLL
                     LPIRRPGIYRLQRVVDESNLDVRMRRSDALVVSCPRASIKSSHTHKCRGELSNLVLTV
                     EGTPPLKIKYSRQVNRRDRGFSFQNIQPDYLRSPLLGQRNIGTLFNSQEPDVAWAQSQ
                     NIEVPLNESLNIGGEWLYAIEEVHDGCGNVANYTAFFNEVDRLPTKFLSQWHQFSVHE
                     RPRLSLSGCNDQHFIEVARGDSVDLPVKFHQSGQGYDKDGPFSIVYSFNNNQETAGNM
                     PGRVRELSLKNLGQKPQIKDPGWYVLDAISSQFCSGEILEPSSCYLHNPPEPELAVRY
                     EKIFDKCANNPVGLLVDLDFTGSPPFRLRYVVEHSKGIETKTQLIEGLRTQLDLTPSE
                     AGLYRYRFLDIADTVYAPRPLKDKAPVLEQHVKPPASAHFLGPREVRKACFGEPVSVD
                     VALLGEAPWTLQYELVHNGKKTKYVLETENEVSSIVTEKLVSGGEYNLVLTSVKDRSN
                     CKRILKDSIQIDARPKPPHVSFGEIEKSRKYSALQGSKVDIPLRLSGERPWTLKYKTS
                     HDSLVVEKTLWQENSALTVGHEGRYELLEVTDASCPGSVDQAAKIFEVSWIPRPRITA
                     VDGSPVRAGGHKEKRDVCQGENDNLELRLSGSPPYSIKYEQQRKTTRGSPSVRLQNLR
                     TVLHAASMEMDTSEAGLYTYTFTEIGDNLYDHDPRSNPVVVTQKVNPLPSARFDAPGR
                     IYGFCKEDVSGEELIPITLDGVPPFSLEISIKHHSKAKPELVSISNIVSNRHMLPIPR
                     RHLDLGQHVVSIHKVRDARGCQRATENDASSVRVAVSDVPTVIPLESKADYCVGERLS
                     FSLSGHAPFEVFYTFDGVARKATSRTTNFRRIAERPGVFTITAVSDGASGKCKAHKNV
                     TKTIHEMPSVRISRGQTSVVDIHEGGEAELHFEFWGTPPFEFTYIRSSIARRGKRAEI
                     LDIKHDISYEHFKTIKTSDEGTYEVVAIKDKFCSVSSQTHLEKSEKPTVP"
     exon            complement(49397..49595)
                     /number=1
     exon            complement(49659..52634)
                     /number=2
     exon            complement(52687..52835)
                     /number=3
     exon            complement(52888..53328)
                     /number=4
     CDS             join(54217..54394,54735..54927,54997..55181,55238..55791)
                     /codon_start=1
                     /locus_tag="AO090020000022"
                     /note="ubiquitin C-terminal hydrolase"
                     /old_locus_tag="AO070265000029"
                     /protein_id="BAE63270.1"
                     /transl_table=1
                     /translation="MTLRVKRRRLSRQPTMVNQLDNSANDPCRPATAQEKEKWNGFCE
                     LESEPVIVFIGNQFPFPIQTTSNACASVALLNIVNNIEGLELGDNLQHFKDFTMPFTP
                     ALRGDAISNFDFVKRIHNSFARKMDMLNSDLQLKNEATSRRSRSSKGNHDETEMDAGF
                     HFIAFVPALGKVWKFDGLERQPQALGPCTPNEDWLGLVKPHLITRMTEYEEDQIEFSI
                     LSLVRDPLVDLIGKLAVNIKCLELLNQRLTTQAPAVAHSELPFASRILENTILGPDKS
                     FDMTRESIDQAIVPVVLERYNLFSAQEIVDFQQKLCNEQQALRAAIRDEQQTQRADDD
                     YAAGRRYDYGPAIRTWVRFLARKGVIESLIPMGEV"
     exon            54217..54394
                     /number=1
     exon            54735..54927
                     /number=2
     exon            54997..55181
                     /number=3
     exon            55238..55791
                     /number=4
     CDS             join(56849..56934,57012..57088,57163..57202,57259..57328,
                     57390..57449,57524..58474)
                     /codon_start=1
                     /locus_tag="AO090020000024"
                     /note="oxysterol-binding protein"
                     /old_locus_tag="AO070265000027"
                     /protein_id="BAE63271.1"
                     /transl_table=1
                     /translation="MSPATASDAPENTPDDSSKLKTFLSILKKFIGVADIASVRFSLP
                     AHLLEPTPNLEYWNYLDRPETFASIGQSDDPLGRTLEILRFWFTKDLKYIKGKPCKPY
                     NSTLGEFFRATWDVDATLPEVQVHSKPGIATGISAAKDGNAEAVKVCYLTEQTSHHPP
                     VSAFFIDCPQRGVSARGFDQISAKFTGTSIRVAPGQHNLGIFVRIAPRDNEEYQLTHP
                     AAHLGGLLRGALAITVSDTCYVTCPKTRIKVILQYLEDGWIGRAQNRVEGVVFRYDPD
                     MDTTTKIKDVPESDILAKISGSWHGQVYFTLAGTGEPQLLIDIAPLFPATKSVPPEGS
                     QLSNESRKFWSSVTEAIVDKKYSQATRCKQNIEERQRQRAAERQAKNETWQPRFFTDA
                     VTPLGKPELTEDGRKALKGLYNGDYSLEESETKGA"
     exon            56849..56934
                     /number=1
     exon            57012..57088
                     /number=2
     exon            57163..57202
                     /number=3
     exon            57259..57328
                     /number=4
     exon            57390..57449
                     /number=5
     exon            57524..58474
                     /number=6
     CDS             complement(join(59123..59296,59362..61740,61794..61935,
                     61987..62110,62164..62702,62750..62985))
                     /codon_start=1
                     /locus_tag="AO090020000025"
                     /note="chromosome condensation complex Condensin, subunit
                     D2"
                     /old_locus_tag="AO070265000026"
                     /protein_id="BAE63272.1"
                     /transl_table=1
                     /translation="MEDRAQFDINESLKYYLSDPTSVPTADAEPELLECEADPDQLST
                     TLIDNVLNPIVDAVAENPEGLARPSFFDSLQFFLKILTLARILRHCSILPIRSLSKLL
                     DLIVSGLSVEADIVHGDLESDEPDGVQHHKHLLEMYGFLLQWALSAVEVKAAERPAEA
                     APARRGVGKSGRSKASMRDGHWDWTAQIQISMETMCKVMKLKLSRIFLTTSDRDTFIN
                     LFTRSIYLILESEQRVKSMTIRMHAFKVLCIAVKHHGHAFGAQTSIVQSLTYFEHLSE
                     PMAEFLHILAEQYDYPQLSDEILKELGNKEFNSNDTRGPKSVSAFIVKLSELAPRLII
                     KQMTLLAKQLDSESYTLRCAVIEVCGNLIADLSRQEERSDNYKTQINAFFDVLEERFL
                     DINPYCRCRAIQVYMRICDLDQKFPKRRQAVAELAARSLEDKSSNVRRNAIKLLSKLV
                     STHPFSIMHGGQLSYKEWMARLDAVDAELNSLRPPETPGFDGGEASHVDSELLDDATQ
                     MPDESPSKAPRMTEEEKAAAVKRAAEQAATSELLARLQLTRKYYNEAIRFIEVLHTAS
                     GVVTQLLSSRNKSEAIEAMDFFVVLDAYKVETSRSGIRRMLRLIWTKGNSDEGKGVQT
                     HLIDCYKGLFFEAPDSFSPNDAANYVARNMISLTFGSTPAELTCLEQLLSTMMKAGHI
                     SDAVIAKLWQVYGVQRKEISKTQRRGAIIVLGMLALADPDVVIKEIEAMLRIGLGSLG
                     MADLVLARYTCIALRRMVPGRQAKSKEVGIPKLTNDHAILTQLAAIVEIVSDNKEWYG
                     VAEQAISAIYALSKHPDVLCSDILKRKTRSVFQPQTQRSSSQGTSDGDEKRPGTASTD
                     NPTTRKPSSAVLSQLLFVVGHIAIKQIVHLELCELDFKRRKAEQEKNKASTAAPQMNK
                     DPTEGDELDLIGGTTEDDFTDAMAHIRERELLYGDKSLLSNFGPLVTEICANSNIYPD
                     RNLQAAATLCMAKLMCVSAEYCEKNLPLLITVMERSEDPIVRSNAVITLGDMAVCFNH
                     LIDENTDFLYRRLNDDDVSVKRTCLMTLTFLILAGQVKVKGQLGEMAKCLEDNDKRIA
                     DLARMFFTELASKDNAVYNHFVDMFSLLSAERNLEEASLRRIVRFLIGFIEKEKHARQ
                     LADKLAARLPRCETERQWNDVAYALSLLPHKNEEITKIVSGGFNKVVTAST"
     exon            complement(59123..59296)
                     /number=1
     exon            complement(59362..61740)
                     /number=2
     exon            complement(61794..61935)
                     /number=3
     exon            complement(61987..62110)
                     /number=4
     exon            complement(62164..62702)
                     /number=5
     exon            complement(62750..62985)
                     /number=6
     CDS             join(63625..63892,63973..64432,64496..64556,64666..65349)
                     /codon_start=1
                     /locus_tag="AO090020000026"
                     /note="serine/threonine protein kinase of the CDC7
                     subfamily involved in DNA synthesis, repair and
                     recombination"
                     /old_locus_tag="AO070265000025"
                     /protein_id="BAE63273.1"
                     /transl_table=1
                     /translation="MSTLHPAPTGIFEVQKPGPSRPPRAPAGPRYARDDDAATDSDAS
                     VMEHEDEDLQDEEDVDDSVKEDMKKLEDTFPGISDRFRLVNRIGEGTFSTVYKAEDLL
                     YDHYRNDWDMFQGQQCDSWTSPPSKRRRVEGERGQSLPTKRRKPRYVALKKIYVTSSP
                     FRIQNELELLHDLRGCRSVCPLITAFRYQDQVVAVLPFFPHTDFRIQYRTFLVADMRH
                     YFRSLFTALHSVHKHNILHRDIKPTNFLYNPKIREGVLVDFGLAEREGSEYTGTCLCA
                     NPSYVRRSRLLQSYYSTQCSTSTLSAGYPKNDSRPSRRANRAGTRGFRAPEVLFKCTS
                     QTTKIDMWSAGVILLTLLGRRFPFFNSADDVDATIEMASIFGTRRMKMAAAMHGQIFE
                     TNIPTIGEKGYSWEKLVKWASCVEELTESEKQATRLLAGLMELDPYKRLSARDALQHE
                     FFTDPIEHDVEWGGNPEDSADSVEEDEAEKDDEADEVAMI"
     exon            63625..63892
                     /number=1
     exon            63973..64432
                     /number=2
     exon            64496..64556
                     /number=3
     exon            64666..65349
                     /number=4
     CDS             complement(65637..66665)
                     /codon_start=1
                     /locus_tag="AO090020000027"
                     /note="OTU-like cysteine protease"
                     /old_locus_tag="AO070265000024"
                     /protein_id="BAE63274.1"
                     /transl_table=1
                     /translation="MTQAPVYQYPLFKMRFRIRGPGGQSTVTLDDSATVNELRTQIVD
                     KTGLTAYDVKYGYPDLKHFLLDELQPNQRISDIGFKLDGEQLLVTKREVPPSNEGLTP
                     ISQEPPEKPPTSHTSSGAISDDPPEIPSLEHAGTFVLRIMPDDNSCLFRAVGSALMGG
                     MDAMNELRSVVAQTIQQNPGLYSEAVLEKKPDDYCRWIQNEDSWGGGIELSILSKHFG
                     IEICSIDVQTLRIDRFNEGLPTRCILVYSGIHYDTVALSPSDPPHTHAYAPPEFDTKV
                     FDAADPFVLEKALELCKVLQSKHYYTDTAGFRIRCNTCGGVFIGEKGATQHATQTGHY
                     NFGEASQD"
     exon            complement(65637..66665)
                     /number=1
     CDS             complement(join(69823..69908,71847..73200,73313..73434,
                     73551..73743))
                     /codon_start=1
                     /locus_tag="AO090020000028"
                     /note="predicted protein"
                     /old_locus_tag="AO070265000023"
                     /protein_id="BAE63275.1"
                     /transl_table=1
                     /translation="MQVSASRNTPSQPPPSHTPRAHNRLSGDMKNRAPLPVPSGTIQN
                     GHSRNLSGFDMAARSPPNQSNTKHVPCKFFRQGACQAGPACPFLHSTDAAIDYAPCKY
                     FTKGNCKFGAKCALAHILPDGRRVNRPNPGVGMGGSHLNLGGRVNPQAYVNQDSALTN
                     SVLSQQRMNGQEPRYGPQVHSQEEYATTHSPQQPYDAIPTIDAGLASDAGSKYGSPID
                     DMRFPMSPNHRHLTALDAPLPASFDSQGISHAARYGPVAASMPSKFGLKLSPPAQRIG
                     APSDALRSLRDTAYGSDLRKPPSFMGSSPPGIPEDGPGPRFLHSQRSVKPRMLSASVP
                     RLTALDDWDDSNFPMEEDYLPINLHDDVLTPQERLRRLSRTDYEPSSSHRDLSGLGMT
                     GTSLSKVGSPLASSPSRFGALFAKQRQKKEEDAHGTSLPQVGSPLRESSLNFGASPSL
                     GPIGSRQTSGDVSPFVSTPSRQQSTSMISQQLSSMSLHPGPARHSSSVGASGRLDRTV
                     SSPVSTSRIDEEQGDLVFSMEEEENNKRNCTSWSTSKAESHDDDSTPTTCRAGAEGKF
                     CGGKDGGGEGVGSGGGDS"
     exon            complement(69823..69908)
                     /number=1
     exon            complement(71847..73200)
                     /number=2
     exon            complement(73313..73434)
                     /number=3
     exon            complement(73551..73743)
                     /number=4
     CDS             complement(join(74930..74998,75116..75525,75569..75688,
                     75838..75901))
                     /codon_start=1
                     /locus_tag="AO090020000029"
                     /note="predicted protein"
                     /old_locus_tag="AO070265000022"
                     /protein_id="BAE63276.1"
                     /transl_table=1
                     /translation="MSLLLFFDSLVANLEEQSSLFSAIGSICSKGLARATSKSKNRRK
                     SIRLVNPACMRHRGRVGGRQAVYHALQKGADESTLERMVVLDDHILQLQEQLTDLKGY
                     VKRARAELATLRATPLAFDLQKSINQLQVEKETTFAILTQARGTSAREVDEEGRTITK
                     RVWERWQKRVNLRRKVCRDLWRRCLEMVDKDVTREELWGQAKILMGLHHLSSVPFPVY
                     GV"
     exon            complement(74930..74998)
                     /number=1
     exon            complement(75116..75525)
                     /number=2
     exon            complement(75569..75688)
                     /number=3
     exon            complement(75838..75901)
                     /number=4
     CDS             complement(join(75975..76040,76722..77966,78025..78144,
                     78203..78938,79136..79245))
                     /codon_start=1
                     /locus_tag="AO090020000030"
                     /note="extracellular protein SEL-1 and related proteins"
                     /old_locus_tag="AO070265000021"
                     /protein_id="BAE63277.1"
                     /transl_table=1
                     /translation="MNRPPQGRGQPRLGATWYPGGQDDFYMPEVISPSPQRVMPEVPE
                     TMQDNIAHLEHEARSPHRSQYAPVQYDRSHFPERTSSAAVVQGQPITAGYEDTAHYEQ
                     AAVYDTMESPNFSAFPVLRNPPPNVPPTDEQREASLERARMAVLSSNDPEMQLAWAQD
                     ALAYVEVAVQNEARLSLIQPPRPQTPQVEHQLKVDAMNIVNFLADQHHPKAEFIKGMW
                     LEFGKFGYRVDKKEAFRAYSRAAEKGYARAEYRMGMQFESSGEPEKAIRHYEKGVALA
                     DSASFYRLGMMILLGQHGQRQDYQTGLDYIQLAAQSCDENAPQGAYVYGMLLARELPQ
                     VSVPENYLPLDVNAARVNIEKAAYHGFAKAQVKMGAAYELCQLGCDFNPALSLHYNAL
                     AARQGEPEAEMAISKWFLCGHEGVFEKNDELAFTYAQRAAQSGFPTAEFALGYFYEVG
                     IFVQVDIKEARSWYAKAAANGNKDATSRIDSISRSKTLSRRDHEQVAIARIKSRYGSH
                     QRNESMQSASENLEMPDPSRMSLSDNTPPSAPYPDRPPSRARPVYPPGYSVPDPRPSS
                     AFGINPNIRTSAPNYNRAASYGPGPMGYRSPAPVTPTTSGPASPTSATPKLDIGYSAP
                     IESPNSRRPQRLDSTPPDRRPVRTPVSAQGGPVGSPKPVTSPSSATFPQRSESMPPPS
                     APLASSTTPKPSSASASVSQKPAAQPAKSQGGLPGKGPKTFEEMGVPTAQKDNDCLST
                     TGLLWFWTISVNHSPAFL"
     exon            complement(75975..76040)
                     /number=1
     exon            complement(76722..77966)
                     /number=2
     exon            complement(78025..78144)
                     /number=3
     exon            complement(78203..78938)
                     /number=4
     exon            complement(79136..79245)
                     /number=5
     CDS             join(80945..81078,81769..82291,82345..83010,83066..83236,
                     83338..84009)
                     /codon_start=1
                     /locus_tag="AO090020000031"
                     /note="helicase of the DEAD superfamily"
                     /old_locus_tag="AO070265000020"
                     /protein_id="BAE63278.1"
                     /transl_table=1
                     /translation="MEPQAEEFHHPYSPYDIQLQFMRALYSCIEKGKVAVFESPTGKL
                     AGLSTGTLELLKRFQHKSSAHPRQDEDYGDEDIKILYCSRTHSQLTQFASELRRVNMP
                     SSIPKDFSEGVADTDGLQEGVRHLSLGSRKNLCINPRVSSLDNVTAISERCLDMQQPG
                     VAAEQRCPFLPSNENEAQVLQFRDHVLATVKDIEDIGKLGKDIGICPYYASRSVTKHS
                     EIVTLPYPLLLQRSARDALDLSIKGHVVVIDEAHNLMDAISNIHSVTITLSELQTSLF
                     QLTTYARKFKTRLKGKNRNYIAQVIRLVTSITDHLKTILETSQAPEGPVQPSDLMSGK
                     GVDQINPYKLCRYLRESKLARKVDGYSEFSRERADRQADRKPSTPVLFHIQSFLLPLM
                     NLSAEGKLFYIKAQGDIQLKYMLLDPMNQFREIVDDARAVILAGGTMSPMTDYIHHLF
                     PYVPSSRLGTFSYGHVIPPENLIAQVLGKGVTGTEFDFTFETRDSERMVIPDGVVAFF
                     PSYDYLSQVLSIWKRTLAGEKNRTVYDLIEGKKTILHESRDVTISTEELLQEYASIVG
                     SGRGALLLSVVGGKLSEGINFSDRLGRGVLIVGLPFPNIRSAVWQAKIHYVEQKAYKE
                     SSGSDANRQLVAKAAGKDFYENSCMRAVNQCIGRAIRHRNDYAAIVLMDRRYDKPAIQ
                     GKLPAWIKQSMASSSALRPAGATIGSLSKFFVAQRTSKT"
     exon            80945..81078
                     /number=1
     exon            81769..82291
                     /number=2
     exon            82345..83010
                     /number=3
     exon            83066..83236
                     /number=4
     exon            83338..84009
                     /number=5
     CDS             join(84274..84305,84461..84659,84858..85076)
                     /codon_start=1
                     /locus_tag="AO090020000032"
                     /note="60s ribosomal protein L15/L27"
                     /old_locus_tag="AO070265000019"
                     /protein_id="BAE63279.1"
                     /transl_table=1
                     /translation="MPTRFSKTRKARGHVSAGYGRIGKHRKHPGGRGMAGGQHHHRTN
                     LDKYHPGYFGKVGMRYFHKTNQQFWKPVINLDKLWSLVPAEQRDAYVNGQKTDTAPVI
                     DLLPLGYSKVLGKGRIPEIPIVVRARYFSRDAERKIKEAGGVVELVA"
     exon            84274..84305
                     /number=1
     exon            84461..84659
                     /number=2
     exon            84858..85076
                     /number=3
     CDS             complement(join(85660..86381,86440..86827))
                     /codon_start=1
                     /locus_tag="AO090020000033"
                     /note="predicted protein"
                     /old_locus_tag="AO070265000018"
                     /protein_id="BAE63280.1"
                     /transl_table=1
                     /translation="MADPLKPLDAAPRTNPSPISQKTYPVAGILTTVFGLNELPAQAS
                     EVACLWLLHPRLATQERMTGIATAAITDWNNRIKTSYTNDSQSVKGLIAVAFDQRNHG
                     TRLVDPTGNEAWKQGNPRHAQDMFSIFQGTARDVSLLIDYLPSFVFPQSEYKITQNLV
                     LGVSLGGHAAWSCILHEPRITAGVIIIGCPDYVNLMADRARLSKLPAWTSSNPPGSQF
                     LGSEAFPVSLLDTVRKYDPASLFLSYMDMKKSVEPLRNCTLPEPTEKEKQALQPLLAR
                     CLAGKRILNLSGGIDKLVPYHRGEAFLTWLKQAVSPNGWFSNGAVTLEDVIDESAAHE
                     VTPKMVDEAVRFISDALAANDEDLRKSGFVRESKI"
     exon            complement(85660..86381)
                     /number=1
     exon            complement(86440..86827)
                     /number=2
     CDS             join(87640..93041,93103..93171,94715..94730)
                     /codon_start=1
                     /locus_tag="AO090020000034"
                     /note="phospholipase D1"
                     /old_locus_tag="AO070265000017"
                     /protein_id="BAE63281.1"
                     /transl_table=1
                     /translation="MTESTVHPSEMRVPENPSDRLTPGKPEPLALSNGPRLSSPFPSP
                     TGTTGTEYSPSDNREKAEATVEENQRVANIITDENGGKSHVGETDGSWELWDGFPRAK
                     LASLHPRRPNESLDNKQKAMSQESQTSHHGLSSRRPSVQFTGEFIENDPPAEFARSRP
                     SSVAGDDVDADLKGKQSIFGKLKAFAASPSFVSHSRSASAATIGDSRHANHDLTTPGS
                     ERGEFRFPNTLEEEGSDIDADAEESAGEQQGRQQQQQQQQQKKKKQLRRRQENDSTPQ
                     TEPNTPKASGRPSFHLPSSFGPFENYRTNFFPRRNNGDYAQQREGVSEDEGRDRLNRD
                     NAWRRRSAWLANTRALNSGGRPIDSQPNQDERRPSNLRRFTGMAGPSENVEGLGAPWR
                     RHRAERGSSLSAQRWRQIKAGLKLIGQRRKTDNTVDHAKSAELLAELTSGVPAALILA
                     SMFQRDEHGSKRIPILLEQLKVRVTDSRIDSHSGDRHLVFRIELEYGSGMTRMKWIIH
                     RTLRDFANLHLKYKLHFGTQKYIQLRNTEGAHNLPRFPRSAFPYLRGVRGLESDMEDE
                     EDDGGYETAAEATSGNERAGKRQQSRRRSSGNISRRQSTVTNPDTENAAGASGAADAG
                     PSKKESYPERQRKKLESYLQKLIRFLIFKPDSNRLCKFLELSALGVRLAAEGSYHGKE
                     GYLIIQSSKGLDFRRALTPTMVKNRHSPKWFLVRHSYVVCVDSPEAMNIYDVFLIDPF
                     FKLQTQKISIRNQKAKELAKSAKESARHPQHHTLRLENSERKLKLLARNERQLHQFED
                     SIRFMVNNTPWARPNRFESFAPVRRHCFAQWLVDARDHMWMVSRAINQAKDVIYIHDW
                     WLSPELYMRRPAAISQKWRLDRLLQRKAREGVKIFVIMYRNINSAIPIDSEYSKFSLL
                     DLHPNIFVQRSPNQFRQNTFFWAHHEKLCIIDHTLAFVGGIDLCFGRWDTPQHLLTDD
                     KPTGFETSDGPKDADHCQLWPGKDYSNPRVQDFYDLDKPYEEMYDRNVIPRMPWHDIS
                     MHVVGQPARDLTRHFVQRWNYILRQRKPTRPTPFLLPPPDFDAADLEALGLDGTCEVQ
                     ILRSSSAWSTGTSDLTEHSIMNAYVKLIEESDHFVYIENQFFVSTCEIDGRKIENLIG
                     DALVERITRAAKNKEAWRAVIVIPLMPGFQNTVDSEGGTSVRLIMMCQYRSICRGETS
                     IFGRLRALGIEPEDYIQFFSLRAWGKIGPQKQLVTEQLYIHAKCMIVDDRAAIIGSAN
                     INERSMLGSRDSEVASVVRDTDMIWSSMNGRPYLVGRFPHTLRMRLMREHLGIDVDEL
                     MEHSMATEEELRRIQIAEEGSKSPGDHERLDPESLMLEKQDERDMIERRHRIQDEFLS
                     RSEDMHSFNHDVDWEQGDNPNLKSNRKLTADARVTANPEHKKDVDGYGPDHLSAALQA
                     GLGEARDSQLLGDKSEVLVSPIASEGKGTIQQPRHCPQQEANGDNETRKASFILSDDV
                     DDPGSVVEGLSAARNPALSGHDTESGGNGAVPSSKEKFDVTKHPHPLVADMKHVFIDK
                     DCMRDPVIDVFYLDTWHAVAEKNTKLFRSVFRCMPDSEVKSWKEYKDYADYGERFAEM
                     QNQHSAKAFRPAHARQTGPPGTGASLIAGGLTTKSNLLGAGPNAEGQMMGQKDQSSSE
                     KIDLRQAANTQNHDRMRSDIAQQQKTLSSKDEKMTGLRTLDAPASGNVQNGRHDDNGS
                     SGEDHGKQVSDPPVVDYSEALNRNATAQSRRRRRRATTLGSKREFHASDEVMDKQQAE
                     DLLNQVQGHLILWPYDWLEKEEQGGNWLYTLDQLSPLEIYMLVT"
     exon            87640..93041
                     /number=1
     exon            93103..93171
                     /number=2
     exon            94715..94730
                     /number=3
     CDS             join(97102..97326,97421..99665,99724..99890)
                     /codon_start=1
                     /locus_tag="AO090020000035"
                     /note="trehalose-6-phosphate synthase component TPS1 and
                     related subunits"
                     /old_locus_tag="AO070265000016"
                     /protein_id="BAE63282.1"
                     /transl_table=1
                     /translation="MSSESSNATPTTPAQAAKDARSRIELLRRLSLRETPKVLEADLR
                     QQHPGLRLSGRIISAAFCIPYKVYYRRESSWELKPRPGTSALFDSLAYLGSEETNWSH
                     TLVGWTGEVEPVPEDTVPLQQIPINTSAKLPAATNGTAKPLNKAAAPVPVDANQRPPS
                     HPLLDGFTVSQDDRSRLDAQLSSGRYGKIAPVWLSAETEIPEDTIFLEDQGRWRRYAE
                     RELYPLLHYKQHGPTDGRSERNWWADYVRMNRLFADRILKEYQEGDIVWIHDYHLFLL
                     PSMLRQRIPNIYIGFFLHAPFPSSEFMRCLAKRKEVLTGVLGANMIGFQTFSYSRHFS
                     SCCTRVLGFDSNSAGVDAYGAHVAVDVFPIGIDAKAIQNIAFGASEIENAVTGIRKLY
                     AGKKIIVGRDRLDSVRGVAQKLQSFEVFLERYPEWRDKVVLIQVTSPTSVEEEKEENK
                     IASQISNLVSTINGRFGSLSFSPVKYYPQYLSQHEYFALLRVADVGLITTVRDGMNTT
                     SLEYIICQQQSHGPLILSEFSGTAGTLSSAIHINPWDTAGVAGAINQALTMSPESKKA
                     SHQKLYKHVTTNTVSAWSTQYLSRLLTNLSSFDQSVATPALDRAKLLKQYRKARKRLF
                     MFDYDGTLTPIVKDPQAAIPSDRVLRTIKTLAADSRNAVWIISGRDQAFLDEWMGHIP
                     ELGLSAEHGCFIRKPRSDDWENLAERSNMGWQKEVMEIFQHYTERTQGSFIERKRVAL
                     TWHYRRADPEYGAFQARECRKHLEETVGKRWDVEVMAGKANLEVRPTFVNKGFIASRL
                     VNEYGTGPGQAPEFIFCSGDDFTDEDMFRALQKFDLPQDHVYSVTVGASSKQTSASWH
                     LLEPADVIETVTMLNSSSTQDY"
     exon            97102..97326
                     /number=1
     exon            97421..99665
                     /number=2
     exon            99724..99890
                     /number=3
     CDS             101073..102515
                     /codon_start=1
                     /locus_tag="AO090020000036"
                     /note="monocarboxylate transporter"
                     /old_locus_tag="AO070265000015"
                     /protein_id="BAE63283.1"
                     /transl_table=1
                     /translation="MLDRVPNGTSYSQPMVNEEEDDIRQDETASGVGNAPGNRESNED
                     PCRTKEFFKTPTNVSNAGALASKTLSLVRTRESNREIGPPPDGGFLAWFQVALGHFVI
                     FNTWGYINSFGVFQTYYTETLGHPPSDISWVGSIQIFLLFFIGTFSGRATDAGYFKVT
                     LVMGAVLELFCIFMTSLSTKYWQLFLAQGVGQGIGCGLMFCPTIALVPTYFTKRRSIA
                     MGIVASGSATGGLVFPAVVMRLLPRIGYGWTMRILGFISLGTLTPCLLFLKQRLPPRQ
                     SGPLVEWAAFKEPSYALFAIGMFLNFWGIYIGFFYIGSFARNIIGVSQSTSIDVLLVM
                     NGVGLLGRLIPNLMADWYTGPLNLLVPCSLATGVVAYCWAAVNSPGGMYAFSVFYGLA
                     AAGIQSLFPATLSTLTTDLKKAGVRMGMVLSVVAVAALIGSPIAGALIQLNDGQYLYA
                     QMFMGSAVVAGAVTLFAARVAKLGFSWQRS"
     exon            101073..102515
                     /number=1
     CDS             join(103184..103229,103308..103375,103488..104063)
                     /codon_start=1
                     /locus_tag="AO090020000037"
                     /note="predicted protein"
                     /old_locus_tag="AO070265000014"
                     /protein_id="BAE63284.1"
                     /transl_table=1
                     /translation="MAPRGRGKFSKPSRGGGKHFSRDVQPVDKHGNPVGLWREEGEEK
                     EEEEVSESEEESSKEDAKPGSSSPAAAEMTREERRAAAKAKKQAAIAKRNQVQPGDLP
                     PSDSESEVSGVSEGDEELPSNPNHTAKSRSQLKDSNPDKDMSQLSRREREAIEAQQER
                     ERYLKLHAEGKTEEARADLARLAIIRERREAERLRKEAEKEEKAELAKQRAAEIEAKL
                     NAKKKGGSKKK"
     exon            103184..103229
                     /number=1
     exon            103308..103375
                     /number=2
     exon            103488..104063
                     /number=3
     CDS             complement(join(104543..104854,104910..105247,
                     105389..105528,105640..105749))
                     /codon_start=1
                     /locus_tag="AO090020000038"
                     /note="predicted protein"
                     /old_locus_tag="AO070265000013"
                     /protein_id="BAE63285.1"
                     /transl_table=1
                     /translation="MNPHISVPRQHASPSNFGGTTPASRGSSIRMPRFFKRMFKFPQM
                     DFEMAIWEMTSLLIAPKKVFKSIYYHVSIAFNRWSCYLAETKNTWHRPDPSFTYLLCF
                     FLLLTALAWGLAYAPSFGAIVRLSLLFIFVHFIGSSLLVSTIGYFVIGRLFGPDGAAA
                     SLSGLRGGRGRRRGAAQGLFVQPGEKDQLEFGYCFDVSNRAFFPLYLHLYVAQFLLLP
                     LLTRSPSNLLSTFLGNTLYLSALAYYTYITFLGYNALPFLHNTELLLLPILAFAVLWL
                     VSLILGWGIVAQGGSVEGLFWGA"
     exon            complement(104543..104854)
                     /number=1
     exon            complement(104910..105247)
                     /number=2
     exon            complement(105389..105528)
                     /number=3
     exon            complement(105640..105749)
                     /number=4
     CDS             join(105859..105900,107775..110367,110436..112324)
                     /codon_start=1
                     /locus_tag="AO090020000039"
                     /note="guanine nucleotide exchange factor"
                     /old_locus_tag="AO070265000012"
                     /protein_id="BAE63286.1"
                     /transl_table=1
                     /translation="MESGEQLSFKGFRTLAHQNSWVELLFHNPDRRQTCGLSSAYSRD
                     QTRAIRHSSRLPQQLPEMHASNSPPTTPSAASNYKATRRMTQSRPSVRETFLDEYNVG
                     DNTNNGMDSGDERDPHDLSLSPKHAARTSIVDNMLLSLDQFASSNASVLDDYRLFNSV
                     FESDLYGRCSPDSMTQRRYRGHTFSSSLSSELDYNPDDAAGLYGTQPGRARRSTSSSN
                     YNSNFRRFGSTRTPDGPSSRGQLYDHRSNSGGGTSGVRGTRQGSKGSSSLHMDFGPPL
                     SGNHRADLAPERRSASFDFGTRQTIIPFKETAVDYDPVSLDGVDAAPTPSIPGGPRKY
                     QVSSQGEYPGTLGPQPSRTPVASRRNSVKSARTRSTAAMTGRENDLTQLGAPILEPPP
                     AIPAATFDPPAPSPTISFNKPIFPTPSDPAPTRERPGFFWRVFGSSKNSTPGAENNQL
                     DLVVSQDNDLRDLNGSTTNLKDRRQPLKSSTAGTTTVRQGAHQVVNKKSSFFRRRKRS
                     VTENVPPPILIPPESGSKPHEVMKPQPSPVSSLRKVMNPYLADASAPGLLHSTESHNR
                     NIGTDKQENKGVDSHAEKPKESFHGAGRVQRPKHSLYPAASSDARDASILGSKIGDED
                     IPKVNHMDSTSSANPEQLVPRDGIGSRDSGPDSESDRVGGIRNRLTPQDLCVPSLSPV
                     VERFSQKSVSPIESSEETRTVNPGEPEEVKHQSEPRLYDREDEPSPKSLPVDTSGSLK
                     VSTSNISNYYTASNTPVISPVESKSVEISEGKVDLTDNVLEDQPGDSEKEQAQKLYDS
                     QDQVVGNEPAAAWLGDPDRATIRKAYMEFFDWSNMNILAALRSLCNRLILKGETQQVD
                     RVLDAFSIRWCECNPNHGFKASDVVHTICYSLLLLNTDLHLADIEQKMTKGQFVRNTM
                     PTIHRVAFDAAPDGFEALHVAHDKSKVSARESLTSHMDESDRGNMVADKPANAPAKLV
                     NRLSRTDLSVKLSGDPETNTGPLVNVPFNGTDKAWGQQVETVLRDFYTSIQKQRLPLH
                     GAQAEKEALRASSNHLLSPNPSGLRRSPSTVSRSGSDIYPRGRSADSRYGTARWSSKN
                     RSRARLYPSSVMGSSRTSLEEQSSFWSPSASSTWSKQSLGKLTSVSVDSFGSDYMRGD
                     YQQAIGFANALSQAIIREDSAYSIASTEEVEGTIPLLEDETLQLAGAPWAKEGSLKHK
                     QHLDSADKRAKDRNWNECFAVIQQGWMRLFSFNSSTKSVRHKPKTHTHGGVVVGGGNW
                     TENAEEVRKFLLRQTLASVLPSPGYSKSRPHVWALSLPNGAVHLFQAGTPEIVHEFVS
                     TANYWSARLSKEPLVGGVSNMEYGWSDTVINSALISTENNSNRSPPSSSGARPSIQSS
                     IRSSIDQQGGVRPRLPADRVHISDWAPPQQSMVASNLPEADQLKALRMYVKNVEDELQ
                     RHNELRPAMVLAFSPRHPNATKSMANWERKSSYLLRENVKFRTYIETLQRALDLKNKI
                     YASREESSPSRCG"
     exon            105859..105900
                     /number=1
     exon            107775..110367
                     /number=2
     exon            110436..112324
                     /number=3
     CDS             join(114758..115234,115292..118147)
                     /codon_start=1
                     /locus_tag="AO090020000040"
                     /note="predicted protein"
                     /old_locus_tag="AO070265000011"
                     /protein_id="BAE63287.1"
                     /transl_table=1
                     /translation="MTLKEQSSTIDRLSKENFDLKMRIHFLNEALNRRSEEGIKEMIS
                     ENVELKSDKLKLQKDSQTLKRKIRDLEKQLKDQQSDKESMVNHDPEGSDDDGREPAQE
                     EEILFLRERVEVYELEIERLRSESIARESEKRKLAEILKSLNDGRPMGSDVGAREERD
                     MWKDMLEAETAAREQAEEENKRLRDDALRLKSEMSSIIVSTRPTQRDRVESMHSYSAV
                     SDRELNRNTNPSSSSSSTLVMELELLKQENAELRKEVSAQTSMLTSRNREKERLYQEI
                     EELKLGQRRDGGRSIAGDSIFDRSASRAHGRPSSRASDGTAPYPGDDAEREDLEVRNG
                     QLRDQVSALKLDNQAVRTELEEYKRELEEYKKELETLDKAYQERGKEVETFDKAYQAD
                     MDQAEEEMQKLQQDLQNLEQERDRALLMADEHNAAFQDLRAEAQDELEALGEELDQKT
                     EECQRLGEELKIQDEYLRALQAEMRSASEGIIRLEEDAQNNMQRYKAVQQELEDCNRE
                     MESFEKSLFEANTKVQRLTVQIESSQNEIAFLREEQDGDKIRIGDLESELKTYKMSLQ
                     SEKDKARELEERLTEERHQREVVGSKEKQEVQRIVNELNREASAAKEEARKLKKSLSA
                     QEIETNTWRERLMDLENNLRETLGDLTGSRSSLISKIMELQKNLESTAWELESTRSKL
                     DETESLLRNRDALLESHGLESRKLAELLERERHSRRADKQSFEQALKSHHQASRTITQ
                     NNSRITELENARNQDRKRFTNLEQQFKDQLNERNTMLLMIWKRLSAMCGPDWAHSNSL
                     INGNLPSQEVIGNILFWPGFSRNLLLAVKTLENVILGFKNRIKGVERDLTKQYQAVEH
                     TLSLRIKKLDRLEESMMSIRAQQHKLGQSGLSPEMAKLRGENRLLKAELNLLQSHSRS
                     RGPAGIGPGSPRLESGADLDPTSLVRHNSMVEKPANPNNSRGLTRSSTSGIPQPSHVS
                     STTTLADGAGAMVHSSRTRHAVGDQGNNEKWIQRLHELEKRLKQEREARLLDRNGARK
                     RLEERDAENQRLRAQLERERVRKDMSTDYSGDNNAGLARGQNLRMIQGTAHDSGDGYG
                     NHRDDDDPSSSDGEGICVDIEV"
     exon            114758..115234
                     /number=1
     exon            115292..118147
                     /number=2
     CDS             complement(join(118893..119619,119688..119743,
                     119831..119986))
                     /codon_start=1
                     /locus_tag="AO090020000041"
                     /note="quinolinate phosphoribosyl transferase"
                     /old_locus_tag="AO070265000010"
                     /protein_id="BAE63288.1"
                     /transl_table=1
                     /translation="MASTYGDFRHLLPSNYKRLITSWLEEDCPSFDYGGFVVGESDGE
                     ARLLGKAKGVVAGVPFVDEVFAQLGCTVEWHVQEGEPIEPIKHCATVRGPIRKILLGE
                     RVALNILARCSGIATKSASLVAALRAHGWSGTLAGTRKTTPGFRVVEKYGILIGGADP
                     HRHDLSSMTMLKDNHVWACANNRVAKDGAGPASTESVAAAIPRAVQAAKVAGGFATKV
                     EVECRSVEEANAAIEAGADVIMLDNFTPDGVREAAKQLKQGWADKKQSFLIEVSGGLN
                     ESNAASYACSDVDIISTSSIHQGVGIVDFSLKVSLR"
     exon            complement(118893..119619)
                     /number=1
     exon            complement(119688..119743)
                     /number=2
     exon            complement(119831..119986)
                     /number=3
     CDS             complement(join(121903..122407,122499..122986))
                     /codon_start=1
                     /locus_tag="AO090020000042"
                     /note="predicted mutarotase"
                     /old_locus_tag="AO070265000009"
                     /protein_id="BAE63289.1"
                     /transl_table=1
                     /translation="MADEPSVKFTSLGAIIQELNVGGQNIVLGFTKKELYEKYNTPWF
                     GATIGRVANRIKDAKIQSLNNQEYELEKNNDPNALHGGSRGWGRRHFEGPTLLQRNGK
                     DTLLYTYTSPHLDGGYPGTVEIKVFYTASKEDNRSVLSIEYEVELVGDECNETIVNVT
                     NHSYFNLTGGETIEGTSAKLFTQHYLPLDKTGIPFGRIDVHPSKVTEPFTIGPNKEAF
                     DDAFVMDRDVAVIPLDTRERPLQLLAEFHHPESRINLQVHSTEPAFQFYTGQGTNVGA
                     VDGNPSRGPFSGFCIEPSRFVNAINEPDWRHMVVLKKGDKYGSKIVYKTWKDPQ"
     exon            complement(121903..122407)
                     /number=1
     exon            complement(122499..122986)
                     /number=2
     CDS             complement(join(126107..126797,126881..126978,
                     127034..127141))
                     /codon_start=1
                     /locus_tag="AO090020000043"
                     /note="predicted protein"
                     /old_locus_tag="AO070265000008"
                     /protein_id="BAE63290.1"
                     /transl_table=1
                     /translation="MTARQSSPTSDNSHSDSNVRKRVCKACDRCRLKKSKCDGGNPCG
                     RCRTDNAICVFGERKKAHDKVYPKGYVEMLEQQQAWLVYGLQELYRRTSEGEGWPGEP
                     LKCEANGHPLTHDLLTRLGALDQSKGERFEESTESMQQELWKQNAGHMQRQDSSDGSS
                     ESAQSPVLPTRFSDAFARQPLTPPTFSPPLRQGPTIKTEPQIVPNTPSFIPPMAMHGD
                     VVNPLALQDPQQWPNSLGNFDDMDLMATADYNNLSFDDPVSSPMFNRQIPMNCMSYMD
                     AKNDYEDISQFLNANPPEITSS"
     exon            complement(126107..126797)
                     /number=1
     exon            complement(126881..126978)
                     /number=2
     exon            complement(127034..127141)
                     /number=3
     CDS             complement(join(130359..130657,130712..131146,
                     131229..131245,131342..131390,131555..131609))
                     /codon_start=1
                     /locus_tag="AO090020000044"
                     /note="Ras-related GTPase"
                     /old_locus_tag="AO070265000007"
                     /protein_id="BAE63291.1"
                     /transl_table=1
                     /translation="MADAPNKITITICGDGGCGKSSITLRLVRSQWIHEYDPTIEDSY
                     SVTRTVDGVPYFLAITDTAGQEEYRGLWAASNLKSDAFLLVYDITNASSLSALDYFME
                     MIDIEAEQRVEDNQRLLKELGDSAQGLEVGMPPPVKIIAGNKCDLKEGRAVGAKEGLE
                     YARKHGCGFMETSAREMVNIEETFALLVRRVVEARQQHYQKDRQAAHVPQTVGSLPAK
                     RSAATDQNKGAALKSFNEGSHSRPFCCGIFSGMERRSQGQQQTDGNKGSVSSKSTAPR
                     LWRRLSCW"
     exon            complement(130359..130657)
                     /number=1
     exon            complement(130712..131146)
                     /number=2
     exon            complement(131229..131245)
                     /number=3
     exon            complement(131342..131390)
                     /number=4
     exon            complement(131555..131609)
                     /number=5
     CDS             join(132136..132205,134050..134144,134221..134676)
                     /codon_start=1
                     /locus_tag="AO090020000045"
                     /note="predicted protein"
                     /old_locus_tag="AO070265000006"
                     /protein_id="BAE63292.1"
                     /transl_table=1
                     /translation="MGMTWTVTVHSSDGANNDAEIGTAPLPPHPKSAAGETSQYASIY
                     SSSGFDIMGVLAEVVSRPNPKINIGAVDLSCAFVLCDITQNDHPIIYVSEAFERLTGY
                     TEQEIVGQNCRFLQGPEGVVQKGMKRTFVDDETTSRLRSTIEDRTEIQASLINYRKGG
                     QPFMNLITMIPIRWSSQEYRFYVGFQVDLVETPDAVTRRNPSRVQV"
     exon            132136..132205
                     /number=1
     exon            134050..134144
                     /number=2
     exon            134221..134676
                     /number=3
     CDS             135183..136031
                     /codon_start=1
                     /locus_tag="AO090020000046"
                     /note="predicted protein"
                     /old_locus_tag="AO070265000005"
                     /protein_id="BAE63293.1"
                     /transl_table=1
                     /translation="MVLVGRPRFVYCLDHIASIGHGSLAETDVWAKLSKSGIVLFMTS
                     KARPVLGRMPDELIGKSLQDLMDSRAEAQKALGVARTGQRVTFSHKIRHKKGHMLPAQ
                     TTLHPGDTKEGVRPSFLVAHISFPKPPQGGNDELNSAPPPNRNLAVSKIHRQAVSGVS
                     GVAGQNMLASVKQANPQIQKLPFFTELVPTRGSSWQVELRELEKQNRTLSDELQKLLT
                     RRKKRKRKQSTASVEKSCAICQTKKTPEWRRGPSGERDLCNSCGLRWAKQVRNAAQVA
                     GRPNAY"
     exon            135183..136031
                     /number=1
     CDS             complement(136472..137614)
                     /codon_start=1
                     /locus_tag="AO090020000047"
                     /note="predicted protein"
                     /old_locus_tag="AO080527000048"
                     /protein_id="BAE63294.1"
                     /transl_table=1
                     /translation="MSSSLGAHKALVARSYPLFSTPFSPLPQHQFRRRDIYLTSRGHA
                     SSSKTHTRPSSSAQPATSRVPSTSSTATTSPANDVNPPPSTRPADLNLPDPVSRSAAT
                     ADKLKRYIAMGRAYLSFYKTGLKNVYHNYRASLPIRRSLGLPAYLPTSPPPAPPSSNS
                     QSNKSTAFRKAIESVKLSRSSFQLVRRAAYDVRRMIPFTLILIVCGEMTPLAVLALGN
                     AVTPFTCRVPQQLEKDRAQRVARKRAALVAQQAATSGSVTPPAAGSDLELDILVKMYT
                     NLEWIESASAEEILRACAVLNLVKTHTRSSVLLSLYRARLQRYAEYLSLDDQLIRRCG
                     GVRAMEGAEVRTAVEERGGVGVTEGKGGWDAERDERRWLEKWLERR"
     exon            complement(136472..137614)
                     /number=1
     CDS             137920..138624
                     /codon_start=1
                     /locus_tag="AO090020000048"
                     /note="amidases related to nicotinamidase"
                     /old_locus_tag="AO070265000003"
                     /protein_id="BAE63295.1"
                     /transl_table=1
                     /translation="MDIHTNKMSLDLNLPTALVLIDNQAAFTHPTYWGTSRSNPSYED
                     NILSLIQAFRAAIKNKTEGGNAKEIIHIFHSSTTPNSPLHREDPGNGIQPLDVAQPAS
                     DGSEVIMWKCVNSSFIGTDLEAHLRTRGIRQVLFAGLTTDHCVSTTVRMAANLGVVDR
                     YPDGPLTLDPEAGIHNQARVDRGRIILIADATATWAKGGFDAETIHAVSVASLDGEFA
                     DIMKTEDVVKALKQMN"
     exon            137920..138624
                     /number=1
     CDS             complement(join(138801..139760,139823..140134))
                     /codon_start=1
                     /locus_tag="AO090020000049"
                     /note="predicted protein"
                     /old_locus_tag="AO070265000002"
                     /protein_id="BAE63296.1"
                     /transl_table=1
                     /translation="MGNLLNLAILTMLVATLYGPVYRRLTVLGVLRKATDEVRLAAQQ
                     AFYRIEDTMQCEDLHYYTPTHQIFTACEDSVLPRFKWFPPLGNFEGPVDSTGSIHVID
                     PRTMKSTRLAFENFAGPLVTHGIEVLEDPDSPDAVYIFVVNHLPNMVYYHAGPHSQEI
                     PRACSQVELFHHVLGTNTARHVRSIRHPLIVTPNDIIAESPLSFYVTNDHFYRDGFKR
                     HIEDLFPAAKWSNIVHVQLDSLESEQAETGVDAKVALTGLQNNNGLGHGQSKGELLIS
                     SATSGIMYRGRTNPETRNISIVDEVHFDSSIDNPSYYTDPYRTSSEDAGGYVLAGLLR
                     CIDLAKTHANPNGKDGVMVWYTRPKAAKEEGGVVEWETRLIFEDDGTNIRSSSTALLV
                     PIEPKPQEKKKAWLFVTGFVSESVIAVEVLL"
     exon            complement(138801..139760)
                     /number=1
     exon            complement(139823..140134)
                     /number=2
     CDS             complement(join(140795..142057,142104..142318,
                     142412..143234,143446..143580))
                     /codon_start=1
                     /locus_tag="AO090020000050"
                     /note="predicted protein"
                     /old_locus_tag="AO070265000001"
                     /protein_id="BAE63297.1"
                     /transl_table=1
                     /translation="MSTSVSQASSVNPNTLITVKVLYNDNTRRFKIPLKELEARVLPQ
                     KLRQLLGIPRDVNVTLERLSDSAGCYIHLDSENNAVYKQLYRAAKAKLKLRIKVTEVD
                     SSASRSPLPTEDPSEHQDQVRYNYLQTVLSSPLPEGSAEAVSESPRDAAKPTPTEPDP
                     KQWSNTGVVAPEPHYQDFSLSQDNLSTPVVSHKSPTGVFCIDCNHCGLSIPNEHYHCS
                     ICDDGDYDLCLHCVDSGVTCPNEDHWLIRRIVKDGIVTNSTTETVAPRKLQTDVPKEA
                     PEKVEKKLEFVPEPVYEETPRTSPVAVEAPVHSEARICNACLKEFNETKMVTCLQCKD
                     YDLCITCLLKDAHGHHPAHNFTLLHDGPFCLKNLVLSRCKPGRRYQHAAICDGCEKVN
                     VVGVRHKCLTCPDWDYCSECFSHAPDTHPGHRFAPLYEAISEPSQDHEVHYGIFCDGP
                     LCKNKAVPGYITGVRYKCSVCYDLDFCASCEALPTNTHNRTHPMVMLKTPVRNVTVST
                     LQEDRFGGSTVALGDRAQRSPSTQALNLVEPEASNTDVPVKEESRLSQDSESVKQECS
                     LSREQLIKAEKSTNNAASGYDALFVRDTVPDSTIMLPNKVFRQTWTLYNPGPLAWPAG
                     SDVRFVGGDAMFNVDTNHPLSLDSISAAMESNKLTEPLESGQSAEFTATLKAPSRVGT
                     AISYWRLKLPNGMPFGHRLWCEIQVREDAPSIKGPSSLEPEGKHGSERTESQMIFPKL
                     EKESPDASAHEAGVVAPVPPSVSNPSEQDVLEDMESLSLGGHETENGFLTDEEYDILD
                     ASDQEYMDAKSRE"
     exon            complement(140795..142057)
                     /number=1
     exon            complement(142104..142318)
                     /number=2
     exon            complement(142412..143234)
                     /number=3
     exon            complement(143446..143580)
                     /number=4
     CDS             complement(join(144974..146369,146454..147109))
                     /codon_start=1
                     /locus_tag="AO090020000051"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000001"
                     /protein_id="BAE63298.1"
                     /transl_table=1
                     /translation="MAPRRRNIGASRRKRRDEEGEDEGSIDGELEDDSLSDGSGISNP
                     DDDDADGEGSDDSDDDGMSTSPQVAANGRRQINGRVPEINQELTPRHSVSPRKHPMTT
                     AVSDTEAMMNGLRILDESSEVMEVHFDDLKGESSHQTERTPSAPPTEPKRDTFLDRKR
                     REQERHIREKDESPVVVPTRGSFFLHDKRTTETVTNGHKPFNKSKSRPYGLIVDGNVR
                     RTSVKPVASEGLWTHDLHDTVAGDEPSVSKPSTTSALTSIIPPKPVPTAPRSSPPNRS
                     FSSTTLIGNVPVVVSLPGMEHPVPYPSVSKKQHTRLPQHRPPLRRDKPVRISLPGQPP
                     RYILPATERSFIFIPRALRPNQQTFRGRGRGGFYGGRRPSLYANSTYTSSITVSRRSS
                     FGKAPSQEGYHSPAGSVLSRHTMVTTENGKPVVRLPPPGRPPGSVGAIPQTTAGPVAA
                     PTTVPQPLPHPQPPNPVFRESRPAPIPMHQPRPQKAVSLADIETPARFPFNPPQPQQE
                     QPFHHQVPVSANGSGYGPDASGHPPPSAHRSLTPSSHVQDRTFHAPSHMPAYQQAFWP
                     ASYPPGAIYYPGSGTEFPPYNSAVGPGPSVPPLPPGQQPPYMVPVSHGSTEQPSLSGT
                     VAHEAGGTVYFYDTTQMPPNSSYAMPAAPGISTVMDMGAPPVPFYYYPYPQAGVYYPA
                     Q"
     exon            complement(144974..146369)
                     /number=1
     exon            complement(146454..147109)
                     /number=2
     CDS             complement(148169..149293)
                     /codon_start=1
                     /locus_tag="AO090020000053"
                     /note="nuclear localization sequence binding protein"
                     /old_locus_tag="AO070327000003"
                     /protein_id="BAE63299.1"
                     /transl_table=1
                     /translation="MSAIGEANHKKRKLPEVSEIEIDVSAPEPASKKALRKAKKKAAE
                     APPEPTTSEQQTEVAADHEENSKKRSDYGIWIGNLAFSITKDDLRKFFTSNCSFTDTT
                     ITRIHLPKSSEKNGKAQNKGFAYVDFSNQKATTEALGLSEQLLSGRRVLIKDAKSFAG
                     RPEKSQQENQKTGVAGAASGNPPSKRIFVGNLGFDATKEIIEEHFGKCGPVAHVQVAT
                     FQDSGKCKGYAWVTFEDLTAAEAAVKGFVMVNEDEEDEEVPGSDSENYKQPKKLKQRR
                     VWVNQIMGRRMRMEFAEDATTRYKKRFGKDGEGKKTQTTDVRGTEPFDDQDTTGRQPQ
                     RSRSAKTRQGRTDYSRYDQETVQKLSGAIVESQGKKTTFD"
     exon            complement(148169..149293)
                     /number=1
     CDS             join(149706..149800,149860..149976,150033..150873)
                     /codon_start=1
                     /locus_tag="AO090020000054"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000004"
                     /protein_id="BAE63300.1"
                     /transl_table=1
                     /translation="MSQDADEAQSVAESLPDAPAGAPTKQSYRSFKKKFAKLKVKFEL
                     GMRESESLIREELRIQDLSKRIQEQNDQLLEALLEFNDSIYISPDLRYDLNAPGDDLF
                     PPTPKRELSPSHNDPSLASSMLRNAKTDLALGLMKVEHYCDLENSVKRNEVFAPRMRY
                     TSLIRIPHTLPQPEENQSENIISEHSLGFFTPEHENEYYLATDAKLGDTSALMQLNDI
                     PEKLSFVEREREAALRNPISVYNWLRRNQPHIFLQDNENASEKSASRPSNLRTSKKAA
                     LNQSRKDEDLHDDDSILMDIGHGSGGSKGKRKREEDVGNKFKGSSSNRSSRKKKDDGS
                     SNVVKRSSKRTSGVGA"
     exon            149706..149800
                     /number=1
     exon            149860..149976
                     /number=2
     exon            150033..150873
                     /number=3
     CDS             join(151738..151958,152029..152986)
                     /codon_start=1
                     /locus_tag="AO090020000055"
                     /note="exosomal 3'-5' exoribonuclease complex, subunit
                     Rrp4"
                     /old_locus_tag="AO070327000005"
                     /protein_id="BAE63301.1"
                     /transl_table=1
                     /translation="MAITILPPVVDHVDICPSDSDMDSMSVDSDGGVDLATGRTSRPS
                     KRPRLVEGTDITSGVVTPGEIVTDDPQWMRGHGTYINPLSTSIIATVAGTVQKTNKLL
                     SVQPLRARYTPEIGDLVVGRIVEVQSRRWKVDVAAPLLAQLPLSAINLPGGILRRRTS
                     ADELQIRTFFSEGDLVVAEVQTVHSDGAASLHTRSLKYGKLRNGVFLAVTGTGGSGAS
                     SSMVKGGVGSGPIPAGAMGASGTGGVVRSRRQVWTVNTANGGGDVDVILGVNGYIWIS
                     KHADDTAAACSTTDSVSITRMEEMVSSSIYSSQNDDIPPQTRREIARLAQCIRVLVQG
                     GVRVDEENVMSAYEASLQVDLEVGDDDDDDDDDRRREGREYLEGNKARRILELVLERN
                     "
     exon            151738..151958
                     /number=1
     exon            152029..152986
                     /number=2
     CDS             join(153871..154061,154215..155451)
                     /codon_start=1
                     /locus_tag="AO090020000056"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000006"
                     /protein_id="BAE63302.1"
                     /transl_table=1
                     /translation="MPDLRRQVLESGKTISRKAASREGSRRTSRTNSAQNSHQSSRNA
                     SRHPSDEEDSGNLSDDTALSIGSLDDLTDNPEVDSNNWAQELRDVIQEIGDRKRSSVQ
                     SREECYAAFCRLLKCHYVEEHVRSSLDELLDAFCRSIKLESSVRETTLALRALELLVI
                     TVFEDTNYRNVEPILTRTIRDSTSNLVKAAAIHCLGACAIFGGAGEDGILDQMTFFLD
                     IAASDGQSIDAADDPSSVTAALQEWGVLAVEIEDLEGESEEAIQIFMDQLNSSESPVQ
                     IAAGENIALLYEKSYTPQEDDDDENSEHDTDDESLDDRQGPKLIKRYDAYHNTHELEQ
                     QLQSLATVHNKRISKKDKKNLHSNFVSILTTVEDPRRGPMYNTAIDQETNRHYGSKLT
                     VKIGRQGVMNIDRWWKWIRLNSLRRILQGGFAVHYYQGNRAVLDSLPVMVRQPTPADR
                     GAAKKTVKSRNSRRWAVHEQSDEEY"
     exon            153871..154061
                     /number=1
     exon            154215..155451
                     /number=2
     CDS             complement(155847..157289)
                     /codon_start=1
                     /locus_tag="AO090020000057"
                     /note="oxysterol-binding protein"
                     /old_locus_tag="AO070327000007"
                     /protein_id="BAE63303.1"
                     /transl_table=1
                     /translation="MESDVSQEFFDAVDGGSSSPLLKIKGDSDDEGANDFSDATARQA
                     EDKVVVDDAPSDSEDEVSETPTPQGDRYAPLFPAKPKSLTPLPLSKVPRRSNIPAPTV
                     MPPSLIGFLRKNVGKDLSQISMPVSSNEPFSLLQRAAEVMEYSVLLDHAASASDAVER
                     LLYVTAYALSSLSCNRVKERSIRKPFNPMLGETYELVREDLGYRFIAEKVSHRPVQLA
                     YQADGKDWSVAQSPMPTQKFWGKSAEIVTEGKMRLTLHTTGEHFSWSNATSFLRNIIA
                     GEKYSEPVGEMSVVNETTGQKTVSAFKAGGMFSGRSEEVVTKTLDSSGRELPLGLTGT
                     WTTSLQMTKNGSATAPVWNAGPLVPNAPKHYGLTVFAATLNEITPIEDHKLPPTDSRL
                     RPDQRALEDGDVDQAEEVKVKLEESQRARRREMESAGQTWNPRWFTRVDDDLVGNEGE
                     VVWRLKSGKEGYWEERSKGNWTGVVPVFET"
     exon            complement(155847..157289)
                     /number=1
     CDS             complement(join(159521..159771,159893..163550,
                     163639..163818,163882..164061))
                     /codon_start=1
                     /locus_tag="AO090020000058"
                     /note="transcription elongation factor SPT6"
                     /old_locus_tag="AO070327000008"
                     /protein_id="BAE63304.1"
                     /transl_table=1
                     /translation="MSARDLVEGEAMLDDEENEEELADDYDGEGEAHQGAGTANPYDS
                     SEEDDDDDDDEEAARAVREGFIVDEDEELEDRAERRREKRKRRREEREREDEHLDEED
                     LELIGELNPSLQAPVAAESKFKRLKRGHKDRDLRQPSQGIDDIFNSDEEEEAAGDYGR
                     HGHRRHMHDEMDDFIEEDVFSDEELQREREDLEIARPAKKGMTGLGATDAAGLDENAL
                     EDMRAAFGDGNEYLFALEMEDQEEEQEEDEEKHLDLKDVFEPSQLAEKMLTEEDNQIR
                     LLDEPERHQIARKPYRNVVLTEEQFREEAAWISNLMLLKKRIEPELREPFQRSVAKVL
                     EFLVTDDWEVPFIFQHRKDYMIHAVKAPVEGAGEDGDASQYTVRAEKLLNMTDLWDIF
                     DHDLKFKALVEKRNTIQKTYDNLQSLFNVSDSVVEEMLPAAVTMEELQDVQDYIHFQY
                     ASQLRDMTLMNSDVNGETHRRKASSKTFFERVRNGKAYGLVRAFGITADAFAQNALKE
                     GRRQYTEDPAERPEEMADGFVDNDFSNASHVIKAAKSLFAEEIVMSPKMRKVIRQAYY
                     MNGAVDCFRTEKGLRRIDEQHPYYEFKYLRNQQLSDIARRPELYLRMLKAEEEGLVEV
                     KVRFENFDQFRQRLYPDIESDNYSEIADGWNRSRRDVLDMALGKLERLINRSVKENIR
                     QECENHVAKECRETFSQRLDQAPYKPKGMVLGTVPRVLALSTGSGVVGREPIHWAYIE
                     EDGRVLENGKFVDLSIGDRDRNIPDGKDVEAFVELVDRRRPDVIGVSGMSPETRRLYK
                     LLAEVVDKKDLRGAPYTDDHDEEISDRLEVIIVNDEVARLYQHSERAKKDHPSFAPLT
                     HYCVALAKYLQSPLKEYASLGRDIVSIQFKPGQQLVTQELLLKQLETALVDMVNLVGV
                     DINEAVTDSSTANLLPYVCGLGPRKAAHLLKIVNMNGGVVNNRVELLGVNAQYPAMGV
                     KVWNNCASFLYIDFENVDPDADPLDNTRVHPEDYDIARKMAADALELDEEDIKAETDE
                     NGTGAIVRKLFREEAQDRVNDLILEEYAEQLEKNLNQRKRATLETIRAELQQPYEELR
                     KQYVFLSTDDIFTMLTGETSDTLAEGMVVPISIKRVSDDHIDGKLDCGIDALVPESEL
                     TDRYDIPVRALYSPHQTVSAKILFLNRKNFTCNVSLREEQVSRPVSNTQDRLRGEWDE
                     RQEQQDRESLQEKTQSGGRTMRVIKHPLFRPFNSTQAEEFLGSQSRGDVVIRPSSKGH
                     DHLAVTWKVADGIFQHIDVLELDKENEFSVGRTLKVGGRYTYSDLDDLIFNHVKAMAK
                     KVDEMMLHEKYQDGTKDATYSWLETYTKANPKRSAYAFCIDPKHAGYFFLCFKAGENA
                     RLHSWPVKVIPQGYELQRNPYPDMRALCNGFKLLFTNMQAGKRR"
     exon            complement(159521..159771)
                     /number=1
     exon            complement(159893..163550)
                     /number=2
     exon            complement(163639..163818)
                     /number=3
     exon            complement(163882..164061)
                     /number=4
     CDS             join(165480..165767,165818..165975,166043..166580,
                     166642..167229)
                     /codon_start=1
                     /locus_tag="AO090020000060"
                     /note="mitogen-activated protein kinase kinase (MAP2K)"
                     /old_locus_tag="AO070327000010"
                     /protein_id="BAE63305.1"
                     /transl_table=1
                     /translation="MADQFKARTLKRKNVKGLALNAAPKPLSNPSDGDAQVPGAIGNT
                     DSNRTDTLEIGLEFRLDLRSEDLITLKELGAGNGGTVSKVMHASTKVVMARKIIRVDA
                     KENVRKQILRELQVGHDCNSPNIVTFYGAFQNEARDIVLCMEYMDCGSLDRISKDFGP
                     VRVDVLGKITESVLAGLVYLYEAHRIMHRDIKPSNILVNSRGNIKLCDFGVATETVNS
                     IADTFVGTSTYMAPERIQGGAYTVRSDVWSVGLTVMELAVGRFPFDASDSSAGDRASA
                     GPMGILDLLQQIVHEPAPKLPKSDAFPPILHEFVAKCLLKKSEERPTPRELYDKDAFL
                     QAAKRTPVDLQEWAISMMERHNRKSYLAPPPPKSLKDEKEESPRRSPAPKPALSKSSR
                     TPHYTPTSGEIPVNMVNEMSSHSRHYHVPPNPSPRPSRSTRSPPTISLEHLSLETKDD
                     DYRSGRRPSRAHLGDPVSALEPPSRQHIASRSASSHNMKSRMPLQTSAMPVRAAPPPS
                     GPLPPASVPGTPWQR"
     exon            165480..165767
                     /number=1
     exon            165818..165975
                     /number=2
     exon            166043..166580
                     /number=3
     exon            166642..167229
                     /number=4
     CDS             complement(168821..170806)
                     /codon_start=1
                     /locus_tag="AO090020000061"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000011"
                     /protein_id="BAE63306.1"
                     /transl_table=1
                     /translation="MSTEPAIRTAQDDLESRTSIDQTPRETRPRRSRRKKDEGQDAGR
                     KDTPKPTKSKTKEKEKEKEPETGRQNDKELDKENHKDKESRDKEQDPKESKRGSRRQR
                     DKSSSTSANPSNSSSTHARKKPKLEATPPDQSPSVPATSATAAASPPATTTVTTSTTA
                     VTTAAPAPAPSAAPAAAAAPAPAPVQVPSTPAASPPASSGSIHLLQSHLHQQHRSPLH
                     PSPSLPPSSHPTPPPAALGHPSSYPTMAPTGPPRPQSQPPPPPPTRTSGQNFDPIRSA
                     FDTASPAPTPGPTSTFSPPARPLSPRPTFRASASPAIASIIDPPTTTSPSVYAPRPYA
                     SPNHGASIYSPSPAATPIIAPTPHPPPQPISPYAHRSPYPTPSQLQPSHDSQLSGHSS
                     SQGPPPPPAPPHLSAAPEPPAPAPSNNHRAPSPGPTPMDVDTDQHAAPKAPKKDTKAP
                     PTAPPSNAASPKPSRATKEPPPPLPQGSGLISNALFGVGDAASTSDSDSRRTPSIIIH
                     IPLQGTGNRIVNFARLAEEQYGFAALHPRLAAHKERLARVAAAGAALERNDKSGRGLS
                     AGESADEDLSLEVERDSDLDGDSALGSAAARTNGPEAPDGKKKRRKKKMEEYDRDDPF
                     VDDSELAWQEQAAASKDGFFVYSGPLVPEGEKVQVER"
     exon            complement(168821..170806)
                     /number=1
     CDS             172001..173320
                     /codon_start=1
                     /locus_tag="AO090020000063"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070327000013"
                     /protein_id="BAE63307.1"
                     /transl_table=1
                     /translation="MAFRGERFVVDLDSDDDQSSSAPPASSISLPGLIGEIRERSPAA
                     PPAPPKPAAAGFPAHRRRVKQSAFRQRREDSSTTNTSIASQNDEKRIIDDENRRQLAT
                     MSHDQIQQEREELMASIDPSLLERFLRRARIDSEESKTDTRSNPPVSIKHQVDPAEAA
                     APPPEPVSESKPLTSRDEQTHRDDLPPPQMPDDLRPAFESPLPSSVHFPTPPSQLNPM
                     PNLDPSSPSFLSDLQAHYFPNITHDPSALSWLQPPSTDSDAPDATSAYHPASNAEAVH
                     PAALRFSFLGTLLSPTTSLALPTDLGLHHHGKDPHAAGYTIPELAILSRSSFPAQRCI
                     AWQVLGRILFRLGKGQFGERGSTLVEGLWSVIEREGVVAGMLAEADGTSNGATRSEKQ
                     EQDSARSKGGIGHHASATAWAVEGVWLWQMGGGGDRGVLKEGAVRSQ"
     exon            172001..173320
                     /number=1
     CDS             complement(173709..179960)
                     /codon_start=1
                     /locus_tag="AO090020000064"
                     /note="anaphase-promoting complex (APC), subunit 1
                     (meiotic check point regulator/Tsg24)"
                     /old_locus_tag="AO070327000014"
                     /protein_id="BAE63308.1"
                     /transl_table=1
                     /translation="MATVRSLGLHQPSAIPFLVAEGLLNPDPSDDHYAWTSSVDIGPN
                     GPVEDEIVWTKGCVVWSRAGVVQRVYRLDLEKEEIRHALLTNFSVDQLKRTNGNASQA
                     TKEGFFRTSNDPGRSRGLHGQQNGEEPRLEASGVTLNIRGRGAQGGNGSDSTRALVVV
                     LKSQAHIFFLAGNSHVVPLPFEVDSIFATPKGLLFQRKMYEEDNKDTSLCPMAPPNSF
                     MSTLPMTADFRASQSLEVPSSKGKRPSLTVSPAPGTSLRSPRKQPDLPRVFSLMDPYS
                     EMGLVVTNQTSRFLQSSVTSRPSGLDVLGAADEIIYVSPRDELLESNRNLISGPLILV
                     VTVNVNTGLYTIWTARYREDEANPSSKKRGRRETGGTWSKRRSSHFGMATGTTTPGAR
                     PSAARESFGPRGDNWNTPGLSHSQYSTDGKPDEDDLASKLGQDFGDIGVPLKTSRRVS
                     SLLARADLATGQDRITFSDLATGSQSSSMPHGNFRQSIGAASSRGSFGFNPRASLPPG
                     NGSVYSTTTSFADAPVDRLLEELNSESLFEGLDNMDLKESASGLPEEVLLSKVESFSS
                     RFSENFQTPVKSKSARKSKIITVCPSEGANSQNGNSAALALCVVEQAAKFMTVVNLRA
                     DRVSIPKKDPVFSKRMKKRKPPDERSLLVQATSVQHFSGICDACKITDGEISRIMTLS
                     MADDGQHELLLQTPWSRPITVNVPEKLMLYEPYGISATASVNRPRESGMNRLMTDSFT
                     ITGLDHATIRGRVDLIDSEKRKHRLQIQMEPSNELVKRVFRICRFVLPDSEKAGDGIL
                     TAWWETVKWLRESETTESDLEWTALVVVLFAMAIPFIDSDHSRTPAQRTRRKKALLRS
                     SSGSHVDLESWETMLDQESGSAGVVSSWINNSAWGWIVDQDAEEERSAPSRRKSVKTE
                     QPGSSRLTHRKNSYLLRCAALTREFLQTPKGIAAVGSDGHLPTALSYSQSLRQTALCT
                     ILVGLHLLREEQKLSICESEESRKTLGLLAPVLAQIGGWLGWKSWTWSENAYYGLEIA
                     GINRWQFEDTRISMLDVPQEQFTPPSVFSYLETGWRQSSSPFFTLLNLVTGSEYTPRK
                     GKMWQECFMLTPRTLALDGFLSEVHNFSTPLDRIKLLHRWGFTRSIIETFPEGVSAPL
                     YEAIMRSQIHASTSWSATLLELVDREDLSISMRTHSPCTPSAWQPAVSHEAMRDVHHI
                     GVSALDIDAINSFEASAEADRFSVTKLIFREDKRFIEAARLLNQSKAPVAECVPEPDW
                     NDSDLLEAQKEVVQLVTLRTLSIPTGRAMLAFSGRLPLLTEKLPIPSFSLQCVMKPSN
                     VTISADRTSFSEEKVCWAFFHNGVSTGLAISKNSKGIDTSWILFNKPQELTNRHAGFL
                     LALGLNGHLKSLAKWVAFKYLTPKHTMTSIGLLLGLSASYLGTMDTLITRLLSVHVTR
                     MLPLGAAELNLSPLTQTAGIMGIGLLYCGSQHRRMSEVMISEIENVDQEESSAGREDL
                     RDEGYRLAAGFALGLINLAKGKDLRGMRDMHIVERLLAVAVGTKNVDLAHVLDRATAG
                     ATIALAIIFMKTNDETLAQKINIPDTTVRYDYVRPDLFLLRTLAKHVIMWDKIQPSDE
                     WFVQSLPGIYRRRYRLTGVRRLKSEDMPFFNIIAGLCFTLGLRYAGSAQTAVRDILLS
                     YLDQFIRICRLPAVNYDGKLSRNSVRHCQDVVALSAATVMAGTGDLPLFRRLRSLHGR
                     VDTDTPYGSHMAAHMAIGLLFLGGGSYTLGTSDLAIASLICSLYPVFPTSVLDNKCHL
                     QAFRHLWVLAAEPRCFVPRDIDSGRPISMPITVTNIGGSTRKITAPCLLPELESIAKV
                     EVRSTDYWPLVLDFTLNSALREKFRHGDQSVYLRRKETYNPTGSSAFVSTLSGLSEAQ
                     DVLPSSTSASNHGKGLPPAAWPNIATLLSGTTAPTPPPSPSQSMWEWIFNLKSLQGLD
                     VREKALVLPSSFPAHTRTPSTNVVSYAPWLRQSAVDSKLVVENIVQNLARLHPDEIRD
                     RLWQLRLLFNWVDSCSDERVPVIEKEIETSNDAIPRVSGQSQGLWLRQDFVEEARWKV
                     WGVQTDDYA"
     exon            complement(173709..179960)
                     /number=1
     CDS             180481..182445
                     /codon_start=1
                     /locus_tag="AO090020000065"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000015"
                     /protein_id="BAE63309.1"
                     /transl_table=1
                     /translation="MFSRSALTVIFSCSYQLPHRVYTAKGYPVLAPNGSSIIIYGYEN
                     GLKVIWRGGRPFTSRKPSAPKDQPQEKTNRSNNDIMVIDSDDESSAETQQNEEPSYGF
                     EEDEPEIDPLFPYETVLRQIDIPLGTRVVELAVPRILPETARSSLDPFPPILRKLMVI
                     SAVCADLSTRVVTLPLTPPHPAQFELSSWVQALSISGGVSHQEIPRGVGIALTYQASE
                     PQGDEDMAQSQSGSNGNGPGRWDLLIATHSAESSGLLIIHRIPVVEETDHNEVVYRLS
                     EDDIESKRRYLPAPAQNIAFNPSPYPSPRHSTLLVAFHSGCVKVYSCFSTKPYKASRR
                     SSSPQSDFETSETEGKWLISLYPGFEQSPPGPPRRKTIVNAEWVLGGRAIMVLMADGE
                     WGVWDLEGAGPGTMKGPLQRQSSVQGVTGGSLTAFSVSGRVLGPLSGARAETGGPIAE
                     QRPKFAPLTPHTKRVREDTLLKGAMVRSIIPSLCGEISVYQTNSYRDTLPDESILLRH
                     GNQSAVIPSLLSLWRNAVKATGTFDASNRCRVSAIQDITLMGEHLKGIGHLPAASRQT
                     RQAEGGDHDALLITEHRIIILTPRLNEPDESPALLGSVDETPTAETDQLRLRRGELDV
                     EGMDRLLSGMTSSNQTLRMGSPIKRARIFT"
     exon            180481..182445
                     /number=1
     CDS             join(183530..183551,183672..184128,184259..184718)
                     /codon_start=1
                     /locus_tag="AO090020000066"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000016"
                     /protein_id="BAE63310.1"
                     /transl_table=1
                     /translation="MVQQPKQEKVWASLITNLSYLPGILTLSHSLQTTETAYPFIALY
                     TSTFPAEGLAALHARGIRTQAVPSVQPGQSRVFLQDPRFNETWNKLIVFSLVEYDRIV
                     LLDGDMLVRKNMDELMDVPLDGPGSGLSSEENKQERVFAASHVCACNPLNKPHYPKTW
                     IPKNCAYTSQHSDPVRAQTSGAPAATGVAMLNSGLLVVRPTISAWAEIQARLHMPDRT
                     DKYTFPDQELLSDVFRGRWVVLPYVYNALKTLRWEGVHDDIWRDDEVKNVHYIFANKP
                     WHEDPDDGMDEPSRWWWEVNRQRQQLEVKKGITDGH"
     exon            183530..183551
                     /number=1
     exon            183672..184128
                     /number=2
     exon            184259..184718
                     /number=3
     CDS             complement(join(184992..186166,186230..186458,
                     186514..186937,186993..187064,187138..187207,
                     187310..187334))
                     /codon_start=1
                     /locus_tag="AO090020000067"
                     /note="predicted translation initiation factor related to
                     eIF-3a"
                     /old_locus_tag="AO070327000017"
                     /protein_id="BAE63311.1"
                     /transl_table=1
                     /translation="MAAPTQLAFRTVKGIGILDAAPVYEPLSGFERPEGNLRCSAYSP
                     CGRYFAWASPEKVTVIDPSVGHIITNIPAENVFELGFSPLGTYLITWQRPSKDANGDA
                     VKNLKVWKIVETAPDSNGDEHTIVGSYVQKSQTGWNLQYTSDERYCARVVTNEVQFYQ
                     SDNLSKVWNKLRVEGVIDFAVSPGKSQSVAVFVPERKGQPAAVKVFMVPQFGAPVSQK
                     TFFKGDKVQLKWNASGTTLLVLAQTDVDRSGKSYYGETTLYLLGATGGFDSRVDLDKE
                     GPIHDVTWSPNSREFGVVYGYMPAKTTIFNFRGVPQHSFALAPRNTISFSPHGRFVLV
                     AGFGNLAGQMDIYDLEKNYFKIATVEASNASVCEWSPDGKYILTATTSPRLRVDNGVR
                     LWHVSGALVYNEEMHELYDVFWRPQSTTQHPLGDPFHPLPTPHPSAVAYLSTRKAPVK
                     PAGAYRPPGARGQLTPLAFKREDQGGATFIRDGANGGALNGLGKPRRREIPGADPVEE
                     YLPPGAAPGGGVVLPPGADQPEKLSKSAARNKKKREAKKLKDGEDGQPARSPESHGDK
                     GHHERSRSKANNSERKNANQANGASPASTKPNNNAAVEAAGTPTAQEKKIRGLLKKIR
                     AIDELKMRLAGGEKLEDTQLKKIQTEESVRKELESLGFNG"
     exon            complement(184992..186166)
                     /number=1
     exon            complement(186230..186458)
                     /number=2
     exon            complement(186514..186937)
                     /number=3
     exon            complement(186993..187064)
                     /number=4
     exon            complement(187138..187207)
                     /number=5
     exon            complement(187310..187334)
                     /number=6
     CDS             complement(188457..189134)
                     /codon_start=1
                     /locus_tag="AO090020000068"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000018"
                     /protein_id="BAE63312.1"
                     /transl_table=1
                     /translation="MTSTTTLEAERADRISRLAGLERVVAARTGGGSQSNTAVPMSHA
                     PGYFDTSSTLKERSTVGSASATGSVGARTTWASGSDAFDADKMSEEPDDGTSSVGNLS
                     DEGNASLVGFGEGASTISGPISHPNLNRTSSVGRPNSLGSPSIPRANPIPSSSQQSGD
                     GGMIPVALSPTGSTTPEPVQDARMVDGMTYDPDVVDTTVRTPRLATPLGRDDPSNMQG
                     DRGSGLL"
     exon            complement(188457..189134)
                     /number=1
     CDS             complement(join(192860..193641,195279..195291))
                     /codon_start=1
                     /locus_tag="AO090020000070"
                     /note="protein involved in establishing cohesion between
                     sister chromatids during DNA replication"
                     /old_locus_tag="AO070327000020"
                     /protein_id="BAE63313.1"
                     /transl_table=1
                     /translation="MDEADPPKKKAASQQPVLKQMQLDLGHEVRRTCATCGMEYVPSN
                     SEDAALHKKFHDMNSTGVDLGKAFMRANASRWVYEATRFDEGYVVIVDRKASPTAKNQ
                     AKKVLEVINKELSSPEIQDDVLWSQTEPPTHLRKNGVSEKVDRYKVFLHMKDSRCVGA
                     CLTERIWESRPVEKPSSQTNRTDPAVTVRNETHPAIVGISRIWTSGSSRRKGIAMDLL
                     DCVVSNFIYGMEIPKERMAFSQPTESGRALAQSFFGDDEWHVYEES"
     exon            complement(192860..193641)
                     /number=1
     exon            complement(195279..195291)
                     /number=2
     CDS             join(197889..198200,198277..198753)
                     /codon_start=1
                     /locus_tag="AO090020000071"
                     /note="protein required for 18S rRNA maturation and 40S
                     ribosome biogenesis"
                     /old_locus_tag="AO070327000021"
                     /protein_id="BAE63314.1"
                     /transl_table=1
                     /translation="MQSEHNEPYANRIQLSGTQSCPPPELPQLVAEQHVPIAANDKET
                     QRLIVVLSHASLETYRASHGGRNGAGRDEKYSLLNSDEHIGVMRKMNRDISEARPDIT
                     HQCLLTLLDSPVNKAGKLQIYIHTAKGVLIEVNPSVRIPRTFKRFAGLMVQLLHRLSI
                     RSTNSQEKLLKVIKNPITDHLPPNCRKVTLSYEAPVVRTRDYIESLGPKESVCIFVGA
                     MAKGHDDFADSFKDDTISISNYSLSASVACSKFCHAAEEVWDIV"
     exon            197889..198200
                     /number=1
     exon            198277..198753
                     /number=2
     CDS             join(201425..201600,201658..203203)
                     /codon_start=1
                     /locus_tag="AO090020000072"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000022"
                     /protein_id="BAE63315.1"
                     /transl_table=1
                     /translation="MPVSHLTLTVSHLPTSTSFFLSCLQPLGYQFIGRHDDYIGFGQN
                     PGEPADFWITEQKPGVPAGAAHVAFPAPSKDAVGQFFIHALKAGGKIHGEPKTRDSES
                     GYYSAAIIDVDGNSIEAVYRPSSSSARSEVSRSALALLENGSVVSKTAPSIVSKATSK
                     ASSVKPESVASPRSEARSYVSKATTAVERAAPSVISREVQPAPSPTYVVHHTTQKTDD
                     GMAAKTIVGTLIGAAAGAAIAYAMSKGDSEPSETTPPPQYTPRDLAQLISPSQAQSPS
                     QELQGFRAIEAPPARSVYSHSEVRPTLTRSVTSKNPRASTIYEGSEFVPRGGGGSVYL
                     DQNGRRSSEGSVYSGSDYPIRAIEYPPSVDSRGYEATLISSFHDKSRAMDNGSVYSSS
                     TIRPSKANYQDHHSSHSSHHSSHHSSRHSSRHSIARSHSSSTVSATRSACNVPLPEGS
                     IASFASSRSGAKSGVSARNIPLPESVYDDVDVETNVTPDDSISQVDDSRRSSVSHRSH
                     VSKAASRISKHSSKFDEPVKPSDSVSQVSSHASRASQRTIKAGGSVAGGSKAPSKVSS
                     RRGSQVA"
     exon            201425..201600
                     /number=1
     exon            201658..203203
                     /number=2
     CDS             complement(join(204332..204471,204527..204710,
                     204853..204882,205033..205078,205251..205294))
                     /codon_start=1
                     /locus_tag="AO090020000073"
                     /note="ubiquitin-protein ligase"
                     /old_locus_tag="AO070327000023"
                     /protein_id="BAE63316.1"
                     /transl_table=1
                     /translation="MALKRINKELSDLGRDPPSSCSAGPVGEDLFHWQATIMGPGDSP
                     YSGGVFFLAIHFPTDYPFKPPKVNFTTRIYHPNINSNGSICLDILRDQWSPALTISKV
                     LLSICSMLTDPNPDDPLVPEIAHVYKTDRGRYEATAREWTRKYAI"
     exon            complement(204332..204471)
                     /number=1
     exon            complement(204527..204710)
                     /number=2
     exon            complement(204853..204882)
                     /number=3
     exon            complement(205033..205078)
                     /number=4
     exon            complement(205251..205294)
                     /number=5
     CDS             complement(join(206680..206726,206799..206908,
                     206972..207887,207994..208216))
                     /codon_start=1
                     /locus_tag="AO090020000074"
                     /note="glutaryl-CoA dehydrogenase"
                     /old_locus_tag="AO070327000024"
                     /protein_id="BAE63317.1"
                     /transl_table=1
                     /translation="MNRSLLRAASRRLQSASHVHNAPTASLNASVRGFATAFNWEDPL
                     AASELYTEEELAIQDTARQYCQERLLPRVLDAYRNENYDRKILEEMGELGLLGASIEG
                     YGCAGASTVASGLITKEVERVDSGYRSGMSVQSSLAMTAIYEFGSQELKDRFLPGLAK
                     GKIAGCFGLTEPNHGSDPGSMETVAREHPTKKGYYSLSGTKTWITNSPISDILIVWAK
                     LESTGKIRGFVVERDQCPPGTLETPAIKNKTALRASITGMIQMDDCPVPKENMFPDVE
                     GLTGPFTCLNSARLGIAFGAMGALEDCLSRARTYALERKQFKGNPLAKYQLIQKKLAD
                     AATDAAYGTLAATQVARLKDEGKSTPEMISMIKRQNCDRALANSRILQEVFGGNATSD
                     EYHIGRHVANLFVVQTYEGQSDIHSLILGRAITGVQAFV"
     exon            complement(206680..206726)
                     /number=1
     exon            complement(206799..206908)
                     /number=2
     exon            complement(206972..207887)
                     /number=3
     exon            complement(207994..208216)
                     /number=4
     CDS             complement(209370..209951)
                     /codon_start=1
                     /locus_tag="AO090020000075"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000025"
                     /protein_id="BAE63318.1"
                     /transl_table=1
                     /translation="MITFAAVFLLKIAARSCSSCIPSKPGKQNSIASAGLSIDIAYVR
                     ALVGRVIEMMVSCSRRASERHLSHHIARGLRKMLTGLEEWERRNSYNGQPTGQSFRDP
                     SQNSMFKPIIIPGAQPLGERDTILNHPPPLLGIAPLSAERGSGLESAAAQSKQQPGLS
                     EGSVDPMMADLWGFDEEYFPTGVFDFLQSQMPA"
     exon            complement(209370..209951)
                     /number=1
     CDS             complement(join(210546..210552,210695..211770))
                     /codon_start=1
                     /locus_tag="AO090020000076"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000026"
                     /protein_id="BAE63319.1"
                     /transl_table=1
                     /translation="MKRSRLDFEANGDASSASPPRGALPYPASEANSRRESIHVPKIS
                     RKIRACTECKRHKVRCDMKAGESVCSRCRRMGLECVVNKSLQTLLDDEAEYVRFVSFQ
                     PGFHQAVSLLTRLYTLYRWKTTIELAMADLLRKAQLPELSYYQAVGKSAETPHKKSGR
                     RGSTVSTDDIHTSRGDVGRDATDGGAKSVDGISHPPSHTTQQRSQIAIDREEKLLVTA
                     PMGSLYEVTQLSDIQERTPERHHTSDRDTDLISRGTVDPQEAEELFCFFDQVLNRYLW
                     DGIALVHKDLTSVRNSSSMLSAAILAVTALHMPQKERLFDTCYTEFAKLASESMLDRH
                     HTLDDLRALCIGAFWLADVSWKLSGI"
     exon            complement(210546..210552)
                     /number=1
     exon            complement(210695..211770)
                     /number=2
     CDS             join(212561..213118,213178..213699)
                     /codon_start=1
                     /locus_tag="AO090020000077"
                     /note="5'-3' exonuclease"
                     /old_locus_tag="AO070327000027"
                     /protein_id="BAE63320.1"
                     /transl_table=1
                     /translation="MSIYSFLIAVRSEGQQLMSDTGETTSHLMGMFYRTLRMVDNGIK
                     PLYVFDGAPPKLKSGELAKRTARKAEATEAHEEAKETGTAEDVEKFSRRTVRVTRDHN
                     AECKKLLKLMGIPYIDAPTEAEAQCAVLARAGKVYAAASEDMDTLCFEAPILLRHLTF
                     SEQRKEPILEIHLSRALEGLDMDRKQFIDLCILLGCDYLEPIPKVGPNTALKLIREFG
                     SLEKVVEHMESDPKKKYVIPEDWPYQDARELFLNPDVREASHPDCDFKWEAPDIEGLV
                     EFLVKDKGFNEDRVRNGAARLQKNLKTAQQSRLEGFFKPVARTDEEKANLKRKHDEKL
                     QEQKKRKKEEAKAKKEAKARPRGAG"
     exon            212561..213118
                     /number=1
     exon            213178..213699
                     /number=2
     CDS             join(220889..221742,221814..222774,222838..223314)
                     /codon_start=1
                     /locus_tag="AO090020000081"
                     /note="phosphatidylinositol-4-phosphate 5-kinase"
                     /old_locus_tag="AO070327000031"
                     /protein_id="BAE63321.1"
                     /transl_table=1
                     /translation="MHSLGHVSARDPRDGGRPSMTHEQDFARKSTDAGAGAGSATASI
                     ASQQPNGTSLNPRSPNGRPMMNGDHVRRSADGLVSSESIGNVSETWQSTPQPNDTGRL
                     SPDPGRLSPSPKSPHRYSSPPLPSSTEQPEPANTGLRHRHTLQVPRNPSGRRSSRDHS
                     EDAAYSSGRLSPTGGVRRTSFSLGRRASKTNRSDTFLDEANPDEDAARWAEAIKQRRA
                     SKRRRRDDDDDDRVIVGTKVDQNHVNWVTAYNMLTGIRFTVSRINAKMDRELTSADFE
                     AKHKFSFDITGNELTPSAKYDFKFKDYAPWVFRHLRTKFRIDPADYLMSLTSKYILSE
                     LGSPGKSGSFFYFSRDYKYIIKTIHHSEHKLLRKILPEYYKHVEQNPNTLISQFYGLH
                     RVKMAYGRKIHFVVMNNLFPPHRDIHQTFDLKGSTIGRDLREEDLEKNPRATLKDLNW
                     VRRERHLECGPSKRDFFLAQLERDVELLKRLKIMDYSLLVGIHDLERGNEEKLRDKTL
                     QVFQPGGDREEEANPNMLMRTPSKLENERKARELRMSLKRERPVPLDKATAKMPEEIL
                     DERKFHVFYSDDGGFRATHENGQPGEEIYYLGIIDCLTHYGMVKRLEHFFKGLSHDRN
                     QISPVPPEGYGDRFVKFIKGITMSKEEAVRCRESRQLGRTSAERTPSVERTIQAAEKE
                     AAKDVSFTHPRTLSTVRDPTDTNSTGPTSTLPIVDEAGEASSVGGQSQHSRHGAPSAS
                     EKKLPPLPNQDHLRPDGKRRAIA"
     exon            220889..221742
                     /number=1
     exon            221814..222774
                     /number=2
     exon            222838..223314
                     /number=3
     CDS             complement(join(224836..225090,225171..225566,
                     225909..226727))
                     /codon_start=1
                     /locus_tag="AO090020000082"
                     /note="transcription initiation factor TFIID, subunit
                     TAF12 (also component of histone acetyltransferase SAGA)"
                     /old_locus_tag="AO070327000032"
                     /protein_id="BAE63322.1"
                     /transl_table=1
                     /translation="MDGSQVPAAQPMVTQHSNLIRTDQVQKLPHLTEQQKSQHTQLVR
                     NFWEVLNNRDPQSTEYQHAHSRLTQISQSLMKGMRAFQQNRQLQQQQLQGQPGQPGQR
                     PQSVNPQTFNQLLPQIQQKVNSLQFSLPPNISQEQAQSWLPEARLRYGIALQKQEIGR
                     ARVAELRQQFSQRQAAGNMTQEELQEFKNRQLAAEKLYREGGDFLTKFKEQQENFKAQ
                     QQRAGVQNVTGQPQGATATPAPTVPAGSDGRPANTPVSMHPGQAPTPAPHTITSAAAQ
                     NYTNNNANNNMGQQQNMPQPATNSHAHPQGYIPNRATDNTARNINMAIPKTLNVPPPE
                     PVAMAPARPTLSGGPSHGAMGMMGQPAIQKHPGYVLEGEGQRVLSKKMLDILVRQVTG
                     GGEGEGLTPDAEEFILQMADDFVDDVITAACRLAKLRPSSTLEIRDIQLVLERNYNMR
                     ISGFSTDDLRTVKKPQPTQGWTQKMSAIQAAKVTQGKAE"
     exon            complement(224836..225090)
                     /number=1
     exon            complement(225171..225566)
                     /number=2
     exon            complement(225909..226727)
                     /number=3
     CDS             complement(join(228066..228375,228437..228802,
                     228856..228920))
                     /codon_start=1
                     /locus_tag="AO090020000083"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000033"
                     /protein_id="BAE63323.1"
                     /transl_table=1
                     /translation="MSLLDSHLEQILLSSNAIAELPFPPPRIFTNALLGPHDITALIR
                     DTETHERALFQTDPSVKAINASQRRSTRRGTVFPSETEGESMASRIYAARNSKSQSAV
                     ARVLGSDMMEEIKRSAGTSSRGRGEVNVDVLLRGAEILCNVYPVSGAQEKIASLRYRH
                     QLVTDSIVDLEDRVARNTAELEKMSHSYGGDYDDYESSGTLQPDVADLTDADIEQEMD
                     EIRELEKMKRTLEARVSGMERDLGGLIG"
     exon            complement(228066..228375)
                     /number=1
     exon            complement(228437..228802)
                     /number=2
     exon            complement(228856..228920)
                     /number=3
     CDS             join(229842..230064,230135..231432,231519..231662)
                     /codon_start=1
                     /locus_tag="AO090020000084"
                     /note="26S proteasome regulatory complex, subunit
                     RPN3/PSMD3"
                     /old_locus_tag="AO070327000034"
                     /protein_id="BAE63324.1"
                     /transl_table=1
                     /translation="MGEDTAGAPTSSFNASKDRKGDEKMTVVVPPTKGSRLSGDKGQD
                     QEGDVAMEGAEGDETQKPEPEVDPRAKAIQDIKTNFTLLERAVAHFDPRFTLRVLRSI
                     SSMRKHITSDVLAEVLVESYPPSSPTASFLLEAIGETGAFESAVASSKMDVESEKTRS
                     NSKEILPEIDTYLSILVQIFLYDNKEIQRGAKFSTSLIERLRTINRRTLDSLAARVYF
                     YYSLFFEQITPLPPSPAATVTMIRQPLLAALRTAVLRKDVDTQATVMTLLLRNYLSTS
                     HISQADLLISHNRFPQSASNNQIARYLYYLGRIRAIQLQYTDAHGHLIGATRKSPSSH
                     SARGFYQSSHKLLVVVELLMGDIPDRAIFRQPALERAMHPYFLLVQAVSVGDLDGFLS
                     IVNTHSTTFRKDGTYTLILRLRQNVIKTGIRMMSLSYSRISLRDICLRLGLDSEESAE
                     YIVAKAIRDGVIEATLDHERGFMKSKEVGDIYATREPGEAFHERIRACLSLHDESVKA
                     MRFPMNQHRLELKSAQEARERERELAKEIQDGDMDDEDAGADFDAI"
     exon            229842..230064
                     /number=1
     exon            230135..231432
                     /number=2
     exon            231519..231662
                     /number=3
     CDS             join(232352..233545,233610..233771)
                     /codon_start=1
                     /locus_tag="AO090020000085"
                     /note="geranylgeranyl pyrophosphate synthase/Polyprenyl
                     synthetase"
                     /old_locus_tag="AO070327000035"
                     /protein_id="BAE63325.1"
                     /transl_table=1
                     /translation="MKARAVPASGLVLPSRVTPATSICWQCLRNDLISIQINSQTRAY
                     HPTRRKFASPFGAAVTAAQTLLKGLPKAPPGISVDPLRIVGKELKFLTKNIRQLLGSG
                     HPTLDKVAKYYTKSEGKHMRPLLVLLMSQATALTPRHGRWSSSPSYTVNDPISSPSVL
                     ADTNPDLNPLVSSSAEAKYDFAGDENILPTQRRLAEITELIHTASLLHDDVIDNAVTR
                     RSSSSANLQFGNKMAVLAGDFLLGRASVALARLRDPEVTELLATVIANLVEGEFMQLK
                     NTASDEKNPVFTDETISYYLQKTYLKTASLISKSCRAAALLGDSTPQVVEAAYAYGRN
                     LGLAFQLVDDMLDYTVSDAELGKPSGADLELGLATAPLLFAWKQNPELGPLVGRKFSR
                     EGDVQRARELVYQSNGVEKTRVLAQEYADKAKAAISSFPDSEAKDGLLQMCEKTMNRR
                     K"
     exon            232352..233545
                     /number=1
     exon            233610..233771
                     /number=2
     CDS             join(234814..235283,235349..237617)
                     /codon_start=1
                     /locus_tag="AO090020000086"
                     /note="uncharacterized conserved protein TEX2, contains
                     PH domain"
                     /old_locus_tag="AO070327000036"
                     /protein_id="BAE63326.1"
                     /transl_table=1
                     /translation="MGSLGIFLFVYFLGGLTFIPLVLSLILLHAYLTLPSPPPVEQRC
                     ELAKDPLRRPGDDQYSLKSGTDELAEKFHRTHESDVAAGYFAVCREYVPGGVNGKPPE
                     RTTPAGEVIAAESPSVYQTMYRSLFDRKQTPTIEPTKNNGKSGKKARNVFYIVLRHGH
                     LMLYDDANQVEVRYVISLAHHDVNICGGEGEIQEGELWLKRNAICLSRRLESLADLGG
                     PSPPFFLFSENLSEKEDFYFAMLQNQSRMWNSPDAPPKHQPFDVKHIVTLVQRLHSSE
                     EQLQTRWINAVLGRLFLAMYRTPEMEEFVRKKITKKISRVNKPNFISKIGLQRIDMGE
                     GAPFIINPRLKDLTVDGNCCVETDVQYNGNFRVEISATVRIDLGPRFKAREVDIVLAV
                     VLKKLHGHLLIRFKPPPSNRAWISFETMPSMDMDIQPIVSSKQITYGIILRTIESRIR
                     EVVAESVVQPFWDDIPFLDTATQRFRGGIWQRDIPTPDTKVDIPDESGAQPPTTGAEK
                     VDLVDVLKTKDERTMSAPVLSESIPITMKPRKGSKGELERNNSSASYAAIEKFGSSPP
                     RAIRSQTFSNAADPVLTADNAKIDKVVYDGKDAEKSSAASAMIEISNRSPPGSPNRSP
                     SGSPPTDSHMPQDNASQSRDPSIVESIESVGEFSTDSSVHPSTVHKTSSSSLRSMAAS
                     STASPSGNKPRRSTLEALARSVTSSTTAEKSQVSLSLGTATSVAKRWGWNMFSKGEQN
                     ATHESPRPAGTPEEPIGRGHPLPPPGTPLPRPESFVFKRNSVPVTKRKPVPHNASAEQ
                     QPKGDGKRRVSKPPLPRRNPIFDSGDSENHPDELLVVEAPYDSGPNSPVVDVAPDNAL
                     PGPSTQRDSPTSKVIMRRSNELWEKANGHDRSSLVEDTEADKHGMAILSATDGIIP"
     exon            234814..235283
                     /number=1
     exon            235349..237617
                     /number=2
     CDS             join(238138..238150,238191..238425,238496..238542,
                     238611..238628,238721..238796,238855..239012,
                     239066..239155,239210..239267,239318..239532,
                     239553..240601,240655..240804,240858..242072,
                     242147..242233)
                     /codon_start=1
                     /locus_tag="AO090020000087"
                     /note="actin-binding protein SLA2/Huntingtin-interacting
                     protein Hip1"
                     /old_locus_tag="AO070327000037"
                     /protein_id="BAE63327.1"
                     /transl_table=1
                     /translation="MNCRHAFNFSTLSVLIIHHPFFCNSIDFSIALHCRSAQVLPVRA
                     QSNCAVWTRAHRLPPHIVVCSPDPTPRQFTGLQPVTMSRTEADLAINIRKATSIEESA
                     PKRKHVRSCIVYTWDHKSSAAFWAGMKVQPVLADEVQTFKALITIHKVLQEGHPIVVR
                     EAQQHANWIDSLMRGVGGDGIRGGIGYGPLIREYVFFLESKLAFHRNHPEFNGLFEYE
                     EYISLKTINDPNEGYETISDLMTLQDQIDAFQKLIFSHFQSGTNNECRISALVPLVQE
                     SYGIYKFITSMLRAMHTSRSYLPSCCLATGDAEALEPLRGRYDAQHYRLVRFYYECSN
                     LRYLTSLITIPKLPQNPPNLLSDDDERPALPRRPTKEIEQEPTPPPKAPPADPEPIND
                     FWTTEAKRQQEEFEAEQRRLQQQWEEQQRQQILAQQQAQHDFEEQQRLQAEQQRLAQE
                     QLLRDQYQTQTQGRLAELEQENLNARAQYERDQLMLQQYDRRVKDLEEQMNQLTSNLN
                     MQSASKDEQIRSLQEQVNTWRSKYEALAKLYSQLRQEHLDLLQTTKSLKLKAASAQEA
                     IERREKLERELKTKNLELADMIRERDRALHDRDRLTGNNKEELEKVKRELRLAIERAE
                     NAERQKGTEISTLLSKYNREMADLEEALRNKNRALEDISSRNADRQGDHDAVLREKDE
                     EIEVYKSGMEQALMELEELKMNQGDVDNALDSQIDTVLHSTVAKINDIIDSVLQTGVQ
                     RVDDALYELDSSMQAGNQNASPPYVLSQIEKASASATEFSTAFNNFIADGPNSTHAEI
                     IRTVSIFSGSVADVLSNTKGLTRFANDDKSADQLINAARKSAQATVRFFRGLQSFRLE
                     GLEADHKTDVVINNNLEVQRDLQSLSKLVETFAPKSTKISTNGDLGDLVDQELTKAAD
                     AIDAAAARLAKLKKKPRDGFSTYELRINDVIVEAAIAVTNAIAELIKAATESQQEIVR
                     EGRGSSSRTAFYKKNNRWTEGLISAAKAVATSTNTLIETADGVISGRNSPEQLIVASN
                     DVAASTAQLVAASRVKASFMSKTQDRLEAASKAVGAACRALVRQVQEIIAERNQDGSE
                     KVDYAKLSSHEFKVREMEQQVEILQLENSLAQARQRLGEMRKISYQED"
     exon            238138..238150
                     /number=1
     exon            238191..238425
                     /number=2
     exon            238496..238542
                     /number=3
     exon            238611..238628
                     /number=4
     exon            238721..238796
                     /number=5
     exon            238855..239012
                     /number=6
     exon            239066..239155
                     /number=7
     exon            239210..239267
                     /number=8
     exon            239318..239532
                     /number=9
     exon            239553..240601
                     /number=10
     exon            240655..240804
                     /number=11
     exon            240858..242072
                     /number=12
     exon            242147..242233
                     /number=13
     CDS             complement(join(243793..244619,244672..244960))
                     /codon_start=1
                     /locus_tag="AO090020000089"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000039"
                     /protein_id="BAE63328.1"
                     /transl_table=1
                     /translation="METTVSPLQRAFNAFLMTMPPEQLEELLKYLQDAKSQENTQSSY
                     PKENFQSCLEFKADKNNGSTNPASANPRSSVSRGKRASDAKRRPLNSFIAFRSYYSVM
                     FPDLTQKAKSGILRFLWQNDPFKAKWAILAKAYSIIRDDHDSDVSLEPFLGLSAQFIG
                     IIGPSRYLEVMGWQLDVDDQQQYTIARVKATTANEADISTNYSVNDIVKHCYTSGYVS
                     EKNRKSKASNNNSAPVMAFAAQPTLVVHKNNSIRVSGNHTIVTDVYKTNPAMEISSPE
                     QTEDTFSPNTSDLSTIADEPPLDAMEVVGICNRPQLYSDSSTSNRFDFDNIQFPGLDE
                     ENAMFTYDAALQTPLMPYDPLHYDPLEAYDFSRFVDI"
     exon            complement(243793..244619)
                     /number=1
     exon            complement(244672..244960)
                     /number=2
     CDS             complement(join(246772..247725,247778..248487,
                     248538..248670,248723..248768,250664..250731))
                     /codon_start=1
                     /locus_tag="AO090020000091"
                     /note="apurinic/apyrimidinic endonuclease and related
                     enzymes"
                     /old_locus_tag="AO070327000041"
                     /protein_id="BAE63329.1"
                     /transl_table=1
                     /translation="MRAANIAYRSRLLPGLWEAICALNPFAYEPWRGKRTFEAMFEIL
                     EADIVVLQETKIQRKDLRDDMVLVPGWDCHFSLPRSKKGYSGVVIYTRNATCAPLRAE
                     EGLTGVLCPPNSSVPFRDLPLDRQIGGYPTTEQLSTLELDAATLDSEGRCVILEFPAF
                     VLLGLYCPANRDESRDSFRQGFLDLMDARIRNLVAMGKRVFVTGDLNISRGEIDAAHA
                     SEAIRKGTTTEDEFISAPARRLFNQLVYSGKVIGERDEGREQPALFDICRSFHPNRRG
                     MYTCWEQKINARPGNYGSRIDYVLCSLNMQDWFCESDIQEGLMGSDHCPVYAIFKDSV
                     CLNGQQVNMLDIMNPPGIFDNGERRQEYTTKLLLPTSGRLIPEFDKRRSIKDMFSRKP
                     DMSSQKLPTTSALTACASIREQVYKIDAEENSLGASKPSLPIADSSPTPKGTVRKRSE
                     KSDPPPSVKRSKSFPSQTRTTSVSAQRTLKGFFKPKGVVSSQISETKTPDTPVQAMER
                     SSGPLPASSTISQPEEQEDLQGIHSVPAAPTSYMDSSGPAAPFVGQNSETVIDPIVSK
                     EDWSKLFAKKPVPMCEGHREPCISLSTKKPGINCGRSFWICPRPLGPSGNKEKGTQWR
                     CATFIWASDWNP"
     exon            complement(246772..247725)
                     /number=1
     exon            complement(247778..248487)
                     /number=2
     exon            complement(248538..248670)
                     /number=3
     exon            complement(248723..248768)
                     /number=4
     exon            complement(250664..250731)
                     /number=5
     CDS             complement(join(251311..251514,251564..251975,
                     252022..252115,252163..252874))
                     /codon_start=1
                     /locus_tag="AO090020000092"
                     /note="anaphase-promoting complex (APC), subunit 5"
                     /old_locus_tag="AO070327000042"
                     /protein_id="BAE63330.1"
                     /transl_table=1
                     /translation="MSRFLTPSKVALLCLISIYTEGVIPNSSAVHVLSFLVASLSPLD
                     ADPSSSKNWKAQYSASITDLEGALSTHSSSIPGRTIWDLFLKKVWSIDSCDALEVFFS
                     NVLDLLVKSREEQIRDRDNGLATELGCMRLSRCSPLGAFVRRAQLEFTRLQFHDSVKL
                     WKGFVKYRLPTYHAWARRNPFGEQAMVDMNLLELGLDTGSQLAQVAYGNIEDDLEEDN
                     YVSTKDVERLLEFQIGELQRMGGRVPDGMKACLERIIKSGATLPNLIHYLRFLDAWRA
                     GDYPSSFDNLHRYFDYTMHSRDRSSYQYALLNLAILQADFGCYGEAISAMQEAVSIAR
                     ESHDMNCLNFCMSWLYHFGKAFPEQMKDVQNTGMLGNEKEGLAFLKAKAKETEMWSLL
                     STTLLSEAKFELQNGESLASSIENIIRASHLNVAKNLINSTGPQLLLQTALYARIGTT
                     ASETNVYILLRVYRYHALGMVEQ"
     exon            complement(251311..251514)
                     /number=1
     exon            complement(251564..251975)
                     /number=2
     exon            complement(252022..252115)
                     /number=3
     exon            complement(252163..252874)
                     /number=4
     CDS             complement(join(253590..253745,253829..253939,
                     254039..254104))
                     /codon_start=1
                     /locus_tag="AO090020000093"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000043"
                     /protein_id="BAE63331.1"
                     /transl_table=1
                     /translation="MPITHIVLFQFKAGTSPDIIKDICSRMLGLKDTCLHPSSQKPYI
                     RTSSGGIDDSPEGIQHGITHAFVVEFASAADRDYYVKEDPVHQEFVKSLDGVVEKAQA
                     IDFTPGVF"
     exon            complement(253590..253745)
                     /number=1
     exon            complement(253829..253939)
                     /number=2
     exon            complement(254039..254104)
                     /number=3
     CDS             261111..261671
                     /codon_start=1
                     /locus_tag="AO090020000095"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000045"
                     /protein_id="BAE63332.1"
                     /transl_table=1
                     /translation="MHQFLTLAALLATTALAADRTPALVARQVVELPCSYQGEKECGS
                     GCIPLSYTCCPNNLGGCPLGSYCDGLGCCPNGKTCTGPGGVSTRPGSTITVTNSLTNT
                     LTSTSTSTHTLSSSEVVTPTYTPTPSSSTSSSRSVIPPSSSAVPPSSSTPAVSPTSPP
                     LHTGAASHLTPGFYAAAGLIVGAAIF"
     exon            261111..261671
                     /number=1
     CDS             complement(join(262381..263543,263600..264878))
                     /codon_start=1
                     /locus_tag="AO090020000096"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000046"
                     /protein_id="BAE63333.1"
                     /transl_table=1
                     /translation="MERQGSVRRAREMLEAGRRHEPQADAGVPPLRRDVAHMTQWPLP
                     TENSQMNMVDSHVRHLTPQGPPPQRPPRPDMPSPSVYSERSVPDVAPSPLHIKRPVPS
                     FSQPLSQSSPPRVAVQRPPPPSPSSVAASTPRVSVATEDLLRHSTVSSAASMASIPDF
                     PFPAQRLPADPSQRNIANLAPPVGRQVVNRVSSVSPIPEEQSDSKGSYASSRAIPSWT
                     SAKAESEILGTYLDGASDDDREPDHAVNGNSSTLVRQASIGKRGQPSVCMIRRSTAES
                     PVPPPEDPARARPAAPDVPPPSFAKEISTGKARRGSFLTSSSDSSHFDLDKAPFVLDV
                     GQQHPEHVNSEALAKEIEVFPRAMPTMSDKRRGGRRPPPLNMGAVRDAEKRGSLTSLP
                     DLIRRATKLATNLEHGRTASRNDLLGGGPSRFPFGHQHRGSGSIKDILASFPPPAATP
                     ENGHSSWPFFFRRSTLHQLNSRESGPREVQEKEQKRPRRCCGMPLRLFIILCVVFLII
                     VLVAVLVPIFVVAVPKHNAASAKTGCAKTAPCENGGVSVSSGDVCSCVCANGYTGSRC
                     TIAGDASCTTTQIDDDSESRNATMGSEIPRLFEDSQNNYSIPLDPLTIMALFSQNNVS
                     CTTENALVSFRNVSNNKARRSLPVDLPAAPLPEDQIGGSIPTATPENVPTRTLAARGS
                     TSTMNGIIFDGSEPTEVHGPPTSTTPSTTKESSAASSTATTTTTPTPTATVSTEVLDF
                     SRIAVLYIFEKTGTLDAAMLSEEKIETYLTGPYPSSKDKYTIDLTNSGVNGNYTLNFE
                     RFQITSPSGNVVGGK"
     exon            complement(262381..263543)
                     /number=1
     exon            complement(263600..264878)
                     /number=2
     CDS             join(265139..265285,265557..265672,266155..266245)
                     /codon_start=1
                     /locus_tag="AO090020000097"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000047"
                     /protein_id="BAE63334.1"
                     /transl_table=1
                     /translation="MFPAAVAVDYTEMRKKRMALEDLVLKFERKECADKRIARALNAV
                     AAVNMGSRKEKKTQRASSPCWENIKGEECREGRKQPPDAYRERKNNFWKRSDWIIGSA
                     AVLRPHWPGGDLQGR"
     exon            265139..265285
                     /number=1
     exon            265557..265672
                     /number=2
     exon            266155..266245
                     /number=3
     CDS             270537..273263
                     /codon_start=1
                     /locus_tag="AO090020000099"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000049"
                     /protein_id="BAE63335.1"
                     /transl_table=1
                     /translation="MSRALLRAARAGCIYIRKATKDAEDEEKEVTDVEEQPTLQTAER
                     SFVTRKWTTVPRHLENSEVEFLAKRRPGLPSLYGATTSGANGAENGSAPMRRTRFKKV
                     DPTSGNISIYEAWVPEGHKIEGEITDDSQLVPENSETIVTPEAPAPGTVIEGVGVVNA
                     EGVVVADPASAAVMTPPKRRPPPPKRKAKGFGKGRRKKVMFAPGEGADANAVHGAGTG
                     AVDGIAEPGYGKEDADRSQMSVDQNGQDEEEDDGEEGEESDEGDESMLDAKTPETPLH
                     QPSAEPTNDPASGPVAEPVPTSTAPATESVVASQPPAPNPPAVASDSSAQAFPQPPAV
                     PTMPLAPQQPFQSIQPSTDLPSSTVPPTKPTQELTPAEDVEMTDVNPDLPGVDTNAAP
                     LTQTTPSTQQQATPQVIETQTETTMAAVPAQPQDIPRVTAPDPFPVVKSEDPTEKPLE
                     VPPMEQTDLVVQAGVEDENVKLKPPASLPEMPPPEHAPQPEQALQPQQTTQPGQTHHP
                     QPTHQLENTPKLEQAAEPEQASQSEQIPQSEPASHPEPAFAAQPAGDIMGNNESSLLD
                     SLEASLGHAPGVEKGSEAQFGEQTEALSDHNAGHPSTETTQQPGSMEIDVDTMDPSTE
                     PSLQTPAPQPTEPIEPVADQPPNQVPEIATGNSAEQAAELPKEHTQPPAETPIEPSIE
                     PATQEFTQTSVEQPVEQPAEPAMEQTEPKAEEPAPVQVEEPLGEPQGAQQPEAQPEPI
                     SQQSSAEDIEPAPASNSEPPAAPLPEPPQETPIEQFPQPTEQEVAQPFLEAPVKPAIE
                     QVGEGAGVSQPETTQPLQEDEPAPPQQPAEPQPPQAATPPAPTGTEDARPRPIETSET
                     SETHDFTAPNFSPISDLNPELEKKEEIEAQPKAGEAGEPAPPGPDTVQNPSN"
     exon            270537..273263
                     /number=1
     CDS             complement(join(274270..274990,275047..275084))
                     /codon_start=1
                     /locus_tag="AO090020000100"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000050"
                     /protein_id="BAE63336.1"
                     /transl_table=1
                     /translation="MTGDELTYDYNFDPYSQKNVQQCRCGSDRCRGILGPRPREKEQR
                     SKEKELRAENEKKSSSKNNNEKASITKQKVLNGSTSRVNKRQLLGSKSIKSGVKKVVS
                     KARASASKATTASRTSLKTTVSTKTSKTTNKKATATPTRRQVKKDNTKSKKEVKLPKV
                     KTTKTKARAPASARKPAQKNKTQSTPLTSKLSRPSEKTKAKTLQAAKGTNARRRTVKK
                     EDTKPKSPTKRTSKAKETSPRGKAASKAAKNTKA"
     exon            complement(274270..274990)
                     /number=1
     exon            complement(275047..275084)
                     /number=2
     CDS             complement(join(275234..275679,275728..276802))
                     /codon_start=1
                     /locus_tag="AO090020000101"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000051"
                     /protein_id="BAE63337.1"
                     /transl_table=1
                     /translation="MAFEYSEQLLTPENSRSETSSNNENASTEEKPPVRRRSTRVTRA
                     SLRGEAQLDGDMEIDNQGTLSTAGENNPVVSGETLVDKAEGGKRSQASHLRHSIAVME
                     SWSEATLAQGNMETEGDHPLAPDTPVSKSSQELQASDMGTSLQQRTLRKRVERILTEE
                     GHGNKGKVTVTAKEIKSPVRRSSRLSLLEKASDLVGRASSVLGKRSRDVMGKGKELGR
                     RASLRPRTTAPKEEPTKAASEAPAAKKRRISESDLPVKIQENEEAVQEAPKPVVRSRT
                     KRWLAHGLYTGQEHTESRPLQSRSRNAKRKSQGPTQRRLLPMPMFAGDRLLKQGRDFQ
                     LPFDIFSPLPSGQPKPNEWRKTNKNVFVGEASSIWRANKPLELSKCMCAEETGCDEEC
                     QNRYMFYECDDTNCGVGPECGNRNFEELKQRTKAGGKYNIGVEVIKTEDRGYGVRSNR
                     TFEPNQVIVEYTGEIITQAECEKRMRTIYKNNEVCILCSRFLWWTGDLLTAISATT"
     exon            complement(275234..275679)
                     /number=1
     exon            complement(275728..276802)
                     /number=2
     CDS             complement(join(278034..278780,278839..278947,
                     279008..279990))
                     /codon_start=1
                     /locus_tag="AO090020000103"
                     /note="DHHC-type Zn-finger proteins"
                     /old_locus_tag="AO070327000053"
                     /protein_id="BAE63338.1"
                     /transl_table=1
                     /translation="MAFSSTNSETSDAPHLGPTQHALGIPRPPSVGGISSRVTEDIAS
                     EDGDQSQSNTGVSSHAQHRSRPSVSSRPGPPPVRSSIISQATNRPGSSNSRLSRSHIP
                     SLTAQGFFRPLSSQRLQAHRGRPMTKGTESSEDWVDHASQNRRSLISNSTLAQSSIPQ
                     EQEVPPSRGTEFTDPIIPDRNTSNASPIGNTTARSIGESAKLLRDKERHNQPSQPHLN
                     LGVSASSQNGHDISQRSPLSFLSPPNRNGGQEHRDSRNHERLSSAGSSPGSIEKQSRT
                     VSKSRLGKNYEYFLGNTIFCGGGRFQNSRDKPVNVATGVLVVVPSALFFGFSAPWLWH
                     NISPAIPILFAYLFYLCFSSFLHASVVDPGIIPRNLHSMPPPDPSDDPLAIGPPTNDW
                     VMVKLATSEVAAMDVPVKFCKTCNIWRPPRCYHCRVCDNCIETLDHHCVWLNNCVGRR
                     NYRYFFTFVGSSTLLALFLIGASLAHILVYRSREGISFNDAIDQWRVPWAMVLYGAVA
                     APYPASLWAYHLFLVGRGETTREYLNSHKFAKADRHRPFTQGNILKNWISVFGRPRPP
                     TYMQFKKPYHEGDQRLSMVKRKYLPRDVEAQAGIEMQHVPSDQPQD"
     exon            complement(278034..278780)
                     /number=1
     exon            complement(278839..278947)
                     /number=2
     exon            complement(279008..279990)
                     /number=3
     CDS             complement(join(281786..281823,281926..282169,
                     282366..283826,283879..284162,284219..284508,
                     284574..284836))
                     /codon_start=1
                     /locus_tag="AO090020000105"
                     /note="dolichyl-phosphate-mannose:protein O-mannosyl
                     transferase"
                     /old_locus_tag="AO070327000055"
                     /protein_id="BAE63339.1"
                     /transl_table=1
                     /translation="MSPKSKNALEVQPPTKSTRSSSRSPRPKNRKKAPVETLNYGSDG
                     VKDNSIFSLPTSDYKALVLVTLVATAVRLFRIYQPTSVVFDEVHFGGFASKYIKGRFF
                     MDVHPPLAKLLITLAGWLAGFNGDFDFKEIGKDYLAAGVPYVAMRMLPAIMGVLTVSL
                     MFLTLKASGCRTTTAVLGAGVVIFENALVTQSRLILLDSPLVFFTALTAMSFTSFTNQ
                     QELGPSHAFRGPWWFWLAATGLCLGATLSVKWVGLFTVAWVGSLTIIQLWVLLGDTNN
                     VTPRLWFKHFFARFFCLIVIPLGFYCGMFAIHFLCLVNPGEGDGFMSSEFQATLNSKA
                     MQDVPADVAFGSRITLRHHNTQGGYLHSHNHMYPTGSKQQQITLYPHKDENNVFIAEN
                     QTQPLGPDGEIAGPFAWDNITAEYIEDGAIIRLNHLMTQRRVHSHDERPPVTEADWQY
                     EVSAYGFEGFAGDANDMFRVEIVKSMSEGEEAKKRLRTIQSKFKLVHVMTGCVLFSHK
                     VKLPDWGWEQQEVTCAKGGTLPNSVWYIESNSHPMLPADAEKVNYRNPGFLGKFWELQ
                     KVMWTTNAGLTESHAWDSRPPSWPTLLRGINFWGADHRQIYLLGNPLIWWSSTLAIGI
                     YVLFKGISILRWQRNCADYRNVNFKRFDYEVGTSVLGWAFHYFPFYLMARQLFLHHYL
                     PALYFAIITLCQEFDFLANRIHALGLASRPAIGKALAGIFLALSIFTFTLYSPLVYGN
                     PWTPDACRKVKLLDTWDFDCNTFHTDEEAEEADDANVTPEPQPPRAKARVEYRDQDGN
                     ILDEKLVAALAKEGKVSFETRHETRTRLEHGHEVEMINGQVAPPHPDVEAKPASEGNE
                     ATN"
     exon            complement(281786..281823)
                     /number=1
     exon            complement(281926..282169)
                     /number=2
     exon            complement(282366..283826)
                     /number=3
     exon            complement(283879..284162)
                     /number=4
     exon            complement(284219..284508)
                     /number=5
     exon            complement(284574..284836)
                     /number=6
     CDS             join(285646..285739,285810..285863,285925..287369)
                     /codon_start=1
                     /locus_tag="AO090020000106"
                     /note="splicing factor 3a, subunit 1"
                     /old_locus_tag="AO070327000056"
                     /protein_id="BAE63340.1"
                     /transl_table=1
                     /translation="MASTSNGNTPNLPEEVSKPPEGVVLPPKDIRAIVEKTAGYVARN
                     GIVFEDRVREKERNNPKFSFLNPNDPYASFYQWRLTEIKEGRGTSVSAGRPGEPAVAP
                     EPEQPTGPEPPTEFHFSARMPIINAQDLEVVKLTALFVAKRGKSFMTALSQREARNFQ
                     FEFLRPQHSLYQFFTRLVDQYIILLRSEGLDQATSEKARLAELEHNVQNKYHILDRAK
                     KRAEWVKYQEQQKQKKEEEEEQERIAYAQIDWHDFVVVETVLFTEADDQVDLPPPASL
                     NDLQSASLEQKAMMSLNPLRIEEAMPTEEEAPTYYNAYPVQPEPMPQPVVQPAGPAFP
                     PQVQPSQPLPVAAAAAQEEDQRIRERMEARDRAAATQAAAKAAPGQQPMRIRSDYVPR
                     AQARRLNQSGATALCPNCHQQIPVAELDQHMRIELLDPRWKEQRAKAESRSATTNLST
                     ADVVNNLKRLASQRSDVFDSTVLPGAPDPEEEARKKRMAFENAPGAGPTPPMVGPAGG
                     PPNPQNMNIEEQIRHLHERYRQ"
     exon            285646..285739
                     /number=1
     exon            285810..285863
                     /number=2
     exon            285925..287369
                     /number=3
     CDS             complement(join(288334..289806,289871..290510,
                     290645..290676))
                     /codon_start=1
                     /locus_tag="AO090020000107"
                     /note="guanine nucleotide exchange factor"
                     /old_locus_tag="AO070327000057"
                     /protein_id="BAE63341.1"
                     /transl_table=1
                     /translation="MGKTDRLNSTCLIAFHTYYSRHSFLSPSTMIPRTNNHKRSNSSD
                     NRTLSPDRTLTKARSANDLSGVANGKPVPTVRSTSVGNFPESGFSTLKDPRLLSTSVE
                     TEPTESSFHHPDLSNEVAALSVKLVQAINNQTTLDDTLVATRQELEQAQTKIRTLESE
                     NEKYRRDIDQEVFIKKADVDYEILRLKAALADEKAQRALVEKEKKGIEQELETLTAAL
                     FEEANKMVAAAKLEREAVEKKNEQLRAQVKDTESLVASHQEQLAELKSVLQEMNITKD
                     DIEAGTIGSTAPASPAKQQQQTPAIIKHSAETPVLAEPAPIQEELVPGPSTSFPHLIR
                     PICRTDIHAFEEFKELFTLSSVSKPPSRATSGSYTGLNVMSLAAGFSSGGFGSASSSP
                     AKSQTHSPNGSISSPQPANSHIPLKETRFYKRVLNEDIEPTLRLDAAPGISWLTRRAV
                     LSGICDGSLVVEPMPASAKKYEFPCSLCGERRTGPVNERTHRFRTSDSETAQRYPLCV
                     LCLEKVRSSCEFTGYLRLILDSHIRVGDTEDEKDAWEETVRLRERMFWSRIGGGVVPI
                     FTQIVGLGSHSCANEQDPEPVAGDHSDVSGEVKEVLTTTSNDDDESNDHDPRRASLSE
                     DPFESAASASPVSSTAVSAPYDGSEAQKYGKDEVSEQPLEQAEACVIANSGKHEDPKV
                     LLQPGESAISQAAVTSCEKVDAQLSATENQQG"
     exon            complement(288334..289806)
                     /number=1
     exon            complement(289871..290510)
                     /number=2
     exon            complement(290645..290676)
                     /number=3
     CDS             complement(join(293384..294030,294184..294394))
                     /codon_start=1
                     /locus_tag="AO090020000109"
                     /note="protein involved in ubiquinone biosynthesis"
                     /old_locus_tag="AO070327000059"
                     /protein_id="BAE63342.1"
                     /transl_table=1
                     /translation="MSVLRRRGALSLRELSLSTPVTVVSCRARSFSVNNRPPPKYPGH
                     VPLNFVERGALAVGSAVGALLNPRRADLIAACGEATATPYFIYRLRDAMLSDPTGRQI
                     LRERPRITSETLPLPYLRSLPENSVGRTYAAWLDREGVSPDTRDNVQYIDDEECAYVM
                     QRYRECHDFYHAVTGLPTFVEGEIALKAFEFLNTLIPMTGLSMFAAVRLKPAERERFF
                     ALWLPWAVRSGLASKELINVYWEKILEKDVDELRGELGIEKPPDMREIRRMIREQKKR
                     EKERLQQSA"
     exon            complement(293384..294030)
                     /number=1
     exon            complement(294184..294394)
                     /number=2
     CDS             join(295050..295309,295435..295495)
                     /codon_start=1
                     /locus_tag="AO090020000110"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000060"
                     /protein_id="BAE63343.1"
                     /transl_table=1
                     /translation="MLTSERIPSYFTSKFPDGTPTHALYAAFLTNGNAEDLEEFNAWR
                     KTWPSRQDFEDSMPILWSESLRNYLPPSISSHWHSIQSRDKLHEHEKLFLFDARPGAT
                     RRSK"
     exon            295050..295309
                     /number=1
     exon            295435..295495
                     /number=2
     CDS             join(295746..295945,296029..296347)
                     /codon_start=1
                     /locus_tag="AO090020000111"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000061"
                     /protein_id="BAE63344.1"
                     /transl_table=1
                     /translation="MDLILMISCLLNVSHEHVLLLSGSRLTTTDGFYLDENESETLYL
                     DDIILKDLSTSLQEELEFQQYYGNYQLTATGVCYRTEIAACINYMPLEKWRNYVLGYS
                     AEGADEKKMEVMIQGWIRAYSNEADTVITALEKIESSQADKKDHQRTKMLRKRWTQIR
                     DLCIKASEAASC"
     exon            295746..295945
                     /number=1
     exon            296029..296347
                     /number=2
     CDS             complement(join(296429..297500,297689..297708))
                     /codon_start=1
                     /locus_tag="AO090020000112"
                     /note="ketopantoate reductase"
                     /old_locus_tag="AO070327000062"
                     /protein_id="BAE63345.1"
                     /transl_table=1
                     /translation="MLSAVAPSWLERKKCLSINTNGLDDVKTGFDVNVLNDKTWYSVP
                     YWNKDGTAENGNDSIDQHTEGVGNEELLAQPADERIECLIVAVKGPVTVAAMDSVKRR
                     LTPDSTILFLQNGMGIIEELNEKVFRDPRRRPHYMCGVISHGLARRKEPFQVCHTGVG
                     TTILGSVPPADAVSPANKVDVDWAPSTKYLLRTLTLTPPLVAVAETPSSLMLYQLEKL
                     ALNCVINPLTAIMNCKNGELLYNYSFTRIMRLLLIEISSVICALPELQGVPGIESRFS
                     PERLRMMVVQLANKTAKNHSSMLQDVLARKPTEIEYLNGYIVRRGEELGIKCVVNYMI
                     KHLVLAKGLQTKQVESGAIPIDLLREPQI"
     exon            complement(296429..297500)
                     /number=1
     exon            complement(297689..297708)
                     /number=2
     CDS             join(297738..297788,298409..298486,298539..298904)
                     /codon_start=1
                     /locus_tag="AO090020000113"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000063"
                     /protein_id="BAE63346.1"
                     /transl_table=1
                     /translation="MPVRKRGRRRSMDNTLEALEAEPEQRTLTLDKQAASRFIKHGLA
                     GNDKFDMERKEQQAKEKARAQLKASLLAKKAVAAAPESSSKKSADDSASGSDSESDSG
                     ETAKATTQSGDLAKKSKEMKVDKTAKRESAKNKKKRSKDDRKEEQKERRKKKQESRKA
                     RKAQ"
     exon            297738..297788
                     /number=1
     exon            298409..298486
                     /number=2
     exon            298539..298904
                     /number=3
     CDS             join(299856..300094,300240..300492,300510..300578)
                     /codon_start=1
                     /locus_tag="AO090020000114"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000064"
                     /protein_id="BAE63347.1"
                     /transl_table=1
                     /translation="MPRQRRGAAPTPARSAPTRPTAAPARPAAAPSAQHSQPHSTAAH
                     PQSTSQQAYPHPPPQAAPVQQSAGPGLFGQMASTAAGVAVGSSIGHAIGGFFSGGSSA
                     PAEAQQAAPAEAQPMDTGLWQSNTANSSYGNPACETDVRNFRQCMDENQGNLSICGWY
                     LDQLNAGTWWLLRVLTGITESLPGRC"
     exon            299856..300094
                     /number=1
     exon            300240..300492
                     /number=2
     exon            300510..300578
                     /number=3
     CDS             complement(join(301087..301122,301189..302263,
                     302325..302443,302514..302617,302667..302745))
                     /codon_start=1
                     /locus_tag="AO090020000115"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000065"
                     /protein_id="BAE63348.1"
                     /transl_table=1
                     /translation="MFFSGTLQEGIALAVSQAKAVICFVRDELHRYPLANQLDVFSTD
                     NDQTSNLWEEDYFADKDFAQLLGSRSVLLRLTKDSQEATFLTSFCPVTKFPAVVVIKN
                     GMLREYLVPDISKDDFHSRLKAVLEDSKPTTQPSLNSPAQGAQGHTANPSTSSHTASA
                     TAPQSEPSPAPAAAVPARAPASTEPPVTGSQRRPDQLEYNSLRAGGRTYRVETPSQAQ
                     KPQPKKQETPKPQGIGKPKDSTEEQKEPETKATKRSASVERTNTPADERKPQAPTPPK
                     QYRLQVRLFDGSSIRSSFSPSQTIRGDVRPWIDSQPGDEKRPYNLKHILTPLPNRTLT
                     IAEEEQTLAELGLGSTANLVMVPINTYTEAYSATGSSLPARAVSSAYGLVSSAVGTAT
                     GLVGSFFGYGQPTPSPSATSQASTSSPSPSGDGASRPRPSSSRGPIIRTLRDQRNEQN
                     DSQFYNGNQLNFEPRQDSGR"
     exon            complement(301087..301122)
                     /number=1
     exon            complement(301189..302263)
                     /number=2
     exon            complement(302325..302443)
                     /number=3
     exon            complement(302514..302617)
                     /number=4
     exon            complement(302667..302745)
                     /number=5
     CDS             join(302981..303227,303319..303831,303884..303989,
                     304050..304149)
                     /codon_start=1
                     /locus_tag="AO090020000116"
                     /note="mitochondrial protein Surfeit 1/SURF1/SHY1,
                     required for expression of cytochrome oxidase"
                     /old_locus_tag="AO070327000066"
                     /protein_id="BAE63349.1"
                     /transl_table=1
                     /translation="MRSIFSVLQRAAATSWQPPIAASIRGPRMAFKLDSICARCRRQQ
                     IRFYSKQLADDPRWLSVVDHPAQIVRTGRKHGPGLIILALIPIISFALGTWQIQRLDW
                     KTKLIAKYEDRLVKPPLPLPPQIDPDAISEFDYRRVYTTGRFRHDQEMLVGPRMREGE
                     DGFIVVTPLERGDGESTVLVNRGWISKKMKDQKDRTEGLPQGEVTVEGLLREPWKKNM
                     FTPENKPEDGKFYFPDVEQMAELTGSQPVWIEETMIADMVEYYNRSGKGIPIARAAEV
                     NLRNNHSQYIFTWYGLCFATSIMLWMIVRKRPNEATRRVRQNVNW"
     exon            302981..303227
                     /number=1
     exon            303319..303831
                     /number=2
     exon            303884..303989
                     /number=3
     exon            304050..304149
                     /number=4
     CDS             complement(join(304225..304324,304378..304844))
                     /codon_start=1
                     /locus_tag="AO090020000117"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000067"
                     /protein_id="BAE63350.1"
                     /transl_table=1
                     /translation="MDGPLNDDEGFELPPVDLVQDTAPMSDDSDDAAVTAGEFGLDLH
                     MPSRASLSESPGIVGGGLRDEDTITVQGKQKKLSRHGIPVPNMPSGVIRKLATRFAPA
                     RAGSKAKISKATLAAIEQASSWYFEQVAEDLAAYSKHAGRKTIDESDVITLMRRQRHI
                     NNSTTVFSLASKHLPKELLQDMRLSMPP"
     exon            complement(304225..304324)
                     /number=1
     exon            complement(304378..304844)
                     /number=2
     CDS             join(306209..306575,306625..306802,306858..306956,
                     307009..307111)
                     /codon_start=1
                     /locus_tag="AO090020000118"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000068"
                     /protein_id="BAE63351.1"
                     /transl_table=1
                     /translation="MSAEAAKSSGLSAKIDNKRKRQAEESSKQAGAATGNAEGPSNKK
                     RKNGKSKLKKGGKDKKDKPQLDASEKEQRDAKQTETKGGIDEAIGKMDGRLLADHFMQ
                     KAKRHNKELTAVELSDLSVPESSFLDTSSFDLPRQLEKLPAFLKAFSPKGSDLSKPSE
                     EKGTPHTLVVCASGLRAADAVRALRTFQTKESPIGKLFAKHIKLEEAKQFLERSRIAI
                     GGGTPARISDLIDAGMAFSHSSAQSRLNMS"
     exon            306209..306575
                     /number=1
     exon            306625..306802
                     /number=2
     exon            306858..306956
                     /number=3
     exon            307009..307111
                     /number=4
     CDS             complement(join(308134..308252,308308..308646,
                     308692..309052,309143..309399,309450..309738,
                     309792..311892,311943..312540,312609..313218))
                     /codon_start=1
                     /locus_tag="AO090020000119"
                     /note="RNA polymerase II transcription mediator"
                     /old_locus_tag="AO070327000069"
                     /protein_id="BAE63352.1"
                     /transl_table=1
                     /translation="MIPHSSAGVQSWGHPLRAVNNGSGHVDASQAVGPPDPQFEKLPT
                     PVPQPQPRQPAVIDLTTSGGDAQELEPPPKRLRLDLPAAPSARDASPAPGSGGELRST
                     PGTGGSKPPSLSWRNRPVWSFQAMLSEVPGSNVMNEEDATAVAQGGKPASPPSLPVLP
                     WKYIPESLGSNPTTSRASSPVKEVQTIPYRIETPSVAPVLKGEKVADFSPWIGNHPED
                     VLNEQTAKQGHYDRTQVSQNESNTARPSLYAQLKHRSGLQMLSSVFAAALEKRQNHSL
                     VTAPSTFKPPPRVTLTDNKREAWLRDLANPSVPLRKLSRTIPHGIRGKALLDQCLNKG
                     IPVNRAVWLAKCVGANEIRAFKRKGTSGTLALGLEAKWVRDWTASVQQFLEGVLGACG
                     SAQWKMKMTYAVSLTARLFFERLLDHDQYLGWFLSSLEAAPVNIVPVWLLMLGIYWDN
                     IMRYRKRGRRLAELLLVKLRQVRALILTVNTLLIRQQVTQPDKGGPLQPLVDRLSLYV
                     RRLVLEHTSSVVLPGSWENHKELISSCLNLKDNVHKTIYQNLSERNSRLQLPKNHQDT
                     AERSPQQRVIQLFDSIRSAHDISSASTACLKTIEDKAILISKLLEWTATPFRYGLCRV
                     YTGVRLLRKWKMSGIDVDSYILSFLADVRVTSALNMENIYHIISELVRSQTFSVGRYL
                     QWLMAKGVTNTPQPVPSDLCLLKQLPANRLPEHVRNLRNTLLYRAGIPVMEEDSAIAE
                     LKISIAQRLPNIFGAEMDSAMPTESSQPHPTWAVKSEIGQWIRHGIAGHCRDSPRYVY
                     LLSRSTAPANNYRKLSGVSVAVDPGASALTPDEFYSVREILETFGDLSMLADILKQAT
                     RCDDDVVLASVADTVNCHFDCFCVIGATADLFRGLVESYARLKRLGNASLDLLFSLIE
                     LGLRIPSEFNTVALLRQDLTRLENKSALAAPSPLSDSIPLALSDVDPSFQEKLNQLLS
                     SGGGMDESTMDTVFYSLMHILENSGSPAKLSANETARYLAYLRPFQPKHFDTMLIRWI
                     CGLLKSSTPSMSRILPPLIGVGCVTIHAFVFLVKKLLQSEKVAAVIPNLAGLRVDLLQ
                     LLVPLVSGKSKYADLVTYRFHVAQQEFFMKHPQETLDIICDAVALVNSETGSNPGQPD
                     IAGCATELLDILLTQNPEVTVQYCLQGFIGKHSTSTTVLERALDNLLGFDSLAGPPTM
                     SEAEKVVRMTDDFSLPFCQLKLQMLFNAESGRNVGNGIVDVMFKAAVEDTRSKGSNWV
                     GFVGLMSQDIIRQVWKHHYHYKNLEAHGHPGTAKSLETAKLYLTIIEKLAYSVPEAGV
                     QSVAPILVEKMDLLLHRLVIMQTNFNNVTMNRHGAATTQILQSRSNFERSLAFWFSAF
                     LRMIVIHRSAFTMPSPAPRANGLQEQSHSVIRLFPAADYFPHPIPSQGYRPCPGILLQ
                     THALDVAASLIDTFPDEARQQCARFLKEKCPPFLQYQNDSRFIYLLGPMSDAAALNSL
                     QAASLPSPAAGGSTPTPTPSSALPVFQKALIALPAIFASNTGDVLWDPTQYALGSSSK
                     MPHQS"
     exon            complement(308134..308252)
                     /number=1
     exon            complement(308308..308646)
                     /number=2
     exon            complement(308692..309052)
                     /number=3
     exon            complement(309143..309399)
                     /number=4
     exon            complement(309450..309738)
                     /number=5
     exon            complement(309792..311892)
                     /number=6
     exon            complement(311943..312540)
                     /number=7
     exon            complement(312609..313218)
                     /number=8
     CDS             join(317449..317476,317705..317779,317890..317982,
                     318044..318192)
                     /codon_start=1
                     /locus_tag="AO090020000122"
                     /note="translation initiation factor 1 (eIF-1/SUI1)"
                     /old_locus_tag="AO070327000072"
                     /protein_id="BAE63353.1"
                     /transl_table=1
                     /translation="MSIENLKTFDPFAEADEDTGETKQSQNYIHIRIQQRNGRKTLTT
                     VQGLPKKFDQKKILKVIKKKFACNGTIVADSEMGEVIQLQGDQRKDVQEFLTDKKEGL
                     ELDAKTIKVHGF"
     exon            317449..317476
                     /number=1
     exon            317705..317779
                     /number=2
     exon            317890..317982
                     /number=3
     exon            318044..318192
                     /number=4
     CDS             complement(join(322259..322370,322434..322504,
                     322564..322658,322717..322860,322918..323461,
                     323515..323723,323783..324389,324450..324503,
                     324572..324730))
                     /codon_start=1
                     /locus_tag="AO090020000125"
                     /note="predicted Rho GTPase-activating protein"
                     /old_locus_tag="AO070327000075"
                     /protein_id="BAE63354.1"
                     /transl_table=1
                     /translation="MADVSLHDGPAPSAPSPRDADAPPASADSAGHSATPAISDELKA
                     RMDKVVYSDIGITTLLTRLKQSVASARDFSTFLKKRSSLEEEHAQGLRKLSRSLLDAS
                     VRTDNRQGTYGQSHNDLSRFHDRMADHGLQFAVSLQQMADSLHELASNIERGRKQWKQ
                     TGLSAEKRVMEAEAAAEKAKAKYESLAEQYDRVKTGDKQSGKFGLKGPKSAAQHEEEL
                     LRKVQNADSDYASKVQAAQAARQELVSTHRPQAVHNIQQLISECDSGLTLQMQKFATF
                     NEKLLLGQGLSISPLKDSAGNAAIAPKSLYEVIQQIDNEKDYRDYVLSHQNNPGAVTS
                     EQIKYERHPTLGGTTGPVVPASQTSTQNKRNSSMLLQSFSQQHLPAQSSQQSPAPAPA
                     PTAAPAPSTQQSSYPHNPDSYSSSTFQPPYPVSDSPAVPEKQPLNPPSMAAAPSPLPP
                     AGGTTGNFQQHLPPLKPVFGVSLEDLYLRDGTAVPMIVYQCFQAIELFGLDMEGIYRL
                     SGSANHINQMKQIFDNDSSQVDFTNPENFYHDVNSVAGLLKQFFRDLPDPLFTSQSYT
                     DFINAARIDDDVQRRDSLHALVNNLPDAHYATLRALVLHLNKVQEHYTQNRMNAGNIA
                     ICFGPTLMGASSGGNVADAGWQVRVIETVILNTFQIFDDD"
     exon            complement(322259..322370)
                     /number=1
     exon            complement(322434..322504)
                     /number=2
     exon            complement(322564..322658)
                     /number=3
     exon            complement(322717..322860)
                     /number=4
     exon            complement(322918..323461)
                     /number=5
     exon            complement(323515..323723)
                     /number=6
     exon            complement(323783..324389)
                     /number=7
     exon            complement(324450..324503)
                     /number=8
     exon            complement(324572..324730)
                     /number=9
     CDS             join(325685..325924,325982..326023,326105..326190,
                     326256..326564,326619..327056,327113..327942,
                     327997..328205)
                     /codon_start=1
                     /locus_tag="AO090020000126"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000076"
                     /protein_id="BAE63355.1"
                     /transl_table=1
                     /translation="MDLEFRGVMAPHGLGTHASLLTPSGTPSDLRNNPRMPRPVTGFD
                     LSARNSEPREMEKIPPITGKRRGGSRKACNECKQQKRITPPKSDVLASTVTPAAACSR
                     CRRLQIECKVEPSFKRISKRRRNAEMEKEIAELRRRLATSADHPHGVEATVSDELSPC
                     SEEVFCGPDSAVSNRTRTLSAPLEPQPLATPLTIQRDASIMSQEDNMWRLEDVSLSRP
                     RVARLFEQYFKYYHPFLPLLNPQKPPEEYLRRCPLQAWTIICVASRRAPSEPGLLTAL
                     SGPFSRFLWSTITGVPQDYRVVKALCLLCTWPLPTTSQRTDATFMLSGLMMQISMQLG
                     LHRPVQPEEFTTFRMEVQGEAVKDRIQTWAICNIVAQNVATGYGQPPGTIYDWALEPA
                     SLQDADYHPSHDLQTRLRIEKFCDRVTKSLYSSKPEPAEFISSEKLLIVQLLENELRD
                     MEVDLGRDISSMSRLYPLVFESGLIWSPLDINMIHLRAAELHLRYFVFLGSNPRSDDL
                     TKLFIATTSFLGRVLDLETSPGELIGHATNYILQMIVSAAFALMKLLKSDFSRHIDFD
                     HGKLLFNGAISAIRRISVMDHDRPVRLADILAQMWNAGGSDPSGEEALLLKVRCRMSM
                     SHVYDTVWRWRQRFRPIKSVEDAQASLANPNLSATAGPVSRQDDSLEDPGLMYAPNFD
                     QGGAFISEVGFSEVFDSLNWVFDGIPDSFVAPPVM"
     exon            325685..325924
                     /number=1
     exon            325982..326023
                     /number=2
     exon            326105..326190
                     /number=3
     exon            326256..326564
                     /number=4
     exon            326619..327056
                     /number=5
     exon            327113..327942
                     /number=6
     exon            327997..328205
                     /number=7
     CDS             join(330962..330994,331070..331102,331176..331234,
                     331297..331441,331559..331791,331853..331913)
                     /codon_start=1
                     /locus_tag="AO090020000127"
                     /note="Ras-related small GTPase, Rho type"
                     /old_locus_tag="AO070327000077"
                     /protein_id="BAE63356.1"
                     /transl_table=1
                     /translation="MATGPATQSLKCVVTGDGAVGKTCLLISYTTNAFPGEYIPTVFD
                     NYTASVMVDGRPISLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSIWFPEIEHHAPNV
                     PIILVGTKLDLRDDPATTDALRQRKMEPVSYEQALAVAKEIRAHKYLECSALTQRNLK
                     SVFDEAIRAVLNPRPAAKPKKSKCLIL"
     exon            330962..330994
                     /number=1
     exon            331070..331102
                     /number=2
     exon            331176..331234
                     /number=3
     exon            331297..331441
                     /number=4
     exon            331559..331791
                     /number=5
     exon            331853..331913
                     /number=6
     CDS             complement(join(332532..332721,332782..333010,
                     333069..333657))
                     /codon_start=1
                     /locus_tag="AO090020000128"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000078"
                     /protein_id="BAE63357.1"
                     /transl_table=1
                     /translation="MSDKKRKIVENAPEEAIEPQGKKAKCEEKKEKKEKKRKSKDVVE
                     DVKMEDTGVEEQTKSDEKEKKDKKDKKDKKEKKEKKEKKEKKEKKKEKKEKKDESEED
                     APEVNGAEEEKQETAGAMDVDEKPTEESEDKVDKKAQEKKERKEKTKQEKKAKKEKKK
                     AEAQEQQSVSNGQQSQAEPAEDDAPKQKGSRFICFVGNLPYSANHESLSAHFEKIAPV
                     SVRVATQKEKPTKCRGFGFIEFDNYDRMKTCLKLYHHSMFDDKKYPPRRINVELTAGG
                     GGNNENRKAKIEAKNKKLFEERQRNAKSIHQEKERKAKVEETGVDEYAGVHPSRLSRM
                     A"
     exon            complement(332532..332721)
                     /number=1
     exon            complement(332782..333010)
                     /number=2
     exon            complement(333069..333657)
                     /number=3
     CDS             join(335017..335427,335617..335766,335871..336394,
                     336481..336508)
                     /codon_start=1
                     /locus_tag="AO090020000129"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000079"
                     /protein_id="BAE63358.1"
                     /transl_table=1
                     /translation="MGYMNQPKFMELYAYALESDFQIPDGESAAWAPGHPFHWGQELD
                     KIILGGVGSSLSLSPDDQFLAVGVGQNIHVYSTFTREYVETLTGHLDEVSRVFFASRM
                     IGCGLYTLVSSAEGSIVIWELDRDGKNVSAEKENKSQRIENGICHPEQHRSERDARRR
                     NSALREHQEYRGQRKSVSPSRAYRHDYGLLEDKCGLVLSLLPPNTSLFSQGSPKAVVY
                     VYDIEKAEEVLHFEGCEHWARSLDWSPDGKLLAVGASDSSVRVLDPYTGEEKIGWRLK
                     FDNRLMRRFAGIQGVKFIDAGRKLMFRSTVGFTEVYDLQLTKQQFARGPECQLERGST
                     SKPIYTADSSLPVVSDADGAVRFWRHCDFRDTDPYL"
     exon            335017..335427
                     /number=1
     exon            335617..335766
                     /number=2
     exon            335871..336394
                     /number=3
     exon            336481..336508
                     /number=4
     CDS             336621..337337
                     /codon_start=1
                     /locus_tag="AO090020000130"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000080"
                     /protein_id="BAE63359.1"
                     /transl_table=1
                     /translation="MGRDPFLPPKFQATLALLNIHCCNLLVNCEYFNRIAMRLFVGHF
                     VLSFLLFSLNIGCASAGINTSCLKVVTALAARPGDLFAKFQEHICDQGCRPTVPHWDL
                     WTRNNSFLPAVRSVTKRLEAPRHEEAMIKLGDDAADIIKRRCGPLLHGGDLCSDSETL
                     AGFGNCFKTNFVRAAVMNLPTLLPMVSEEVCREQYEYLKTDRLWEEIIPNNMKEYASV
                     CQTLGDGAPELDHGRVHEEL"
     exon            336621..337337
                     /number=1
     CDS             join(337646..338445,338500..339712)
                     /codon_start=1
                     /locus_tag="AO090020000131"
                     /note="predicted unusual protein kinase"
                     /old_locus_tag="AO070327000081"
                     /protein_id="BAE63360.1"
                     /transl_table=1
                     /translation="MASMTSFARALRSTPTTHTTTCSILRSHLRPRSLPRSVSPRSAR
                     FVHPGAYQPFVPPSPSELGKPAPAKTYDRSRKWLRRLVYLSLATGVVYAIDTQFYASS
                     LTRTARTFTLGLIVALDYKINFRPNPLLASSINHLHTRNAERLSDLLRHNGGLYLKIG
                     QAVAMQSAILPPEFQKMFSRMFDDAPQNDWKDVEKVIREDFGKSPEEVFGVSFTGDPT
                     KGVMERKARASASVAQVHWARLADGREVAVKVQKREIAQQIQWDLWAFKVVTWVYSRV
                     FDIPFYSLVPYVSERLFLETDFENEADNSEHMARLVAGESRLRNRVYIPKVYRELSSK
                     RVMTAEWIEGVRLWDKDAITRSWRGGWHQGSPGCHGTPMDPPQSDSTSTKVSRNPNAT
                     QLKPERDHWRGWNGRGGLGLSLKEVMTTMIDLFSAQMFLWGILHCDPHPGNIFVRRKP
                     SGQPELVLIDHGLYIHMDTDFRHQYARFWKSLLTFDNAAIRDIVKQWGVTNPDIFASV
                     TLMRPYQGGDLSTQQHFEGLSKKDRAQRHYEAQQAARKGIRQILGDESKWPKELIFIG
                     RNLRIVQANNQFLGSPVNRIKITGTWASRALVESPDLPLNEKIQNYGRHILFRLVLFT
                     SDIYFYFTKIRQFLRLGGGMEDSLEAQMQSMAKDMGVDLQQNVFEG"
     exon            337646..338445
                     /number=1
     exon            338500..339712
                     /number=2
     CDS             complement(join(340078..341226,341320..341720,
                     341784..342771,342840..342854))
                     /codon_start=1
                     /locus_tag="AO090020000132"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000082"
                     /protein_id="BAE63361.1"
                     /transl_table=1
                     /translation="MSVLRGFESSRGYRRKFSFSELALDLAEENHDKRRTVHFGSLPV
                     MNGARDSQVKRLSLDIKRKQVPSVSARRPVEGAVADPGYHTDPEPSCVHRHRSGLTQD
                     LDKEVVAALGFSDADSRSGQSGHALSYRSTAGDLAELAASDSAVLAPTGSQEHWELPG
                     DSASSAHRLAPVQPGRDCPPRKPLSRENESPPMTPIQVAINDAPLLIPEYKSDQRDIG
                     DKILSWTEQANSVDDPMDQPNNVQPQPASEEPSPERETTTRAPSSTGKRFYSSVMETK
                     NRDSQRSNGEIKTATLLDPSHHRRGSSVQVRLQPVPSVSSLGTLEADRDPQRPLRQVL
                     GQANSSRVSFLSDHDGGDGQHQSLGGILRPDRQGRRPKSPWPGDEAEHASRRLSGVFR
                     PLLSGSRPRDASQSTDHAPSNPPAQPASKQAPTQTALSTMEKLKVVGNKIRRPSRASE
                     SHGVKTGQPHRKALDKISGFFNRRAEHGRPKSRAAETHVPPVVQIQRQAHSMDRLYPV
                     SSQRTSTSDHSHLPSAEYDRPRSNIENHSFQGQPPPVEGYFAPESFSRLNDPQEPGTP
                     LTQQITVEDVASNTITSNRIPSPTDYFRHRHSGSGSGNGRLTPQSPLFRPPTNPQTPQ
                     YQQPPIASPGLASPLRASPIASPVVPAPQSPPSRGRSEERTYAQDLNIRSRSPKTFAP
                     RPEERHIPSTDTTDPAYHLGIFRQNPRTSRIGDQERPWKLTIPGESEEDKPPDNALAW
                     RQQTTQGVLQCGHDRLPTYEEDTKDPPQENPRDEKPPLSDTPAPARPSMPPLSQSTGN
                     LHPTRGEGRVLNNDAPVELPVQTDDDSSEEILMSSTAYPGQEWRPVGFSGWE"
     exon            complement(340078..341226)
                     /number=1
     exon            complement(341320..341720)
                     /number=2
     exon            complement(341784..342771)
                     /number=3
     exon            complement(342840..342854)
                     /number=4
     CDS             complement(join(343028..345395,345467..345501))
                     /codon_start=1
                     /locus_tag="AO090020000133"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000083"
                     /protein_id="BAE63362.1"
                     /transl_table=1
                     /translation="MARPFQNPYEPVDSPGADNPLSPQPRGGTPISFKTNVNRAKTKR
                     WVEAKKISYDGNDWGDDEYDEYDEDPVPPPPQQQPLNQSTGDLPGLASRNIPKPWALG
                     MDRSRSMDQVMTLGTGPVADSRSHSADRNAEEQNHNLPLRSADIYSRLREQTVGPGSP
                     PSLSRASTDPVPTTSPAGQEAKGKQSENQSVPSRPQNDVPIIGLPDIRRLSGFGADLT
                     AAPSSDAQKDQPAEPQQQEPQLHHNPSVGFRSVVNQAFDVPETPSTIIDSITRSDSNS
                     TSIISPIIPPRGTNEKTPTIEEEPESTSPPRGFKPGHRRDLSVPSPDNSPLRRPIITN
                     NDTIAPESLAEMSSDLPSDSPQDQSTPTYQQATVQPTTTAAEDRPAPLKISGNMSPPE
                     NSIPTIVPSLSTENSPQDTESDRLRKEIIRSLSRENTPSEEPDPQDRSRPQTSRQDSL
                     IPSEYERYWNETASASPQGEFKPVLGYNPAQNESQDLYSSSPLQTSTTAPNAAPQQDI
                     TPKLKRRFSWESASSEEQLVPATNVQSPPVGPIPGQFPVVDEKSLQPEPEPELEPNTV
                     APPVETHDEAERDNVPEKPKLTIIPPSATDNSSIVSGRYLPEVANAQTVGDAYSPAGA
                     NQDAVTPAPALAPTQSPSIEASLLGFRDILELKTSDERVKAFNKTRDQFVTIDTGLNN
                     WLRVTIHAHPEYADVVQQSLKQTTDESKYPVPRAKFPKLSSLGNLVSSHQEGSSGSGH
                     VRRPSTHLGSMMNKQHVEQRGKDFLHTAGVFGGKAGEAAKGLFAKGRSKFKGGGSDKV
                     EP"
     exon            complement(343028..345395)
                     /number=1
     exon            complement(345467..345501)
                     /number=2
     CDS             join(346296..346548,346601..346782,346839..347399,
                     347453..347488)
                     /codon_start=1
                     /locus_tag="AO090020000134"
                     /note="SNARE protein SED5/Syntaxin 5"
                     /old_locus_tag="AO070327000084"
                     /protein_id="BAE63363.1"
                     /transl_table=1
                     /translation="MTGPSIQDRTGEFHAILGQAQKRVATNKVGSQRQALLSDSQRRQ
                     ANGSANGGAQPGRRSEFARRAVEIGRGITATTAKLQRLAELAKRKTLFDDKPVEISEL
                     TYVIKQDLASLNQQIASLQALTLSQHPKSNRSKADQEGEHNDNVVVMLQGKLADVGAN
                     FKEVLEVRTKNIQASRSRTENFVSSVSSKSQAALDTQRSDSPLYTSGRRTPQPGGSSD
                     LLTLEPSNPSPLGRPSMHSDQQLLVMEEAQTSNSYIQARGEAIDAIERTINELGGIFG
                     QLAQMVSEQSEMIQRIDANTEDVVDNVQGAQRELMKYWTRVSGNRWLIAKMFGVLMIF
                     FLLWVLISG"
     exon            346296..346548
                     /number=1
     exon            346601..346782
                     /number=2
     exon            346839..347399
                     /number=3
     exon            347453..347488
                     /number=4
     CDS             complement(join(347893..348457,348512..349045,
                     349081..349163))
                     /codon_start=1
                     /locus_tag="AO090020000135"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000085"
                     /protein_id="BAE63364.1"
                     /transl_table=1
                     /translation="MSPAVIERVRSIIHRAKNSAKLRRRSTIQVTNQIPSSSSTQKRE
                     SIWKRVPDSVLVRVLAQCELQDIYSLLLSCRVLRRRVSHLEYAISQAYLHHRTRPYQY
                     TTETGHELVPSVGDDLTFISSLFPPPPPQYTSTGAGDDLPEYSFGYLADLTRCWKTCI
                     KLSYYLTEYVVHQHLQKDSLWSSKTEKEVVYSKGVGLLQSRLLSPVAYIIFFLETHAS
                     DPQSSTRSTNSQHQSLKSQQSILQQPPFNNTQTLLSTHHAMHLLCSSVRHLMAPDIAS
                     ASTEAWLGLLLTTSTLERIMEFFVAAAKDESVKVAAADANGHSPTWTNRMEFMWQMRR
                     DWGEFVASGALTPPKLSEVWFEAAQREICRRGAIPHECEEVVPVLHGPGVALRCEFCE
                     E"
     exon            complement(347893..348457)
                     /number=1
     exon            complement(348512..349045)
                     /number=2
     exon            complement(349081..349163)
                     /number=3
     CDS             complement(join(349710..350915,350967..351428,
                     351483..351495,351520..351956))
                     /codon_start=1
                     /locus_tag="AO090020000136"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000086"
                     /protein_id="BAE63365.1"
                     /transl_table=1
                     /translation="MTDSNDRLAVVVQQSPMTAEYQTPKNPSCVVCARRKVRCDRNDP
                     CSACIKRGIECVFPTHIPPRRRKRQRSEEDRRHSGFYQSPIRQDNAASARIRNIDHPA
                     TTHNAFPSASRAEQGMLLTGDGKSVYLDRLSYLGMNNDTQMANGVRGELPRAEDVLRD
                     MSDNGSNHSVQEVDDETSLILGGAVKKSLSELHPSPLHIFKLWQTFLENVNPLIKILH
                     GPTVQQQLLEATGSLETVSKEFEALMFSIYCIALVSLKADDVQNTYGESKAVLLSRSR
                     RGARLAFTKAGILRTSKPVVLQAYVLYLLSLRASSDSQSIWSLCGVAMRMAQRIGLHR
                     DGSELGLTIFETEMRRRLWRQLSILDVTTAQSSGITSQFPYFSVDVLPPSNINDSELD
                     PRMTDPPREHHGATEMMFVLARNEYGEWMRRWSKAGGESHGGRGFLASSLLSPEAKDE
                     AINELNRAFETKFLQYCDKSIPLHYMSARLMQTVVCQMRFSAHHPRQYVEKDPVSLAE
                     RDFVFSTCVQILEGFEDCQSNEIIERYLWHVDNHIPWDALIYTLYELRTRSDEEETKR
                     SWVLIDRIYSRHYDQMRNRPKTPLHIAVQGLILKAWKSHSEERTRRNRSMLPRPHIVS
                     VLSERSERGTSSHQPRSEPSVSESGTPRGRTTQDITPGNVGMLDPLNNLDLSPLDWSQ
                     WDDLLENFQLEFTNNELFSTDAL"
     exon            complement(349710..350915)
                     /number=1
     exon            complement(350967..351428)
                     /number=2
     exon            complement(351483..351495)
                     /number=3
     exon            complement(351520..351956)
                     /number=4
     CDS             join(355032..355788,355846..356066)
                     /codon_start=1
                     /locus_tag="AO090020000137"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000087"
                     /protein_id="BAE63366.1"
                     /transl_table=1
                     /translation="MHHAPPPTSSSGDLLVSAPENHLSVNWDPSSLANPPVPRIDNNP
                     KETGGTWGDGCSAATSLTDNQDDTTLRSSLARHFRTNIDTTHTDIVLIICGFVSGLVD
                     GLSFNAWGSFASMQTGMPLLHPRTRTSSAQATANQLPAGNSVFIALGVSGQPAYPAYL
                     WAKSLIALTVFITSNILFIHVSRALGPRRRSTLILSFAVQTAALLAAAILVQLGVISP
                     KPEDPRAPIEWMQILPISLLSFQAGGQIVASRVLDPKLTEKVNPKRNRRAGAFLALFL
                     GAMTAGGLSKVTEMAASLWFAFVLKFLITAGWFVWKREGRTEGKRDVEG"
     exon            355032..355788
                     /number=1
     exon            355846..356066
                     /number=2
     CDS             356750..357427
                     /codon_start=1
                     /locus_tag="AO090020000138"
                     /note="enoyl-CoA hydratase/carnithine racemase"
                     /old_locus_tag="AO070327000088"
                     /protein_id="BAE63367.1"
                     /transl_table=1
                     /translation="MGGTFCAGADLHEVAGQDSRDATSKETNGGRSHFQAPPESGEQS
                     LGPMGPSRLQIQKPIIGAVSGYAVAGGLELSLLCDIRVVEEDAVFGVFCRRWGVPLID
                     GGTVRLQAVVGLGRALDMILTGRPVSATEALSMGLANRVVPKGKAVEEATAIAKQLLS
                     FPQLCMNADRESCYYSAYQASSFQDAMRHEYEKGVKVLDFESIKGAAQFSHGAGRHGS
                     FKNGSRL"
     exon            356750..357427
                     /number=1
     CDS             join(358480..358665,358726..359088,359148..359192,
                     359246..359455)
                     /codon_start=1
                     /locus_tag="AO090020000139"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000089"
                     /protein_id="BAE63368.1"
                     /transl_table=1
                     /translation="MAPHYAILDTRALEAASSHLAKRDLTVTHTQAVTLGVMAVYVVV
                     IALLWNLPYVRWSLWPFKMLVIAFHEFGHAITACCTGGKVESISLDPHEGGVTHMRGG
                     ISAVTLPAGYLGSSIIGALLIFAGFDIVASKVASIVLGVCFLLTLWWARRDWLTIVTI
                     LLAVGLLVACWFIAHGEALKWVVLFIGVMSALYSVWDICDDLIIRKVNTSDASVFAQR
                     YGGSSRCWGVIWSIISLCFMAIGIIGGIAAFRESFSEQEDSSKHFIPTI"
     exon            358480..358665
                     /number=1
     exon            358726..359088
                     /number=2
     exon            359148..359192
                     /number=3
     exon            359246..359455
                     /number=4
     CDS             join(360030..360680,360829..361674)
                     /codon_start=1
                     /locus_tag="AO090020000140"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000090"
                     /protein_id="BAE63369.1"
                     /transl_table=1
                     /translation="MGAILSKIIETYHALAAFWSEISQNAAESSALLRRIATPEFPVP
                     DPTVSFWQTNPKHQELVHAKSEQLPQSADIVIIGSGISGASVAYTILTECQALGIEKR
                     VVILEARQVCSGATGRNGGHLKCSPYLTYSELKVLLGKEKAKRVLYFQLRHLPTILEL
                     VKDEGLDEAEAREVETVDLFTEQTTWDKAQEMVQELRRDAPEYAEDTMVWDAKQAQES
                     QYHSSFSIETGATVREIHVEDNDTTPYLLHTSRGKIRATHVVHATDAYAPNLVPGLKG
                     KIFPVRGHMSAQAADGPSSHLDGSRSWSIIGKKGFEYITQRPRESAGPHSSGGEIMLG
                     GGVYKSDGKGMDEIGIWKDDCVDPTISAYLGGIWSTVLQGEHTRVLQLWSGCMGFTPD
                     LVPFVGKVSPTFTKRRRPYNKRKGAASESGSTANEWITAGFNGDGMVLAWLSGTAVGL
                     MVLGREDVHLEARAGRPAGKVTEWLPKELYLSESRVRDLSIFKLARFL"
     exon            360030..360680
                     /number=1
     exon            360829..361674
                     /number=2
     CDS             join(362277..362475,362534..362941,362994..363381,
                     363429..363883,363934..364109)
                     /codon_start=1
                     /locus_tag="AO090020000141"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070327000091"
                     /protein_id="BAE63370.1"
                     /transl_table=1
                     /translation="MGTESVLESKPSVENREAVDDASSNHNVERQQVLSVGLNDALTK
                     ERMSPWSWAMFRLYGLVALTTLNCCMNGFDGTLMSSINAMPTFHEHFGTRMQGSGTGI
                     LFSIYAIGNLAGALVAAPAADTFGRRFGMFIGSLIIIVGTILEASAPKVAQFIGGRFL
                     IGMGISISNTSAPIYLVEVALPQWRGIFGGLYNVVGYYIGALSCTWIAYGTGFMDTNW
                     SWRLPVVIQAAPSVVVLAVAFFMPESPRWLFANNKPEEARQMLIKYHGNNNPESALVA
                     HECREIEEGIRFEVETGGRRWWDYKVLFSSRDMLYRLWLLFLVCVFSQFIGGSVITYF
                     MPVMLENAGITSSTQQLLLNALNTVFSFIGGLFGSCFVDRWGRRTLFLYGTFITGLIY
                     IPINVISSYDADSLTTSMGYGFIACIFLYGIVFSFSWTPLQALYPAEILPSRVRAKGM
                     AFQNVVYGGSNFINMYATPTGMDNIGWRMYIIFLVLHFLEYIFMFFTLPETKGRTIEE
                     LEELFLERNPVKASLKKREVVVREGMGVKEVGE"
     exon            362277..362475
                     /number=1
     exon            362534..362941
                     /number=2
     exon            362994..363381
                     /number=3
     exon            363429..363883
                     /number=4
     exon            363934..364109
                     /number=5
     CDS             365126..366022
                     /codon_start=1
                     /locus_tag="AO090020000142"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000092"
                     /protein_id="BAE63371.1"
                     /transl_table=1
                     /translation="MKSLPLLTTLLLTLTTTPTTQAWTFTWRNASNSPFIERSTSPAP
                     CTKIDQAEGQEFVFEPNNSPYSFYIWSNDNCSGSYSGFTPPSRWGKKASTDLRSYMVN
                     YGGNDGPSTTAVSSSTSTSTSSASSTGTATGTATGGSSTSTTTASASATATSSPGDSS
                     SSSSGISGGAVAGIVIGVVAGIAVVGGAFWLGRRQRSGSGGKPPGNAGQGFGSASGLG
                     PGAGYVQPGTPIGGSDAGGYMGAEVAKGPLPYMYENHPMSPVPAYQPPVGQQFAELPG
                     ESVRVEMSDTSRVNELEGSGKR"
     exon            365126..366022
                     /number=1
     CDS             complement(join(366756..367257,367318..368578,
                     368635..368824))
                     /codon_start=1
                     /locus_tag="AO090020000143"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000093"
                     /protein_id="BAE63372.1"
                     /transl_table=1
                     /translation="MLLKPATPLTILLLIAFVLLLLSVISTPIVKGIPLATFENVDYG
                     VFGYCKAGQCTNIHLGYTNDDLSDTGDDFNLPSSTRRSLSSILIVHPVAAFLTLICLC
                     MAAAAHFHAPSHSPRYLLVLLILLLPTLLVSLLAFLVDILLFVPHLGWGGWIVLGATI
                     LLVSCGVVTCAMRRTLVSRKARKRRIAENAEMSGENYYNRQNAAAAAAGLNNPKPLNG
                     EAKEPFVTGSPPGSDTGPTFATFRTTTHESDDDRTPLNSRTPPNDFPLPDPSYPTQMR
                     DNGPPYNPSRDEFGNPLPPSGPYGPGPRMRPGPGDPRLRNQYSDGSMGSRRGPAPPGF
                     VPRGRGAYPARGGYGRGGPYGGPRGPPPGGRGSPMGSMRGGRGGYRGPAPFGYGPNPG
                     PRPMPPPEEERYDYDAPPDSMRQPSPGPIGMAVSPPDGSPIGQAIEMTPQPRRTGSAE
                     PVPQEVLLGQQPHALSADGQPEPVSPSSLYSRTPSYVPPRAAWEQAERRPGHSPSPVH
                     AYRSAETARTPHHAGSESAGYFEDADPRFANRNEPAVGNPRLPSALTPGSSGEPKLTE
                     DLAEGPSSPTTSDISHFTSISERPINPRWQPPPLPAQQRQNVLLENNPDFDLRAGMRR
                     GGAAGGVGGRMPPMSIPREASRYPIP"
     exon            complement(366756..367257)
                     /number=1
     exon            complement(367318..368578)
                     /number=2
     exon            complement(368635..368824)
                     /number=3
     CDS             join(371422..371496,372270..372370,372646..372755,
                     372823..373241,373294..373659,373711..374184,
                     374246..374998)
                     /codon_start=1
                     /locus_tag="AO090020000144"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000094"
                     /protein_id="BAE63373.1"
                     /transl_table=1
                     /translation="MSHVEHLRHTALQLRSPLFTCPHLPVWAGGIQDLVNALMKPVED
                     SVSHLPPLDWVPHPNSEYKDSYKVFRNVVSDYKADNTGNQDSAPAIQRAIEAGASNGP
                     SRNSKSMGTTGQPAVVYLPGGTYLLQTSLQLFTGTVLVGDPSNPPVLKAASGYSLDHI
                     VYAKDPNHEGTNNFYIGIKNIVLDSTGVDSAKSLSLLDWTVSQATQLANVAFHMPTGS
                     KHTGLTTQYDYNSNIIVNDLSFSGGGVGMKLSGQQWVFKNLTFTGTTIGVVAGATDIV
                     FLGCQFQQGAIGINASETSGSLTVIDSSASGLDTFITSGDSGGAGNAIVLENVQSSGV
                     TVSLGGKAVLTGGVSDTWVHGTMYNSGSTNKERVDGKIVVTNRASSLLSGNKYYTVSP
                     PTYQEYRSNKVLNIKSVSSSPVYGDGQTDDTANINKILSENKDCKVIYFPAGTYIVTD
                     TIFVPSGTRIIGDAFASTISAVGNNFKDEAFVRVMIRVGYPGDMGVAQISDMVLTVGD
                     ILPGCQLMEVNIAGKNQGDVGFWNVHFRIGGGVGSRVHSDCTSSPDSCKAAYGLLHLT
                     GTSSAYIENMWGWTADHDLDGSSTQTISTGRGLLVEAVAATWLIGTGFEHHTLYQYNF
                     EHAHNVLATMQQSETPYWQGVGSTLAPAPWGNHLSASDPDFSWCAGDDATCRMALFER
                     INGASNLFLYGGCNWAFFNNNGGCNGKCQKNAVQIIESSALYLYGTNTKSTANMILEG
                     STTIATEDDNAGGWGGVIAAFLYKT"
     exon            371422..371496
                     /number=1
     exon            372270..372370
                     /number=2
     exon            372646..372755
                     /number=3
     exon            372823..373241
                     /number=4
     exon            373294..373659
                     /number=5
     exon            373711..374184
                     /number=6
     exon            374246..374998
                     /number=7
     CDS             376227..378431
                     /codon_start=1
                     /locus_tag="AO090020000145"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000095"
                     /protein_id="BAE63374.1"
                     /transl_table=1
                     /translation="MPNDNKNAPSPAASTVRSVQDREVHMSPMTESTSRQVPSDSYAG
                     PPPTPGMDDVPYIRFAINQLTREEDSRSLRRPSSVASEDYPAERLIWDEGLGYFIRSP
                     EANNTPPAQQPLLQHPSPEPVDRSLQGSVEPEAFVAVEPPKDSLLYPRLDYVPCVLRP
                     WALTAVILCSLLMIAGIVFCNIWSQGHQGFWDYGGQGGGRYFVVQFLPQILAVIITIW
                     TFVIQAAVYRTMPFAIMASERKLGHVLHRLPILSQNFLVPDFSQFRHGEPLVGLSLVL
                     IWLSNMISLPLLSCFFQAKWFIIDGRGTWRWTAVQDVGWTLVAMYGLLTVALVFLVFR
                     FVRTRSGLMWDPVSLADLVSIIQRSNILRDFEQSEILPDVGDSLNPRVLRLGYWQLSN
                     REATFYGIGEVAAPLGNPSLHLSEKSREKQPYGLSRVSYDLEQRIGEGKYGFDEHKYS
                     PSVRYRWAPWFLRDTFIVAWTVTIGALFIAFVLVSFIHDAIKGGFPPRLPTLPSPKSF
                     SSSNFLYSFIPALIGNVLFLAWQPIDVYFRALQPFVSLSLPEGATADQSLLLSYPSCF
                     PFHVTVLAILNKHYKVAWISFMSVASAAIPILAGGVFIALNYPSQSEIRIAALMPAFY
                     AMVAFCALYTVSFLCIWPGRRRYLPHDISTLADQISFLYQSPLLSDKILREPRSKADL
                     VTRLVVAPPGDRDHPMYGFGIYVGRDGKEHLGIDRFHRPGRADMLITTGSMQ"
     exon            376227..378431
                     /number=1
     CDS             381367..381951
                     /codon_start=1
                     /locus_tag="AO090020000146"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000096"
                     /protein_id="BAE63375.1"
                     /transl_table=1
                     /translation="MFSFFRRGPPQTPEIPSDQAPSQQTTTQTSQSPPQPQNQRPESE
                     PELKFINPQTKYKLLLGGLTIFAFSLWSTRRALNRRYLASVPPFYTSSLYHKPDVSGG
                     AEAFEALNLATLNVLSLGMAGTGGILCALDINGVDDMRRFVRRGFYGDGGDVTKVDKE
                     LEDEVEAWVGSVLGEKFGVELKKEKERERNENKA"
     exon            381367..381951
                     /number=1
     CDS             complement(join(382489..382968,383017..383180,
                     383252..383310,383369..383376))
                     /codon_start=1
                     /locus_tag="AO090020000147"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000097"
                     /protein_id="BAE63376.1"
                     /transl_table=1
                     /translation="MASPGSKGSCQVVCRVGPDFQRYPELGVTNHYQPDRTRYPIVNY
                     PHAAVELTGVYKTFQAIANDTNAYEEGAAKVSRLLLGQKYPLLIHWENDIYGVRKTTT
                     QDHYADDDILYAGKDKPPKIMIMLETVDKKYKKKHIGSGCKVVPWIYDNEGRSLGNLV
                     DHHHSIRTHDLGDYEPPPLDIRHVRLEEKVTCFMDGKKLQIEYFNDTLERHDPATVFA
                     HTDDKENQPFKHFVFTNI"
     exon            complement(382489..382968)
                     /number=1
     exon            complement(383017..383180)
                     /number=2
     exon            complement(383252..383310)
                     /number=3
     exon            complement(383369..383376)
                     /number=4
     CDS             join(384997..385071,385130..385951)
                     /codon_start=1
                     /locus_tag="AO090020000148"
                     /note="lysophospholipase"
                     /old_locus_tag="AO070327000098"
                     /protein_id="BAE63377.1"
                     /transl_table=1
                     /translation="MADIDITETQFKLPDGLSVYQKTWAPSSAAPVARLVHFHGFSDH
                     INNTFDLFPSLARRGIFCTGIDQRGWGQSVKTKADRGNTGPTAAILADFAAFIEVQLE
                     AKPSVPVFVMGHSMGGGLVATLASTPKYQGLVSRLGGIMLEAPFIGLDAEQEPSIITV
                     VLGRLAGKLLPRFQITQPMKVETIVRDPAVQQLLKNDPLNPCVGTLEMFANMLDRAAD
                     LTSGKLKLNDGVRSVYVAHGTGDQVTSHDASKRWFDAQTGKVADRKFKSYEGWSHVLH
                     ADLPENRQEFADDIAEWILARV"
     exon            384997..385071
                     /number=1
     exon            385130..385951
                     /number=2
     tRNA            386392..386463
                     /locus_tag="AO090020t00001"
                     /note="tRNAscan-SE"
                     /product="tRNA-Glu"
     CDS             join(387961..388226,388396..388581,388635..389004,
                     389219..389266)
                     /codon_start=1
                     /locus_tag="AO090020000149"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000099"
                     /protein_id="BAE63378.1"
                     /transl_table=1
                     /translation="MALITSSPRVLRAGKETVHCKRAAIPDIFNSFFVIHWCLDVRGT
                     ASDRDRFNWTINLSYGIILILRVRHCERAIPRTSMNIQYLLCATALAIKAGDHPKVTE
                     ILDSGLQVATPGHFLLATQKKDYATLKLFLSHGWDINTDIDSLVPSALVYAFEDVELL
                     DWFLDHGADPNKESRIRDCTPLSYAVMEAPFNIVKYLFENGGQLKRGQLLHYAAMRRK
                     DDSYEVLQFIYNEDPDYNELQINKLLDEGTSHHLMNYRSGLGTPLHYAASSGSVDMDD
                     DSDVRFREKQDVG"
     exon            387961..388226
                     /number=1
     exon            388396..388581
                     /number=2
     exon            388635..389004
                     /number=3
     exon            389219..389266
                     /number=4
     CDS             join(391390..393840,394291..394374)
                     /codon_start=1
                     /locus_tag="AO090020000151"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000101"
                     /protein_id="BAE63379.1"
                     /transl_table=1
                     /translation="MSERFEYDPLPEPTCIRLVSFVPQDDGTSPPPMNQGEPLLRLSL
                     CTADLRDTPHYEALSYTWGSPFPPEDSRSRAYENEKNHQRVVINGREHEIGRNLWEFL
                     HQQQQINAYLRKVAAEMLASGLDIHGRTPLMRAVIDNIVDLTETLLALGAETGAQDNQ
                     GKTALHYALLRDRPNLELAELLVYYGADIHAQTKEGKTPLDNAEDEVVTLITSFNKDL
                     GGKALPRGLRLSAQRPMWVDSISINQKDITERNKQVTMMSNIYSTAMSVVVWLGVEDD
                     RRIPLALDSLDNPRPWIFLTSLRDSGFAGSRLENAMKVGHSSEQILDAQGIEELMARS
                     WWSRTWVIQEVALAKRILIICGSVTIYPMRTTFILCALCGIPSPWKERQDVLDTTALF
                     ESARFSGLPGIEALMLADISFRAAPHTGEREYYVKKILKAMGAVPNISWGRRLSLQNL
                     GRLSWWSQSSDPRDKVFALLGIACPDPQHQQIIVDYNIPTDEVFVQYGRLFMQGSSEP
                     IQNLHTGESYVFEPLEGLSYVQDTSKPHPEFQDYKAKLPSWTPNFSAHHTTCRIWSRE
                     FAAASAIANSPTILSHPDPKILYVSGSIVDCIVAIEPTQSKGDVHEPEIMAWLELIQP
                     LQPKYLGGGSPVDALRKTLTVGKGYQNKKRARSAFRDFIAWRLCQSPMEPPLESILTR
                     LRKTGARDTLPSVMELRKQKQEPRNQKQEYWRSVLKITERIERQVQEFQDKKQGPEEI
                     EQGLLKLKQELLDQGYNIRIKRQGQAETGWVDLETMQEDLQVGYPEYSQVEFYILFKR
                     YYRSRCLFRTRKGYIGLGPGPFNGNGRKTVVSQASERSKNGSTNLQ"
     exon            391390..393840
                     /number=1
     exon            394291..394374
                     /number=2
     CDS             complement(join(395225..395646,395717..396037,
                     396098..396234,396300..396628))
                     /codon_start=1
                     /locus_tag="AO090020000152"
                     /note="2-polyprenyl-6-methoxyphenol hydroxylase and
                     related FAD-dependent oxidoreductases"
                     /old_locus_tag="AO070327000102"
                     /protein_id="BAE63380.1"
                     /transl_table=1
                     /translation="MIGQSEVEEALLHQLDIPVDYNSHVNGIEETTSGVVVTTDKGKT
                     ITAKYAIAADGARSFVRTTLGIPFTGTKPEMVWAVLDTFIKTDFPVCPEIITFQKDGQ
                     SRVAWIPRERGMNRFYILLDGEITQEKAEASVRDHMAPHKVEFKKTEWFSTFEIKERV
                     ASTFISKDGNGRILLAGDAAHVHAVNGGQGLNTGIADAFNLIWRVAFVAKGHGGSTLL
                     KSYDEERRATASAVIDVAAKLVRTTVKTALEYVEIIEKNAGYITGMGVSYSSNTPLVV
                     DSNYGDFVAGNRCPDLWVTKLPVRSSQTNAEELSRMRLYELFGYGKFKVLFIGNEKPA
                     SFEQAIELQQKAEIWHIHDQDHRLTTLTYEFGAEWVKSDEGAVVVVRPDLYIGYVGKD
                     WVQYLASVFN"
     exon            complement(395225..395646)
                     /number=1
     exon            complement(395717..396037)
                     /number=2
     exon            complement(396098..396234)
                     /number=3
     exon            complement(396300..396628)
                     /number=4
     CDS             join(398953..399367,399413..399417)
                     /codon_start=1
                     /locus_tag="AO090020000154"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000104"
                     /protein_id="BAE63381.1"
                     /transl_table=1
                     /translation="MSATEVQVPFAPTSFSALSPVESIVFDAKALQKATEILNVIYRY
                     RAPVPESVEDRSDEGTLKFLPLIYSRVKAHQAIQLILPAFPFKSPNRKNKVLGTLPDK
                     GEETALSHLNGLCAAITDIYEPGAILTIASDGLVYND"
     exon            398953..399367
                     /number=1
     exon            399413..399417
                     /number=2
     CDS             join(399555..399812,399880..400520,400610..401075)
                     /codon_start=1
                     /locus_tag="AO090020000155"
                     /note="probable taurine catabolism dioxygenase"
                     /old_locus_tag="AO070327000105"
                     /protein_id="BAE63382.1"
                     /transl_table=1
                     /translation="MPLDAATYESLAGTFRQRLVENYTPLDYDCAASIKEDKDVCATY
                     RGYIKFLTKDLEHMYVDDGSVSKRSHKQKLESIAKEMIVRGKAFAEAIRKNYADHIRL
                     SIHPSAGSTKISIKVLPLALHAVTPWHSSPCFTVDGRIEYGMREVFDNREDVELVHKD
                     GRPWYYREKSDLYRWSESVEIEPQYPCGLIIRPTESNTSVTDLDMLKLRGLVQENSPV
                     VLRGFNDTRDKELFVKKAEEMGTPMPWKFGLILEVKDHGTESQGLNNVLSAEWMPFHY
                     DGLFKVKKEINADGKEVTVSCPPKFQFFTGMTPSPKDTGFTLFSASHLIWHYLPQNYT
                     LEQLSKLSWTVRTTSFDEAKITDLPLVVPHFAHNRPCLRYHEPWPQEKTAFDPTYITI
                     QDVPNSPEICQMLDSLLHDRRVAYWHSWEEGDWVISDNVTMMHTRSSFTAKSDRCLRR
                     IHVD"
     exon            399555..399812
                     /number=1
     exon            399880..400520
                     /number=2
     exon            400610..401075
                     /number=3
     CDS             complement(join(401258..402298,402351..402700,
                     402751..403066,403119..403235))
                     /codon_start=1
                     /locus_tag="AO090020000156"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000106"
                     /protein_id="BAE63383.1"
                     /transl_table=1
                     /translation="MCMSPVVPVDVLNRLRMNSETVIILRALRKFGLSVIGRLKYPDS
                     SAFSDSETSILRALLLSATFRPFTSTVQALVGMTVEPKSASHIAGRERIVLAPELRGI
                     GLARTWVVYYTLLGNAANISIQCAIVNYSTRSKCFRCQAPRPEPGPTGPPGIAAPKVE
                     NSGDNDAAPENQPSQFLLFRGLEPTVTEELLAKGVAKLYRPAPSNSENASGNQKKGAK
                     VASTTGDSNLGARDGSIRRVLLVRDRKSNESWRYGFAEFATIQDAQAAVTRLNSFEKF
                     TISSRPVLVSYIHAGVFVPVINPSARTERFTFSPLNNPSLKLMYWDEEAYVTELTVST
                     GESDNNQMLLKNDQHDQSENQGKTQKDTDKTKKRKADNPAGAGAKKLAMPSHLQFWSN
                     RHAELHGIPKKNPDDVGISSDQGAPSTDPGAPPAQSYADPNRNCCYLCMRQFKSSAEV
                     NRHERLSQLHQSNLQNEELTSKAMGKLIKHGIAQQTPEYRDRARERRQAFGSSKAPVK
                     KSAPPPKEEEEPPVESTSKGASLLSKMGWSAGTGLGAQGTGMTAPIATEVYAQGVGLG
                     AQGGKLGDAVEEAGRNTRARYDEFLEKTRQTARERYEQMER"
     exon            complement(401258..402298)
                     /number=1
     exon            complement(402351..402700)
                     /number=2
     exon            complement(402751..403066)
                     /number=3
     exon            complement(403119..403235)
                     /number=4
     CDS             join(404523..404534,404587..404978,405155..405584)
                     /codon_start=1
                     /locus_tag="AO090020000157"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000107"
                     /protein_id="BAE63384.1"
                     /transl_table=1
                     /translation="MSLRPLHCKSGIIEAESQLSDITWPTGDSDVSSFTTSIASSIKD
                     YVYENGRRYHGFREGEYLFPNDETEQARMDMLHHIYRLMLGGGLYKAPTPQSPQRILD
                     IGTGTGIYAIDIADEFPNAEILGIDLSPIQPHCISNWDRLFQQAFHHMRPGGYIEMRE
                     FRVWFYSQEGELSDESSVRQWNCHLVDGMNIFGKSINVVDELVEKLKAAGFVGVREDV
                     LKVPVGPWPKDPRLKELGRWMQIQTMDAIEPLPLALFPRVLGWSEQESRILFFESSTR
                     I"
     exon            404523..404534
                     /number=1
     exon            404587..404978
                     /number=2
     exon            405155..405584
                     /number=3
     CDS             join(406235..406417,406464..406997,407057..407974)
                     /codon_start=1
                     /locus_tag="AO090020000158"
                     /note="phytoene dehydrogenase and related proteins"
                     /old_locus_tag="AO070327000108"
                     /protein_id="BAE63385.1"
                     /transl_table=1
                     /translation="MSSIPIGILSRPESRQLIAPGAGAGGIATAARLAQEGFHVKVVE
                     QHGFIGGRCSIISKDGYRFDQGPSLLLMREVFEETFQDLGTSLEQENVRLVKCEPNYC
                     VWFPDKDIIELSTNLTRLKAQIQHHEGPDGFPRFCAFLNEAGTHYNLSLAHVLRKNFP
                     GFLSLLRWDVLRSLISMHPWTSTYSRAARYFYSEKMRRVWTFGSMYLGMSPYRAPGTY
                     SLLQYIETVDGIWYPEGGFQRVLRALGDIGMRSGVEYILNSPVKSVLLDDSNHVVKGV
                     LLEDGEELYADLVVINADLVYAYNELLPKTRRSHDLKKRPVSCSSISFFWSFDEKLPH
                     LRAHNIFLAEKYRESFDAIFEDHRIPDGPSFYVNVPSKIDPTAAPPGKEAVVVLVPVG
                     HLTSEKGGQLEEEKWDTLVSQTREIVLDTIEARTGLQDLRSRLVHEMVETPLSWEERF
                     NLDRGAILGLSHSFFNVLSFRPQIKHPDIERLYFVGASTHPGTGVPVCLAGSKLVTQQ
                     IVEDWNMGIRQKPRSGFILTLVMALLTLVVSFLWRH"
     exon            406235..406417
                     /number=1
     exon            406464..406997
                     /number=2
     exon            407057..407974
                     /number=3
     CDS             complement(join(408098..408926,408988..409278,
                     409331..409504,409553..409899,409949..410048,
                     410097..410119))
                     /codon_start=1
                     /locus_tag="AO090020000159"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000109"
                     /protein_id="BAE63386.1"
                     /transl_table=1
                     /translation="MGLDYILVHVTYNIPLAGILTLVYWPFMTRLDWQKISTLVIISL
                     VATIPWDSYLVRHRIWTYAPNGVIGWTLYDIPSEEVFFFIIQTYNTSLVYLILTRWLV
                     LPMYLGTVARKETLIGASILLLAISVGLIALCFGDHFTYFGMIITWAGPFLLIQWVFS
                     SGFIIALPKLELMVSITLPTLFLWTVDTISINQGTWTVEAPTKLGVQLWSGMDIEEVL
                     FFLITNIVIVFGLVCIDYAIAMATCELVQSPQAVQSFPSYFRVLARFVTNKYHPDKQF
                     VASLRKAVDRLAASSQSMYMGSAMFQGPFRIDLILLYSFFRVADDLVDESQDTESARM
                     IIEQCDQLLEAKFSHPELFPFSPGYQEAKHPAPPELIAAIDSLPVSRLRLEHLKGLIE
                     GFRTDLTFSAKPGSFPFVTESDLDTYAYHVASSVAASMLGLVVHHFPDHQFAINVFLR
                     RRVVDAGERMGQTLQYINVARDIARDAAINRVYLPTTWLKQQGLGPEDVLASPTDSRL
                     ELVRDRLLDRAEFLSASAREEMKFLPDEVQGPFLATVDSYLEIGAALRRGMRPRTLDD
                     KLRLPLGTRLWVAYRAMAWRK"
     exon            complement(408098..408926)
                     /number=1
     exon            complement(408988..409278)
                     /number=2
     exon            complement(409331..409504)
                     /number=3
     exon            complement(409553..409899)
                     /number=4
     exon            complement(409949..410048)
                     /number=5
     exon            complement(410097..410119)
                     /number=6
     CDS             join(410599..410630,410684..411320,411371..411772,
                     411878..412492)
                     /codon_start=1
                     /locus_tag="AO090020000160"
                     /note="lignostilbene-alpha,beta-dioxygenase and related
                     enzymes"
                     /old_locus_tag="AO070327000110"
                     /protein_id="BAE63387.1"
                     /transl_table=1
                     /translation="MIGKEKNRKHLYFSGNYAPIYTVQHAYPCEVQGTIPEEFLGGQY
                     VRNGSNSLQDDDRRDLHWFDGDGMLSGVFFRRMSGSKVQQPLYSNRYILTDVHCATAE
                     YPHISPIISSATTLLSPMVSPLKVFMGMLRTMALMLSSFLGFVVRPIRRISTANTNIL
                     YHDGRVLATMETGPPMRVYLPSLSTVGWFTGSSAEGEPPDETMGPSIGGPGIEGFHNE
                     MTTAHPHSDYQTGELLLFHSTFIFPFVHYSIISSGCAGKHGSYLNQPVPGFTSGKMMH
                     DFGVSRKHTIMLDVPLSMDPTNITHNKPAIEYDPHGRTRFGVFPRYCPPQIQWYETDP
                     CCIFHTVNSWDESVPWGTRVHMLFPADKSSTITEQWALSAIPFEFPHVPRHIEMTAAR
                     FVYGCSMSEGNFATRQKSSVKIDCLVKIDVRHLLQVAEAHPPTQITGCVDQRSINEIL
                     ATNDANDPIQVFALPYGWYAQECSFVPRKDGISEDDGWLVTYVFDESQLDANGNAPAT
                     SRSELWIIDARNMRDIVARVLLPQRVPYGMHGDWFSEEQILNQREVAEFRSLD"
     exon            410599..410630
                     /number=1
     exon            410684..411320
                     /number=2
     exon            411371..411772
                     /number=3
     exon            411878..412492
                     /number=4
     CDS             complement(join(412807..412917,413054..413487,
                     413551..413742,413804..413869,413946..414444))
                     /codon_start=1
                     /locus_tag="AO090020000161"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000111"
                     /protein_id="BAE63388.1"
                     /transl_table=1
                     /translation="MSSSTAPQGVATHLSANGLIGITWAGVALSVAFTSIRIAIRLQR
                     MKHLLADDYFVLCGLALLITNAVLQTIQAPHLYYMTLTPTGEDIKYHSLRYVHLEFVI
                     IGLFWSILWSIKGSFLALFWMISDGLPKYRRACAGIAIFAFIAYVGCWLASALNCHPP
                     SDYFRFDIKGSVISISYSTAVDIITDLMIMALPLRILWKAKITRQQKIGLGVVFCVGF
                     IIIATAIVRAIEITGRAYSDQVGLAIWSIAESSISVIVGCLPPFKSFISRNSSTNQYP
                     YGSSGYTANRYDRSATSARKKRSLITTSLSEVPLPLEDMKSYRDLGYESHRQNVHITG
                     GVDGPDGLGNTSWFKTSEDEPRGEIRMVKEFVSVHFFSFSLVVSVFTDVCRAWFLQDD
                     LCFFVYINQSSSTKGRPIQRSGSRAIYPNRHGYPSQHNPHP"
     exon            complement(412807..412917)
                     /number=1
     exon            complement(413054..413487)
                     /number=2
     exon            complement(413551..413742)
                     /number=3
     exon            complement(413804..413869)
                     /number=4
     exon            complement(413946..414444)
                     /number=5
     CDS             join(415854..415928,415983..416374,416426..416630,
                     416693..417619,417670..417858)
                     /codon_start=1
                     /locus_tag="AO090020000162"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000112"
                     /protein_id="BAE63389.1"
                     /transl_table=1
                     /translation="MRSTLWSLLGLTGLAYASTEGSCKCTPGDSCWPTLDTWNALNAS
                     VSGKLIKNTPPAISCYPGPYQNDEECAYVYSQWSNETWQSLSPVGYIYPTDDNCPPVD
                     LSSGEKPGNCTLGQAPLYTINATEPEELATGMAFAKKNNIRLVVRNTGHDILGKSEGY
                     GALQIWIKYIQKGITYHENYVPSDQCKHTNWTGAAFTIAGGYVWSDVYQEAFKRNLTI
                     VGGGDPTVGCIGGYIQGGGHSPASRDYGLGSDQVLEAQVMLANGTTVTANACQNSDLY
                     FAIRGGGGGTYGVVTSAVVKAYPSKPVVAQSLAIMPLGNNTDALLEAVTDIHTEYPSI
                     SDAGFSGYGTWSINGPMVLFGNETVGYVHAVAAMGKSQKYAEVAFEPLLKKLQKYNGT
                     SLFVSVQWFQFPSYPAYYNAMSGAHQSTGSANSALTSRMFDKDSLTKNRTLLRRMIGV
                     IAGAPEEYTINSVELVGGGKVLTDGEDRFSGVNPAWRSTYMVNVVARGWADESTAQAV
                     KDDITYKKGGAMRALTPKLGSYMNEADRNDPLWATDFFGANYKRLSLIKRKYDPEGFF
                     YCPACVGSEAWHQDSLPGQAYGPLCHGRK"
     exon            415854..415928
                     /number=1
     exon            415983..416374
                     /number=2
     exon            416426..416630
                     /number=3
     exon            416693..417619
                     /number=4
     exon            417670..417858
                     /number=5
     CDS             complement(join(418103..419314,419408..420514,
                     420655..420723))
                     /codon_start=1
                     /locus_tag="AO090020000163"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000113"
                     /protein_id="BAE63390.1"
                     /transl_table=1
                     /translation="MDMVKAAYRGQEYDMHFPGAEEEVPGFVPTCFEESEKDKYRGMA
                     DHLNSDMTERNAQVGMMGRIYQSADLVLVWLGDCSSKLAQGLPELEALAQRPPRELPP
                     FELLIDDESTSTTAASSAFFKNDRFCISAAAMTVLDLTNRQWFKRIWVLQEFCLAKHV
                     VFLYGKHYVSLQALLTSFIWAYQNPGEAMKPEKGWNIAKTYILPRWFSHTGDIPNVLL
                     ARKAIAQGHKLTLREWLLTCKGRSATDPKDFVFGGLSLIYPESLRIDKQRLQPGDYAN
                     STHPPPLPPRPGTRAPNSNQPTMERPTAMVGVSVSSVPLPKGLWCVIEIDYKASEAEI
                     LVNVAACLLSQNEPHSLDLLSIAARPRDADDLLKAPLKCKSSKTYDLPSWVPALGSWT
                     SLVNSNLAAAAVAAGGGGTAFAAGTLGQLQEAVPSPTISRDGTTLYLDAMPLDKIDEI
                     ILNAKFSYSKEHLDALIPFLELLAALPYTYPSDVGTSFNAIATALASSLSSFSSRDTE
                     LDSMMDGDVNRSSSSLPPQLLPRVWLCEIIEREVRLWVTVLRIDIKAFTVLKKIRANK
                     RRRLESLLAVYRQLIGKFDDLPWSGTADQGIPPPDESHGDEQKKRRSEEIIESLCSKI
                     EERIPGQSRRFLEAEMEPISPEAQRYENAFYSAMNWRSLFRTKDGLIGMGPSWLSCGD
                     WVMPVRGAIVPYVFRHIDEDLKQQVKSLGNTVEKLEKHLFELKSTAKRNQQRLSIADT
                     ERKIASLKQKIGELCGQVGRKNAWVLIGEAYVEGVMRGEALERAGFDAFERIAIV"
     exon            complement(418103..419314)
                     /number=1
     exon            complement(419408..420514)
                     /number=2
     exon            complement(420655..420723)
                     /number=3
     CDS             422304..423053
                     /codon_start=1
                     /locus_tag="AO090020000164"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000114"
                     /protein_id="BAE63391.1"
                     /transl_table=1
                     /translation="MATPDPHPDLKALYDKENELNAQWEHDIHEARKIHYEHNKSFYQ
                     RRAELATGWTGDTQTHHPPIRDFWLTALRNEHETRKLVTKLDLGPLKSLIDIRVEWLE
                     GFDYVLAFYFAPNEYFTNRMMRKEFYYDKTGEPTPNPSPLEMRGDRIHWKKNHILQAE
                     CHARIGTKSFFAFVSRSLAYGDAQTSEEESMEDARITEDFEMGESIRDSVQPYAMELN
                     SKAFGLEEDGVGEEAEEAEEEDDEDIDYDME"
     exon            422304..423053
                     /number=1
     CDS             complement(423568..424200)
                     /codon_start=1
                     /locus_tag="AO090020000165"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000115"
                     /protein_id="BAE63392.1"
                     /transl_table=1
                     /translation="MKFFNVLFFFYAALVVSVPTAINDAELDKSNASPDALTVVCQWD
                     WDCPKQQLCCKGRCHRTGDCKHVPPKSEVAGPQRCTWATDCRPGDLCCSGYCQSVYDC
                     RRVPPKPPVKDSEDTADNKDSPETPGDAEPVIDNSSETQLDKRRYRSPEDKFNKTNDE
                     SSIQSLQTEVTCKQYWDCGVSGEHQWMCCNGKCIKWYPGSTPWIRPKCLK"
     exon            complement(423568..424200)
                     /number=1
     CDS             complement(425220..426338)
                     /codon_start=1
                     /locus_tag="AO090020000166"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000116"
                     /protein_id="BAE63393.1"
                     /transl_table=1
                     /translation="MPVTFAVAEVSPTKWTFGGKVRNTEELFKESCPQIFKNGMKITH
                     SSFSPSSFDRNFFIASNHGFVRAVYLAYCYHYHLKVRPDDVWVAILVQLGFYINAHAE
                     ECRKIFVAHEGKKELIVKQGSRLDPEDLAIRLAELIENEIVEDLRSWFMPSFSTTTEV
                     DQVVASVLMMGTMQKYFGYRGVLSCGIPRVTLLGERADWVQLQNKIEKINEFGEEPRQ
                     FANLLRPVLRHFVACFDGSQGTQAKSFWSASVHMSGKSGPPTISGWVTAFCFWNAEGK
                     CRKDVARHRSTKHLELDGLRYLPLRVKDIPSGSASVPIVIKGGKQDYKREMVAGLIGV
                     NFTDPETLDTIEPVSGWCMYGPVQEVLPESKESTGDDL"
     exon            complement(425220..426338)
                     /number=1
     CDS             complement(join(430926..430942,431002..431575))
                     /codon_start=1
                     /locus_tag="AO090020000169"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000119"
                     /protein_id="BAE63394.1"
                     /transl_table=1
                     /translation="MKSLTFPILLTLTSLAAARTDLDGCTKSATVNQWGEASMIWYVP
                     DTGEICDFPDCGGGRAPPKYNQPGCAAYTGTETLTPSYLPGWGPDGKVAPSTSAVSAS
                     ATHSEAEATSTGAVTSDTTKTGSTLITAAPTLSTGVSSSAAGSSSPAGSSSRVAESGS
                     SSSSASSGSRGSSNTTSSAGVLATGNAASAMGISLR"
     exon            complement(430926..430942)
                     /number=1
     exon            complement(431002..431575)
                     /number=2
     CDS             complement(join(432296..433988,434044..434048))
                     /codon_start=1
                     /locus_tag="AO090020000170"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000120"
                     /protein_id="BAE63395.1"
                     /transl_table=1
                     /translation="MQESSAYYNLGSHRRSVTTSSPEAQLWFNRGFLWAYSFNHDEAV
                     RCFERATKHDPKCAMAFWGIAYAVGPNYNKAWHFFDMADRQHTVKKANEALTRAIELA
                     SNATPVERDLIKALTARFPPSDNIPSDMGPLNHAYADAMRPVYHAYSRDVDVAALFGD
                     ALMCISPRGLWDLDTGKPTGDHTVEAQKVIESAMAQGIEGRDHPAHCHLYIHLMEMSP
                     MPERALPASDRLRRLVPDAAHMLHMPTHIDMAVGDYRRAVDSNEEAIIADDKYFNRDR
                     GSALYVAYRVHNICAKLYAAFISGRFEESLSAAKKLEQIIDINVLTSTSPPMADWTES
                     FLGNLAHVYVRFGRWEDILNLELPADRAVYCATTANILYARGVAFSALGRLAEAEAAQ
                     KQFEAARATVPPSRLNSIPVKEVDVLKVGSEMLSGELEYRKGNYEVAFAHLRQAIELE
                     DALPYSDPPPWMQPVRHALGGLLLEQNRVEEAEQVFREDLGLAKDFPRRKARLNNVWG
                     LHGLHECLVRLGKLEEALSIQVQRDIAVGSADVPITTSCYCRLSAVGKAETCCSSHI"
     exon            complement(432296..433988)
                     /number=1
     exon            complement(434044..434048)
                     /number=2
     CDS             complement(join(434545..434901,434954..435287,
                     435356..435527,436269..436300,437016..437065))
                     /codon_start=1
                     /locus_tag="AO090020000171"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000121"
                     /protein_id="BAE63396.1"
                     /transl_table=1
                     /translation="MGQSVLGIFMALVGMSIEILVGPSFMRDISPSLVTEFTRFSEFA
                     ASANCQGNHNGSSTGSSVYCDSGYCNTLHKSSTQIIDGFEEIKPGGTTGYLALDKTNK
                     YIVLTFRGTVSAENRNADLDFQQVDVSTICDGCKVHHGFWAASEGAMNVLLPKVEETL
                     RANPDYSIILTGHSLGGALATLGAVTLRNSGHTVDLYSFGAPSVGNKAFAEFITKSTA
                     GKNYRITHTNDEVPKVLFRSSRRRPLDSLVPEYSQSSPEYWITSPNGVSATRSTIQVI
                     EGVNNEAGNLGTTEVTMEPHGWYMGDMSVCAQTWKDWE"
     exon            complement(434545..434901)
                     /number=1
     exon            complement(434954..435287)
                     /number=2
     exon            complement(435356..435527)
                     /number=3
     exon            complement(436269..436300)
                     /number=4
     exon            complement(437016..437065)
                     /number=5
     CDS             complement(join(437765..437881,437972..438166))
                     /codon_start=1
                     /locus_tag="AO090020000172"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000122"
                     /protein_id="BAE63397.1"
                     /transl_table=1
                     /translation="MTYTSEKPEEDPERGLLIKSPVNYETDEKIEYASDHESEASTER
                     LIPGPSFIIWTGINILSTVAITPHSATAKYHSQHITSSSPVPHYGPHRVPGAASSFPK
                     A"
     exon            complement(437765..437881)
                     /number=1
     exon            complement(437972..438166)
                     /number=2
     CDS             complement(join(438971..439745,439803..439873,
                     439923..440066,440116..440316))
                     /codon_start=1
                     /locus_tag="AO090020000174"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000124"
                     /protein_id="BAE63398.1"
                     /transl_table=1
                     /translation="MTFVMSRWNTKTIIKLVAAACCSYFIFTILLADREAYYSTTRDV
                     IRAGQHHLTEETTFDHINNETLGFQHIYAIGMKERTDKRDYLTLAASFLGIKVDWRDG
                     VYPDNVSEKSYPLKLGESGVKPAAIGCWRAHMNTLIDIVENGYTTALILEDDADWDVS
                     LRQQLAEFARGVRTLTNNQHESKKAPYGTNWDILWVGGCASGAHQNETDFYVIPNDPT
                     VPNTTIRGPWESPAGPSIQWRQEHPEWPVDSTRYIYRANMGCCTFGYAVTLEGARRIL
                     AELSINYLNLPVDNAMSDLCAGSNRPQLRCYAPFPNLIGTFRSEGYVSRDSDIDQWED
                     RKFEWHPALAYNMVYSTRLNIHRLVAGEETVYSQWRESPDPWSKAEVKLGELEYPRGV
                     FVSQ"
     exon            complement(438971..439745)
                     /number=1
     exon            complement(439803..439873)
                     /number=2
     exon            complement(439923..440066)
                     /number=3
     exon            complement(440116..440316)
                     /number=4
     CDS             complement(440486..441160)
                     /codon_start=1
                     /locus_tag="AO090020000175"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000125"
                     /protein_id="BAE63399.1"
                     /transl_table=1
                     /translation="MVFHPIELRIQALTLVAWGIPAKEIAASLGMPERTVQDIYRRAR
                     ARGYDPSKDPRIKMEYVEDAKRSGRPKTITDEVENSVVQSIIQDRAAGSEKSSRKLAD
                     ETGISHSSMYRILKRHGYVIAKPTWKPGLTDAAKVKRPFCRDHNAVVHFEYVNTRKRK
                     RVHQLPNPVQESAILASDWPEPTTIALSGPSYAIFGHHQTRDAKPQDSTPCESSQLHD
                     VSGNAE"
     exon            complement(440486..441160)
                     /number=1
     CDS             complement(join(441484..442006,442075..442834,
                     442907..443378))
                     /codon_start=1
                     /locus_tag="AO090020000176"
                     /note="alpha-amylase"
                     /old_locus_tag="AO070327000126"
                     /protein_id="BAE63400.1"
                     /transl_table=1
                     /translation="MATPGNQNHRAWWKESSVYQIWPCSFKDSNDDGIGDIPGIISKL
                     DHIKNLGIDIVWLCPSYKSPQVDMGYDIADYYDIAPEYGTVADVEKLIKGCHERGMKL
                     LMDLVVNHTSDQHEWFKQSRSSKDNEYRNWYIWKPARYDEQGNRQPPNNWVSHFQGSA
                     WEWDEHTQEYYLHLYATEQPDLNWEHPPVRKAVHDIMRFWLDKGANGFRMDVINFISK
                     DQRFPDAPIKDPRTPWQWGDKYYANGPRLHEYFQELGKILKEYDTFSVGEMPFVTDTE
                     EVLRAVKYDRNELNMIFNFEHVDIDHGKYDKFEPGSWELTDLKFFFERWQKFMYENDG
                     WNALYWENHDQPRSVDRYTNAKEEDRVIASKMLATILALKAGSPFVYQGQEIGMGNVP
                     PEWDIEEYKDIDCLNHWKRLPNDPEIQKIARQEYQKKSRDNGRTPVQWTNAPNAGFTS
                     PNVKPWMSVNPNYARGINAEAQVNDPNSTYSYWASVLGLRKKYVDIFVYGNYELVDRD
                     SQEIFAYTRQYEDQKALVLANWTDGTLEWDSSSNGVKAVKDVLLNTYDSASDVKERFS
                     GSKWSLRPYEAVVLLIEA"
     exon            complement(441484..442006)
                     /number=1
     exon            complement(442075..442834)
                     /number=2
     exon            complement(442907..443378)
                     /number=3
     CDS             complement(444123..445040)
                     /codon_start=1
                     /locus_tag="AO090020000177"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000127"
                     /protein_id="BAE63401.1"
                     /transl_table=1
                     /translation="MTASKDLPPDTTPYYYLKIFLKSQLCTKAQLPPKNTTLIDKVAI
                     VTGANTGLGLESSRQLLSYNLSLLIIAVRSVAKGEIAAATLRKEYPIATIEVWNLDMS
                     SYDSIRAFVRRTETQLSRLDIVILNAGLQNMQFGVVPSTGHEETIQVNYLSTVLLSIL
                     LLPVLKNKSTVGTPGRLSIVSSGTALFARFPHRKFSLLLPSYDDPKNFDLIEQYSASK
                     LLGHMFMWKLADYVSADDVVVNLVDPGFTKGTQLQRDVSGVVSLAMSLAKVITARTVR
                     DGASTYVDATVVKGKESHGCFVMDWQIRP"
     exon            complement(444123..445040)
                     /number=1
     CDS             join(446590..447087,447189..447208,447322..447364)
                     /codon_start=1
                     /locus_tag="AO090020000178"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000128"
                     /protein_id="BAE63402.1"
                     /transl_table=1
                     /translation="MKRFCVLVNIAIRKQQRLSMDFFLETMTSVMYRLLQLKFETGSI
                     GEAIRLGLLAFSSHIFLQWRDIQRPYIQFSASYKESLVSLKSLNGVSSDIVLWLLTVG
                     RISVFGTSDDEWLKPWLRANSQLCTVHSWPAMRDVMESFLWIGALHDKPGKDLFESAM
                     LQLSPQDNALWVGQIEYHRSSSYETK"
     exon            446590..447087
                     /number=1
     exon            447189..447208
                     /number=2
     exon            447322..447364
                     /number=3
     CDS             447712..448251
                     /codon_start=1
                     /locus_tag="AO090020000179"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000129"
                     /protein_id="BAE63403.1"
                     /transl_table=1
                     /translation="MTTSEDQTTPAHLDPKTYPRHLTDPTQNIHLELTYSPLNAQSAL
                     DKISSPAAGANVLFLGTTRNTFEDRAVSQLSYTAYPPLTLKTLAGIARDAVAKHGLTG
                     IVIAHRLGVVPIREASIVIAVSSGHRRAAWRAGEEVLEICKEKAEIWKREEFVDGGME
                     WRENRERDGEGKKVVVSEN"
     exon            447712..448251
                     /number=1
     CDS             complement(join(448256..448332,448471..448569,
                     448624..448948,449016..449483))
                     /codon_start=1
                     /locus_tag="AO090020000180"
                     /note="putative cytochrome C oxidase assembly protein"
                     /old_locus_tag="AO070327000130"
                     /protein_id="BAE63404.1"
                     /transl_table=1
                     /translation="MASTMRPLVQMVGRASRSTVPSLERSTLRSIPSQNAFLPLRTKP
                     AQPAYTQTLRHNGLSSQRSFSTTTLRARARTMGQLKARNSTGPFSWKSALLFVITGAG
                     MIVYFRVEKERLARKRIAEMSKGVGRPKVGGPFVLKDLDGKQFTDEDLKGKYSFVYFG
                     FTHCPDICPDELDKMAEIIDKVKEATKGENIFLPVFVTCDPARDTPEVLRSYLQEFHG
                     DIIGLTGTYEQVKNMCKQYRVYFSTPQNVNPGEDYLVDHSIYFYLMDPEGDFVECIGR
                     QDTPDSATKVIMEHINDWKREELISTWSHIPISLSSQLTIYSTQPV"
     exon            complement(448256..448332)
                     /number=1
     exon            complement(448471..448569)
                     /number=2
     exon            complement(448624..448948)
                     /number=3
     exon            complement(449016..449483)
                     /number=4
     CDS             complement(join(450324..450498,450583..450792,
                     450875..450996))
                     /codon_start=1
                     /locus_tag="AO090020000182"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000132"
                     /protein_id="BAE63405.1"
                     /transl_table=1
                     /translation="MPDWKTESTSKKEGTTANNDGLAFQVLLVVCLTVYVVTAIWLLL
                     RSYCLAYSSLASGATDPAIANVSPQDSMERRLDCLERVAPTKPFKIWWLSIQTIRSPL
                     KQSDHIFTCSICLDKVRKKDPIHTLQCHHVFHRECLENWFLGFHNQCPMCKKPFFEEL
                     DMSPECAV"
     exon            complement(450324..450498)
                     /number=1
     exon            complement(450583..450792)
                     /number=2
     exon            complement(450875..450996)
                     /number=3
     CDS             join(451936..453109,453208..453338)
                     /codon_start=1
                     /locus_tag="AO090020000183"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000133"
                     /protein_id="BAE63406.1"
                     /transl_table=1
                     /translation="MSLTVPQGAVVKVTSTSEVSEVIKFARKHRISFAVEAGGHSTTG
                     SSASHGGIVISLSQMRKVLTDPASKTVCVQGGATWQDVNSSTAPYDLVVVGATSSHAG
                     VGGSTLGGGYGWLTGRYGLIIDSLLSVRMVLADGSIVEASETTSPDLFWAVRGAGQAF
                     GVVTELVFRAYDLKHHVFGGALYFTPDRLAKIVEFANEFHRRMNENSGLMFGFTAPPF
                     MEETAVLVIPFYNGSREEAEDFFEPILSAGPAAGQTDMMSYTKLNAVANVDPSPEGRK
                     NINGTNISLPFDTDFVYDVYKQFDRIMKSCRRVGNSVLMFELLPYNHIIEVPLDATAC
                     ANRGRYYNVGSIFCWPDPDLDQKMLTEQQGIISKIENFGSGSRDEGEKRVAKYANYAG
                     HNISAANLFGENLERLQQLKRAYDPNNVFRKWHDLLHQKNPV"
     exon            451936..453109
                     /number=1
     exon            453208..453338
                     /number=2
     CDS             complement(join(456308..456323,456447..456802))
                     /codon_start=1
                     /locus_tag="AO090020000185"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000135"
                     /protein_id="BAE63407.1"
                     /transl_table=1
                     /translation="MHYVEHGTKNEATAASAKKAVDLVLDQIEQNDKLQGLIAYSEGA
                     TVAASVIIEEQRRYKESGRPVRIKCAVFISGWPAIDIHSGKVIIPTGLDDEEYIPVPT
                     CHVIGAEDAFLEGSKAFLDCE"
     exon            complement(456308..456323)
                     /number=1
     exon            complement(456447..456802)
                     /number=2
     CDS             join(457790..458484,458576..459104,459161..459740,
                     459839..464481,464550..464870,464924..465823)
                     /codon_start=1
                     /locus_tag="AO090020000186"
                     /note="polyketide synthase modules and related proteins"
                     /old_locus_tag="AO080527000177"
                     /protein_id="BAE63408.1"
                     /transl_table=1
                     /translation="MNGVNGSDGSHGRNESDRAAIVGMSCRLPGMVDSPSRLWELCSR
                     ARSAWSEVPESRFDAAGYYHPTPGRAGSFNYKGGHWLDEDVGLFDAPFFNVTMKEAQS
                     MDPQQRILLECTYEALENAGLTKSSLSSQRVGVFIGGSTSEYNMRNTKDPENIPMFQA
                     TGGTMCMQANRISYYFNLKGPSVSVDTACSSSLSALHLACQSLKSGESEIAIVGACHI
                     NLIPEQSISMALSRLLADSGRCYAFDHRASGGFGRGEGCGCIVIRPLEAAIEANDAVR
                     AVIVGTGVNQDGRTTGITQPNSGAQEELIRAVYESAGIDPSETGYVEAHGTGTKIGDP
                     IEASALHAVFGGGRTSRRPLYIGSVKSNVGHTESVSGIISVIKTAMMLEKELILPNCN
                     FEKPNPAIPLQEWNLKVPTKLIPWPRNKRYASINNFGFGGSNAHAILTKAPPAQSDMF
                     TELENLVHGSSDDTQSHAPTRRVYPISANDKQAFTRRLKALETYLEQQPEAFNMYLME
                     NLAYTLGERRTAFPWRAAVSAASATELIGQITSPNFKPERAPEEPVISFVFTGQGAQW
                     HGMGKELLARYALFEKAMKRADQCIKELGAEFSIIHPCYSQSSCTAIQLSLTQLLKSW
                     GVVPTAVVGHSSGEIAAAFAAGMLDFDDCMRIAYCRGAVAAKLRTTDVKGSMMAIGTC
                     KDDAEKMISQVHSGTVVVACINSDSSVTASGDTHAINELQTLVEDQGLFNRKLRVDVA
                     YHSHHMGIVSAPYLSLMGDIRPQESNIKFFSSLRGQQVQSSELNADYWVANLLSPVNF
                     VGGLSSLLREAKSHSGKPVDTLIEIGPHSALEAPIRETAQECANVKNFKYLPCIKRKS
                     NAVDTMQQLAVGLFMRGLNICFDLVNADGDGKGSKRPTLLTNIPKYPWDHSVKYWHES
                     RWARSLHNRSFPRNDLLGSLSVDSDSIETKWRNVIRVDDHPWIRQHQAQGKNIYPFMG
                     YVAMAIEALSQSARMRNVSIDNYCLREVAVDKALIIPEASTVEMMTTLRPFAEGTRAS
                     SEIWYEFRVSAICDEQEWMEHCRGLISGTREKEPNPVDGAREIFEKELDGKRRESMVD
                     APGMSAVDSEEMYGVIAASGMQYGDMFKGMSSIRASDHLATAELMVPNTSLAMPDEYE
                     SGHILHPATLDLCLQLMWPLVGYRGPGQKQLYLPTFIGCLYASCKTKLSPGDRLKLYG
                     SRTNNLHPRRAAELNIVTTRSEDPSDVLIRMDNVRSTPLIDQTLCTDRPVKNQCYKVH
                     ETPCVDFLNSRFLGFLDQPTSPKSSELQTVRVLEQASFYLLEAAQNKLSTVDPASVKG
                     HYHYLMDWIRETRHRARRGDLPLQTPDWLECNKEEQEAIIEQARSMGAPGEMIWTLGS
                     LLPEILRREVDPSVVMRKSSLLERYYQELDSFRRSYISAASFIDKMADQKPHMNILEI
                     GAGTGAATLPFIHTLGGGDTKKGPRFNRYDFTDVSDTILDEAKEKFRFWGGLLDYQKL
                     DIAQDPIQQGYEEHSYDLVIACHVLHLTPRLDVTLANVRKLLKPGGKLVLLEENGQQL
                     RQFIYALLPEWWHSGDSRIDGPLLDKNSWDALLRESGFSGLDLALDDYPGAPEQCGSL
                     FVTTLQDTPDLKGRQVTIVCPEISSSFPVDNLARDIESMTGCFPEMGTLSSIDTKGKL
                     CIFLGELDNPYLSQLDEARFNLIQNLLQDASGLLWVIRPGCSSDSKPPESHLITGLAR
                     TVRSETSLPLVTLELQSGLPQPDYGAVKHIMDVFGASFGVQSSPRLTDREYSVKDGII
                     YVPRMVNDTLLDEFIHREAGRSDPELQPCRQEERPLKLVAGEPGILDTLHFTDDRGAM
                     SELPESHVEIQVEYIGLNFKDVMTAMGQMSKDALGNECSGIVTRVGGDVEGLAKGDRV
                     CAVCEGALATSVSCPATSVWRLPDSMDLKTAATIPLVFCTAYYSLFDLGRLVQGEKIL
                     IHAAAGGVGQAAIMLANMVGADVFATVSTPEKKQFLMDTYGVQEDRILFSRDSSFTQH
                     VKKATNGEGVDVVLNSLAGEMLRASWDCVAPFGRFIELGKKDILQNSRLEMSRFDDNV
                     SFSSVDLTAIYQKRPLVMKRLLSNVFKLFAKGLARPVAPITSYSVSDVEVAFRSLQGG
                     RVFGKSVIEMQPDALVKVYPPQKPQVHLSADASYIVVGGSGGLGRNIADWLSQHGAKH
                     VVLLARSGDGKENVKRLIQRAESKGVKILAPRCDISNEADVRAAISKVQREMPPIRGV
                     IFGAMVLRDCLFEKMQYDDYRAVISPKVDGLWNLHHTLKEAQQHLDFFVNLSSVSGVI
                     GNRGQAAYAAASTFMSAFARAQLAGGYPYTNIDLGPVKGIGYLAERKGTVNEVLDTLE
                     TQGVEEEELHALLAGAISGKMLNTCNGHCVTSLEIAASSPADQGPFWMVDPRFSHLVR
                     ASIAARAASESDDNDQQTAAVPLATAVRKAGKREAAQALIIDALGQKMSTLLMVPLED
                     IIPSKSISSYGLDSLVAIEVRNWVFRELESYLQIMEIVSAPSLFYLADRVICKSKILQ
                     HLQLNDGQGEGEPGISK"
     exon            457790..458484
                     /number=1
     exon            458576..459104
                     /number=2
     exon            459161..459740
                     /number=3
     exon            459839..464481
                     /number=4
     exon            464550..464870
                     /number=5
     exon            464924..465823
                     /number=6
     CDS             complement(join(467193..469411,470707..470773))
                     /codon_start=1
                     /locus_tag="AO090020000188"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000138"
                     /protein_id="BAE63409.1"
                     /transl_table=1
                     /translation="MDRVCASVQTNQIGDPEWRRSVDLPQRQQQAASNPAPPRYPSPR
                     PLSSQGSARSLRRTSRSIRQRPGSVYASGRPSQIEQTIPVLVQPVSDRNGGVAALRPA
                     LSEAQTEEDDDADSLTDDRPRILGESYWPRRSTRVSPRTASAILWALEEAIRKPLPFT
                     PDWEEVNAPMSDLGSATGPIGLAGTGRTQNGASRAAHGPVPVNTHPPSGVRTPTDIMR
                     QRRDREARKKAEQEARDKEQEEAERRRQESQERTQDPAQPYAAGVAGNRPPQRRAGPG
                     APAGCDMQPESRTTQQPPGIPAAAQRPDSQAQGQTPGPHAHPRQPGPSTQHNPQQPPT
                     GSTGFQKQQAQTLNPPGTSQSQQSPRRVGFPHAFERWETLSSHWEGLTGYWIRKLEQN
                     SEALERDPISQQMARQVTDLSAAGANLFHAVVELQRLRASSERKFQRWFFDTRAEQER
                     SKELQADLERQVRTEKQSRTEAMAALQKAESDKARVESLLKEMRRELQISKEEARRAW
                     EELGRREQEERDRTNSLRNGEPTLVGGVQVVPMIQGLPTRSNTANHPSGGAGKSSEGH
                     YYEEAPGSPTETDPFTEGQRGYQESDSQRYAPRPPHTSVAAESSGQYAGNYYEHDGEY
                     HGRPTSENDNRSYDPSAASSEPGDDEYGSYRPTQPQQGPSIVYPRPMSEESDDYERGS
                     MEDEGGYVPSTMPSTTSAPYSQGSVDYSGSGWGTTWDSVTPRHRHPTRLSDVMEEEEP
                     RTTPSRASRASRASQASRSVH"
     exon            complement(467193..469411)
                     /number=1
     exon            complement(470707..470773)
                     /number=2
     CDS             474553..475503
                     /codon_start=1
                     /locus_tag="AO090020000189"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000139"
                     /protein_id="BAE63410.1"
                     /transl_table=1
                     /translation="MSQSDALDSLRGKPLPSLPAVARNANTLANRRAQIVVGKPPIEA
                     SMISPPCRINPVTMEPHTTRFDEAMFIPANDCPSPVPSPGSNSPSMEKPPPFGRDRPS
                     TSTSEVVCEQSVWESDSDTEDTDPKSRSRKPMDTLKKVRSRVHLRMAKSAPKLQNSSN
                     SPQALEKFPTTPDKPPEERHPAPMRSIGKSRFAPDKFQSAHQTVRIVAPSTTSLVPPR
                     TPRSRRNSKDERPNFDIDRSTAAAMQAKSRRKPHSNSPQSSLSSEGGKIRTLCREDRS
                     DKALQSLTPLRQPLYKRVWESLRVLGCHGDMPPPRPRKAM"
     exon            474553..475503
                     /number=1
     CDS             complement(join(478597..479308,479369..479554,
                     479604..479687,479737..479786,479836..479866,
                     479916..480109,480158..480205,480258..480350,
                     480425..480586,480738..480899))
                     /codon_start=1
                     /locus_tag="AO090020000190"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070327000140"
                     /protein_id="BAE63411.1"
                     /transl_table=1
                     /translation="MSGLCRTVQVKAITMSWPTVNALGRMIQFLADCCNQVRDVYQSC
                     YREHIKWKADSSDEFQGTRNHIFDDSDAAEYWANVYEKAQYEGRHRFDPSFTWTPEEE
                     KKLVRKVDLRIMFWAWLMFCSLDLNRRNINRAITDDMLPELGMNTNDFNYGQTIFLVT
                     FLAAELPSGLISKKVGPDRWIPFIIVCWSSISAAQVALSNRAGYFACRALLGLLMGGF
                     IPDIVLWLSYFYKGRELPIRLSWFWTAISTCNIVGSLLAAGILQMRGLRGWSGWQWLF
                     LIEGLVTAIIGVLSWGLMPPGPCQTKSWFRGKDGWFSEREELILVNRLLRDDPSKGDM
                     NNRQAVGPVALIKCLKDFDLWPLYLLGLLIYIPPQPHANYLSYILRRLGFSTFHANLL
                     AIPSQFMFAVNLLIITRISDKLNERSIVASTSNIWILPCLIALVALPESASTWTRYAI
                     STVLLSYPYCHAILVGWNARISNTVRTRAVGAALYNMCVQAGNIIGSNIFREDDSPLY
                     RRGNKILLAICSFNVVLFYAVKAYYVWRNKTRERKWESMSEEERSDYLLTTTDEGVKR
                     LDFRFVH"
     exon            complement(478597..479308)
                     /number=1
     exon            complement(479369..479554)
                     /number=2
     exon            complement(479604..479687)
                     /number=3
     exon            complement(479737..479786)
                     /number=4
     exon            complement(479836..479866)
                     /number=5
     exon            complement(479916..480109)
                     /number=6
     exon            complement(480158..480205)
                     /number=7
     exon            complement(480258..480350)
                     /number=8
     exon            complement(480425..480586)
                     /number=9
     exon            complement(480738..480899)
                     /number=10
     CDS             483803..484603
                     /codon_start=1
                     /locus_tag="AO090020000191"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000141"
                     /protein_id="BAE63412.1"
                     /transl_table=1
                     /translation="MAGRSPTRLLFTLATPSLLVGYGTHVWLNSLEARYPPIAPDRTS
                     TELLRTPANSTTQHVPHIDIYAARIRLRDLQARTNNPTEKPTKQDLNIAWAQSLLNCS
                     ILRLEAKVIGLFSKGKFNPGDLGTTPAGFSPDPETGAPRELLNGAMTVIRQPVRDEPL
                     LVKWEIPDGPRRFFEMIARWGYPWRLMTGGRHEMSVEGPFDGEGDEEGLGPFVEVRFA
                     SAHTYEIVPEEGGLLQQKTIPKWVGRLHRGYARFLLDTAVKELVEGTK"
     exon            483803..484603
                     /number=1
     CDS             complement(join(486613..486955,487032..488335))
                     /codon_start=1
                     /locus_tag="AO090020000192"
                     /note="acetyl-CoA transporter"
                     /old_locus_tag="AO070327000142"
                     /protein_id="BAE63413.1"
                     /transl_table=1
                     /translation="MNSNIEMRKRDTSIESTSSAQASRIMSRSSFSLDHDPPVTPQTP
                     GLTTTSFSNLPRSDKRNFLLLCVLYFLQGVPMGLATGSVPFLLKPYLSYGQIGVFSLA
                     SYPYSLKLLWSPIVDAVWSRRFGRRKSWITPVQVIAGLAMIYMGGRIGDMMVQAGANG
                     GAGVWNFTYWWFLLVFFCATQDIAVDGWAITLMSPPNISYASTAQTVGLTAGHFLSYT
                     VFLAFNSQDFANRWFRSIPGEGGLLSLGTYLTFWGWAYLVVTTCLAIMKKEDKTHDRD
                     SISDVYKSMWSVLKLKNVQTIILVHLIAKIGFQANDGVTSLKLLDKGFGQDNMALVVL
                     IDFPFEIGLGYYAGKWSTEYTPMRLWCWAFMGRLAAAVLAQLTVMIYPSGSEVPFWYM
                     LTVIGEHVLSTFMNTVMFVAVSAFHARISDPAIGGTYMTLLATVSNLGGTFPRYFILK
                     LVDMFTEATCIPPSVPPAADQLKGELVTAPFSCALEPDKNRCTNGGGSCQTIHDGYYT
                     TNILCVLIGTVTFFMFIRPAVLKLQGLPLRAWRLSPNSRQ"
     exon            complement(486613..486955)
                     /number=1
     exon            complement(487032..488335)
                     /number=2
     CDS             489248..489994
                     /codon_start=1
                     /locus_tag="AO090020000193"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000143"
                     /protein_id="BAE63414.1"
                     /transl_table=1
                     /translation="MFTCLVSSNSRTTVSCPFSAAQESGVRLESSLVSTSASPVSISS
                     LTKKSCPFSAARDSGVRPASESFEFTSACPVSSNSLATVSCPSSAAQPSGVDPVTSFE
                     FTSTLPVLRRTFTTASSPDCAANVKGVRNKLSLEFTSTSPDSSNSCTTPACPFPAAQP
                     SGPRPSSKSTAFRSTFPVSSKRWTISSCPFIAAMDIAVKPDSSPASGKAPSRMLIHAV
                     SSTPCAAAQTSAELSEFHALNRYKYGLMTA"
     exon            489248..489994
                     /number=1
     CDS             join(491991..492227,492282..493994,494046..494336)
                     /codon_start=1
                     /locus_tag="AO090020000194"
                     /note="oxidosqualene-lanosterol cyclase and related
                     proteins"
                     /old_locus_tag="AO070327000144"
                     /protein_id="BAE63415.1"
                     /transl_table=1
                     /translation="MALSTSPNTSICNLIYNPIYRLKPEELRMPPELPEKTDYTRWRL
                     LNEDGRHTWHYLEDDESSRKWPQTLADKYYLGLPLNLPDLPQPKSPLETVQNGLTFFS
                     KLQLSAGNWGCEYGGPMFLLPCIVFAWTATATPIPGPYATEIKNYLFARANPVDGGWG
                     LHIEGESTLFGTSLNYTVLRLLGVPADHAIMIKARTLLHKHGGAVYAPHWAKFWLALL
                     GIADWDIVNPVPPEAWLLPDWVPVAPWRWWIHIRQVFLPMSFIWSRRWTMPETEVIRS
                     LRNELFTQDWGTIDWRGNRNSIAEIDNHHPKTWVLGSLNWLLSEVWMPFLRPRFVATW
                     AEDWVSKLVDMEDENSDYADLASVNGPLNMVVCFIRDGGDAYSVRRHRERLEDFLWVN
                     KEGMLVNGTNGVQCWDTAFLVQAAHAAGLAESEEWRPMLVRALEFLDHQQMRENCKDQ
                     EVCYRHPRKGAWGFSNKDQGYAVCDCISEALKSVILLQKTPGYPQLLDDRRIFDAVDT
                     LLTYQNPSGGCSSYERTRGGEYLEMFNAAEVFGRIMVEYDYPECTTAVVTALTLFKKH
                     WPDYRSNEIEVFIQRALGYIKKAQFPDGSWYGSWAVCFTYGTMFALESLASVGETYRN
                     SEYVKKACHFLLSKQREDGGWSESCEGCRQIKYIEHPSGSQVVQTAYAVIGLLSAEYP
                     DMKPIEKAIRLIMARQQPNGEWLQEAIEGMFNKTCAISYPNYKFTFTMLALGKFARMY
                     PDYRLD"
     exon            491991..492227
                     /number=1
     exon            492282..493994
                     /number=2
     exon            494046..494336
                     /number=3
     CDS             complement(join(495036..495215,495338..495671,
                     495779..495988,496039..496079,496147..496213,
                     496262..496303,496357..496443,496535..496569,
                     496640..496681))
                     /codon_start=1
                     /locus_tag="AO090020000195"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000145"
                     /protein_id="BAE63416.1"
                     /transl_table=1
                     /translation="MSRDTDLDVVEVDTDAESGYGESAQSEWTSLRSSIMNYHYENGR
                     RYHAYHAGSYWGPNDEKAMEQLDIGHHVFNLLLDGKLYLAPIPEDVEQVLDIGTGTGI
                     WAIDFADTHPSARVIGTDLSPIQPTWIPPNLHFEVDDCCDDWVYGKDSFDFIHVRGLY
                     GCVADWDKFYKEALDHLKPNSYLEQVEVSVVPKSDDGSTNNTVFEEWGRVSLQAGDAF
                     GKTLRIVDEAKEKMIKAGFVDVQEHRFKCPVGPWAKDPRLKVLGKYNRLQWEMGIEGW
                     SMMLLTRFLNWTRQEVEVYLARMRQALRDPSIHAYQEKYSYPPLPLLFLLPFPWDLPY
                     PTTALITKPMT"
     exon            complement(495036..495215)
                     /number=1
     exon            complement(495338..495671)
                     /number=2
     exon            complement(495779..495988)
                     /number=3
     exon            complement(496039..496079)
                     /number=4
     exon            complement(496147..496213)
                     /number=5
     exon            complement(496262..496303)
                     /number=6
     exon            complement(496357..496443)
                     /number=7
     exon            complement(496535..496569)
                     /number=8
     exon            complement(496640..496681)
                     /number=9
     CDS             complement(join(498332..498628,498647..498679))
                     /codon_start=1
                     /locus_tag="AO090020000196"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000146"
                     /protein_id="BAE63417.1"
                     /transl_table=1
                     /translation="MFNLINSRTPWIQIGTSPSLFFGNQMLLQSVQYRLHSTIPAGQN
                     SLEQLVSSIIADDYRTLHDPIIGHFESSHPSIFPFKPNISCIESRGGKRYNAEVIRLQ
                     PDFLLVI"
     exon            complement(498332..498628)
                     /number=1
     exon            complement(498647..498679)
                     /number=2
     CDS             complement(join(499033..499692,499751..500650))
                     /codon_start=1
                     /locus_tag="AO090020000197"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000147"
                     /protein_id="BAE63418.1"
                     /transl_table=1
                     /translation="MQSSKSVGFDENRYRNEVLLVSSEEDERSQEQTLVEEARQLGLK
                     VPEVEIVASLAASIASGMVDLSSPILSSAGSSTNRNSVCEVTPSNEIPPLDQIASSFS
                     EFNLSDHAKCGSTRSLASLSTRPTSYSSSEGKLAHGTDGIALRKPGHRSSFLSVASSE
                     KKERRKSTLKSAIDKIHFRKRRSPSAVLLPPAAQITVAKGEGGVDKYYVESKINEPRG
                     HDGADEESPVLRLEIPVFDNESVRRSLENADLRQMRESQKMEKNRHMTFQDAFMSELR
                     RNHQTIVADRLAANKRSEEEKREKNIADASRMEERQLAVEMDQVREFERAKMNSRTRI
                     KYMEGYFSNASPPPSPGSASGSEISPPPTRKYTPQHKAQLAQEYHDHESMDRLHEAKI
                     KVLRDRQELKLQEAIARMEKELDDLIDKHALEFANLQRDHQQEEASVLQTFEDKKTRL
                     RHRWNLEEAILRKKLEVQHDQPYGPLPPLSFSDCRYETRDSAISVSEENPTSVSGDEE
                     LVHRKRSEPLL"
     exon            complement(499033..499692)
                     /number=1
     exon            complement(499751..500650)
                     /number=2
     CDS             complement(501728..502390)
                     /codon_start=1
                     /locus_tag="AO090020000199"
                     /note="esterase/lipase"
                     /old_locus_tag="AO070327000149"
                     /protein_id="BAE63419.1"
                     /transl_table=1
                     /translation="MHGSDDEFCRQVSREAGYTVLDIQYRLAPENPFPAALHDAEDAV
                     NWVLQRPEKFDTSRLAISGFSAGGNLALALSSSVFPRGTFRSLLAFYPPVDLYTEPGL
                     KTPPDPAGKPLPAALARVFDRCYIPASYDARDPRISPLYAQPDRFPDRILLVTAACDS
                     LAGEAEALAAKIGKEPEREISVHQMQGCNHAFDKNAPEGSTSANAKDKSYAMAVAMLS
                     RS"
     exon            complement(501728..502390)
                     /number=1
     CDS             join(503452..503547,503598..503667,503782..504088,
                     504166..504241)
                     /codon_start=1
                     /locus_tag="AO090020000200"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000150"
                     /protein_id="BAE63420.1"
                     /transl_table=1
                     /translation="MTSLNQSGDTNFTVFIRLPFPRGDFVDPPPASWNAAKDQALWDL
                     LSRPSKGDDIDCRAERFDVTLQFLLQQAAWLYDRQLSQVRWQMRKVGTTQSSSPSPAP
                     GSVSGSTALGGQSAKGGPGAGKQVFRRCVCHRLIFVSPTSSKSSILTSKRYSPSTRSA
                     TTSHELGNYSQPNQTFEGITPH"
     exon            503452..503547
                     /number=1
     exon            503598..503667
                     /number=2
     exon            503782..504088
                     /number=3
     exon            504166..504241
                     /number=4
     CDS             join(506488..506690,506749..507766)
                     /codon_start=1
                     /locus_tag="AO090020000202"
                     /note="uncharacterized conserved protein with similarity
                     to phosphopantothenoylcysteine synthetase/decarboxylase"
                     /old_locus_tag="AO070327000152"
                     /protein_id="BAE63421.1"
                     /transl_table=1
                     /translation="MASAPTHEMTPAEAESVYFNNYPPPKALPKHEALARAFINYHVE
                     DNRRLVLVTSGGTTVPLENQTVRFIDNFSAGTRGATSAEYFLEAGYAVIFLHRQFSLL
                     PYSRHYSHSTNCFLDFMDEAPPASNAESDHGRIVVHSEYQDQMRDVLRKYRHAKKHNR
                     LLLLPFTTVSEYLFELRSLATLMKPLGPNALFYLAAAVSDFFIPSDRMSEHKIQSSEL
                     PQNLNNEEAIDPSDIYTGGIPQETKPPTHSKKLIIDLDPVPKFLHQLVDGWAPDGSMV
                     VSFKLETDPNLLVYKARTALQRYAHHLVIGNLLSTRKWEVVFVTPESPYERWIRVPKS
                     KRSKSISGAEEQVGLAEAKTAGGSAAPKNGETGGDYQQGQDSSHEGMEIEALIIPELV
                     KLHSNMIAKHGAQA"
     exon            506488..506690
                     /number=1
     exon            506749..507766
                     /number=2
     CDS             join(508646..509611,509667..509987)
                     /codon_start=1
                     /locus_tag="AO090020000203"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000153"
                     /protein_id="BAE63422.1"
                     /transl_table=1
                     /translation="MFPRRFRRIAVITSVLCLFLLYHFSGLRSSFHATTSHGRRRFEC
                     PPLPGMEDVLVVLKTGVTEALDKVPVHFQTTLRCVPNYVIFSDFEEEINGIKVHDAFR
                     NMDPDVKGTVPDFSIYNRLVQLGRAGLETGDFADEANSAIGKPNNPGWKLDKWKFLPM
                     VQETLRYKGDAKWYVFMEADTYYSWGTLLEWLSHFDASKPWYLGTETQIADVIFAHGG
                     SGFAISNPAMQRVAKEYTERNVELNEYTDAHWAGDCVLGKVLADVGVPLHFSWPILQN
                     TNIGELDEFTTAFYRRPWCFPAVAFHHLSARDVQDLSNFEQRRWREKQTTLLLHGEVF
                     KELIYPNLSSYRDNWDNLSDEEHSEITTFDDCQTLCKDKSDCAQFSFRSGSCFTGRTP
                     KLGTASSGARSGWAMKKIEEMMHEAPVCSSVEWGAA"
     exon            508646..509611
                     /number=1
     exon            509667..509987
                     /number=2
     CDS             complement(join(513167..513364,513480..513577,
                     513627..513706,513755..514115,514170..514305,
                     514356..514426,514501..514813))
                     /codon_start=1
                     /locus_tag="AO090020000204"
                     /note="ATP-dependent RNA helicase"
                     /old_locus_tag="AO070327000155"
                     /protein_id="BAE63423.1"
                     /transl_table=1
                     /translation="MDTFNVSSMGTALDDVTQAQNAKKAEAASTAREKGWAEPEGYDY
                     SKYNAAPLGPPLATPGEGNEPEQPQQELPEWAANAAKYEWKDEYGDVGPANPQLEEML
                     FRTDLRSLQNIEVEAESRDRPNPIKSFDDAGLHPIVRENVKLCHYDIPTPIQAYAIPA
                     VMTGHDLIAIAQTGSGKTAAFLIPVLSKLMGKAKKLAAPRPNLADGFNPIVDAVRAEP
                     LVLIVAPTRELSTQIFDEARRLCYRSMLRPCVVYGGAPVRDQRDELQKGCDILIGTPG
                     RLLDFMDKPHILSLRRVKYTIIDEADELLLADWESDFNKIMSGGDMNEDADHRYMMFS
                     ATFNKECRQLARKFLAGDHIVYSEEHLKKQCLYDLLLAMPPSRTLIFVNSKAQADLLD
                     DYLYNMGLPSTSIHSDRTQREREDAL"
     exon            complement(513167..513364)
                     /number=1
     exon            complement(513480..513577)
                     /number=2
     exon            complement(513627..513706)
                     /number=3
     exon            complement(513755..514115)
                     /number=4
     exon            complement(514170..514305)
                     /number=5
     exon            complement(514356..514426)
                     /number=6
     exon            complement(514501..514813)
                     /number=7
     CDS             join(516740..516955,517105..517387,517459..517957,
                     518011..518293)
                     /codon_start=1
                     /locus_tag="AO090020000205"
                     /note="pantothenate kinase PanK and related proteins"
                     /old_locus_tag="AO070327000156"
                     /protein_id="BAE63424.1"
                     /transl_table=1
                     /translation="MSSTNYNPPSRATRLEKAITNPGAVKINVKGAFIVDEDPRSKSP
                     VRLDGVHYEGHDIRLPHHTGVVSHVAVDIGGSLAKLIYFTRELDSVDNGGRLNFINFD
                     THRIDLCINFIKELKEEYQKAHGPSSDELCVVATGGGAFKYYDKLKETLKVNIIREDE
                     MECLITGLDFFITEIPNEVFTYSETDPMQFAEARPDVYPYLLVNIGSGVSMIKVSGPR
                     QYQRVGGTHLGGGTFWGIMSLLTGARTFDDMLAMADSGDNSGVDMLVGDIYGMDYNRI
                     GLKSTAIASTFGKVFRLKNDVHEEDGEDKPHGEDGQTNGEVTFKPEDMSRSLLYAISN
                     NIGQIAYLQSEKHQVKHIYFGGSFIRGHRQTMNTLSYAIRFWSKGEKQAYFLRHEGYI
                     GAVGAFLRRQPANWGRRNSLDGSAMPQELRSSSS"
     exon            516740..516955
                     /number=1
     exon            517105..517387
                     /number=2
     exon            517459..517957
                     /number=3
     exon            518011..518293
                     /number=4
     CDS             join(520585..520606,521070..521180,521227..521464,
                     521735..522374)
                     /codon_start=1
                     /locus_tag="AO090020000206"
                     /note="N-acetylglucosaminyltransferase complex, subunit
                     PIG-C/GPI2, required for phosphatidylinositol
                     biosynthesis"
                     /old_locus_tag="AO070327000157"
                     /protein_id="BAE63425.1"
                     /transl_table=1
                     /translation="MTEYLEESLRPPHAVPARKLRGTSRRRRRKGAWKKLLWVKQSCM
                     DPDNYTDTETFLDHLQRNPRVRPYDFWPLVADSTVIVQHVCSVAIFVCCFVGIVQGRV
                     SPVSIVCWGSVGTAMGWILWDSVPPLPPHDAPMISRLSSRNRQRLSTVKSAFLIYCAL
                     LGLSPILKSLTKSTASDSIWAMSCWLLITNIFSFDYGSGEGAGATKFPASLSTNAAVM
                     ASTVLASRLPSTTHVFSLMLFSIEVFGLFPIFRRQLRHISWTGHVFLTLALVIAAGGA
                     VGITLRGGLTAAVVGSMLGSILTALAMGGCSWWLISLQKYKNVVTGPWDPARPIIRRH
                     WD"
     exon            520585..520606
                     /number=1
     exon            521070..521180
                     /number=2
     exon            521227..521464
                     /number=3
     exon            521735..522374
                     /number=4
     CDS             join(523135..523217,523319..523611,523674..524277,
                     524375..524690)
                     /codon_start=1
                     /locus_tag="AO090020000207"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000158"
                     /protein_id="BAE63426.1"
                     /transl_table=1
                     /translation="MKWKSLALGLLATAQSAASLRFVMYIDEYHTQGLPDSSGTAGIS
                     HAVMGFAKSTLFNSDSPQSWKPFEPIDTMRKRFSSDTKLLVAIGGWGDTSGFSEGAKD
                     EASRARYAKNVKAMVDEHGLDGVDIDWEYPGGNGEDYKDIPNEQKAGEIETYPLFLAA
                     LRKELGKDKLISVAVPGKRGDMIAFTKEQGPKIWESVDMVNVMTYDLMNRRNNVTTHH
                     TSVKGSLDSIKAYEEIGLDTQKINLGLAYYAKWFTTKKDAGCDTHPLGCEVVELEDAK
                     GKDTGKSGALTFEKGTMGEPSKDLKESTDGSCGFGKGKCPNGSCCSQYGTCGTTDAHC
                     QAGCQSDYGTCKGISLIDSWRRAEKDGVTDEDAGGQYYFDKEVDLFWTWDTAPLIKRK
                     FKDIVDAEKLGGVMAWSLGEDTLKWEHLHAMQEGVQERS"
     exon            523135..523217
                     /number=1
     exon            523319..523611
                     /number=2
     exon            523674..524277
                     /number=3
     exon            524375..524690
                     /number=4
     CDS             525131..525871
                     /codon_start=1
                     /locus_tag="AO090020000208"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000159"
                     /protein_id="BAE63427.1"
                     /transl_table=1
                     /translation="MKWALFYLICLPVCWGVPLPGISLSSSDKDHDHKDLKKFRGMKS
                     WNFFDGDHHSNTDILSPSRKDTDVDIDITKTGQHPLTLHQPSEDPDYTSNSNPNSHHT
                     NNINNANLNNNNHNNDNSPTTHGTFLTTPNTPPTQIPPSTTKRYLRVLHDTQLPTNFL
                     KNHMHEIVVVGLFLLIPVTLALVEIIERIGLGVDEGVELEDYLELERGRGMIRRGRRR
                     VFRKKRGKKKKKPTSILEMDVEDQVFLR"
     exon            525131..525871
                     /number=1
     CDS             complement(526022..527563)
                     /codon_start=1
                     /locus_tag="AO090020000209"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070327000160"
                     /protein_id="BAE63428.1"
                     /transl_table=1
                     /translation="MVLQGRPLRLTQVFLIVVPAFILFGYNQAGVGPLATLQSWVHVF
                     PEIDAVNTTGAVKAHNSTSKGAVVASFQLGALIGALSCSFLGDWMGRRKTVFLGTIIS
                     IIGQVLQTASYGLVQFTIGRVILGVGIGMFSAAVPVWQSECTSAKHRGQHVIVDGICI
                     CLGYTLCNWIDFGLSKVDGTLQWRIPLAISFFFELVLVCSVFLLPESPRWLVRVNRIE
                     EATTSLAAYKGIPEEDDEIRMEIAGIESSLEVSAEHSGSLKEMFSKNDKDRLLYRFGL
                     CMALQFFQQMCGGNLISVYASTIFEENLNMDSDLARILSSCAMTWKFLCSFIAFVAID
                     RLGRRAIFMISGAGMSVCMIVLAITNSFGKNYAASIVSALFIFLFNSFYPFGFLGGNF
                     LYCTEVAPVRLRVAMSSISTANHWLWNFVVVMITPVALDTIGYQYYIMYAVISGCIPF
                     VVYVFYPETMNRNLEAINNVFRDAPSTWNIVNMARHLPQGEAAEVDAFTRAAEKAEIE
                     QRENV"
     exon            complement(526022..527563)
                     /number=1
     CDS             complement(join(528326..528664,528883..529373,
                     529487..529724))
                     /codon_start=1
                     /locus_tag="AO090020000210"
                     /note="isocitrate/isopropylmalate dehydrogenase"
                     /old_locus_tag="AO070327000161"
                     /protein_id="BAE63429.1"
                     /transl_table=1
                     /translation="MKTYNIASIPADGIGPEVISAGVTVLNALAEKLNTFKLDFTHYD
                     WSSETYKTTGKYIPDGGLEDLKRHDAILFGAVGAPDVPDHISLWGLRLSICQPLQQYA
                     NVRPTRVLRGTQSPLRNCPPGKLDWVIVRENSEGEYAGQGGRSHRGFPWEVATETAIF
                     SRHGVERIMRFAFETAAKRPRKLLTVVTKSNAQRNGMVLWDEVATEVGKEFPEVQVDK
                     MLVDAMTTRMVLKPETLDTIVASNLHADILSDLAAALAGSIGIAPTSNLDPTRQHPSM
                     FEPIHGSAFDITGKGIANPVATFWTAAEMLAWLGEETAAQKLMECVENVCERGILTAD
                     LGGKATTKEVTEAMVGEIQRL"
     exon            complement(528326..528664)
                     /number=1
     exon            complement(528883..529373)
                     /number=2
     exon            complement(529487..529724)
                     /number=3
     CDS             complement(join(530091..530481,530537..531020,
                     531073..531997))
                     /codon_start=1
                     /locus_tag="AO090020000211"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000162"
                     /protein_id="BAE63430.1"
                     /transl_table=1
                     /translation="MDSPHHDYITSPAKRHKSNPPREIGVMRKSFVDNGSATFLGSSS
                     GIHFIRTVYNSFARRSAHLSQSKNTQENLVPGEDDQLLQSPGYDAQAVKKELWAPQEL
                     DHRSWTASFEQLVQWTRSYFECWHPMFPFLSGPKFLELLEQISQGGLDGVKTTDVILI
                     RSIVSISLMDGRQVTATRSTPVPAKLVFRTVDQAMESLHTLFCDPPTISILQAAFSVA
                     LFLASLLRLNAASRIGGVITRTAFHLGLHRCPARFACFSPEEAAVRQRLFWSIYCLER
                     YLSQSLGIPLSIRDDDIDVCYPGIERHGEGVYDPNLRLLTYLAKFARVRGLVLELRNK
                     SILHSQETSNTATQVNGELAHWWNEVYDDVYPVEEDPGLTPLHRLLLIVFRHESIISM
                     NRPLLAAEQSSPEYKTALQVCIESSRSLITALRGYVLPGGQGTVPLVWPSFTWAVWMS
                     CLILVYAAWEGDFPVLSASRYAKTGLSILQNLSLRGNTWPQTCIEAIRDLESALSNPP
                     PTPPIDNRPASPGPAEDRAPDYPTNIVEDPRPAPQYHPSVVFGDSSINNFPLTYPFPD
                     PGDFESGWNDLWTVADGPWLIEENFDQNFGFHI"
     exon            complement(530091..530481)
                     /number=1
     exon            complement(530537..531020)
                     /number=2
     exon            complement(531073..531997)
                     /number=3
     CDS             complement(join(533617..534524,534582..535159,
                     535214..535665))
                     /codon_start=1
                     /locus_tag="AO090020000212"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000163"
                     /protein_id="BAE63431.1"
                     /transl_table=1
                     /translation="MAPTLSSANLILAFFALLTSSRAAPSPSVPAETAVPSSKTAAGA
                     PLFHSETLQSTDGVLTKLNLQNNTSLFAFGSNSSSSKLSLGDSGACKVFPGDSEWPST
                     STWSLFDRLLGGALIETVPLASSCFSSWPEYDSAQCNLVSNNWTDSNLHAADPASIMW
                     PLYEGRTCLPTDDTSGTCTVGGYSKYAVNVSSVAQIQLAVNFARNTGIRLVVKNTGHD
                     FNGKSTGAGALGIWTHNLKDIQYLENYQGQGYSGPAVRMGAGVQATEIYAKAKELGFT
                     AVGGEGKTVGVAGGYVLGGGHSPMSSIYGLAADQVLALELVLANGRFVTVTEETDPDL
                     FWALRGGGGNTYGIVTSIISRVHPKVGVTTSTFSFSTGGNVTVDTFWAGVRAYLDRFA
                     INADAGTYAYFWVMSTGTNSFSFLMNPYFAVNHTVSEFNALMKPWFDELNHLGIPYTP
                     DTKYHDNFYDAWDAVFPLETVASSTMVTGSRLFPRANWEDASLLNETFNALKTTVTAG
                     YPLLAFNMKAELPEGYPESSANPAFRQTLMHAITSASWTANSTNTQILNQMEHFANNV
                     LGIWRKTCPEAGAYMSEANILEPNFQQSFYGSNYERLYQLKQKYDPSGLFYAPTGVGS
                     EDWTVKSQDGLPDQNGRLCRV"
     exon            complement(533617..534524)
                     /number=1
     exon            complement(534582..535159)
                     /number=2
     exon            complement(535214..535665)
                     /number=3
     CDS             join(536743..536918,537013..537238)
                     /codon_start=1
                     /locus_tag="AO090020000213"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000164"
                     /protein_id="BAE63432.1"
                     /transl_table=1
                     /translation="MAKYYPLSQILTVAKVHPFYSDTQWAPTRERLSDILANSNDYAE
                     DIHLHSFPPTEKAKLPQNGYRQSTYISTTGGGSGGAPMVFATDSLENRHQRAAIGSLI
                     RACQIIEPGDWVLTMHVSGHFYRQVNALRRW"
     exon            536743..536918
                     /number=1
     exon            537013..537238
                     /number=2
     CDS             join(537332..538176,538194..538221)
                     /codon_start=1
                     /locus_tag="AO090020000214"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000165"
                     /protein_id="BAE63433.1"
                     /transl_table=1
                     /translation="MEMEALVDALNQYRVNVVAGDAGQLVQLVRYLDTLPVNQRASLQ
                     IRKMIYTSEPMTPAQRKFITSVLGGVTICSMIGSAEAGPWAVSNPLLTGYNPESPSAD
                     FIYDTRAMLLEVLPLSYQGSEVKSNCHDGCIAGVPDGEKGTLLQTSLQRLRNPLVRYV
                     CGDVASLHPLPAEVRARLPAEEAEHYRIVRIYGRDKRISFDWYGEYFEFETVQALMRQ
                     ASWGILQWQVILWTKPEGLDKCLEVRLLRSTASDGALLSEEDLIKEVKHFFMVFDFNE
                     SLFQLKWVRSQCNG"
     exon            537332..538176
                     /number=1
     exon            538194..538221
                     /number=2
     CDS             complement(538776..539477)
                     /codon_start=1
                     /locus_tag="AO090020000215"
                     /note="multidrug resistance-associated
                     protein/mitoxantrone resistance protein, ABC superfamily"
                     /old_locus_tag="AO070327000166"
                     /protein_id="BAE63434.1"
                     /transl_table=1
                     /translation="MVDNVDISQVSLGRLRSQLAIIPQHPVLFRGTVRSNLDPFGDYD
                     DAVLAGALQAVGWHQNEDSASEPTSSTLRASSTESARESLIKGDTDMEHDCLLTEETT
                     ERGLDQPVADCGENLSHGQQQLLCLARAIIRRPKILVMDEATSSVDNPTDDLIQRSLR
                     SALGQSQPTFLVIAHRLKTIADSDLVLVMDDGMIVESGSPKELLHCDQSCFRSMVYQD
                     PEGEMLENIILNGVE"
     exon            complement(538776..539477)
                     /number=1
     CDS             join(540706..540735,540792..540855,540941..542322)
                     /codon_start=1
                     /locus_tag="AO090020000216"
                     /note="aldehyde dehydrogenase"
                     /old_locus_tag="AO070327000167"
                     /protein_id="BAE63435.1"
                     /transl_table=1
                     /translation="MATEYKLPFELNDPSLLHFDSFVGNSWVQAKNPGTDIPWASCPT
                     NSAEDVPSAVETAHAAFEQYKKSNPRQRAQWLLKWDTLIREAKPDLAKILTHETGKPL
                     AESYGEIDYATGFTWWFAGEAERIHGSISVPSAPNRRVFTVKQPIGVAAALVPWNFPI
                     AMVLRKAGAAFAAGCTMIVKPSPETPLTALVLAHLAQKAGFPAGVFNVLTTDLENTPS
                     LSEALCKHPLVKKVTFTGSTRVGKLIASHCAHGLKKLTLELGGNCPFLVFDDANLDQA
                     LDQLMALKWRHAGQACITANRVYVQAGIYDRFAQLLKERTQKLVVGHGAKEGTTMGPV
                     TTPRSIDKALSQVEDARRLGADVILGGNKVTDTKGYFFEPTILTGMTKDMLVSREETF
                     APIAALYKFETEEEAVQLANDTSMGLASYAFTKNIDRMWRLLENLDAGMIGMNTGNSS
                     AAESPFGGIKESGYGKESGKEVAVNEYLVTKTGTLTIEGQY"
     exon            540706..540735
                     /number=1
     exon            540792..540855
                     /number=2
     exon            540941..542322
                     /number=3
     CDS             join(543275..545636,545702..545931)
                     /codon_start=1
                     /locus_tag="AO090020000217"
                     /note="glutamine synthetase"
                     /old_locus_tag="AO070327000168"
                     /protein_id="BAE63436.1"
                     /transl_table=1
                     /translation="MDLTSLQSLIQTHPLIDNHAHNLLKRDEACNYAKYPFEQITSEA
                     QGSALGNATSTLPLHRAATQLAALYRCASSDWDHVKAARDAWVQRDYDGLIRECLQGT
                     HTLLLDDLLTDQDIESYEWHDRFTTSQTKRIVRIEILAAETISTLMRDDARPQEGDVS
                     VLRERWEQFREGFKQRIAEAIADPAVVGFKSVICYRTGLNVQPIEDSDDTLLLESFGR
                     TVGQGQGSAYRVEDKRLNDWVVRQTLNLLQSAKAATASAPNKPLQLHTGLGDNDIDLV
                     LANPAHLQSLIAQYPEVDFVLLHSSYPYTREAGYLACVYPNVYLDLGEVFPMVSRDAQ
                     ESILRDSLDIVPTTRLLWSTDGHFFPETFYLANKQFRDVMEKVFVDYVHYGDFTVDQA
                     KQAAADILFHNSNRAYSLNEKLAYEAPVSANSVSASSTATLDAFMRGNPDVKYIWMQF
                     IDYTNTTRVRMFPVAEFAKIARKQRRVGICLCTQLMLQDDSIAPEGSVTGQFYMEPDL
                     SSLRRNVGIDSKSATVMTYWKTEEGAPLPGCPRTTLQRVTNNLREHGIEVTCGFEIEV
                     ILLKPITNDAGETDYVPVVRNHSWSQMTSDTRKMVPLLEEIVEALASIGIHLEQFHAE
                     SAPGQFEFILPPGSPIATVDTLIKARQVVTCVAEQHGLRATLHPRPLPHAAGSASHAH
                     VSIAPPTQEDAFLAGVMRHYPALAAFTLSQDVSYDRVKSGLWAGSEWVTWGTQNRETP
                     IRKISPGHWEIKTLDGLANMYFAIAAFLSAGYLGVKENLPLTVKDCIHDAAKLPQAER
                     EALGITTELPKSLTQSLDALEADSALQSIIGETVVNNYTSVKRIESKRLLAMDETTRR
                     TWLLERY"
     exon            543275..545636
                     /number=1
     exon            545702..545931
                     /number=2
     CDS             complement(join(546608..546858,546931..548681,
                     548715..549982,550043..550181,550242..550368,
                     550525..550573))
                     /codon_start=1
                     /locus_tag="AO090020000218"
                     /note="signal transduction histidine kinase"
                     /old_locus_tag="AO070327000169"
                     /protein_id="BAE63437.1"
                     /transl_table=1
                     /translation="MESNHRSDDHNTGRRVRSTGAASTVVPEEALVLGNPNTTLSSFA
                     QLAALRLDVERVLTSVSDRNSQFILAQSTRSTATSNKHEMSGDGVWSGCSTISTEAWK
                     MCAATVALGPSKKEEGHCKFLVIDDLSQHDEYKGLSFVREKPNFRFYAGTPLTTETNI
                     NIGCLFILDTKPHDGLTDTDKQTMKTVSMLIMDYLRVSRQASEGRRAARLSRGLSCFV
                     EGSSSFVDTSHPSYAGSFAAVPGTPQSSCLRANHLSVGSLNSFELPSRRSQSSDARSI
                     SSMSEGRGDSGLSPLPDWWSGNRGNQRLDEVHGNSWAFKRAANLLRESLELGDDGGVI
                     FLEAGNTPMLDIESGSDCSTENSSPAPVLAISTNDEPFAPGPGSSNLYPASNFDSSFL
                     HQLLRRYSKGKLWSFHRDGLVSSSDDEKPSRSRSRATKTSELGRGTGKKWKSLENSML
                     NLYFPNATQVLFVPLWNAANSQWFSGCFCWNTVETRVFNSSVELSSVLGFGSSIMAEY
                     SRVESLISDRQKGDFIGSISSAIDRYLFHRHELRSPLHGILAAAEFLSGTKLDDFQGS
                     LLETIDACGRTLLDTMNQVLDYSKIVSLEKSWRQIKRDKTVPSDYRALDRLSAHLDTY
                     VSTDLALLTEEVVEGVCLGHAYGQKSTISSDQPVVVSPMEDPGDKGSLSHPRPEVDVV
                     VNIAQNDWVYQTQPGALRRIIMNVFGNAMKYTDSGRVSVRLEVTEAEGRCRRSGMEEL
                     VTLVVSDTGKGISEEFLRGRLYTPFAQEDTLAVGTGLGLSIVRSLVKSLNGRINVNST
                     PGEGTTVKVTLPLLRPDVEDIAEDPLTPRSPSAKEKDSPTESRLLRDNHAGRRVAIAG
                     VEPDEIAGHPWWSIISRYLTEWYGLELVSWSSQGPVDIVLSEGATSAADLKKQFATKV
                     PALLLLCDKSVDRATKLKECSSLASIVNIIRPPCGPHKLARSIRKCFDSHANSIPTTK
                     SIVLPERPKFIPDGKGGFESEFSDDVADLTPDATSSSGASSLLGSAHSPTHSEIPEIL
                     PTIMSPSSSVRDPSPSEIKEPESKPQRLARVLVVDDNAINLNLMLTFMKKRNLSTLDS
                     AENGKVAVDAVERLQQGYDLIFMDISMPVMNGFEATRAIRAIEKERDCCTPATIIALT
                     GLSSSRDESEALTSGVDLFLTKPVSFKEVSRLLEEWAENGLGNRCLSS"
     exon            complement(546608..546858)
                     /number=1
     exon            complement(546931..548681)
                     /number=2
     exon            complement(548715..549982)
                     /number=3
     exon            complement(550043..550181)
                     /number=4
     exon            complement(550242..550368)
                     /number=5
     exon            complement(550525..550573)
                     /number=6
     CDS             complement(join(551951..552138,552206..553754))
                     /codon_start=1
                     /locus_tag="AO090020000219"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070327000170"
                     /protein_id="BAE63438.1"
                     /transl_table=1
                     /translation="MTPILAAGFTQVADTYDVSTQQVAYTTGLYMLGLGVGSVIMSPT
                     AILYGKRPVYLLGATLFVISGVWCALSPNYPSLVIARVFQGIAVSPVECLPSATIAEI
                     YFLHERAYRVGIYTLLLLGGKNLIPLVSAAIIGNLGWRWVFWIVSIVVGACLVLLFFF
                     VPETFWDRTPRPRTRKRPHLYRSVSDLVSHGIRGRPTHVQRLEDHAPEADTESALPKK
                     SKKGHVGFVENPDAEGHSPNEKEAEADHDRVSIAPDVPGEDHVHFARDADPEKADGFL
                     HPPAPAAFGSERASDLGVGRQAAMSPARSDSLDPGAPMNGSMHYTNWLRERPQMPYLH
                     YLRVWNGRISHDNWMRVAVRPFILFAYPAVLWSAVVYALSVGWLIVLSESVAKVYETR
                     DTYNFTALQVGLVYISPFVGGLLGTAVAGKVSDVIVRYMTRRNGGVYEPEFRLVMAIP
                     IALSTTAGLMGFGWSAQEKNAWIVPTVFFGLVSFGCCLGSTTSITFCVDSYRQYAGEA
                     LVTLNWSKNVFHGLIFSLFIVDWLNAQGTQTVYLALGGIQLGFLLFTIPMYIYGKRLR
                     MWTVRKRLMEQW"
     exon            complement(551951..552138)
                     /number=1
     exon            complement(552206..553754)
                     /number=2
     CDS             join(557344..557515,557593..559037)
                     /codon_start=1
                     /locus_tag="AO090020000221"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000172"
                     /protein_id="BAE63439.1"
                     /transl_table=1
                     /translation="MGGEMSPGVALQHDALYHRNSLRSLLAICPGELRCFHSTMEQPK
                     LWRHFSSRLFRKAEAFNGSIVALATNRYDYDAMRTKTPAKTFQRVGLMVGLNQACQCI
                     GSILIAPLIRRFPSRIVLSSAVLVFALFSALLLIIDASTGGTFAPASFRDQHPDHDFH
                     YYGRYNTDGMIPVYCVAGIAYGMVELMRRVIPRDIVGGNVKKLRHLDALVHIFYEISG
                     TGGAFCTALALIPFFGNNYSFLITPICFAFAAISWFFLTDETFRSHDTPALERQPSYI
                     KAVTVGFWLFIESIWTGARIIFTSRKFIWLVPGYSVALYAHRYLENAVAPAIARRYLG
                     NAAWSQIIVGGSNLGELLGALFVILFTNLVTTPVPWLRLDAVMLLITWYLPFWRPPMQ
                     ISAAWMAAATFIPISFGWAAGDVSLAAYIQAALARVESKTQNVSALGAVMAFLYSTYI
                     ILYAITSPILGSYIDRVYSDTGGSENGGNIYAAIQNVASVQFTIISGLVLLSTFVPRG
                     SLAFNPKMLYNEYLDGEAGLERVSSDDLRK"
     exon            557344..557515
                     /number=1
     exon            557593..559037
                     /number=2
     CDS             complement(559248..560351)
                     /codon_start=1
                     /locus_tag="AO090020000222"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000173"
                     /protein_id="BAE63440.1"
                     /transl_table=1
                     /translation="MAALAPNATFSAGAELLLDRIQATTNSNSPLWVLAWGGTNVLAQ
                     ALVKLHKDNSPEKAANLRKNLRIYTISDQDDTGAWLRQQWPDLFWINSIHGWNQYGMS
                     TWVGISGDEFYDVDKGGPNSTLVSKAWLKENIQIGTLGAAYPDVAYTMEGDTPTFLYL
                     IQNGLGVSEHPEYGSWGGRYQLVTSNQHGPGFRHYSDVQDQVVGLNGNTFKSNKATIW
                     RWRDAYQHDFAARMRWTLTDDVTKANHHPLVKVNGSSGLEPVNVYGVAGSEVVVDAGE
                     SVDPDGDELTFNWIYYPEPSTINGTPDVNVTTFGSRGESARLPVPIIDRTCEAGIEHC
                     DLFHFILEVKDSGSPPLTTYRRILLHVAKSDAK"
     exon            complement(559248..560351)
                     /number=1
     CDS             complement(561965..563146)
                     /codon_start=1
                     /locus_tag="AO090020000223"
                     /note="nucleoside phosphorylase"
                     /old_locus_tag="AO070327000174"
                     /protein_id="BAE63441.1"
                     /transl_table=1
                     /translation="MDSSTRTLCVRVSPSAHEQTPLDERARQLNKDMTALLVQSFRPI
                     SKLDKGLRPEELKSSCDKATKTAPLANRTTPKESEEYTIGWICALSLEMAAASAMLDE
                     IHETLPTPSNDYNNYTLGKIGSHNIVIACLPIGVYGTTSAATVATQMLATFPSIRFSL
                     MVGIGGGVPSSTADIRLGDVVVSKPNGRLGGVVQYDYGKTVANGIFEQTGALNKPPQA
                     LLTTVAKMQAEHMMRGDKIFKYLSQMVTAYPRMQNFTYPGQERDYLFRADYDHEGPNP
                     TCKNCDPAQTVDRKVRMQSTPVVHYGTIASGNQVIKHGQTRDRIAQQQGILCFEMEAA
                     GLMDNFPCLVIRGICDYADSHKNNDWQEYAAATAAAYAKEFISMTPARQVEITPTAVE
                     A"
     exon            complement(561965..563146)
                     /number=1
     CDS             join(563321..563566,563668..563745,563854..564570)
                     /codon_start=1
                     /locus_tag="AO090020000224"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000175"
                     /protein_id="BAE63442.1"
                     /transl_table=1
                     /translation="MEATVISLYWPSVRLQGPLRTGVLVRSGSLALSLAFNAVDPRTT
                     GSTKSFPAMPRGPKYSVRTGPKFERLIGSWLAGAIFSKNPPLGIRHKRAVNLDRSQLP
                     VSQALATRYLRDVAQLEVLVEKFKLVVPNCVCTLYVFTNRIQSSKRGGFSLAGQRGTF
                     IFRQLHKTGCTLSTIPLPFYSVSVLHGDTFWSIQWKSMSSHPARNVLQPTGTTLPLEL
                     ELEEDIEKEIHHFVQLTRMGHYTDAQKFFDNTLGKHDHLFPVVAEYADMLLEQGRYRH
                     AAEFLNEHIRAKEEIFDPDEMQLLKIMKALAEIYSKGALRSALVEAKRAWSLLDLEGK
                     QRLEDLNEVQAS"
     exon            563321..563566
                     /number=1
     exon            563668..563745
                     /number=2
     exon            563854..564570
                     /number=3
     CDS             join(565942..566088,566404..566473,566539..566700,
                     566794..567497)
                     /codon_start=1
                     /locus_tag="AO090020000225"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000176"
                     /protein_id="BAE63443.1"
                     /transl_table=1
                     /translation="MSEDSDTLTSKVSLEDPSDSPISTYSGLVSAASPKVSMSPMSRM
                     ALRSDSLTETVMDYPFQYGRRYHKYHEGAYVFPNDEKESVRLNMQHHMFKLVNNGRLY
                     FAPLQDPRKMLDIGTGTGIWPIEMAALFPNAEITGTDLSPIQPTVVPENVHFLVDDAA
                     EEEWLWHHDYFDYIRLAHLTGGIPSSEELLRKSLQHLKPGGWLECHEMDPKPMCDDGT
                     MPPEAEEGGLSAFALHDWWRAQHQSGQFTNPPRQFRIAPRIERSMIESGFVDIQQRIK
                     KVPTNPWPSDPEMKEIGFHSERNWLEALSGWSYKPLTSLGWTRPEIEVFLVNVRKAIR
                     NRDVHCYTNYHVVIGRKPFPDEKEAL"
     exon            565942..566088
                     /number=1
     exon            566404..566473
                     /number=2
     exon            566539..566700
                     /number=3
     exon            566794..567497
                     /number=4
     CDS             join(569506..569678,569736..569823,570108..570695)
                     /codon_start=1
                     /locus_tag="AO090020000226"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000177"
                     /protein_id="BAE63444.1"
                     /transl_table=1
                     /translation="MKKAGADLKDKLASAKQRVKELENEALGLKGSLATTQASLEKLE
                     GYATRYSDITEDSAIESMLKFWDYAKTEIFAMLETDLSNDTLRVLANQASIDSEKESF
                     CRSILLSLDPTTQDRICRVGIQTVVKNVLEYLDELLPEDRRLAFHKTLEEVVQEAAKI
                     WKPIQGSKRRYEPDFDPPTADDDCEAFTFPVTDNTNTEKGAKPKHTKKIALTVFPRLS
                     IIENNMSTAYTTITQLSNSQYEWMAAESEMDKEPASPTIGRIPWRRKSNNPKSLSLPN
                     GGSKKT"
     exon            569506..569678
                     /number=1
     exon            569736..569823
                     /number=2
     exon            570108..570695
                     /number=3
     CDS             join(571541..571801,571855..572358)
                     /codon_start=1
                     /locus_tag="AO090020000227"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000178"
                     /protein_id="BAE63445.1"
                     /transl_table=1
                     /translation="MAEVQQDEQDPQYQFFLYLFLSEEALEVQVTNDSSITNVDEVVR
                     QDPMLKRFVGYKDDITKPRFIDMGRQGFVFRFKYREQDLCLKVFYPYKAPYNVHKEVE
                     AFISPFGCESRAFARLCDLRENGHWAVRCHGWMYLTDSQLQQLRRVCGRRVGNDPYWG
                     NARWAIVKDFIADKPPSRQDEQFQNILSNFCIPKRGGILPDDVKKENYRGDRIVDLGS
                     TITFPFYRRYAQAEDLDRFFKELDQYELPEWDNSNE"
     exon            571541..571801
                     /number=1
     exon            571855..572358
                     /number=2
     CDS             complement(join(572454..572747,573257..573328))
                     /codon_start=1
                     /locus_tag="AO090020000228"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000179"
                     /protein_id="BAE63446.1"
                     /transl_table=1
                     /translation="MKQHDEEAEYVLMLHAWKRADTFNRGFLHLSNGAVTQQVPGGAQ
                     LVEVPQNPAIANNHSLLVEHVCTAKRHPSGTGLVVTLKDATLPRYLVSDENRFWSRVK
                     QRWFRLVLGTNGDVIWEEL"
     exon            complement(572454..572747)
                     /number=1
     exon            complement(573257..573328)
                     /number=2
     CDS             join(574886..574928,574980..575716)
                     /codon_start=1
                     /locus_tag="AO090020000229"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000180"
                     /protein_id="BAE63447.1"
                     /transl_table=1
                     /translation="MRILCLGLTRTGTNSLVVALRKLGYTPYHGSECFKSPPRDFNLW
                     IEALKCNFFNPDPKKIPRYGREEFDRLIGSYDAVLDIPASMFWEDLIHAYPDAKIILT
                     TRDFDSWWVSMDKTLFRFIRMPFFRYWQYFDQKEVGPLYRMSELVWRVFCGNCYEKEV
                     CEKAFQEHYRKVREAVPEERRLELKVGRDGWDVLCPFLGVEVPAEEWPREYPARALNE
                     NIDMAFWGAVRTILFWVGFGVVVVLGVVWMGAYAGRYHDEI"
     exon            574886..574928
                     /number=1
     exon            574980..575716
                     /number=2
     CDS             complement(join(581109..582171,582227..582354,
                     582554..582715))
                     /codon_start=1
                     /locus_tag="AO090020000231"
                     /note="chitinase"
                     /old_locus_tag="AO070327000182"
                     /protein_id="BAE63448.1"
                     /transl_table=1
                     /translation="MSSSKTVALFTLALASFKGALAALRLNSPNNIAVYWGKYHAKRI
                     ICAITDMTSQVYQISFLTRINGAGGVPEVNFANAGDNCTAFPGTQLLDCPQIAEDIKE
                     CQSLGRTILLSIGGATYNEGGFTNEAAATAGAKMIWETFGPVSNPSVKRPFGDAVVDG
                     FDFDFEATVNNMPAFANQLRSYYASDTSKKYYTTAAPQCPYPDAADGPMLDGAVYFDA
                     IWIQFYNNYCGLQAFVPGSAAQNNFNFDVWDKWARETSLNKNAKVFLGVPGNQGAAGT
                     GYQPISTVSEIIKYVKQFSSFGGVMVWDASQVYANTGFLSGLRSALGGGGTTPAPTTS
                     PTTTPTTSLTTTSKTTSPTPTTKSTSTSTTLTTTTKSSTASPTSSKPTASPTSTVCPI
                     AGQTCPTSGAFSCNGSQFGICDNGRWVMQQCPAGLVCAQSGSGVYCDYPGSTGVAPCS
                     "
     exon            complement(581109..582171)
                     /number=1
     exon            complement(582227..582354)
                     /number=2
     exon            complement(582554..582715)
                     /number=3
     CDS             join(587107..587186,587244..588729)
                     /codon_start=1
                     /locus_tag="AO090020000232"
                     /note="sulfite oxidase, molybdopterin-binding component"
                     /old_locus_tag="AO070327000183"
                     /protein_id="BAE63449.1"
                     /transl_table=1
                     /translation="MTKDEAAIKAVGDPKKLFPREIEGWKGYVEWEEYPERKKAAHKI
                     LTSQAFPPNPEYQMGPIPDTNPVLPGTHWKQWHHAVGGELTDVPEDSWNTVLKEKHPE
                     MLHLLQFPYNGEPPKRLTTAQPVTPNSLHFVRNHGGIPLIDKDKFFLKLDGLVKNPKT
                     YTMDDLMDESKFPRMKKMITMQCSGTRRIEQISLYAGQGDEVPQAPWAEGAIGTAEYV
                     GISLKKVIKDCGGLLEGGKHLELYGAETYFKNNEAMNYVVSVPWSKVKANEVMLAWEM
                     NGEPLPKIHGYPLRVMVMGYIGARSVKWLYRIKAIETPSLAPVQSKEYLYFNQQVGKH
                     NQRPTDGIQIQEMPVSSAIMSPWKNQVVIHNGKIRCKGWAYSGGGRWPERVELSSDGG
                     FSWYPVPLENMSEKGQWTWRTWEIDLPCDVEGWIEIVCRCWDNSLNTQPLAVRAAWNW
                     GLHVTSSAHRISVYSINKSRPLTAERLEMLKAHGQPLAPITWPEELQTQSWDEYKDFF
                     KKYPRDPDNEAVC"
     exon            587107..587186
                     /number=1
     exon            587244..588729
                     /number=2
     CDS             complement(589296..590729)
                     /codon_start=1
                     /locus_tag="AO090020000233"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000184"
                     /protein_id="BAE63450.1"
                     /transl_table=1
                     /translation="MRTSSRDYLMLAMLAMPQAHLASAERVLGAYIFARHGDRTPKIL
                     GNTQLTDLGYSEVFMTGSYYHNRYIDSNSSLQIEGISTDVVNLKQLSAAAPSDAVLQN
                     SATGFLQGVYPPVGATASQKLANGTTVDAPLNGYQLVPLSLTTTGTNSEDNTWLQDTT
                     KCQKAKVSSNSYYSSSLYKDLLASTQDFYTSLTPVLKGEFSDSDISFKNAYAIFDYLN
                     VARIHNSSTENMQTDAQFEQLLALANIEQYNLAYNSTETVRAIAGAQLAGEMLDALSE
                     TISTQGKTKLNIQFGSYGTFLSYFGLAQLPKANSDFTGIPDYASSMAWELITDSPSGF
                     PDPADISVRFVFHNGTITGADEPTEFPLYGQSSTTISWTEFEKQTKNIAVMSTAEWCS
                     ACGNTDGKCANPSSDSAGAESTEKKSNEVSRPVAGVIGAMVTLAVILGLEAAFFLFGG
                     FTIAKRRKAAAGSIASDATETKFVEHS"
     exon            complement(589296..590729)
                     /number=1
     CDS             join(593097..593366,593425..593465,593518..593555,
                     593612..595374)
                     /codon_start=1
                     /locus_tag="AO090020000234"
                     /note="molybdopterin biosynthesis protein"
                     /old_locus_tag="AO070327000185"
                     /protein_id="BAE63451.1"
                     /transl_table=1
                     /translation="MADPTLQPAILIVSDTASEDPSTDKVVDALTPLLLTTDQSPWKT
                     PFSNIVPDNVLDIQRSICDWTDGQDAVNLVLLSGGTGFTSRDNTPEAVTPLLHRHAPG
                     LVHGMLAASLKATPFAMMSRPVAGVRNGTVIVTLPGSPKGAKENLDAIVKLLPHACIQ
                     AAGANSRLLHAGGMQTLEAEAGVSSGNNLESRAENSHAHQPQLGHSDCGHSHHRGNNT
                     TKSNDTSEGPSRRNRLSPYPMLSVDEALWRISHHTPDPVVVEAPVTPALVGSVIAEDV
                     YAAEAVPAYRASTVDGYAVIAPDSTSENMTSTTGTKGIFPVASVAHANSSDFAPPLER
                     GTISRITTGAPLPPNANAVVMVEDTLLHSSTPDGTEEATVEILADDIKPNENVRQPGS
                     DIELGSMILRKGDIVTPVGGEIGLLAATGTHTVKIYRKPCIGVMSTGDELVPYDDPQR
                     LHGGQIRDSNRISLLSCLSSWGFPIVDLGIAPDTPAGELEERLRDAVHREENSVDVII
                     TTGGVSMGELDLLKPTIERSLGGTVHFGRVSMKPGKPTTFASIPVKRSPVQTDDAPRT
                     WGKKLIFSLPGNPASALVSLHLFVLPCLHKLMGMGQGRLSPGSGPVPGLPVVTVTLMH
                     QLPLNRERTEYHCAIVRASQADGLLYACSTGVSVTGQRSSRVGNLAYANALLVLKPGH
                     GYIEKGTLVEALIMGPIRSGV"
     exon            593097..593366
                     /number=1
     exon            593425..593465
                     /number=2
     exon            593518..593555
                     /number=3
     exon            593612..595374
                     /number=4
     CDS             join(596103..596405,596475..596498,596552..596554)
                     /codon_start=1
                     /locus_tag="AO090020000235"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000186"
                     /protein_id="BAE63452.1"
                     /transl_table=1
                     /translation="MAQAPTGTFQVHYFASASSYTNRQSESLPAPLPLAKLFDVLESK
                     YPGIEAKVLTSCGVSVNVEYVDVEEEKLKLRDMEAQDGQRSDLVIIKEGDEVAIIPPD
                     YILGSYC"
     exon            596103..596405
                     /number=1
     exon            596475..596498
                     /number=2
     exon            596552..596554
                     /number=3
     CDS             join(597200..597391,597447..597818,597875..598795)
                     /codon_start=1
                     /locus_tag="AO090020000236"
                     /note="inorganic phosphate transporter"
                     /old_locus_tag="AO070327000187"
                     /protein_id="BAE63453.1"
                     /transl_table=1
                     /translation="MTYDPENAMGEARADAPVEAEKEHEATQTTVKESTLGYDNSSDP
                     SRRDSYRPTKLQSNLTIVSCYIANFSDGFQNSLANPTNVIFKKLLGTDGYPSEMQTRI
                     SNSLLIGAILGVLALGYTSDMFSRRAGLLFTSGLVAIGTLMSTLALQVHPTYNMLWYF
                     VIVRGIAGFGVGGEYPPSAAAGIEESDDFKRKYRGPLFVSFTTLMATSAAPIQMIVYL
                     ICLIASNDNLPVTFHAIYSIATILPVIIMVLRFFMTDSTLFHYSNFKRQKRPLKFYLL
                     LLKRYRWRLFTTSLAFFLYDFINFPNSIMSSTIINSLVKDHNIRTTAIWQVILGALPV
                     PGVIVGAWLTNAIGRRYTGILGFAGYMVLGFVIGGTFPHLSKNMPAFVVLYGLLQALG
                     HMGPGATIGLISTESFPTAMRGMGYSIATAFGRTGAAVGTQCFTPLQERAGKQSTFYL
                     AGGIAILGMIVYWFLPESSELNLEEEDRDLSVFLAENGFPMEKA"
     exon            597200..597391
                     /number=1
     exon            597447..597818
                     /number=2
     exon            597875..598795
                     /number=3
     CDS             complement(join(599152..599280,599333..599339,
                     599385..599881,599920..600624,600692..600910))
                     /codon_start=1
                     /locus_tag="AO090020000237"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000188"
                     /protein_id="BAE63454.1"
                     /transl_table=1
                     /translation="MQIADMAASTTAQILVVSLGLLIFVLLCPWFGYLRLPSSMRWWP
                     SIPSGPLSALRLSLKEYSGSRSSENGYKAFSKKAEPFAICNPSFYPQVLLPPEQIPWL
                     LSQPENVLSHEKANEDVHALPFLAPAFDNYDHLELIRAIRTDLTRNIPNTEDAFLDEL
                     RHTTNEVLGAPGDNAWKEVNLTVALDSIIFGICLRLFFGVSLSRNRTFVYYVKIFTRV
                     TGAMMLFVSQLVPWPLKPVVGIVAGFPIYYYWVRLIIYLYPTFKERIQCLRTKKETPP
                     ADMVTWMVDLAISQNPTRKVHISSLIVRLTLININVRLTRSSKVFLPVDVLIAMTDNF
                     FLDLLSSDPDRKYYNALRQEAEAAFTNRDKTQPISQSMPYMESTIRESLRLSPLSDRM
                     LSRRVVHKGGITLPDGQFLPRGTWLAVAAVGVHRDERTYEDPDEYRPFRFLSEDTETK
                     EAKAMLVPVTSEKFLAFGHGRHSWTMLIIGYILVNYDIEPLEKRPVNSVVGQTIIPQL
                     DVKIRVRRRE"
     exon            complement(599152..599280)
                     /number=1
     exon            complement(599333..599339)
                     /number=2
     exon            complement(599385..599881)
                     /number=3
     exon            complement(599920..600624)
                     /number=4
     exon            complement(600692..600910)
                     /number=5
     CDS             join(601589..601813,601874..602593,602662..603128,
                     603180..603342)
                     /codon_start=1
                     /locus_tag="AO090020000238"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000189"
                     /protein_id="BAE63455.1"
                     /transl_table=1
                     /translation="MIGEQYTSIITGFKSALAVSCIAVSLFLLSPWIAYARLPSSIKS
                     PIKAKGPLSALRACLNEISAGAKTSTRGYELYSKKGQSFAMLNINFRPQVILPPEHVR
                     WLVTQPEDILSHAKASDDADALGYIWPLFDASALHSFSKVLQIDLTRNVTQTEKDVLE
                     EVQHIMDELVGQTESWKEVNMVQAFERIMYQATQRVYVGLPLCRDSTYMGYVKGYARS
                     LGTAMVFAAQLTPWPLRQVTALLAGLPVYYYVLRVRSYLSPLFKERMERLKEKGGTQD
                     DNLEGEPRNLITWMSNGVLSGVGPKSISPSEMVTWLGILALLPTDNLWTTCTNVLLDL
                     LSSESEHAYLHTIREEARTVFASSKESGKPVSHGLHHIDSAIRESLRMNSLSPRSLHR
                     QVVRRGGVVLPDGQKVPTGTWLCVLSGNIQRDEDYYEDAQTYKPFRFVPKLTEAGGDK
                     APLLPLTNEKYLTFGYGRHACPGRWFSFQVMKIVIAYILANYDIQPLEKRPDNIVFAD
                     LNIPHLSHIIRIKRMT"
     exon            601589..601813
                     /number=1
     exon            601874..602593
                     /number=2
     exon            602662..603128
                     /number=3
     exon            603180..603342
                     /number=4
     CDS             complement(join(604871..605466,605525..605861))
                     /codon_start=1
                     /locus_tag="AO090020000239"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000190"
                     /protein_id="BAE63456.1"
                     /transl_table=1
                     /translation="MPAESLLLSVPILLREMGLVATRCCQHLVALGEHLSTSTLMTRC
                     VWLMLPRQNQAINGRIKIFTTEGGPTEFDMGKIIVDSAVQAGVKHLVFSSGPPCTEMT
                     NGRVRMKAMDMKNKIEQYARSLGSFETFTPIGAGWFLENFLGKEVAPVFGGFPYFPDD
                     QGYLTFRVPYWGGDEHVPWLSISDDFGDIVQGIFLDPGRWNGHFVHGVSDIRSFEQVV
                     ADFAAVTGNKARFQPILPTWEAFDTHGIQELEDVKLMFGFTQLTGGRYFGPEDTEVDT
                     ARQLKQITGLKLGRPEGQHKLTSARDWFAARFAN"
     exon            complement(604871..605466)
                     /number=1
     exon            complement(605525..605861)
                     /number=2
     CDS             606673..609801
                     /codon_start=1
                     /locus_tag="AO090020000240"
                     /note="non-ribosomal peptide synthetase modules and
                     related proteins"
                     /old_locus_tag="AO070327000191"
                     /protein_id="BAE63457.1"
                     /transl_table=1
                     /translation="MPSQVLTHEEEYDLAVRQGKGLAQQFFDHAFLNPSAMAVIDGDT
                     NLTYQDLHERAAMLARELQRGNLHTEEPVGVVVQHGISDVVAQMAILYAAGTCVPMDP
                     TLPDLQIKGRLDRLKARYILVDRANQHRDLPFHPLIVDDSSASFSKSSHVRDNEEPMQ
                     ITLEHRTHIIHTSGTTSEPKAVQIAARSILQVVFHAPFEPLYPTDRVAHVNNSSFDVS
                     LFDIWAPLLRGACIVVVSKVTLLDLETLAAYIDRQGITVMATTTAILNLAASVYPRAF
                     EKLRLCFIGGEAANISAIETIFQAGPPTQLINAYGPTECCIFCLAHRVTIADVQAGVV
                     SIGKPIGRTVAYICDEAGRPVPDGHEGELLIGGAGVSPGYINQPDKNRASFVAIEGSD
                     CQRFYRTGDIVRRRVSDGQIDYVGRRDHQVKVRGFRIELKAVESAIMKTGQFSEAVAL
                     KVEAGSEGAGSILVAFAVALSGTKPHAVLSAVDMLKAVLPDYMVPKIELISKMPVNSH
                     AKVDRKYLQQLFRNRWAEQHIDMDNEDSTRGKLANLWASILGVPVPASNDNADIFLLG
                     ATSMQASLLISRIQKTFNVQVSLLTLYDNSSLIRLAGILEERILGTQESFCKESERHM
                     WLEDSKLADSLVPPSDPPVDWCRDTEGRVFLTGATGFVGSFLLADLLRQPNVHQVGCL
                     VRAVDPATGLRRLQNGLAKYDLWEDQFRYKLLPLCGTLEDRYLGLGPDRFEEIAHWAS
                     VIFHLGARVNYTQPYSLHRPANVQGTVNVLRLACAGRSKVLHYVSSISCFGPTGFITG
                     TRTVMENEPLPRHLEALPYDHGYAQSQWVVENMLQRLMDNGFPIVVYRPGFITGHSQT
                     GACNPDDFLSRLIIACGEMGSYPLLPNQRKEFVPVDYVNAVILHIASSTATAVGRVYH
                     IVPPNRDLSLDMNDSMELVGSLAEGNESSVRGVSYQQWVQELDRQSPERLRPLQPMLT
                     EKLYQGLTRWELYENMPVYDTTNTRQALESYPGGLKFPVLDSELMQKYIRYLQIRSAS
                     PKEENPSNGTDS"
     exon            606673..609801
                     /number=1
     CDS             611198..612298
                     /codon_start=1
                     /locus_tag="AO090020000241"
                     /note="predicted NAD-dependent oxidoreductase"
                     /old_locus_tag="AO070327000192"
                     /protein_id="BAE63458.1"
                     /transl_table=1
                     /translation="MDQDTENKVLVIKNMDSGYLVAGEQVTLEDVSYDATEPLAEDEL
                     MVQLLYATYDLFKRDLASSSADATELRGRKPVETMSIAQVIKSNNKQFQEGDMVIGRL
                     PVQQYVLIKADDATELKLLENPCEFDDIRLFLSVLGVPGLLAFSSLYEIGRPKKGETI
                     LIAGASDEIGQLVGQMARLEGLKVFGSVESDEKLDFLITELGFDGGFNYAKESPYEAL
                     PRLVPNGIDIYYDNLSWMSRLNIGGLDTHFDLLGSRHLNAAFSSMRRYGRIMFYGTIA
                     EQTVLDPIIGMFLHNTVLKRLTIRGFGLSDPSFGKKWGKLHMERMQQWVKEEKLKIPT
                     FEITGMDNAAKAFVEAFYSSENTHTHTILAVT"
     exon            611198..612298
                     /number=1
     CDS             complement(join(616890..617055,617188..617719,
                     617789..618130,618185..618299))
                     /codon_start=1
                     /locus_tag="AO090020000242"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000193"
                     /protein_id="BAE63459.1"
                     /transl_table=1
                     /translation="MHLVYTATRTPEYFHQVRAFPSSFAIFSRSWDMIPESPEYGYEW
                     LWTESSCVTNTRKHNLWKSIFELYRMASLCFVYLSDIEKVADWDQSKWFQHAYTLPEL
                     MASNEILFFTKTGKVVGRKSDLCKELSSTTGIEEAVLRNPEKVQSCSVAKRIFLVPDL
                     SVRFNGLTNAMLSLQLEIMKEYQDDLSIFEWQHTDINDPCTNGLLAGSPFQFHLCGDV
                     KTCKNGSKINLASDSNGMFSIHGLIISQPLGRIGLVLNSYHSDIHPRMYPCIHLSTVP
                     PESPESPESPESPEVECRRMDISKVYCISAADAMKTPMAQGTIYIREDGTAFIHLYLA
                     ITHPLLHSMKMSHRPILSYISSLPKPDTLSQSLRELRQGLPDGLMAMPFV"
     exon            complement(616890..617055)
                     /number=1
     exon            complement(617188..617719)
                     /number=2
     exon            complement(617789..618130)
                     /number=3
     exon            complement(618185..618299)
                     /number=4
     CDS             complement(620252..620794)
                     /codon_start=1
                     /locus_tag="AO090020000244"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000195"
                     /protein_id="BAE63460.1"
                     /transl_table=1
                     /translation="MEQMQGFPESQPSSSIMDSLRAARDARMFASTSNTENIEILMEQ
                     PLETPWAILSYTWRNVFRMSQTPTSKTSLCTACKAAAYIDIPFLQIDTCFISGPGVSL
                     RAKSAMNGLEYADYRRAPMCLVYLQDVVYTDGDSNFMEKIQNSSWLNEAWALQELLAS
                     NEITFYSSEAKRLCKKSDIL"
     exon            complement(620252..620794)
                     /number=1
     CDS             complement(join(622066..622279,622415..622617))
                     /codon_start=1
                     /locus_tag="AO090020000245"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000196"
                     /protein_id="BAE63461.1"
                     /transl_table=1
                     /translation="MPNILQNGQWLRPGQNIKSEDDRSGLTMQEDGKIDVYHDGRCVW
                     QNTREQRYDIQGIHMQEDGDLVMYTSTRGEGSDVYCIIQDGGNLVLYNDGDRPIWASH
                     TQRVLSISQMMMTNIETRHCYVGHGHKRSGLVFGRS"
     exon            complement(622066..622279)
                     /number=1
     exon            complement(622415..622617)
                     /number=2
     CDS             complement(join(623546..623726,623812..624020))
                     /codon_start=1
                     /locus_tag="AO090020000246"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000197"
                     /protein_id="BAE63462.1"
                     /transl_table=1
                     /translation="MSLYSSYILYPGDWVEVGHNLKSKDGTVEFGVQTDGRLILSHSG
                     QCVFQTEQRNDIKGLKMKRDGNLCLYTKRGKPIWQTDTAYPIGDHSVCCFVQDDGNVV
                     LYRGENAIWSSRTPRDPGHVCSGSCRP"
     exon            complement(623546..623726)
                     /number=1
     exon            complement(623812..624020)
                     /number=2
     CDS             complement(join(626843..627405,627613..628066,
                     628125..628172))
                     /codon_start=1
                     /locus_tag="AO090020000247"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000198"
                     /protein_id="BAE63463.1"
                     /transl_table=1
                     /translation="MAIDDKSSRINKQPLLISTGVFFALAIVGVIVRFVLRFGVQKHK
                     FQADDGVLIVATVFLVASTVVMYHKTVYIMYLVDAIALGRLEVPANMVELSNEDHTWT
                     LATLMLTWCAICAVKFFFLVFFRKLIDRLRLWQIYWWFACLFNFGLLVFGLVAFWVTC
                     PHRGAAAILAIPVGVIWKVRADWTQKLAIAGSLCIDVVQVGLSIARAAGLEHDGHADG
                     IFEMYTLYISAALGVFLAAATAFRPFIMAKKHSKAYTPPYSPWANSFSNQRKRGSDRS
                     ETSGWSGQTPTPTTGDFERLTPDSKDSDSRRDDPEWHAMSSTNSSATDCASVVRDHSM
                     ADDPVEVTEVQPVIVLKHTR"
     exon            complement(626843..627405)
                     /number=1
     exon            complement(627613..628066)
                     /number=2
     exon            complement(628125..628172)
                     /number=3
     CDS             join(631677..632125,632291..632300)
                     /codon_start=1
                     /locus_tag="AO090020000248"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000199"
                     /protein_id="BAE63464.1"
                     /transl_table=1
                     /translation="MADPLSITASAAGIVSLGLSVCKGLLAYYRPYKSCYEDIENTVE
                     VVESLNGTLEGLDSLLAEASVFQSSSVAQQAVCAAGLIKRCQVRMHKLDTMLAKFRKT
                     SSNGKMAGLRGQVNRMLYPFRKETVLSIKESLTSLQGSLVIALHILQLLE"
     exon            631677..632125
                     /number=1
     exon            632291..632300
                     /number=2
     CDS             join(633599..634240,634351..634353)
                     /codon_start=1
                     /locus_tag="AO090020000249"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000200"
                     /protein_id="BAE63465.1"
                     /transl_table=1
                     /translation="MKDWILLYANWPEGVLLLLQAGYKAHEYELYAALDFDCESSVCI
                     LIETGNVIVGYGELWAATRHPNSKIADLIIQALVDRRKRLQLLAEAHLSVDELSELKI
                     RPDVLIDLQTQQVIQILRAKNIDLSGAIEPYPWSVYEALGHNYTIADRVWEAGFRDVD
                     VPCVRGRTLLMTKRCETGLYFKYILEEAAWLLGKGAQPYRLCENTPALHFVGFA"
     exon            633599..634240
                     /number=1
     exon            634351..634353
                     /number=2
     CDS             complement(join(634417..634425,634460..634774))
                     /codon_start=1
                     /locus_tag="AO090020000250"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000201"
                     /protein_id="BAE63466.1"
                     /transl_table=1
                     /translation="MILLHAPHPVVREEAWELSEKLSVGGKDVDHKAFEILQQVPLLV
                     TNFSYVVWCHLTPRVVTGVGDAYTVESQEAKDIHGKLVEVLGVPVECDDEPGYDLGCL
                     VGIAR"
     exon            complement(634417..634425)
                     /number=1
     exon            complement(634460..634774)
                     /number=2
     CDS             complement(join(635443..635656,635719..635866,
                     636049..636810,636867..636963))
                     /codon_start=1
                     /locus_tag="AO090020000251"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000202"
                     /protein_id="BAE63467.1"
                     /transl_table=1
                     /translation="MKADELQNCFPQQDGRWDASNAQAWATFGEENISIQNITLGQVI
                     NGRTWRYAWSKTGTLGKQTILQYLANVVNGKDHVSPASPSFSPEQNRAALEALETLLE
                     ETGDQGYGHSWSDLKASAIHRVMILSALTLYHTPTSHIVPLAIKVIYGKMNDDSWTLT
                     IDRWRSSSCQGRTGVLYASNLFETVRSARCIHFMTPVLLLKAVLVMWLYSIIHDRLRH
                     GRGYQLEIPSVVLDLKSLDTPATKQWIANGSSCIKLPGISNLLSRQGRCKMLEESVVV
                     MRSLRAWGISTIASSNATSVIISLCFHSDIFPREQGLGRILLRQMSRSDHHKFKIKVS
                     MIRIALWTQSLERYLKDSQPKTSTPGAPRDPFMPICFISAEEPYYHLLVSATSNGIAK
                     EGTERCYCRDIYQT"
     exon            complement(635443..635656)
                     /number=1
     exon            complement(635719..635866)
                     /number=2
     exon            complement(636049..636810)
                     /number=3
     exon            complement(636867..636963)
                     /number=4
     CDS             complement(637333..638097)
                     /codon_start=1
                     /locus_tag="AO090020000252"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000203"
                     /protein_id="BAE63468.1"
                     /transl_table=1
                     /translation="MVTMNVTLAPDLSADHLIDFESWFSVPADNDCWPDLTCYDQDFS
                     VLDIVGPSVTEGSMQKSWDTQKRNASLPQPNITEVYRRNQVPEIDKDAVEPRHYDPAR
                     AEDDAQLIFPDMTVIPREDIEAENLAHVEEVSAEVTSIVFELANDMQLKSNYPQFIEL
                     RIPPAPVLNAWVQLYFEHFHPMFPVLHKPTFSTSGSNPFLVLAVAAIGAHFSDIQGAQ
                     PCLRAMHELIRRYTSYTVRVTVPSRSSDDTDRRWKV"
     exon            complement(637333..638097)
                     /number=1
     CDS             complement(join(639196..639747,639813..640099,
                     640153..640255))
                     /codon_start=1
                     /locus_tag="AO090020000254"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000205"
                     /protein_id="BAE63469.1"
                     /transl_table=1
                     /translation="MPSKDYVYKTSGSLEIAATVYYRQDEPRSSKKPIAIGFHAGGFT
                     IGSRFLFNSNEIDALLDFGFVVISADHRLCPHVSLYDGPIEDAKDAFNWARTTLPDLI
                     KKDVNIDIDGDRIVAFGQSSGGTLALHLGSLPNPPRAIAAFYAAAYFSDEIWTQPTPG
                     ADMMPPIDKAFAESVYDEAPASMTIVAPQQFIAPGTMPMPNLSVPRDAWMALAFKEGQ
                     HLSRCVKDGDFGRVDPATYFSPKFPPTVFLTGTDDTFINPKFSKQAHAQLSGLKVETK
                     LVLAEAGQHGYNFGMEKDDVRFQETVLPGYEFLADHV"
     exon            complement(639196..639747)
                     /number=1
     exon            complement(639813..640099)
                     /number=2
     exon            complement(640153..640255)
                     /number=3
     CDS             join(640968..641939,641997..642068)
                     /codon_start=1
                     /locus_tag="AO090020000255"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000206"
                     /protein_id="BAE63470.1"
                     /transl_table=1
                     /translation="MTPNPSSTNKAEASPTNVIVVGAGPVGLLTALRLAQSGIHVDVL
                     EKEEKLNVTPRACSYYAAALHALQRAKVLDDVKKAGFTTHGLCWRSPLEDDGKGGKKF
                     GDILASLPIVGNEDWDSGVVNLQQAKLTNLLYQKVLETGLVTVHLGAELVAIEQDSNS
                     VTAIAIRGGGNQEHFQGSFLVGADGGRSTTRRLLGIRFKGHSWPERLVAMDVLLDDVE
                     FDEKFPSSLFVDPIYYGLMSPLEEPRAGTESLWRCTVAVDPTDARTDDELVSENSIEE
                     LLLKAVPGPRPLPFKVLRASPYRVHQLCASTFNRGRCALAGDAAHLNNKSSPWEPWVS
                     QLVLLTPKLLQMR"
     exon            640968..641939
                     /number=1
     exon            641997..642068
                     /number=2
     CDS             join(642120..642182,642851..643379,643460..643983)
                     /codon_start=1
                     /locus_tag="AO090020000256"
                     /note="dimeric dihydrodiol dehydrogenase"
                     /old_locus_tag="AO070327000207"
                     /protein_id="BAE63471.1"
                     /transl_table=1
                     /translation="MSAEEFSRHSWTRLPRRTSCDFAKDLLIDPSTKGAHDVTHNLVA
                     VASSTSLQKAQDFLSAVNAPPSTAAYGSYESLLADPTVEIVYISTPHSHHYQNARAAL
                     LAGKHVLLEKAFTVNAAQARILVQLAREKKLFLMEAMWTRFFPLTLYVRQLIKDGAIG
                     TVQRVVSDRNLGRDIETLYGTEHRLVNPALAGGALLDLAIYPLTWIFQILHHDSPPAS
                     GTSKPAPHVSGSLVKYAPTGVDETATVIVTFPESKTQGVATASLRVASDPTDPGVRIF
                     GDKGQIQIFGPAARPLSIAVVTYGEGGPEVVERKDFEIPVGHGLFWEADACARYLAKG
                     ETESDVMPLDETLLIMDVMDRVREENSLRYPAEVEGH"
     exon            642120..642182
                     /number=1
     exon            642851..643379
                     /number=2
     exon            643460..643983
                     /number=3
     CDS             complement(join(644264..644409,644464..645252,
                     645304..645538))
                     /codon_start=1
                     /locus_tag="AO090020000257"
                     /note="thioredoxin reductase"
                     /old_locus_tag="AO070327000208"
                     /protein_id="BAE63472.1"
                     /transl_table=1
                     /translation="MMFTCNWTALLCALLSILSVCVADIPQTNYDVIIIGGGPSGLSA
                     ASALSRVLRKSVLFDSGEYRNNPTRHMHDVIGNDHVVPAEFRKTAREQISFYNMTTFI
                     DQKVTKLEKTGDNAFQATVGDQQYTARKVILGSGVKDDLPDVPGLQEGFGKGIFWCPW
                     CDGFEHRNQSMGVLGDISEAYGAVRELHPTLNKDIRIYANGTNTTEQIAILDKNHPNW
                     RKVFQAYNVTVNNKPILNITRIQDGAVVNDPAIRLEFDKFQIYFADNSSEVRGAFITN
                     YGTSQRSDLPAQLGVEMLGSKINTLRKGLQTSVPGVWGVGDANSDNSTNVPHGMSSGK
                     SAAVYCHVELAQEELDRDAGLEKRETEFDAESFHETTERQMGSEIQDLYKRLSRR"
     exon            complement(644264..644409)
                     /number=1
     exon            complement(644464..645252)
                     /number=2
     exon            complement(645304..645538)
                     /number=3
     CDS             join(648902..649064,649121..649399,649453..649562,
                     649637..649669)
                     /codon_start=1
                     /locus_tag="AO090020000258"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000209"
                     /protein_id="BAE63473.1"
                     /transl_table=1
                     /translation="MKFSSTSALVAALVAGVNGASIPRTQGSVPITFIGAADAQFTQD
                     FPTDGSSVAITNPLSISHIASSTNGVSCVFDGIDKSVTVVSNAETVDVGPPQTQISGS
                     CAVGAVPLTQHERRENDEDVVITFVGAADGQFTQVFPVNGVATQISNPLSISHIESHR
                     PGVSCTFNGIDSSVTTVTGVQTVDLSDCPRPHTS"
     exon            648902..649064
                     /number=1
     exon            649121..649399
                     /number=2
     exon            649453..649562
                     /number=3
     exon            649637..649669
                     /number=4
     CDS             join(650864..651187,651243..651499,651553..652653,
                     653649..653754)
                     /codon_start=1
                     /locus_tag="AO090020000259"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070327000210"
                     /protein_id="BAE63474.1"
                     /transl_table=1
                     /translation="MGLPKLKLPRANADRAYKDEPDPRPSDAVLRQSANGDDGLVDTK
                     IPFLTFRSFSMCVVISMGGFLFGYDTGQISGFLEMEDFLQRYGEQRADGTYYFSNVRS
                     GLIVALLSIGTLMGALVAAPIADRVGRKWCVSGWCVILCAGITVQISSPTGKWYQVAL
                     GRWVAGLGVGALSLLVPMYQAETGPRHIRGSLVSTYQLFITLGIFVANCINFGTEKKT
                     STASWRIPMGVTYIWAIILGFGISMFPESPRHDYRKGKVDKAISTLAKMYGVPKNHRA
                     LAIEFDEIKQKYEEEVARGQVSWIQLFKAPRMAYRVAVGVALQALQQLTGANYFFYYG
                     TTIFQGAGIENSYVTQMILGAVNFGSTFLGLYLIENYGRRRSLIAGALWMFCCFIVFA
                     SVGHFSLNRDDPPSTKTAGVVMVVFACLFILAFASTWGPMVWTIIAELYPSEYRARAM
                     SLATASNWLWNFLLAFFTPFITSAIDFRYGYVFAGCLFLAAGLVYFAVMEGKGRTLEE
                     IDTMYVWKVKPWHSSKYVFPETEPSIMEKRRASHASNPSTNPTTIDDNHETTVLSGKN
                     INCRSSLNLRPKSRGLIRREEKTWSKLLA"
     exon            650864..651187
                     /number=1
     exon            651243..651499
                     /number=2
     exon            651553..652653
                     /number=3
     exon            653649..653754
                     /number=4
     CDS             complement(join(656189..656850,656918..657541,
                     657616..657675,657749..657899,657952..657999))
                     /codon_start=1
                     /locus_tag="AO090020000261"
                     /note="predicted protein"
                     /old_locus_tag="AO070327000212"
                     /protein_id="BAE63475.1"
                     /transl_table=1
                     /translation="MELPIRYCLGISLAVAGVAFCLYQMFFHPLAKYPGPTLAKFTAA
                     RAAYCAWKDDVHLDIWLCRKKYGPIIRYVPNHLCFDTVTGLKDIYLSGKDLRKDKIMG
                     KASFVPNLLTIMDRKEHARHRRLIGIGFSQSAMKSVNERLLHHVKSFYHVAYNAGLPD
                     EANGWSHPLTMSDLCSYLTFNVMADFIYGKSYDLIHCPDYRHLLEHIEESNLRTGVLL
                     YCPQLYIGRLDRKLFPRASTGNKTIHSFINQIIQERKSENGVGQSIYEQLGTQRKSTD
                     HPLTPEEIRSEAMLLTIAGNDTTSTALCAALFYLGKNLHAYEKLAAEIRTKFSVVDGI
                     GQDETLRNCHYLHACTYESLRMSPPVGSSMWREVGPGGTSIDGEFIPCGYGVGTGIYS
                     IHHNPKYFPRPHDFIPERWLSEKDGFICKEQADIPFAAYILFSAGTRACLGRHLAITE
                     LLTTIAALVLLYDFRISHTENGELGCGHALGRHGRTNPGEFQLYHRVTSGKEGPILQL
                     RPRKGN"
     exon            complement(656189..656850)
                     /number=1
     exon            complement(656918..657541)
                     /number=2
     exon            complement(657616..657675)
                     /number=3
     exon            complement(657749..657899)
                     /number=4
     exon            complement(657952..657999)
                     /number=5
     CDS             660833..661282
                     /codon_start=1
                     /locus_tag="AO090020000262"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000001"
                     /protein_id="BAE63476.1"
                     /transl_table=1
                     /translation="MSMDSHTLPLFPWDLRLSKIKSEAYEALYSAGAQRKSDSEILSS
                     IRTLDEALEQWRVSLHPDFRPTLSFSQEMPVCANLNTQAVMLRLAYYHCVTMIHQASE
                     RGRLSDDCNEGRLSGINTSTSLAINAGTSTLSYLQTVLPVVEGECFW"
     exon            660833..661282
                     /number=1
     CDS             complement(663348..664706)
                     /codon_start=1
                     /locus_tag="AO090020000264"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000003"
                     /protein_id="BAE63477.1"
                     /transl_table=1
                     /translation="MDILPNELILLVGEYINDDVFSKLALSKCSRRLQWLFDPTTVYS
                     SIHISSIGTREVELIQYLWHRPDLAQLVHDANFGFARGFHPDYPSLTKACSPRWNSTI
                     EHIVDDICESEREKASWNMRLRQLCEDAWLGVLLSRLNNLKSITLGYGDNQWLLTSIL
                     DKALLGRRPFSTATPFPLLQKVTLINYQGQFKYNPHFALGWFHLPAVRTIEGVNMWDS
                     SGGMDVGTSNISRLIDRVSSVTEVVLSPAFFCRGMGDWIAACPKLEHFKVDIGVISDA
                     PSSYIFDPREFRQGLAPRKKTLKALSIEFHNSYRRFRAKHRTMEVQHYLGRDDLPFGS
                     FREFIVLEHLSMRHANLMRLPGVNIRDSHDAAPQCLVDLLPTSLKSLEITDVVQAFIL
                     GLISELRLLVRQHTTIIPQFKRIVLHLQEGELELAMLLIDDLKSECERMGIRLMVIGR
                     SI"
     exon            complement(663348..664706)
                     /number=1
     CDS             complement(join(665059..665151,665209..665416,
                     665476..665590,665661..666230,666302..666392))
                     /codon_start=1
                     /locus_tag="AO090020000265"
                     /note="glyceraldehyde 3-phosphate dehydrogenase"
                     /old_locus_tag="AO070329000004"
                     /protein_id="BAE63478.1"
                     /transl_table=1
                     /translation="MAPSISDFPHSVASTQPSVCKVGINGFGRIGRNVLRASLNRTDL
                     QIVAINHTCNTVQDLIYLIRYDSCMGKLSDDISIHALSDTLITINGRQIVLTSERDLQ
                     KLNWSAVGVDYVVECTGKFTKRDLALQHVTYGHAKRVVISAPSSDSPTYVYGVNSDNY
                     RADEDRRVVSCASCTTNCVTPVLKVLHQQFGIVQGLLTTVHAATQSQQVLDGYSKKNR
                     RLGRSVFDNIIPTTTGAAKAIATVLPELTGKVTGVSIRVPAPNVSMIDLTVTTEQPTS
                     LAEIMAAFRRAAKTSLAGVLYVSDEELVSSDYKGNPNSAVVDAPACTELNPQFFKIMA
                     WYDNEWGYSNRLLDLTAHVALQEQ"
     exon            complement(665059..665151)
                     /number=1
     exon            complement(665209..665416)
                     /number=2
     exon            complement(665476..665590)
                     /number=3
     exon            complement(665661..666230)
                     /number=4
     exon            complement(666302..666392)
                     /number=5
     CDS             join(668341..668544,668605..668708,668767..669912,
                     670240..670279)
                     /codon_start=1
                     /locus_tag="AO090020000267"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070329000006"
                     /protein_id="BAE63479.1"
                     /transl_table=1
                     /translation="MKSHSPPEGGKAQSTYIEDVHSLKHADEKAQGDYAGATAKTDPR
                     EIRLVRKLDMRIMPILWAMYFMNFIDRNAVPNARLNNLEKDLGLVGTQYNTCISILFV
                     GYLLMQIPSNMLMSSKKVRPSLYMSVCMGSWAVVSACTALTKNYVGLVMVRFFLGITE
                     APFYPGALFLLSVFYTRKEIALRISILYSGNIIATGVAGLVAAATFSTLDKTHGLAGW
                     QWLFIIEGAVTFGIAILGLFMLPDHPLTTRWLTPEERQLAHDRILKDTVNSEESKGPI
                     AGLKQAFRDPRLFLLAFMQNMHLSSCSFNNFFPTVVGSLGYNSTITLVLTCPPYIATC
                     LASIVIGITSGRYNERTWHITGCIGAAAIGFIISCATLNTAARYISCFLFASGAYAAN
                     SVILGWVSATLGQTPEKKAASLSFVNVVANASYIYTAYLYPKSDGPRYLTAMASNAAF
                     SVAVIVSAWVLRFWLQNTNRKIRQGILPGADEGLLSRSCFDHHNYKL"
     exon            668341..668544
                     /number=1
     exon            668605..668708
                     /number=2
     exon            668767..669912
                     /number=3
     exon            670240..670279
                     /number=4
     CDS             join(672320..672466,672490..672523,672612..672808)
                     /codon_start=1
                     /locus_tag="AO090020000268"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000007"
                     /protein_id="BAE63480.1"
                     /transl_table=1
                     /translation="MDRLSERSIFNVTIDDMQDHSPKKEEVWEEVTHYAVFGEISEEG
                     PNYRNVYTLVETDQWLGMVPGVIVLCAVAAITTWSAYVVGTFKLRHREIYGIDDAGAL
                     ILGPIGRVILATAFCLCRCLNHG"
     exon            672320..672466
                     /number=1
     exon            672490..672523
                     /number=2
     exon            672612..672808
                     /number=3
     CDS             join(674666..674714,674765..674896,675040..675584,
                     675638..675908,675967..676142,676205..676385,
                     676438..676937)
                     /codon_start=1
                     /locus_tag="AO090020000269"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000008"
                     /protein_id="BAE63481.1"
                     /transl_table=1
                     /translation="MKRSSETAFTPDVEPEDAVGSEEPAIHAPLRVDHARSIWTSPFT
                     LPSKTIKNTHRNKRSWIWLAPSSMWSFTARLTLMMTERLNLESHSAPNLIDRDIYLLH
                     WRPAPPDDQPDIHGLPSLDHALYLLNTVMFYMGQNYFLFEKKTFLAHLHEFYYGDALS
                     KAMEYKLWFVQYLLVLAFGSAFVIQPTKNTREPPGAKYFIRAMSLMPEHSTLWKDSLL
                     AIEVLGLAGLYLYSIDHRESAHVYLGQAIRIAQLEGMHTQLPEEELGIDTVTRCHNLW
                     WTLYLMDRHFSASLGLPMITQDNDITTLTDPPTASSRNATLSLRVRLSQMLSFILSSI
                     YKTEETQLGIFLEQTRSVLHTMAGLAQEIESAVSIQLQKPLHRVPRETRLIMLIYHQC
                     VIVATRPLLLSVLKERLEKLGHGEEDWQSLLVATVALIATGIKSAAKTLQLLTDEDDL
                     LEAFLPFDLEYTYGAAIHLMMAHTLFPGAVEDCSLNQVYSILDGMIYKGNQVAAARKA
                     ELTHLEYLFQELATRIEQCGLQTLTLHSLPQDEHAVESSSHQLENHLLPVPEPTLPMD
                     GDPELLPSDLRPTASNMECLDSLGISSYEFFSIVAQIGHHESYSLLDPRET"
     exon            674666..674714
                     /number=1
     exon            674765..674896
                     /number=2
     exon            675040..675584
                     /number=3
     exon            675638..675908
                     /number=4
     exon            675967..676142
                     /number=5
     exon            676205..676385
                     /number=6
     exon            676438..676937
                     /number=7
     CDS             complement(677543..678331)
                     /codon_start=1
                     /locus_tag="AO090020000270"
                     /note="2-keto-4-pentenoate hydratase"
                     /old_locus_tag="AO070329000009"
                     /protein_id="BAE63482.1"
                     /transl_table=1
                     /translation="MAAKETELQEVSLALRTARANKTPIPTPSKTWPTLDAEDGFKVQ
                     QINTEHAVKNGDRLVGYKLGNIAKVMQDAFRLDHPDYGFLLASTFVYESTTVHLKDYI
                     KPYVELEPAFVLHKPLKGPNVTVADVINAIDYAIPAIEIIDSRVQNWEIGLADTLADN
                     GSTGAVILGGTPRKLTELTLRDTRGTLRFNDKQVMDGNTANVLGNPISAVAWLVNRLA
                     AYDIEFLPGQVILPGSCLQAVPMTEAGHWNCTFEGWGSVEFDVV"
     exon            complement(677543..678331)
                     /number=1
     CDS             complement(join(679515..679844,679924..680239,
                     680291..680655))
                     /codon_start=1
                     /locus_tag="AO090020000271"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000010"
                     /protein_id="BAE63483.1"
                     /transl_table=1
                     /translation="MAPAALLSPEPPVVIGPATKKATRPSSALPQSLIDGARIAKKDT
                     FNAAKHLNFQAPKRIYTMEEIGLEGQGISPHAGSEPFSLFNEEAIKQMRAEIFSDEVL
                     ADCQYSSTFNKHMVRGMGPARAPFTYAAWNDPEVLRRISEVAGIDLIPSIDFEIANIN
                     ISVNSNPQPVPEQQVPSNEELPAVAWHYDSFPFVCVTMLSDCTGMVGGETALRTPSGD
                     IMKVRGPAMGRYIEHQALKALGGRERISMVTCFRPKDPMVRDETVLVGVRGISDLSEL
                     YTQYTEYRLELLEERLRLKQKEERRRVVAKRPFDIADIRQFLKEQKAFLESMLEEIIE
                     VD"
     exon            complement(679515..679844)
                     /number=1
     exon            complement(679924..680239)
                     /number=2
     exon            complement(680291..680655)
                     /number=3
     CDS             join(682954..683029,683087..683370)
                     /codon_start=1
                     /locus_tag="AO090020000272"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000011"
                     /protein_id="BAE63484.1"
                     /transl_table=1
                     /translation="MHPTIILQNAARAPRIRALGQHFVTRSAGQPSRLPSMSSTRSSY
                     DSFAAYRSRAYEHGPLHQASLVRALANSRSAASEKSLNSRGGCIDHGDLSSQTHHLPW
                     TEAEIDAIESGGASLLS"
     exon            682954..683029
                     /number=1
     exon            683087..683370
                     /number=2
     CDS             join(686165..688186,688237..688413,688473..688709,
                     688803..688835)
                     /codon_start=1
                     /locus_tag="AO090020000274"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000013"
                     /protein_id="BAE63485.1"
                     /transl_table=1
                     /translation="MSSKRALLIASTYGGLNGTLNDVKTMEGLLTKRDFEIIPCYNEN
                     ATRAGILEAWNNLIESTSPGDAVVIYYSGHGALVHDEKRKEKNKSWQFQFLVPVDYDE
                     STEGDFRGILDVEISYLLRDTTDKTRNVTIVIDCCHSGRMFRDPAEEPVKHKSLSKVQ
                     FHDLNLYLKQLREKGYFHGEVFQLGNPYAVRIAAAATAESACEHINARGQWSGALTDA
                     LAKAMGETDGIDVSWRTTLVRVCQLVNTRHQWQHPQVEGPDTRAHFSLQHVKSGALYV
                     KVENGKAMIDAGSVVGVRKGNVYTVVPFNPDEADDGEPVVEATVTAVAAFKSKAALTH
                     MPSWRSINHEGALAFLKRDVVDKLPVSLPQALDGLQAGVEESRYLKPSSPDDKQAPLA
                     EFRHEAGSIVLVDHQGVRIRTRPIDSTEEGTSQAFSDIIADAERLARAKRVRELCCER
                     RQDLLAHNLQVTVGTVENGEPKVNFQMAGNDRIAEGESVYIRLENAGSTALYVSVLNI
                     NVVGTVSSLTGAWPLGIELPGGLDITLGSNSFDELVGSKLSWPTGVATDLPVEERFVI
                     LVSNRPVSLNYLAESVNLDVDILRDAAEFVKTAAHLYDVVHVPFKLYAKGTDLDDVPD
                     LDDDSSSETVFYDALDELPDQCILAANLPEPETVAEWADALSYPLDSVPKGIFGAILR
                     TSKNIPPCIRVINQHTEEITVVVSKYRPNRMLSDVGINASATGAGVNFGTTTFNGPAT
                     KKTLASQTDECGCCVATFPLWSRSEGFGVISIFKGPEKVLYIENDRVPAGATAYFANK
                     PDLRLEKYAAGQQWFINGTNQQRV"
     exon            686165..688186
                     /number=1
     exon            688237..688413
                     /number=2
     exon            688473..688709
                     /number=3
     exon            688803..688835
                     /number=4
     CDS             complement(join(689805..689993,690050..690193,
                     690249..690839,690904..691253,691323..691554))
                     /codon_start=1
                     /locus_tag="AO090020000275"
                     /note="cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies"
                     /old_locus_tag="AO070329000014"
                     /protein_id="BAE63486.1"
                     /transl_table=1
                     /translation="MNDERIVLTQDKGQSYTAQLLYLIVAGYIAHTVYYAYWGPTARI
                     QGPWLARFTRLWELLKVSKGHFEQVNIDLHKKYGPIVRISPNTFSISDPSAIKQIYLG
                     RTTLMKSKFYEPFGDPLDPNLFSETDIKKHAQSRKAVAHLYSMSFLVTYEGSADRCNV
                     QLCAKLRDFARHRTAFDVPTWMQFYAHDVIGEITFGEPFGMMAKGQDEHGIADSIDET
                     IAYASRMAVIPELHRWVSWFGRVAHLKTPFHNIQKYILEQIDSRSGSDSVGIDFLKKL
                     LTLREDDKITQLDIEKTVGNNIMAGADTTAISLSAVIYSLLKNPGTETKLREDIDTLA
                     AAGKLSNPVTFEQARHMPYLQACIKEALRVHPAVGRPLLRVVSPEGLTIAGQYFPGRF
                     QGNSRYQCLVAHYNEDIFGRDATTFRPERWLESDKEKLSVMEQSLLAFGAGVRTCIGK
                     NLSMLEMSKVIPELYRQFEFELSESEGAWMTWNNWFVKPAFECYVRLREGV"
     exon            complement(689805..689993)
                     /number=1
     exon            complement(690050..690193)
                     /number=2
     exon            complement(690249..690839)
                     /number=3
     exon            complement(690904..691253)
                     /number=4
     exon            complement(691323..691554)
                     /number=5
     CDS             complement(693605..694159)
                     /codon_start=1
                     /locus_tag="AO090020000276"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000015"
                     /protein_id="BAE63487.1"
                     /transl_table=1
                     /translation="MRFEIPILVALTAGGSIVSAIKLPLTYCVQVIPEVISGLNPDRI
                     YEHARTKVCSAGCVVKVSDYQSKGREMGIQIIDEQSKEMGAPELSSEYTKVLDSIYNT
                     ALEKCEAKQLGETNICDVDPAQGRKIGQCVKRNMLSIVFDQPEAFWSILTTKCEEQYR
                     FFSNEDLWEIKFPQYLEKFARERC"
     exon            complement(693605..694159)
                     /number=1
     CDS             join(696538..696688,696746..698028,699540..699665)
                     /codon_start=1
                     /locus_tag="AO090020000277"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070329000016"
                     /protein_id="BAE63488.1"
                     /transl_table=1
                     /translation="MKDTTPTQGTADQLQTNAATTSPPVPDAPYSIFDKRQKWLIIAI
                     VSTAATFSGFASNIYFPALPTIADDLGVSLELVNLTVTSYLIFQGLAPSLWGPVSDVK
                     GRRIAYICTFIVFLGACIGLALSKNYATVIVLRCLQSTGSASTIAIGSGVIGDITTRA
                     ERGGFIGIFQAGLLVPVAVGPVIGGALAGSLGWHSVFWFLTIYCSVFLVLLIALLPET
                     LRSVVANGSTTPSNPLTRYPLNIYQRTTKAQWKLEDDSDASRPAARKRIDLTGPLRML
                     ITKHAAPIILFLAVYYAVWQMSITAMSSLFKDRYGLGETQIGLAFIANGVGSMIGTLV
                     AGKILNMDYQRVKENYETSLHAEAANDGSDSEDDFPIEKARLRLVPVFSILQCLSIIL
                     FGWTIQYPDRVHIAVPIVSTFITGWTAVSTQSVIMTYLVDIFPDRSAAASASLNLARC
                     LFAAGGTSFIMPMVNGVGVGVAFTICVAMVSAKSLVTLVFGATLAAATLSPASSNTKG
                     KCPGTLNCDRT"
     exon            696538..696688
                     /number=1
     exon            696746..698028
                     /number=2
     exon            699540..699665
                     /number=3
     CDS             join(701431..702009,702067..702958,703014..703081)
                     /codon_start=1
                     /locus_tag="AO090020000279"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000018"
                     /protein_id="BAE63489.1"
                     /transl_table=1
                     /translation="MKVQHLSSPFLLFLLPAIATALTDFAPNPASSLNPTVAERDTTV
                     SNAAVDGLAAPKVSPKGTLDAPVDGKDGRPHAGPWVETNAERDRKKTGTAKTEEQADT
                     KSAEHTGPDGKPIPHSNDGVMDDPHRTGPKEGTRGTEGGVSEKQKGSTDSGEKVPDRP
                     KEAPPLPHSEQQKAPASEDKEGKTSDSKMGVVEKPADLPEKPHDIPHPKSPPSVNDDP
                     LGLNTPKGSTGQIPGTPEEPVDVLHSLLASFTMIVVSEIGDKTFLVAALMAMRHPRLL
                     VFSAAFAALFVMTVLSAILGHAVPTLIPKSMTKFLAAILFFAFGLKMLKEGREMSPDE
                     GVGEEMKEVEMELEEKEQEQLRRTRRRSSVTPHSLESGRAGRGKSRSAGNRLPSPPES
                     LSSSSSRGSSPSRGRRLDDMLSGMNNLFSLLLSPAWVQTFVMTFLGEWGDRSQIATIA
                     MAAGQDYWWVTVGAISGHGLCTAAAVIGGSAIAGRVSMRVVTLGGAVAFLVFGAIYLI
                     EALY"
     exon            701431..702009
                     /number=1
     exon            702067..702958
                     /number=2
     exon            703014..703081
                     /number=3
     CDS             complement(join(703351..703977,704043..704584,
                     704693..704801,704881..705093))
                     /codon_start=1
                     /locus_tag="AO090020000280"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070329000019"
                     /protein_id="BAE63490.1"
                     /transl_table=1
                     /translation="MREEKKHSDTVAHAIPTHRADDAAEYLEGHAGVADTQDVDISAL
                     RRKIDYRIIPFMFCCYVLQFLDKVMLNYAAVMGIKKDLGLVGNDFSNTATWFFIAYLI
                     AEVPNVYLLQKTPAAKWLGLNVTLWGVAAAASAGAHDYRSLLVSRIFLGIFEATIGPS
                     LMLLSSQFYTRSEQAPRFTFWYLGLGVAQIIGGIISFGFQQVHHSFAGWRIMFLVLGL
                     VTMLVGVLTMFFIPDTPMKARWLSEREKVALLRHVSVNQTGVWSSQIDMRQIWEAVGD
                     VQLWLLTLTTICTSVSSGVVTTYSATLINGFGFTPPHSALLNTPSGIVSIFFTLAVGI
                     GIRRISHRWAWFIFCTIPGITGGALMSFLPKHNKAGVLIGIYLVNAIVATLPILYQWT
                     MANCAGHTKRAFSSALVAGSFSVGNIIGPQTFQARDAPEYRPAKIAVLATQAAAGTLA
                     FVLFLYYVWENRRRASTADEGEEEVIDETKWAGLTDKENRWFRYVY"
     exon            complement(703351..703977)
                     /number=1
     exon            complement(704043..704584)
                     /number=2
     exon            complement(704693..704801)
                     /number=3
     exon            complement(704881..705093)
                     /number=4
     CDS             join(705908..706084,706105..706290,706350..706541,
                     706590..706889,707017..707275,707347..707354)
                     /codon_start=1
                     /locus_tag="AO090020000281"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000020"
                     /protein_id="BAE63491.1"
                     /transl_table=1
                     /translation="MGWVHHAAPEVEAQSQYREILGVCLSLTVLMVITVSLRLGLRAH
                     ARRLGAADYVMFMSMALVEAIPLTWSSSSASFTALFVSPVSISIKNIRPALTSTESRY
                     GLGLPLNLRPKQNLPIYKKLNYAGRPFYQIGIAGFKASLCLSYLRLLTKTSLSIYRIL
                     IWTVLTISTLGHIAGALALIFNCRPVQLAWRTDITGTCLPVGGTFYGLAIFTIICDLM
                     IIFLPIPLLLRLKIKPAQKAGVVCLFLLGLFTTICSIMRLTQIHRVAYGDGNSTALVL
                     WGTIEFNVGNIITCIPYLAPLLKGLVRDFRSNSKAYESQGHYVLESWKDPRSQLRSTA
                     SAPVHPRRTPSEELIMDSLGPSHGGIEMTVEVRVSLESL"
     exon            705908..706084
                     /number=1
     exon            706105..706290
                     /number=2
     exon            706350..706541
                     /number=3
     exon            706590..706889
                     /number=4
     exon            707017..707275
                     /number=5
     exon            707347..707354
                     /number=6
     CDS             708022..708420
                     /codon_start=1
                     /locus_tag="AO090020000282"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000021"
                     /protein_id="BAE63492.1"
                     /transl_table=1
                     /translation="MADEQLPVLIIGAGISGLVLAQYLKTKGVPFQIFERDSAIDARS
                     GGWGLTLHWALPALRQLLPEDIVAQMPETYVNKEAAARGDTGRYQFFDLKSGEALYNV
                     PAAERIRVSRVRMRQLLTSGIEVQVRFINS"
     exon            708022..708420
                     /number=1
     CDS             join(708627..708762,708829..709125,709191..709266,
                     709329..709506)
                     /codon_start=1
                     /locus_tag="AO090020000283"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000022"
                     /protein_id="BAE63493.1"
                     /transl_table=1
                     /translation="MQPLPVQLLGATALYTPKEMNGAQKIDPFIFQGAHPDTNVYLFF
                     SFLDTPNNFSDSTDKYHCQLIVSWADSKGIDVPKSNAERLALMKSLTTNWADPFRSLI
                     HQIPDETEVVSIRVVDWIFSPRRQRGHPRVVLVGDSAHTMTMFRGEGANNAIVDVQDL
                     VKRIDFTSAESFTLDALRSSVAAYEQDIFARAETSVLNSRQACLDAHDFEKILNGSPL
                     VSKRVLKEDK"
     exon            708627..708762
                     /number=1
     exon            708829..709125
                     /number=2
     exon            709191..709266
                     /number=3
     exon            709329..709506
                     /number=4
     CDS             join(710471..710663,710853..712125,712174..713927,
                     714001..714029)
                     /codon_start=1
                     /locus_tag="AO090020000284"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000023"
                     /protein_id="BAE63494.1"
                     /transl_table=1
                     /translation="MARIATRVAGQQDIHGLKASPPRRRWTRSQSRELEAHPMDDVAA
                     GKSSLKGNKLWKGKGKLGGHDLDVVTEESPLKSSRKSGFPARQVIPESPEDVHNNTMS
                     GSTIIVPEAETDQEEDEDDDQDELGPELMLETLPSLERSAKDVLDFLVPGSADLKSIV
                     NMAKRLSDPRNTQSKRLNLRKNALKNQPGWFEGRTYIDVTRASESLSSHFSKDGVQLN
                     WSAEPILHHANCARFALEVLLASNNSTGFRKAIRDVEGQFPAPFMRDLVNGRRNAVGE
                     SALLKDTFQLALEIRTQSLIMQLEYRQHEPSFDPNFILEDGFFLDVSVHEPIDSDNAP
                     MRGFNLPRLNIDGSLPDEFREAASDRFEEMVANLPDEDGTFDIDDFKTTYSWRSFLLR
                     AARWIRKRCEEIDQDISRQPSAESAREEFFAEIDAKNRRSSSVAGRSSLAPRHTEERS
                     ERGTIASPDNRRVSAIPPATPRDSPRGVESKERRKSGKPAFLNKSSLERIAQRVKQPH
                     VSIRDFEARRQSDAAARPAPRNIHKESESQLRRQTLPAPRQSRPAAFEEATEEHVEEP
                     AEEPAEEPTGEHIEERTEELIEEHTGEHIEERTEEHIEEHTEDLIEEHTEVRTEEPTE
                     VSGFREESPLLHHDEQDVFNVDSESELSELFVGERTQLEKSHSPVMRRSREPRFATLS
                     PVRTRLFATEVRLEPTSTQTSNTFRPIPSSQELWKAAASRRGTTPTQTSNASRPLPSI
                     QELWKAGNRDGPSKHAKMSEQASRFIDRQANAHRVSPISQSADPQSAERRHTELQSKK
                     RRRYESEDEESDGEFSNYNRPVDTARRRAEKPAQPNKRQRIEEHDESAAQLLNGLQET
                     TRRTSVPESPEVAPRSTNTVRESPEAAPRSTNPVPVSSSARHTVTSTKAPVRWTPAED
                     KRLIRLIEEVGLGGPKGSGWCKIASQNEAQPVKEGESRIAGRNQVQLKDRARNIKIRY
                     LKYVSFSCQLPENITNTKQRPKTSSLELRARNHEREGPGHARGERYQRDLIAEGDLFP
                     SLCLVHLSLALILVISVSRMIPLMRSRAFFECRGSMSELFYVYASGLGIQRA"
     exon            710471..710663
                     /number=1
     exon            710853..712125
                     /number=2
     exon            712174..713927
                     /number=3
     exon            714001..714029
                     /number=4
     CDS             complement(join(714173..714663,714760..715042))
                     /codon_start=1
                     /locus_tag="AO090020000285"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000024"
                     /protein_id="BAE63495.1"
                     /transl_table=1
                     /translation="MTRTIINLSILGLLSVPALALNTACYNDLGSLTLSRSTEYQSVA
                     LCQQICNEENQPVYAVQDQKCFCGDTLPPLSAKVENTECTTKCPGYPADSCGGPKTYT
                     IGTLTTSKSRRAIYPTTTPESDKDTERETETNGILTAPDVDDGDSDPLASLSVNPTMV
                     KTASNAPSTATGTIVTAPSGTAYPNQPDVVASPSKTLTTSVATGSARASVSASASASV
                     SGGATPSASVVAGGASQISSERGVVVGVVAGVVGVWGLF"
     exon            complement(714173..714663)
                     /number=1
     exon            complement(714760..715042)
                     /number=2
     CDS             join(716735..716832,716893..717103,717167..717541,
                     717600..717917)
                     /codon_start=1
                     /locus_tag="AO090020000287"
                     /note="dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /old_locus_tag="AO070329000026"
                     /protein_id="BAE63496.1"
                     /transl_table=1
                     /translation="MQSVLKPIIGPKKEIHDLSGRVALITGGALGIGYEVARAFVLNG
                     ARVIMVNRKEEQGQAAIDKIKEEAGADAKIEWVPCDMGNLAQIKEVFTGIREREERLD
                     LLILSAGINANQYGETHDKIDRHFQVNWLGQFYVCNLLFPLIRKTSKLPDTPAPRIVW
                     ETSEQHRAAPKVVHFGSLDEINNPAIDNTELYGRSKLAIILGVKYGFLDRVIKPNEDN
                     IYVLSVHPGAVNTTMQQQWKDAYPGLLGKVLTTAMLAIGRDVEQGAFSALWAATSPEI
                     EEKSWNGYYFSDSAQPGKETSQASDPTLGASLWDLSHRIIQDKVGKDAIVDWNSSKS"
     exon            716735..716832
                     /number=1
     exon            716893..717103
                     /number=2
     exon            717167..717541
                     /number=3
     exon            717600..717917
                     /number=4
     CDS             join(719190..719536,719649..720994,721064..721125)
                     /codon_start=1
                     /locus_tag="AO090020000288"
                     /note="aminoacylase ACY1 and related metalloexopeptidases"
                     /old_locus_tag="AO070329000027"
                     /protein_id="BAE63497.1"
                     /transl_table=1
                     /translation="MHPKTLPWIVGLLSPTVTSLSIPIPFLPSQQIFNPSPWSDNEIC
                     PLAPKISPPEDGLLPALRFVKDESIRARQANRLSRAVQVPTTVTDYMKDPYDEGFAPF
                     VEFQELLEKLFPLTHKKATLSHINRLGLVYTLTGADTTLKPLLFTAHQDVVPINDASD
                     WTHAPFEGYYDGTWLWGRGASDCKNVLIGLLSVVEDLLSQDWTPNRTVLLAFGFDEES
                     HGFLGAGAIAEYLEGVYGRDGVEFVLDEGGMGLETLSSSSSSSFSSASGDGEGESEDG
                     VIYALPGVSEKGSVDLVLTLSVPGGHSSIPPPHTGIGILSEIIYTLENTELFTPRLDT
                     SHPSRKKLECQVRHSPSSVEPWLASALQSSDHVSTAEKLARSRGDQFRYILQTSQAAD
                     LFHGGVKTNALPEHIEAIVNYRVALHQTPEEVMDRAVRIVSPIVEKFNLTLAAFPENK
                     KEEEGKVNHLTISTLSGALSPAPVSPTGTGEDAVWTRFAGVARAVFESVPSLKGKTVV
                     VSGDIMTGNTDTRFYWNLSRNIYRWSPSRAGGALNIHTVDERVAVDVHLEAMALYYDL
                     IRAFDAWDGSVESTYDLR"
     exon            719190..719536
                     /number=1
     exon            719649..720994
                     /number=2
     exon            721064..721125
                     /number=3
     CDS             complement(join(721421..721490,721537..721672,
                     721728..721871,721918..722120,722172..722755,
                     722810..723252,723311..723606,723682..723917))
                     /codon_start=1
                     /locus_tag="AO090020000289"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000028"
                     /protein_id="BAE63498.1"
                     /transl_table=1
                     /translation="MKDVPCVNPSIRIMMHFLSFCLSVASLVSYAGAASTFSPARPPA
                     LPLAVKSPYLSTWLSAGTDGGNGGYLAGQWPTFWFGQVTGWAGQIRVDNSTYTWMGAI
                     PNTPTVNQTSFEYTSTSSVFTMRVGDMVEMKVKFLSPITPDDLRRQSLVFSYLDVDVE
                     SIDGKAHDIQVYADISAEWASGDRNAIAQWDYGVTDDGVAYHKVYRQTQLLFSENTEQ
                     AEWGEWYWATDDQDGLSYQSGPDVDVRGAFAKNGKLANSDDKNYRAISTNWPVFAFSR
                     DLGSVKTSAGTLFSIGLAQDSAIQYSGKPEGTTVMPSLWKSYFSTATAALEFFHHDYA
                     AAAALSKDLDDRISKDSIDAAGQDYLTITSLTVRQVFAAVQLTGTPEDPYIFMKEISS
                     NGNMNTVDVIFPAHPIFLYTNPELLKLILKPIYEIQENGKYPNTYAMHDIGTHYPNAT
                     GHPKGDDEKMPLEECGNMVIMALAYAQKAKDNDYLSQHYPILNKWTTYLVEDSIYPAN
                     QISTDDFAGSLANQTNLALKGIIGIQAMAVISNTTGHPDDASNHSSIAKDYIARWQTL
                     GVAHDANPPHTTLSYGANETHGLLYNLYADRELGLNLVPQSVYDMQNTFYPTVKEKYG
                     VPLDTRHVYTKADWELFTAAVASESVRDMFHQALATWINETPTNRAFTDLYDTQTGNY
                     PAGITFIARPVMGGAFALLIL"
     exon            complement(721421..721490)
                     /number=1
     exon            complement(721537..721672)
                     /number=2
     exon            complement(721728..721871)
                     /number=3
     exon            complement(721918..722120)
                     /number=4
     exon            complement(722172..722755)
                     /number=5
     exon            complement(722810..723252)
                     /number=6
     exon            complement(723311..723606)
                     /number=7
     exon            complement(723682..723917)
                     /number=8
     CDS             complement(join(725894..726205,726272..728419))
                     /codon_start=1
                     /locus_tag="AO090020000290"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000029"
                     /protein_id="BAE63499.1"
                     /transl_table=1
                     /translation="MSLQADDPRSRGRSKSRQRSSSHASARGNTYLSSEPADEYLRAR
                     SRSRGYRTSAGHLPSGPDLGHYTYPRDNTDPSRSPNLRPVRYDAPPDDVYSESDDEGL
                     AYGDFPGGLERDYYGYMATPRTSSSQVNGAMMSGALNGDRRAGKEPTSGRSSEEALGG
                     HPSYAKPGAWKYATPGQYLHAQPDWATIPECERPGFVPPSSQAGEQYMPGAFPQPATT
                     TAPAFPMPQYANLEAQSNPYPSWGGRPVSMSGPHAYTPTASTPTHKRSVSSDTNAKTP
                     YANPPAFQYAQIDPKVQYTSKSASKQPVSYTAAPQYTKPGEADRGQPSQHSNIKYSAN
                     PQFSKIPTSRPESGQQYVEIVPGDRTGTRPKSHSLSSGNNLSVAGPDPGLRPVSPMLE
                     PYKGTYQSISPMPSPIVIPSRRDEDVSDLEPLDGGSDSSGLRKHRRKKSKDERELKEP
                     KSDRSKRERSRVRQERPGSQEQAVMLIEPSTPRKKVSFYDPEPDAMAMQDALSHTRSI
                     DSKTLIRVLPHLTSEEILDLRAEYKKHVKLHGKSVNLAKHIRLKLGNSTFGKVCYATA
                     LGRWESEAFWANCYYQSSTSRRELLIESLFGRSNSEIRAIKECFRDSRYLDSLEKCMK
                     AELKADKFRTAVLMALEANRQSEREPLDDELIERDVNELHKALVSRHGGETAMIYIIV
                     RRSDSHLREVLRLYERIYGRNFARAMISKSQNLVGETLAHILNGVINRPMRDALLLHQ
                     ALRESRTGKERSELLISRLVRLHWEPRHLEQVKSEFRRRYGERLEEAIAEEVLTSSSG
                     DDWGEFCIGLARSSKALSKKG"
     exon            complement(725894..726205)
                     /number=1
     exon            complement(726272..728419)
                     /number=2
     CDS             complement(join(730331..731414,731472..731965))
                     /codon_start=1
                     /locus_tag="AO090020000291"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000030"
                     /protein_id="BAE63500.1"
                     /transl_table=1
                     /translation="MATATSGLRSPGHHDPSDIENGSTNKDQRRNSSLGFLRRPKSIE
                     PLASKSKKNSKSQAIEEELRRQGAMLKQPPRLPDLSPAPILESFGGEERGHANNTTAP
                     SNSTPSPQLQQPPSRNSMSTDYDPYARTESMTHRGRYSYASSAVSTVNNPRRLRRRKD
                     PTPYNVLVIGARNSGKTEFLNFLKSSLAMPAHKHPSRPAEEMEYQHRHEPANQGYTSE
                     YLETEIDGERVGLTLWDSQGFERNIVDIQLRGVTGFLESKFEETLSEEMKVVRSPGVR
                     DTHIHCTFLLLDPVRLDENIAAAKRAAQGTPKASDSPVIGVLDENLDIQVLRTVLGKT
                     TVVPVISKADTITTAHMSYLRKAVWDSLKKANIDPLEILTLEDQEEEYTSSESADEEE
                     EDTPDNAGDGQKEPGSPSTKSQGSGTQAPPQILPFSILSPDPHSLEAGDEPVGRRFPW
                     GFADPYDAEHCDFVRLKESVFSDWRTELREASRVVWYERWRTSRLNWKTPVPSAGPSK
                     KMYAGRLGPLDQGPRVR"
     exon            complement(730331..731414)
                     /number=1
     exon            complement(731472..731965)
                     /number=2
     CDS             complement(join(734024..734056,734325..734624))
                     /codon_start=1
                     /locus_tag="AO090020000292"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000031"
                     /protein_id="BAE63501.1"
                     /transl_table=1
                     /translation="METYNANCHCGAVRFSFSLAPLKTIKINRCNCSICTKNSYLLVY
                     PLRKDVVFRRGEDQLAEYRFGNRTKPHKFCPNCGTSVLIDFKESQFEKEREMMAINGN
                     CITRRRRL"
     exon            complement(734024..734056)
                     /number=1
     exon            complement(734325..734624)
                     /number=2
     CDS             complement(join(735635..735992,736051..736212,
                     736269..736325,736380..736705))
                     /codon_start=1
                     /locus_tag="AO090020000293"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000032"
                     /protein_id="BAE63502.1"
                     /transl_table=1
                     /translation="MVWLHSEEAYMPSDIGEQLVHTTPMVNWKPIDKAPSATTLDNLD
                     QFNNLGNTSVYLTSKEGIDADPQPSWFGGVKPDQDGRTQDAISSTIILRDHGDGTLDA
                     FYFYFYAFNQGNTVLAMEFGDHIGDWEHNMIRFSEGVPQAIWYSQHASGQAFTYGATE
                     KIGKRPIAYSGNGTHANYAISGKHDHTIPGFNLPDGLIVDHTDSGTLWDPILSAYVYS
                     YDASKETFQAYDSGYPVNWLNFNGQWGDDALPGGPELFGQKKYVAGPNGPKFKKLVRD
                     KVCPSSPCVVLPFRIWENQTLEEH"
     exon            complement(735635..735992)
                     /number=1
     exon            complement(736051..736212)
                     /number=2
     exon            complement(736269..736325)
                     /number=3
     exon            complement(736380..736705)
                     /number=4
     CDS             complement(join(739238..740357,740414..740547))
                     /codon_start=1
                     /locus_tag="AO090020000295"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000034"
                     /protein_id="BAE63503.1"
                     /transl_table=1
                     /translation="MPPHTGRANGSLDDDDYVAQVLANEARDSSLKYSALGMGAYMPK
                     RPTGAAPKPNTRFLRHIIKETDNHNSALKRKEEREARERMRQLRNQPASSSNDSRKDP
                     HSRQPRSDDRKSHRDRKYDREDRHNSYRRRHRSRSASADRDRSHRHRRRRDSYGEDED
                     RHRSSRRSRRHRSYSRSRSRSPQEDRVTKSRSRHHRQRRRSRSPSRSRSRSLSSNDRR
                     KRRDREQCSPERSSTSKVKASSPLHPVAIQDQQPGYESDPLEDLVGPLPPQATNSTGA
                     APIRSRGRGAYRPNMSNIDAHFAPDYDPTLDVQLEDDDENASGKPSRRPVAGLMTGDD
                     DWELALEAVRDRARWKQRGEDRLREAGFDDTFVKQWKSNTTPTTGDSEGRLEDVKWSK
                     KGEGREWDRGKYVNEDGHIDVKASW"
     exon            complement(739238..740357)
                     /number=1
     exon            complement(740414..740547)
                     /number=2
     CDS             join(740984..741205,741259..741478,741620..741702)
                     /codon_start=1
                     /locus_tag="AO090020000296"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000035"
                     /protein_id="BAE63504.1"
                     /transl_table=1
                     /translation="MSDVNPAEILEQLQQLQKESGDLKSQLAILRISEPIFSPDAENQ
                     SQSLSKRTSDASAIDNPTPASLEADLTHYKELFSKLRFSYVEQVTKEKFLRAIVGDPP
                     LVVGHNENVELETQLAEVKAELKASKEEVRMMIEEMEKTGRDLANHDAALYFARIHRE
                     SRVYNCRTARQTGI"
     exon            740984..741205
                     /number=1
     exon            741259..741478
                     /number=2
     exon            741620..741702
                     /number=3
     CDS             complement(join(742289..742700,742776..742874,
                     742954..742972,743045..743082,743148..743161))
                     /codon_start=1
                     /locus_tag="AO090020000297"
                     /note="ribosomal protein S4"
                     /old_locus_tag="AO070329000036"
                     /protein_id="BAE63505.1"
                     /transl_table=1
                     /translation="MAPVPRVYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWR
                     VQLTLSKIRRAARELLTLDEKDPKRLFEGNALIRRLVRIGVLDESRMKLDYVLALRVE
                     DFLERRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFMVRLDSQKHIDFAL
                     TSPYGGGRPGRVQRKKAASANAGGDDAAEEDDE"
     exon            complement(742289..742700)
                     /number=1
     exon            complement(742776..742874)
                     /number=2
     exon            complement(742954..742972)
                     /number=3
     exon            complement(743045..743082)
                     /number=4
     exon            complement(743148..743161)
                     /number=5
     CDS             join(743513..743548,743629..743696,743767..743814,
                     743916..744240)
                     /codon_start=1
                     /locus_tag="AO090020000298"
                     /note="60S ribosomal protein L21"
                     /old_locus_tag="AO070329000037"
                     /protein_id="BAE63506.1"
                     /transl_table=1
                     /translation="MGHSHGLRSGTRYAFSRNFKEHGQIALSTYLKTYRVGDIVDIKV
                     NGAVQKGMPYKVYNGKTGVVYNVTKSSVGVLLYKVVRNRYLEKRVNIRIEHVKHSRSR
                     EDFIKRVKENAEKKKQAKEQGVHLHLKRQPVGPREAHVVQAAAPETITPIPYDTHI"
     exon            743513..743548
                     /number=1
     exon            743629..743696
                     /number=2
     exon            743767..743814
                     /number=3
     exon            743916..744240
                     /number=4
     CDS             join(744512..744744,745426..746379,746617..746674)
                     /codon_start=1
                     /locus_tag="AO090020000299"
                     /note="mitochondrial carrier protein - Rim2p/Mrs12p"
                     /old_locus_tag="AO070329000038"
                     /protein_id="BAE63507.1"
                     /transl_table=1
                     /translation="MSSNAELLPCAWESDLRYGGGVPRVTLVVRALMTPNSATSMTIH
                     LPGKIQPISCGSKTSFAVNYSANDWSLHPKVCAMLGGMTAATLTSPLDVLKTRLQSDF
                     YQAQLRSLRAAHPLPPSSSLSSLPRSALMHFNETFQILRSIHVHEGWRALFKGLGPNL
                     IGVVPARAINFYVYGNGKRILSDHFNYTNSQETPVGIHLTAAAVAGIATGTATNPIWL
                     VKTRLQLDKSNAEHHNGQGRQYKNSWDCIKQTVRHEGIRGLYKGLSASYLGVTESTLQ
                     WVMYEQMKMFLARRESAKRADPNYTYGTWDDVELWGGRICSAGLAKLVAAAATYPHEV
                     VRTRLRQAPTVSIGDGKAVMKYTGLVQCFKTVWKEEGMVGLYGGLTPHLLRVVPSAAI
                     MFGIFLVDLVLSVLSGTGVLLI"
     exon            744512..744744
                     /number=1
     exon            745426..746379
                     /number=2
     exon            746617..746674
                     /number=3
     CDS             750566..752815
                     /codon_start=1
                     /locus_tag="AO090020000301"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000040"
                     /protein_id="BAE63508.1"
                     /transl_table=1
                     /translation="MKSFVTDTYNCLENMIQEEIDGEIHSPHSTNSTTSTKDWYACQL
                     CENHRRRTYSTKGAFRRHVSTEHAPRFRHSCPRCDWATPRRDKVWEHLRHRHSPLDGL
                     KRNDIKRTKLRSPRACPLCDKSVQSWEAYFNCVAEHCRIQSGSSPGTSGVQSRRNSGD
                     SGSGGDGFNGHFAPGNLFDGQGPQTQFPNGGGGTANNGGNYFSGHVSYFYGNGCSREN
                     NSAQLVGQRPSHPLGSVPDRDDASVDPALLSRTLGKKASEISHPGPSSLSGHHQLLDS
                     AMESSPHAMPPMDNSKHHGGRKPHNLRSPSETTSFNNKSPRQMTSFKGLSPKKSQERP
                     SSEPQNLLPKKCKSCGHIMKNCVECKLQEGNVDRCHLCTGKASQQHGVSKVLEDYDQY
                     YDFACNGMSDRNRSASKIAWALEQVSQAFKTEGDLCSTGISRTSTYSSFEESFQWVSV
                     MKAPDTACAFQASEQSTFTIMGPGNSTKTLSGAWEAHATRCRYTRMTLALCSPQVYNK
                     IGHSGSLIGIHIGLSEVLYDTQYIIGDTSIACQPGPEKKTASGLTAEHAISCLPKTPE
                     SLCTIQSKTMSFRGFTIYRASCVVKDRQSPQHPIHLIDAPSPAKVQLTRRRRARLRRK
                     LQVIIGLLVLQASVTDTYPVSKQLEDKDAKILITESEDTDLIETGSDLDLSEPKILPQ
                     WLRETISTFSAGLIDHVESTMLATSIYKAEEEIWPKVKTFVGSMASYLETPVSPVIEQ
                     HIAEYTKLG"
     exon            750566..752815
                     /number=1
     CDS             join(753381..753606,753727..753783,753826..754196,
                     754255..754593,754647..755418,755476..755705)
                     /codon_start=1
                     /locus_tag="AO090020000302"
                     /note="WD40 repeat-containing protein"
                     /old_locus_tag="AO070329000041"
                     /protein_id="BAE63509.1"
                     /transl_table=1
                     /translation="MSSPDPHTASGDRPPSRNSHAIWHPAREWLEEDEEDDMDDEPET
                     EISEYPEDASHPDEDTFDDEDGFYGVNLNYLGNPAQSGEAAGQAGGRHSRVSHHLLLA
                     VSAARLLNLLASNGMRHILHYSRAGGQMDEDEEDEEEELAGFFGFRRRARRGGGDPAP
                     PVPSEEGAKLMASGDFGSNSYYTDELKKRRKSLATRTMWRELGIDLSGPRQEVQSITQ
                     GLIPGSVADKIIHFDSRCYSGQFSDDGNFFFSCSQDFRVRMYDTSNPYEWKYYKTVDY
                     PFGQWTITDATLSPDNRFLAYTSIRNLVCLATTDPLDTSEPSVLNLSSSNGRQFGIWS
                     VRFSGDGREIVAGTSDNSVIVYDLETRQSILRLRNHEDDVNAVCFGDKSSPHILYSGS
                     DDSTLRVWDRRSMGDGREAGVFIGHTEGLTYVDSKGDGRYVLSNGKDQNMKLWDLRKM
                     MTTAKFDTIDAQDYTSGFDYRFEPYPENYYQSHPHDCSVVTFRGHRVLKTLIRCHFSP
                     PDSTNSRYVYTGSADGKVYVYNLDATLAGTIDVGQATVDTRPQDPDMMNSAYDFSSRS
                     GDLAWQTCVRDASWHPNAPVVAATSWNGWGLSTGTCTVHSWNGGAAEDEGTPPVSRNY
                     DCRLKSVREYDQFKETVHHLRSRPVYRRRYEDDEYAGEIW"
     exon            753381..753606
                     /number=1
     exon            753727..753783
                     /number=2
     exon            753826..754196
                     /number=3
     exon            754255..754593
                     /number=4
     exon            754647..755418
                     /number=5
     exon            755476..755705
                     /number=6
     CDS             join(757800..758269,758328..758938,759012..759133)
                     /codon_start=1
                     /locus_tag="AO090020000304"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000043"
                     /protein_id="BAE63510.1"
                     /transl_table=1
                     /translation="MATEDDNFDIDIYGDGGGYNANEQGGEDDIKHDDTELILDAPEQ
                     PQNGGPAHGDGAADTNAQQGHAQGTAPNGEHVTQSNPQQQAATETPAPPQGVKRKEHD
                     DRPSDPDATPALLISDLYWWTTDDDIRGWVREADCEDELKDVTFSEHKVNGKSKGQAF
                     IEFTTLQAATATKHKLESSGTTGRKYSVNYTNPQPNPFRTLPKDAPMRKDNQARSMSG
                     GFNSPAQNMNFGMNNMGGGGGGFRGGRGGFNSRGGMNNNMGGFNNRNFQNPMGFQNPM
                     AGGFGGNPMGGMQNYGGFNNRGGMMGGMRGGPGGMRGGRGGGGMGGPNMMGMPNMNPM
                     GGMGMNPMSGGMNPMMGGMGGNMAMQGKGGFQGPNPAFNQNFFPPNQGVGGDGSWNPH
                     GAKRSRQE"
     exon            757800..758269
                     /number=1
     exon            758328..758938
                     /number=2
     exon            759012..759133
                     /number=3
     CDS             complement(join(759879..760648,760720..760852))
                     /codon_start=1
                     /locus_tag="AO090020000306"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000045"
                     /protein_id="BAE63511.1"
                     /transl_table=1
                     /translation="MTPARCNLKEVSFSHLFPAEVARALVGGLTLAIAYMHSRGIVHG
                     DIHLGNILVKLPSSLNHLSIKQLYEEYGHPETVPITHRNGKPLPPNIPAKAVLPLYLG
                     KDAEEFSLSDAQIRLSDFGETFNPDLEPRLGKDCHTPLAARPPDAWFEIQTSLSYSAD
                     IWSLATAIWEIIGMKAIFSSEYTSVDEVICQQIDVLGSLPLEWFESWGKRDLYFDDDG
                     VPKDGRYVWSSIDGAFEEGVQKYRRKFGMGEFDGEETAAFLDLMRRMLTFRPEERPTA
                     REVLQSRLMVEWVLPDFERSSQMG"
     exon            complement(759879..760648)
                     /number=1
     exon            complement(760720..760852)
                     /number=2
     CDS             762907..763344
                     /codon_start=1
                     /locus_tag="AO090020000308"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000047"
                     /protein_id="BAE63512.1"
                     /transl_table=1
                     /translation="MGTYDDWIRLQDDAHRVMNERQDGQNMRDWCARSLEFWKRFDDS
                     MLTAQMWITMLDEDVQRELTRAPQPQTLSEAMEMAVRFAGILSREKEHETDKERGRKR
                     AGRRNPTLTEQTATRKRKRQRSSTGPSFSKIRRHRRQRPEGPR"
     exon            762907..763344
                     /number=1
     CDS             join(764267..764344,764527..764848,764932..764960)
                     /codon_start=1
                     /locus_tag="AO090020000309"
                     /note="sorting nexin SNX11"
                     /old_locus_tag="AO070329000048"
                     /protein_id="BAE63513.1"
                     /transl_table=1
                     /translation="MQAVPESRQQTFEEIYGPPENFLEIEVRNPQTHGTSRNMYTSYE
                     IVCRTNIPAFKLKHSVVRRRYSDFEYFRDILERESTRVTIPPLPGKVFTNRFSDDVIE
                     HRREGLQRFLQIVAGHPLLQTGSKVLASFIQDPNWDRNAW"
     exon            764267..764344
                     /number=1
     exon            764527..764848
                     /number=2
     exon            764932..764960
                     /number=3
     CDS             complement(join(765693..766554,766608..766637,
                     766691..767709))
                     /codon_start=1
                     /locus_tag="AO090020000310"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000049"
                     /protein_id="BAE63514.1"
                     /transl_table=1
                     /translation="MDSNGTFARSFDESLTRELPQLQSLRIAPLRQPVSSRILSIPSP
                     LEPNASGVREPNSIPKTNNSTGVLPGRNDSGGLTESVNAARAKKNDHTVDAVSSLQPP
                     PKPILPEFVNLRALERFPYSSFDDDSHARKRRRLEVQADSFGEHLQLPIPQAHKEPRP
                     PPFGPFAILNGLNEPPPNAALLPPIEAGSITQLLTKPSRGTSFVEPALLTANTIVESQ
                     SVERIEGRIHEILDSPVGENTVDGVQANVESGLFEDASVDQIGHEKGDLQNDKEAQPR
                     AEEKEPLSPKTRGRSRKNLRKWTEEETTALLRGVVKCGIGNWTAILAQPELKFNKRSA
                     SNLKDRFRVCCPWAYRAADPNEATKKLRDTLADALSRAETEGTDGAPGKIRLPHPWPV
                     SETPPGGISAGSSQESLSSSGTPTEESEPKSSISQAKQASTKTGPTLSSKSKSTLASL
                     GIPEPHFTMKSRRRSRRPFTVAEDEALLKGYAVHGFQWTLIQQDKRLNLGHRRATDLR
                     DRFRTKFPHAYRDGGSVSGNSFNQSEESGLKDGKDRASSSKRNLQPTKQLPGSQNGKS
                     DNSEQSALGPIDPALSPPAPPPGLPLESMAGAPSTGVFSFPLDENATNPTGVDPSWAD
                     NTLAPMVWDELA"
     exon            complement(765693..766554)
                     /number=1
     exon            complement(766608..766637)
                     /number=2
     exon            complement(766691..767709)
                     /number=3
     CDS             join(768369..768430,768506..768917)
                     /codon_start=1
                     /locus_tag="AO090020000311"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000050"
                     /protein_id="BAE63515.1"
                     /transl_table=1
                     /translation="MSVEVPLWPHFLFRVFEPLSCFGGYIFPLLDLNKFIVDSTPNVP
                     PPETIHPSSVVLAGQLGNIYAVLGLLSFLIHHNTTDPKVFRNYILAYVFSDINHLYAT
                     YRGVGWDTFVDPWAWQNLLTWGNIGMTVFMLVNRILFLLGVFGNAKVSETHRKRS"
     exon            768369..768430
                     /number=1
     exon            768506..768917
                     /number=2
     CDS             complement(join(769620..769922,769990..770475,
                     770537..771253))
                     /codon_start=1
                     /locus_tag="AO090020000312"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000051"
                     /protein_id="BAE63516.1"
                     /transl_table=1
                     /translation="MSIPNQDTVVGFHQSPPQAFFSLPETGGMTGVPRLRAMDESMSA
                     TSMSVQSSYPSLFQSSAEIPPFFVTYRWWEDEATTVLWAFDVEDIKRVIQYGLYRDEN
                     LPRSSLQSRNASAVDSFLLTLVQPKERAYIANLSFIQKVEEIIRRCKTNTPSLVAWSW
                     FPSQVNRDLDPAAIADAIDAESHFHFTRIPFEELVRYSLGYPAIAVEWFLQQHTALYI
                     HLLNYFNTFPEEIVRYTKVEQHLRNRSPFAHRALLHCLLALQSGGNYELPSATPGFEF
                     IADPIQGLFKELPPSLTSILKVLSVLRVRFERQYVHARTMNWIQPFDIDFSLYEDLTG
                     STSAADFARTLTNADERSFSALTPQQIMAEDPVVTKLLTKWESLSIEVWECCTALPDM
                     IPYIQDCVQALLVIRNYHSFSALINGLRKYSITDSVFSNNGTAGAMALNPIVPPDLLF
                     LTVPYQNYAAYRQQFQSSPGIPCLIPHIREYQQQGQPALLQMFQRMRNAMR"
     exon            complement(769620..769922)
                     /number=1
     exon            complement(769990..770475)
                     /number=2
     exon            complement(770537..771253)
                     /number=3
     CDS             complement(join(776403..776829,776972..776985))
                     /codon_start=1
                     /locus_tag="AO090020000313"
                     /note="40S ribosomal protein S4"
                     /old_locus_tag="AO070329000052"
                     /protein_id="BAE63517.1"
                     /transl_table=1
                     /translation="MPRGPTKHQKRLSAPSHWLLDKMSGTYAPKASPGPHKLRDCLPL
                     IVFIRNRLKYALNGREVKAIMMQRLIQVDGKVRTDPTFPAGFMDVIGIEKTGENFRLI
                     YDTKGRFTVHRIQAEEAEYKLCKVKRVQLGKGGIPFLVTHDART"
     exon            complement(776403..776829)
                     /number=1
     exon            complement(776972..776985)
                     /number=2
     CDS             complement(join(777377..778182,778236..778493,
                     778548..778575))
                     /codon_start=1
                     /locus_tag="AO090020000314"
                     /note="aspartate-semialdehyde dehydrogenase"
                     /old_locus_tag="AO070329000053"
                     /protein_id="BAE63518.1"
                     /transl_table=1
                     /translation="MASSPKKKCGVLGATGSVGQRFILLLADHPFLELHAVGASERSA
                     GKAYKDAVRWKQTTAMSEKLSNLVLRDCKASQFTDCDLVFSGLNSDIAGEVEMEFIKA
                     EIPVFSNAKNYRKHPLVPLVVPTVNPHHFDLIPHQRKEFGLKKGFLVCNSNCAVIGIV
                     IPFAALQAKFGPVEEVEVFTEQALSGAGYPGVPSMDILDNVIPFISGEEDKLENEAQK
                     ILGSVNADATAFEEQAGLRVGATCTRVHVSDGHMAFVSLRFKNRPAPSAEQVVQALRE
                     YQSEAQKLGAPSAPKEAIRVFDEADRPQPRLDRDICGGYTVSVGRVREGAQGGYFDLR
                     FAALSHNTVIGAAGSSIINAEIAVLKGYI"
     exon            complement(777377..778182)
                     /number=1
     exon            complement(778236..778493)
                     /number=2
     exon            complement(778548..778575)
                     /number=3
     CDS             complement(join(779029..779181,779237..779418,
                     779469..780522,780609..780941))
                     /codon_start=1
                     /locus_tag="AO090020000315"
                     /note="proteins containing the FAD binding domain"
                     /old_locus_tag="AO070329000054"
                     /protein_id="BAE63519.1"
                     /transl_table=1
                     /translation="MRALSRLPRGFPANPRVFHRRPTLPRPEVCQRSRIARLNSSSSS
                     GNDREKRGDAGISEPSTGSSNSWTASRTLLVSALAAGLSYAYAISSNKSQPESLKQPQ
                     YGSTQDLKKAIAELRAKLGDEAISTDEDDLQVHGFSEWSSVNADRFPVAIAYPKSTED
                     VAEIAKICHKYKMPMIPYSGGSSLEANFAAVHGGLTIDFVSMNKILELHEDDMDVVVQ
                     PSIQWMDLNEKIKDSGLFFPVDPGPSAMIGGMIGTNCSGTNAVRYGTMKDWVINLTVV
                     LADGRIVKTRRRPRKTSAGYNLTGMFVGSEGTLGIVTEATLKLTPIPEETRVGVVTFP
                     TMRDAASTAMLLIRKGIPVQCMEILDDVQMDVINRAGGTGRSWKTLPSLFFKFSGTSA
                     GVLDSVTLTRDLAKKNHAESFEFARDEREALDLWSARKQSLWSMLALKKEGSQVWSTD
                     VSVPISRLPDIIEITKKELDDLGIFASVLGHIGDGNFHTCILYNRKDQEETERVEKFV
                     YDMVDRALEMEGSCTGEHGVGLGKKKSLQKELGPETIDVMRSFKKALDPHWLLNPGKI
                     FDFKDES"
     exon            complement(779029..779181)
                     /number=1
     exon            complement(779237..779418)
                     /number=2
     exon            complement(779469..780522)
                     /number=3
     exon            complement(780609..780941)
                     /number=4
     CDS             join(782485..782955,783017..784435,784493..784621,
                     784677..784793,784890..785528)
                     /codon_start=1
                     /locus_tag="AO090020000317"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000056"
                     /protein_id="BAE63520.1"
                     /transl_table=1
                     /translation="MTGLQSSPRVLHGIPPEIMSSLQIELTKTLRNLDDHMGNLLCLA
                     TFARIASSQRVPRGDESAQQVPGWLQNIRHFFGAKRGLKTLDLVVLRVILACSTSCQS
                     LMTDQAAESIKLGIEICATVEGSQRESWIQSNSSKIAKLCEKVTRDNIDPEVQMLGIT
                     FLVYLLPTATLPSGLPEVALHWLLSENSTRILAALPQEYISRLAEANVVSQNNAPIEN
                     NTKCFKLCPGQTAMCRIMDYVIATLSTRHSADAANVDTIRVAQSLVIGLQNVVSQGFG
                     TTAAEATLTRLKGSIDELIESFPRRPYLPSCQNSTICYTFVSESENELLYDLFSLYFQ
                     ASLSPSLDQGASHLTHIDSFRAFMFKARNLICHNTCSYSEIKPLKLRGTVSFLTIHDE
                     RPNSRNDWRAGLSETLMLSARTSHDSMMQKVEEICHDLERRCGSIEAPLRAVEEERRK
                     ISLEAQEAKKHNDELRLQLQQASRTIDELQQNMSRLEVHAEAASARIEELTVSLDAAR
                     GELEDQRRDSQEAANRDRENARTRELDLIASVAEKEEQLEQLQEDAHRQREESGRLQQ
                     MLDARSKERDAAIEQNAMFEQDMAKLRECIEEYRLLLTGKDEEVARLQAAKEDIETLM
                     ETLQSKLNEEVSESDNIRSALREAELNFKRELATLTEQFEVQLSASAAEGTKQKEEIA
                     TLQATMQAAASTACRELQTKEKRIQYLEKKVQHLRDERAAKAREFSEAQQHITRLMAV
                     MGWKPDTTNTTTSGRQSRSRSSLGPSQAAVTQQQTHPEDECSQPQADIILAQSFETDT
                     SQFGGRSPKRSRITAFPVAELPAESHESTENKARHPVYRRGGTRQSRDRTVLGDTDQN
                     SQPSSQENNKSISNRRGSFKDVQSYGGANENHLQDVNLDMDLEFSKDFLFTSTSLSQA
                     TDEHNPQPEI"
     exon            782485..782955
                     /number=1
     exon            783017..784435
                     /number=2
     exon            784493..784621
                     /number=3
     exon            784677..784793
                     /number=4
     exon            784890..785528
                     /number=5
     CDS             join(786129..786348,786529..786760,786817..786973,
                     787027..787495,787551..790849)
                     /codon_start=1
                     /locus_tag="AO090020000318"
                     /note="RNA-directed RNA polymerase QDE-1 required for
                     posttranscriptional gene silencing and RNA interference"
                     /old_locus_tag="AO070329000057"
                     /protein_id="BAE63521.1"
                     /transl_table=1
                     /translation="MQRATEKPQLSEREHGRGSRKQRSRKGKKHHKRSSTLGPSSQTS
                     SSTNKGSEDRSSSTATYQTGVSPHRALTTSTSRQPQNSSRLQQQPAQLLLAPWTFWDT
                     VAVNLFNLPREINTRILWQTFSSEGYVSSIDLFEDSHGNRDSRGKIRFKPPPKTDFWR
                     KGLYTIKLPNGRTSVINIGLDLNREEPQIASPVRSGVSYPVEVKLPILSMDIGVLLSE
                     TTMLPMRSVGSGENESSRLVLNLKQKALFVYFQLPIFTPGYKPTPASGMLQEYRLKIP
                     FVQLSWIFQVRDTVTGDISHFIVLDSPPLYHRRINNIDVTHSEENNTWRESETWYRQT
                     YIVRNALELPYLPIGLKKAKAVIDIGRWNTFKITYPRDADFKGKLTLLCDILKDYNVT
                     FQDTDRFTQWDTNVEMNPPIWKWIDLSDSQPPRKACSLEDLFDHNFVHLPFQVRYQLE
                     VCISNGYLSEFTMTREFAVKLSELGETQAVKLLEHVSAKKQVYYDPMKIFDLKFIKGV
                     TQAKIPPYCCYMHSARITPSTIYYNTPTVDISNRVIRRFIEHADRFLRVRFTDEKLLG
                     RINSTTDSTMDEIFTRIKRALTNGIVIGDRRYEFLAFGNSQFREHGAYFFAPLPNLTA
                     ANIRAWMGHFNSIRNVAKHAARLGQCFSTTRAIAGCPVDVVKIEDVERNGYNFSDGVG
                     RISRFLAQMSMSELKIKTPTGEPPSAFQFRLGGCKGMLAVSSEAQRQEVHIRKSQFKF
                     AAIHNGLEIVRWSQFSMATLNRQLIIVLSTLGIPDQVFHAKLHTMLQGLDQALESDPQ
                     AIYWLKKYVDPNQMTLTISQMVLDGFRRSKEPFLTSVLTLWRAWHLKYLKEKARIAVD
                     QGACLLGCMDETGLLQGYFHDKVPGNDASVEEKTAALPEIFVQVSRPEADKKSEVIEG
                     VCILARNPSLHPGDIRVVRAVNVPQLRHLQDVVVLPQTGDRDIASMCSGGDLDGDDYI
                     VIWDQDLLPKDWFREPMKYTSNKAQDLDRDVTVNDITSFFVTYMKNDFLPRIAHAHLA
                     LADFLEDGVNEEKCIRLAQLHSDAVDYNKTGIPAILTRNLEPRKWPHFMEKFNKPKDR
                     IYHSNKILGQLYDAVERIDFVPSLEMPFDKRLLNCEIEVPDDLLTFAKNLKGQYDDAM
                     RRIMAQHEIKTEFEIWSTFVLGHANTSKDYKFHEEIGAISATLRDTFKKQCYEKVGGR
                     NFDQLAPLALAMYRVTNEEMSDALNKYRAENSTTGNKFFHKPTPKIDQLPLISFPWIF
                     PHILGKIALGHFEVPGGIPVVDNDPFGLFTDDLDPTSPLPCRCSIVPAASMPLSFSDN
                     VESLEQLLDFGLSTSGPHELASSTDAALSDVPIEADLSLLDFSDIPKYSQSPSCNGSI
                     GGGCVIQSMDTTTPAMAVDTIQRSGSPSGGSTGGGCVVQSADVSNSTFNEVVSEKWVE
                     IVEEEDDLKPTALDKLNELLGF"
     exon            786129..786348
                     /number=1
     exon            786529..786760
                     /number=2
     exon            786817..786973
                     /number=3
     exon            787027..787495
                     /number=4
     exon            787551..790849
                     /number=5
     CDS             complement(join(791134..794266,794663..795995,
                     796053..796287))
                     /codon_start=1
                     /locus_tag="AO090020000319"
                     /note="DNA polymerase zeta, catalytic subunit"
                     /old_locus_tag="AO070329000058"
                     /protein_id="BAE63522.1"
                     /transl_table=1
                     /translation="MEPFQVRLNCVDHYQAAPSEFDPPFPYRDPSTEKYDRPKVPVIR
                     IFGATETGQRVCVHVHGAFPYLYVPYDGDLSPEEVRRAIRDLHISIDHALALSYRRNA
                     YDKKAAFVAHITLVKGVPFYGYHVGYRFFFKVYLLSPIYTTRVADLLLQGAILKRSLQ
                     PYESHLQYIPQWMCDYSLYGCAYMKCSKVKFRSPVPEYLELTNLSHRWHDRSIQPDSI
                     SDASELPKQSHCPLEVDICVQDILNRLEVRERPIHHDFTEFLKPVDQNEKLVPSMEGL
                     WKDETHRRKKRLGLADPDSSPFDPEELVSLSAATREQYKGEWIHEEEYRQLTLRAVAE
                     ERRQYGGGDVNVDDFLVQDPLGKDVKTVLESVEDLYPDNNNFPGLQAPQDLEIGESAN
                     EGAYTDENAALPVASDSSDDDNIADLFSEGNDEEERDVFDDPLADVFSELPSDEHREP
                     NAPLAHTSTDYKPFFDRTEGSSSRHSTNSYAQGQLEHINSQAKIREDIRRAERTLKRS
                     ESEVIDHVHFNKRPNSFLSVMAPMIYETFNIPQNTRICCLRRPCPSPSEVLSTLSDYD
                     YPAVIYDKAHYSDQGDVPDRPRDYAGREFRLQGSGIHYLPDFDPTGRSPAMLGEQTSI
                     LRDRQEQEQIDQHLRESCTSRVWEFAPVPPSRSEVIQWFESRQQEPKAETVQPERHLH
                     EPNTKLNVLSQIEGPTQKNEYGFKYSQKGRSTSVEHQTQYMSIMSLEVHVNTRGVLAP
                     NPEEDEISCISWCIQSDDEDLDVNSHLSGVRVGMVFQGEYDKPEETLSKALRIDLEHE
                     PTELDLINRLVDLVRLYDPDIITGYEVHNGSWGYVIERARKKYDFDICDELSRVKSQA
                     HGRFGKDADRWGFNHTSSIRVSGRHMINIWRAMRSELNLLQYSMENVVFHLLHRRIPH
                     YSFRDLTEWYQSGKPRDLMKVVDYFVSRVQMNLEILESNELVPRISEQARLLGIDFYS
                     VFSRGSQFKVESLMFRIAKPENFLLVSPSKKQVGQQNALECLPLVMEPQSDFYTSPLI
                     VLDFQSLYPSIMIAYNYCYSTFLGRVHQWRGRDKMGFTEYQRQPRLLELFKDKINIAP
                     NGMMYAKPEVRRSLLARMLAEILETRVMVKTGMKMDKDDKALQRLLNNRQLALKLIAN
                     VTYGYTSASFSGRMPCSEIADSIVQSGRETLEKAIALIHSVERWGAEVVYGDTDSLFV
                     YLKGRTRDEAFDIGEEIAKAVTETNPSPVKLKFEKVYHPCVLLAKKRYVGFKYEHRDQ
                     KEPEFDAKGIETVRRDGTPAEQKIEEKALKLLFRTADLSQVKRYFQKQCTKILQGRVS
                     IQDFCFAREVKLGTYSERGLPPPGALISTKKMLEDPRLEPQYGERVPYVVVTGAPGSR
                     LIDRCVPPETLLHDAQLELDAEYYITKNIIPPLERIFNLVGANVRQWYDEMPKVQRIR
                     RVEGTVTSTGKDARKTTLESYMKSSTCIVCKAKLDDTDVPVCAECIRQPHISLLDLVT
                     RQRHAEKSVSDLLRVCRSCMGVPFGDEVKCDSKDCPVFYSRTRYVANWRHTKAVLDPV
                     IKLLQDKSESELEW"
     exon            complement(791134..794266)
                     /number=1
     exon            complement(794663..795995)
                     /number=2
     exon            complement(796053..796287)
                     /number=3
     CDS             join(796655..797534,797841..798067)
                     /codon_start=1
                     /locus_tag="AO090020000320"
                     /note="RNA splicing factor - Slu7p"
                     /old_locus_tag="AO070329000059"
                     /protein_id="BAE63523.1"
                     /transl_table=1
                     /translation="MSSRKPADVASKERNEYIPSFISKKPFYIDDDSTNDYLEHQRLQ
                     KQTTEQSKWYERGKRAGPAATKYRKGACENCGAMTHKTKECLSRPRKQGAKWTGKDIQ
                     ADEVVQNIDMGWDAKRDRWNGYDASEYRQVVEEYEELEKLKRVTGQKKITDGEDEEGG
                     AEEEARYAEESDMGRQQSTATRNLRIREDTAKYLLNLDLDSAKYDPKTRRMVDMGAQE
                     DQAAALVAEENFVRASGDAAEFEKAQKYAWEAQESGQKIHLQANPTSGEILRKKEQAD
                     TEAKRQAQRKALLEKYGDEQPEAETEDAAGHLNQEQDIDDRRADDSGTKSKKRTLMEV
                     QSGITEEELESYKKTRLAADDPMAKFIGNDILEQ"
     exon            796655..797534
                     /number=1
     exon            797841..798067
                     /number=2
     CDS             complement(join(799783..800106,800174..800641,
                     800738..801046))
                     /codon_start=1
                     /locus_tag="AO090020000322"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000061"
                     /protein_id="BAE63524.1"
                     /transl_table=1
                     /translation="MPAQPPLPPLLAPYVSSLPQSSLTVLSSVLGATGNWLVLRFLYA
                     ALSAPSNSETAFGLNGSEGVKNRKVVLVSFLRGWEFWRSEAKRLVSFYPSMCIFYCGF
                     EGLDLARLTDKRQFAFVDGLSELFYNPTTATATPRPSFPGTAAPRTVLPVRSQPSPVP
                     ARTPQPVPRPGNVSTNPASREIGPVKRLHLSGNGTAALDALERDIATVIKQLKAPIPG
                     EADEPEVLLILDQPDLLLAATGPSKGIGATEMGDWVMGLQQNTHATILTLSSDSPLIH
                     NASASAPQPATPLETEHAAFAIGSAHRAQMVMQLRNLETGAARDVSGVLRVSKGGAWG
                     QNEAGAEGSWEEREVLYFVQRDGGVSVFGRGE"
     exon            complement(799783..800106)
                     /number=1
     exon            complement(800174..800641)
                     /number=2
     exon            complement(800738..801046)
                     /number=3
     CDS             join(802514..802558,802622..802716,802770..802854,
                     802987..803086,803142..803833,803885..804733)
                     /codon_start=1
                     /locus_tag="AO090020000323"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000062"
                     /protein_id="BAE63525.1"
                     /transl_table=1
                     /translation="MTIVQCDECRLRKSKCSKEKPTCAQCRQLNKECKYSPKITRSPL
                     TRQHLTYVEDRLQAFETALGRLFPGGDLDATADGFDWTENKITVGDLTDGMAALSIKP
                     EGTGYFGASSSVVPLRALLKHGFDLNFPVGSAKPNAGPEGVPLKSQLLNSAPSGVIEQ
                     AFIDAFFLNYHRSYPFVHEATFRAQFYEQATRRHGQAWQILLNTILALGAWSVGDDNS
                     DLDITFYQEARGHLQRVSVFETGNLTLVQALLLLSNYAQKRNKPNTGWNFLGLAVRMA
                     MSLGLHKEFPGWKISLLQKEMRRRLWWGVFIFDSGAAKTFGRPILLPEESVMDAKPVL
                     NIQDDALTASTTTLPPEVNGPTIYSGMIAQARFHLLTNSVYQRLISTPPLTPEETRSL
                     QKPLEEWYNGLPDYFKQPSFTSESDPFALVRNRLMWRHWNLRVLLYRPILLRWASRRW
                     TPGSFNEPEDPLEAECRMLCLRNARLTISSISDFMSNYLCTRIGAWYMLYFLFQAGVI
                     PIILLMTDPTSTDAPAWLQDIEATKNLLLHPSLSSNRLAARCLQVINRLCSPAYADTA
                     ADRPAGQPPILMQFPDQLLNDPTFGAMFPDVDQELNLGGMDFSDWVNYTPQAQFP"
     exon            802514..802558
                     /number=1
     exon            802622..802716
                     /number=2
     exon            802770..802854
                     /number=3
     exon            802987..803086
                     /number=4
     exon            803142..803833
                     /number=5
     exon            803885..804733
                     /number=6
     CDS             complement(join(804929..805081,805151..805277,
                     805343..805439,805515..805764,805833..806422,
                     806480..806525,806579..806643,806694..806834,
                     806893..807037,807096..807179))
                     /codon_start=1
                     /locus_tag="AO090020000324"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070329000063"
                     /protein_id="BAE63526.1"
                     /transl_table=1
                     /translation="MESTVIDHSSRGGFALIYQNPYLLGVASFSTLGGLLFGYDQGVV
                     SGVITMESFGARFPRIYTDSSFKGWFVSTLLLAAWFGSLINGPIADRLGRKLSMNVAV
                     VIFVIGSAIQCGAVNIPMLFVGRAIAGLAVGQLTMIVPLYISEVSIPEIRGGLVVLQQ
                     LSITIGILISYWIDYGTNYIGGTRCAPNTPYTGHTKTTPTFNPYTDVPPNGCTGQSEA
                     SWRLPLAIQILPALILGLGIIFFPDSPRWLAMKERDDEALTALSKLRRQTRDSPALVN
                     EFLEIKASIMLENTFARDHFPGLSGLRLHAAQYVSFLTTWARFKRLAIGCCVMFFQQF
                     MGCNAMIYYAPTIFAQLGLDGNTTSLLATGVYGIVNCLSTLPALFLIDKIGRRVLLMS
                     GAVGTCISLVIVGALIGAYGSDLVNHKSAGWAGIAFIYIYDINFSYSFAPIGWVLPSE
                     IFNLSIRSKAISITTSATWMCNFIIGLITPDMLESITWGTYIFFAAFCLLALAFTFFC
                     IPETRGKTLEDMDLIFGDTAAHEEKQRIVQIEAELRGTQGPNKDTLVKPSVQQEEYV"
     exon            complement(804929..805081)
                     /number=1
     exon            complement(805151..805277)
                     /number=2
     exon            complement(805343..805439)
                     /number=3
     exon            complement(805515..805764)
                     /number=4
     exon            complement(805833..806422)
                     /number=5
     exon            complement(806480..806525)
                     /number=6
     exon            complement(806579..806643)
                     /number=7
     exon            complement(806694..806834)
                     /number=8
     exon            complement(806893..807037)
                     /number=9
     exon            complement(807096..807179)
                     /number=10
     CDS             complement(join(811291..811391,811412..811606,
                     811750..811811,811864..812292,812357..812628,
                     812732..813115,813176..813220))
                     /codon_start=1
                     /locus_tag="AO090020000326"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000065"
                     /protein_id="BAE63527.1"
                     /transl_table=1
                     /translation="MDYASADPTFVAKTSALAVTHPFSRIMKGDGNCGWRGDDSCLSE
                     ILYHANSPDVAVAFGYFENLFNLRDTLRVHRELLRIKSMNVLLNQVGQQEHLYEIFVD
                     ATEEIFNQISEAIQNGVRDDSFLVDAFNNEYNSSAIITHFRILTSAWMKLNPHRYQAF
                     LSLPVDQYCATRIETVKTEIDEVGLQALVDGVVEPAGFAVEILYLDRSEGDAVTPHML
                     TPARPSVVTIRLLYRPGHYDLLYQAETTVNMEPVVNYQYAMTSNYTPWDQGALSFDVN
                     SSLMSIPNLMMDPTFGLAPSPIPAAPASPFQVSSPPDVYQPPIHTSPPVPMASPPPPR
                     MSAPPPMSSLPSRSSDGPQIRLNPLVMKPNLSHSLPVTTPFKNSPYNQAHFQNQDFEP
                     IHWEPTPRLSDRRFIKGRPSSPLSTKDLLTVSSTFGTIESSHPHSLPYLFSSSIDLSV
                     SLLLSVCLARCMVLRFRSLQQTLSGWRLFIKFCLSNERKHSCPHV"
     exon            complement(811291..811391)
                     /number=1
     exon            complement(811412..811606)
                     /number=2
     exon            complement(811750..811811)
                     /number=3
     exon            complement(811864..812292)
                     /number=4
     exon            complement(812357..812628)
                     /number=5
     exon            complement(812732..813115)
                     /number=6
     exon            complement(813176..813220)
                     /number=7
     CDS             complement(join(820049..821305,821361..821421,
                     821477..821635,821693..821736))
                     /codon_start=1
                     /locus_tag="AO090020000328"
                     /note="COP9 signalosome, subunit CSN2"
                     /old_locus_tag="AO070329000067"
                     /protein_id="BAE63528.1"
                     /transl_table=1
                     /translation="MSDDDDFMQDSGDEDYDFEYEDADDDESGDIGIENKYYNAKQMK
                     IDNPEEAIDEFLEVPALEQEKGDWGFKGLKQAIKLEFKLGRYSDAVEHYRELLTYVKS
                     AVTRNYSEKSINNMLDYIEKGSDDDKAYQCMEEFYSLTLHSFQNTNNERLWLKTNIKL
                     ARLWLERKEYGQLSKKVRELHRACQREDGSDDPSKGTYLLELYALEIQMYAETKNNKR
                     LKALYQRALRVRSAVPHPKIMGIIRECGGKMHMSEENWEEAQSDFFESFRNYDEAGSM
                     QRIQVLKYLVLTTMLMKSDINPFYSQETKPYKSDPRISAMTDLVDAFQRDDIHAYEAV
                     LSKNPDVLADPFIAENIDEVSRNMRTKAVLKLIAPYTRFTLAFISKHIKISIQEVQDI
                     LSFLILDKKLNAKIDQENGTVVVESTSDVDRLRSLEEWNASLRTLWRATLNDGEGFRT
                     DETSQLHGMRGGPLFQSGFGDEAPPAVGLRAGRRLRTGWKGKGSGHGPKATGAGGY"
     exon            complement(820049..821305)
                     /number=1
     exon            complement(821361..821421)
                     /number=2
     exon            complement(821477..821635)
                     /number=3
     exon            complement(821693..821736)
                     /number=4
     CDS             join(823601..823783,823839..824040,824103..824221)
                     /codon_start=1
                     /locus_tag="AO090020000329"
                     /note="Ras-related small GTPase, Rho type"
                     /old_locus_tag="AO070329000068"
                     /protein_id="BAE63529.1"
                     /transl_table=1
                     /translation="MSTVIAFTPSMSNSYIHTSLDIFVDNVHMELSLWDTAGQEEFDR
                     LRALSYEDTHVIMLCFSVDSPDSFENVASKWVDEISENCPGVKMVLTALKCDLRKDEF
                     ENPNPNAITYEQGLAKAKEIGAVKYLECSAVQNRGIMETFYEAAKVALEVKAQGSNGS
                     KEGCVIL"
     exon            823601..823783
                     /number=1
     exon            823839..824040
                     /number=2
     exon            824103..824221
                     /number=3
     CDS             complement(join(824680..824697,824842..825576))
                     /codon_start=1
                     /locus_tag="AO090020000330"
                     /note="lipoyltransferase"
                     /old_locus_tag="AO070329000069"
                     /protein_id="BAE63530.1"
                     /transl_table=1
                     /translation="MRLAHLHIPDITSFTRVSNLQQTLTTRLLAHKKLIPKDTAPGTT
                     PIQPPDPTIITFTPNPVYTTGRRDLPPSNTSPTAHLSLPPPLEPIRSLLTSANGAEYH
                     PTLRGGQTTYHGPGQMVAYTILDLRRLGLTPRCHIRVLENSVVDVLRGYGIRGLITED
                     PGVWVPPVSGEGVPKKVTAVGVHLRRNISSYGIGFNVTEEPMWWFKQIVACGLEGREA
                     TSLEGQGVSGVEIGEVAERFVSAFLERIMLAS"
     exon            complement(824680..824697)
                     /number=1
     exon            complement(824842..825576)
                     /number=2
     CDS             complement(join(826134..826751,826829..826945))
                     /codon_start=1
                     /locus_tag="AO090020000331"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000070"
                     /protein_id="BAE63531.1"
                     /transl_table=1
                     /translation="MTESLNPPLSYEASATTTHPHVASTLPQEVIACLKNSRFLHLAT
                     CDGLTPHVSLMSYTYLPSTPYDQYPTIIMTTNPSSRKTNHLLTNPRVSLLIHDWVSHR
                     PPTRAPNPGGQRDGSPPPAATRSSLANLLLNLNTSALSSISTTIAGSARVLEPGSEEE
                     AWCKEQHLENNTFEEEMGLFGQQQQQQPGQRRPSISIDDDVRVVTVRVREGRIADWKG
                     GVRDWQVVLEGEDQPAPLVNGTLESQ"
     exon            complement(826134..826751)
                     /number=1
     exon            complement(826829..826945)
                     /number=2
     CDS             join(828198..828867,828950..829434)
                     /codon_start=1
                     /locus_tag="AO090020000332"
                     /note="NIPSNAP1 protein"
                     /old_locus_tag="AO070329000071"
                     /protein_id="BAE63532.1"
                     /transl_table=1
                     /translation="MLAPRILRPVSSLVRPLSSSATAYRAPSIRDITPSSAEEFAARQ
                     KEFRENLEVARKKKVQQESQSVDASASSSPVSRDRFREYATAPTAPGASNASSNYSPA
                     VFDAAQVLDNKALGSLSTHRILGEEQQLEANQLPKRGPLSSLIYGTKEGQQLDKDIER
                     SFSQVLARGKYVHSIVFHEVKPDRVDEYVDLVGQWYPRMAGTEENRVNLVGSWRTQVG
                     DNDTFVHIWEYQRYEGYHASLHNISRHPEFPEFDRKLKSLIKSKKTSLMQEFSFWPTT
                     PPRRLGGLFELRSYTLHPGNLLEWESHWRTGLRARREVMEGVGAWFVQIGDLNTVHHL
                     WQFANLEERKIRREQSWGIEGWAETVHKTVPLIQSMQSRILIPMPWSPVG"
     exon            828198..828867
                     /number=1
     exon            828950..829434
                     /number=2
     CDS             join(830532..830671,830680..830745,830905..830961,
                     831019..831130)
                     /codon_start=1
                     /locus_tag="AO090020000333"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000072"
                     /protein_id="BAE63533.1"
                     /transl_table=1
                     /translation="MVYIRQHQLPKLREYRYAGVDHSLISRYVLKPFYNNVVIKCFPM
                     SMADASSFQPVSGLANSLLALVLTPCAVGLFLYQTFDGVDGIQARRTKQSGPLGELFD
                     HSEANLPLYGKLRLIHVSTYRR"
     exon            830532..830671
                     /number=1
     exon            830680..830745
                     /number=2
     exon            830905..830961
                     /number=3
     exon            831019..831130
                     /number=4
     CDS             join(831278..831937,831992..832114)
                     /codon_start=1
                     /locus_tag="AO090020000334"
                     /note="sn-1,2-diacylglycerol ethanolamine- and
                     cholinephosphotranferases"
                     /old_locus_tag="AO070329000073"
                     /protein_id="BAE63534.1"
                     /transl_table=1
                     /translation="MTFYVQTWDEYYTQVLTLGIISGPVEGVLTLCLVFGLTAYMGGG
                     SFWHQSMLETVGVPKLDAIPEQLYDMPFTQWYLVYGAIVLFFATGSSIVHVMQIRRER
                     GQDPIAPLFGLLPLVAVWVFVPAYLYLQPTILENYMVPFALYVGLVNAYAVGTMITAH
                     LVKSSFPYFNVLLCPLALAVLDSAGPVFGLWPSALGGGDGQVAFVYVCLGLAIGVYGS
                     FIHDIITTICDYIDIWCLTIKHPYVEKQTANGEVDAVEKKMS"
     exon            831278..831937
                     /number=1
     exon            831992..832114
                     /number=2
     CDS             complement(join(835094..835391,835527..835582))
                     /codon_start=1
                     /locus_tag="AO090020000336"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000075"
                     /protein_id="BAE63535.1"
                     /transl_table=1
                     /translation="MTDANTIQTLDTRLGELLAAIESHPMMTSSQPHPTGFYVHDFIR
                     NTHTKLRNIDAQKLQAADPATVKEFQDIRGRNMLAEQLIEGSGPMAQMMLMMGGGPLD
                     FGDAIKQKVRDVNAV"
     exon            complement(835094..835391)
                     /number=1
     exon            complement(835527..835582)
                     /number=2
     CDS             836634..837482
                     /codon_start=1
                     /locus_tag="AO090020000337"
                     /note="phospholipase/carboxyhydrolase"
                     /old_locus_tag="AO070329000076"
                     /protein_id="BAE63536.1"
                     /transl_table=1
                     /translation="MSKQPLKLLMLHGYTQSGPLFHAKSRALIKHLTKAFPLHDVTAT
                     YPTGPLRLNPADIPGYEPTQETPTEPLEAYGWFRRSNTASPPEYLGLEDGLAAVAKVM
                     SEEGPFDGVIGFSQGAAMAAMVVSLLEPGRKEAFARFLDANVASEGKGETDAVVAGVP
                     FPKAFEGLSHPPFKFALCYSGFRSPGARYRGFYESPALQTPILHVLGSLDAVVEESRS
                     RALVEACAGDPEKEGKVVWHPGGHFLPSQRPYLDAAVRFIREQLEGGNKKDAEEEDVN
                     DMDLPF"
     exon            836634..837482
                     /number=1
     CDS             complement(join(837708..838307,838357..838845,
                     838900..839136,839196..839252,839307..839390))
                     /codon_start=1
                     /locus_tag="AO090020000338"
                     /note="26S proteasome regulatory complex, subunit
                     RPN5/PSMD12"
                     /old_locus_tag="AO070329000077"
                     /protein_id="BAE63537.1"
                     /transl_table=1
                     /translation="MADGVLKAEKDFSKDADKLIPEAEQIAKTDAQRAIDSLLGLEKQ
                     ARQASDLPTTSRLLVTIVTLSKNSGDWNLLNDQVLLLSKKHGQLKQAITKMVQVVMGF
                     LDETPNLDVKLSVIQTLRTVTEGKIFVEVERARVTRILSNIKKSQGDLNAAADILCEL
                     QVETFGSMTRREKTEFILEQVALCIERGDWTQATILSRKINKRYFNRKPKKSPEEIAK
                     LKKEAEEREKTRGPDEPPMEVDDDVTDLKLRYYEQQIILSNHDYKYLEVCKHYREVLD
                     TESVENNPEQLRAVLARIIYYIILSPYDNEQSDLLHRIQSDSRISMVPVENRLLKFFT
                     IHELMRWPAIGQQFGPHLCNTDVFSPKPSQSADDQPFKRWQDLRKRVIEHNVRVVAKY
                     YTRIQMGRLTQLLDLTEEETEKYISELVTSKTIYAKIDRPARLINFAKPRDADDVLNE
                     WSSDMKSLLGLLERIDHLITKEEMMARILPTREKGKAR"
     exon            complement(837708..838307)
                     /number=1
     exon            complement(838357..838845)
                     /number=2
     exon            complement(838900..839136)
                     /number=3
     exon            complement(839196..839252)
                     /number=4
     exon            complement(839307..839390)
                     /number=5
     CDS             join(840420..840744,840797..842148)
                     /codon_start=1
                     /locus_tag="AO090020000339"
                     /note="uroporphyrin III methyltransferase"
                     /old_locus_tag="AO070329000078"
                     /protein_id="BAE63538.1"
                     /transl_table=1
                     /translation="MKDASCDNGSPAPLLTAVYAESQVHLIIGGNPLAAARCAKSLEA
                     GAKPVIIAPDTGDLHFSLSERIENGSVQWVRREFQDDDLKTLGREEVDHVVDTVFVTL
                     GGNHPLSAHISKLCRRLRIPVNVSDAPELCTFSLLSTYSDGPLHIGITTSGRGCKLAS
                     RLRREISSSLPSNLGTAIDRLGAVRRRLWAEDYAAGLCTAPLEGDEDDITGQSHTFNK
                     LVTEDDISAAKTRRIRWLSQICEYWPLQKLAAISDADIDAILQAYSSGKNSLDSTNGL
                     GHLEKKGKIVLAGSGPGHPDMLTRATYNAIQNADIILADKLVPEPVLKLIPRRTEVHI
                     ARKFPGNADQAQEEFLQMGLDSLRRGRYVLRLKQGDPYLYGRGGEEFEFFRGEGYTPV
                     VLPGITSALSASLFAEIPATHRGVSDQVLICTGTGRKGAAPEPPTYVPTQTVVFLMAL
                     HRLSALVESLTTPPQEGSRPRTPWPKDTPCAIIERASCTDQRVIRSTLENVCLAFEAE
                     GSRPPGLLVVGASCHILHPRKDEKWTVEEGFRGLDDLRGEIVPENDQKHD"
     exon            840420..840744
                     /number=1
     exon            840797..842148
                     /number=2
     CDS             join(842545..842808,842930..843136)
                     /codon_start=1
                     /locus_tag="AO090020000340"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000079"
                     /protein_id="BAE63539.1"
                     /transl_table=1
                     /translation="MNATYHHSITVINRTNNVWSLLHHVVKTANLPVQWTGSGKVWRQ
                     PLYALDDNSLTVPYHLSPPLWVRINRLIENIYIFFGLYFVSLFSLDPYTAAQNSQFNI
                     NRSQNHPNTRARWGGSGGSGSGGGGGGGGGPGGFGPRRIGRVDDIRGPECKSCR"
     exon            842545..842808
                     /number=1
     exon            842930..843136
                     /number=2
     CDS             join(843571..844363,844467..844480,844552..844589,
                     844701..844779,844848..844996,845086..846172)
                     /codon_start=1
                     /locus_tag="AO090020000341"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070329000080"
                     /protein_id="BAE63540.1"
                     /transl_table=1
                     /translation="MSPPKNDAEWAALISTIKDSLPEAFPEYKTPLPSEVNRTIDHTQ
                     LALTATEQQIDQLCAEALQYQFATVCVRLNHVRRAVQELKGSSDVKVACVVGFHEGMY
                     ETSEKEQEARDAVEQGAAELDMVLKYPLLKEGKYTDVYTDILGVRKAAPSPIKLKVIL
                     ETSQLSREEIIAGSVIADVAGADFIKTSTGFNGPGANIDNVALMRATAGLVGNGCKVK
                     ASGGVRSAEDCIRMLKTGAERIGTSSGVKIMQELKGEAVGEQGAQQAVPDPAVETDVI
                     KNHPYRLPSYSVPKPPLSPRLRPKMRRPNVPKKRKTSHDHGQLDNGGHSNYVFTSKPT
                     AVFTPTGGRSHTLTVAIPGSIVANAHSVEQKTLLAGIIARALAVFCVDEVVVFDDDEN
                     SPRDTYHGQGNYHEFPIDKTSGALNGNDSSAKRYTAYSDPSNFLAHILSYLETPPYLR
                     KHLFPMHPNLRGAGLLPSLDMPHHLRANEWCEYREGIVVSSSDGGGQRRHSTQMSNYH
                     NNRRHSPSSPTNFSATVIDTGLPKKVVLPDIQLPEYARVTVRFPDYGREHYAQPVHPS
                     TPRSEAGYYWGYYVRRCRSLSSVFTECPFDGGYDLSFGTSERGAPVYSVLEEDRQEHD
                     NYDRRKIPPDYKHLLIVFGGVAGIEAVVHNDPQLCDMDIRATEAGKLFDYWVNLLPGQ
                     GSRTIRTEEAVWLGLTSLWGLVEGTHRPRPSYKSSNF"
     exon            843571..844363
                     /number=1
     exon            844467..844480
                     /number=2
     exon            844552..844589
                     /number=3
     exon            844701..844779
                     /number=4
     exon            844848..844996
                     /number=5
     exon            845086..846172
                     /number=6
     CDS             complement(join(846942..848339,848424..848771))
                     /codon_start=1
                     /locus_tag="AO090020000342"
                     /note="WD40 repeat protein"
                     /old_locus_tag="AO070329000081"
                     /protein_id="BAE63541.1"
                     /transl_table=1
                     /translation="MLSECFIAATLTSGKAPASASLRDVGICVHEFQPSPNLRSTFKK
                     SSTPTNCLAVSPSHVYAAQAEKAIVHVYSREKGNQEAVIPFPERIRSLAIAGSKNGDV
                     LVLGTEGGRLILWETCTGRQVATTASHLSPVTSLVVDPSDNFILSGSSDASIHVWPLV
                     DILSFTKIPSGRDRQPPNCPIRTFSNHRAAITSLAVGHSSGRYNIAVSTAQDNTAIAW
                     DYHTGRVLRTFLLPSSAVSLTLDPVDRAFYVGYEDGSIQSVDLYKAQSFQHPLHDPSL
                     QSTPAQPSAEEKWSPPSADCGAAQSLSLSYDGMTLLSGHQNGKVLSWNVGRKKYATTV
                     ADYTHPVTNLHMLPLAGLPNPGQDLKRVAHTIVKPRYDSSLSESSQAAGAVPADYTFS
                     THLLNSTSSKPAAARNLDGSDRTNQFTEAFTSAVFPNSMIEEGLAELAAFNQPGGSTA
                     QGSPMMTQATNYEDLAAKDSQIASLESELAALKKKTTANEAARQLTTDEVTKLRSDLA
                     NLNDYVNGLHQKQDQAQREKVLRQARKEERETRKREAWFKAEKKGKKGDAVVRRMEAE
                     EAMQTSDSDDQSSDE"
     exon            complement(846942..848339)
                     /number=1
     exon            complement(848424..848771)
                     /number=2
     CDS             851196..851957
                     /codon_start=1
                     /locus_tag="AO090020000343"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000082"
                     /protein_id="BAE63542.1"
                     /transl_table=1
                     /translation="MSDSGYATTDPSCDSPGDPKPDKEDEFIHVSSVGSNNETTIRDK
                     PMRKVTSSPKSPPRPDVAQKANSPPKPRRSAPSSDTAENGELKKWWDHEWAMDQLEHS
                     IKEFPRSMLRLTSPVIILIRHTDEKDILRRFRQIFPDAADNLLDGLCAALIARNYVLS
                     LASSKRKIANHCHRPTLSRLDTVPERASAMLGTPLAPSSPSRIRDRVLGSRSGELNKS
                     LDRMIDDLLFAICRKHDATLKSAVLVLAQVLETKA"
     exon            851196..851957
                     /number=1
     CDS             852581..853828
                     /codon_start=1
                     /locus_tag="AO090020000344"
                     /note="lipoate synthase"
                     /old_locus_tag="AO070329000083"
                     /protein_id="BAE63543.1"
                     /transl_table=1
                     /translation="MAASTNRLRFLYSSARTVPQTGSITPISRRTYATTEPSPSATGA
                     PATARKRTNFTDKLNAGPSFADFVSGGEDNAPLEPSEAYALKTAMVGPAGRKKEMTRL
                     PSWLKTPIPDSKNYQRLKKDLRGLNLHTVCEEARCPNISDCWGGSDKSAATATIMLMG
                     DTCTRGCRFCSVKTNRRPPPLDPHEPENTAEAISRWSLGYVVLTSVDRDDLADGGARH
                     FAETVIKIKQKKPSMLVECLTGDYLGDLEMVKLVARSGLDVYAHNVETVEALTPFVRD
                     RRATFQQSLRVLEAAKQARPDLITKTSLMLGFGETEEQLWDALRQLRSVGVDVVTFGQ
                     YMRPTKRHMPVHEYVTPDQFELWRQRALDMGFLYCASGPLVRSSYKAGEAFIENVLKK
                     RRAAGTAGESVTDSKAAVDEATR"
     exon            852581..853828
                     /number=1
     CDS             complement(join(854407..854730,854819..855076,
                     855155..855979))
                     /codon_start=1
                     /locus_tag="AO090020000345"
                     /note="phosphoserine phosphatase"
                     /old_locus_tag="AO070329000084"
                     /protein_id="BAE63544.1"
                     /transl_table=1
                     /translation="MAANNPTTRPQRPTLQESLRSNSFLHDHQQYKPAVPISSIGNVL
                     ESSLESGVGSLSLNPISPDPEKVTESGITHSLFNHQVNPLPTGTPQIVATIYYKSSDP
                     IHPHLHPDSSFNAGAGVKLPSPTVPVGSAPTVDIEKIPREPPAPEPEPLDHLYGPFVS
                     QLCLTNFLQILESLPTPYQRMNTSHRCLDQNEHPRVVEVTFSPPPNPEYLTFADLRKH
                     ESIWRFEREWNVEVVLQEESVFRRHKRLVVFDMDSTLIQNEVIDEIAKFIGVEKEVSE
                     ITERAMNGELDFSASLRERVSLLKGVPADVFEKLKSVITISPGARELCKALKALGCKL
                     AVLSGGFQPLAEWLAGELGIDYAFANHLEVDPASQTLTGKLVPTYPIIDASQKRKLLQ
                     SIAAENNIPIAQTAAVGDGANDLLMLHTAGLGVAWRAKSKVQLEAPTRLNGETMVDIL
                     HLLGLSKEDVKELTTEVA"
     exon            complement(854407..854730)
                     /number=1
     exon            complement(854819..855076)
                     /number=2
     exon            complement(855155..855979)
                     /number=3
     CDS             join(857066..857246,857306..858051)
                     /codon_start=1
                     /locus_tag="AO090020000347"
                     /note="phosphoadenosine phosphosulfate reductase"
                     /old_locus_tag="AO070329000086"
                     /protein_id="BAE63545.1"
                     /transl_table=1
                     /translation="MPAKMPDTYPSHAEDFESKDNATDSDYVSGSSSDDYLPEIVFTK
                     PHLQFLNRQLQFLEPQDVLRWCVTSLPHLFQTTAFGLTGLVTLDMLSKLEVPRPQMVD
                     LIFLDTLHHFSETLTLVDKIRQKYPLNNIHVYKPKGLNSEEEFAKKYGARLWERDDQL
                     YDWAAKVEPAQRAYRELNVHAVLTGRRRSQGGKRGDLDIIEVDEAGLIKINPLANWTF
                     DQVKQYIKDNDVPYNELLDRGYKSIGDYHSTQPVKENEDERSGRWKGQAKTECGIHNP
                     RSKYAQYLMELERKRQEEALSQALQNQMTTAQ"
     exon            857066..857246
                     /number=1
     exon            857306..858051
                     /number=2
     CDS             join(859181..859368,859415..860216,860270..860566)
                     /codon_start=1
                     /locus_tag="AO090020000348"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000087"
                     /protein_id="BAE63546.1"
                     /transl_table=1
                     /translation="MSQTENIHVISKKDNSQHAVVSIDNPSSGTRQLPPSSVRVRPLI
                     LSLSSNNLSYARAGELLHWWDTYPVPSEAPAPYNDQSAWGIVPAWGYATVLESTTDIA
                     PGSTLWGFWPTSGLPTELTLIPGQPRGHWTEVSEHRKHLMTYYNRYEVVSEDDRDTMA
                     WTAAIRAIWGAGYLLSEYVFSSTGTPVHPYGGAAGLSWTTEDADLSSAVVVNLAASTK
                     TARSFTYNLLCRPAGSGPLGVLQITSSPEALERAAELQIAKRQTPAGPVKALAYSDVD
                     RAVPWLVGLKPAKLVIIDYGARDNVLVRLRELVQSNEALKDCKVVIIQVGSQQKVYTE
                     EEVREAYASMKALGKIQSNASTTRDTAIELDGPEAFFDRMDLRWKQWLDDRAATVPDM
                     RLVWGKGVAGTEGMYGGWERLTKGDVRPEEALVYMV"
     exon            859181..859368
                     /number=1
     exon            859415..860216
                     /number=2
     exon            860270..860566
                     /number=3
     CDS             join(862535..862703,862816..862843,862993..863175,
                     863265..863410,863469..863538,863600..864725)
                     /codon_start=1
                     /locus_tag="AO090020000349"
                     /note="ATP sulfurylase (sulfate adenylyltransferase)"
                     /old_locus_tag="AO070329000088"
                     /protein_id="BAE63547.1"
                     /transl_table=1
                     /translation="MANSPHGGVLKDLLARDAPRHDQLAAEAESLPAIVLSERQLCDL
                     ELIMNGGFSPLEGFMNQKDFDGVCENCRLADGNLFSMPITLDASQQVINELKLQAGSR
                     VTLRDFRDDRNLAILTIDDIYRADKEKEAKLVFGGDPEHPAIKYLNTKVEEFYIGGKI
                     EAVNKLNHYDYVALRYTPAELRIHFDKLGWSRVVAFQTRNPMHRAHRELTVRAARARA
                     ANVLIHPVVGLTKPGDIDHFTRVRAYQALLPRYPNGMAVLGLLGLAMRMGGPREAIWH
                     AIIRKNHGATHFIVGRDHAGPGKNSKGEEFYGPYDAQHAVEKYKDELGIEVVEFQQVT
                     YLPDTDEYKPKDEVPAGVKTLDISGTELRNRLRTGAHIPEWFSYPEVVKILRESSPPR
                     HTQGFTVFLTGYQNSGKDAIARALQVTLNQQGGRAVSLLLGDTVRHELSSELGFSRED
                     RHTNIQRIAFVASELTKAGAAVIAAPIAPYEHSRKAAREAVSQHGSFFLVHVNTPLEY
                     CEKTDKRGIYAKARAGEIKGFTGVDDPYEAPENAHLTVDVSKQSVRSIVHEIILLLET
                     EGFFDRA"
     exon            862535..862703
                     /number=1
     exon            862816..862843
                     /number=2
     exon            862993..863175
                     /number=3
     exon            863265..863410
                     /number=4
     exon            863469..863538
                     /number=5
     exon            863600..864725
                     /number=6
     CDS             865149..866903
                     /codon_start=1
                     /locus_tag="AO090020000350"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000089"
                     /protein_id="BAE63548.1"
                     /transl_table=1
                     /translation="MLPRRLPSRLPGAIRATRIPVHHSLRHPSRPFTQKSRLELVTPP
                     YVRPQLPFLSPLASSRPVPPLSIHLRQHFARLISTESREHYKQRLYRGLRIGLSFYAI
                     LVLFQVIKLGVYQEEIEHQWPTPPEWSWKSRWCLRSAQALQHPEDIGKLMTNWPMVAG
                     YLKELLERLEDPVGEGKGIVEQGDGGFLVEGVGKTGFDVSSKSEPWRRGYFQALMGAA
                     KAAENLEGWLTDRKQRISAPAEYVVGPSNPRPKPMPAGQKKVPREEDCEQASPSPEVF
                     YMKILTTRGFDTRQKLDAALAYADWLDYKGLQDTASDMYNWAMDIAASGSPVDAGKVV
                     DVKTGVLKNDGKALPSENILRVSTALAVYHARHNNLPTALSIFTSVLKARRSLPPPPP
                     GTIMPKLPSLHKSKDPFRYLFDSIKIILVPVEYPAPLPSGNEPPLRTATSACDEAGLM
                     TYIGEIIYASSSKKKGLAWTRDAVDTAEATMLELGESDRIPRHRCAECLRVGLENWKT
                     MVSRLVAKAEKEEQESIQNAGRSWFGGQKQIEAKSVERKRWEAENLILDDRIRRLWPM
                     IDGESGLEGIAPNSSLFV"
     exon            865149..866903
                     /number=1
     CDS             join(867989..868166,868229..868374,868437..868857,
                     868915..869637,869704..869801)
                     /codon_start=1
                     /locus_tag="AO090020000351"
                     /note="serine carboxypeptidases (lysosomal cathepsin A)"
                     /old_locus_tag="AO070329000090"
                     /protein_id="BAE63549.1"
                     /transl_table=1
                     /translation="MRAATAIASLLLVGSVVGLENPHRKAKAVQRAHQHKTVLPRAVP
                     VAREDDYKYLTNKTERFLVNGTGIPEVDFDVGESYAGLLPNSPAGNSSLFFWFFPSQN
                     PKAQDEITIWLNGGPGCSSLDGLLQENGPFLWLPGTYKPARNPYSWTNLTNVVYIDQP
                     AGTGFSPGPSTVDDEEGVAAQFKSWFKHFVDTFGLHGHKVYLTGESYAGQYIPYIASA
                     MLDEEDEKYFNVKGIQINDPSINDDSVMIYAPAVRHLNHYTNVFALNDTFLADVNSRA
                     DKCGFNKFLDEALTYPPPKDFPVLPEISSECAIWDDIVAAAYDVNPCFNYYHLTDYCP
                     YLWSEMGFPSLAGGPNNYFNRTDVQKALHVPRTDYSVCGETTIFKNGDQSPPSALGPL
                     PSVIERTNNTIIGHGWLDYLLFLNGSLVTIQNMTWNGAQGFQKPPVEPLYVPYHYGLA
                     ELANGNAPEPFTLIAGAGLLGTAHTERGLTFSSVYLAGHEIPQYVPGAAYRQLEFLLG
                     RIENLQQRGGYTA"
     exon            867989..868166
                     /number=1
     exon            868229..868374
                     /number=2
     exon            868437..868857
                     /number=3
     exon            868915..869637
                     /number=4
     exon            869704..869801
                     /number=5
     CDS             complement(join(870541..870546,870760..871125,
                     871316..872683))
                     /codon_start=1
                     /locus_tag="AO090020000352"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000091"
                     /protein_id="BAE63550.1"
                     /transl_table=1
                     /translation="MRLIHTERLQLEEFADEIPPYAVLSHRWGKDEVTFQDILLNQNH
                     DTEGYRKVENICKVANQDGFEYAWIDTCCINKESSAELSEAINSMFRWYESAGRCYAY
                     LRDVSPDNNQSDLSTKVRNSVYFKRGWTLQELIAPSDVRFLADDWSEIGSRESWCTLI
                     HSITNIDESILRGSAQLSDFSIARRMSWASGRKTTRVEDIAYCLMGIFHVNMPLLYGE
                     GEKAFIRLQEEIMRESADQTLFAWGARESFDRSATGLLARSPADFKHSGDFVPFYFSK
                     KDSAPFSITNRGIKLHLPLYHSLVVKDVLILECQDTSLDYIALAGIYLLPSHGGQLQY
                     MRYNSGPSRVPLWRIRHVKAQTIYVMKTSIGEGGSSLLHERKPYRYTESRLRGEISQS
                     GERPKKVILCFDGGNHKHGANHQSNIEKIHKMLYGTNGSQLCYYQRANFSRPDDFKTC
                     MGDGYSAAWDIYQSWNNYALRTDADKLWEERESYFQMKGFREKLSKPTNRIPFLGLFD
                     AVVVKSKYLGREGERISTTTEISKSASTICHAVSIDECRAELRPVLLNEELGSGLLMK
                     GLKQVWFPGSHAI"
     exon            complement(870541..870546)
                     /number=1
     exon            complement(870760..871125)
                     /number=2
     exon            complement(871316..872683)
                     /number=3
     CDS             complement(join(875768..876520,876583..877275,
                     877326..877472))
                     /codon_start=1
                     /locus_tag="AO090020000354"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070329000093"
                     /protein_id="BAE63551.1"
                     /transl_table=1
                     /translation="MSAMEQEDKHPSPDVRIATGSDQSSEYSKRNDNGIVLIPQPSDD
                     PEDPLNWPMRKKIIIFASICLAGFAGQMSPNSNQLTFVYQIPAYHKTQTDLLNSVAAG
                     LAGWVAGPFFIIPLVAVIGRSSVVLWSLVAIFACQIWAAEMTGANDYISFTISRLFCG
                     TFGGIPAILGSGYIMDMFYLHQRGKAFAIFEVLIIFAVVGGGTLGGFIAEHKPWNYVF
                     WWTLGPVGAAVLAVFFFVEDTTFPRDPSMPKRAPLPKGWFANRIATFLPGTKTQPSGK
                     GREFYPQVRKAITPLQITFTPITLLTGTYIFIALGLPIMQASTLATYLERPEEAGGYG
                     FSSLQMAFFTMTAWVGIISAQVYGFFFNDKTPLWLARRRGGTWHTEYRLANTILPSII
                     LPIGLGIYGAGLEYHLHFMVLALGSFLIWFGALLALPVCYNYIIECFLNNPVEASVSL
                     NAYRVSFGLMSVFIVTQWQSSVGVGWMWGMGAFLIVFVDLIMAGIILKGHLVRKWTAT
                     LGSSLDVTEDGANISAKKEGGV"
     exon            complement(875768..876520)
                     /number=1
     exon            complement(876583..877275)
                     /number=2
     exon            complement(877326..877472)
                     /number=3
     CDS             complement(join(878854..878975,879027..879240))
                     /codon_start=1
                     /locus_tag="AO090020000355"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000094"
                     /protein_id="BAE63552.1"
                     /transl_table=1
                     /translation="MLWLTVVVLSLTSKKWRVFFWCFIAFNTITSVLDAAVIFPQCTP
                     VELNWDKSVEGHCWSANAIDAIGITQGAIAASTDFALSILPIVFLWNIKLPKRVKVGI
                     CGIMALGFA"
     exon            complement(878854..878975)
                     /number=1
     exon            complement(879027..879240)
                     /number=2
     CDS             join(880640..881491,881550..881981)
                     /codon_start=1
                     /locus_tag="AO090020000356"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000095"
                     /protein_id="BAE63553.1"
                     /transl_table=1
                     /translation="MGSVESSKDFTVTIVGGGIGGLVLAAGLLRRKVPVQIYEAASAF
                     AEIGLGLSIGPAAHRAMPLIDPQIREIYDSLVTTHADSPGFEHFRQTWFEIVWASGDR
                     EGETLMNLKALPSGQTTLRRADFLDALVNLIPPEIVQFGKRLDSLEETAEGVSLRFDD
                     GTTAVADVVVGCDGIKSKVKESMLPEESREKQPQYSGMYGYRAVLDMDEMVEAVGEQR
                     ARVSTMYVGNGAYGISYPIMRAKKVNFGLYILSEKWDCDTWVRPAKREEMRQDASNMG
                     RYVNALIERMPDPSQWAIFEHPHISTYSRSKVAILGDAAHASTPHQGAGAGQAIEDAH
                     VLAELLGDARVTKPEDVVAAFKAYDEVRRPRSQRVVTSSKENAYLLCLCLDGVGDDEE
                     KLKDTWNQRLRWLWDLDIQEQAEEARKKMVEHMRA"
     exon            880640..881491
                     /number=1
     exon            881550..881981
                     /number=2
     CDS             complement(join(883469..884812,884883..885080))
                     /codon_start=1
                     /locus_tag="AO090020000357"
                     /note="cytochrome P450"
                     /old_locus_tag="AO070329000096"
                     /protein_id="BAE63554.1"
                     /transl_table=1
                     /translation="MSWPRIGAYALLAFVAIMALNVTYQFLFRMLNKTRPPLVFHWIP
                     FIGSTIHYGTDPYGFFFSCREKYGDIFTFILLGRPTTVYLGTQGNEFILNGKLKDVNA
                     EEVYSPLTTPVFGSDVVYDCPNSKLIEQKKFIKFGLSQAALEAHVPLIEKEVEDYLAM
                     SPNFHGTSGEVDIPAAMAEITIFTAGSALQGEEVRSKLTTEFAVLYHDLDKGFTPINF
                     MLPWAPLPHNKKRDAAHARMRAIYIDIINKRRNAGDNVPEKLDMIGNLMQCTYKNGQP
                     LPDKEIAHIMITLLMAGQHSSSSISSWIMLRLASQPAVVEELYQEQLANLERTGPNGS
                     LAPLQYKDFDNLPLHQNVIRETLRLHSSIHSLLRKVKNPLPVPGTPYVIPTSHVLLAA
                     PGVTALSDEYFPNAMAWDPHRWETQAPQENNKDDIVDYGYGAMSKGTSSPYLPFGAGR
                     HRCIGEKFAYLNLAVIVATMVRHLRFSNLDGQTGVPDTDYSSLFSGPMKPARIRWERR
                     AAKSG"
     exon            complement(883469..884812)
                     /number=1
     exon            complement(884883..885080)
                     /number=2
     CDS             complement(join(886477..889948,889985..890973))
                     /codon_start=1
                     /locus_tag="AO090020000360"
                     /note="ankyrin"
                     /old_locus_tag="AO070329000099"
                     /protein_id="BAE63555.1"
                     /transl_table=1
                     /translation="MSSPRRHQDYAIGWICPLPVEQTVALLMLDETHDRLPQQPADQN
                     IYTLGSIDDHNIVIAGLHQPGNSPAATVVTQMRNTFPNIHYVLLVGIGGGVPVRTESD
                     WVRLGDVVVCKPIGEYPGVVQYDTDKAEVGQFKRIGALPPPPVVLLQAAQDMEVKRSL
                     LKTQDDPIAKCLQRIPSDIPALKKYLYPGFATDRLYHNDYIHKQPGVPCDECKCDLSR
                     LRRREDPKNTNPKYIRVHRGVIASGGMVIKDANQRDNLAGKYGVLCFETEAAGTLADL
                     PALVIRGIADYCDSHKNDLWHGYAAATAAAYARQLILHMPTYSRLRSVCATWTYDDMS
                     PNSPVANTASPSQIAPLAHLFQQMQTLRLTASRLKPSISDRRKELVAWIGGTVTDDEY
                     HAALSAQIPGTCRWILQRTQFKAWAALTSEVSKVLWIRGGPGCGKTILTASIIRHVTS
                     LHSTRSIPAAYFFCRDEDDRKRDLNEIARSWVQQIVNKMDDAVSMVYPLCEQNKSRAA
                     TMMEIWDILYRVCHGIHNCMLFLDGLDECVISGDPWHQDKASFLARLWRTISGTTARV
                     LISSRSDTEIHSQFLSASQDTITFLEHNIAIEDTAQDIIDYSTSIVNERLGVNKDQDF
                     ISEISKDVARKCDGMFLWVRLMGKQLFPGKNKNQIRRTLDSMPQGLEQTYRREIHSII
                     NLGISEKTWAIGILRWTYFAARPLTVRELTEALLTETNTLTTFPFHEMPDTWDEYYVN
                     DQIRRYCQSLIDIRGSPAASITTHTVHFIHTSVKEFLSQTSMCAMDQGFSFSEVAKEH
                     ELLARTCLTYLCLDDVAVDDPYDLRTLQDIKETFQFLEYASLCWYDHMSRSENGHWRL
                     EQFIRVLFDPSSTRWMMWSEMISQNLWPGSTLHPIKEHNGPTPLPIVSCLGLLDTVKW
                     LLSLGSDIDATVGRFGSTLHSAAARCQKNTAQFLLENGADRNKQGGMYGYPIVAAAAA
                     AKYNPRESADIVDMLLKAGADISCRDQTGCSALHHTAAVGSEETLSILLRNGATVDDH
                     NGRQRTPLFFAAAHGHKLITELLIQRGAEVSTRDVHNRTPLFAAIQNGHIPIVEVLTK
                     HGVDVRTQDNDGLTPLHIAVELGHSQMVDLLLRHGADANAADKDGETPVYVAALGGHN
                     TILQNLIRHQGQVNCKDSLEAWTPLHAACAEAKEATTVQLLLDNGAEVDAADSHGATP
                     LFYAAENGSPAIIELLIQYGAQVNATKEDGLTPIHAALGGVQPLAVEALLKHGGCNLT
                     SDDCVSLRGNSPLMVAIMKEEYHPVVQPLVRAGVWVNSRNTAGLAPIHLATLVGDVGI
                     LELLLENNAAVNALADKGFTPLHLAVSEGKRDIIQLLIDSNAAINALTDEGLTPLHVA
                     VMGGKRDIVQLLLDNGADVNAEKNGITPIYRAIHNKDELITTSLIRHGAEVDAPLALA
                     IKQGDEDIVRFILQHGPEIGPEYLIYGNRSGHDHILQLMVEHFLAKDAID"
     exon            complement(886477..889948)
                     /number=1
     exon            complement(889985..890973)
                     /number=2
     CDS             complement(join(892122..893464,893524..893988,
                     894419..894893,894954..895382))
                     /codon_start=1
                     /locus_tag="AO090020000361"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000100"
                     /protein_id="BAE63556.1"
                     /transl_table=1
                     /translation="MVRLEPLLLLHAADVLAASSSGLSSLGTFENPSVRSRPRFRYWL
                     PDAGVDKEIVSTNIKDSGARGAGGVEFVPFYNYGGEAGDPPPQADWVTNGFGTPAFRG
                     VFRAALQAHKDAGLLMDFALGPNQGQGVPASSDDPGLQWDLVPYSVPISSNETFQGPI
                     PGWGTGELVAVVSARVLSQTNISLPEIDSPFLTAQSGYLSLVLEHESLTDITDQVSED
                     GQLSIRFPTYSNGFGHRIFAYYKKRTLNRNLHFTNNATATIWDNGSFAVDHYSSRGAQ
                     TVIDFWENHILIDGIKELLMEVGHYDAPECESLQFGDSVDAYRQFSGPALLAGKSVIS
                     NEMGATMAAYGYPFRSLLFSVGRAIVGGVNQLVLHGQSYTGDYYETTWPGYTAFSYST
                     SELYSNKQPSWDHGLSDVLNFFARVQYTQRQGIPRVDVAIYNKVSATDAAAFPSMYQA
                     DDLVDEGWSWAYLSPDNFALPGATVENSTLGPDGPRFKALVVESDSNMTLSGLDNIRE
                     YATQGLPIILSGGLPGIFPSANASESAAIEAGLTHLSTSANVHLVRRGGVAEKLSALG
                     LSPHIQVQTDGKWLTTWREDSSSGIDYALIFCDSNTSSGYITVTGSAKDKVPLYLNAW
                     TGARSPVFTYNVTDHALTLPVSLQGNQTMIIAFSPRGLNESGEPKTHAIETPPSVIGA
                     TYDQRDGWVAHVANQGSDTTHERIHLSSDRYIELPQHQRTASPFNLTNWQLVAEHWEA
                     PTNLSDAKTIARKHNTTHELTTLVSWSQIPILRNASGLGYYSTTFQWPPTTHRRDNGT
                     ADGAYIVFPSILHAIQLSINGHRVPPLDYTDAKADISQYLKAGTNEVLAVVPTTMWNY
                     IRSILPEIRDQGHLPGLLVEGLPVPGISENGLVEEVSVIPYSKLVIR"
     exon            complement(892122..893464)
                     /number=1
     exon            complement(893524..893988)
                     /number=2
     exon            complement(894419..894893)
                     /number=3
     exon            complement(894954..895382)
                     /number=4
     CDS             complement(join(895984..896151,896322..896604,
                     896837..897687))
                     /codon_start=1
                     /locus_tag="AO090020000362"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000101"
                     /protein_id="BAE63557.1"
                     /transl_table=1
                     /translation="MSYDYTVASMEPGLPPVDELHRLIELFFKVYHPIYPFLDRGMIR
                     LLVSESSDMSQRSARSRRVSKTSRLMLLYLITILGTMAGPTVFQQHLNTYLSYCHTLV
                     GHLILQPSIESVQALLLFSITLRLRDQLSQAWDVLTLAISMSQTLRLAHLSAHLRTIH
                     DKGSGSNMNPMRTWWALYVFEKFLAFDSGRQSTLDDPRLSSVGRQDPTEPMNNEKALV
                     LQDYENFLTSLANVLREMQHRSWHTWRTESLDTTSDADARASKIRTAGAIDTLLWEWR
                     GSLPSEYQVIVLYRNTLLLDWSEVKREVDRYGSGEPWHLRLRNGPQICLEAAKGMTNL
                     QVMVTEADEPSFLVLGTSPLAAAYVLAVHIRRQPATILSRTHFELLSDMALQSSVEFS
                     TDPVENHLTPMTIPNPLESPPLSWGSFDLLSWDWNDLVPQT"
     exon            complement(895984..896151)
                     /number=1
     exon            complement(896322..896604)
                     /number=2
     exon            complement(896837..897687)
                     /number=3
     CDS             complement(join(898409..898952,899008..899494,
                     899546..899594))
                     /codon_start=1
                     /locus_tag="AO090020000363"
                     /note="predicted dehydrogenases and related proteins"
                     /old_locus_tag="AO070329000102"
                     /protein_id="BAE63558.1"
                     /transl_table=1
                     /translation="MSIGVALLGAGIFAKKEHLPAIESCPSLSLKAVYSRSQTSAESF
                     AAAAGEDIEAYFESPSVQSKSLDDLLQRQDIVAVIIAVAITAAPDLIQKALAAGKHVL
                     SEKPIAPDVETAQRLMDYYHGQTKSGVLWGVGENFRFWDPVQKAARILTEMGGSLVTF
                     SVTAYSFTDSKNPFYHTDWRQKPTFQGGYLLDGGVHFAAVLRTLLAALGQRVDVVSAY
                     TTSLQEDLPPLDTVHAILRTNKGGSGTYTSSVGIQAKRGMEFEIVTDKGYVTYRPFQM
                     EILVKQDQGGNWEERSEPAPLMWGVKEEIAAFATSISTGRLDSRLSTTEALEDLKIVE
                     AMLRSGDAQALPVDITSTFRTYSIS"
     exon            complement(898409..898952)
                     /number=1
     exon            complement(899008..899494)
                     /number=2
     exon            complement(899546..899594)
                     /number=3
     CDS             900431..902176
                     /codon_start=1
                     /locus_tag="AO090020000364"
                     /note="predicted acyl esterases"
                     /old_locus_tag="AO070329000103"
                     /protein_id="BAE63559.1"
                     /transl_table=1
                     /translation="MKEFKDVQVIYKPLSQPKIGLGYQGFNPRTEILPKGWSNEGKRP
                     LTCDILVEHDVGYKVRDGVTLYADVLRPPTGRVPAIVCWSPFGKKFNGSDALNLMAPY
                     NLGLRDDALSGLEKFEAPDPAFWVEKGYAIVNVDNRGSFDSEGSCAVLGTQEGEDGHD
                     VIECIAQEPWCTGNIGMAGNSHLAQSQWFIAAQQPPSLKAIAPWEGCADMYRETFVRG
                     GIYCGDLFDELISKYVIHGREIEGIRAMFDKYPLANDYWNDKRAEIEKIDIPTYITGT
                     WSNTMHGMGAIRGWLKVKTSNKWLRFHPYQEWYDLWGCPESTQELLQFFDRYLKGLDN
                     NWESTPRVRMALLKFGQTPSIGGIVEQDFPIPNAEYKKAYLESNERLALNKPINSLIL
                     SYDATSQAGFLKFRYTFDKTTRIMGMPKAVLYMSCQEHDDMDVFVILRKVSSTGEPML
                     CLNVPWEGLPVKSFHEIPEKLRTEVILYKGPTGILRASQRAIDHDKSMHPNWPFHPHD
                     REERIPPGQIIKLEIGIWATGIEFQAGESIQFEIAGHFRGVSNFGRPEHVKNKGRHIV
                     HIGGGHDSHVLLPFC"
     exon            900431..902176
                     /number=1
     CDS             join(902951..903425,903434..903904,904025..904064,
                     904177..904266,904299..904516,904558..905205,
                     905260..905365,905424..905631,905684..905868,
                     905923..906151)
                     /codon_start=1
                     /locus_tag="AO090020000365"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070329000104"
                     /protein_id="BAE63560.1"
                     /transl_table=1
                     /translation="MTPYIGDTADPSSEPVKHGDWRDEFDAKGYVVLKNVVPKERALY
                     YRQKMLDWLGSFDNGFNINDRSTWTEENLPWSFKNGMYLNYCAAHEKYVWDAKQEPGV
                     LDAFAKIWGTDELIASYDTVNITLPNAAEMGGTKPWPHVDQAPERNGMHCVQGFINCP
                     EQGRNSKMLTHVRLAVSEAGPKDGGLVVMEGSAPLFEKFFKEFPPDRTKGPLAALHYD
                     FYPFQDEELKWYEARGCKIVKVCAEPGDLVLWDSRQMHYAVYPETDLIRTVIYTCYTP
                     AAWISPEDLEKKKEIFHKWEATTHWPHINIHSHGKHMIDEGYYIRGYRVIRKYVSDCK
                     MNGSLYFLRSGLTLTGSPRLPIGHHTGIIIGLGYPKYSKSTRPAMEAKSTSEVQIEDV
                     ETFNNKVYNQVVGSTKLINDSEVVLVPTPSNDPNGKGFDYPLNLPVWQKYVILFIVGA
                     FAATGNLMTSGMSAFLPAVRASYNGDPKTNDLITWPAFFMGIGNLIAIPLSYAIGRRP
                     IYLFSSILLAFGCLWCAKSESLESHIAGRDLMSIAAGTCEALCPIIVQEIFFLHERGR
                     AIAAFSALQTVGTAALIIASPYIASDSHLGWRWWYGIFGCVSGAVALLSIIFVKETKY
                     TRSMEALNGEGIKLEGVLVPVTTHMAPWSGNAEWSLTIDCCKQMCQVVLFPNVLWLIL
                     LNSAGLGIYVLMSALFAGVLVKPPFLWGFNTLGYVFAGQIVTAVAVPIVCGYFSDQIT
                     KLLSKRNNGVSEPEYRLLAVILPTVAILLSTIIYGKTAEHPQYWTWAGIAVTLNFEYF
                     GFVGIVVSSFVYCMDAYPQRVDATLVLICSCRGFIGFGISYGAIAFVHKTGYEGAFNI
                     CAGIMAALMVIGIFIYIFGRQIRRRTQKFAGGT"
     exon            902951..903425
                     /number=1
     exon            903434..903904
                     /number=2
     exon            904025..904064
                     /number=3
     exon            904177..904266
                     /number=4
     exon            904299..904516
                     /number=5
     exon            904558..905205
                     /number=6
     exon            905260..905365
                     /number=7
     exon            905424..905631
                     /number=8
     exon            905684..905868
                     /number=9
     exon            905923..906151
                     /number=10
     CDS             906969..908273
                     /codon_start=1
                     /locus_tag="AO090020000366"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000105"
                     /protein_id="BAE63561.1"
                     /transl_table=1
                     /translation="MPKLKVIIVGGGLAGACMANGLVNKGNDLFDVTVFERDTESSGR
                     DGYQIRLGAHALMGFRACLTEEQYRELLLCFGRSGGVVSSAPAIYNTEMELLLDLGKF
                     PAYEKSAPIGRARLRDFLQAPLRQKGIMRHGRKFVRFEVIDDEETPGQSKIRAHFEDG
                     PSEDCDILLSAEGSGSRANKQLGCNNIIEDGSLGAGSLLGKCHLPWSVLRTLPRPLIE
                     KGAIFTTAASAMLFAAAYLPDSLAPSQKASVSGDLSGLKKPSNYDEEQAFLMVGFGWM
                     EGPSSIEAIQLPDTKAFMREKLAETRCHPDFFKLIDALDPDAIQSVPWRYAKTIPVDW
                     RRNLLLGKESSLDRSIANPRVWLIGDAIHPMLPSRGMGANQAIHDTADALGPLLELAK
                     QKDRIGLLFDDDIRVQVGVYERAMIPRAFTWVKRSSAQVVRA"
     exon            906969..908273
                     /number=1
     CDS             complement(join(908589..909599,909669..909980))
                     /codon_start=1
                     /locus_tag="AO090020000367"
                     /note="monocarboxylate transporter"
                     /old_locus_tag="AO070329000106"
                     /protein_id="BAE63562.1"
                     /transl_table=1
                     /translation="MAECPTRSHYREQQRFEKSDIGTSTEIPIIQQDTTHSDFPEGGR
                     QAWLVVFGAWCALFCTFGLITCIGVFLEYYKNGPLEKYTASQISWITSVQVFLQVGSS
                     ILWGRLYDSYGPRWLLLLGTPLYCFGLMMTSLSTQYYQIFISQAILSSIGSGAVFNAS
                     LTSTTAWFYKRRGTIFGIVNSGSSLAGVVLPIMMTRLFQSIGFSWTLRVLGFMFLALC
                     GIACATVKTRLPPNWRPISVTDYIRPLRELKMVLTVLGGFLYFWGMFLPLNYIIIQAQ
                     ANRVSPTLVPYLLPIIIAVSLIGRLLMGVAADRFGRFNCIIAITAMSGITTLALWIPG
                     SNSTAAVIIYAVCFGLGSGGYVTLFPSCVTQISDFEEIGTGLGIAQLINAFGALTGSP
                     LGGALIRGQDSSTDFLGLQVFCGVTMVASAVAFCAARYTQVGMRMAKV"
     exon            complement(908589..909599)
                     /number=1
     exon            complement(909669..909980)
                     /number=2
     CDS             complement(join(910595..910724,910761..911125))
                     /codon_start=1
                     /locus_tag="AO090020000368"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000107"
                     /protein_id="BAE63563.1"
                     /transl_table=1
                     /translation="MKHGLLRLGELMPVEQQSEGQRSFVEYVSDRKRNVFSHCDGGQL
                     MYNFLVEGKALLWSAHLGGYEGILKDLKPKPDVAILGIAGRANLNGKPFDGSAAEFAL
                     QEIQWLGSPSQVIWCLHDERLTLHSCIPPYRIDTLAATAAVEKETASKVLHLTHAEVY
                     RLDL"
     exon            complement(910595..910724)
                     /number=1
     exon            complement(910761..911125)
                     /number=2
     CDS             complement(join(912562..913386,913446..914020,
                     914065..914557,914644..915502,915562..915841,
                     915906..915986,916038..916089))
                     /codon_start=1
                     /locus_tag="AO090020000369"
                     /note="cytochrome P450"
                     /old_locus_tag="AO070329000108"
                     /protein_id="BAE63564.1"
                     /transl_table=1
                     /translation="MRQNDNEKQICPIPGPQGLPFLGNILDIDLDNGTMSTLKIAKTY
                     YPIFKFTFAGETSIVINSVALLSELCDETRFHKHVSFGLELLRSGTHDGLFTAYDHEK
                     NWELAHRLLVPAFGPLRIREMFPQMHDIAQQLCLKWQRYGPRRPLNLVDDFTRTTLDT
                     IALCAMGYRFNSFYSEGDFHPFIKSMVRFLKEAETQATLPSFISNLRVRAKRRTQLDI
                     DLMRTVCREIVTERRQTNLDHKNDLLDTMLTSRDSLSGDALSDESIIDNILTFLVAGH
                     ETTSGLLSFAVYYLLTTPDAMAKAAHEVDDVVGDQELTIEHLSMLKYLNAILRETLRL
                     MPTAPGFSVTPYKPEIIGGKYEVKPGDSLDVFLAAVHRDPAVYGSDADEFRPERMSDE
                     HFQKLPANSWKPFGNGKRSCIGRAFAWQEALMILALILQSFSLNLVDRGYTLKLKESL
                     TIKPDNLWAYATPRPGRNVLHTRLALQTNSTHPEGLMSLKHETVESQPATILYGSNSG
                     TCEALAHRLAIEMSSKGRFVCKVQPMDAIEHRRLPRGQPVIIITGSYDGRPPENARHF
                     VKWLQSLKGNDLEGIQYAVFGCGLPGHHDWSTTFYKIPTLIDTIMAEHGGARLAPRGS
                     ADTAEDDPFAELESWSERSVWPGLEAAFDLVRHNSSDGTGKSTRITIRSPYTLRAAHE
                     TAVVHQVRVLTSAETTKKVHVELALPDTINYRPGDHLAILPLNSRQSVQRVLSLFQIG
                     SDTILYMTSSSATSLPTDTPISAHDLLSGYVELNQVATPTSLRSLAAKATDEKTAEYL
                     EALATDRYTTEVRGNHLSLLDILESYSVPSIEIQHYIQMLPLLRPRQYTISSSPRLNR
                     GQASLTVSVMERADVGGPRNCAGVASNYLASCTPGSILRVSLRQANPDFRLPDESCSH
                     PIIMVAAGSGIAPFRAFVQERSVRQKEGIILPPAFLFFGCRRADLDDLYREELDAFEE
                     QGVVTLFRAFSRAQSESHGCKYVQDLLWMERVRVKTLWGQDAKVFVCGSVRMNEGVKA
                     IISKIVSPTPTEELARRYIAETFI"
     exon            complement(912562..913386)
                     /number=1
     exon            complement(913446..914020)
                     /number=2
     exon            complement(914065..914557)
                     /number=3
     exon            complement(914644..915502)
                     /number=4
     exon            complement(915562..915841)
                     /number=5
     exon            complement(915906..915986)
                     /number=6
     exon            complement(916038..916089)
                     /number=7
     CDS             complement(join(916992..917001,917058..917107,
                     917131..917183,917300..917606))
                     /codon_start=1
                     /locus_tag="AO090020000370"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000109"
                     /protein_id="BAE63565.1"
                     /transl_table=1
                     /translation="MVQFLETVFPHHFEDIDFKRDVVYDWTGIQGFTKDGASIVGRPT
                     KGSPGEYVSVGHNGEGMGRCFACATVATDAMLNYLKGNKSWTPPEWFPMSFARNLGSG
                     ETSTVTICGSSSLSASKRLCVDDSERLLIDIGSSEGL"
     exon            complement(916992..917001)
                     /number=1
     exon            complement(917058..917107)
                     /number=2
     exon            complement(917131..917183)
                     /number=3
     exon            complement(917300..917606)
                     /number=4
     CDS             complement(918120..918785)
                     /codon_start=1
                     /locus_tag="AO090020000371"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000110"
                     /protein_id="BAE63566.1"
                     /transl_table=1
                     /translation="MATWPSDSVWSPQTHNEQIYARAPNPAEFPEVPAISKSYWIREH
                     RLDFEEECARTSLPSEVDVVIIGSGITGATVAYQISRSQPDLCVALIESRGLCTGATG
                     RNGGHIGRPEVYHFRELAEEVGVKEALKLKRFGQKNRNMMVEAINELEAVAEVDLQLN
                     GTIVVFETAEEKEEFVADLESAKQHGHEPEGYLIKETSDVLSVRTPPFTATISIDTDT
                     VRV"
     exon            complement(918120..918785)
                     /number=1
     CDS             919352..920815
                     /codon_start=1
                     /locus_tag="AO090020000372"
                     /note="NAD-dependent aldehyde dehydrogenases"
                     /old_locus_tag="AO070329000111"
                     /protein_id="BAE63567.1"
                     /transl_table=1
                     /translation="MASFITDDEFRSLHQKLRAAFTDNRTRDVRWRKWQLKQLFWLLD
                     ENEDALVKAMADDLHRHAFESLSYDVSDVKNTILTMLKNVDTWSQGAPPPEAGLFFRY
                     VGKAWIRKEPRGVVLIIGAWNYPLSTLLSVAAAAIAAGNSVILKPSEIARHTELLLSE
                     LVPTYLDSSAIALIRADPASMGTILEYKFDFIFYTGSTRVGRIIAEAAAKHITPTALE
                     LGGQAPAIVTKSADIEVTAKRLVAAKLTNLGQICVCVNHVYVDPEVHDSLVARLIYWT
                     ERFSKGDGLNGLARMVGERQYDRLHNLLEHTQGKKVFEGPHSRKEKLIFPTVVTDVKL
                     DDSLLSEELFGPVLPVVKKTVPEVLDILRGSPYPLGLYIFSNDSTEIDTILNFTNSGG
                     VTINDVAIHADVPSAPFGGVGDSGYGAYHGKWGFDTFSHNRTVVRVPTWIDRFVQWRY
                     PPFDIKNRSETDAPRLRFKKGETLEDQGGSGMGCVVM"
     exon            919352..920815
                     /number=1
     CDS             complement(join(920863..920996,921061..922594))
                     /codon_start=1
                     /locus_tag="AO090020000373"
                     /note="amidases"
                     /old_locus_tag="AO070329000112"
                     /protein_id="BAE63568.1"
                     /transl_table=1
                     /translation="MSSVEPPLWEQRAAQKRASRDAEIRKWQPGPVPDLKPDDTYVKD
                     VPLRCGLLTKEQLRITESTPSQLLSNLSSSHWSAEAVLRAFIARVTIAHYLTNPLSEI
                     FFERAVARARNLDEFLKTTGRTVGPLHGLPISLKDVMNVAGQETTLGFVATIGQIPDY
                     EDRLVTKLHEAGAVFYCKTNVPQTLMSGECVNFVFGRTSTPYNTGLTAGGSSGGEGSL
                     IALGGSPLGIGSDIAGSIRTPANFNGIYGLCPSPNRFPEHSAENSDGNMIIQGVAGPM
                     SRSVDGLEVYTRTLLGLRPWEWDFSSARIPWREAEYQEGLGKTHPLCYAFMPHDSVVL
                     PNPPILRGMREMKEALIRAGHQVIDIDPWDGRELMKAAFPIFFATGGEEVRKILSVLD
                     EPLIAEITPLEAMTTLSVAQYKSAAVKIKLLRQKYIDIWQATASKTATGLPVDAIILP
                     SGGTVAPPHGKMEYFTYEAISNVLEWTCATVPVTQVDPVLDAKPQSPFEPMSDYDQRN
                     WDTYAPETYKDGPVCLQVMGRRFEEEKVLGLLRTIDKALGRDEFYMS"
     exon            complement(920863..920996)
                     /number=1
     exon            complement(921061..922594)
                     /number=2
     CDS             complement(join(924762..924769,925152..926304))
                     /codon_start=1
                     /locus_tag="AO090020000374"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000113"
                     /protein_id="BAE63569.1"
                     /transl_table=1
                     /translation="MPNWRLKLNGRENQDIRFLIHSCQRSIVAIGECSRPLLDEILPL
                     ASEHPSILSALLAYSARLRVSSGDGSAARTEGSKRNALDRYQETITKVQSILSRLQSE
                     NPVNDGDVMEVLASCLLLTLFGLPEQVHNWSVHVTGMIALVESLDIEGFRSVPLVRYL
                     QTVAAHLDISAFALNRSEASQHKWLAWGICPWRSSTSTIDEPTEFTTFEISSGYPETL
                     VTVVALISAVIEGQIDDSVAAYINDIYQGIHPVQEQRLAEYGSPQQTESYWTSRMHAI
                     IAGWEPPMVPPHISSTLSLALTTAWETIRKAAHIYLTRGGFATSIYIPVAPRRQRVNQ
                     RYVREMIVGLQSLITLAEKKGITIANAMIWPMTVIGNEIFNDYALQAELVSE"
     exon            complement(924762..924769)
                     /number=1
     exon            complement(925152..926304)
                     /number=2
     CDS             join(927286..927735,927796..928608)
                     /codon_start=1
                     /locus_tag="AO090020000375"
                     /note="acetylornithine aminotransferase"
                     /old_locus_tag="AO070329000114"
                     /protein_id="BAE63570.1"
                     /transl_table=1
                     /translation="MAESITTLKQQLIDEFIQANPKSKAAFDRARNALPAGNTRSVLW
                     SEPFPLTLQSGNGAHVTSVDGQEYLDFVSDFTAGLYGHSHPVIKQAVKDALATGFSLG
                     GVVEKEAQLGEILQTRFKSIERVRFCNSGTEANTFALATAKAFTGRNKILVFDSGYHG
                     GTISFHGTTPNPMNLPHEFVVGAFNDIERTQSLVDNSLAAILIEPMQMAGGVRPASIE
                     FLRFLRESATKVGAVLIFDEVVTSRLHYHGLQGAREVYPDMTTLGKYLGGGFPFGAFG
                     GRADIMEQFNPIAHGRSVLHHSGTFNNNIFTMTAAVAAAELVTKQSLAELNKLGDDLR
                     ATGNSIVQQAGLKDIVFVGYGSTVGMGFLGDRGQVLREVFYFTLVKQGILMGRRGFLC
                     LNLAHTKEHIDRFLDVVKVFAEQHRADV"
     exon            927286..927735
                     /number=1
     exon            927796..928608
                     /number=2
     CDS             join(928897..929087,929144..929212,929269..929613,
                     929680..929854)
                     /codon_start=1
                     /locus_tag="AO090020000376"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000115"
                     /protein_id="BAE63571.1"
                     /transl_table=1
                     /translation="MSFTNESRGDKSPVDNKLLQPLEPVSTYGTVVENGTIEELGYVA
                     VYRRVFRSLGNMCMVVALTTPLSAILVTAFYQISYGGYWGLSWGWIIPNVILIPEVLA
                     IAELASSMPVNGSFYWWAGALAPPGWSHAISFVTGWLNVFTMFASTASFAYAVASSLS
                     YAVTIAAPSMAWTNAQIMCLSLAVIVVWSGVMTLKLERIASVNSGLNSDSCLHIRPAN
                     QPQSPESPICVCKDCLWRVHQLLRLGSRRVRSIFLVLYSLG"
     exon            928897..929087
                     /number=1
     exon            929144..929212
                     /number=2
     exon            929269..929613
                     /number=3
     exon            929680..929854
                     /number=4
     CDS             929995..930705
                     /codon_start=1
                     /locus_tag="AO090020000377"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000116"
                     /protein_id="BAE63572.1"
                     /transl_table=1
                     /translation="MTLRPPQQMRGMSLKIRLRAFMLTPSSGYPLMNLIYEHWGHAPT
                     SAYFLFITPVGFIGGSGTLLTYASQIAAFARDGGFPWHERVAYVHPRLNLPIYSLAIL
                     GIGTFLVLIIALSPAASSIIYSLSVVTGLITFIVPIFFRIFAGDRWVPGPWNLGRWSI
                     PIHIAAVVTQMYLIIMECFPTARAWTVETFNYNFALTVGAMLISCGLYWSVGRRNFKG
                     LDLEALEAWRRHHAAYAE"
     exon            929995..930705
                     /number=1
     CDS             join(930949..930970,931026..931699)
                     /codon_start=1
                     /locus_tag="AO090020000378"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000117"
                     /protein_id="BAE63573.1"
                     /transl_table=1
                     /translation="MAEHEVDKQTLLNLITQDPGLPRNNPTAAYWQHLPHRLSNVQSA
                     NLPQTTDIAIIGSGITGVSVAKTILEQDEAATVTVFDARALCSGATGRNGGQLAINAA
                     ESYLKLKKMVGMEMAGKIIHFNIKTLEALRRIAAQLALVQDPEVTDVVKIRSFKDEES
                     FRRVQGGIEALEADHPSLRGLYTVLDPEACRKVRSPSPFPAVLSLIASRNMVSTALLA
                     QCCILPGQSGHTG"
     exon            930949..930970
                     /number=1
     exon            931026..931699
                     /number=2
     CDS             931921..932511
                     /codon_start=1
                     /locus_tag="AO090020000379"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000118"
                     /protein_id="BAE63574.1"
                     /transl_table=1
                     /translation="MKGTMTVQDLTTIPSVPNRGSTTSWAIHYTPFLDAATGGLADGL
                     IYGMQNANTGWHFFGGEKSPPEQLLSSDDSTLSQSSVQFLQESLGSLFGLQGPAHQKL
                     VSAWSGIMGFTSDTLPLVGKLPSALTGRDGQGEWFSGGYNGYGMPSAWLAGESLGLMI
                     LGQSPREYLPEAYLISEERLRERLTVARSMEYLSEA"
     exon            931921..932511
                     /number=1
     CDS             complement(934161..946124)
                     /codon_start=1
                     /locus_tag="AO090020000380"
                     /note="non-ribosomal peptide synthetase modules and
                     related proteins"
                     /old_locus_tag="AO080527000367"
                     /protein_id="BAE63575.1"
                     /transl_table=1
                     /translation="MGSLDPEREALEPTFAMDTITDSIQQAKIPLTHIQTAHAASKLQ
                     EEMILATMMDVDHQVYLETYHFTTTQKIQATQLSHALQRLIEKHAILRSLFCWDDNGN
                     STKSTMVRLVVLDTKYLLKMGTFIGYNAQNANVVFYMIGSPFSAGVEWSGELPWKISL
                     SQSSDQQGSRLTLSFHHAILDGTSARQLLLAIQNELDSPASVVPQFDIFAANKALAKR
                     CNDDTRAQIKERFAAVQIKPNLQSMEPGRRSTENFRHAEQTSRIETRFPPYAARAAVP
                     AWIARLALSMALCSCEGVSETVFLEIMSGRKALSQQHQEVLGPLLAPQIRHARFPRDT
                     PLSDAAQSLKSTHDVEHGFSVGQLKSLLPELAHHIDVSLVCQTDMSYPSNGVGGFLWD
                     YRETKTDIPLVVELLPPREGFFHVSIRYHQNRYTDDYITRLLRTFGGYLQWLQGNYTH
                     LSHYTFHHRSSDGDPLLNIVKRHEIDAIPQEQLHCSTEPHIKTEVGVHEIFELQAKRT
                     PQKIALQYENSQYMTYADLNLRCDEMAGALAYQIGRLVPRPADYEEVVAIWFEKSIDM
                     IIAIMSILKAGLAYVVIDVNHPAERIAHILELCKASIILCGNMTGAEKLSEIARRRGA
                     SIFTLGDLLNEQNPQLGQRSLNKRREGFSASSLACVHFTSGTTGVPKGIMIEHRNIAA
                     VVRTKVPGFMGDWTACQLQLTGPTFDIIILDVFGTLGCGGRLILGSTTSLLSSLPQWL
                     EKTSVTHLGTTPAVASAFNEQIPVFLRVITLGGEVFHPSLLRDTPKECRIFNGYGPSE
                     TTVVATLYKTDPSDQSVQKIPVGLPYGRSRIYVVVPQTFQQVAVGEIGEIIIGGPQVT
                     RGYLGNPELTASKFQPSPFPDSKLVYRTGDFGRFLPDGTLDYIGRIDNQVKLRGQRIE
                     VEETEAVITMHSRVKACAVVKADTSDGGCLAAFVELHTRSTTDDQNGASGELSWSQTT
                     KELMSKASQTLPEYMVPAFIFQVKDRLPHTMNGKVDRRGLSNRATKLIEDEAQLATAS
                     YSEPQSKAERVVCNVFGDVLSCRVGVDDNLLNMGGHSITAIRAATRINHELNLEITFR
                     DILQFPTPRSLCARIYQPGESTEQSEARKPRLVRVSEPVELSSAQSRLWFLDQLHQSL
                     SWYLMILAFRVRGPLRLDALEAAFLALEQRHETLRTTFEQKDGVTVQVVHPFQHRPLR
                     VTDINGSDKEQTLHKALLKEQTTPFNLTREPGWRPSVFRIDSQNHVISIVLHHIIGDG
                     WSMGIVLRELAVLYAAAISGSDPMTRLTPLPLQYPAYSVWQRQEEQLAKHRHQLKYWS
                     EQLQGSQPAEFFCDKARPSSPSGNAEVRTLSITGEIYDQLRSFCQSYQVTPFVPLLAA
                     FRAAHYRLCGTEDATVGTPITNRSRAEHEGIIGLFVNVQCIRIRISETDSFDTLTKHV
                     RDTVTAAFDNEEVPFEDIVSELQPTRATDRNPLVQTVFAVHPEGFDQISLEGLYTERI
                     NVTYATRFDLEVHFYQHADGLAGEIMYATDLFHSETIQAISSVFMSILQYGVQSPNTK
                     IDVIPLMQAPSTFQDVDIVGTPSTDYPKDISVVELFGQQVAASPSAVAVKDSSCQLTY
                     AELDHQSDRICHWLMGQGLPAETIVAVFSQRSCQTIVTFMGILKASMAYLPLDERVPD
                     ARIEVILASLQDPRLILVGSGVRTPVVGLKDVMIMPILGIMDTKEIPPVVPVAGPSAS
                     SLAYVIFTSGSTGQPKGVMIEHRGIVSRMKRGNTVSESDCTKAWAHLSSIAFDASVLE
                     IYTPLLNGGSVICIDTMTVLDYAALEQTFSKTGVRCALLTPAMLKQLLSESPDIVAQL
                     DTLVVGGDRADPQDMFRAQRLVGSSVINAYGPTENTIVSTAYCMSKDSECSNGVPIGR
                     AINNSGAYVMDQELRPVPLGVMGELVVVGDGLARGYTDPERNGGLFVTITISGHSMKA
                     YRTGDRVRYRPVDGELEYFGRLNDQVKIRGHRVELGEIEQALLDQGSLAEAVVVLQRS
                     DADDDTRLVAFVREKRDVEDKEHNNEQQQEEGWKEIFSTAVYDVGIQSHQVGRDFSGW
                     TSMYDGTNIDKGEMNEWLDDTISTLLDGRPPGNVLEVGTGSGMILFNIPQGLRTYVGL
                     EPAQPIVDFVQKTIHDHRGDLNDKVRLHIGTAADVGKIAEFCTAQPDLVVVNSVAQYF
                     PGGDYLARTIGDLLKEHKAKTLFFGDMRSYALYRQFQVSKALHILEDKAEPSAIRKIM
                     AETVENETELLVDPGFFTALPHRFPGLIRHVEILPKKMRATNELSCYRYSAVIHTVHG
                     DHPLSIYTVESHKWIDFVSEAMDQAALIDILSKRADDTDVVAVANIPHEKTIVERVVL
                     ESLENQPQAWQGLTSIRDEAHKRNSLSVIDLINIASMTGFRVEVSWARQFSQDGGFDA
                     IFHRIQSEQNQGRAAFQFPTDHEGRHADTLTNNPMLPGLRKPIEQTLREGLQQRLPSY
                     MVPSIIKVLDQLPINHSGKVDRKRLAQMTVTVSPSLDEIEREYVAPRDDLERTLCEEF
                     GNILGSEVGIMDNFFNLGGHSLMATRAVSKIIRRLGSVLNVRDLFDYPTPAQLARRIS
                     SERDGEMIEPTVGASHALTNLAPNEVVGWREAVREAGLHDGDIERVMPCTPFQEGVLT
                     SDIVLEGRSAYQAVVQVTINSALDLEALSAAWRITVKREEMLRTAFLPSIDASNQQGI
                     CGRSFLQTVFRDSSVEVQRVATIQGGKARSGDIQPQMDMGKIPVSLELDRERGSSRWS
                     LRLKIHHALYDGQYLSSIIQGLVGVYKEGSTLCKSSHKDRVSFSTFVRTLQDGDPDKA
                     CAFWKDYLKGGMSATWPVTNGLKGPMAVDRSPKIKIGEWAGDARKIAKRFQITPAAMA
                     RAALALTIAEHSNSDDVILGEVSSGRYHTGFVAGPCIATHPVRINMAKQDTFQSTDNT
                     QSRRISLHSLLKLCRDTYLDTMHYQQVGLESIRLSSESPDLLPFQVLFVYQEAGPETN
                     DFTISQSEQGRVDFPLVFEVSCHSTTGHLSIRCVFDPVIFPPGDIDWVMQHVIDALSL
                     IADQAIARKAVHKHIDARLMISANERAKLQQLASKQDVVANDPDQTVIDIISQQAEKA
                     PEKIALQFEQDQFLTYRQLLDSATMLAGSIERMLENRMTDVDNQPLIPIAFDKSSDMV
                     IVILAILKAGAAFIPLDMNYPIKRLQEICELTQPPILIWDGINGSEKINSLTNATGAV
                     AYTIADLRKSGGPVSGGNRPTSLNSLAYILFTSGSTGVPKGVMVEHRNLTAFTMSEEG
                     SVDCSWTSNRLSFLAYTFDASMGDLFATLCKGGRFSLVRRSKMLSQLNTWLDNMNITH
                     LALTPTLGGLLPNDLREGSRQLPHLRNLVFGGEPFRASFLRRTPVELTVWNGYGPSET
                     TIEATACQLQGPSAESERARAYLPIGSPTGGCRIYILRPETEEPVPIGAIGEICIGGP
                     QVARGYLGQPDLTACRFTPDPFAPSREGRMFRTGDLGRFHSDGNLEYLDREDGQVKLR
                     GLRIDINEVESVAQTHPAVTACVVAKAVNNDSEALIAFVELSQSPSINGNDLMTLIKD
                     HISRSVPDYMVPAHLLLPQGPLPRTAHGKTNKLAIQKMANAAYEQCMADVSAGRQVLV
                     PAIPGTLEATIASVWAKVLGIKEDRVDITMPFSKLGGDSIRSITLLALLRRAGLRVDM
                     ADVAPSSTIQVEAVKIRDRTKNGRIAGNLHVHDRGGRATIVLIHPFLAQSTIFEPLVP
                     LLDRRLNVILVDDPFFGTDSCPATLAEWATSYLINLKPHLIRGQPVIFGGYSVGGLIA
                     FEMAQLWGTRYGSHSASVVLLDPGTYEPINRTSAGNSDEEIIRNSLGMSDVEPEDLAP
                     FREHFDRHIRVLQHSARPALYQGRCLYLGLPERFQDGTTAWWKNQCPNIVMNKVDCDN
                     HYKMLKGRGRIQAITQYINEYSASLLFGVADSDSSPNQKKRSRPSAPFVSTKKTKRR"
     exon            complement(934161..946124)
                     /number=1
     CDS             949728..951149
                     /codon_start=1
                     /locus_tag="AO090020000381"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000121"
                     /protein_id="BAE63576.1"
                     /transl_table=1
                     /translation="MGFFHSALSFLMGAFSQTMAQTAPPQMEGRIDVSKYSPPDIITR
                     DVCIIGGGPAGTHAAIRLRQHNKSVVVLEKQDRLGGQTNTYIDPESGRAVDYGVTYFQ
                     NLSSVREMFEHFEIPLTKAVFDYKMHMFDFRTGTPVQDSSKAEMAAFTEKYMAQLAKY
                     PYLKTGFDLPDPVPEDLLLPFGEFVQKYDMMPAVGQMGAWINALGDWQTMPTLYIMKY
                     MCADTMNGVKTGFVRPADHNNSAIYDAARKELGEDALLNSRVVQMDRDDAKGWVYMEV
                     QSGSQTRLIRAKKIIVAFPPHLDNFGGFDVSPKEKELFSQFQHIYFYPALVRIQGIPD
                     NICYINRGADHPFLRPQLPGILMMRTSDVQGLCTVHFSSRFPVSEEQVKAGIVKGISS
                     IRETQGIDGTDLEFVRLANHSPYQMTVSADAIAHGFYQELNALQGERHTYYTGATFDS
                     HNTPQIWNFTEQLLQEQILKSLE"
     exon            949728..951149
                     /number=1
     CDS             complement(952641..953546)
                     /codon_start=1
                     /locus_tag="AO090020000383"
                     /note="flavonol reductase/cinnamoyl-CoA reductase"
                     /old_locus_tag="AO070329000123"
                     /protein_id="BAE63577.1"
                     /transl_table=1
                     /translation="MRVFVTGGTGFIGKAVVEELIGKGHSVLALTRSEKGAKLLANLG
                     ADVYHGNLGDLESLRKGAAASEGVIHCAFRNTVQDFTVAEFEAACQEERQAIEAIGNA
                     LVGSNKPLVITSGTMLLPPGRLGTEDDHDPNPRSPIALARGPSEILALSFASKGVRVS
                     ILRIPPVNYGEGDEGFVPMMIDAARKNMKSIYMGDGLNRWPATHVQDTAKAYRLALEK
                     APAGSTLHGVAEQGVPLKDIAEAIGERLSVPVESKEWEDMKAHFGWLANIVALDNYIS
                     SQKTQALLDWKPKQRPLLSYIKEDI"
     exon            complement(952641..953546)
                     /number=1
     CDS             join(956484..956502,956545..956719,956997..957849)
                     /codon_start=1
                     /locus_tag="AO090020000384"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000124"
                     /protein_id="BAE63578.1"
                     /transl_table=1
                     /translation="MAWMYNCSDFYGKAMCASLVLHLGLPVIITPDRGPASRAPGELS
                     AESRTRDSRLRTLWSSVLMDRYSFDFSELSSTERSRLLLDARDQLLSFYRQIHPSLQL
                     SRTSITTETPTPAVIYLHISYHMSFILIHRPYLKVAVRNSLTIYRLALRSVTTAAASI
                     VRLLRIHANILPLSLAPPFIVHSVLTAAVTHLCNATSTHNTLRSQSIAHFRVCFRALL
                     VMQSRWVKATRAIRLLRGLAHRWRVMGALPLQYGFEAGGGGEAEETGWQQAEAEAEEG
                     EREVERENEDEEREEDGRIVDTEENWPLAAEADAANSNFDGDEMEMFDSIRPETFVFD
                     TEYRQWELSMGLEL"
     exon            956484..956502
                     /number=1
     exon            956545..956719
                     /number=2
     exon            956997..957849
                     /number=3
     CDS             complement(join(957922..958298,958362..958807,
                     958907..959085))
                     /codon_start=1
                     /locus_tag="AO090020000385"
                     /note="predicted amidohydrolase"
                     /old_locus_tag="AO070329000125"
                     /protein_id="BAE63579.1"
                     /transl_table=1
                     /translation="MTTPQPSQVRVAVTQAEPVWLDLKATVDKTCSLIAEAASKGAQL
                     VSFPECWIPGYPAWIWTRPVDQELHSRYIQNSLTVSSPEMTQICKSANENNVIVVLGF
                     SENIHNSLYISQAIISNTGSILTTRKKIKATHMERTIFGDAFADCLDSVVETAVGRVG
                     ALSCWEHIQPLLKYHTCAQREAIHVAAWPPLFEWGGPEDESLFSMSRDGTIALARTYA
                     IESSSFVLHTTAVISQEGVEKMRTATGAIMNMPGGGSSAIFGPDGRLLSKPLLPTEEG
                     IIYADLEMHDIYKTKAFVDVLGHYSRPDLLWLGVGSCDRRHVKEDAEERREDRVEVL"
     exon            complement(957922..958298)
                     /number=1
     exon            complement(958362..958807)
                     /number=2
     exon            complement(958907..959085)
                     /number=3
     CDS             complement(join(959678..960789,960840..961221))
                     /codon_start=1
                     /locus_tag="AO090020000386"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070329000126"
                     /protein_id="BAE63580.1"
                     /transl_table=1
                     /translation="MFSEKHQLLFGPPVSSTDPLTWSRLRKELLFATIIFGSCATGSL
                     GPLLVPAFVSLAADLQVSLTSITLLNGSLVMALGLSAYVCSCSARCFGKRSVYLFTTI
                     LVLAACCWGAASKSYTSLLASRVFQGLGMGGFFALAGTASINDIYNVDERGWRVGLWN
                     FAVIVSVNLTPIISGTVISALSWRWAFWLQAIQFGVLLAAVIFFFPETTFRREISGSR
                     PTTCNLETSSDDHTLDHPELDTEEKGGRPVVTSASIESIPVQRHNSLFVFTEPLAIVI
                     DPIVIWGSIMWSMTFTWTILLGAVASQIFTAPPYNMSTVAVGSLTGIGPLIGSALGTV
                     IGGFLCDLSSKSMAGKNAGIYEPEFRLPVMLPATLAMIVGAFGLGAATQYGLSAVVCG
                     VFMAILNFAVGMGCTGIVAYTNDACGQRAGDCFGLAMVAKSAFAFGLSFVFNDFVVKR
                     GTLIFFSTFGAVSVAVMLTNIPLFIWGKQIRAWADGRDLLRRRNIRM"
     exon            complement(959678..960789)
                     /number=1
     exon            complement(960840..961221)
                     /number=2
     CDS             join(961950..962312,962404..962538,962592..962864)
                     /codon_start=1
                     /locus_tag="AO090020000387"
                     /note="predicted amidohydrolase"
                     /old_locus_tag="AO070329000127"
                     /protein_id="BAE63581.1"
                     /transl_table=1
                     /translation="MKHFMHIGFAASLLTVCWASSSYHGMGNAMVRRANELTRKGNNN
                     LTVHEIVAKWDLENLTIAAVREAPVNWPLPMLNKDWDGVTLDLNATVDLGISLIKKAS
                     ENQARVIGFPEVWFPGYPKGILNSENPNPWFEYHVRDYIENSLVIGSDNWNKLVQAAV
                     DNEIYVGLSFSERDAAHLYMAQALISPDGEILIHRHKLRPSAQERDLWSDGTVDQIYA
                     VSTPIGRIGMLSCGEHTAPEATFIMQSQTEDIHIGSWP"
     exon            961950..962312
                     /number=1
     exon            962404..962538
                     /number=2
     exon            962592..962864
                     /number=3
     CDS             complement(965861..967156)
                     /codon_start=1
                     /locus_tag="AO090020000388"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000128"
                     /protein_id="BAE63582.1"
                     /transl_table=1
                     /translation="MPTNKKSFIPFCLLSPSHPEYTVCAAYTKDGERCSSKVYDINGI
                     NKLHAALHNSYKTMIEDETREGMLKKLAELTICGRQKSRSEGIIEAAVHQWNAELQPP
                     VNAQSNDDKGSPKFEFTPYQTAKIDKLVRGELTQELNRLIDGKISQKFITHKWKKERD
                     YLYIFECEEAEGMCKLGHTDSPSRRASQHVKCYPNFTQERSLYCPNSEVFERVVQLEF
                     ARLRYKHACLKCNATHTEWFKADLDEIYQRANVWCQFSQGLQSPEKRSQVSIPLFFEF
                     PSDPDRWYKWAQGYVQSWDNKLSPSEPNTTSKSVVDQDIVTVDDDAESIPGLSPSSSA
                     SGTPDDDYSDPPTPTPIERSRKTKPTSKQRLIIPPASPSVSSEAYWTPVESMSTPKGR
                     VLFPRVPGEYPVSPVNIVPEKTKEDANGLTDIFENLKLF"
     exon            complement(965861..967156)
                     /number=1
     CDS             complement(join(972020..972095,973611..974082,
                     974151..974235,974292..974711,974765..974857,
                     974914..975148,975203..975332,975395..975434))
                     /codon_start=1
                     /locus_tag="AO090020000389"
                     /note="catalase"
                     /old_locus_tag="AO070329000129"
                     /protein_id="BAE63583.1"
                     /transl_table=1
                     /translation="MIPKTPRQYTLAEGQPISDPSVSTTLPTFGGGSLTTLADTTLLE
                     TLAHFNRERIPERVVHAKAAGAWGEFEVTHDISHLTSAKFLNGVGKKTPVLCRISTTG
                     GEKGSADTVRDVRGFGVKFFTEEGNHDIVGNHTPVFWVRDPLKFPAVNRAHKKHPQTN
                     AHDFTMFWDFHVNSPESVHGLLHLFGSRGIPSSVRRITGFGLHTFKLVAPDGSFNYCK
                     FHFRPEQGVGNLSEDEATRLAGANADYHTTELFDSIARKNYPVWGLYIQVMKPEEAEK
                     AGLMTFDITKVWPHKDFPLIPVGKMTLNRNPANYFAEIEQAAFSPSNMVPGITYTPDP
                     MLHARMFAYPDAQRYRLGANYTHLPPNRPVAPVYAPFERDGLTQTSNYGAEPNYNPNM
                     FTPAVQSQRSTQDVRHGEFLKGAVLGLNNIPVTEADYVQPRALWRNVFDDAERRLCAS
                     NISETLVTLPADLRTGVIDLFNKVDPEIGRLISAKLSGSARLTARVAECCSGPNPGVH
                     CIHQYPDK"
     exon            complement(972020..972095)
                     /number=1
     exon            complement(973611..974082)
                     /number=2
     exon            complement(974151..974235)
                     /number=3
     exon            complement(974292..974711)
                     /number=4
     exon            complement(974765..974857)
                     /number=5
     exon            complement(974914..975148)
                     /number=6
     exon            complement(975203..975332)
                     /number=7
     exon            complement(975395..975434)
                     /number=8
     CDS             join(976334..977873,977929..978092,978157..978234)
                     /codon_start=1
                     /locus_tag="AO090020000390"
                     /note="glucose dehydrogenase/choline
                     dehydrogenase/mandelonitrile lyase (GMC oxidoreductase
                     family)"
                     /old_locus_tag="AO070329000130"
                     /protein_id="BAE63584.1"
                     /transl_table=1
                     /translation="MSAQVNNNQYDFIVVGGGTAGNAIAGRLSENPSVRVLVVEAGIA
                     NPGQIDDITTPSKAFGLRGSQYDWAYKTTMIKRDDYERIEKPNTRGKALGGSSCANYF
                     TWIPGSKATFDDWYEFGGSDWTWDNCVEYLRKCATYHDDEKLYPTDLNKIGTGGPVQI
                     SHAELVPELETFRNALTTAWTSRGEPLSEDIYSGEMHGLTHCVDTIYKGERQGSWLYL
                     ENKPNVTILSQVHSKRLIIDRTTQTCTGVTVVDPTNGAELNLYATREVIVSQGVFETP
                     KLLLLSGIGPAAELNKHGIDVVVDSPHVGKNLLDHPIVPFVLRLKDGVALDDHIHRAG
                     PANEAAVAAYRRDKTGPAASGFLELVGFPRIDERLNRYPAYREAKAANGGLDPFGPGG
                     QPHFELDFVGLFSSAFQWHYPVPPSGSYMTVIVDLLRPVSEGGEVTLNSTDPLQQPNI
                     NLNFFADDLDVLAMREGVRWTYDVLTKGEGFKDLVLEEYPWNMPLDSDEAMNKAVLDR
                     SQTGFHPCGTARLSKNVQQGVVDNKLRVHGIKNLRIADASIMPVIPDCRIQNSVYMIG
                     EKGADIIKAQYRELYEQKNIPYFSSKL"
     exon            976334..977873
                     /number=1
     exon            977929..978092
                     /number=2
     exon            978157..978234
                     /number=3
     CDS             complement(978712..981210)
                     /codon_start=1
                     /locus_tag="AO090020000391"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000131"
                     /protein_id="BAE63585.1"
                     /transl_table=1
                     /translation="MTEPKNQTSSTISTQCELRDLYEYEPLPTPTSIRLIKVEGKDQD
                     GTVHVRLKTIDLKDAPWYHAVSYTWGNPHTELPHVQATHETYSQKYPPDYREPIVANG
                     KLLHVSRSAYDILVSVPKDAWAKRCNQRNPKNQLRATIHSACMTNKKEYVEELISAGV
                     DIDVQDEYGRTPLCYAARLGKLEFVELLLAAGADLDILDGNENRAIDHARESGVEEII
                     KCLEEAEKRVKVHGTSRSWPEGPQMWCWVDQICIDQSNLEERASQVSIMDRIYECASY
                     TLIWLGLEDDYTEVAVETIQKLYSAQGDLIHDNEIIPYRHQPKEVYATAEIPYVSLEE
                     WTALATLFLRPYLRRLWVIQENILSDTCLGYCGKFEVPWRAFCTVAQQIYFRQLVLGR
                     VTSTEFIDINSPVVAIESEIVHLTQWKDRLQNGDQASMPKTLSLENLLFETWTFRATD
                     PRDKIFGLYGLLLKAGPVPWKPDYSKSVAQVYAEATKEIIQNANELRMLSAVLDHSLH
                     NIPDLPSWVPDYSVPFCNMMCANYNAAGTLPQQTIQPSSWNELKVSGVKIDTVLQTGN
                     TTSGPKQMSMFFDARWFELALLLPHPYHNGQTRTEALWRTLCADHKKDGSFPAPGAYG
                     ALFRNMLCQLTCVKAEETARAAEQDPNIVVLEAALHHIRQILSKPPISTLSLEEIQRT
                     FGNPDTNLSSPDFQTLTHLLYKLHFLGMVEEDPWTPTIDEIEKSYRRTKWQTWEESSA
                     LPGDDIEFHVALRSKHGRRRLFVTEKRYLGLGPASMVDGDEVWVIPSAGAAFVLRPVD
                     RGIFRLVGEAYVHGVMDGEVVGECDVKLSSICLV"
     exon            complement(978712..981210)
                     /number=1
     CDS             complement(join(981528..982157,982197..982208))
                     /codon_start=1
                     /locus_tag="AO090020000392"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000132"
                     /protein_id="BAE63586.1"
                     /transl_table=1
                     /translation="MSTECQDAPLDENMVDDSESLGTSSCSSISTEVSEYGMEILNEN
                     DIEEIKTRILMALPIHDFIEIQPIRSIIESFTQQQLADIVGKFLELDKLRVNQQSLTT
                     YSMIYCHPSPNLMRFIQRHLTKDVPCPGDERATKVLTFDDIDNGFHKKSKSELIELLE
                     ETLSAFHASKLYAVLEEQIQALPEEEREQIHTEARRIFGDLDSMSSGGSGEGW"
     exon            complement(981528..982157)
                     /number=1
     exon            complement(982197..982208)
                     /number=2
     CDS             complement(982667..983974)
                     /codon_start=1
                     /locus_tag="AO090020000393"
                     /note="ankyrin repeat"
                     /old_locus_tag="AO070329000133"
                     /protein_id="BAE63587.1"
                     /transl_table=1
                     /translation="MHLLRLPNELLQLVADNLSTDADLNALIQTHSCYYHLLKTYLFE
                     HNVRYGESSALVWAAAHGHIEIAKKSLRAKADANALSPLHRSIFKLNLCTCPSILLPA
                     DHACEWCPTDRRHRSTPIMLAAMNGHKEIVELLVHHGADINRQVGGVCTPILGAIGHG
                     NVDVVEYLLITGVNLDVTLDGFWDYDPLELAAHEGHAEVVKLLLRHGVDPNKSSALAL
                     ATSMGKLEATRVLLEAGASIERVCTRNQMDALFNAVDRGEATVVGLLIEYGANLESRD
                     SDGMTPLAYAAYFRRPEAAEVLLNHGANIDALSQGLTALSFAIDEGKVPMVKLLLENG
                     ADLTITNEPLLLRILKSNRIHNQEADAAIVELLLYHGADPNCCDRKGRTPLFLATVKQ
                     KVDIMRVLLARGANPNREDEEIDLLSWAFLKGHEDVVNMLLAY"
     exon            complement(982667..983974)
                     /number=1
     CDS             join(987156..987204,987271..987303,987375..987395,
                     987458..988532,988541..988619,988840..988998,
                     989054..989429,989578..989969)
                     /codon_start=1
                     /locus_tag="AO090020000395"
                     /note="phosphoribosylamidoimidazole-
                     succinocarboxamidesynthase"
                     /old_locus_tag="AO070329000135"
                     /protein_id="BAE63588.1"
                     /transl_table=1
                     /translation="MGARLTYINSIILLSDCTIAHNLVSFHDLNAGFRTNIHLRLPKQ
                     TSDFHTMSSSLSTGSFQTLTFHPDNTVIIQDKIYGEHTISEPVLAELLRCPALLRLAG
                     IGLHGQTDLLGITHTVTRLEHSIGASLLVRKVGGSIGEQVAGLLHDISHTVLSHDVDG
                     ALSKPGESYHEVQKSRYIMTTELPRILTKHGFVDLKPFDEELYPLVERPAPHLCADRL
                     DYSLRDAVAFGKLAIEDARRVYDSLTAFPDASSPHRLLVLRDIDLALAYARAYGECDR
                     DVWCNPAHAVMSRKIGQLIGDLVQQGSLKEEVLWNLSDREFWELLKSKVDSKGLETIK
                     HIEAGPHAEDYHRLPRGTKIRTIDPDLLLPGAGQPSPLSFVKPEWAKERQDFIQARQA
                     LLASFTVYINGGVSWEQDSIQPQFENNNPIMSEALTNTDLQGALPLIARGKVRDLYDV
                     DEKTLLFVATDRISAYDVIMENGIPEKGILLTLCTKTWFKILSDKIPSLRTHFLTLDL
                     PPQIPESLRPVLQNRSMQVRKLKILPIEAIVRGYITGSAWNEYKKSGTVHGIKVAEGL
                     RESEAFPDGPIYTPSTKAEQGEHDENIHPDQAVAIVGERYASKIASLAVQLYKVAHEY
                     ALTRGVIIADTKFEFGLDPETDEVVLADEVLTPDSSRFWPKDSYEIGRGQQSFDKQFL
                     RDWLTSEGLKGKPGVRMTDEIAQKTSAKYREAYERITGETKVPAV"
     exon            987156..987204
                     /number=1
     exon            987271..987303
                     /number=2
     exon            987375..987395
                     /number=3
     exon            987458..988532
                     /number=4
     exon            988541..988619
                     /number=5
     exon            988840..988998
                     /number=6
     exon            989054..989429
                     /number=7
     exon            989578..989969
                     /number=8
     CDS             complement(join(990128..990831,990913..991057))
                     /codon_start=1
                     /locus_tag="AO090020000396"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000136"
                     /protein_id="BAE63589.1"
                     /transl_table=1
                     /translation="MADRAVGGFSTASLDYVPADPATHSPAHARFHGSISTKLPNNWR
                     VERTGYAAFRNKDRGLWLFGRLFWDMDPYSYLALRVKSDGRRYTVNIQTDSIVETDIH
                     QHRLYTRHHRVQEASDEDLSSHEAAAEESPEVYPSRVPPSLSDVPPESTIMSTSTSTE
                     TAGTTGWETILLPLNAFVRTNHGLVVEPQTSILRQRVKSIGIGLTDRVEGPYDLRIHK
                     IWATNGMSEAEIEEERRICGVDALPVDEGVRSGWTRESAQQHTSPQEAPKAKKGLKAL
                     RSEWDQ"
     exon            complement(990128..990831)
                     /number=1
     exon            complement(990913..991057)
                     /number=2
     CDS             join(993110..993240,993295..993587,993645..993988)
                     /codon_start=1
                     /locus_tag="AO090020000398"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000138"
                     /protein_id="BAE63590.1"
                     /transl_table=1
                     /translation="MHNNVTYIGDMAPSPEHPNHNEPQLTFEEVQQRYGKDARLFVGN
                     LSVNVDQSTLMRDLHEAFRPFGACCVGLKYSRTRQGLQLPGAFVQFEVSHLLCASLNG
                     LQYETNDLQRPEYAQAALSLDQQRELHNRPLRVERAAGQRNRSANGSPPYPQHGPSPQ
                     APYPQMPQQWYPSLQRSSLESISGSYEYPYMAGAPGPYPPVWGEHSYPGQVEANNVPI
                     QEQASGGQVERQQGSTAAIWNGPLIVDGSCWADKRRK"
     exon            993110..993240
                     /number=1
     exon            993295..993587
                     /number=2
     exon            993645..993988
                     /number=3
     CDS             join(995049..995391,995445..995737)
                     /codon_start=1
                     /locus_tag="AO090020000399"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000139"
                     /protein_id="BAE63591.1"
                     /transl_table=1
                     /translation="MIAEAKKAKGHTDKVAVDLHPDRPDYRGFALGPNIVSFQADPTF
                     EELEAAGGAIQKHDEAHTVLDNFFLISGEIPRQTAYENGIKGGMRFDKEEKDWFSDEL
                     ISDERFLVCNLKGKGLVLFTGCSHAGVVNCSRHAVESFDGSVPLYAVVGGFHLATSTA
                     ADTESTIKDLERLDPAVLLPGHCSGWRAKFVIEKYMPGSLVPCTVGAKVTF"
     exon            995049..995391
                     /number=1
     exon            995445..995737
                     /number=2
     CDS             join(997960..998222,1000438..1000492)
                     /codon_start=1
                     /locus_tag="AO090020000400"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000140"
                     /protein_id="BAE63592.1"
                     /transl_table=1
                     /translation="MHQRITPQCGLLDPIPFTSQRTLHLLAVKKFITAPDALSITACQ
                     PQVNVQQSVLPELVAGVDTLSLQFIHQSSTVIVLHLNSVYKGPTTTEDLGDPFEIAPF
                     SLA"
     exon            997960..998222
                     /number=1
     exon            1000438..1000492
                     /number=2
     CDS             join(1007123..1007492,1007547..1007770,1007837..1010185)
                     /codon_start=1
                     /locus_tag="AO090020000403"
                     /note="plasma membrane H+-transporting ATPase"
                     /old_locus_tag="AO070329000143"
                     /protein_id="BAE63593.1"
                     /transl_table=1
                     /translation="MAERRISYAPDVENGDRDGATLDEYAALNRYISTARDKRRGSTS
                     SAGAMSAKKEKKSWWKKKSDGVEEGFVCPDEWLETDLRAGLRGSDIEARRKRTGWNEL
                     TTEKTNFFVQFIGYFRGPILYVMELAVLLAAGLRDWIDLGVIIGILMLNAVVGWYQEK
                     QAADVVASLKGDIAMKAIVIRDGQEQEILARELVTGDIVVVEEGTVVPADVRLICDYT
                     KPEMFETYKEYLATANDDTLKEKDDEEDDTGIEARAGVSLVAVDQSAITGESLAVDKY
                     MADTCYYTTGCKRGKAYGIVVATAKQSFVGKTAALVQGASDSGHFKAVMDNIGTSLLV
                     LVMFWILAAWIGGFYRHLKIATPENQDNTLLHWTLILLIIGVPVGLPVVTTTTLAVGA
                     AYLAEQKAIVQKLTAIESLAGVDILCSDKTGTLTANQLSIREPYVNEGVDVNWMMAVA
                     AIASNHNVKNLDPIDKVTILTLRRYPKAREILARNWITEKYTPFDPVSKRITTICTCD
                     GVRYVCAKGAPKAILNMSECSEEEAAKFREKSAEFARRGFRSLGVAVQKEGEPWQLLG
                     MYPMFDPPREDTAHTIAEAQHLGLSVKMLTGDALAIAKETCKMLALSTKVYDSERLIH
                     GGLAGSAQYDLVEKADGFAEVFPEHKYQVVEMLQQRGHLTAMTGDGVNDAPSLKKADC
                     GIAVEGSTEAAQAAADIVFLAPGLSTIVDAIKLARQIFQRMKAYIQYRIALCLHLEIY
                     LVTSMIIIEETIRADLIVFIALFADLATIAIAYDNAHFEQRPVEWQLPKIWVISVVLG
                     VLLAGATWIMRASLFMANGGMIQNFGSPQEMLFLEVALTENWLIFVTRGGKTWPSWQL
                     VGAIFVVDVLSTLFCVFGWLSGEYEQTSPPSKAEFSINGDVDIVTVVVIWAYSIGVTV
                     IIAVVYYLLSIIPALDNLGRKNRSKADTKIENMLSHLSKLAIEHEVDAHGKSRYMLGA
                     RAEVEEEE"
     exon            1007123..1007492
                     /number=1
     exon            1007547..1007770
                     /number=2
     exon            1007837..1010185
                     /number=3
     CDS             join(1011731..1012333,1012392..1012955)
                     /codon_start=1
                     /locus_tag="AO090020000404"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000144"
                     /protein_id="BAE63594.1"
                     /transl_table=1
                     /translation="MRSSGLSLLVGALLASASPLKTSRYACQTALSCPEGTILVSKTD
                     PSAHFTSVQDAILSLPNDNTTQTILILPGTYKEQVNVTRSGPVTLLGQTDDPNNATKN
                     KVTLTWAQANHDNTGQAVDNVFSSVLTVAPTLESSYTGSGTTGYPVPEDTPFGNIDFR
                     AYNIDFTNTWRDYSDGPAHAISFSRANGGFYHCGFYSYQDTVYVGKLGNAYFHKSIIA
                     GQTDFVYGFGTAWIQSSEILLRNCGGGITAWKGTNTTFTNNYGVYIVDSTVKAANASI
                     APEIRGKCALGRPWNSQHRSIFARTSEDASIIPAGYIDWIVDGEGRLNKDTVMAEYKA
                     SGPGFNATGREDGNVTIVMDDKEYARYSSPARVFQYPDGRFGNIGWIDLSVDKN"
     exon            1011731..1012333
                     /number=1
     exon            1012392..1012955
                     /number=2
     CDS             complement(1013081..1013536)
                     /codon_start=1
                     /locus_tag="AO090020000405"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000145"
                     /protein_id="BAE63595.1"
                     /transl_table=1
                     /translation="MNPRTALLNRTRTLCQNFSTSAPLPTLLSNFTQNPPPTALEHGL
                     PQLAPFLGRPFTGQEGLERYFGLLGELLTIEKMEFEAEEKWVVDERAMAVSLRGEARF
                     RWNETGQAWDETFAYRIGLAEEGGEVKVVVYEVWADTGAAYLARVGGLD"
     exon            complement(1013081..1013536)
                     /number=1
     CDS             complement(1014006..1014920)
                     /codon_start=1
                     /locus_tag="AO090020000406"
                     /note="transcription elongation factor TFIIS/Cofactor of
                     enhancer-binding protein Sp1"
                     /old_locus_tag="AO070329000146"
                     /protein_id="BAE63596.1"
                     /transl_table=1
                     /translation="MPLEAKEIELKAKALTKAATQNEPAANIVSLLKELQQGVKATED
                     LLRSTRVGIIVNKFKQHKSPEVSRLSSEIVSRWRNEVNKQKASGSPAPSQRSSNSPRP
                     AQNGTASPAGTTPTDKASKLSVAPDKRTWKADGVDINQTGNKIRDSCIGLMYDGLCLN
                     STEAPRNVLSKASAVEAAAYKSLGPETKEQYRTKIRSLFQNLKNKSNPSLRIRVLSND
                     VTPDQFVRMSHDELRSDEQREKDAKIQKENMDKAMVAQAERSISTSLQCGKCGQRKVT
                     YTEAQTRSADEPMTLFCTCLNCGKSWKQ"
     exon            complement(1014006..1014920)
                     /number=1
     CDS             1016240..1016641
                     /codon_start=1
                     /locus_tag="AO090020000407"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000147"
                     /protein_id="BAE63597.1"
                     /transl_table=1
                     /translation="MKANSFLIALLPTALAIPLPTPNEGATSLSESQRLQSITDELMF
                     GLELPDFTARREANDPPQLDWYSDGCTRAPSNPLGFPFQRACERHDFGYQNYRIQGRF
                     TKAAKAQIDLRFKEEYDFPFVPSFSPGICFC"
     exon            1016240..1016641
                     /number=1
     CDS             complement(1017532..1018785)
                     /codon_start=1
                     /locus_tag="AO090020000408"
                     /note="Ran GTPase-activating protein"
                     /old_locus_tag="AO070329000148"
                     /protein_id="BAE63598.1"
                     /transl_table=1
                     /translation="MAPPKVFSLEGKGLKLDTAEDVEAHIKPLVESTDYTEIRLGGNT
                     FGVTACERLGAAFSTQKNLEVAELADIFTSRLIEEIPIALTHLLKALLEIPTLHTVNL
                     SDNAFGKRTSKPLVDFLSTHVPLRHLILNNNGMGPDAGVEIAGALEELAKRKDEARKA
                     GKEVPQLESIVCGRNRLENGSMKAWARAYEVHAAGMRSVKMTQNGIRQEGISSLLREG
                     LRHASNLEVLDLQDNTFTIMGSTALSEVLPGWTSLRELGVGDCLLSARGGVKVAQALA
                     GAKNEKLETLRLQYNDITAEGVKQFLHATKTALPSLRRIELNGNKFMEEDDNVTELRE
                     ILEARKEEHGKDDDPEEMWGVDELDELEEESDEEEEEEEEEEEEEEKAEKFVKDNVQA
                     EEAKVAQKQDKEVDELAEALGKTGL"
     exon            complement(1017532..1018785)
                     /number=1
     CDS             complement(join(1019982..1021362,1021409..1021571,
                     1021622..1021859))
                     /codon_start=1
                     /locus_tag="AO090020000410"
                     /note="glucosyltransferase - Alg6p"
                     /old_locus_tag="AO070329000150"
                     /protein_id="BAE63599.1"
                     /transl_table=1
                     /translation="MAPPPSSYRPRKKRKFPLSSTGSNNALIVDDGNGKHTPAFPLAS
                     FLWAARAGVSQWLILPLILMAVGLFRWAVSLWGYSGFQVPPMHGDFEAQRHWMEITIH
                     LPMSKWYTYDLQYWGLDYPPLTAYHSWLLGKIGTLFDPSWFALDESRGFEDPQLKVYM
                     RATVVVSEYLIFIPAVVNFLRRYTQMHGVPVWSASVALVAILLQPSTILIDHGHFQYN
                     TVMLGFVAASLDAILAGRMLWACIFFVGALGFKQMALYYAPVMFAFLLGICVFPRIQL
                     IRLVCISLVTVVAFAVLIAPLVVSAVSAGAQNELSSIPLPPLLQALPIKLDKSSILYA
                     PLLQLTQVIHRIFPFARGLFEDKVANAWCAIHTFYKLHRFEATLLQRVSLGATLASIF
                     IPCAIIFRHPRASFLLPALSTVAWGFFLFSFQVHEKSVLLPLLPMTLMLSGDGGLSKE
                     TRAWVGWANMLGSWTMFPLLQRDGLRVPYFVMTFLWAYLLGLPPSSLEVYRSRSSSDD
                     PSPLLEPHIITKLVHLCFYLAMVAWHVLEAFVPPPPGKPDLWVVLNVLIGAGGFGLTY
                     LWCLRKLVLQCWMIGRKVEKDTQKKNQ"
     exon            complement(1019982..1021362)
                     /number=1
     exon            complement(1021409..1021571)
                     /number=2
     exon            complement(1021622..1021859)
                     /number=3
     CDS             join(1023222..1023686,1023774..1024018,1024069..1024681)
                     /codon_start=1
                     /locus_tag="AO090020000411"
                     /note="nuclear localization sequence binding protein"
                     /old_locus_tag="AO070329000151"
                     /protein_id="BAE63600.1"
                     /transl_table=1
                     /translation="MESSSSSSESESEEEKPAKKEVKKAAKSSSESSSESSSESESDS
                     DSDEEMEDASSSESEEEKPAKKQKQESKKESKKAKESSSESSDSSESESESESEDEKP
                     AKKEVKKAAESSDSSESDSSDEEEAPKKAAKEASDSDSSESESDSDSEESPKKSESED
                     SEESAKDSKKRKAEEDVSATPKKTKTEEPAAGASANLFVGNLSWNVDEAWLQSEFEEF
                     GELSGVRIMTERDTGRSRGFGYVEYTNAVDAAKAFEAKRDTEIDGRKINLDYATGRPA
                     NREQGGFQDRAQARARSFGDQASPESDTLFVGNIPFSANEDSLHEVFGQKGSILGIRL
                     PTDPESGRPKGFGYVQFSSVEEAREAFNELNGAEIDGRPVRLDFSTPRANNGGGGGGR
                     GRGGFGGGRGGPRGGGGRGRGGFGGRGGGPPNKARGGIPEYKGTKVTF"
     exon            1023222..1023686
                     /number=1
     exon            1023774..1024018
                     /number=2
     exon            1024069..1024681
                     /number=3
     CDS             join(1025762..1025851,1026001..1027245)
                     /codon_start=1
                     /locus_tag="AO090020000412"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000152"
                     /protein_id="BAE63601.1"
                     /transl_table=1
                     /translation="MSLDERHETLIIGIPSSHVLHPVLLPRDPKYYIDSWIEVASQPS
                     SSSLSSIATNDDIITTGLRVEQHGSRAYHHRSRRRRLQRLAAVTAAQVDYSSREQSSS
                     QDEYEESESESDRVMTNSNEDMPQRPLGGPLLAHSGPPSMSDIPSSDEDDASTALGMR
                     ISSSPFVPQPNVFSHPPASQNPAWTRPVERRRPQPSEVSNSSRQTAIRRNSQAGIRPA
                     HRQSQQHSPYNMISPSYQADHDAALRSSLSTLLSCAAAARGLPKSDPQPSPASGPSRA
                     QPASFRLVSESVAMGEHLSEEVPTSAVETNTSRRPMSHNPTVASYSPRPSPSAPKVRR
                     RSSSPREHHASASRKSRRATTADSAASPTIMTWVISAGVVVLFSAISFSAGYVIGREV
                     GRMEASTGVGSVMGDGNFSGGRTSAACGQEAIKGGLKRLRWSSGAAGSGVIA"
     exon            1025762..1025851
                     /number=1
     exon            1026001..1027245
                     /number=2
     CDS             complement(join(1028011..1028862,1028924..1029496,
                     1029545..1029574,1029630..1029659,1029714..1029736,
                     1029789..1029840,1029900..1029947))
                     /codon_start=1
                     /locus_tag="AO090020000413"
                     /note="chaperonin complex component, TCP-1 delta subunit
                     (CCT4)"
                     /old_locus_tag="AO070329000153"
                     /protein_id="BAE63602.1"
                     /transl_table=1
                     /translation="MATAVSQGAAGNNAFKDKEKPMAVRTSNILAARAVADAIRTSLG
                     PRGMDKMIQTPKGNTIITNDGNTMLKDMSVMHPAARMLVDLSAAQDVEAGDGTTSVVV
                     IAGSLLGAAERLLSKGIHPTVISESFQRAAAAAVEILHNMSRPISLVDRSTLLQAAST
                     SLSSKIVSQHSGLLGPMAVDSVLKVVDPKTAENVDLRNIRIVKKVGGTIEDSEMIDGL
                     VLNQSVIKSSGGPTRIEKARIGLIQFQLSPPKPDMENQIVVNDYRQMDKILKEERQYL
                     LNMVKKIQKTKCNVLLIQKSILRDAVNDLSLHFLSRLKILAIKDIERDEVEFLCKSLG
                     CKPVANVDSFTEDKLGTADLVEEVQSSGARYVKITGIKSAPTTNQTVSIVARGANNLI
                     LDEAERSLHDALCVIRCLVKKRALIAGGGAPEIEVAQTLAKRARELTGTEAICWKAFA
                     DAMEIIPTTLAENAGLNSIKVVTDLRHRHAQGQHNAGVSIRSGGVKDDITEENILQPL
                     LVSTSAIELAAETVKMIMRIDDIALSR"
     exon            complement(1028011..1028862)
                     /number=1
     exon            complement(1028924..1029496)
                     /number=2
     exon            complement(1029545..1029574)
                     /number=3
     exon            complement(1029630..1029659)
                     /number=4
     exon            complement(1029714..1029736)
                     /number=5
     exon            complement(1029789..1029840)
                     /number=6
     exon            complement(1029900..1029947)
                     /number=7
     CDS             join(1030319..1030413,1030483..1030597,1030649..1030878,
                     1030930..1031809)
                     /codon_start=1
                     /locus_tag="AO090020000414"
                     /note="26S proteasome regulatory complex, ATPase RPT1"
                     /old_locus_tag="AO070329000154"
                     /protein_id="BAE63603.1"
                     /transl_table=1
                     /translation="MPSATGENWEKYKKNFADDEEPEKKITPLTESDIQVLKTYGAAP
                     YANALKQLEKQIKDKQASVNEKIGVKESDTGLAPPHLWDVAADRQRMAEEQPLQVARC
                     TKIIQDEKDSDKSKYVINVKQIAKFVVNLGERVSPTDIEEGMRVGVDRNKYQIMLPLP
                     PKIDPSVTMMTVEDKPDVTYGDVGGCKEQIEKLREVVEMPLLSPERFVNLGIDPPKGA
                     LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKAC
                     IIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDARGNIKVMFATNRPSTLD
                     PALMRPGRIDRKIEFSLPDVEGRANILRIHAKSMSVERDIRWELISRLCPNATGAELR
                     SVATEAGMFAIRARRKVATEKDFLAAVDKVIKGNLKFNSTATYMQYN"
     exon            1030319..1030413
                     /number=1
     exon            1030483..1030597
                     /number=2
     exon            1030649..1030878
                     /number=3
     exon            1030930..1031809
                     /number=4
     CDS             join(1032574..1032615,1032699..1032753,1032816..1032889,
                     1032947..1033110,1033168..1034556,1034614..1034833)
                     /codon_start=1
                     /locus_tag="AO090020000415"
                     /note="succinate dehydrogenase, flavoprotein subunit"
                     /old_locus_tag="AO070329000155"
                     /protein_id="BAE63604.1"
                     /transl_table=1
                     /translation="MSSLSLRSLAPASKISRALRDQRRLFSSTRPAARIFGSNPLRAR
                     EATGAIAEKYPIIDHEYDAVVVGAGGAGLRAAFGLAEAGFNTACVSKLFPTRSHTVAA
                     QGGINAALGNMHEDDWRWHMYDTVKGSDWLGDQDAIHYMTREAPASVRELEGYGCPFS
                     RTEDGRIYQRAFGGQSKEFGKGGQAYRCCAAADRTGHALLHTLYGQSLRHNTNYFIEY
                     FALDLLMEDGECRGIIAYNQEDGTLHRFKAHHTVLATGGYGRAYFSCTSAHTCTGDGM
                     AMVARAGLPNQDLEFVQFHPTGIYGAGCLITEGSRGEGGYLLNSEGERFMERYAPTAK
                     DLASRDVVSRSMTLEIREGRGVGPEKDHIYLQLSHLPAELLHERLPGISETASIFAGV
                     DVTKQPIPVLPTVHYNMGGIPTKYTGEVLTQDENGADKVVPGLYACGEAACVSVHGAN
                     RLGANSLLDLVVFGRAVSHRVRDIATPGKPHRELSSDAGAQSIKDLDFARTADGPKST
                     FEIRNAMQKAMQTDVSVFRTQESLDEGVAKVTEIDQLYDQVGTKDRSMIWNSDLVETL
                     ELRNLLTCATQTAVAAANRKESRGAHAREDYPDRDDENWMKHTLTWQKKPHGKIDLGY
                     RAVEHNTLDEKECKPVPPFKRVY"
     exon            1032574..1032615
                     /number=1
     exon            1032699..1032753
                     /number=2
     exon            1032816..1032889
                     /number=3
     exon            1032947..1033110
                     /number=4
     exon            1033168..1034556
                     /number=5
     exon            1034614..1034833
                     /number=6
     CDS             join(1035926..1036496,1036588..1037264)
                     /codon_start=1
                     /locus_tag="AO090020000416"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000156"
                     /protein_id="BAE63605.1"
                     /transl_table=1
                     /translation="MGPCSGKKQWYVCSQGPFQGCCSVDPCSAGGVCPDDDDATTVTS
                     ISTSTKVHTVTPTKPVSSKQSTFETSTTTTSRLETSNTPGTTTASTTSTSSTSTGTGT
                     SVADNVNADAETGHGTPVGAIVGGVIGGIAFLILLAIALCIAYRRGKKRVRQFTFLRS
                     PHTDIFKETTFNTDNKPPQNDTTTTEQVTHAPTKKEKAETSSLLTPTDYSTNGTTPIS
                     PTSTAAELDAFHLYPPQSPYTLFTHPNASTPEPSDTGVYTPRAELPAQPTRELINTPH
                     DQRQSLNQSISSQGPTHAELPAQPCRELINVPHSRRQQPATLPMTTPCEQVDECVTRA
                     NSPPVVTTDGVVLSANFDTSASPEADVLSTHGLASSHAMSFMDYDTARRSMLPAHRPE
                     WVDNPGEGVTDKSKGEKHSNRPE"
     exon            1035926..1036496
                     /number=1
     exon            1036588..1037264
                     /number=2
     CDS             1038479..1039129
                     /codon_start=1
                     /locus_tag="AO090020000417"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000157"
                     /protein_id="BAE63606.1"
                     /transl_table=1
                     /translation="MLDTFEPVVRFLAQYQGGDYVKGWAELWDKGDLIDWDKGFPNPA
                     LEDTLIQRRSIIGDPVVKDAGGSQYRRKALVPGCGRGVDVLLLASFGYDAYGLEYSHS
                     AVETCKKEESERGGRYPIRNLEFGRGSVTFVQGDFFDDAWLDALGLLPNAFDLVYDHS
                     VSRPVRLSICTMYCWRMIRESSCTHSAFGSFSVPWIHRSAPDGHCDKLSFLSPMAI"
     exon            1038479..1039129
                     /number=1
     CDS             complement(join(1039533..1040041,1040105..1040935,
                     1041010..1041064))
                     /codon_start=1
                     /locus_tag="AO090020000418"
                     /note="argininosuccinate lyase"
                     /old_locus_tag="AO070329000158"
                     /protein_id="BAE63607.1"
                     /transl_table=1
                     /translation="MSGPKAVAENMLWGGRFTQGLDPLMVQYNQSLPYDRIFWKQDIA
                     GSIAFARANVKTGILTQQEFSEIERGFKQIAEEWSTNTFAVKENDEDIHTANERRLSE
                     IIGKEIGGKLHTGRSRNEQVATDMRLWLRDELRRLDSILCDLIKVSISRAEAELDYLM
                     PGYTHLQKAQPVRWSHWILSHATAFASELQRLREVTKRVNRSPLGTGALAGNPFNIDR
                     ESMAKELGFEGLLYNSMNTVADRDFAMETMQWGSSFMLKISRWAEDLIIYSSLEFGFV
                     RLSDAYSTGSSLMPQKKNADSLELLRGKAGRAFGQMAGLMMTIKGLPTTYNKDLQESI
                     EPLLDHIKTVSDSIQIATGVLSTLTVIPEKMTAALAPEMLATEIADYLVRKGVPFREG
                     HHISGRVVALAEKTSVPMDTLSLEQLKTVDARFDEDVQTCLDYERAVELKDAVGGTSR
                     RAVLEQTSVLRSLL"
     exon            complement(1039533..1040041)
                     /number=1
     exon            complement(1040105..1040935)
                     /number=2
     exon            complement(1041010..1041064)
                     /number=3
     CDS             complement(join(1041554..1041586,1041651..1041685,
                     1041718..1041967))
                     /codon_start=1
                     /locus_tag="AO090020000419"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000159"
                     /protein_id="BAE63608.1"
                     /transl_table=1
                     /translation="MPIAWAFLGIDGSLATLHVEPEYRGQELALHVSKEAMRRGMAEG
                     SIWRHCGEEGEAWVHANVSESNIASRRVMEKLGGDIGWTYCASVQSVLLLGIMSHRLY
                     AIS"
     exon            complement(1041554..1041586)
                     /number=1
     exon            complement(1041651..1041685)
                     /number=2
     exon            complement(1041718..1041967)
                     /number=3
     CDS             complement(1043823..1044659)
                     /codon_start=1
                     /locus_tag="AO090020000420"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000160"
                     /protein_id="BAE63609.1"
                     /transl_table=1
                     /translation="MDVQGSGRDCWESSPCMEIHESSPLASIAYHSPSKKDPNDLRNS
                     HDGLSLRSGSLAESIGLDSEFNGHGQAPAVCVSESPCEYDMSPNRGMLTPTEEPPVDA
                     EFSQVDLNEWYPRYWACMQHFLNQGQHSPQVQSLAAFVNIRLPYQRSTVPVIGFPAPH
                     NMDSGVEGTYNAPSLRPFIRRLIVTGYDTPSVLQAFFGDDWQAGVGCVCKQERINYLF
                     TAKSGGWTSTKAAYDMLPDEQTPFLRPLRDATEEELRIAESRWSEWLAMEDWMVGSRS
                     PW"
     exon            complement(1043823..1044659)
                     /number=1
     CDS             join(1049698..1050250,1050331..1050856,1050921..1051122)
                     /codon_start=1
                     /locus_tag="AO090020000422"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000162"
                     /protein_id="BAE63610.1"
                     /transl_table=1
                     /translation="MARYSNIDDLDYADDSSDDGLHSFNDNNNSASSYRLTKYARPLI
                     DYVRNEWQSNPKYASLPTTNSDTSDYPRWVQMLGSIVTAPRFRRYVLVYTTVLVSCWL
                     GWKFVVSPRLEEHAAILHALDPQVKEEVGGWFGANALPRFDIIVQLRTLEPSLLPGEV
                     TSESDEHGGRRLIFIGDVHGCKDELERLLEETSFNPDTDHLIFTGDMINKGPDSLGVV
                     DLAREYSASCVRGDHEDRVLSLRHNMIAANTMNDEFLDDANMHRGQYTKERQLARQLS
                     EEQADWLDTCPVVLNVGQIKDMGQVVVAHAGLVPGVDLDKQDPYSVMNMLTVDLDTHV
                     PSSSRKGIKWTKVSYTLCFLRVCNRRLHETFENPESMLTTVIYGHDSKSSLSLKTYTK
                     GIDTGCFKGGKLTALVVGDGGKQKTVQVRCNNHT"
     exon            1049698..1050250
                     /number=1
     exon            1050331..1050856
                     /number=2
     exon            1050921..1051122
                     /number=3
     CDS             complement(join(1051454..1052900,1052972..1053570,
                     1055003..1055065))
                     /codon_start=1
                     /locus_tag="AO090020000423"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000163"
                     /protein_id="BAE63611.1"
                     /transl_table=1
                     /translation="MPVVSRLVSIVLRVVEIICGAESLSRGSLSTHPWLMLPKMHSDQ
                     TPRRGSRSRSSSPEKKLPDAEAYPMHILAHEDSSGNNPFVIVTRPSTDSVHADNHFQG
                     TDDFHGTNEPLLPTSTPRLRPDQESGQFSCSLSRIYTWIKGPSPPRKYLINPWLRRWQ
                     TAPGRLVERYFPSKSAKVWLLVLCLGVWGAVFIETLHYSISAQEIPGYGKPVKLPCYG
                     GLWSNATSCGINGDDCRPFDKGGFAFRCPAGCASTIVLEPYYVGPEEINYKNLVIGGG
                     TESSESNNYGIYRGDSAICPAALHAGLISDQKGGCGILRRTGEYSGFVSIEKNGISSI
                     GFPSNFPLSFTFGSGEFSDESSVSCQDLRWPLFTFSLIVTAILSLFTTSPAAFYASIY
                     FIVYFQVALSSDPPYSPDFYEVVSTALGRFLPCAFVGFALYYFCIRHTLKDLDAHWDK
                     TVLWLGPCWVGALNTDTFDKIPISRLTPHDIQQQPGAIPALVIIVVLLIAIVLTQALA
                     FRNEGRLPKMLSIYGIMVCGIVALLVVPNMNLRIHHYILSLLFLPGTTIQTRPSLMYQ
                     GLLVGLFINGIARWGFDSILQTAAALLNGAELGSILPVIGAPFVPSAQNIVFKFPDVA
                     EDADGISVLVNDVERFQAFKSDNGSVESFNWTRLKADEPEYFRFGYVKMNALGGLWYE
                     DFTKPVVWEADGVWNNSGHP"
     exon            complement(1051454..1052900)
                     /number=1
     exon            complement(1052972..1053570)
                     /number=2
     exon            complement(1055003..1055065)
                     /number=3
     CDS             complement(join(1056376..1057061,1057137..1057269))
                     /codon_start=1
                     /locus_tag="AO090020000424"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000164"
                     /protein_id="BAE63612.1"
                     /transl_table=1
                     /translation="MAPQLFPKNPSEVMVIRNVTSDVITMSLPFARFGRLKFGGRGTL
                     VKLASGAIAVFSPVSLTPEVREAISSLGGHLKYIAALDLEHHINITSWKEAYPDAEII
                     APEGLYEKRQSNPEYKDTPFQHVFRKENHGQQKISEEFDSEFETEYVYGHPSRELVFL
                     HKRSRTLIEADLLFNLPAREQYSKTGESATSGLLTKIISPLLSTNAPATWQKRFVWYI
                     LSSGDRKAFNESVRRIDKWDFNRLIPCHGDVVESGAKGVFRTVMEWHLEGRKNL"
     exon            complement(1056376..1057061)
                     /number=1
     exon            complement(1057137..1057269)
                     /number=2
     CDS             complement(join(1057832..1058016,1058072..1058917,
                     1058967..1059276))
                     /codon_start=1
                     /locus_tag="AO090020000425"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070329000165"
                     /protein_id="BAE63613.1"
                     /transl_table=1
                     /translation="MARISHSRRPSSQSSSPEPSSDKENRQVSARVEKRSQAQTMSSS
                     ANAKRQRLSNRASNIQSGSQSQVSPSQQDRDKQFYDPDQDEKERRRVRKGLRDLTREL
                     HDSRSEYMQPGNYGIRDTIQKANEYFQEVKQTSDATIDSRLLVSAADLSYKKTAHLVL
                     GDASAGIDVDEFVSKCISFMCRAPEDSQAMLSSTQRRRGQASGRSQADPNDSDEDQGD
                     AMNWDWLGRSACFRHNSRPSVSGFLLGPLSVQKRTRQITQRRARERIDPSQAVRPQEL
                     REEDLDRQETSNLTTMCTSINKLLARTQNAGQDMVERLLSQLEEEPTDEMVQKVMAQH
                     HVADDGGVPLFHFCINPRSFGQSVENLFYVSFLVRDGTVGIQVDSRHLPTLHAAKPYA
                     PSEAQRKGVQKHQAIFSLDFETWRDLIEVYGIEESIIPHREEEQHENTGHGWYS"
     exon            complement(1057832..1058016)
                     /number=1
     exon            complement(1058072..1058917)
                     /number=2
     exon            complement(1058967..1059276)
                     /number=3
     CDS             join(1059695..1059753,1059841..1062490)
                     /codon_start=1
                     /locus_tag="AO090020000426"
                     /note="phosphatidylinositol 3-kinase VPS34, involved in
                     signal transduction"
                     /old_locus_tag="AO070329000166"
                     /protein_id="BAE63614.1"
                     /transl_table=1
                     /translation="MEAFTFAVSTQVDFPIQIKIGSLEGKQKEVPFSILLKRPELRHL
                     GSVQNPTSDLFVTVQLWSDSKPLGVPLQTSYRTFKSVRAWNEWLQMPMSLKDAPYKCQ
                     LAITIWDLSPFGGEGAQGHYVPFGGTTISLFDEEGKLKMGRQKCKVYRHKAADGFSST
                     TTPSIPSTKRRKANAPDPLGPSPEEIELERVEVLIKKHEMGEIPRIDWMDQMVFRQLE
                     KLKINAEESARKRAILLKSTKQKHREKYGADGDDSDEGDLDDENFTLYVEFPRFDHPV
                     VWSDHEYPPPPVSSYPQNAPANPSSALKPAPEVRFGPGIEGADGEGVIRIYDPEVGQT
                     GNPCEDKHRRLIRSHRTGIMDRDLKPNPKIRDELNAILSYEPTQDLTAEEKDLVWRFR
                     YYLTREKRALTKFVKSVNWRDAGESHQAVEILPKWTEIDVDDALELLGPTFDNPAVRS
                     YAVERLRKADDEELLLYLLQLVQALKYEDNSNVDTEDAAHDSSLANFLITRAANNFKL
                     GSYFHWYLMVECDDTSPGTLSAQRRLFARVEYYFMADLEQVHPEHRKTLLRQGELVAV
                     LSKIAKDLRFSRDNRLLKIEKLKKYLKDPKNELVHIDPPLPLPIDPEISVTGCFPDNS
                     NVFKSTLSPLLITFKTSEGQKYPILFKVGDDLRQDQLVIQIIILMDRLLQKENLDLKL
                     TPYRILATNATAGAVQFIPSASLSAISAKHRSVLAYLQANNPDESEPLGVRKETMDTY
                     IKSCAGYCVITYLLGVGDRHLENLLLAPDGHFFHADFGFILGRDPKPFAPMMKLCKEM
                     VEGMGGTTSPHYLQFKQYCFTAYTTLRKSANLILNLFSLMVDANIPDIRVEPDKAVLK
                     VKERFHLEMTEEEAIRHFEQLIGDSVNAIFGVVIDRLHEFVQGWRA"
     exon            1059695..1059753
                     /number=1
     exon            1059841..1062490
                     /number=2
     CDS             complement(join(1062780..1063386,1063448..1064379,
                     1064416..1064484,1064584..1064971,1065105..1065163,
                     1065235..1065271,1065399..1065681,1065737..1066122,
                     1066185..1066297,1066365..1066472,1066527..1066576,
                     1066635..1066729,1066791..1066807))
                     /codon_start=1
                     /locus_tag="AO090020000427"
                     /note="Na+-independent Cl/HCO3 exchanger AE1 and related
                     transporters (SLC4 family)"
                     /old_locus_tag="AO070329000167"
                     /protein_id="BAE63615.1"
                     /transl_table=1
                     /translation="MQLNPSNMSSTTALDKINVVNDPRIRRCSATINGKTYGYLLAEP
                     EGGFTRTVFLIHGFPDLSMGWRYQIPLFLKLGFRVVAVDCIGYGRSDAPTGSLDAYSY
                     KSHADDLAELGKQLGCENIVLAGHDWGSVIASRFALYHPSFITHLILFVVPYLPPSPK
                     YIDTADLAKVVPTVGYQLQFGSAEGVVESHTQDKEGIRAFLNGLYGGATPEGKFAMDS
                     TRGFDFEVASKLGRTRLLSEEELQYYVEEYSRNGLQGPCNYYRIRQQSWTEEQSLLAQ
                     GKEAISIKCPVLYVHALADLVVNSEMPKAMVPFVPNLTVKEVEAGHWALWQKPAEVNT
                     FVTEWLQQQGLLDSAKLYMNMDSGFAWHESNVTVPTDSLHSLSIHYKSKPPRRRDERE
                     QSGIHEFEVEERDDAHSIITPSKHTPKAFRVLRGSVSAGGPLRPFRLVKQDIVNLRRR
                     YVSDWTIFNQLIFASAVYVFFTNLLPGITFASDLYVLTGKTWGTIEVVFSTGLCGIIF
                     SLYARRISMHCVTKFLRYFLAEANPPLVPFLPFMAWSLIHAAWLHYILAIINAHDWTM
                     RYVTTFATEIFSLLNSIIYFHKAIQELERAHDTLSFAAFLYAVIGAVGTMLLAIFLST
                     AESWKPLFHRYIRMGLTEYAAAISIIIFIGMPHIGELAHLDKMTLPVSSSFKPTSPDR
                     DKFFVEFWTLPVGWVFAAIVPGIIITILFFFDHEVSSIICTIDRYGTRKPGGFAWDII
                     LLGTTTALCGILGIPPANGLLPQAPLHSESLMHSEREQRTVITDGEEKVETHEVKRVY
                     EQRWSSFLHAGAILLFVSPPFMKVLGLTPTSVLAGLFMFMGEQSLSVNPILYRTFYLL
                     TPPSELPSLPSSLAKKPGDEDHNDNSNPPRPSYIPIHLYTILQIVITVAIFIVTLTRG
                     APAFPVLIVALVPFRLLVMKHWWPREVLRFVDAWACREGTPEDDEDAEAKKDEFSGDD
                     LAGRAGLGNETDGIFSSQLDESGCRPSGTPALISRSTSHPGEVGIADRNDSGQEWVEL
                     EYRTRQDEELGRSIKGC"
     exon            complement(1062780..1063386)
                     /number=1
     exon            complement(1063448..1064379)
                     /number=2
     exon            complement(1064416..1064484)
                     /number=3
     exon            complement(1064584..1064971)
                     /number=4
     exon            complement(1065105..1065163)
                     /number=5
     exon            complement(1065235..1065271)
                     /number=6
     exon            complement(1065399..1065681)
                     /number=7
     exon            complement(1065737..1066122)
                     /number=8
     exon            complement(1066185..1066297)
                     /number=9
     exon            complement(1066365..1066472)
                     /number=10
     exon            complement(1066527..1066576)
                     /number=11
     exon            complement(1066635..1066729)
                     /number=12
     exon            complement(1066791..1066807)
                     /number=13
     CDS             join(1067975..1068055,1069099..1069386,1069460..1070206)
                     /codon_start=1
                     /locus_tag="AO090020000428"
                     /note="conserved ATP/GTP binding protein"
                     /old_locus_tag="AO070329000168"
                     /protein_id="BAE63616.1"
                     /transl_table=1
                     /translation="MAARIMVLPQAIQAQPTYGKLQNDTGPNLPDYCSMAAKFIPRQT
                     FPSYTSIPRSYFLGHHRAGLKKMQNMLSSIDYVVECRDYRVPVTSINPMFEEALGKTR
                     RLIVYTKRDLGAESGSSAQQQAEKRIRNFDKNSAVFFVSSSSRPDVSSILKHLRNDAE
                     GPDKLVGCRVMVVGMPNVGKSTLINNLRNQGVHKAKAVQTGGQPGITRKIGTPVKIIE
                     RENGSHVYVLDTPGVFMPYVPDAENMLKLALCGCVKDSVISPVTLADYLLYHINLHDT
                     QVYERWSPPTNEIMPLLNDFARHTGLLAKGGIPNTDLAALHFIQKWRAGGLGKFILDD
                     LQAEERHRQEGTKDAVGTSMSQARKAERMARKQPQRL"
     exon            1067975..1068055
                     /number=1
     exon            1069099..1069386
                     /number=2
     exon            1069460..1070206
                     /number=3
     CDS             complement(join(1070444..1071199,1071307..1071309))
                     /codon_start=1
                     /locus_tag="AO090020000429"
                     /note="mRNA splicing factor"
                     /old_locus_tag="AO070329000169"
                     /protein_id="BAE63617.1"
                     /transl_table=1
                     /translation="MARNSEKAQSMLFRFRAQQAADLGIIDMGRTRRPKAITSVDSIP
                     MCEKWRGQVLKEISRKVSRIQEPSLSDYQIRDLNDEINKLMREKWIWEMQIRNLGGPN
                     YMRGSGRVYDDEGREIPGGGKGYRYFGRARELPGVKEMFEAAARRGRKPAEEEGEESR
                     GRGGDIATRKVDANYFGYGLDEEDGTLLAYEKQKEKEAVERLREKKEDDVEDGWEPLP
                     GDAGDGVEWRLPTLEEVQEELVDRRRRRLLEKIT"
     exon            complement(1070444..1071199)
                     /number=1
     exon            complement(1071307..1071309)
                     /number=2
     CDS             complement(join(1072224..1072652,1072715..1078709,
                     1078766..1078950,1079011..1079154,1079205..1079660))
                     /codon_start=1
                     /locus_tag="AO090020000430"
                     /note="myosin class II heavy chain"
                     /old_locus_tag="AO070329000170"
                     /protein_id="BAE63618.1"
                     /transl_table=1
                     /translation="MLPSQLNGSPKRANPFSRASPSPSPSPSPAPRAARPKSALITQS
                     SKFEEARGHFRNSSSLAQSTQAPFSRITSRQRSNSLRNDVTSGTFAPEFIKSEELQRG
                     ADQIRGLEGDNDFSGNKYVWLRDPEKAFIRGLILEERANGKLLVQSDDGEQREVDADQ
                     IDKVNPAKFDKADDMAELTHLNEGSVVHNLHTRYQADMIYTYSGLFLVTVNPYCPLPI
                     YSNEYVKMYKGRSREETRPHIFAMADEAFRNLVEEGENQSILVTGESGAGKTENTKKV
                     IQYLAAVATSDTPHARSGTKQLSILSQQILRANPILEAFGNAQTVRNNNSSRFGKFIR
                     IEFTRSGQISGAWIDWYLLEKSRVVKPNSQERNYHIFYQLLRGADPALRESLLLSGLG
                     IGDFAYTRDGNDSIIGVSDDEEWNALLEAFHIMDFSEDEQMHILRTISAVLHLGNVAI
                     VKESLRADQAALGPDALRSVEKACQLLGIPSKPFVKGLLHPRVKAGREWVEKVQTPEQ
                     VRLALDALAKGIYERSFGNLVNRINQRLDRSATTSDDSYFIGVLDIAGFEIFQNNSFE
                     QLCINYTNEKLQQFFNHHMFVLEQEEYAKEQIEWQFIDFGKDLQPTIDLIELTNPIGI
                     FSCLDEDCVMPKATDKSFTEKLHSLWDRKSPKYRASRLSQGFILTHYASEVEYDTNGW
                     LEKNKDPLNDNVTRLLAASTDRHVANLFSDCGDPDDEADYSKSRVKKGLFRTVAQRHK
                     EQLSSLMSSLNSTHPHFVRCIIPNHKKRPKMFNAPLVLDQLRCNGVLEGIRIARTGFP
                     NRLSFAEFRQRYEVLCRNVSKGYLDGQSIAQMMLDKLGLDPTWYRVGRTKVFFRAGVL
                     AELEEKRDELIRSIMTRFQSMARGFVQRRISNKRLYRAEATRIIQQNFGVYLKLKANP
                     WWRLFSRMKPLLGETRTANEVKKRDEKIQQLETKAKQDLADRQKLDEERRRTEIEIQK
                     IQQTLESERALALDKEEIFKRLQMREVELSEKLAGAIADQESLEDQLDELIAAKKRCD
                     EELHTRITQLEQAGEIIQRFEAEKHEMQAHLEEIDRRLLEAEQISAQKDGNIKELDQE
                     LKMLQSHLTLKDRKVQELEAKLLKVDQDLDIKLANTSKELDQSKKQVKDLIDENRSIR
                     QQISDLSVTSTGYEEMLRRKESEMAVLRNDVRRHEEDKQQLETERTSLSTRHDNMQKR
                     LRELQAETDAMRSEKAHLERELTDVKKLLDEKISEDAEAVESRKLLEQQIHDLKEQLF
                     QAQADLSRERQSRDDVQMLAEHNLTELRDKYTSLNDSKIIIEKEMYIQQDTLRRATEA
                     RLAAEQSRKELQTELIKLRDRFTSVENARLNAEAEIERNIKNQANERLDSVRKDLDEK
                     SRQVDEIEAERERLSIRVQELTNAIAESDNFRIRHDQHKERLERELVTLKGRLTASEN
                     DNRALLTKIQQKNLDIARSNSKASENSRLRVTTLQREKAKLEEDSKKLSRQLGDLQIT
                     ITSLEKQKEKLSLSLEDLNHEANRERKACRNAEKAASTANLQLAEANRNLETERQLRT
                     QAQANTRKLQTSLDTANKEIEGLHRQLMLLHKAVDPDSDRSPESWEEVQPDLSQKVDL
                     AQLLDTTRAQLQVTEEKYNRAESQLAEMRRRHGDEMRELDARYSSSKRALLEEIDQNQ
                     VAGNRTPTHLRKDSENGIAKKYNTPTTPNRRFNFNENANDSARSDRTVDTVGYQKRMD
                     MAAELEELQNKLQMSEMQNKHLQSQIQLANPLGDMRQDESPSVRRMQLLERENGRLHD
                     QLDDSAKKVSALERSIHLGDLSLRDVQAKSHEELYDLINSQEQSRRSLLKVHNEAIAE
                     FSDMKAQLEKLKRSKATLEVELRDSRSEAQELQLAKDQDAASRNQLLQEFADLQIRLD
                     AETSKSADLAASQSLYKTRADEYFSKLEQAEVTVLKATRAEQFAKAQAQEAEDTCARI
                     MSERKEMDSLVEDLQRQTQALEARMEDQAAELEGALQSKQRLQNELEDYRNQRAIDIE
                     DKETSMEQTRQKYQREFSTLNNELEMEREKILKVRGENSRLREELEDLRSKWDNEVLN
                     SSTWAKEKSRMEVMLQDVTTSRDEAVNAHNEAQSRVVTLLSQVRDLRTSVDDVTAERD
                     MLLKEKKMLEVRLTEAGERLEELAKGESPSMRNAASMNRELLELKSKLAQQEDVSAAA
                     VGKMRRADALVTEIQKEITAEREANAQLFKDKATLEKQLKESQLRCVDLETKSYSSGS
                     QDVKFLHKRIKDLEAHLEEQEAKHSSEQRSLRNVDRTVKDLQSQIERREKINAQLTDD
                     VNKARDKIDRLLRNIEELQHNDTDTQLQVRRAERELREEKEKSLRLERELQGWRALRL
                     ERGRGHVTFSDVGSRRGSNGFSSSDIPQRMPSNTKGFL"
     exon            complement(1072224..1072652)
                     /number=1
     exon            complement(1072715..1078709)
                     /number=2
     exon            complement(1078766..1078950)
                     /number=3
     exon            complement(1079011..1079154)
                     /number=4
     exon            complement(1079205..1079660)
                     /number=5
     CDS             join(1081179..1083132,1083199..1083995,1084050..1084343)
                     /codon_start=1
                     /locus_tag="AO090020000431"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000171"
                     /protein_id="BAE63619.1"
                     /transl_table=1
                     /translation="MSVNVEPVVPAGRIANEATVKPIGQDLSARSVFPPPTADPQLII
                     NGGKSPAQLRVQAQGALLSLAPHNIRYSELVGEGINPVILKQLYEEVGIKVPTPQPDA
                     VSTQASSLVSTPRGHSFTDHTASVETAGPGEKPPAEPVRADNVTQSTGLAENASTSTP
                     SSQPCAAKPMERKEVIARMLAAKAAKSTGVPTSPPRDLTKEAPTSGSSTTDIEKTSDT
                     GVAAEAPAQEKEVRVREKNKAQTELARQRIEQLKKQGLMRLQQKSTSSDASPSNDLPN
                     SKTTNDITPTLNSSSIQHPLPERPPDPETGAFARIPGLFMTEVAQASHDDPSPTPTQG
                     LVVDSTPQPRFNQRKRPRASDFDEPVPLPRKTSNNGVNNSVSGDRLIIDISDDDLYGD
                     DEDDAMDIETSQENDVPSVPEGPAGTYLSVESLPPRPATSSSQGFSLSATPQLPRNND
                     PEDLRRKHLEIQAMHKRIAELEKRKQAKLAASRTQSPRAADSEISPPGAFPPTDTEAC
                     ETPIQDASASAGHNSSQVNVMDALQETISSAPSHHPTSNGLSCRLGSMDAEQLKDMKS
                     KVLRKREIESGVPALDAEIKRSETRLAELNFEQEKLLLDITRGKEGRQQLLEELSNLN
                     TELDGVSLEEVESALDNLRTTQESTNEAYTSSNAFRIVQELQPITPDDKDIEMPSGSE
                     VSTQLQQQKGSAQEPSINTPTDTSNPPRPSDITAGQHDVSEVSRESTPTSSSDSTGSS
                     MDESSDSDSDDSDDDSDDSASVEQEEPNARPPVPDVPMSVVSDGVKEINQVAPSPLSE
                     DHHDPLPNQPQATNVTDQSDMSSSSSDQDIEITKDQASDNSTVSEAYEPPEPEGNASP
                     ANSVYSPPFSPASPGPVEPTVEPTVASSPVEKPQNTGEPSFGTVQELGVSQLGNNQVG
                     LLDNARQPVDSNHKYSPYVSPLKSFKAFRYHPRYTDEVTGGYRSLTYSHDIDPMVYLC
                     PFEAAGGVCNDRSCEFQHFRDMTLSGASTDLSKLHATPPHVP"
     exon            1081179..1083132
                     /number=1
     exon            1083199..1083995
                     /number=2
     exon            1084050..1084343
                     /number=3
     CDS             join(1087615..1087821,1087884..1088024)
                     /codon_start=1
                     /locus_tag="AO090020000433"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000173"
                     /protein_id="BAE63620.1"
                     /transl_table=1
                     /translation="MHSVTGRKGGGIIWEGKVKKETQQVACMICRYSASLTGGPRLEA
                     RNINLPESASSLPMVSAAKINTGSLFENAVRMTGGKCLNLFIDPYKMCNQRLLVDYWP
                     GFNVLMFVVDGFG"
     exon            1087615..1087821
                     /number=1
     exon            1087884..1088024
                     /number=2
     CDS             complement(join(1088299..1088365,1088671..1088972))
                     /codon_start=1
                     /locus_tag="AO090020000434"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000174"
                     /protein_id="BAE63621.1"
                     /transl_table=1
                     /translation="MPCYHEMSPFSQVPGRKERRDSVSSLASVSSTMEDDSLVHRPSM
                     SYVNVPDSSLHGLSGRVRTNGYLYICCNCHDGPKLYNNQPRCVMCQHVVCSDCQHVNV
                     LIFVMFDYHDGLMGPLQDKV"
     exon            complement(1088299..1088365)
                     /number=1
     exon            complement(1088671..1088972)
                     /number=2
     tRNA            1093560..1093647
                     /locus_tag="AO090020t00002"
                     /note="tRNAscan-SE"
                     /product="tRNA-Pro"
     CDS             join(1111670..1111744,1112687..1112951,1113096..1114151,
                     1114488..1115210,1115362..1115564)
                     /codon_start=1
                     /locus_tag="AO090020000435"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000175"
                     /protein_id="BAE63622.1"
                     /transl_table=1
                     /translation="MTGMVQTDLAHPSTSKYKDEPADEHLRHPGHQGPPHLQLQHPRP
                     ASLVQQQKHPNSPLQPSAGLSSGSYAPHALGNGVLHHPNPYGPPAQEPAYYASHPPYT
                     AASAPAQYPSSGPPEMMATATQMQRPYPPIYQTPQSGSPASVTSQSHEQHSRNLYSQS
                     PQMASQMYGYSPYSPINTVQPSPYAHSSSQHPLTSQSMILPHQTSSAPIPHTQAPAVT
                     MATSPSTVTAQQQPTPPQRTVLNPPLPTATSAPIPPSSVHHQNSAIGASTSAAPGPIP
                     ATTPLVVRQDSNGVQWIAFEYSRDRVKMEYTIRCDVESVNVDSLSQEFKTENCVYPRA
                     CCSKDQYRGNRLVYETECNAVGWALAELNPALRGKRGLIQRAVDSWRNSNQDPRLRSR
                     RVRRMAKINRRQGLPAQPPAHMATATPVAPGVPGASLTAPGPRPSLGPLAMGPPQLHH
                     HHAQPEGNTSNEEVSGTADYANGTNRPPAADSHPTPGHSPAEIRTAQVFHGFPAFPPP
                     TGGARGPSIPPLIRDSGIATLGRHPAVVTSSSKIEEVEDEDEDDDDERNPSNDALFGV
                     FPEGKRRKFILVDDNQRGCRVRVKVMLDQVDMNEIPDSYRMSNSVYPRTYFPVQMKNP
                     PGRVIPGRRYIKDENEEDDEETPTVGRILVPAPSVDGDSEIAVPKLSRARRKKEVLLN
                     DLGYRMSWSQSRVFAGRMLFLQRSLDAYRNKMRSTMLAAGQEPTAIPRHFETRAGKRR
                     FLERKRRTTAPLGRASGANTYSASRRSAEEVEA"
     exon            1111670..1111744
                     /number=1
     exon            1112687..1112951
                     /number=2
     exon            1113096..1114151
                     /number=3
     exon            1114488..1115210
                     /number=4
     exon            1115362..1115564
                     /number=5
     CDS             join(1117543..1119455,1119508..1119652)
                     /codon_start=1
                     /locus_tag="AO090020000436"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000176"
                     /protein_id="BAE63623.1"
                     /transl_table=1
                     /translation="MSGPHRSFSFNQGDDGAGDAGDVSPIRSQEGHFMNSPPRHNDVS
                     PVSARSQAMGSSPSSGFLSAHEHGDRGWGQNSGHTQAMRTNSTTPGMDNLGPAAVGGG
                     ISGIALGVANSHNRQSGIDAFRDTDGRNLPAERGYNTTGSDNPYVPTPPGGGSHGSAE
                     NLRPRDSYGSNVALGAAAAPAGQLTPGGSNPSQRSLFDSPYQGVGAMDAGPYQRQSAY
                     SAAGDYPLVINPDEIADDGDDGFTPVPNGKSASSNARAIPAAAAGGAAGGGLFGLFKS
                     KKADNPSYGPVPGAGLEAGEKSRWVKPTPGGGSRKRGWIVGLALAFIVVGAIVGGAVG
                     GTLGNRENEAPDTTKSASSDTESNGDLNKDSSEIKDLMNNPDLHKVFPGMDYTPWGVQ
                     YPLCLKYPPSQNNVTRDVAVLSQLTNTVRLYGTDCNQTEMVLHAIDRLELKDMKVWLG
                     VWIDSNDTTNDRQIKQLYKVLDDTKDISIFKGAIVGNEALYRAGNDIASAKKKLISYM
                     DDVRNHFKEKNYDLPIATSDLGDNWKEDLVTATDLVMSNVHPFFAGVTAKEAAGWTWN
                     FWNQNDVPLTKGTNKKQVISEVGWPSGGGNDCGSNNKCTDDTSGSVAGIDEMNQFMSD
                     WICQALENGTDYFWFEAFDEPWKVQYNTKDENWEDKWGLMDAARKLKPGLKIPDCGGK
                     TAA"
     exon            1117543..1119455
                     /number=1
     exon            1119508..1119652
                     /number=2
     CDS             complement(1120156..1121007)
                     /codon_start=1
                     /locus_tag="AO090020000437"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000177"
                     /protein_id="BAE63624.1"
                     /transl_table=1
                     /translation="MPHSNRKRNLNHHKRLEVTDSSGWTHVTAGGKSARRALRPTQQH
                     HDNSEQGKQSQILVPAEAPAQLNLEDLQTQFWGYRQRWEGSDSWRVVERALSSAPVKV
                     DRIVCIGLGSPSGFLKGGWVDRRSVSMYQLAGLVSVVDLMSESYVLDLLPFYRRVDIL
                     HTDVVRLEKSIPNLEVFAQDPVFNTHDRSLLASLDITVLDHPHGFEKVSPSTLLYCPG
                     AERTHLEQLLSHAPALVFGGPLEDIESDAVRQFVESRLSVKISRFEDMEHAFWNMRVY
                     SPEECEQ"
     exon            complement(1120156..1121007)
                     /number=1
     CDS             join(1121949..1122174,1122238..1122551,1122613..1122819)
                     /codon_start=1
                     /locus_tag="AO090020000438"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000178"
                     /protein_id="BAE63625.1"
                     /transl_table=1
                     /translation="MRTFQSSVSQWMAFLLMCLGLANAHTVIVYPGYRGNNLFTNGTV
                     AEANGLGVAMSPNATDSNSFIYPYGQQWIYPCGGMPTSTNRTKWPVSGGAVSFQPGWF
                     QGHATAFIYINLGLGTVPDNMSHPMISPFQINGPSNEPYPGTVCLPQVPLPANISVSP
                     GDHATIQLVETAKHGAALYNCVDIEFAEPEDVAEVTRDNCFNSSHITFSQIFAATSLT
                     SGAVAQGTTRGTFTSLLAAVLAAVMGAMMM"
     exon            1121949..1122174
                     /number=1
     exon            1122238..1122551
                     /number=2
     exon            1122613..1122819
                     /number=3
     CDS             complement(1123021..1124217)
                     /codon_start=1
                     /locus_tag="AO090020000439"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000179"
                     /protein_id="BAE63626.1"
                     /transl_table=1
                     /translation="MTTPLPLPEGITTRFIPTKTLTFHILESNPDPNTPRPLLLLLHG
                     FPELAFSWRKVIPPLAAAGYHVVAPDQRGFGRTTGWDTRPFSEVDLNTFTLTSFVRDM
                     VTLVHALGYRSVQCVVGHDCGAVTAAMCALVRPDFFRSVVLLSHPFNGSPVLPFGTSS
                     SSSSGEEGEEKGGGGGTESAAGDHVHDELAARGRKHYKWYYSTSPANEEMVEPVAGLG
                     EFLRGYFYLKSGSWGGNQPFPLEGWTAEDLVKLPYYYVMPLEANMREAVQRHMESESE
                     GTVAASKEWLSDEELAVYVGEYARTGFQGGLNWYRVRTAAGGRYTWDFDVYAGRKIEV
                     PAAFVSGKSDWGIYQEPGALEKMVDGRVCSDFRVLRLVDGVGHWAPQECPGVVVEVIL
                     ELLRGL"
     exon            complement(1123021..1124217)
                     /number=1
     CDS             complement(join(1124948..1125085,1125139..1125645))
                     /codon_start=1
                     /locus_tag="AO090020000440"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000180"
                     /protein_id="BAE63627.1"
                     /transl_table=1
                     /translation="MSIGEYSVDHFQTLPSLEVARTNFVKLNGDDLVKDVFKKFFVEQ
                     GMDRTFGLAMLHRHFDLEPGEMLVDYQGKSVPWSAGHVSGMKPPQPAIWAVSSDGAFK
                     QTEFYFSEEKGLTIGEEELRFMKRFQELLREHKVTQSFGLCRYPGDDFNGLCEITHGR
                     ANINLKPNDWPKNLSAVDTAWFFSEPIWTRGCRCTCNARSPDHPHGVHIYTVSG"
     exon            complement(1124948..1125085)
                     /number=1
     exon            complement(1125139..1125645)
                     /number=2
     CDS             1128591..1129082
                     /codon_start=1
                     /locus_tag="AO090020000442"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000182"
                     /protein_id="BAE63628.1"
                     /transl_table=1
                     /translation="MLRMQNNQVEKKVQARVEKVLKTRRRERFTGRTPIASIPQGVHI
                     PVEVLSWNQFCSDYAMDSGITFFNILPRYYTDSAPTCCREAVHAVTLASLARKLRESE
                     LMARARQHYSKAIAALNIALNDPVLTAEDSVLVTLLLFSLFEVSFALRLFPLRISRVS
                     LLI"
     exon            1128591..1129082
                     /number=1
     CDS             1129332..1130075
                     /codon_start=1
                     /locus_tag="AO090020000443"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000183"
                     /protein_id="BAE63629.1"
                     /transl_table=1
                     /translation="MSTFVDYELSDAKWFSFEELMAPWTSDPLLEPVLSRAIHFKRRA
                     QIQFTTTGSRSPRLEVLLQLIRDGSTISEELEAAAISVRRSSDPNMSSHQQLTTFNGM
                     FEVSTKTTEAIVRSLYRTVRYRVVELVRGLVARIGDGEDYSASCEFDSQVCSSEELAM
                     ILEQIHGDICAVLGLDPEHHAGDDNQGLAHRVFGMFFPITVLMFSSSAGEEKRVWFQE
                     KLRCMGEKTGLGLATWAAQKWNSHLCIPC"
     exon            1129332..1130075
                     /number=1
     CDS             complement(join(1133534..1133791,1133894..1135056,
                     1135124..1135157,1135210..1135340,1136779..1136876,
                     1137046..1137050))
                     /codon_start=1
                     /locus_tag="AO090020000444"
                     /note="aromatic amino acid aminotransferase and related
                     proteins"
                     /old_locus_tag="AO070329000185"
                     /protein_id="BAE63630.1"
                     /transl_table=1
                     /translation="MASSRSVSRRSPVPKFRGRVGKTRNDTAIQKSEAPQSACTGASE
                     KRRLLNEIYERRAKAGKLVAGVAAKSNSDLFKATGAGKPKAKRYDSHFSSECKSRLPC
                     VLQQTAGYLKTPGLISLGGGLPSSEYFPFYECTLRVPKPPHFSEKDALSPDSPTAQTV
                     SIGKYDVNNDLSEYDLSIALNYGQSTGSPQMTRFITEHTELVSNPPYADWKVCLTVGN
                     TSALEQTVRMLCDRGRNDSILTEEYTFSSALETFAPQGIKAFGIKMDEEGLLPKNMDV
                     VLSSWDETVRGARKPHLLYTVPSGQNPTGATQSLKRRREIYAVCQKHDIYVIEDEPYY
                     FIQMPHFEGKGTPAQKSSEDIESFLAGLVPSYLSLDVDGRVLRMDSFSKVLMPGSRLG
                     WITASAQVIERYINHAEVANHGPSGISQLMLWKLLDETWGHEGYLKWLMDLKNNYTRR
                     RDMLLAACEQFLPKAIVSWTPPTAGMFLWLKVDHSKHPEYPRRSIEELEEEIFLQGIS
                     NGVLCTRGAWFRTEPNTPASGMFFRTTFASASEEAMATAIQRLGQAIRQSYRIE"
     exon            complement(1133534..1133791)
                     /number=1
     exon            complement(1133894..1135056)
                     /number=2
     exon            complement(1135124..1135157)
                     /number=3
     exon            complement(1135210..1135340)
                     /number=4
     exon            complement(1136779..1136876)
                     /number=5
     exon            complement(1137046..1137050)
                     /number=6
     CDS             complement(join(1137705..1137761,1137847..1138266))
                     /codon_start=1
                     /locus_tag="AO090020000445"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000186"
                     /protein_id="BAE63631.1"
                     /transl_table=1
                     /translation="MQDTVFAVARWPFWRILAYTDPRYAGAIVQHHITLWDEIWGGDE
                     GERCREKFVEHYNYVRKVVPPRRLLEYQVQEGWGPLCRFLEVEEPKEPFPVVHTGSQF
                     MRTAARGWWDCVGRSIRNVTAAAVCLWILVYGFFWGLETSAKGCSPSRRVTDLIDS"
     exon            complement(1137705..1137761)
                     /number=1
     exon            complement(1137847..1138266)
                     /number=2
     CDS             complement(join(1138391..1138611,1138669..1138753))
                     /codon_start=1
                     /locus_tag="AO090020000446"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000187"
                     /protein_id="BAE63632.1"
                     /transl_table=1
                     /translation="MANLQSVREPRNREMKILILGLARTGTSSLTAALQQLGYSPYDW
                     PDRCVLGHLPRWTEGLQAKYLSRGRPLEADEMDQLTSNFDVLRSIPYPSAFSMYHLG"
     exon            complement(1138391..1138611)
                     /number=1
     exon            complement(1138669..1138753)
                     /number=2
     CDS             join(1140295..1141256,1141644..1141650)
                     /codon_start=1
                     /locus_tag="AO090020000447"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000188"
                     /protein_id="BAE63633.1"
                     /transl_table=1
                     /translation="MNPPGVEKAISLAAGTLMKGSGLEGTPMLYHQTDTLLEYHPRDL
                     PFCITHHAPFHRHFAGVFSEALAAHAYGDADKAEHLARKQEVGIKLLKHRVNGHVLQI
                     SRLQGKLLLSYGVNAAKIREICPSIQLSSSSYHVESEIAEVFNTGGVTLFTAVARVDY
                     FKNVDLLVDVAVALWSQNIAVRLFIAGGASMDSTELHELSKKVPRQFTRYATFRSKLS
                     RTSLHALFRLAKDSGVFICPSRYETLGVTPLEAALSGVTSLIANSSHVEASRYFPERF
                     RFQPVKEELCQTILNLQGRNLASLGEILRLHVEAQVSDQRFRMDLL"
     exon            1140295..1141256
                     /number=1
     exon            1141644..1141650
                     /number=2
     tRNA            1141924..1142078
                     /locus_tag="AO090020t00003"
                     /note="tRNAscan-SE"
                     /product="tRNA-Glu"
     CDS             join(1143286..1143345,1143389..1147414)
                     /codon_start=1
                     /locus_tag="AO090020000448"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000189"
                     /protein_id="BAE63634.1"
                     /transl_table=1
                     /translation="MFRRRRSASHHQVGLQYSNLPLSTSNAQSAQSAASHAFLKSQPS
                     SSSLSSAAAAAALRSLTPTPTPVENVQTKRMIQRRASVASQSSIAGSLRPSSQNTLRR
                     ANSSSSMSNRTFRDQSPRRPASSSGPVPVAPPIPSIPREYATRTPPNRRSVSVGPSLR
                     PTSPVKRQPSGRGVSVDPAARGSASRSSAHGHELDQIPELQRAGSRNSINFSYPMNSR
                     PNSPTLTSEPLDRRDTSVCASLASQLSSPDSPKIQKSALQTANTSARRKTRGGLSGSP
                     GRGVQPADTAILAAQAAIVPRSEEAAYQPSPPRLAAPREQNTRDLAYKAPKARETAGR
                     SVHDQQDQLQPRDPEFSQQLPETDHKQPPRPVLTKRPSTVPEDFPGEERAEADTPAEG
                     VEHAAVERSLPETRSTVRTPTPEKFKDPLPSSIVSSPESTSSIGPERESQLLHARPPS
                     SSPGRSTRFSNQLSVMGLVGEHLHQPPPRSVSPAKSAMKNPRKCSVSPDGRTGVVLRP
                     GPALSELSDGTSVGSDEGSRLGFRRKPVKVSFDDEAEIVGVAASPPTSPEDIGLESPP
                     MKPKGKTGWFGMGKRKSATVGSDEFDEVFKPRPELPSFGSIRKARDGEQQEPARQDMS
                     DNESTASSDPTVSPISFSNDHAIGAIISNTQSQDANPHTQLDRTASPTPAAAAKSGVP
                     LEGPGGNTFVSNQGSQPAQDAQSASLNSHQDEKLETTENLAVPGIAVQPATPEGERGR
                     SSLDWYTVPGGFPRSSLEVDTTSHDSTKRKGKKQTPGDPVVDATRSNVSDEDESGESI
                     YSDAEEGLEGDGFGSINAVVDEPTSPQRKDAVTTDNNIHSIDQVTGIPQTCQIARVAN
                     PVHTISLSPVSESPSSSHERLPYSSPYPPFPARSNSRRNMREIPRSSSSTGTARRSMS
                     VNAPDGHPVCEATDSVVHGPLQPQSGNVFNQPRHKPGDEQIKKRPASWAPNLLKGGLN
                     DDLYVNGNVPEPQRPLSNGSDSSSSFKRSNRPRTDSPHTIRRSLRGPSSSPFRTISPQ
                     STKLPPTNSRPLSSGSSTGALRVTLRSNDARREKPAFFSTGKVQKARTTKASGALFTS
                     RFAESDDEQGTSQQKWQSRFEDSSDDEERVVNNLPPVRGIPRRKGAHDGDSTELEDSS
                     DNERPGLDSRATKAKESDARPARNPALAAVAKSRGMSEEEMEEFLRQPGGRRGSLFHR
                     LSIRKPKAPSERRTSRSRSEARNGSLDPEQVRENPLLDGARGNTVTTITTNNTRPSSS
                     PRRLRRAISRSSNGDSWPLRSDRRETNTDAPLSALRSSERPKTADGAFRNGSTASNAV
                     DASAKKADLSSTNATDAMDVEFASGRKKRFPRLRKAFGLRS"
     exon            1143286..1143345
                     /number=1
     exon            1143389..1147414
                     /number=2
     CDS             join(1153484..1153505,1153656..1154164)
                     /codon_start=1
                     /locus_tag="AO090020000450"
                     /note="predicted protein"
                     /old_locus_tag="AO070329000191"
                     /protein_id="BAE63635.1"
                     /transl_table=1
                     /translation="MGYYDDDVSRDGAHHAVRVVEPRSSGRRSADTVPIPCNFIRIGD
                     ILILQGRPCQVIRISVSPQTGQHRYLGVDLFTRQLQEESSFVSNPSPSVVVQTMIGPV
                     YKTYRILDIRDNQIVAMTETGDVKQGIPVVPQGELFSKIKAAFEDGHGSVRALVINDG
                     GRELVVDYKVIQSSRL"
     exon            1153484..1153505
                     /number=1
     exon            1153656..1154164
                     /number=2
     CDS             complement(join(1154979..1154991,1154997..1155276,
                     1155343..1155667,1155713..1155808,1155848..1156167,
                     1156226..1156243,1156365..1156410))
                     /codon_start=1
                     /locus_tag="AO090020000451"
                     /note="predicted protein"
                     /old_locus_tag="AO070284000001"
                     /protein_id="BAE63636.1"
                     /transl_table=1
                     /translation="MKTVYEALRRLINVIGGAGRQARVFNIPRTTLQRRLSGYTFRTD
                     TRANSHKMTSSEEESLKEWILSLDKRGAPPRPAHVREMANILLSKRDTTSPSTTVGEK
                     WVYNFTKRTPELKACFARRYNYQRAKVNEAIQKYGIASSDIYNFDETGFAMGLIAAAK
                     PGNREWVTAIECISSNGWALPSCIIFKGKVHMEAWYENDKIPSDWRIEISPNGWTSNE
                     IGLRWLQNHFIPYITGRSVGKYRLLVLDGHDSYLTPQFDQICVENDIIPICSYGGLIE
                     SKMRCGFNHIDKLDFLEVYSQAHAATFTDSNIYSAFRATGLVPLSPERVFSQLTVQLK
                     TPTPPGSRPSSRGSSAPKTPYTVKQLKKIYA"
     exon            complement(1154979..1154991)
                     /number=1
     exon            complement(1154997..1155276)
                     /number=2
     exon            complement(1155343..1155667)
                     /number=3
     exon            complement(1155713..1155808)
                     /number=4
     exon            complement(1155848..1156167)
                     /number=5
     exon            complement(1156226..1156243)
                     /number=6
     exon            complement(1156365..1156410)
                     /number=7
     CDS             complement(join(1157721..1158421,1158479..1158735,
                     1158820..1159098,1159337..1159935))
                     /codon_start=1
                     /locus_tag="AO090020000452"
                     /note="PHD Zn-finger proteins"
                     /old_locus_tag="AO070284000002"
                     /protein_id="BAE63637.1"
                     /transl_table=1
                     /translation="MTPRRSSRARTSQPSPAILQHTNSSSSSASLTRERSTRSNAKNP
                     SPQGSSGHRSQSIDDADAAKLDFPQTRQRQRARGDEEIDKIAEVEEEEGEEDEEEEIT
                     RCLCGQQEYPGLPPSRRDLLGRNGMHGRVKDDPILNFSADSSDLMSDEIGSMFIQCDQ
                     CKVWQHGGCVGIMDEAMSPDEYFCEECRKDLHRIKNESNGQYSSQYLPVAPPSPASSS
                     RDSSRDNSKRTKDSKSRQNDPSNPKRRSTMNSRDAAYDEEEQIRRAIEESKEETKPAS
                     EEIAARRGKRSRSDSEAHKQAAKRQRTSSPSPGATSNKQSNPVSQPASEDEKAKAATN
                     GTRRQRAASRSQHNKETKDVEEPEAEQPDATNRRKGRSDRRKGDGTDSDHEAVSPTKT
                     VATNLEPPQPSPDTTAPAPEPAPSRPSTRKSGRPPARRGGRVGRNQYTRDRDVNGNGD
                     SSFMMNSPRRGQSHDTNGDSPRVGGANGTYLNGSESGKPSRPRYVNQRTTMNEMKRRV
                     AAILEFISRMQVEMASAGESTTPPGVNSDRLNGILMKAVSEQLENAMASTVSEADSGT
                     ATTDGENGAVSTEKEFKDLSSVEMMDVLTRHLLKWQQEYGKFGER"
     exon            complement(1157721..1158421)
                     /number=1
     exon            complement(1158479..1158735)
                     /number=2
     exon            complement(1158820..1159098)
                     /number=3
     exon            complement(1159337..1159935)
                     /number=4
     CDS             complement(1160033..1160497)
                     /codon_start=1
                     /locus_tag="AO090020000453"
                     /note="predicted protein"
                     /old_locus_tag="AO070284000003"
                     /protein_id="BAE63638.1"
                     /transl_table=1
                     /translation="MGSWVSRRKFASRGRAKAGKKADRPAANEDSGMASNPSPVTVPV
                     THSVLLAFRFSLSSLDFSLARSLFSQKASPHPSDYVVLGFGASSLSLLLDLLILLSQL
                     PAPLPFSNALLLFLCIIFSFLYESLSTPSYLLACDSLPTGSVCSTSPFADSL"
     exon            complement(1160033..1160497)
                     /number=1
     CDS             join(1161342..1161356,1161452..1161531,1161891..1161976,
                     1162573..1163345)
                     /codon_start=1
                     /locus_tag="AO090020000455"
                     /note="predicted protein"
                     /old_locus_tag="AO070284000005"
                     /protein_id="BAE63639.1"
                     /transl_table=1
                     /translation="MVYTCNRLWECQPGDRRMTDQRQSTPSYGARFRGLCRGPSLPTT
                     WATKKSASAVSVNSSLDGMYNTAPDTPSPVYPDRLIRPLPKRTLRSRLSSEAAESIFY
                     PPAPPATHLFYGTCTDNGDAVNESKVYVQQCDGPEQTPERDHHHPYENGFDAESGDED
                     GPVVVRRSAGFRESSSSPTMPPGHPGNGPRTQIKSSSAGPDGYDAFENTNNKKKRKIP
                     TPGTLAGHHSTLSPEFSSMGLASSAPTSGEGSHVSTFYGTGSPASPVSNGLSGAGRGR
                     LGRHGARSSTGRASLSLHTQVSWPQARTSGRRDGVLSSPGM"
     exon            1161342..1161356
                     /number=1
     exon            1161452..1161531
                     /number=2
     exon            1161891..1161976
                     /number=3
     exon            1162573..1163345
                     /number=4
     CDS             join(1163712..1164220,1164407..1164434)
                     /codon_start=1
                     /locus_tag="AO090020000456"
                     /note="predicted protein"
                     /old_locus_tag="AO070284000006"
                     /protein_id="BAE63640.1"
                     /transl_table=1
                     /translation="MDQQGQSSHRAPGAEPTTVGKKKKRSPGSIYALAARQRKIQQQY
                     ANLHHPPSMEDIWICEFCEYESIFGRPPEALIRQYEIKDRKERKRLAEKKRLLEKAKM
                     KGRKNKKATKNVTKNAAAQPAAYDQGYDRASVDHSSMGGTGLHDDDYIANEDDEESVS
                     APPAPPATPTLGFCMIAF"
     exon            1163712..1164220
                     /number=1
     exon            1164407..1164434
                     /number=2
     CDS             1165695..1166375
                     /codon_start=1
                     /locus_tag="AO090020000457"
                     /note="predicted protein"
                     /old_locus_tag="AO070284000007"
                     /protein_id="BAE63641.1"
                     /transl_table=1
                     /translation="MWWMLLFKAFKIGNKAYKTHKNKNGNDDTLNPNSINLSSTITTP
                     PPPPPPLKTRLKAHIQLLLHFLQLVFGLTVVGLYGRDVRAAHKNGDAQNAKWVYALVT
                     GVLGAGTGLVYLGYGVVMMKMGKLGRERMVVGSLGRLGWGFVLVVLWLVVFGVFGGLY
                     IGVYGEGSEEEVEKTKRMRHAVWVDLVNLVFWVAGMVIEGLRWWKLRGGPGAGGDLEK
                     GEKEVAPA"
     exon            1165695..1166375
                     /number=1
     CDS             complement(join(1166650..1167275,1167350..1167584))
                     /codon_start=1
                     /locus_tag="AO090020000458"
                     /note="predicted protein"
                     /old_locus_tag="AO070284000008"
                     /protein_id="BAE63642.1"
                     /transl_table=1
                     /translation="MEDINQSIPKPKTVFVKGKNTKRRPVIMRRKSSQTSSSTSTRTQ
                     SPQRTSKLLTLGARTKPSKQEDSSDSEAEAVHIEHVVPREKSSDTTDKPPELPPEFLR
                     SLKEILTNEEPVPQNSKSTPPKWGFVTTDDWTHYDVRYLSAENYEQPSSESLVDKGFR
                     SRFTEQVGLEKEYLAKSVGASSRDGLLQFLQSRSFEIKASDASHAPPDSTVDTSATST
                     GIPIPTPNTDSSTTLSTNSPSRATFGGFPTLLTPFSLTRGRSQLSLLIEEHRKSQPAE
                     SNPVGSDEQE"
     exon            complement(1166650..1167275)
                     /number=1
     exon            complement(1167350..1167584)
                     /number=2
     CDS             join(1173192..1173239,1175065..1175554,1175628..1175923)
                     /codon_start=1
                     /locus_tag="AO090020000459"
                     /note="dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /old_locus_tag="AO070284000009"
                     /protein_id="BAE63643.1"
                     /transl_table=1
                     /translation="MLSNGIWMIPLYAASGLLWFVLLICHPGIGAAIARGFASAGCDR
                     IAITDLNPTSLDETKQAILSSHPQAHLVVRAGNIADEQFVDSFIAEVAHTFGRLDYAV
                     NCAGIFGDALRSTEMSTETFDQINNVNYRGCWLSSRAELRQMIKQEPLPSHDPSRSPQ
                     RGAVVNIASQLGMVGRPKAPAYCSSKAAIIAMTRSDAIDYSKDDIRVNCVCPGIIETP
                     MTTHSEEILGRLRPAVDIAPMRRMGQPDEVADTVLFLCSSFASFVQGHALVVDGGYVL
                     N"
     exon            1173192..1173239
                     /number=1
     exon            1175065..1175554
                     /number=2
     exon            1175628..1175923
                     /number=3
     CDS             complement(1176845..1178038)
                     /codon_start=1
                     /locus_tag="AO090020000460"
                     /note="predicted protein"
                     /old_locus_tag="AO070284000010"
                     /protein_id="BAE63644.1"
                     /transl_table=1
                     /translation="MPSKPNLIFLTLLASSNVLANQCFSANSDAPKENFLKCCSVTSG
                     GKGVVAGYDFDYMCNKYPSAYEPGQRGFKTAQACAEYCATDPQCKASVWRASSKLCAK
                     VTATSYEAVSGDGWLLVEKSEKSDKLSDDCQGKIDSAIKGYKEKEAKCQKENGACGEK
                     IARYETEKLRSEKNLDECQSSKDALLQENRNSLEKTMQCESKKTVLESQLDQCQKDQA
                     AETTKCKEKFQQCEAEKAFAAHQCEKDRREAEDKCTEEKGALEERIKTQKCTGKCQVG
                     HTTASTVDRILSSPKREAFISDLKALTVFVLDDYDLEKSKEEVRKFTSRYELDFKLWG
                     HDSRYITGLSQAEGRAAWEDKSAPLLDRARGWESELANHLNGKWWMTWYDVARFLGDL
                     LEYVE"
     exon            complement(1176845..1178038)
                     /number=1
     CDS             join(1179426..1179699,1179755..1180122,1180171..1180248,
                     1180288..1181364,1181418..1181429)
                     /codon_start=1
                     /locus_tag="AO090020000461"
                     /note="predicted protein"
                     /old_locus_tag="AO070284000011"
                     /protein_id="BAE63645.1"
                     /transl_table=1
                     /translation="MHLTAALTLFLAAAQASPPIQQVIGTSGRSLHRWSLDDIVTSYF
                     GDASKCCPKGTQFDGERCVLDGPKCDNGKLVDGKCVTDPICPVGQWNVEMFVSMSPVL
                     HVGMAQNPTAMSVSPRGPLSVTTPATSSREEFVLVPRNQSARMDRSPVAECVSARSLQ
                     CVVAMRNGPLSSKSAFLERLLSASRASSTTAFVFLILTRNVSTMRISTTRRPASTENA
                     LAKLSRIARIDTLTATIWRLRLLAIPSPGRTGAPPTPPRARTAVRSHLVVLPIARLNL
                     ERAMANALAEVPSAPPCSTMNPVSMPASRTRIPNVWSLAASSRTAGVFWSSPLNALRA
                     PARKVTIVLRSPNPTVRAKTKEKPTLTEPSVFPTRLLSVRIRAPNMTARSALLAVSRS
                     ATRPMDSSSKVAAACRQRPPSVLTVVSSMLRASVFPRESLSARPATSLARTVWLVLSN
                     VPREPGMARTVSSMKIPGALPTINGFPAKASVSLSKRLNAERAITRRTENVSPSTTRF
                     VATMAQSGTPRLRLVLEPSPSVKTVVSLREASVSLRRFPGAQIPSDSNSTARNVYSRR
                     ALIVLRVSDCSRASVFRRLALSVATARLQRMAAPLL"
     exon            1179426..1179699
                     /number=1
     exon            1179755..1180122
                     /number=2
     exon            1180171..1180248
                     /number=3
     exon            1180288..1181364
                     /number=4
     exon            1181418..1181429
                     /number=5
     tRNA            complement(1184949..1185053)
                     /locus_tag="AO090020t00004"
                     /note="tRNAscan-SE"
                     /product="tRNA-Met"
     CDS             complement(join(1186527..1186750,1186809..1186887,
                     1186948..1187304,1187359..1187482,1187544..1187587,
                     1187647..1187796,1188992..1189072))
                     /codon_start=1
                     /locus_tag="AO090020000466"
                     /note="mitogen-activated protein kinase"
                     /old_locus_tag="AO070284000016"
                     /protein_id="BAE63646.1"
                     /transl_table=1
                     /translation="MSGRVWPRSEVSDCHGELGEDDMRREGANKRGLSSAYDQITQQH
                     VAVKKMMNPFANASIAKRTYREVKLLKQLRHENLIGLCDIFISPLEDIVLMPGFARYL
                     VTELLGTDLGRLLRARPLDNKFAQYFMYQILRGLKYIHSAGVIHRDLKPSNLLVNENC
                     DLKICDFGLARVQEPQMTGYVSTRYYRAPEIMLTWQRYGKMVDIWSAGCILAEMLRGK
                     PLFPGKDHIHQFFLITEVLGNPPPEVVQKITSGNTQRVVNSLPNQEPRPLRAVFHEFD
                     NDVISLLEQLLLFDPDKRLTAETALQHPYLAPYHDPDDEPAALEKFDWSFNDADLPID
                     TWKLMMCVAIGSAKCAPN"
     exon            complement(1186527..1186750)
                     /number=1
     exon            complement(1186809..1186887)
                     /number=2
     exon            complement(1186948..1187304)
                     /number=3
     exon            complement(1187359..1187482)
                     /number=4
     exon            complement(1187544..1187587)
                     /number=5
     exon            complement(1187647..1187796)
                     /number=6
     exon            complement(1188992..1189072)
                     /number=7
     CDS             complement(join(1190752..1191177,1191243..1191937,
                     1192002..1192112,1192162..1192303))
                     /codon_start=1
                     /locus_tag="AO090020000468"
                     /note="oligosaccharyltransferase, beta subunit"
                     /old_locus_tag="AO070284000018"
                     /protein_id="BAE63647.1"
                     /transl_table=1
                     /translation="MRWCLSLLLFGFLAVVHALSSSGNRLLVVLEDEAEKDAYSTFWG
                     DLEARGYNLAFESPKSDKLSLFELGERAYDHVLLLPPRSKGFGPSLNPKNIIEFMNKD
                     GNVLLALSGKSTTPSAISSLLLELDLHLSTDRSSVVVDHFDYDTLSADEKHDVLVLQR
                     PGQLRRDTKAFFGGEGVLAFPRTAPHTLGDSNPLLAPILRAPATAYSYNPKEDVGSVE
                     DVVASGSQLALVSAMQARNSARFTLLGSVESLQDKWFSATVKAPGDGKESETANREFA
                     KQLTAWTFKETGVLKVGKIEHHLAEGGELNPKIYRIKNETVFSIEVSEYSYDKYLPFE
                     VPENDALQLEFTMLSPFHRLDLQPSAKTENSTIYSTKFTVPDQHGIFSFRVNYKRPFL
                     TNIEEKHEVTVRHYAHNEYPRSWKISGGWVWIAGLWSVIGGFLAFVIVWLYSAPTSTA
                     STTKKTQ"
     exon            complement(1190752..1191177)
                     /number=1
     exon            complement(1191243..1191937)
                     /number=2
     exon            complement(1192002..1192112)
                     /number=3
     exon            complement(1192162..1192303)
                     /number=4
     CDS             complement(join(1193506..1193717,1193778..1194117))
                     /codon_start=1
                     /locus_tag="AO090020000470"
                     /note="predicted protein"
                     /old_locus_tag="AO070284000020"
                     /protein_id="BAE63648.1"
                     /transl_table=1
                     /translation="MTYYSQWFCMAVAEDRTYYARDGGAAFYRAIYTGGDAYLDTEEQ
                     ANTNAFHMSVYRAKMLDKALNILKSGMSKFVSVLLVNESHYDPDLMGELPYLTCCKVD
                     DEELPWVTWPNDSDQDEDAEIDITEPESTTGEVTSADTSATFATDTLPVDTDITDVES
                     IETEDENKNASVVDEAEERTTAE"
     exon            complement(1193506..1193717)
                     /number=1
     exon            complement(1193778..1194117)
                     /number=2
     CDS             complement(join(1196355..1197002,1197090..1197134,
                     1197243..1197389))
                     /codon_start=1
                     /locus_tag="AO090020000471"
                     /note="predicted protein"
                     /old_locus_tag="AO070284000021"
                     /protein_id="BAE63649.1"
                     /transl_table=1
                     /translation="MTGRLGYEGRPERQNEYFIPGDGISREVIQADICRYLGNDALVR
                     PGNHQGRQGYFIRAYRNLTSEMIADLKADSARWEADVLRRADQGYPRGSYIQDYSVSQ
                     PPPNMVPATYASSSLHEGRQQPGPSPPPAYTAPPPQQYVDPYTQPPYAQTQSPPYPTS
                     SSYPANHSPFGSGQTYPPPQVPYSAPSQPPVSADMHQTYTYTSAAGYGYENGRNNPRY
                     PGPGYETESDYSPVTSGIAYPATTAPDPRIGGMDPRYTPESAYSDRSRPQPTRERDPA
                     RRR"
     exon            complement(1196355..1197002)
                     /number=1
     exon            complement(1197090..1197134)
                     /number=2
     exon            complement(1197243..1197389)
                     /number=3
     CDS             1202143..1204164
                     /codon_start=1
                     /locus_tag="AO090020000472"
                     /note="DNA polymerase iota/DNA damage inducible protein"
                     /old_locus_tag="AO070284000022"
                     /protein_id="BAE63650.1"
                     /transl_table=1
                     /translation="MSRSSPDPFVASPSSPSHPVKNHSRYTYRQLQLLRQSSTASPLR
                     VIAHVDLDAFYAQCEMVRLQTPREIPLAVRQWDSLIAINYPARAFGITRMISAKEARK
                     LCPEIVLQHVATFREGEGGKWAYREDSYKRMNTDKVCLDPYRAESRKILKTMKEELSR
                     WYTDLVDEERGLGPHAQIQQASVEKASVDEVFIDLSPLVYGVLLRRYPELRNGPDGDD
                     RVASLPRPPTTALEWNQGDCLVDLDENETEVDDPDWDDVAMLIGSDIVRAVRTVVWDN
                     LSYTCSAGIAKNKMMAKLGSSSNKPNKQTIVRNRAIQTFLGGFKFTKIRMLGGKLGDQ
                     VTALFGTEQVSDLLQVTLEQFRAKLDDDTANWLYGIIRGEDKSEVNPRTQIKSMLSAK
                     SFRPSINSVEQAERWLRIFAADIYGRLVEDGVLEHRRRPKTLALHHRQGAQVRSRQSP
                     IPGSTPINETLLFDIGRTLLRQVIGDGCAWPCANLSMSVGGFEDGVGNNKAIDSFLLR
                     GDQAKNIGHPAKDRLTDDLPEMLQLSEKRRKVEDDGIKRFFNQSLGVNTKPQPSEAIL
                     ETPATSVEGNSENILLSDASCNPQITEVALRFYTCSRCEKTLPEAERDEHDDWHFAKD
                     LERQERQEAMRSQQTARPSNNTGSSSARGRPGRSSRGKPEKGQTRLAFG"
     exon            1202143..1204164
                     /number=1
     CDS             join(1205071..1205848,1205901..1206580,1207044..1207058)
                     /codon_start=1
                     /locus_tag="AO090020000473"
                     /note="predicted protein"
                     /old_locus_tag="AO070284000023"
                     /protein_id="BAE63651.1"
                     /transl_table=1
                     /translation="MPRRYRAREYDEDMYEVERDHYHRKHQHRPRGGRHYKEEVICEQ
                     PRAPSPPPVEEFDRLRIRDDAGPELIREPPRETSKELRKVRDDTFKRRRPHRREVVEE
                     EEHVSQDEELTRRITGSESEDEVPIIPKRRSAPRRGDVRDELSKPRSRRSEYELELPP
                     SVDEMKHEYRKTRSGPHYHAPPRLRPQSGPNTDVEDGYEEEEDDVLVRRSRRRRPPRK
                     ADLHEDDDSTSSPDSEDSADVSLARAPIHRSPPKRHVQDPEDFDFSRPPRPPRAPSPE
                     VSFEKPKREKLRPASHEEILVEERGGPELPNIVRGPPPEPFLRQRDEAYPTPQSRPRS
                     IEREKEISIHEVMPGGFDEHEVLEEVYGRPRELERSIRESTPKMTGDDWAIISAAPKT
                     EREALLDEISHGPREPALKDKKPKFTVSEERHSESDPDFARGKVGRRYIGMKDQRNGL
                     WTEITKDLVVREAIERSGYEYEETVSSYYVFSYLQFIHET"
     exon            1205071..1205848
                     /number=1
     exon            1205901..1206580
                     /number=2
     exon            1207044..1207058
                     /number=3
     tRNA            1207334..1207510
                     /locus_tag="AO090020t00005"
                     /note="pseudo-tRNA"
                     /note="tRNAscan-SE"
                     /pseudo
     CDS             complement(join(1213405..1213647,1213712..1214216,
                     1214303..1214691))
                     /codon_start=1
                     /locus_tag="AO090020000476"
                     /note="predicted protein"
                     /old_locus_tag="AO070284000026"
                     /protein_id="BAE63652.1"
                     /transl_table=1
                     /translation="MENNSLVLFVARISSHGQGDYRERLTKSLEYTRLRYEETYGAVG
                     EKVPFLIFSQSSNRMFPANGQTIADLNAFLSRCAETGCPAVLALNGWDGLSTNAVALT
                     SLFEPYMDRVCITIGSSRIIHEDFMKFRVRALYYCKLKIAEDVLALQEESYHRNTPPE
                     WRLGGSHTCGECGNAFDTSVQLNNHMHKHHEVTEKPMCQYCSEEFTRADHRDRHEKEF
                     CKQRPGYVQKPSKRRAPRGSKSRTAQREEDAVISDNGIPNYLSLTVNTLDLPRVEPKA
                     ELSERLVYRGEVWCRYPGCVHQTKYSSPAKLRTHYKNAHRFEYPALSPGNLIQREQRV
                     HDQGLEWLARCAYYGRDRWFKAGVQPKPLKKYGDLAGPKNATSD"
     exon            complement(1213405..1213647)
                     /number=1
     exon            complement(1213712..1214216)
                     /number=2
     exon            complement(1214303..1214691)
                     /number=3
     tRNA            complement(1216382..1216555)
                     /locus_tag="AO090020t00006"
                     /note="tRNAscan-SE"
                     /product="tRNA-SeC"
     CDS             join(1217719..1218187,1218340..1218359)
                     /codon_start=1
                     /locus_tag="AO090020000477"
                     /note="predicted protein"
                     /old_locus_tag="AO070284000027"
                     /protein_id="BAE63653.1"
                     /transl_table=1
                     /translation="MQPQFGLVLQTVPREQIRLYFERVLRMKPCNPVHDRRFPFISFG
                     GAGTHFPSAGQDSRSQNLLRFRETNGVSAIPSDEEWFDIKDIEGFLIEQGIKTEERYE
                     ASVTSSSITNSNPSARPGLLLPSGNLVGSADLTSHSPTASSNVVMVLDEATLIDIWGP
                     HK"
     exon            1217719..1218187
                     /number=1
     exon            1218340..1218359
                     /number=2
     CDS             complement(join(1218556..1218564,1219660..1220154,
                     1220217..1220587,1220653..1220924,1220980..1221281))
                     /codon_start=1
                     /locus_tag="AO090020000478"
                     /note="predicted protein"
                     /old_locus_tag="AO070284000028"
                     /protein_id="BAE63654.1"
                     /transl_table=1
                     /translation="MSSKSFKVIIAGGSIAGLSLALMLEKNGIDFLVLEAYPSIAPQV
                     GASIGLLPNGLRILDQLGCYESVMEMAEYPVDKVCFRDSRGKLIRSLENFNQLMTGRH
                     GYPIVFFERRMLIQILYDKIQDKSKVLTSQRVQTVHTSQSHVTVTTKDGKSYKGDIIV
                     GADGIHSTVRRQMWEEARKMNPSWIDPSEENALPATYACIFGISEGVRGIEKGTLSSV
                     FNEKFSYLIPSGPGEKTYWFLVRNIGETMYGPDIPRFTKQEEETLVKEHWDDQITPTV
                     RFSDLYKNKTSSVYTSLPEYVYKRWYFQRIMTIGDSCHKFEPLTGQGGNSAIETAAAL
                     TNHLMSALRSNFCQSLSTVDISSVFEKVQRQREERTWSLVRAAHARQRLECLETPLLK
                     LIARFVTPYYPLQLLKEHWIATYSAAVSLDMIAIPRRPREIPFYDELFRVPATRGIAG
                     LLLYVGYLLIAFVAFRLLFVATAANGTWALSS"
     exon            complement(1218556..1218564)
                     /number=1
     exon            complement(1219660..1220154)
                     /number=2
     exon            complement(1220217..1220587)
                     /number=3
     exon            complement(1220653..1220924)
                     /number=4
     exon            complement(1220980..1221281)
                     /number=5
     CDS             join(1222545..1223117,1223177..1223518,1224254..1224424)
                     /codon_start=1
                     /locus_tag="AO090020000479"
                     /note="predicted protein"
                     /old_locus_tag="AO070284000029"
                     /protein_id="BAE63655.1"
                     /transl_table=1
                     /translation="MSSTKLLVVLGATGNQGGSVIRSFLADPTWQIRGLTRNTSSVKA
                     QSLREQGVEIIQADLDDIVSLESAFQGATAIFSVTDFWNAFATIAPNSEIEDQSKIRR
                     TYEYELQQGKNVFDAAAKIDTLERLVFSSLSDASKWSKGKYTRVLHFEAKAHAVDYGR
                     ETYPELWKKTSVVQVGWYLSNFLGPFLRPKKAESGVYQFVGGLKGEVKLPIAAAEEDT
                     GPAVKALIACPPGKNLIAYREWMTPEEFVRTWSRVLGVPAECVTLPEGQSIEGVPDIL
                     KKEFIDNWGYWNEFGYEGRDDPTVLHPKQKASHCKRMRFNTYLASTSKPLMHFQKYTP
                     VCVSLHGPNLRKNQSSHHRTNPRKPST"
     exon            1222545..1223117
                     /number=1
     exon            1223177..1223518
                     /number=2
     exon            1224254..1224424
                     /number=3
     CDS             join(1230165..1230276,1230328..1230692,1230836..1231417)
                     /codon_start=1
                     /locus_tag="AO090020000482"
                     /note="predicted protein"
                     /old_locus_tag="AO070284000032"
                     /protein_id="BAE63656.1"
                     /transl_table=1
                     /translation="MHRNMALLLLTLFSWRAFAASDITYCSTVNTGASNSANVSVYQS
                     NGLCTDTCNSDYAFGILQGKSCWCSNIAPNRATNVDTSKCDTGCPGYPDDSCGSASKG
                     VFAYIQMNEHSPSGTATVSSSTSTSTESSVSRSFPSKSSLPTPQLRQFSVLLCMRSNT
                     TSTDSTSKTTDAPTTTATQSVETVAGEVKTITVPNSKPTSDPSAGMSEKDSSGSGLSG