LOCUS       AP007166             1841713 bp    DNA     linear   PLN 16-DEC-2016
DEFINITION  Aspergillus oryzae RIB40 DNA, SC113.
ACCESSION   AP007166
VERSION     AP007166.1
DBLINK      BioProject:PRJNA20809
            BioSample:SAMD00067075
KEYWORDS    .
SOURCE      Aspergillus oryzae RIB40
  ORGANISM  Aspergillus oryzae RIB40
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Eurotiomycetes; Eurotiomycetidae; Eurotiales; Aspergillaceae;
            Aspergillus.
REFERENCE   1  (bases 1 to 1841713)
  AUTHORS   Sawano,T., Tanaka,T., Machida,M. and Yamada,O.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-JUN-2004) to the DDBJ/EMBL/GenBank databases.
            Contact:Toshihiko Sawano
            National Institute of Technology and Evaluation, Genome Analysis
            Center, Department Of Biotechnology; 2-49-10 Nishihara,
            Shibuya-ku, Tokyo 151-0066, Japan
REFERENCE   2
  AUTHORS   Machida,M., Asai,K., Sano,M., Tanaka,T., Kumagai,T., Terai,G.,
            Kusumoto,K., Arima,T., Akita,O., Kashiwagi,Y., Abe,K., Gomi,K.,
            Horiuchi,H., Kitamoto,K., Kobayashi,T., Takeuchi,M., Denning,D.W.,
            Galagan,J.E., Nierman,W.C., Yu,J., Archer,D.B., Bennett,J.W.,
            Bhatnagar,D., Cleveland,T.E., Fedorova,N.D., Gotoh,O.,
            Horikawa,H., Hosoyama,A., Ichinomiya,M., Igarashi,R., Iwashita,K.,
            Juvvadi,P.R., Kato,M., Kato,Y., Kin,T., Kokubun,A., Maeda,H.,
            Maeyama,N., Maruyama,J., Nagasaki,H., Nakajima,T., Oda,K.,
            Okada,K., Paulsen,I., Sakamoto,K., Sawano,T., Takahashi,M.,
            Takase,K., Terabayashi,Y., Wortman,J., Yamada,O., Yamagata,Y.,
            Anazawa,H., Hata,Y., Koide,Y., Komori,T., Koyama,Y., Minetoki,T.,
            Suharnan,S., Tanaka,A., Isono,K., Kuhara,S., Ogasawara,N. and
            Kikuchi,H.
  TITLE     Genome sequencing and analysis of Aspergillus oryzae
  JOURNAL   Nature 438, 1157-1161 (2005)
COMMENT     URL:http://www.bio.nite.go.jp/dogan/Top
FEATURES             Location/Qualifiers
     source          1..1841713
                     /db_xref="taxon:510516"
                     /mol_type="genomic DNA"
                     /note="SC113"
                     /note="phrap>=30:2-1841713"
                     /organism="Aspergillus oryzae RIB40"
                     /strain="RIB 40"
     CDS             join(2015..2207,2268..2448,2505..2653,2709..2817,
                     2866..3005,3055..3241,3316..4045)
                     /codon_start=1
                     /locus_tag="AO090120000001"
                     /note="H+/oligopeptide symporter"
                     /old_locus_tag="AO070315000001"
                     /protein_id="BAE62641.1"
                     /transl_table=1
                     /translation="MARIVEAGSGPADINDESLSPRDATDEEIESLRHVVDKLPRKVW
                     VSLIVSGAERFTYYTITTPWQNYIQNAPGDGAVPGSLGLGQSRATMIFNAFYLFYYLV
                     PIPVALVSDAWLGRYAVLCISLSLYFCGTLVQFITSLPSLFHYESGLAGLVLSMILIG
                     IGVGGTKAAITPFIGDQYPVKPAQVKTLATGERVIIDRTLTLQYVYNVYYWITNIAAL
                     SILASTYLEKERGFWAANVLALCSSWIGVALLAIFGKELERYPAQGGVLLKAGKVLAY
                     AIHDKFKIDAARPRYQLEKHNRAVPWTDRFVTEIKSGLRACQVMAWFVLFHLGINQMT
                     NNLVSQAGEMQLDSFPNDGIQVLNPIACVLLGPVIQKILYPTLTRYQIPFGPLMRMTM
                     AFFTMAATFAYAAGVQKMIYNSGPCYEAPLVCPAAQRVGQPALPNRIKVWVQTPIYVI
                     LAVSEIFGFVTLSEYSYSKAPKDMRTVVQSMRQLSAGIGSAIGIALGPVSRDPKVLWM
                     DVGLAVSLALSGVLFWAVMGHLEKDKEDLDTMYLSEDQDRAAHTGVEAGSGSKN"
     exon            2015..2207
                     /number=1
     exon            2268..2448
                     /number=2
     exon            2505..2653
                     /number=3
     exon            2709..2817
                     /number=4
     exon            2866..3005
                     /number=5
     exon            3055..3241
                     /number=6
     exon            3316..4045
                     /number=7
     CDS             complement(join(4374..4880,4946..5305,5359..5509,
                     5598..5611))
                     /codon_start=1
                     /locus_tag="AO090120000002"
                     /note="voltage-gated shaker-like K+ channel, subunit
                     beta/KCNAB"
                     /old_locus_tag="AO070315000002"
                     /protein_id="BAE62642.1"
                     /transl_table=1
                     /translation="MEYARLGDSGLKVSKVILGCMGYGTPEWQGWVLNEEESLPLIEH
                     AYNKGIRTWDTADMYSHGKSEEIVGKALKKYNIPRSRVVILTKCYFGVDDQGNFPSPL
                     STGRQNAGDYLNRVGLSRRHILEAVDASVERLGTYIDVLQIHRLDRETPREEIMRALN
                     EVVESGKVRYIGASSMAAWEFQTLQNIAIRNGWHKFISMQNYHNLIAREEEREMIPYC
                     LDSGVSLIPWSPVARGALARPWASRSTLRENTDAGISILVRARESASDKAIIDRVEEL
                     AGKKGISMAQVAIAWSLSHPSEYPIVGLNTKDRIDEAVASVQVKLTPEEIQYLEEPYV
                     PKAIHPGER"
     exon            complement(4374..4880)
                     /number=1
     exon            complement(4946..5305)
                     /number=2
     exon            complement(5359..5509)
                     /number=3
     exon            complement(5598..5611)
                     /number=4
     CDS             complement(join(6459..7283,7338..7628))
                     /codon_start=1
                     /locus_tag="AO090120000003"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000003"
                     /protein_id="BAE62643.1"
                     /transl_table=1
                     /translation="MKHSEYKYCRTSSHVSSRASITRLQVTSKTHSYTTKQHPPNSTI
                     MSIPSHPKLEGFDIIQATYKQIGDHAIRVDILIPQTTYSGKRPTFVRTHGGALVACDS
                     LFMDFFPHWASDLALKHGAVIVSPNYRLMPESTSSEIFDDIDDFWKWLHSPALTDLLA
                     NHTTPTEIDLTRILTTGDSAGGLLSLYLALTYPTQIRAATAGYPWVNPSSAGFQSSRT
                     ILPFGVHTDESVIDVTVAAAASGQIVSSDLSPSRLAFMLAAVEHGRLAGFYERQKEGS
                     SRRELFYPAKKLEEPGLSIPRGGIAIWHGRQDTVVPLEDVEEFVVQLLEATKGLPSGD
                     KAVLALRDGDHGFDMSSRYEEEWLQNALKSAVETWLE"
     exon            complement(6459..7283)
                     /number=1
     exon            complement(7338..7628)
                     /number=2
     CDS             9244..9795
                     /codon_start=1
                     /locus_tag="AO090120000004"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000004"
                     /protein_id="BAE62644.1"
                     /transl_table=1
                     /translation="MFSLWRRILPQRVANTGSQLRDHQANERTFLSWTRMGLGFAAMA
                     LALGRLDAVDHMLSSALSSSKLNLVVGSENATATVAATPAPVQSGDTSHRNSQEHPSS
                     LLFFNHNGGFSATTFCQAISIWSFGYGIFRYLSVRKSLLKGQFTPAIWGPVLMTTGCL
                     GVFGTMGMWVEQKNASKMAKQGS"
     exon            9244..9795
                     /number=1
     CDS             complement(join(10441..10915,11070..11257))
                     /codon_start=1
                     /locus_tag="AO090120000005"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000005"
                     /protein_id="BAE62645.1"
                     /transl_table=1
                     /translation="MKLFAILSSTVLASVALASPLTLERRARNAARLQARVAQRHSNL
                     PFKAGTNEILHLNETTHEECQSAILQTGVDFCIDSSGTTSDAWYEWFPDYSHDFSGIS
                     ISAGDKVKVTVDASSKTAGTAIVENLTTGKTVSHTFAGQDDNALCETNAEWIMEDFSS
                     FLSLVPFANFGTVTFTDISATSGDSSVGASNATIIDIQQNNKTLTSSSASDTEVTIKY
                     IG"
     exon            complement(10441..10915)
                     /number=1
     exon            complement(11070..11257)
                     /number=2
     CDS             complement(join(13273..13576,13631..14070))
                     /codon_start=1
                     /locus_tag="AO090120000006"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000006"
                     /protein_id="BAE62646.1"
                     /transl_table=1
                     /translation="MQFTKSLLLLAALTTGSLAHRVHGHARRQSPSATMSAVPSSSGS
                     ASGGSWTATPASGSYSTAGFGASTANSGSGNTYAGNVGNPWGSNIIEVSESDASNYKY
                     VAAISGQNTEPWTVVFWNKYGPDGKMDGWYGNSAVTFTLNAGETNLPTDSDGGYACTW
                     GEFDFGSNGNSGWSGFDVSAIMAQNAGLTVQGMKMCDVLSGTCSSITTDAASVDNAYT
                     SAETDIGGIGGNISGDGAVRIAVTIDYSG"
     exon            complement(13273..13576)
                     /number=1
     exon            complement(13631..14070)
                     /number=2
     CDS             join(17913..18396,18467..18951,19003..19053)
                     /codon_start=1
                     /locus_tag="AO090120000007"
                     /note="PEP phosphonomutase and related enzymes"
                     /old_locus_tag="AO070315000007"
                     /protein_id="BAE62647.1"
                     /transl_table=1
                     /translation="MPQSNTPYPFTFTNPTGVQSTNGTTQTIPLTIPNVRGTIPSLQT
                     SRLRTMMLEARRDPAKILAFPCSYDGLSSRLIEEAGFPMLFLSGFAVSSSYGLPDTGY
                     IAMEEMCQKVQETVRVTSLPIMVDGDTGYGSPMNVRRTVEAFAAAGAAGVMIEDQTWL
                     KRCGHTKGKSVVSRGEAYARIQAACDARNEGRDIFILARTDALILGWEEAMTRAKEFK
                     RLGADAVFVEALPDRESMQRCVEELDMPMLANIIEGGKTENLSAKELAQLGFAAVAYP
                     WTLVAARLKSVRDALEGLKQSMVEGTAPPMILGYSEVCEGVGFNRYWDQETRYEYDQN
                     GLINP"
     exon            17913..18396
                     /number=1
     exon            18467..18951
                     /number=2
     exon            19003..19053
                     /number=3
     CDS             join(19974..20202,20260..21632)
                     /codon_start=1
                     /locus_tag="AO090120000008"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000008"
                     /protein_id="BAE62648.1"
                     /transl_table=1
                     /translation="MRTAASTGLFLGLASMASAVMYGYNHVPLIKDTEIVAGAFENVN
                     DIELLSPAFLTPNVRLPGFPNGTQGPSSQDDMEAFLEQLAERNDYMTYRTANFTSEEG
                     RSFPYAHLSAGHSVSKVRVWIQGAVHGNEPAGDEATQALLGKFDGDQEWAASILDKLE
                     LVVLPRYNPDGVFYFQRTLATNYDPNRDHIKLARQQTRDIKQLMNEFNPHVIVDMHEY
                     FAGSRFGDGQYVHGCDGLYSAAKNLNINEGIRKLSEELFAKNIAEDMNAAGMRAEPYV
                     TGSSAASGSNFVADFAEAGTDGKIGRNAMGLTQAVVFLLEMRGIAIADQEFQRRTAAG
                     LTMLGSIVQTAADNADEVLQTVEDGIKEFIASDDDVIVTDYSKTEIRPFAMVDVKNGS
                     IVYPPVRFASTTPSFANLTRSRPEAYLIPVAWADLAERLKVSGLEVETLDKPFEGTVE
                     ALTITSAEVDTSYYEGVIRVTVTTETSEREVRLPAGSFRVSTRQKNAALAMVALEPEN
                     IDSYVSFNIVPVEESDEYPIFRITS"
     exon            19974..20202
                     /number=1
     exon            20260..21632
                     /number=2
     CDS             22724..23524
                     /codon_start=1
                     /locus_tag="AO090120000009"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070315000009"
                     /protein_id="BAE62649.1"
                     /transl_table=1
                     /translation="MSSEASAEDMNLVAEYLGDRRIQDLSSSPSVDCIVICASAILYQ
                     AEHLFQVLQDRPSLSKCLVLCGGVGHSTHFMYEAVAQHPRFSQIAQDIHGLPEARVLE
                     RILDTFFDRSAITDGGCMILVEDKSTNCGLNASLSRKILDAAGFHNLKTCIIIQDPTM
                     MLRTKASFQKAYEDSLSSPSFISCPIIVPHMQRTEGSGLKYQTLPLGNAWWPLDRFLE
                     LIVGEVPRLRDDENGYGPRGKRFIPHVEVPEHVEEAWSRLRVVSNACR"
     exon            22724..23524
                     /number=1
     CDS             join(24119..24418,24609..24644)
                     /codon_start=1
                     /locus_tag="AO090120000010"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000010"
                     /protein_id="BAE62650.1"
                     /transl_table=1
                     /translation="MVRTVLEESSRFVPQGLDPATNNELSEIWSRVQSRVLALADGDQ
                     RNIRPLGVNDVLSHLDAAQKKDKVSSWKVKDIKDSFNKTLLFIQTVSSIAAGAASQST
                     TSMGVWTRN"
     exon            24119..24418
                     /number=1
     exon            24609..24644
                     /number=2
     CDS             24788..25495
                     /codon_start=1
                     /locus_tag="AO090120000011"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000011"
                     /protein_id="BAE62651.1"
                     /transl_table=1
                     /translation="MESLVDKENRLVVAQTFALASDAATNSKANRALMQGLVDSFAED
                     RADQKKEKDKKSREQVVLKALAFDETKTNQDSGEPEAFWQTIYRNYLGQRIRGTGEWI
                     FSDHTYVTWEKGQSSRPILAIAGGEGTGKSVLTSTIIKHLNQRKTTKSSDRRITTGYY
                     FLEGNSRDELRNATNLETVAKSLVWQFSQSERIYLKSVAQICEHYGEIDPAEISKHLI
                     LGNRDLRQLEHHFLYCH"
     exon            24788..25495
                     /number=1
     CDS             join(25647..25656,25757..25777,25866..26908)
                     /codon_start=1
                     /locus_tag="AO090120000012"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000012"
                     /protein_id="BAE62652.1"
                     /transl_table=1
                     /translation="MSIRTIFGPDCPGRCKQGTLATDNRGNKKMNESRSEKELLEINE
                     IIRWIVYGKDLLTPKQMLAALYIRNGETSLLPLEQKFKIKYPLFEVDRNGKVDFRSSE
                     IERYIPLKKTTHDLEDSYSKEAVQAAEVAMVKHFLLTVCPSEVYTKLKFDAYLAQLSK
                     PKGRRINKDEPHTGETKMALTCLDVLTEKTDRKRTRLLTYARKYLINHLSTVDLALAD
                     IACKSAVGVLLAKLFTEGSSIDILLHCAESVDDPNLRYKIRRYWLYSNDSVNTILRWF
                     GDSAVTSEITDTATRAWVASVASEAESDEDLMRPAAERMAVHFLQEAHSESFTKDAFL
                     FIAGFVNKVSSALLNQLEILAEP"
     exon            25647..25656
                     /number=1
     exon            25757..25777
                     /number=2
     exon            25866..26908
                     /number=3
     CDS             27050..28414
                     /codon_start=1
                     /locus_tag="AO090120000013"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000013"
                     /protein_id="BAE62653.1"
                     /transl_table=1
                     /translation="MGNLLEVLGLPRLAETRARQALMFNPQDWRASYLLAKLVGTKEG
                     IKILAAAIQARLASDSQWQRDPVQRIRFAKLLYMFGLLHWEDKCPSTAIAYCKMAMEL
                     DPTNYGRVTMVLSSLATEGRWQDIIVSLKGVKNSAHISQGLAEMVIELWNADRFHQIF
                     LQAALRTKHFDMLEETYELAINLLLERQDRATLVNVRYHYATAIYSLRDRESKAIAEW
                     ENVLTEVPQSHLYTILPLLVSKLGPLYLHKARTSGDDTEAASSYLEKIETLIPDGAPG
                     SDALLPPKLYLARYYQTQGDVLRVKQITREIVKQALKILSDDDQDNDRYAYFSLLNVF
                     LPLEDSRNMLASLAMLSFNTSDTAIIHYNGDCGNSWSYLGDMLWSKDCIDFQIDEKCH
                     RKLCDGALPFTVCDRSHDFLHIPGRESIMQDIPVGCVPFGEAAIPLDEWMELVRKNYV
                     YIEH"
     exon            27050..28414
                     /number=1
     CDS             28805..30217
                     /codon_start=1
                     /locus_tag="AO090120000014"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000014"
                     /protein_id="BAE62654.1"
                     /transl_table=1
                     /translation="MSLSLCAPWRLLYAILLTIALVNAQQPSEEDFSPRDTITRDVCI
                     LGGGATGTYAAIRLKDMNQSIVVIERNDRLGGHTETLYVENGGHVDYGVQGVFNYNIS
                     RNFFNRLGVQYKPVTPGSLINKYVNFKTGHEVSHPSGVLDTVAALLVYRTAIQKFDYL
                     KDGIYNLPDPVPEELLWPFSKFVEKYKFEGALNVIYTFANALGDMLASPTLYVIQLFG
                     ISHIDIFLQGGYITPNNGTYELYRKASEELGTDVVYNSKATKATRSDTEIKIITQDTS
                     GKKILIKAKNLLITFPPIPENLKGFDLSPEEISLSSKLFWKTYYVAVLKNTGIPNNIN
                     VHNVDPDEKPGNLPVAPFQWALQDMGPNNYLASKLIGDMNFTDTQAQELIIGDLDRMG
                     TAGTFDIRKDWEMAAFGNHNPTTLMVGVDDIKDGFYSRFYDLQGRRGTYWTGLTLVSD
                     YSALLWKYTESVVERIVKGE"
     exon            28805..30217
                     /number=1
     CDS             complement(30723..33974)
                     /codon_start=1
                     /locus_tag="AO090120000015"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000015"
                     /protein_id="BAE62655.1"
                     /transl_table=1
                     /translation="MTLWSFTVYDVFRLEPYFQLSKEQVFPADVLSANYIFGPFISTP
                     ISSARRKHWVVLGVSIINILVQLMLPATLSALLDVDSVPMSSDATLRGWPELVAVGEQ
                     AEWISSQRNMSLYSLTRGDTGETPSRLSHFAIPPVELPSDDDALFTALWKLNHTVYWA
                     DLTCSDLPISNSLTANVTEIVGETPADYSNYSTLTCALRDLRLTSYSDSSQNCALNAN
                     YSGIFDLTATPVQARRWELDTIPCAPFDLYGFLLDIDTTNTGRLVGQTPKAQFFSCDM
                     QYYTAKAEVSMKANGSVVAIVVDKGSMSALDSSQLDIAGFKAYLKRGICPTGNVCPSG
                     NGTLTNYSLDRCGLGIEAHKSPCSTSAQYSQVPISGDEFISKIRMDMKLGFARLLSRL
                     FNTNAAYTPIQGVGTTDQVAVLVITFPAIASEVILLLGTATCILLALFYQSRENILKS
                     DPGSIAAMCSIVAHLFNPTGVQAFGEYTDKLTARQLNRKLRAWRCYWYDEPSGRKLGF
                     LPGEAPPRTLREKVLYSKPASRKASRQDARLHFLSKPIFVAELLGLLAVICFMTVMFI
                     LCSKDSRLRRLSDSASDRLSVALGILPSLMASMMRALFNSIYVNISILEPWIHLQKGG
                     VDAKNSLLLNLSSQSPITVFFRSIRSRSFVLSLVALCCIINTGLPAVLGALFTQSRTR
                     AAWPTQAVELRYDYSTILNSSTVPTFFQNGPIESTLLNSVSLLPWTAPDYSFVPLSVH
                     TNNMEHKYEAVTLGIGADLNCHQVPLTQDLSKDENIPYLTGRDTEGMDGTPSVNKSSS
                     EPYSIQLLAPSGVTNNGTLTVLAINSVGSNTDSPTLALHCQPIPKIQNFTISFDPSGI
                     LQYYYPIGSTITSGNLVDNVTSNLANYHEHFIASIQDIGNGTITDGPKLFPSDWPSSL
                     IKLVYQNVNPELTTIDAQGLTDATKRVYQWLFAAYFTLQKDMYLQPLPKPITDNDAQI
                     LRPTWSIVCSLSSFIVALIMVSSMAIALVLVFITRYGKFKGPRIPQSLGSVLVWLTDS
                     PILPSFYGTYDWTNDARRDYLVGLDKKYVFRMITTPAGEQKWVIEEDKCEKVG"
     exon            complement(30723..33974)
                     /number=1
     CDS             join(34972..35138,35340..35538)
                     /codon_start=1
                     /locus_tag="AO090120000017"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000017"
                     /protein_id="BAE62656.1"
                     /transl_table=1
                     /translation="MNKLIGPLITCFLPSAGDSLSASYWQMFSFLTDLGPVYTIWLLE
                     SHRIHSWAVVILPNAPGSFLPALIAGYYGPHFGNFFPKIVAMRQCFHAIWQLFPITVQ
                     APFRFLEKCAYPPVRPRPQ"
     exon            34972..35138
                     /number=1
     exon            35340..35538
                     /number=2
     CDS             join(37051..37429,37485..37783)
                     /codon_start=1
                     /locus_tag="AO090120000018"
                     /note="predicted dehydrogenases and related proteins"
                     /old_locus_tag="AO070315000018"
                     /protein_id="BAE62657.1"
                     /transl_table=1
                     /translation="MCGFSRRFDASYRDAFNKMNDGLIGTPSVFRSQTCDKLDPSGFF
                     VEYAQFSGGIFVDCSIHDIDLALWFYGQDSVVKSVTAIGITAVSPELRKYNDRDNALG
                     IVEFYGGKIAQLYCSRMMAAGQEDSTEIIGTKGKLAVNTQPISNLVNIYEPTGIRREI
                     PPHFYGRFREAFITEANEFTAACLDNTELPVQLEGAVAAVRIGAALQESLISGKKIEF
                     DEQGNRI"
     exon            37051..37429
                     /number=1
     exon            37485..37783
                     /number=2
     CDS             complement(join(38293..38303,38350..38379,38491..38837,
                     38937..39553))
                     /codon_start=1
                     /locus_tag="AO090120000019"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000019"
                     /protein_id="BAE62658.1"
                     /transl_table=1
                     /translation="MNRRQNTKQKAREYPSNQHEIKTLEAIATAFLILDSLALKTLKY
                     KGDAEDAEKFEKLTKDYVDRIENDPLRNLRFALRVSRFVSDLELSDLLDLISRPVRTT
                     YYWDAIYLRVNACYEAKDEEDSRYFTDDPPSDEEYAKKELRAIVEEVQKLDRHVRDAD
                     DKRYAGEKILQLKAMLGKLDGALAIACEYLGDEHKPLANWDTTDQHHGFYSCKNKIYI
                     CFLVPVFCVVASIPACVASFNAEAIPGKATDSDFYQLTTSTTIQLLGISTSIWSIIND
                     LRPKRDLLIKCWTYAGISICFTIVAVPLYLTVPVSWSGLLTFIGSCVGFMSRKVISYA
                     "
     exon            complement(38293..38303)
                     /number=1
     exon            complement(38350..38379)
                     /number=2
     exon            complement(38491..38837)
                     /number=3
     exon            complement(38937..39553)
                     /number=4
     CDS             complement(join(40121..40131,40359..40459,40481..41864,
                     41926..42090,42143..42245))
                     /codon_start=1
                     /locus_tag="AO090120000020"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000020"
                     /protein_id="BAE62659.1"
                     /transl_table=1
                     /translation="MASPEPPRPPPVSPQGRAVPLQPPCINCRSKHLRCTYETDQCEP
                     CKRYNRTCVRRKPRKNPIQFRPGSRAKYDQAFAPDQVWVKLGRRSAPLRFIDETVDVI
                     SGYYSASDSENEEIDGEDVSFRAGAAVGAQSEHARFHALGPNSSTKSATQCGTQGQTP
                     ASEMTTLISSNTAALHRGASIVPTERQREIHRPVVFVGNTDIRLQAILLRYFAEVIGP
                     RFDLCDNERHFSRLVPQRARSSPTLLNAILTTSARHLTRLQRYRNSAGVVEWQGHLLP
                     NLSEESAVYYHNECIKDLLRLSMDPEQIHNEALLAAAIILRTDEEMDAPLHEGEEDTE
                     VFLGMLNMFINAQVPLVATLPHSSPPVYPSQEELYGSGVHLVHAPHPPDSPSHPLSSP
                     TPQTNILWPYTIPHVPRPDGLRQAAFWVALRQELFTSFMKQRPLNFPMNHCDAFRNLS
                     PAEDVIWADRLVIFCADLLEYCYGSSYIHNADQPSRRHHDPARWHKLRNYERDLTLAL
                     PKSFEPMCYREPDTSSGQVFPEIWHLESCHVTGTTHLELARILRPNLGPGSVSSQRKL
                     ATTLKNIVRRLCGIAMCNPII"
     exon            complement(40121..40131)
                     /number=1
     exon            complement(40359..40459)
                     /number=2
     exon            complement(40481..41864)
                     /number=3
     exon            complement(41926..42090)
                     /number=4
     exon            complement(42143..42245)
                     /number=5
     CDS             join(42758..43111,43179..44462)
                     /codon_start=1
                     /locus_tag="AO090120000021"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070315000021"
                     /protein_id="BAE62660.1"
                     /transl_table=1
                     /translation="MAQDKDAKSQSPTSIMNDPKKASLPENAHIEVAAGSLTTETGID
                     DLPISMFVWLVAFTASIAGMLFGYDTGIISAVLVYIHDGLDNRTLTSNEKELITSLCS
                     GGAFFGSILAGLTADKLGRKAAIYFGCALFTIGAVLQGAAYTIAQMAVGRVVVGFGVG
                     SAAMVVPLYIAEVAPAKARGRLIGLNNMSITGGQVTSYAIGAAFANVNHGWRYMVGLG
                     ALPALILAALMPFCPESPRHLVYNHRQEEARGVLRRIYGHPSDVQLASVLASISAACD
                     EAREINEGATRWTKMKQLHAVPSNLRALISACGLMVISQLSGFNTLMYYSSTLFALVG
                     FDNPTAVGIVVAGTNFIMTWVNMMVIDKMGRRRLLLSTAWGMSVGLIAIAVAFSFIPV
                     DLDTLDLKSNSVSPPAIVVLVFIIWFVLFYGVSVGNTAWMSTDFFPLEVRAMGTMWIT
                     CSSWGSNVIVSSTFLSMMKSMTPSGAFGFYAGICGVGYVLIYFFYPEVSGLSLEEIKE
                     VFKHGFGVRYARNLRKERRDIIQERLRIQGKTAVVGH"
     exon            42758..43111
                     /number=1
     exon            43179..44462
                     /number=2
     CDS             complement(45905..46795)
                     /codon_start=1
                     /locus_tag="AO090120000022"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000022"
                     /protein_id="BAE62661.1"
                     /transl_table=1
                     /translation="MESIFLKISSDVSLHARISRPSTDNQKPLLVLLHYWGGSSSTWH
                     KLTSPGSPTSLDTTYPILAFDLRGWGQSMGPSEEHGMAYSITAMASDVALALEKLNQD
                     ASTNHLLNHGFIFVGHSMGAKVALATLSTLNENLLRELKGLVLVAPAPPTALSLPPEM
                     KEQQKVAYETEESVRWTVKNVLANTKNLSEDDIELVVHDSLSGSNLAKKAWPTYGMAE
                     DVSGSVRRALGIIGHAGIRASVLVGELDVVEPRERVEAEVCRILEESGVKTSLKVVES
                     VKHLIPLECPQMIYEEISLY"
     exon            complement(45905..46795)
                     /number=1
     CDS             complement(47468..48655)
                     /codon_start=1
                     /locus_tag="AO090120000023"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000023"
                     /protein_id="BAE62662.1"
                     /transl_table=1
                     /translation="MTTYTLSKGSDRPQTSGDTDGPQPYDVLSKYLRFPDFDQDQWWQ
                     NTAPMLGKLLSQCKYNVHQQYQHLCLYGLHVIPFLGPWPDIQRSKLYKSVLSGLGSLE
                     FSQNFTKTGKTVRMGFEPTTFIASTSRDVCNRHCLGKVLNRFKQLDIKLDLQLYHQLV
                     NEVSLTDQEENTLLERAILDDEPAKSQSLLALDFNKDDVTVKLYLYPQLKSLATGIPR
                     TQLMFSAVRNVDKTRAFSESMNMIEEYFTSVRANAAPYWISCDLVEPNKTRFKIYIAL
                     FQVNFENAVSMWTLGNRITDPETMRGLAMVRDLWNSFDIQDGLREQKNRPGNPGDPSN
                     IVPMLFNLEILPGKAYPQPKIYFPTTGMNDLDVAKVMVEFFKRHGLHEHAQSYIDNLA
                     SYV"
     exon            complement(47468..48655)
                     /number=1
     CDS             50944..56199
                     /codon_start=1
                     /locus_tag="AO090120000024"
                     /note="non-ribosomal peptide synthetase modules and
                     related proteins"
                     /old_locus_tag="AO080554000024"
                     /protein_id="BAE62663.1"
                     /transl_table=1
                     /translation="MLKQIIHHLTNSPSRPLVDSCLLSKHHQDQIARWNSDAPAVPLE
                     SCIHTLFRVQCMLQPDAQAICAWDGTITYRELDRLSSAVQGLLQPYNPAPNSVVPILF
                     KKSKWAVVAMLGVLKAGAAFSMLDPSYPTKRLVDICHDVDAKVLVCSEELSIDVSGNI
                     LTIGDHNIANASYSAVHPVKTASHDAAYVVYTSGSTGAPKGIIIEHGSFCTNVMASSR
                     AQNLDRSSRILQFASYAFDVSIHECLTPLLLGGCVCIPSESQRVNSLKEAVRSLGVNW
                     MELTPSVARLWQPEDIPTVSTLVLGGEPMLPSDVSQWKDKVRLVCAYGPAECTIVSTV
                     QSCVQDLGNIGVSPGGTCWIASQDNHQRLMPVGCVGELIIGGPIVGRGYLKRPCLTKN
                     AFIINPEWASLFGLDETYRLYKTGDLVQYNYDGTIAYIGRKDTQVKLNGQRVELGEVE
                     YQARQCFHDAVIAAEIAAPAGRKPTLILFIAPRQEYSIQMDCKTLLYPPSAVFLGQAQ
                     AARSGLQNVLPRHMIPTAYIELVAMPISRTGKVDRRVLREAIENVSEDDFRAYYPTPH
                     NNMINSPNTPVLDQLRHLFSAALDIPEDKIGPNDSFFQLGGNSVSAIKLVGDARDQGL
                     KMTVEALFRQQTICKLETCTHQTSGSIDTPISAFSLLDPSSKATYIAQATEQCSVSPE
                     QIEDIYPCTPLQEALMAYSSKRPGAFQATFRFRLPQQLDILRLKEAWITVIAANPILR
                     TRIVHSETGALQVVLRPEEPLQWDLIYDVNEIPGSFMSYGAPLINVAVVSDTGGKPDR
                     TFCLMMHHAIFDGWSYALILSAVEGAYKHMNAVQRPFTPFIKHIMSCNYESARDFWCS
                     EFKDTQAVPFPVPPFTSGHMVNSITTVQRQIHISEWLGGCYTPSTIIQLAFAMLIAWR
                     TSSMDVVFGLTVTGRNAPVPGVHETTGPTIATFPLRTILHGRLNVADSLVLMQNHITR
                     LIPFEQTGLQRIKSLSSETASACQFQSLLVIQPATNRKSQRILSECPSNEYEQVKFST
                     CPLTLVCELEADKLSIKAVFDNAVVVADGMQRMLDQLEYLVDMITKSPTSKIESIIPR
                     PSNIYPDALRQGQSWSAYIEKKAYDYFDGEVSVVVDTIVPKGGSNQHTVMFICEADQN
                     CESAELSDLFTRPTDQVRWQLHQLICSLQESLPCSVVPSLCLPIHSMPLDAFGQPDRS
                     RLCEEASSKSHCFLRSLMVPANNQIDYNILPGEARLRTAVAHVLGMEPKNISPKDDFF
                     ALGGDSISAMQVVSLCRKHHLSLTASDIFDGKSIETIASSVKPLTLYTPPSTPGSDRS
                     LGARFPLLSLKSDRDMEVLESAIMATYDFQSMDSIEDVYPCSESHQGLLQTQMLQPFN
                     YQSYTIWEVTTGSMASPVCPIKLRNAWFNIARRHPALRTHLIESPLSVGIHQKIHIVH
                     EDYVTDIPIISCADEQVFAELRKPFLQTSTKIYYPHAFTICQTISGRVFCKLEGGQAF
                     LDAASVLIILHELSEAYDGQLSPLPGPLYGPAVAWFQSLRNADDRMDYWRRQLEATRP
                     CIFPMLRDQDSPTETLVITEHLASTATLISFCTLHGLTVTNLMQVAWGLTLRYYTESD
                     DVCFGALMSGRDSQIVDVDKMIGPFFNVLVCQLRFGREDSLLAILRRNQVETGNRLLN
                     QHCSLIEILRFSKYFGQPLFNTCISVEQPLSMDSCNASLCFKELETLEPTEVCFQQSH
                     CLTQLTALNSMALSLPLRLDQRMFG"
     exon            50944..56199
                     /number=1
     CDS             join(60615..61102,61164..61569,61576..61826,61897..62061,
                     62193..62328)
                     /codon_start=1
                     /locus_tag="AO090120000025"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070315000026"
                     /protein_id="BAE62664.1"
                     /transl_table=1
                     /translation="MTNNASSSEKHPETAGPGNIVPLIPPTDPNLVTLDGPDNPHNPK
                     NWSARKKWLAFVPMSMFNLLSSMSSATVAPGLSAIGEDLGFPSNTLLILSLSVFFLGT
                     AIVPLFTAPVSEMIGRVPVPLTMNVVYIVFNTACGAAKSPTQLIIFRFLAGLGAAGPY
                     WRHGMNSDLFEAIAVFTLAPLIGTAIGRITGGFVVQYVSWRWCFYVISIAIFTIQIIG
                     LILLRETYGPVLLKRKAARLRKSTQNPDLHTEQDRTSTHLNTNLIRPFCLLTTQPIIQ
                     ALSLYLAYLNGTLYLMVATFHDTGIYQVSVSIGSLYYLSMTVGLAIAAQFGVRFADKI
                     YQRLRAKNNGQGKAELRLPILCAIAVVVPIGLFWYGWSARTSIHWIMPDIGAAIYSGA
                     TVLQLVCVQGCLIDTYQVYAASAMASVMALRNLLGFGLPLLAPSLYGNLGFAWGNTLL
                     ACVAVVIGIPAPLLLWYYGEDLRGSGNYAQS"
     exon            60615..61102
                     /number=1
     exon            61164..61569
                     /number=2
     exon            61576..61826
                     /number=3
     exon            61897..62061
                     /number=4
     exon            62193..62328
                     /number=5
     CDS             complement(join(62670..63069,63141..63439))
                     /codon_start=1
                     /locus_tag="AO090120000026"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000027"
                     /protein_id="BAE62665.1"
                     /transl_table=1
                     /translation="MVSFSSILLACSAAIGALATPIEPLADHPNEAFNETAFNDLVGR
                     STPSSTGYNNGYYYSFWTDGGGDVTYTNGNGGSYSVQWSNVGNFVGGKGWNPGSSRAI
                     TYSGSFNPSGNGYLAVYGWTTDPLIEYYIVESYGTYNPGSGGTYKGQVTSDGGTYNIY
                     TSVRTNAPSIIGTATFTQFWSVRTSKRVGGTVTTGNHFNAWAKYGLTLGTHNYQIVAT
                     EGYQSSGSSAITVY"
     exon            complement(62670..63069)
                     /number=1
     exon            complement(63141..63439)
                     /number=2
     CDS             complement(64363..65646)
                     /codon_start=1
                     /locus_tag="AO090120000027"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000028"
                     /protein_id="BAE62666.1"
                     /transl_table=1
                     /translation="MLTIQLENQLACYSGHEHLRGCVVYHCPNPIDIQEVRVSFYGRA
                     KAKVQKVKGAAAPAATYRSKCILFQEEKILVTPNGGQLTRNTYEWPFEFTFPSQVESP
                     AKWPEKAPFRSDEHHPLPPSFAVDVGDSQRKLHCVIEYRIEVQMFKPQKNFLSKKAPV
                     YTEAIRVNFLPLAAQWEPTDHADKLSRKHKDEVFTVRSLLLLPENRGRSLKVGEKFQS
                     WLSKKQLPQFDFKASFLYSTRVLQGTPVACVLDVIPCTDGSSMPFPGITLQSVSIAVM
                     SRTSARASQSLRGSIAGDVDDRLEILSKTSLGMPVLGQLDLNETFGPLIFRHSEVSFS
                     TFTISRSYRLCASFTFECVGKTFEFNANDLEFFIVSDVVSPTVQMTPMEQGTAITGVF
                     ELADTTSRRSSSDEYDESPPSYSMTASTSEKPPKN"
     exon            complement(64363..65646)
                     /number=1
     CDS             complement(join(66381..66521,66588..67046))
                     /codon_start=1
                     /locus_tag="AO090120000028"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000029"
                     /protein_id="BAE62667.1"
                     /transl_table=1
                     /translation="MTSSDSQNLPPPPPPPPSIGKTAPNPPSVVSEGPAGAYLVELLI
                     FNGWPFKDHWAYWVRSHSDPDIGVQLHATGDVRNGFVFQIKRNYDFHDDNSERPSTRI
                     PLQWIDGKFFDERAMMNNGVFTLDDVPVCGFEASVYKVKAPEKSLNTVTGTTIAEGQK
                     GQKVNQSNCQTWIVESADQLVRDEIFNQEVATYLHAIEQ"
     exon            complement(66381..66521)
                     /number=1
     exon            complement(66588..67046)
                     /number=2
     CDS             complement(join(67298..67582,67641..67759,67816..67843))
                     /codon_start=1
                     /locus_tag="AO090120000029"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000030"
                     /protein_id="BAE62668.1"
                     /transl_table=1
                     /translation="MVKIGDLGGAAFIRQREQRPVTPTALRAPELIHRIEWDVGIDIW
                     TLGRLIFELATNEPLFPLGTFGLTAEQIDEEHLYLIGQVLDKNNQTGDTFTQYLTDRL
                     PADFGAENLERLASFLSGMLQEKAQKRMSTAELLRHPFLFR"
     exon            complement(67298..67582)
                     /number=1
     exon            complement(67641..67759)
                     /number=2
     exon            complement(67816..67843)
                     /number=3
     CDS             complement(join(67936..67949,68064..68380,68438..68604))
                     /codon_start=1
                     /locus_tag="AO090120000030"
                     /note="serine/threonine protein kinase"
                     /old_locus_tag="AO070315000031"
                     /protein_id="BAE62669.1"
                     /transl_table=1
                     /translation="MRRFERIYDVVEPVEEYRHGCYHPAHLYDVFNDRYKVRAKLAFG
                     QFSTVWLAYDQLRQQQVVLKILKADASKDNKELSILLQLSGSALEHPGKNHLMNLLDH
                     FEHHSPNGTHLCLVLLVMISDGEAVTITGRPHYAADIQEVSRQILLGLDFLHTSDIIH
                     CEPPG"
     exon            complement(67936..67949)
                     /number=1
     exon            complement(68064..68380)
                     /number=2
     exon            complement(68438..68604)
                     /number=3
     CDS             complement(join(71170..71917,71951..72156))
                     /codon_start=1
                     /locus_tag="AO090120000032"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000033"
                     /protein_id="BAE62670.1"
                     /transl_table=1
                     /translation="MAWAVKQGRLDILQMYLKAGVDTNFYTLYGVPMLSHAAYEGQIG
                     SARILLRYGADPCLPTLCGGQAPLIDTEGPNMVELVLRAGAKITSLKLFKFICCDIVN
                     PEHLVQLAIMNGTEFLALKDTWGETVLHKAVRYSEGLTALISKAAPELLHERTSDGGI
                     VLYVAVDRGCVAAARYLIALNEITDVVNMDGETALHIAVKRDLKRVQLLTGRQEVDIN
                     GLNASNETPLSIAISYHTISRCYFDIVDHLLRDPRIYIDPMSVLAMKHLFRPTDLWLL
                     LLFEDVILLIRFLWPYTKQGGYISLLKSCQESLFALLPYLF"
     exon            complement(71170..71917)
                     /number=1
     exon            complement(71951..72156)
                     /number=2
     CDS             complement(join(74889..75149,75202..75818,75881..76010))
                     /codon_start=1
                     /locus_tag="AO090120000033"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000034"
                     /protein_id="BAE62671.1"
                     /transl_table=1
                     /translation="MASRSDGDGYDDSNRAFLQAFMARSTMTFAEARPVLAAIFSVHE
                     GEPVSAEDVTEDDLASYIAAANTAISPFDLEIRSTLRQSQVDPEGSGNQPPERVYALV
                     NTTSDALTQLATTYSADEISFIKRILDAMFDTNNTRRSEAMVVSSMQAIQLAKASSGD
                     ASRRESGNATQSQGGAAQSLSMSQAETVLKQLVEEGWLEKSRKGFYSLSPRGLMELRG
                     WLVATYNDENEDGRRMDKIKFCAACRDIITMGQRCGNRDCAGRLHDHCIRNFFRMQQA
                     EKCPVCQAPWPGDKYVGERAITSTERSTQGRRRSSNTQRQSDVGSSSQIPSEDGAADS
                     D"
     exon            complement(74889..75149)
                     /number=1
     exon            complement(75202..75818)
                     /number=2
     exon            complement(75881..76010)
                     /number=3
     CDS             complement(join(76362..76690,76751..77051))
                     /codon_start=1
                     /locus_tag="AO090120000034"
                     /note="U2 snRNP splicing factor, small subunit, and
                     related proteins"
                     /old_locus_tag="AO070315000035"
                     /protein_id="BAE62672.1"
                     /transl_table=1
                     /translation="MANYLASIFGTEQDKVNCSFYYKIGACRHGDRCSRKHVKPSYSQ
                     TILMPNMYQNPAYDPKNKMNPSQLQNHFDAFYEDVWCEMCKYGEIEELVVCDNNNDHL
                     IGNVYARFKYEEDAQKACDALNSRWYAARPIYCELSPVTDFREACCRLNSGEGCVRGG
                     FCNFIHRKDPSNELDRELRLSTKKWLKERGRDARSVSRSPSPEPTRRRY"
     exon            complement(76362..76690)
                     /number=1
     exon            complement(76751..77051)
                     /number=2
     CDS             78211..78783
                     /codon_start=1
                     /locus_tag="AO090120000036"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000037"
                     /protein_id="BAE62673.1"
                     /transl_table=1
                     /translation="MLSRKRQRPRPSAIAFRILLFATLIVIMAYGAVTPHQMYKVTAE
                     CVLIGIAGLSMAVQVYITWAIFACCLPYTPWVGIALDGVCALGWIGAIIVLSYWDRAI
                     VYMPREGDPGDWFTCAKAHTWDKVLTDDGIGLWINILWCEVEVDGRERLVGNGAARQQ
                     LHALIGLASVSLFFTGLILWWTNKRRNDYF"
     exon            78211..78783
                     /number=1
     CDS             complement(79052..80128)
                     /codon_start=1
                     /locus_tag="AO090120000037"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000038"
                     /protein_id="BAE62674.1"
                     /transl_table=1
                     /translation="MQPSYPIPIKQAAMPPNNSASWLMAKQAPNSVIDVAPYTTPSAN
                     ELVIKTKAVAVNPADVGIQKLGVLLNDYPAILGCDVAGEVVEVHPTLAEVYTPGDRVI
                     GAASPLDRKDGKYCYSAFQEYVVLKVPSIAKIPNGVAYEDAVVLPLGINTAASCLFAE
                     KTLGLEVPSIHGVRSPRGKALLIWGASSSVGACGVQMATRAGYEVVGVASKRNHEMVK
                     GLGASVCFDQSDPTLVDDIATYLSGKEVVGAYGAIASDSALNAMCEILDRCGGRKLVA
                     SVIPGAEQKSTKGVQIVTNFASDIGNSEVGKAIWQWLTIAMEEDWIKYMPRSEIVGKG
                     LERIQEAIDLLAEGVSAKKLVVSI"
     exon            complement(79052..80128)
                     /number=1
     CDS             complement(80386..80862)
                     /codon_start=1
                     /locus_tag="AO090120000038"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000039"
                     /protein_id="BAE62675.1"
                     /transl_table=1
                     /translation="MGIPVSHSEHRRTTKPSLTSAQAKNMPEGWTNDPSELEEFFSPG
                     SGEADLAQCHGLRDIKLLVMGTRDSGDMQHIIKSGRRYYWGYLMIDYIFEITNPKTFP
                     AILRALATKGDSGLKYRKLKQVETVEMEPREQRVVEEEGPRLFVPYNPNAPSVSDK"
     exon            complement(80386..80862)
                     /number=1
     CDS             complement(join(83657..84391,84454..84634,84701..84774,
                     84835..84888))
                     /codon_start=1
                     /locus_tag="AO090120000039"
                     /note="protein containing a U1-type Zn-finger and
                     implicated in RNA splicing or processing"
                     /old_locus_tag="AO070315000040"
                     /protein_id="BAE62676.1"
                     /transl_table=1
                     /translation="MPRAEAGSTKAISNKIKSKGLQRLRWYCQMCEKQCRDENGFKCH
                     TQSESHVRNALLVGEDPRKYIEEYSKEFLNNFLTQLRTSHQEKAIHANIFYQTIVADK
                     THIHLNATKWKSLTQFVAYLGREGLCRVEETEKGLFIAYIDRSPEAMRRREALMKKER
                     QDRGDEEREQRQILEQVERARQNADKEEEIDPEARNLQRKEGEKVKLNIGFGSKANGD
                     SKTESPKPQSPEEKDNAASSATPEPAAASASPDSAPTPAPAPAAAPAPAQDAPKPAVK
                     LSMSLGDKKPKNVFAAAAKKNPLAGKKGPVMEAPKKMSEQERIMKQEMEAMEKKRMRG
                     GFGMPNPKRPKLT"
     exon            complement(83657..84391)
                     /number=1
     exon            complement(84454..84634)
                     /number=2
     exon            complement(84701..84774)
                     /number=3
     exon            complement(84835..84888)
                     /number=4
     CDS             complement(join(85708..86297,86354..87782,87851..87880))
                     /codon_start=1
                     /locus_tag="AO090120000040"
                     /note="actin and related proteins"
                     /old_locus_tag="AO070315000041"
                     /protein_id="BAE62677.1"
                     /transl_table=1
                     /translation="MPPFKDEHILIIAPGSQVTLAQLGLPESFTPARYRFPTRMFPAE
                     KKGEFEPYKIRERRQDGKPSNGTSAPKEDVEMKDAETSAPEATGNNEAAPKPENGEQE
                     DKKDPAEGQDTNGETKKEAQQIFYEEDITSDEGAIYPLENGHIVDWPCFFALLTHVHN
                     TLSPPFHTPIMLISQPAWSARDREAITQFVFEKFKTPAFCMMDSALAICYGYGTSTAA
                     VVDVGKGKVDVTAVTDFLVNEHGRGIALEGCGGDYMTDRLQELLGSKGFTREMCEQLK
                     RSNITEILPAGTPLPGTAATARQNPNPAAAASTGGQDGGPNDAVPRGPGEGTQTGPEG
                     TNGEDEDEGVLDVAAIVSGNTSEFLANREKEKAEKSSSKKGSVDQSGKPIRLPNSKKE
                     KASFQYEEYARLEPEKDAPNAPPRYIRQTREIEVGVERFLSATPKQKTGERLTSNILE
                     DIATQIHHTILSVPDASKRSELWDSLVVVGNGSKIKGFTQALLNTITQKYVLSPSATI
                     FTSELPSNFSTPMPTGGTNTPAPGQTGPFNTPGHGVNPLLVAATHSNNPTAGNMPGTP
                     SMDPSMASHYRSTGHSQTPTSVKTLKPPEYFPEWKEHGNSNVPGTSGSAGMNNGPNAG
                     PGGPGAPSGGHGMEEAVFLGAQVASKVVFVIDQGLSKGFMTRVEYNENGPSAIHEYSM
                     "
     exon            complement(85708..86297)
                     /number=1
     exon            complement(86354..87782)
                     /number=2
     exon            complement(87851..87880)
                     /number=3
     CDS             complement(join(88454..88573,88640..88899,89065..89091,
                     89159..89180))
                     /codon_start=1
                     /locus_tag="AO090120000041"
                     /note="class 2 transcription repressor NC2, beta subunit
                     (Dr1)"
                     /old_locus_tag="AO070315000042"
                     /protein_id="BAE62678.1"
                     /transl_table=1
                     /translation="MSDREFSSNDDLSLPKATVQKIITEILPPSSGQTFSKDARDLLM
                     ECCVEFITLISSEANDISEKEAKKTIACEHVERALRDLGFGDYIPDVLAVAEEHKEQL
                     KSREKKQSKMEQSGLSEEELLRQQQELFRSATEKYHAAPE"
     exon            complement(88454..88573)
                     /number=1
     exon            complement(88640..88899)
                     /number=2
     exon            complement(89065..89091)
                     /number=3
     exon            complement(89159..89180)
                     /number=4
     CDS             complement(join(89988..90024,90072..90442,90501..90814,
                     90874..90913))
                     /codon_start=1
                     /locus_tag="AO090120000042"
                     /note="predicted dehydrogenase"
                     /old_locus_tag="AO070315000043"
                     /protein_id="BAE62679.1"
                     /transl_table=1
                     /translation="MSAKTIIVTGASRGIGLAIAKYLLTSPQSHNVVVIARSVEPLQK
                     LKEQYNKQVEVLNGDLADLSIGQKAVDLALKSFGRLDGMVLNHGVLGQVGKIAQADPE
                     QWKHGFDVNFISFVAFIKAGLPALRETKGKLVFTSSGAAVSAYRGWGLYGATKAAMNH
                     LALSLGEEEPDVTTISIRPGMVDTEMQRELREDHATTLEPQVHSKFTTVHKEGKLLKP
                     EQPGHVMAKLVLDGPKELSGKFLSWNDKALEAFQA"
     exon            complement(89988..90024)
                     /number=1
     exon            complement(90072..90442)
                     /number=2
     exon            complement(90501..90814)
                     /number=3
     exon            complement(90874..90913)
                     /number=4
     CDS             93197..94576
                     /codon_start=1
                     /locus_tag="AO090120000043"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000044"
                     /protein_id="BAE62680.1"
                     /transl_table=1
                     /translation="MTAFTILLGLAVPSLTAANAAANFNLSIATLETYGCDSTCQAVF
                     DYAQAEDRTLFGTDFEFGFYATASNFSRSQPGDLLKFEAINPDGLDVINGMSAYRFQY
                     TSRDLDGSPVPATGFIGIPYTSFRKDQKYPAIAYAHGTIGVFAGCPPSTTPTLYDYTS
                     WSILIEKGYAIIAPDYAGLGNNYTEHKYLSFPAHANDLYYGMVAARKAFPGLFTDGWM
                     GVGHSQGGGSVWKLSESKLLQTGAAGKYLGTVALAPASKIYDMTLLGVESLSQTSNYA
                     SYDILYETIWLPFAIERVFPGMSRAPFAETLQNRTKIADMAQACNYGIMSLAYGLKPL
                     DLFTSAIKNNTDFQEWQDMVAPANGDKAGEPMMIIQGLNDTAVLPQITVSSFQDACRY
                     GNEAHLRLYPGMDHSDVLTASSPEWLAFIDGRFAGWKTPGNCSTITHQPFDVAHMVTE
                     PEAAEIASI"
     exon            93197..94576
                     /number=1
     CDS             complement(join(94808..95473,95525..95638))
                     /codon_start=1
                     /locus_tag="AO090120000044"
                     /note="dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /old_locus_tag="AO070315000045"
                     /protein_id="BAE62681.1"
                     /transl_table=1
                     /translation="MVADPRPQTLAGKVAIVTGATRGIGAGLAEELARRGAKVLITYT
                     SASSEPIADKLIEKIKNFNNGSKAAKVRADLRDLSAGETIVEASIQAFGPNIDILVNN
                     AGVEVVKPLSDLTVEDYNLVYDLNVRGAIFLTQAVLPHLRAPGRIINISSVGARAGFA
                     NLSIYCSSKAALEGLTRCWAAELGDAGHTVNAVNPGPVQTALLENIPKELVEMQKSAT
                     PVEHRVGTIDDVAQVVAWLASEESRWVSGQAIAASGGFAMY"
     exon            complement(94808..95473)
                     /number=1
     exon            complement(95525..95638)
                     /number=2
     CDS             join(96207..96661,96715..97514,97869..97942)
                     /codon_start=1
                     /locus_tag="AO090120000045"
                     /note="possible oxidoreductase"
                     /old_locus_tag="AO070315000046"
                     /protein_id="BAE62682.1"
                     /transl_table=1
                     /translation="MPTVILGGGIIGSAIAYYLSETHPPGDIHIIESSTALFSSASGY
                     AAGFLAKDWFSPDVASLGELSFGLHERLAIEYGGVERWGYMKGMALSYDATIKRGSGS
                     QGDEWMDRGGSRAEMASRSTLGSEMGAPAWLTVRSGVEVERISDVDTAQVDPLRLCRF
                     LMDTAVSRGVQLHHPARATSLVTDSGTLTGVKMVDLVSQEESTLPCTHLVICAGAWTS
                     RVFEDLFPSAQVSIPVSQLTGYSLVLRSLRHTLEHEQQTYGGRCHAIFTENPFSCGFS
                     PEIFSRQGGEIYIAGLNDPDMPLPGLAEESRNLIDRDELRRLKAVSTQLMGRLVDEDA
                     GVTDVNMDDLEVLREGLCFRPVTHRGTPVVCRVDDDFLGDGLKTDGHGGIFVASGHGP
                     WGISLSLGTGRVVADMVEGVRPRADVKSQIFVIFEVRDPILQGSITCADF"
     exon            96207..96661
                     /number=1
     exon            96715..97514
                     /number=2
     exon            97869..97942
                     /number=3
     CDS             join(98384..98411,98462..99288)
                     /codon_start=1
                     /locus_tag="AO090120000046"
                     /note="pyrroline-5-carboxylate reductase"
                     /old_locus_tag="AO070315000047"
                     /protein_id="BAE62683.1"
                     /transl_table=1
                     /translation="MTTLAFIGCGNMGSAILDGLLEATRSEPQKSKIEYFIATTKSAA
                     SAEKLSEKYRSDPSRVLVASGSNVKVMEQSDIVLLACKPFLAQSILSEPGVAKALKGK
                     FVISVMAGKTPAEIMEYIYGDSAQAMNRPVIVTAMPNVAARLRQSMTIIEENPALSKD
                     RAEILTWIFEQIGTVKFVAPDLVNAGSMVSGAAMALLTLAVDGIMDGAVMEGFRRPDA
                     MEVSAQVLEGLAGLLREGVHPAVLRESISSPRGCTIQGLYALEKNGVRGAYAEALVRG
                     VKHLRGEN"
     exon            98384..98411
                     /number=1
     exon            98462..99288
                     /number=2
     CDS             99724..100518
                     /codon_start=1
                     /locus_tag="AO090120000047"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000048"
                     /protein_id="BAE62684.1"
                     /transl_table=1
                     /translation="MKPKVFWPRKPETFYSASKPLADAASPAHNAALHSSPAQKRAPL
                     ADLPTKTLLRSLFLTSAMASPLLKPSIAVLKYVVDSKSPLLSPSKNPIMNYILRATIY
                     NHFCAGVNETEVRKTVQEMKTLGFKGVILGYARESVAKVDAAGSHVEEWKNAQAIEDR
                     AVDEWKEGNLRTLRMVGKGDYMNIKYDRTKIKCDTQRMLTRLDSPAPALQPLKHSLAV
                     TPSHHHASSKLLQKSVKQLQPRDPGSGSTPSNRSSNQPLTPGRSIS"
     exon            99724..100518
                     /number=1
     CDS             complement(join(101741..101949,101990..102089))
                     /codon_start=1
                     /locus_tag="AO090120000049"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000050"
                     /protein_id="BAE62685.1"
                     /transl_table=1
                     /translation="MREYSWPEPVRREDDIVCETAEEYFCGPFFDNNDSRNILGRFLY
                     EDLIPDRKLGDTVSFLEGEEREAFLDLAKGMLLWHPNVRETAGELAGHPFLQPKQTSP
                     "
     exon            complement(101741..101949)
                     /number=1
     exon            complement(101990..102089)
                     /number=2
     CDS             complement(102257..102790)
                     /codon_start=1
                     /locus_tag="AO090120000050"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000051"
                     /protein_id="BAE62686.1"
                     /transl_table=1
                     /translation="MREPLSMYQRRFGDRRMPLPLIKTYIRALLTGLDYLHKQCRTVH
                     TGKFIFDLSSPRDTEPRRRLDLKLENIMVSFEDPTVLADFLESQLEKPMAFKIDSTGR
                     PVYQSRSDFGPLKSLRSIPQLVDFGLATRHEEDDDWGVWPIQPDHYREPEVILGIGWQ
                     MPADIWNLGVLVRPVVL"
     exon            complement(102257..102790)
                     /number=1
     CDS             join(105737..105748,105821..107560,107611..107898,
                     107978..109150)
                     /codon_start=1
                     /locus_tag="AO090120000052"
                     /note="acid trehalase"
                     /old_locus_tag="AO070315000053"
                     /protein_id="BAE62687.1"
                     /transl_table=1
                     /translation="MKLRNLAPWALLLTAVHGLPSQGTQNKHNPRVAKILKRHEGSSQ
                     KAKDSNNVYETKFDGVTWDEENWLLKTTTLDQGHYQSRGSVANGYLGINVASVGPFFE
                     LDEEVDGDVINGWPLYSRRQSFATIAGFFDSQPTTNGTNFPWLSQYGWDTAISGVPHW
                     SGLILDLGDDVYLDSTVDDSTITDFQSTYDFKAGVLSWSYTWSPADKGSFEITYRLFA
                     NKLNITQAVVDMEIIPSVDANATVANVIDGYSAVRTDFVESGQDDGALFSAVRPWGIS
                     NVTAYIYTNLTGSANVDLSSRTLVTGKPYVNTNESSVAQTVNVKFTAKEPVRITKFVG
                     GASTDAFADPKQTAKEAASAALAAGYKNSLESHASEWANIMHENSVDRFTDPTTGKLP
                     EDQHVIDSAVIAVTNIYYLLQNTVSQNAIAAVSNATVNETSFSVGGLTSDSYGGQVFW
                     DADVWMQPGLVASHPEAAQGVTNYRVAKYQQAKENVKTAFTSSKNQTRFDPSAAIYPW
                     TSGRAGNCTATGACFDYQYHLNGDIGLSMIYQWVASGDTEYFQEKHFPIYDSVATLYS
                     NLVERNGSSWTLTNMTDPDEYANHVDAGGFTMPLIAQTLENANTFRQQFNLEPNDTWT
                     EISENVLLLRQNNVTLEYTSMNGTAVVKQADVVLVTYPLAYESNYTAEMALSDLDYQS
                     ADGPAMTWAIFSIVASDVSPSGCSAWTYHQYSYDPYTRGPFFQLSEQMLDNASINGGT
                     HPAYPFLTGHGGANQVVLFGYLGLRLLPEEGIYITPNLPPQIPYVKYRTFYWRGWPIA
                     AESNYTHTTIRRDTKTAPLSTADERFRNATIPVHVGSDEAETHTLQPTGSPLIIENRQ
                     IGTIPTMQGNQIQCQPITSPDEYKAGQFPISANDGATSTKWQPASSNLSSITVTLSDT
                     QLANAVSGFHFDWASAPPVNASVIFHEEVIDNPASVFAFGTQDQAQDEGDEKYRVVLT
                     LTGIEPSTIYTAEEENQVRIPVGNTTTTQLKETVKASKYATLLIAGNQALSGEQEDAG
                     ATVAEWVILSQEGGQSQSAATAQRRGMNVRDRALLERLRR"
     exon            105737..105748
                     /number=1
     exon            105821..107560
                     /number=2
     exon            107611..107898
                     /number=3
     exon            107978..109150
                     /number=4
     CDS             join(109652..109791,109885..110304,110353..110687,
                     110758..110783,110837..110863)
                     /codon_start=1
                     /locus_tag="AO090120000053"
                     /note="mitochondrial phosphate carrier protein"
                     /old_locus_tag="AO070315000054"
                     /protein_id="BAE62688.1"
                     /transl_table=1
                     /translation="MSVTTAAPVEAKTEPQKLSGLNLYSRFAFAGAVCCSVTHGGLTP
                     VDVVKTRIQLDPVTYNRGLIGGFRQVIQNEGAGALLTGAGPTFAGYFLQGALKFGGYE
                     FFKQQSINTIGYENARNNRIAVYCVSSAFAEFFADIALCPLEATRIRLVSEPTFASGL
                     VSGFGRIARQEGLAGFYSGFGPILFKQVPYTMSKFVVYEKVAEFAYANFFDKEKTSDG
                     MQTAINLGSGLIAGFAAAIVSQPADTMLSKINKTKGLPGEGTTSRLIKIAKELGFRGS
                     FSGIGARLVMVGALTAGQFAIYGDLKKAMGAVGGVEIAK"
     exon            109652..109791
                     /number=1
     exon            109885..110304
                     /number=2
     exon            110353..110687
                     /number=3
     exon            110758..110783
                     /number=4
     exon            110837..110863
                     /number=5
     CDS             join(115023..115168,115315..115803,115855..116977)
                     /codon_start=1
                     /locus_tag="AO090120000054"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000055"
                     /protein_id="BAE62689.1"
                     /transl_table=1
                     /translation="MPRGLDSREAGNLEPGANRDARKLVSERQAHARMDQRLWSTASL
                     GLRTGHPQYNVADFGVAFRSVSRQLMTQIIEPPTDILDLAEEYSAFYSLDEGESGLWS
                     LITSSFESVFVVFDAANASEAALKDMLVCLGGNDVQNSRLHILITSRYPPPRSLLRTY
                     KLPTIVTRASDDDLMTYIMHELGDVSGEKHLYPIPKDVREAMSDIIEMLDGIFPPLPR
                     FGAISDTLNELAQVLSNVPSSEKSKALSQLALSHIEKAEHEKNPIQVLHLVSTLEEIG
                     YKPTIPQIVDFLRFLGLYKNEDNDYTTHDVANMCAHFVSFGTCTQAMRIRSPLLQSHL
                     CEEVSKSNTKGTMLRAALSYLSQEDFQRGACTSSASLKKRFQTHPFLPFASRIISLYT
                     SRVPHQQEALDDFLRFASHRGSIDSYLQAADAWLYQDDDSYDELESAEQRWAYFPRGY
                     GPLHVAAHIVGGRLFVKALLQQGGDVEAQSGNGQTALHVAAGIEDESETARTLLEYGA
                     SVSAVDDDGETPLSIAVVEGDLETVKLLVEFGADIGSLDTSILVECAEERRDVVEYLT
                     GLGVNFPDEDQMDEDDEEA"
     exon            115023..115168
                     /number=1
     exon            115315..115803
                     /number=2
     exon            115855..116977
                     /number=3
     CDS             118377..120257
                     /codon_start=1
                     /locus_tag="AO090120000055"
                     /note="alkyl sulfatase and related hydrolases"
                     /old_locus_tag="AO070315000056"
                     /protein_id="BAE62690.1"
                     /transl_table=1
                     /translation="MSSTSYPPEDPTDKTNASRGLITSLEPCVVYSDTDPARAIWDND
                     SFDFLAKEYPPHFTNPSLWRQSQLCQKQGLFGVRPGIYQVRGLDLSNITFIECPNTKG
                     VAVIDPLTSVETAKKALELYQGQFPDRAIKALIYTHSHVDHFGGAKAIADAAGEGLKV
                     YAPNGFLEHAVSENVYAGNAMGRRAVYMYGESLPRQRDGQIGCGLGLTVSTGVSGLIP
                     PTTGIKRTGEKIIVDDDLEIECQLTPGTEAPAEMNMYFPQYNALCMAENATHTLHNIQ
                     TLRGALVRDARVWAKYLDEAIVRYGKDAHVVFSSHHWPTWDNENVNEFLTKQRDLYAY
                     LHNETLRLLNTGQTGIEIAENFHLPPSLNNTWSARGYYGSISHNVKAIYNRYMGWLDG
                     NPAHLWEHTPVASAKRYVKCMGGIAKVIDLAKEYTDEGDLRFAATLLNHAVYADQNND
                     QARSELASVYRKLGYGAENGVWRNFYLTGARELHPQNKPVGSQLAMSAELLMALDLEQ
                     LFDTIAMHVDGPKAWGRSLTIDFMITDMSRGWHLNLSNGALTGHGIEYREPSNERDAS
                     LVIWLTHKDLTALIAGDRKDLGGLTTAGDVKYWETLVSLLTTPDPAFAIVTPRAIQGS
                     ST"
     exon            118377..120257
                     /number=1
     CDS             complement(join(121077..121378,121443..121519,
                     121574..121611))
                     /codon_start=1
                     /locus_tag="AO090120000056"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000057"
                     /protein_id="BAE62691.1"
                     /transl_table=1
                     /translation="MPMPCRTQRYKYCFTVIVCLPYLHLTNFGYLKTNIIPHFSNPNH
                     NSNMQLKSLFVVMAGLMAFAAAAPAEAEARDTANVQARKSWTAEGGCKTDWAGRCNAQ
                     CIGEGVRSHGCKKSDISSGIESSHCFFGWNICKCSC"
     exon            complement(121077..121378)
                     /number=1
     exon            complement(121443..121519)
                     /number=2
     exon            complement(121574..121611)
                     /number=3
     CDS             join(124110..124213,125536..125663,125722..125754,
                     125809..125918,125977..126785,126843..127520,
                     127576..128158)
                     /codon_start=1
                     /locus_tag="AO090120000058"
                     /note="putative alpha-1,2-mannosidase"
                     /old_locus_tag="AO070315000059"
                     /protein_id="BAE62692.1"
                     /transl_table=1
                     /translation="MHCRNNRSHSGCNTSASDSYPDRGGCGCHSLVSLLRLLKVSTLL
                     CLSPVLAYGKGENGNSNFDVFDYIDPFIGTSDGGHSFPGATLPFGMVKAVADTDGANQ
                     GGFASDASFVTGFSHTHDSGTGGPGSMGNFPIFIHPACPDDNLTKCSWQESDRSVRWD
                     RESTKAQPGFFSISLNNGVHAEMTVTNHSALYRFSFPEAAPDSLNPVVLVDMADLHHS
                     RHNGTTSVDPHTGRFTGSATFEPSYGVGTYRVHFCADFHGPSIRDTGIWLDDEVRPGK
                     NTVSLNASGSGGAFARFTPPQANGTMDVRVGISFISATQACSNAEKEQPNFDFEDTVA
                     RANAAWKEKMGVISLDTSGVSTELQTVFWSGIYRTMISPQDYTGENPLWKSDEPYYDS
                     FYCIWDSFRGIHQLITLVDPLSQSRMVRSLVDIYRHEGYLPDCRMSFCKGLTQGGSNA
                     DVLIAEAYLKGIPDVDWDTAYRAVVKDAEVEPENFNVEGRGSLQSWKSLGYIPIHDSN
                     TTAKGLRTRSISRTVEYAYDDFCIAQMAKSMGHDGDYKKYMKRATNWENVFKPNQTSS
                     WRGSNFTGFLQPRNADGTWAYQDPMFCGPYLQPDACLMDENAKETYEGSSWLYTFYVP
                     QDMAKLIRALGGRSKFIDRLSFFHDSGLLNMGNEQAFLPVFQFHYAGRPALSTERAHS
                     YIPRLFNTSVGGLPGNDDSGAMGAFAVFSMLGLYPVHGQDVYLISAPFFKEASIRNRI
                     TGNVATIRNINFDPLYKSIYIQNVTRDGKPWTRNWIGHDFFIEGGTLEITLGDKESNW
                     GTRIEDLPPSMSEYRW"
     exon            124110..124213
                     /number=1
     exon            125536..125663
                     /number=2
     exon            125722..125754
                     /number=3
     exon            125809..125918
                     /number=4
     exon            125977..126785
                     /number=5
     exon            126843..127520
                     /number=6
     exon            127576..128158
                     /number=7
     CDS             complement(join(131247..131382,131969..132369))
                     /codon_start=1
                     /locus_tag="AO090120000059"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000060"
                     /protein_id="BAE62693.1"
                     /transl_table=1
                     /translation="MGSLGIFGLSRDLQEYKYYDLRTTSVTASTIADDLDAFPKAQLI
                     LLLSGKDLQTGKKTLFGYYVPLLEIRHAPFLFQLSDTSDSFRGNGPRPGHELDGGELI
                     IGQRGNGAALMLRQDAKRAIVSHNVSDQFEPIGMMAADYEEETTTCSQQNVTCIRSFN
                     FLVPFLVYYYWIPTDCYI"
     exon            complement(131247..131382)
                     /number=1
     exon            complement(131969..132369)
                     /number=2
     CDS             complement(join(132417..132443,132544..133491))
                     /codon_start=1
                     /locus_tag="AO090120000060"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000061"
                     /protein_id="BAE62694.1"
                     /transl_table=1
                     /translation="MDEPIDINNPNDYAKIDELTAQGLLDRDAVLYKLTRRICKFGVI
                     KSESELPHLRRTFDSLAVQENGTKTLTQTGFLSFLESTGFLPPSMRDTGALVYRSLLY
                     LSQYPFHQPIPDSLTYMGLIRALAWTMAWRTRPIHEACRWSRTRSPADSRRQLFQSFA
                     TGRDGKSVPFDAEYAKAQAQRRAFDFACASHDSLTCIFPKTNYDDHGDEMFHDILDVL
                     FSIQPQIIWLAPPPRDCFRATARKLAGDERLPDLSIPQDQFRAIVKLLVMASIRGPTV
                     PVEELIDLDHVVDCMVNRAIQRPDIGITWDMYDQAARNGMIPRIKTTL"
     exon            complement(132417..132443)
                     /number=1
     exon            complement(132544..133491)
                     /number=2
     CDS             134376..135161
                     /codon_start=1
                     /locus_tag="AO090120000062"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000063"
                     /protein_id="BAE62695.1"
                     /transl_table=1
                     /translation="MKLSKILSIVLATLSVGVSSRPTTLSNDVQQVPADIRDEPFKVP
                     VDIEKRAGHEETERFKNTQKYLGKQKLQLGKTYSFQVTWTQGAAGSTTKTTSPIEREM
                     KKTQQGYGFDHTGIVVGEVVKVPVGQKYELDFKGDLYHLRAKLEGSGQKAWYKTWVES
                     IPWDPKPTPKTVTALHLQEVSGKWEEKAVHANTAGRFSAVFPVLRMRSLKANSSFQLA
                     RLARKTATDGKANGTTAPSMSRLLKRRYRCTIRVELWIELRIE"
     exon            134376..135161
                     /number=1
     CDS             complement(join(135841..136158,136230..136340,
                     136395..136559))
                     /codon_start=1
                     /locus_tag="AO090120000063"
                     /note="cytochrome P450 CYP4/CYP19/CYP26 subfamilies"
                     /old_locus_tag="AO070315000064"
                     /protein_id="BAE62696.1"
                     /transl_table=1
                     /translation="MFAGSDTTAFSLTITLVYLCKYPEKIVKLRREVQCLRDFKVQDI
                     QLATISQMPYLDAVIREANRLSSPLSTVLPREVPSTGCVISGHFLPKGTVVGFHLDDI
                     NRNPKFFPEPNDFIPERWSGEEGKKLQRWFVPFSKGSRRCIGMDFAFVEMKLAVAAII
                     SRFEIWLDNPNVTLNSREMFVKIPEDDLRIRLRAITV"
     exon            complement(135841..136158)
                     /number=1
     exon            complement(136230..136340)
                     /number=2
     exon            complement(136395..136559)
                     /number=3
     CDS             complement(join(137592..138312,138375..138529,
                     139253..139309))
                     /codon_start=1
                     /locus_tag="AO090120000064"
                     /note="geranylgeranyl pyrophosphate synthase/Polyprenyl
                     synthetase"
                     /old_locus_tag="AO070315000065"
                     /protein_id="BAE62697.1"
                     /transl_table=1
                     /translation="MQALEAWLRDRGLQEAFEKILTGPLDYLRENPGKDIRAKLIDAF
                     NEFLEVPNDKLDVIKRIIDLLHNASLLIDDIQNSSTLRRGVPVAHSIFGVAQTINSAN
                     YAYFIAQRELTNLTNPLSFSIYTEELIHLHRGQGMELHWRDTMQCPSEVEYIEMALDK
                     TGGLFRLAIRLMQAESASGTDYVPLVETLGLLFQIRDDYQNLQSDTYSTNKGFCEDIG
                     EGKFSYPIIHSIRSRPGDLRLLSILKQRSEDITVRKYAVEYIDSTGSFDYCERKIISL
                     MQQAREQVRRSIADTTHRGSQIEKILNMLEIDKK"
     exon            complement(137592..138312)
                     /number=1
     exon            complement(138375..138529)
                     /number=2
     exon            complement(139253..139309)
                     /number=3
     CDS             complement(141920..142723)
                     /codon_start=1
                     /locus_tag="AO090120000065"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000066"
                     /protein_id="BAE62698.1"
                     /transl_table=1
                     /translation="MTNDVKEEVLSLDLEENDFLYRIRRNSRIVYVSVLDGGILPPDY
                     RTDGFLVLAKLQNIPKWNDKWKTLTVRNTAQGIESSPDEFPPHGLDLGQLNHPSSIFV
                     NILDLTTVSRISYRLSRVRHGDETWVLKIARFKHEIRSLQHEVSVYSKLMESGFSFCP
                     KFIGFVYEETKDRTIGFLMEEISGRTPGIQDLKDCTETVRLLHEHGIVHGDLNKYNFL
                     VTEEGVKLFDFEVSAAQEDADPGSTEDELKGLAARLEDESGIGRRGSLF"
     exon            complement(141920..142723)
                     /number=1
     CDS             join(145541..145748,145810..145941,145979..146270,
                     146324..146389,146466..146541,146620..146969,
                     147050..147134,147203..147363,147418..147583)
                     /codon_start=1
                     /locus_tag="AO090120000067"
                     /note="cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies"
                     /old_locus_tag="AO070315000068"
                     /protein_id="BAE62699.1"
                     /transl_table=1
                     /translation="MEDTFNLTVLGGVIVLYSLGLVIYRLYFSPLAKFPGSKLAAATG
                     WYEFYFDYWIGGKYVFEIERMHQVYGPIIRINPHELSIRDPDFYNEIYVTENKRRSNH
                     YDLFARGIGMDDARVESHIVTVDHNLHRKRRKPLEPFFSRAGIARLEPALVEMSLKLE
                     SRLRQYEGKHTVVTLDHAFSAFSGDIIRRVCFNKDDFGDLFMDHPDFSPDWYNLIHNI
                     LRHFPVFTGFPLIARIVTYIPESILLKAFPQGQSLNRLKDVALQRITHVMNSKATELK
                     DTHREVSLFHHIVESDMPESERSPERLVQEAQVLLSAGTVTTARTIAFASFYILARSE
                     IKAKLQAELRDAMDGWPEKVPTFMDLERLQYLQAIIKESLRLSYGIMHRLPRVSPDLP
                     IQYKDFTIPVGTPVGMSSYFMHTDPTVYPDPMTFRPERWLGAIDPAMHRNYVPFTRGS
                     RNCLGMNLAMAEISLILAVLYRPNGLKLELYETDETDVMIAHDFMAPMPKVTSKGVRV
                     LIR"
     exon            145541..145748
                     /number=1
     exon            145810..145941
                     /number=2
     exon            145979..146270
                     /number=3
     exon            146324..146389
                     /number=4
     exon            146466..146541
                     /number=5
     exon            146620..146969
                     /number=6
     exon            147050..147134
                     /number=7
     exon            147203..147363
                     /number=8
     exon            147418..147583
                     /number=9
     CDS             complement(join(148563..149476,149539..149713,
                     149775..149939,149986..150401,150467..150692,
                     150752..151033))
                     /codon_start=1
                     /locus_tag="AO090120000068"
                     /note="catalase"
                     /old_locus_tag="AO070315000069"
                     /protein_id="BAE62700.1"
                     /transl_table=1
                     /translation="MRALSLASLIGIASAACPYMTGELERRDTGTDDATAATEEFLSQ
                     YYMADNDTFLTSDVGGPIEDQNSLQVGDRGPTLLEDFIFRQKIQRFDHERVPERAVHA
                     RGVGAHGVFTSYGDYSNITAASFLGAEGKETPVFVRFSTVAGSRGSSDLARDVHGFAT
                     RFYTDEGNFDIVGNNIPVFFIQDAILFPDLIHAVKPRGDNEIPQAATAHDSAWDFFSQ
                     QPSSLHTLLWAMSGHGIPRSLRHVDGFGIHTFRFVTDNGDSKLVKFHWKSLQGKASMV
                     WEEAQQVSGKNPDFMRQDLFEAIEAGRYPEWELGVQIMDEEDQLKFGFDLFDPTKIVP
                     EEYVPITKLGKMTLNRNPRNYFAETEQVMFQPGHIVRGVDFTEDPLLQGRLFSYLDTQ
                     LNRHGGPNFEQLPINQPRVPVHNNNRDGAGQMFIPLNPNAYSPNTLNKGSPKQANQTV
                     GKGFFTAPGRESTGRFTRAVSPSFEDVWSQPRLFYNSLTPAEQQFVVDAIRFENSNVK
                     SSVVRNNVIIQLNRVSNDLARRVARAIGVEEPEADPTYYHNNKTTDVGTFGQKLKKLD
                     GLKVGFLASVETPASIEAASELSKQLSEDGVDVVVVAERLSDGVDQTYSGSDAIQFDA
                     VIVAPGAEGLFSTFSFTAPSNATSSSTLFPAGRPLQIVIDGFRFGKPVGAVGSAATAL
                     KNAGIQTSRDGVYVDKSVTSGFVDGIKDGLRTFKFLDRFKLDH"
     exon            complement(148563..149476)
                     /number=1
     exon            complement(149539..149713)
                     /number=2
     exon            complement(149775..149939)
                     /number=3
     exon            complement(149986..150401)
                     /number=4
     exon            complement(150467..150692)
                     /number=5
     exon            complement(150752..151033)
                     /number=6
     CDS             complement(join(152984..153635,153706..154151))
                     /codon_start=1
                     /locus_tag="AO090120000069"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000070"
                     /protein_id="BAE62701.1"
                     /transl_table=1
                     /translation="MNLLLLAGLLPLAASQSVSDLYLENAPSSPRPYIIPHYANSHAV
                     TIGSQLYRFPVTGPSSDYAFTLMSTNAPYSGSLGVLPHIHQKHYENFFNFKGRFQLWA
                     QYGEEEQQGRLLTQGDYGSVPRNTTHTFQILDPDTEMVGVISPGGFEDLFYTLGTNYT
                     SATNTPYVPQASNDSSATGPDASGISGLESFDVYAQLSFEPRRDFVNGSAPSDEGWHT
                     EDASLGEPGKPYFIANNYGPKYLNSKHGAYQIIQPLVTNSQAQDTNFTLSTIILSRQR
                     TSSSAPTWSTVGATAFEVLEGSVQIQIGDYPVAQLEMGDVAFVPATVSYSYWTEGSYA
                     KVLSVNAGQDGLNQQLIAEGKDWGYPTFPRY"
     exon            complement(152984..153635)
                     /number=1
     exon            complement(153706..154151)
                     /number=2
     CDS             join(157784..157817,158050..158157,158394..158537,
                     158598..158680)
                     /codon_start=1
                     /locus_tag="AO090120000072"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000073"
                     /protein_id="BAE62702.1"
                     /transl_table=1
                     /translation="MIIDYHLDTAPVSFYSLGWGVFLSKRNAASGKLWLSDDCTLGYH
                     IDIPHGREVGAGLGRTDTYSTRRLFDTLDAFNNHASPACDGLEPKDGDFFDISPDKKH
                     IRDFDDRSGLWMGGWDGPGT"
     exon            157784..157817
                     /number=1
     exon            158050..158157
                     /number=2
     exon            158394..158537
                     /number=3
     exon            158598..158680
                     /number=4
     CDS             complement(159589..160311)
                     /codon_start=1
                     /locus_tag="AO090120000073"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000074"
                     /protein_id="BAE62703.1"
                     /transl_table=1
                     /translation="MKSISALAAIIPLLPVTEALVGLDWSATNIPSTGLKDITFPISI
                     ANAPREEGFYFAQQFSFNGVTDIGYTGLQPRPDANGASIIHAVFSSFIPGSTSTDENC
                     SDGADGGAGVSCAVEIPASYAPMYHLVIKNTEGTTWTGTLVDAVNNNETHIGEYTLPS
                     GTGGIKESQVGFVEYYPWNAVASHTCGSLPYTNATFLNPISSESGVTATVGKPYEYGD
                     CEGQVRFDVQEVEDGFEVSVGF"
     exon            complement(159589..160311)
                     /number=1
     CDS             complement(join(161144..162308,162362..162495))
                     /codon_start=1
                     /locus_tag="AO090120000074"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000075"
                     /protein_id="BAE62704.1"
                     /transl_table=1
                     /translation="MWEYYSGKVLFITGASGFLGTALVYRIISQAPVAHIYLLCRGGL
                     PRLEEVWRQYLPSKYIECLYDTGLVTVIEGDILEPNFGINGDHLQALQEHVNIVIHTA
                     SSINLMSSLEKLAKPVIHGSENVAHFGLQCQQLDRFVYVSTAYVNAFIYQESDDTDPY
                     VEERIYPLGREWISDARDEWKQVQREGKSLEYSAHNFPWPYGYAKHLTERLVLYIFSA
                     AGKAEKLLILRPSVIAPAQTFPYEGFSVPKSTPTTVFAAFFILTPTLVVRVTSRADDP
                     ETESTIDEVPVDVVVDRLLVHLAKGTTGPVHAVGGVRTRYTFQAFWEQAMALRKLPWP
                     LRKEWLDVDWRSKLLHPIARVYVIYAASYRFSEEKTVSLWKSLSEKESSELQLFSSGS
                     RNGVDFAARAKQIRFVAEQFAAKGFLSRILFWLFYSSGFF"
     exon            complement(161144..162308)
                     /number=1
     exon            complement(162362..162495)
                     /number=2
     CDS             complement(join(163059..164422,164554..164566))
                     /codon_start=1
                     /locus_tag="AO090120000075"
                     /note="beta-glucosidase, lactase phlorizinhydrolase, and
                     related proteins"
                     /old_locus_tag="AO070315000076"
                     /protein_id="BAE62705.1"
                     /transl_table=1
                     /translation="MARVRLKLPADFIWGVSSSSWQIEGGLQLEGRGPSVLDTIGNVL
                     SPEAADRSDANVANMHYFMYEQDIARLAAAGIPYYSFSLSWPRIVPFGVAGSPVNTQG
                     LDHYDDLINTCIKYGVTPIVTLNHVDAPTAVQADLDSLPEHFLYYAKIVMTRYADRVP
                     YWVTFNEPNIGVGTLFQKYQDLTSALIAHADVYDWYKNTLGGTGKITMKFANNLAMPL
                     DTQDSSHIAAASRYQDILLGIMSNPLFLGKQYPDAAIDTVDMMQPLTDDQIKHIHGKI
                     DFWSFDPYTAQYASPLPQGTEACASNSSDPFWPTCVILSNVQANGWLMGQASNAYAYL
                     APQYVRQQLGYIWNTFRPSGILIAEYGFNPFLESNRTLDAQRYDLERTLYYQDFLTET
                     LKAIHEDNVNVIGALAWSIADNNEFGSYEEQYGLQTVNRTNGKFTRTYKRSLFDYVDF
                     FHRHVQSA"
     exon            complement(163059..164422)
                     /number=1
     exon            complement(164554..164566)
                     /number=2
     CDS             165424..166086
                     /codon_start=1
                     /locus_tag="AO090120000076"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000077"
                     /protein_id="BAE62706.1"
                     /transl_table=1
                     /translation="MRGGRKWRRSARCIHNLDGKDLNGGKRALIDRKGRICRSNADEM
                     RGKAASHNVSPTTTGHCKIKEQTMSYYLSMVISGEGKDPRHRSHWAFAIHQPAQVIGD
                     LLHVRPIDLGRLWYEFEHRSDSDLILVDAIGLAKIADLDGSQRLQAISVIRDETAPKD
                     GVRRCQDWVFSALIALEVEELVPSGTSELWKGLMGRTATEVEKAVGPKWTSFRGCHSS
                     LR"
     exon            165424..166086
                     /number=1
     CDS             complement(166268..167524)
                     /codon_start=1
                     /locus_tag="AO090120000077"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000078"
                     /protein_id="BAE62707.1"
                     /transl_table=1
                     /translation="MATAERRKIVVLGGSYAGVSAAHYLLKHVVPKLPDPEGYQVILI
                     SASSHTLCRSACPRALISDEFFDQEKLFVSISKVFDQYQDDRTRNFRFIHGTVTQLDH
                     TSRNVTVSFTANDTIDTIDFHTLVIATGSSTPSPLLGLNRDIGDLRENWTAFRKALPT
                     AKSIIISGGGPAGVETAGELGEYLNGRAWWFRSKLANPRVPITVVTSGPQILPLLRPS
                     LASLAEQYLAQVGVTVIKSARVQNVAPSADSKDALTAKTTVTLEDGQILGADLYIPAT
                     GTRANAGFIDRSLLTPDGRVDTNPSTLRVDKAGPRVYAIGDVSSWARPTVHFIVEAIP
                     VLCANMKRDLLLAAGEDEGSVGEDRLFKEDTRETQLVPIGKSKGVGAAMGYRLPSFLV
                     WLMKGRDYWLWTTEKLWSGRQWSKEL"
     exon            complement(166268..167524)
                     /number=1
     CDS             complement(join(168212..168537,168632..168809,
                     168869..168880))
                     /codon_start=1
                     /locus_tag="AO090120000078"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000079"
                     /protein_id="BAE62708.1"
                     /transl_table=1
                     /translation="MADEGASPRELVIEACRRDQPHLIEQVLKGMEGKSNEEVAEFFN
                     GVTDSMGNHALHICATYGSGDTMDCLFDIQYFECDPLTRLDKDTPLHNAVRYANEKDR
                     EIGLEMIEMMCEAGCDPRVRNKHGQKPADLVYNNPEIKSILQKTEYVLAEGLRDNSDN
                     GSVHDSASDSE"
     exon            complement(168212..168537)
                     /number=1
     exon            complement(168632..168809)
                     /number=2
     exon            complement(168869..168880)
                     /number=3
     CDS             join(169584..169596,169666..169875,169946..170040,
                     170109..170144)
                     /codon_start=1
                     /locus_tag="AO090120000079"
                     /note="RNA polymerase III subunit C11"
                     /old_locus_tag="AO070315000080"
                     /protein_id="BAE62709.1"
                     /transl_table=1
                     /translation="MPLTFCPNCSNALTISRADPTPRHPLGVNRFECRTCPYQYVLEQ
                     SYFEKTEMKQKEVEDVFGGKEEFANADSMATQCPAENCNGDRAYFFQLQIRSADEPMT
                     TFLKCTSCGARWREN"
     exon            169584..169596
                     /number=1
     exon            169666..169875
                     /number=2
     exon            169946..170040
                     /number=3
     exon            170109..170144
                     /number=4
     CDS             join(171707..172004,172068..173074,173206..173307)
                     /codon_start=1
                     /locus_tag="AO090120000080"
                     /note="translation elongation factor EF-1 alpha/Tu"
                     /old_locus_tag="AO070315000081"
                     /protein_id="BAE62710.1"
                     /transl_table=1
                     /translation="MADKYFPPYSKEDKQHINIVVIGHVDSGKSTTTGHLIYKCGGID
                     QRTIEKFEKEAAELGKGSFKYAWVLDKLKSERERGITIDIALWKFQTSKYEVTVIDAP
                     GHRDFIKNMITGTSQADCAILIIASGTGEFEAGISKDGQTREHALLAFTLGVRQLIVA
                     LNKMDTCKWSQDRYNEIVKETSNFIKKVGYNPKSVPFVPISGFNGDNMIEASTNCPWY
                     KGWEKETKAGKSTGKTLLEAIDAIEPPVRPTDKPLRLPLQDVYKISGIGTVPVGRVET
                     GVIKPGMVVTFAPANVTTEVKSVEMHHQQLQAGNPGDNVGFNVKNVSVKEVRRGNVAG
                     DSKNDPPAGCDSFNAQVIVLNHPGQVGNGYAPVLDCHTAHIACKFAELLEKIDRRTGK
                     SVEDKPKFIKSGDAAIVKMIPSKPMCVESFTDFPPLGRFAVRDMRQTVAVGVIKSVEK
                     NTGGSGKVTKAAQKAGKK"
     exon            171707..172004
                     /number=1
     exon            172068..173074
                     /number=2
     exon            173206..173307
                     /number=3
     CDS             175358..177517
                     /codon_start=1
                     /locus_tag="AO090120000081"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000082"
                     /protein_id="BAE62711.1"
                     /transl_table=1
                     /translation="MDGPPPPPPPHGEKPNTTGGQEYRKASDLPEGNYDIFIIPPHSS
                     GSGFLYLPSLQCQRNSFVAGSVCTLFVVLVWSFISPIFKTWYIAAAAGGGGAGGMGIG
                     LLGIGVGIAGWGFGVYQAGFGGSGFGRKGPGGGAASGGAGANTGQAGAGGEYARGSGN
                     AGGQQGNYGGNYGPPPGSQYSGNQYGAGPPPQTPPPNAGPGPNKSDSAKAEEKARAEE
                     KAREEKAREERAREERAREERAREERAREQKVREERAREERAREERAREEKARAERER
                     EEKAREEARRKEELRRKMEEFKRKREAERQEKQRQQEREAMEKEMRERREQFEKEMAA
                     AREAAAKEARERAEKEAAEARAKAERDAAEARAKAEREAAEAKAKAEKEAAEKEAAAK
                     AAAKKEADAKFAALKEAAAKKYAEKKAKDAQEAAAKEAAAAKDAAAKAAKEKSGSASV
                     PPRSPSPKKPAPSGARTTMSADQDDAYSFRPYDRPRRPYGGTSSSSAYSESSYAPSQS
                     TARTSPAPSNRGRYETKDPDKIVIKGVFQFNNAFIKSPAAQLVSGQGMVTDGLVLRIT
                     TEGLFIDDDIRGVGQREWDVKAWTMKLVEVWCPQYASQKHNPPKQSSFFGRRDEGPSS
                     AESDAYLINLLKVCKNTCRLASPGSQSEIQGLHVLRASIRDQEGRKYLFVLEETEGWK
                     VGIGLQRLRKGALVRSLGVTNMSVNEGRSILGNLGYI"
     exon            175358..177517
                     /number=1
     CDS             180251..180706
                     /codon_start=1
                     /locus_tag="AO090120000082"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000083"
                     /protein_id="BAE62712.1"
                     /transl_table=1
                     /translation="MTEVERTAFRARRAAQTRGYRAKKKAESEPKPPRIVSAKNIRRN
                     AMRKAQRAGDVFQSEKAKLQQRAVRARHRLKKVEAAGDAQRIEEAALALKIARVERWE
                     FAVEHGNSVKIVPSKEDRRMVNEHRAKQASNTNIDRIMLFFKDGKNLGI"
     exon            180251..180706
                     /number=1
     CDS             join(182254..183157,183206..183303,183352..185340)
                     /codon_start=1
                     /locus_tag="AO090120000083"
                     /note="ARK protein kinase family"
                     /old_locus_tag="AO070315000084"
                     /protein_id="BAE62713.1"
                     /transl_table=1
                     /translation="MSYHSNPQSYQSHAASHRPIPSYNPLAAVNAPAGTFLPGTKVQV
                     GNHRVVIEKYLSEGGFAHVYVVRLPQPVEGSDRAVLKRVAVPDKAALANMRTEVETMK
                     KLKGHRHIVKYIDSHASQLRGGGYEVFLLMEFCSGGGLIDFMNTRLQHRLTEPEIIQI
                     FSDVAEGVACMHYLKPPLLHRDLKVENVLISRHGTSSIYKLCDFGSAAPPRPAATSAA
                     EGRLIEDDVQRHTTLQYRSPEMIDVYRKQPIDEKSDIWALGVLLYKLCYYTTPFEEVG
                     QMAILNATYKFPSYPVFSDRLRMLIAWMLKEHPQKRPNIYEVVQEVCHMQGKEVPIRD
                     IYANRSTSEARRYQELPPSPTETAQVGAVFSPPVQETQIIPEIAPMRRGRPTKPTSSQ
                     HTSAKPSPSPFRGGSTDPFAVLDGGQKSRDSTDEFSNRFPSLDQFDILHEKGGKFDFE
                     PAFAETKQEDGDLAQRLTNALADEAFAKRPSPEQAPQPPVQKQPHTSHVKSRPSESFN
                     YREEPQQPQVPLYQPVPQKPTMVSTGTMTSPPQTPSVPELKPPSRPIYRFPSSDHQRR
                     PSSQPWPADGDKKVSRPLNPPSPKKPSADPRTSADRISELSTSSSRPSLEGMRPSNLE
                     LEELTSRSKSANSKTRPLSVQAASKYDFGRGSESARSSLDIPRPSYDMGAPLQHARTE
                     ADRANISSDIDYLRAREEESNRKKEKRYSGSSKHTKRSSLSTLSLSGTKTLFAGRFGD
                     AFRRFEQSNQESKAQSPAAEEPKQVMITSSELVEVPAEMSDAEEDDISPEMRRELERR
                     RLSQEEKRVANAAAEYRRQVAERGEGGFRPGPDTRSSIQNRVQSFLEESNKSAPPPKT
                     ATGYGRFTEETNPALPAKQNEPLPEPRINSRAAGHLYGSQGQSSPVKDRWETPGLPSQ
                     ETANSGYAQSQRTGPSRPAAPPKPKSLRVRGSEVINERSQATPTTPSEDWEANFSRRF
                     PSLSGLEMETEIEIPNIPLRTKEV"
     exon            182254..183157
                     /number=1
     exon            183206..183303
                     /number=2
     exon            183352..185340
                     /number=3
     tRNA            complement(187195..187268)
                     /locus_tag="AO090120t00001"
                     /note="tRNAscan-SE"
                     /product="tRNA-Val"
     CDS             complement(join(187356..187411,187468..187975,
                     188030..188107,188159..188479,188528..188657,
                     188707..188740,188812..188887))
                     /codon_start=1
                     /locus_tag="AO090120000084"
                     /note="selenocysteine lyase"
                     /old_locus_tag="AO070315000085"
                     /protein_id="BAE62714.1"
                     /transl_table=1
                     /translation="MTLDIAQVRSRFPALKQEQVFLDNAGGSQVLDTVIESIASYLTN
                     TNVQLGATYKTSKLSTAGFANGYEAAAKFINAKPEETCLGVSTTQLLHNLSTALKFQP
                     GDELILSKLNHEANSAAWVRIAERLGLEVKWWSASNPQNPVCDPNDLKQLISEKTRLV
                     ACPHASNILGSIVDVKEIAKIVHQYPRALLCVDGVALAPHRQVDVKDLDVDFYAFSWY
                     KVYGPHIAQLYASSRIHDQIDTLGHFFKGTDTLDLKLNLASANYEHVQSIPRVVEYFE
                     PDVSASWEKIAVQEERLQQIILDFLNGNDRVTVYGERSADKNLRVPVISFTVRGTKSQ
                     KLVEEVEKRSAYGFRSGHMYSHRLIKDIIGLEDVEDGVVRISMLHYNTEEEMTGLVKV
                     LEEVIATL"
     exon            complement(187356..187411)
                     /number=1
     exon            complement(187468..187975)
                     /number=2
     exon            complement(188030..188107)
                     /number=3
     exon            complement(188159..188479)
                     /number=4
     exon            complement(188528..188657)
                     /number=5
     exon            complement(188707..188740)
                     /number=6
     exon            complement(188812..188887)
                     /number=7
     CDS             complement(189320..189730)
                     /codon_start=1
                     /locus_tag="AO090120000085"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000086"
                     /protein_id="BAE62715.1"
                     /transl_table=1
                     /translation="MTPAESPTPSTPSSATTPNRQTSYQPSQAEALAARIFAFVSSAS
                     DLSLSLSRPLDKNAHGSKTDSNGLQEGLGNGTSRDDGDGEASEREDDDEVKLLRLRTK
                     KHEIVVVPDKKYLLCVVHDAAHPAGNASAGLRSR"
     exon            complement(189320..189730)
                     /number=1
     CDS             complement(join(190620..192542,192596..193330))
                     /codon_start=1
                     /locus_tag="AO090120000086"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000087"
                     /protein_id="BAE62716.1"
                     /transl_table=1
                     /translation="MSNIPGDIQLPGLSNIQNRSEHVPDLVQFFQAQDSLSNTSSQSG
                     SARDILKAGQRRLRQLAQRPKRTTDPHTKAEEASRQLLALQQEGFLPDSLTLPKPKKS
                     APKQSIDSTVSSTRSASDLSFQASSRRDVESIGRPWLEDSLEKYEMKGGRLSSLDLRE
                     ITSLVGAALPRPPQFEDVTPPPYQASTDHDSQGKSSHPSTGHGSNSTPSEPLDEIEAL
                     PKVPEIPDRTSSQPPEMSTSTLDNKQQSSHEQPAEAKPAGAKDAPEAADSKSSSAGTS
                     NAMQSHSLKLFPDTVPPRMPNKGAWRISNGCPPPSLRSLPTKSAQRGSSAQSNDKNTK
                     PSSSTQSCDAGLENLGCVDQMPPAQPTDLGRNNGTSQEHAKRPLARNGRRPASLPMGA
                     IDAFPLPAPMRPLPALPEAVPGIRPSYGQDTIAGRRGLRANQQEQDPQLPSCSTEEGS
                     MGSGARRDNHGSMNGRATPSVSIPETAMDGGIKSARAGTTSVRASKSRADRVRALKKK
                     DMSASRIYLQDSDDRPSEEGRQSFSRLSHRASSEKYDGTTAASRCTDEGVRSQYGRGS
                     PDTQLFTPSSYGSKFPGQSTEAHAISTRKGSSLGYIDAISLMNTQEPSSLPASARNSQ
                     VYPSGGTRSTSVLSERVANDVDPHGRSETPLPSSEDEGMDVGMRKQQAHPPSSRRRRP
                     KLAPINVDESATRKTRHMKKPSSCDHSRPRTPRNRRSHGLEKASSQSPHLQDSYYYHE
                     TRGGRHRPSYVRELEKRIAHLEHQNRTLQAALLGALGVGGKQNVEGLLGGSSTSLSTP
                     PTSRSFSSMTNSSSSPDSHVMRNERHAHRRQPPYHPETWIASPGSSRRSSYGSEESAD
                     IQELESIIEDFDFGWESDSERTQQLGMRA"
     exon            complement(190620..192542)
                     /number=1
     exon            complement(192596..193330)
                     /number=2
     CDS             complement(join(195790..195855,196763..196866,
                     197341..202723))
                     /codon_start=1
                     /locus_tag="AO090120000087"
                     /note="tRNA-splicing endonuclease positive effector
                     (SEN1)"
                     /old_locus_tag="AO070315000088"
                     /protein_id="BAE62717.1"
                     /transl_table=1
                     /translation="MIDECDIKRITRNLTTATTKLKEVPPQEIGLHVLDRASLLSIFE
                     SLSCDAMLRNDSLLQQYFDEPFRLIQTKRSLKVSDYIPAVTRFLFDPNQSRSFWAIQA
                     WMRYSRPPTDTEFDWAIKEGLLGALRSASQQPVQVAAIQRLWRGMQLVVKRLDKDQIT
                     HHLRALEIDPCRLSVEHIGIQSPGLRFILNTIQIFLEKAPGDFWDAMQTISPQAIIEL
                     VFYNPQLDAFLMQATEGEPYEKSAMKDMLSWITPFMSSLKGPHQPSACRSLVYQLLDR
                     LQDARLPNLARYHCFHIGLSSLLYTLRSFTDHESSRGSVARIVLSETMEVVSANIARI
                     LEPPKFEVEQGRQREISTLCMDVIRNTLALECQSLKSDYEVILRYNTLQHGVSTYSAP
                     IWDAVVKHLHEDNLALSTSALLGILPLVGLEKFPAKGGASQEKTHFNMIYGHLTHLSC
                     LIIERLADFKPEHLDELFKSQDTSSALISALFAADLNTYQAAVDLIKNVSGQSARRDA
                     ISHLLQSFFTTTMYGLSWSFRRISNMKTFASAPRMIHTGTDIVDILCDSQTGMLRTRK
                     LADRREILSLQKLWEYLWQALTTIFDETESWHLRGNDRMVMLEFCRDSIQFADLLFDQ
                     YGVFLSAVVDADPSQETSARENFLKSPTATMSTMVKWLRLKDEYLATTLVGLVAKLLR
                     RLGELSVTTVKEDALDYIEGVAVKSTVKTMLTLREKAELVRALEAYYKKPVVTASTAS
                     LKKQSSITAFAKPAELSATPSPSRTPDEFDDNVPDDVMLQLSRSVELNKERVAAEAKK
                     RAEKAAKALPAIPRPAPAPLKSNVTVQAFREKREREREAKKKRDMAELARLKKGLPAT
                     GVAEQTAEQGSGLAGIGVKGKDHRPADSMMVSSGSESESESEDELDRELFGPKGGSKP
                     DAVRAYEESKRLSLKQKGPVKKIKQVRSAKDMRARLAPDLSSLHRTILSWDFFANGDL
                     PPNSGRTDYSLISNTFRDPIDYQKTFEPLLILEAWQGFQSSKEEGNFKPFEVKVATRL
                     SVDSFVEVSTVMPALEVKDYGLGEADIVLLSKANSPTNNPSAPHCLARVAGINKKKGT
                     VEIAYRVNPGNSFINALAPGSEIWGAKVTSLTPLEREYGALMALQYYDLCEEVVKAKP
                     SPILNYSEATLSPIAENYNVNPAQAKAIKSALDNDAFTLIQGPPGSGKTKTIVALVGA
                     LLSGVLGNQGVTISRPTGVGNIKPPPRTTTSKKLLVCAPSNAAVDELVMRFKAGVKTI
                     QGRHEKLSVIRLGRSDAINTNVLDVTLDELVNARLSQTSRKDSGERDLQKIYMEHKAA
                     DTAFKETRSKLDQCRAQGLPVPAELEREFELLKKKKTALSQEIDNARDKNHSAARDAD
                     LNRRKIQQEIIDGAHVICATLSGSGHEMFQNLSIEFETVVIDEAAQSIELSALIPLKY
                     GCSKCILVGDPKQLPPTVLSKVASKFQYEQSLFVRMQSNHPRDVHLLDIQYRMHPEIS
                     AYPRNAFYDGKLQDGPDMARLRARPWHQSELLSPYRFFDVQGLHQSAAKGHSLVNMAE
                     LRVAMQLYERLVSDFQGFDFSGKIGIITPYKGQLRELKTHFAAKYGNAIFNMIDFNTT
                     DAFQGRESEVIIFSCVRASNKGIGFLSDIRRMNVGLTRAKSSLWVLGNSQSLVQGEFW
                     NSLIKDARRRSVYTDGDVLKILQRPQFTGYKNVDMLDADGPESTKPSVGTLTDPISRS
                     SSSSRDNLPTDGTFGKNEPYVSPPEGPSGGASGLDDNRMCGYCGDFSHMTHNCDNIDA
                     KEAARGNCYRFSQDLVKPSRDGPAYAPINQNKPPSGPRADAGPANTKSSGHITSTQKK
                     GIVKAKSD"
     exon            complement(195790..195855)
                     /number=1
     exon            complement(196763..196866)
                     /number=2
     exon            complement(197341..202723)
                     /number=3
     CDS             complement(join(204340..205255,205306..205535,
                     205597..208545,208600..209055))
                     /codon_start=1
                     /locus_tag="AO090120000088"
                     /note="P-type ATPase"
                     /old_locus_tag="AO070315000089"
                     /protein_id="BAE62718.1"
                     /transl_table=1
                     /translation="MASNHLAPPENVLPGSEIQEVNSNISHPTKRQRWATQRVHGAGG
                     VRKRVSIMDRFNKRSEMKDEKRKSTSSNLPTAENPNAEGDAEASNRRIYFNIPIPESE
                     RDEDGHPKAYYPRNKIRTAKYTPLSFVPKNIWLQFHNIANIYFLFIIILGFFSIFGVD
                     TPALNTVPLIVIVVVTAIKDAIEDWRRTVVDNEVNNSPVYRLIDWNNVNSVEDNVSLW
                     RRFKKACTRATIWTYRAIKGLAQKNKKQHDPEEADRRASFMTTVTPRASVYSQRGDGG
                     LADEAIQMTPVPSPTPEARPDWTHAVDEQSQYLHPDKARDSVAVPAYTATSPKKGGSV
                     VDMSKPIIGKARFKRDYWKSVQVGDYVRLYNGDPVPADVVVLSTSDPDGACYVETKSL
                     DGETNLKVRQALNCGRQVRHARDCERAEFVIDSEAPHPNLYAYNGAVRWDQRDPDFPD
                     APRKEMIEPITINNILLRGCSLRNTEWALGVVLFTGDETKIMLNSGVTPSKRARLAKD
                     LNWNVIYNFIILFFMCLISGIVNGVAWSSTNRSLNYFDLKSYGSTPAVTGIITFWVAL
                     ILFQNLVPISLYISLEIVRTIQAVFIHSDVFMYYEKLQIYCVPKSWNISDDVGQIEYI
                     FSDKTGTLTQNVMDFKKCTVNGISYGEAFTEAQVGMVRREGGDADAVAARERERIAMD
                     TTKMLELLRKIHDNPYLRDERLTFVSSNYVADLGGQSGDAQRKATEHFMLALAVCHTV
                     ITEHTPGDPPQIEFKAQSPDEAALVGTARDCGFTLLGRSGDDLVLNVMGEERTYTVLN
                     TLEFNSSRKRMSAIIRMPDGHIRLFCKGADSIIYSRLAPGKQQELRKKTAEHLEMFAR
                     EGLRTLCVADRVLSEEEYKAWSKEHDIAAAALTDREEKLEEVSSNIEQELMLIGGTAI
                     EDRLQDGVPDTISLLADAGIKLWVLTGDKVETAINIGFSCNLLDNDMELIVFNIPGNE
                     SHRAAQELDQQLQRFGLTGSDEELLAARQDHTPPEPTHAVVIDGETLKLMLDDELKQK
                     FLLLCKQCKSVLCCRVSPAQKAAVVRMVKNGLDIMALSIGDGANDVAMIQEADVGVGI
                     IGEEGRQAAMSSDYAIGQFRFLQRLILVHGRWSYRRMAETIANFFYKNLVWTIALFWY
                     SIYNDFDGSYLFDYTYIVLVNVAFTSLPVILMGIFDQDVDDKVSLAVPQLYMRGIERK
                     EWSQLKFWLYMADGLYQSLICFFMPYLLYSRATFQTANGLDIADRTRMGVLVATSAVI
                     ASNTYIMLNSYRWDWLTTLINVISSLLIFLWTGIYSSVDASAQFYKSGAQVYGTLSFW
                     VVLLLTVTICLLPRFTFKAFQKVFFPLDVDIIREQVTQGKFKFLEQYEAFVPPKAASA
                     AASGQLLSDESAASSDLGKPMQPSMKQDPFSDDQQIYTPSVAPTSRTHQTHNHRSQNG
                     SNGTNYASSLDTTQHYHTQPVDYVRGSAERTRHSFDRVRHDFEANNELTRVETGLTSG
                     AQEPQSPHSPLKAPYDPPSHSS"
     exon            complement(204340..205255)
                     /number=1
     exon            complement(205306..205535)
                     /number=2
     exon            complement(205597..208545)
                     /number=3
     exon            complement(208600..209055)
                     /number=4
     CDS             join(213616..214522,214572..214673,214723..214775,
                     214855..214960,215019..215097,215147..215300,
                     215356..215994)
                     /codon_start=1
                     /locus_tag="AO090120000090"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000091"
                     /protein_id="BAE62719.1"
                     /transl_table=1
                     /translation="MSQRSSIKNYFKRPDFSASRDSRYQDPSETPAESSQSSPLTEPP
                     SSFVTNGGSPQTPDGPALQLKQSLLLSVTDSTENSQHQPSSQNTEPAASDPTLPPSFN
                     LAQRVVRNGREVVISSDGEDTDTSEAFEDPTSLFLKFAKPDDTSTNEETNNDSSSHGR
                     TLRSRPSRDDVKPRRFSLSRVSAPNYKHSIDSLVTQAVDDNETEASIAKLRATLEEEN
                     ARKAASKSEAAPGLQQLHEGILTSALDSQNDETGLRRLLDAVRRTEAFDMEKSWFFFD
                     HGSELAPPPAFPRNCIPAKSSLSVLRDPESRERAFHSGSVDFALSRGLLPDELVVWIL
                     NSVPSEPRDTLRNAYCRAFKSLVRPDSIDAIFQRMGASPKALTFSEVIVPDAIPKNSS
                     LRAAPQHQAALLAILNLLRGAADLFSDETREHILSILFRLSLDISLTRDPMVCSELER
                     TIIAVLESIPEETADNLVYRVCTSAYETIKDAVFQSRLLTHILPTSSWIAMLRCRLAV
                     AFLTSDPSSLAEEPDVMGYLRRIIDVLKDKRFDVKRYKMKGQPEYDYGELMAITTVLN
                     IAIDSGWSGVDFSSKDAEREFNSEVDVLADRIKRIFTSIEDSGASHLKRTLAKEALEA
                     LHYRIIYSVRTKPRPKRSIFGENGADSQNKKVFDPWKIKIKQDPETPTQQPEASP"
     exon            213616..214522
                     /number=1
     exon            214572..214673
                     /number=2
     exon            214723..214775
                     /number=3
     exon            214855..214960
                     /number=4
     exon            215019..215097
                     /number=5
     exon            215147..215300
                     /number=6
     exon            215356..215994
                     /number=7
     CDS             complement(join(216431..216581,216641..217152,
                     217215..217247))
                     /codon_start=1
                     /locus_tag="AO090120000091"
                     /note="vacuolar H+-ATPase V1 sector, subunit E"
                     /old_locus_tag="AO070315000092"
                     /protein_id="BAE62720.1"
                     /transl_table=1
                     /translation="MSQSHALSDDQVAGELRKMTAFIRQEALEKAREIELKADEEFAI
                     EKSKLVRQETAAIDTLYEKKFKQAAMSQQITRSTLSNRTRLRVLSSRQELLDELFQQA
                     RDKISSIASKDAKKYETVLQGLILEGLYALNEEKVAIRVRAKDTDAAKKAIEEAQKVF
                     KEKVGKDVTVEVDEAEPLPEGSAGGVVIIGGQGTIELNNTFEERLRLLEIDALPAVRE
                     TLFGKNQNRRFYD"
     exon            complement(216431..216581)
                     /number=1
     exon            complement(216641..217152)
                     /number=2
     exon            complement(217215..217247)
                     /number=3
     CDS             join(217829..217870,217944..218081,218130..218222,
                     218279..219808)
                     /codon_start=1
                     /locus_tag="AO090120000093"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000094"
                     /protein_id="BAE62721.1"
                     /transl_table=1
                     /translation="MGNLGDLSPQGSVAVGVVVGLVSTSLQAIGLTLQRKSHILEDEK
                     HPYDLRRPPYKRRRWQLGMLMFVISNIVGSTIQITTLPLPVLSTLQASGLVFNTVFAT
                     LILGEAFTRYSLIGTILVCIGALLIATFGAIGEPAHTLDQLLELLQRWNFILWMAGTA
                     VLVLVILLGSRLLKYFASPLRSKHSSSRHSYVPHLQLTPGRSRLIRGLCCGLVSGILS
                     AHALLLAKSAVELLVRTVVDRVNQFNRWQSWVILIAMITLSLTQLFYLHRGLKLCSTS
                     VLYPFVFCIYNIIAILDGLIYFRQMSQLTGLHAGLIALGTLVLLSGVMCLSWRLEVID
                     SHAAVTVVGPSQTALGPGMAVVEEHPRSSLELGLEDEEDQTGEREPLLWKASHRRASH
                     RRTPSLPLLTPQGSSADMDPASIWAELDESDFDYADPDSRTPLLKRLSADPFKSQPRG
                     KTKSITLKDASLRGQRHSSTSPLSHQTWNPRKVRPSVFQPGHQRRTSAPSPDNRRPPQ
                     KRRTYAGGPSFFDISGLGYGTQDNRSEAPSSREPPPPTDTDATPLAGTSSGALGTAWR
                     TGLRYLSRLTGGQRGSDQRTHNDPEHNPDNHTDR"
     exon            217829..217870
                     /number=1
     exon            217944..218081
                     /number=2
     exon            218130..218222
                     /number=3
     exon            218279..219808
                     /number=4
     CDS             complement(join(221157..221441,221519..221653,
                     221827..222072))
                     /codon_start=1
                     /locus_tag="AO090120000095"
                     /note="regulator of arginine metabolism and related MADS
                     box-containing transcription factors"
                     /old_locus_tag="AO070315000096"
                     /protein_id="BAE62722.1"
                     /transl_table=1
                     /translation="MADITAVGEENPSPTQDDLQQAAGNGAADNRGTKRSRMSADDDD
                     DDDDKPGRERRKIEIKFIQDKSRRHITFSKRKAGIMKKAYELSVLTGTQVLLLVVSET
                     GLVYTFTTPKLQPLVTKAEGKNLIQACLNAPDPTTNENGVEAGDVPTEAPEDVAAAHN
                     NVNAQQQNIPRPAGMHPGYMTNEQQQQMAYYQNLQQQQQAGGQYPGMPVGNRMPPQHQ
                     PTA"
     exon            complement(221157..221441)
                     /number=1
     exon            complement(221519..221653)
                     /number=2
     exon            complement(221827..222072)
                     /number=3
     CDS             complement(225659..227272)
                     /codon_start=1
                     /locus_tag="AO090120000096"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000097"
                     /protein_id="BAE62723.1"
                     /transl_table=1
                     /translation="MLKNNSFNNSPKMPIFRTRTVFPLIALFSIGFFFWCIERYDRAA
                     FLRFKHPVDRVTTSAGTPQIQLQPSSAPTAKMCDADPSVMPPLPFTEWLPRKNYTRAY
                     FRPHHVSPKTEFSSLEEIDIPVLPPMTVMERGMVVSPDNEDEDISCPPIIDVNVAADH
                     DVDETDKLLFGLATTADRLDRLLPSLLYSYGNTKAGIIVLVPESDDDIPKQETYFRNR
                     GLDLTLIQSPLDFTARYFGLVEAFANHIRTKRPQTQWVSFIDDDTFWLSLPTVAEELK
                     LFDVTKKHYIGSLSEAHWQVDTFGHIAFGGAGVFVSKPLLDVLEEYYDECQSWGEQPG
                     DQKLGQCIQRYGDTPLTLWPSLYQMDMKGEVDGVYESGRKIESLHHWNSWYTKDVVKM
                     TTVAAAAGRRSVLRRWVFDQEEIVNNSTGKSTRTFWVFTNGYSLVKYTYGENTPDDAI
                     DFDHTEKTWEEDPRGYEERLGPLRPKEHDGVLKDRWLLREAYVVGDNVHQWYVREEDE
                     GHSVIEIVWLGPKGGGGAGIKDYNVRKHH"
     exon            complement(225659..227272)
                     /number=1
     CDS             complement(join(232921..233270,233461..234441,
                     234499..234617,234680..234753))
                     /codon_start=1
                     /locus_tag="AO090120000098"
                     /note="RAB proteins geranylgeranyltransferase component A
                     (RAB escort protein)"
                     /old_locus_tag="AO070315000099"
                     /protein_id="BAE62724.1"
                     /transl_table=1
                     /translation="MEPLAETPWDVTISGTGLAQSLLALALSRSGKKVLHVDQNSYYG
                     GSEAAFSLQEAQEWASKVNGDPEHYPFEDATVYLPEGTPQLPTRSYTVTLSPHLIYSK
                     SRLLPTLVASKVYRQLEFQAVGSWWIHRPSGVDGTSVLYRVPGSREDVFADDIISVKS
                     KRTLMRFLRHIGKPPPDNDSEAEEENLAMSLPEYLTSKFQVPAELHEPLLSLSLSQAS
                     PGQTSAEYAVPRIKRHLASIGVFGPGFGSLLAKWGGGSEISQVGCRALAVGGGVYVLN
                     AGVESIYNLHQSDNGDDMRVQLHLSNDETIKTKFLVGSNWDLPGQGRPACDKVARSIT
                     VVSSALESLFPVTAEGGPIPAGAVVVFPGSSFDQSDDLPPVYLLVHSSETGECPPGQC
                     VVYGSVSHAGAGGQSLIESAVHRLLQTNAEPDAKVLWSLRYTQLGLSSNGANAHSSKF
                     EGPSSNILCFPPPSLDLGFDDALIDRVKEVWKSVMGDEANEQEFMNFEEREHADDDD"
     exon            complement(232921..233270)
                     /number=1
     exon            complement(233461..234441)
                     /number=2
     exon            complement(234499..234617)
                     /number=3
     exon            complement(234680..234753)
                     /number=4
     CDS             complement(join(235985..236395,236467..236508,
                     236563..236595))
                     /codon_start=1
                     /locus_tag="AO090120000099"
                     /note="cyclophilin type peptidyl-prolyl cis-trans
                     isomerase"
                     /old_locus_tag="AO070315000100"
                     /protein_id="BAE62725.1"
                     /transl_table=1
                     /translation="MATDVAFDTSMGSFTVELYNSHAPKTCKNFATLAQRGYYNNVIF
                     HRIIPNFMVQTGDPTGTGRGGSSIYGEKFEDEIRADLKHTGAGILSMANSGPNTNGSQ
                     FFVTLAPTPWLDGKHTIFGRVKSGMRVIQRMGLVKTNGEDRPVDEVKIIRARVVEEGE
                     E"
     exon            complement(235985..236395)
                     /number=1
     exon            complement(236467..236508)
                     /number=2
     exon            complement(236563..236595)
                     /number=3
     CDS             236884..238764
                     /codon_start=1
                     /locus_tag="AO090120000100"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070315000101"
                     /protein_id="BAE62726.1"
                     /transl_table=1
                     /translation="MAEVSPFAEFLGQAIYQFTAVKPLLPTYGHLLVSVLFPIYIASH
                     ASLSRPSSAAEPPKKSQDADGDESDDEDEDEEEENDDRRVEGLAPSDALIFPLTAGLT
                     LGGLYLVMKWMGADKLNKILGFYFSQMGIFFATAFVKDSLAVLRSFVFPRRYSKAGKT
                     WKVKQSDRVFTVVQEGSTTSEPLEARNSPLPGVFGSIQLPGPVLNLLWTCRNLLYQRV
                     KLRVVLRRIIKTECSVGLLDLFSLVLALPAIGYFTFVTKPWWLTNFLGFSFCYGTLQF
                     MSPSTFLTGSLILSSLFFYDIYFVYFTPLMVTVAKGLDVPIKLVFPRPAGPDAPPDAV
                     SLAMIGLGDIIVPGMMIGLALRFDLYLYYKRKGLQKAQAEGKAQEIVKPVYQSATGGW
                     GERFWVSPTAPSQPALEPPYHDARAFPKTYFKASMVGYIVGTLVTLIIMQCFDHPQPA
                     LLYLVPGVLISLWGTALVKGDLEEMREYSDAEEEEDDAEEKQEKKPDETPAANASFFR
                     RILSGEISKPKKSEASSEKPDKEKSSTEAKGDRPEDPKRFSKGANNKNMELFTISLYI
                     PHKGRTDEADQPKSSTEDVKSTVDDENWSFVGNTEREDEPPAKRRRRSPRKAGATSSP
                     AK"
     exon            236884..238764
                     /number=1
     CDS             complement(238961..240205)
                     /codon_start=1
                     /locus_tag="AO090120000101"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000102"
                     /protein_id="BAE62727.1"
                     /transl_table=1
                     /translation="MAPAAATAAQPTPPSLSLPPSQFARLQPHAYLLAHLSPPASSNQ
                     PSIRANGRAPSQFRVTSANTGSLTHTNGSAVVRLGDTTAVCGVRAEILHTEDIASWSV
                     SRPPPASSSTPANKRRKLTDPTAKPSEKSDGNNKEDADESHIQDFNLLVPNLSLSTGC
                     APGFIPGAPPSALAQSLSHQILSLLHSTRLVRAEDLRIWYQPPNLGPEELERHNESEQ
                     MDVDAPQGDAGAEKNREIKAFWVLYIDVMIVSLAGNPFDAAWAAVLAALRDTRLPRAW
                     WDVDNGMVVCSDAVSEARKLSLQGLPVSSSFGVFEADAASGWRAEVIPDAEEERALDD
                     SSRKGNQRRWILADPDGYEEGLSQERVCVVVDKEQGGKGKTVVVKLEKNGGWAVDAKE
                     LKALVDISAQRWEDIKQILEQC"
     exon            complement(238961..240205)
                     /number=1
     CDS             243793..246051
                     /codon_start=1
                     /locus_tag="AO090120000102"
                     /note="ferric reductase, NADH/NADPH oxidase and related
                     proteins"
                     /old_locus_tag="AO070315000103"
                     /protein_id="BAE62728.1"
                     /transl_table=1
                     /translation="MLPGWHSIASLVKRIDIPIVASTTPAEIAEMQQDAWPEAGKYGL
                     GWVYFSVILLAISTIIRFYHLWGDQIRIALHKEDMAGTSPYVTSPQEEYELPSAATDS
                     STTHFFPARGPLPSTNTTKQQSSISTIAPLNNTIAFVRWIFYRPIPVLRIGKLRIGFP
                     SLGASSIILAALIFVTLYSFVPQPLYYSSISIGSPPLAIRAGMIAVAMIPWIIALSTR
                     ANFVSILTGISHERLNVLHRWAGYLCLFLSLIHMVPFYVTPIWESTNFMYYQQYFPRN
                     IYIYGTGWAALVPLIVLCLHSLPILRAWMYELFKLVHLPLSIIFLAMIFWHSKNFLAS
                     WDYLWATVAIWMLSYAVRLFYVNWSNPLRLSFLIGEECAVTILPQNAIKVTVATQMKW
                     KPGQFVYLRMPGISLFERHPFTISSLCSGDFPSEYGENYRDLALVFRPFGGFTRNVFL
                     KTFEYGPYKTWTAFLEGPYGGMKRDMAAFDDVVFFAGGSGITATASHLLNLIKKMRDR
                     KAVTRSVRVVWAFRSPETIDWFREELRICRDFAPPNTVHCHFFLTGLEPHGQDQLAQN
                     QFYQEMLRDKMYNTLEGMDKRNSAYIREEAAGDPEIEKELRRENEDAITALPLAHTLP
                     HINTSRHYTSPMDNNYQHAPYPAPHVSPADTPFNFGFPPSSTVFPKLTTRVGTVPLQR
                     NGWRIDYARPNIPQVLKDYSRTFGRRTCVFVCGPPSMRVEVSKAVAQLQQVVMTDSSK
                     DEIFLHAENYNV"
     exon            243793..246051
                     /number=1
     CDS             complement(246460..247602)
                     /codon_start=1
                     /locus_tag="AO090120000103"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000104"
                     /protein_id="BAE62729.1"
                     /transl_table=1
                     /translation="MAYQFFAKAHQSKAPTSPPLSPPSSSSSNNRHPKPPIYPPSLVL
                     PQSATSTSIADRVKPPPGKDSSFHPPAYPHPIAPSYKTPHPHVTIESVSTAHIPSLIR
                     ITGLLLPIRYPNSFYTATITDPVIASVSRVAIYHDHPGAAAPASTSYAPTSASPLGTS
                     TGTDKVIGGIRCRLERLPPTTAELIQTQSNPHSQEPTNLYIQTLHLLSPYRGCGIAAS
                     LLNSLLFSSAPSSFSSGSRSTYQVSELVKHYNVRCVTAHVHEANEEGLKWYIARGFQV
                     EEGVVENYYRRLKPSGARIVKLVLQWNDDASDKAAEADVHSTSNQSGEDNRKSPEEDD
                     DWEKVEAEDGEDNEDHGVQTFTDSKILEVDDGVNRKRKADDEPQRA"
     exon            complement(246460..247602)
                     /number=1
     CDS             join(248647..248712,248807..249721)
                     /codon_start=1
                     /locus_tag="AO090120000104"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000105"
                     /protein_id="BAE62730.1"
                     /transl_table=1
                     /translation="MGESNGTEQQESSFPSGTIAKLTCDILNNTFYNIIHDIVSKVHR
                     DEKVARMRSAVTIARQKAEEEAGRRREEAGAKPTALKPGEDFEELKDIRVETDGAIFE
                     DGKVYLKGNPLNTTKEIICPDCRLPRLLYPVTGVGARPPPDPYREYCQKQPMISKPGH
                     DVHGNPFATDKLNPKKKKQTNTSNTPASSPPTTPDSSFKQAAPEKVSFPTVKCPNCPR
                     YFVVTRVAQHLDRCLGLSGRQVNRNKTPMENGTSTPSSAPPKRPLDDDTPPTITKKKK
                     LGAPKKLSGKKPPPAPSSKLKNGVTPDMAAAADAAAAGDGDIKSEPNGDA"
     exon            248647..248712
                     /number=1
     exon            248807..249721
                     /number=2
     CDS             250357..251916
                     /codon_start=1
                     /locus_tag="AO090120000105"
                     /note="activating signal cointegrator 1"
                     /old_locus_tag="AO070315000106"
                     /protein_id="BAE62731.1"
                     /transl_table=1
                     /translation="MADPSLISWGVSRISQILPLDEESLTQIITYAASLPKEEGADHL
                     KNLLGDSPAAFEFISAFSSGRDPAPQRPAVPDASSSTPTATSSKNPAARQKKGKKSKP
                     PLHSAGPPRRPENFGDVTGGYKKADLEEDYMAPAPRAKQDTNASRSSHLSVEDSSAAS
                     SRAHSPAPKQSSSKPPPSASGPMLSDLLPNVKSKAAKSSTRHSNNTTTSQSKNSLTTT
                     NISDLTAAIAALEVSTNPTLSNESRKCSCFASIHPLFAPAPNCLNCGKIICSLEGLQP
                     CSFCGTPLLSNEEVQSMIRELRAERGQEKMRAHNESVHREGGPGQGPSPSASSSKLNA
                     AMAHRDKLLQFQAQNAKRTRVVDEAADFETPNVASTLWMSPAQRALALKKQQQILREM
                     EEKARPEWEKKRTIMSLDIKGGKVTRVYQSAGASPADPGSPAEEEPEPEPEASEPADD
                     YTKPRRGEAFSRNPLLAAGGLMRPVWKGPDGKPVEARPQSERTQTWRRVQDDKDDNEQ
                     WILDGGLHGYS"
     exon            250357..251916
                     /number=1
     CDS             join(252847..252924,253040..253654,253711..254610)
                     /codon_start=1
                     /locus_tag="AO090120000106"
                     /note="cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies"
                     /old_locus_tag="AO070315000107"
                     /protein_id="BAE62732.1"
                     /transl_table=1
                     /translation="MLVQEVWKTLSIEGVVVGVSALLGLLSFAYVIYNRFLHPLRKFN
                     GPFLASITPWVQLYHGLKGDRHLWLHNLHQQYGSHVRVAPNFVSINSAQGLHDIYGHG
                     KKLKKANFYNGFTAIKGVYNTHNVIDKTVHGRKRRVLSQAFSDQALKSMEDVMLLHVR
                     QLCTALAEQQTEGNKAEAQKTTVQNMGDWFSYLTYDVMGELCFGKSFDMLVSSGRRKM
                     IQLVDRAANRHYVCGLWMPLDTWHLDQIVIHRLTNDRWNFIMNSRVEANKRAQERTQA
                     GHDSKKDFFYYLLNAKDPETGKGLTTPELWGEANVLMIAGSDTTSTTLAATIFYLVRN
                     PRAMKLLKKEVREAFTSVEEIVTGGKLNELVYLKACIDEALRLAPAVPGAIPREVMEG
                     GAVVDGAFLPAGTDCGTPTYSIHRQPQYYREPEAYLPERWIEGATCVTADDKWESTKD
                     AVETARRAFCPFSIGPRGCIGKGMAFMEMRLTIARLMFLFDMELADRQGEDEKGHLAL
                     VDHFTSAKQGPNVIVRRRDITV"
     exon            252847..252924
                     /number=1
     exon            253040..253654
                     /number=2
     exon            253711..254610
                     /number=3
     CDS             join(255094..255192,255348..255722,255815..255967)
                     /codon_start=1
                     /locus_tag="AO090120000107"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000108"
                     /protein_id="BAE62733.1"
                     /transl_table=1
                     /translation="MPPSPLTVTLIQSTILNAISNILAQLIDRHKENLTNRTHGGKKK
                     PFALNTIALIQFITYGAIIVPPNFSWQRYIEARFPGFPSWKRNNDNHVPEPNGLLPTK
                     EKPFRPKQQRSGMWNFAVKFLLDQTIAGVCNILLFIVLINLLKGSNLGRVWELVCEDF
                     GPIMLARLKFRPIVSALMYTVVPVDRRVVFGSACGVIWGIYLSLYAVV"
     exon            255094..255192
                     /number=1
     exon            255348..255722
                     /number=2
     exon            255815..255967
                     /number=3
     CDS             complement(join(256238..256885,256942..257444,
                     257678..257687))
                     /codon_start=1
                     /locus_tag="AO090120000108"
                     /note="permeases of the major facilitator superfamily"
                     /old_locus_tag="AO070315000109"
                     /protein_id="BAE62734.1"
                     /transl_table=1
                     /translation="MWAVPLNRRPIFAAMMGSMYGIASVAGPLMGGAFTDRLSWRWCF
                     YINLPFGGVTAFFIIFFFRAPKSVKDNSGFKNQMGQLDFPGTALFMPSIICVLLALQW
                     GGTMYAWNNARIIALFVVFGVLLIAFCGIQWWQQDKATVPPRLVKNRNVWGAAAYSFC
                     VGGAFFIYIYYLPIWFQAIKGVTATRSGIMNLPLLLPMIVASIAAGACVTMVGYYTPF
                     MIATPILMSIGGGLLSTLKVDSGDAAWIGYQVLFGVGVGLGLQQPMIVVQAALPIADV
                     PTATAIVMFTQTLGGALFVSVAQNVFQNQLRKNILARAPEVDIAKVVGAGATMLRQAV
                     SKDILPTVLESYNDAITQTFYAAVAIGAIGFFAALPIQWLSVKGKKIEAMAA"
     exon            complement(256238..256885)
                     /number=1
     exon            complement(256942..257444)
                     /number=2
     exon            complement(257678..257687)
                     /number=3
     CDS             complement(join(259401..260699,260758..260940))
                     /codon_start=1
                     /locus_tag="AO090120000109"
                     /note="hexokinase"
                     /old_locus_tag="AO070315000110"
                     /protein_id="BAE62735.1"
                     /transl_table=1
                     /translation="MSSALLDEAARIARQFDFPAEGVQRGVKEYIREIDEGLSKEGTT
                     LSQIPTFVTSVPNGTEKGLYLAVDLGGTNFRVCSVDLHGDNTFSLTQSKIMIPRELMA
                     SGTSKDLFTFLARQIEAFLRIHHNEHFEAHLKRRREGNSEEDLFDLGFTFSFPVRQVG
                     INKGTLIRWTKGFNIPDAVGHDVCALLQNALDALELPVRVAALVNDTVGTLMARSYTS
                     PGETGTFLGAIFGTGTNGAYVEKLDKITKMATIEHSDYDKTTGEMIINAEWGSFDNHL
                     SVLPNTVYDQQLDEESNNPGIQMFEKRVSGMFLGEILRRVLVDLHRNESLGLFKPSAS
                     SDVIVPENSTLFRQWGLDTSLLSLVEADNSESMEPTKTALKDHLKIERASTTDCKAVK
                     TIVHAIGKRAARLSAVPIAAILIATKKLETDDLVDVGVDGSLVEFYPNFEGYMRDALR
                     EVPEVGVAGDKKVRIGISKDGSGVGAALIALVASKEEARMKAQ"
     exon            complement(259401..260699)
                     /number=1
     exon            complement(260758..260940)
                     /number=2
     CDS             join(262447..262505,262727..262784,262863..263363)
                     /codon_start=1
                     /locus_tag="AO090120000110"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000111"
                     /protein_id="BAE62736.1"
                     /transl_table=1
                     /translation="MGAGSSKPDASAGSKHVFSSSGPVEFSSNLVDHLQSNTETDASR
                     AKSIELQIQARVAQELERLRQREQQTIAEIEKRIAESKDTAPSSFSSTPNISYPPGSL
                     NLDAPRIPFAGREYTPAPVPDAQPINRDVSRDSVNTEIEELRAKLEGRRKLVQIDESV
                     EKAKSNVVSCLRLNDRRPLDCWQEVDAFKREVAKLEEAFVDRVVG"
     exon            262447..262505
                     /number=1
     exon            262727..262784
                     /number=2
     exon            262863..263363
                     /number=3
     CDS             complement(join(263774..266086,266191..266526))
                     /codon_start=1
                     /locus_tag="AO090120000111"
                     /note="ribonucleases P/MRP protein subunit"
                     /old_locus_tag="AO070315000112"
                     /protein_id="BAE62737.1"
                     /transl_table=1
                     /translation="MAPNPASKRKSTHPGAQNGSAAARKRAKTFDARTLAAQSAETAL
                     SASGELDVAAYLEAREFEIRALESGMQRSKAALTSRAFQQVPRSLRRRTASHNVKRVP
                     SRLRARAKREMMEDNTPTVTARRRKPTEAMRIRLETARRLQNLNTKTKAKRAHSKANR
                     DKENQKSLEEAGSHSFDIAPRVPKIKKNKLSRPPPPESKFKKRQKCKTWLPTHMFHAK
                     RAHMTTSKDPLWRFAIPLSPTEKSYRPTHRARGARGAIVWDMSYMSTIQLEGTEGALE
                     CVLRAVGVDGNEAWGPRGKKWRAGTRSLQVWAYECDGPQRPIAPVTLIRCAEEKPGDV
                     EMMDADKASSVENKNSKKDRKKLFIRVHPSAFLQLWNELLEVSKRQNPPVMIEDLRFE
                     IGSIDITGPGSTEALLAVLRPVESNENSKLSNTPESTWNSLLGVSNPSSLPQNALLAF
                     PISDPRLRFPHKTMRPPSSEKDMQDLAMTLSSWAPDRTQTTPSIFDRRARLAAVRQLP
                     SQKAINRRRTEAGPGRLPTPRDTDPQIPMMLLATRPRAQTKDNNAPGSWTVLLPWKCV
                     LPVWYSLMYYTLSSGGNPRLGGLKEQQQLAFEAGEPWFPGDFPGTRAGWEWNLRDREQ
                     SKKEWERRPKGRRVEFDSIDLGANQRGEIGRGWACDWERLVQGAEASDASDPNEKDKK
                     AKAEGEIETRQNGEDEETSVDGLPLGIHHLQPAEADRALRDQNSSVDNSALATVRVSL
                     FNRGTPTPRARIYRLPTTNPELRQKWLSFASAKPAGHKSPGRESSSTGSDPQARLAAS
                     LLSAQIDTDVHQEHLPLPSEEDLIGFVTTGNFNLSAGKGTGVGSIQVSKVTLAALGKC
                     KARERTMCIIRGAGERVGRLGYWEVA"
     exon            complement(263774..266086)
                     /number=1
     exon            complement(266191..266526)
                     /number=2
     CDS             complement(join(266998..267033,267099..267242,
                     267303..267579,267639..267688))
                     /codon_start=1
                     /locus_tag="AO090120000112"
                     /note="peroxiredoxin"
                     /old_locus_tag="AO070315000113"
                     /protein_id="BAE62738.1"
                     /transl_table=1
                     /translation="MSGIKAGDSFPSDVVFSYIPYTEEADKFNVCGIPINYNASKEWA
                     DKKVILFALPGAFTPVCSANHVPEYKEKLPEIREKGVDVVAVLAYNDAYVMSAWAKAN
                     GVKNDDILFLSDPDAKFSKSLGWADEEGRTKRYAIVIDHGKVTYAALEPAKNHLEFSR
                     AETVIKHL"
     exon            complement(266998..267033)
                     /number=1
     exon            complement(267099..267242)
                     /number=2
     exon            complement(267303..267579)
                     /number=3
     exon            complement(267639..267688)
                     /number=4
     CDS             join(269889..269968,270291..270684)
                     /codon_start=1
                     /locus_tag="AO090120000113"
                     /note="uncharacterized protein conserved in bacteria"
                     /old_locus_tag="AO070315000114"
                     /protein_id="BAE62739.1"
                     /transl_table=1
                     /translation="MADVKPPFTEESARKKVKAAQNLWNTQDPVRVAQAYTPDCVWRN
                     RTSFFSGTDNIISFLTAKWNREANYRLRKELFSFTDDRIAVQFWYEYQDVEDEMRWKR
                     CYGLEDWTFDQETGKMRKRMMSGNDLVLGSNGNGEGRWFVDGVDVEDVAISEEHW"
     exon            269889..269968
                     /number=1
     exon            270291..270684
                     /number=2
     CDS             join(272171..272763,272812..273543,273632..275847,
                     275905..276146)
                     /codon_start=1
                     /locus_tag="AO090120000114"
                     /note="serine/threonine protein kinase"
                     /old_locus_tag="AO070315000115"
                     /protein_id="BAE62740.1"
                     /transl_table=1
                     /translation="MEQKTVPLNPESVRAPLVDVSNRVNNCPSPNLVQGEESMGGLQY
                     LSSPQPMSIVTSPPEQKRYVDNNCLSPTANPKTSSKRNSTLSANSVISNQGKRKTHVG
                     PWQLGRNLGEGTTGRVRLAKHKYTGQTAAIKIVSKTSAAMTQSNSIAEMDRNRGLHGK
                     SGTRHIPSGIEREVVIMKLIEHPNVVRLYDVWENRGEIYLVLEYVEGGELFNYITENG
                     PLQEFEAVKLFRQILAGLGYCHRFGICHRDLKPENILLDSQGNVKLADFGMAALQREG
                     YWLKTSCGSPHYAAPEIVKGDEYRGNKADLWSCGIILFALLTSYLPFDGQDLSSTLKL
                     VKTAKVEIPSNVSYEAADLIHKILQKKPEKRIDMADVWKHPLLRRYECLDPVMHNPYI
                     GPAPSWSVKECGPRISRHELESESDILRNLQTLWHDVEREVLIERLLDPEPTLERMFY
                     NALVRFRDEHLENWPGQSLEYSASDYHHISKDSNGTFSRRDNDRSKGSRRRGQVPMSK
                     VAQLRSNAIQEPKSCATVGSYDPFRSPCHVVPEKEGHTYVTIHRDVPDHGGRKEESDS
                     IAEGSVISEEEFRDQTPCPPSSPFAIVQNKKKPSSLKSFHSRTSHTGNRRQLNGLSAP
                     RSASYKRNVCFRHVRNRSQGSTTAMKPKGAPINVPDKDMSENSLMSIDPGPFADRESS
                     PLLPAQPAVVRRPGVALRTCAPQKKVRESDFIWKDDARQVSHELSQICEEAFNRASLS
                     TGCTTTSTCMSAETPATSVSMASPEASHSRIATSNSKAPVTPSRCGESPRSYTAAELT
                     ETRRKLIAHSTQDGTEDVPGYLVAVIKHLDRLIEQDKARQRERVYTPEPEAQPSELSQ
                     DAGCLPKISEELHNRQSNSATQYKPYRPGLTTSTGTNTGRPSRNGIGTIRMVPQSSVP
                     SIETIQPLTIRKKSEGPSPNIHHEPFADGSNEENLAPCRYSSMNSFHSRRPCELDPIA
                     EIPPKSEKRNAARYPDNKKWSWLPIKHQPPTETVCKNLRPLHPVDRTVTVHEVNPSAD
                     SLTNQPETPAGKSKGGFFKKFMKGKASNPKYPTTGQYHLINTIRTSSNRPVPDSQATE
                     TTPILSHPTEPPRLINADKPLPQRPGTSRKPVNWFARMFQFTPATKALALNTSKMKGR
                     KEVHRILREWKPYGITVHYDKADGIIYGKVSRSNIRRIRPVAFSAEFYTVLEDGRRGN
                     LSLVRFKQERGAVSSFNKVIDTLEKFMKRRGLLVEDPVRAQQMMKVLDKYQDPQGK"
     exon            272171..272763
                     /number=1
     exon            272812..273543
                     /number=2
     exon            273632..275847
                     /number=3
     exon            275905..276146
                     /number=4
     CDS             complement(278500..279204)
                     /codon_start=1
                     /locus_tag="AO090120000115"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000116"
                     /protein_id="BAE62741.1"
                     /transl_table=1
                     /translation="MFTPVSSQAQAFVPAHAAYPHLRNAQNQPRGGAPVMLYGAHGQP
                     LPPQQQPQAPPDATLPPPQGLYQNPYGSAPPPLPQDPVSSNSALSAVKSTLTHWSLCE
                     QRPIGRRGSSSGFEYPDPTNLAPVTPATSAPGYQAHSASSPYYPPPPQHDRRPSPQSA
                     YPYDNRHSSSPHNSPYPPLHASQSAMTPPPTSTPGGSSRGGLNVRDMLNPGDSQGRSS
                     TDSDMLNALNRRGLNQ"
     exon            complement(278500..279204)
                     /number=1
     CDS             complement(join(292272..292370,292461..292601,
                     293215..293325))
                     /codon_start=1
                     /locus_tag="AO090120000118"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000119"
                     /protein_id="BAE62742.1"
                     /transl_table=1
                     /translation="MPVWLHQISLLMRHICPFSRFESDSVASRHRKRHLLLGYGLDNE
                     NIRLLRLRSFTIGRPLADEELMSPNAQDKIAALIGIMEPFHRYQIRALSPRSPLRLSS
                     HFSGVASDTMIPTI"
     exon            complement(292272..292370)
                     /number=1
     exon            complement(292461..292601)
                     /number=2
     exon            complement(293215..293325)
                     /number=3
     CDS             complement(294343..295062)
                     /codon_start=1
                     /locus_tag="AO090120000119"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000120"
                     /protein_id="BAE62743.1"
                     /transl_table=1
                     /translation="MPRRSSRAVPVSAAAPAPVQKRRASDRLPTASKTGSKRQKSDVT
                     TTTTGRPVRSTSKKSKYFQEEYSDDSGTDSNNGSPPEDSPSNYDDSASSAAESVAFPT
                     ASEATENPRKKPGRPRKSLGSNKGDTEGTRKKSDSVPKGDTNEALNDKQLWKEGVKAG
                     LGPGKEVFIKKPKARDAGTVPYQEHTLHPNTFLFLVDLAENNERAWLKGNNIPCGGNQ
                     GSESQLTMVTIHSARSGLPCV"
     exon            complement(294343..295062)
                     /number=1
     CDS             join(295633..295931,295980..296127)
                     /codon_start=1
                     /locus_tag="AO090120000120"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000121"
                     /protein_id="BAE62744.1"
                     /transl_table=1
                     /translation="MSEVEASAIPEVFESRKRKILAGLSVPDAEYTDLSPKGSVDEGI
                     RDLIHEINTHPGLVTTSSCAGRISVFLEGRKKQPKPHDEQGRQFVASGGKGAGKWLNS
                     SERGDHQGKSLHELFGMVPGDGKPPGLNKQGKAPRLVRFHFEPLVR"
     exon            295633..295931
                     /number=1
     exon            295980..296127
                     /number=2
     CDS             join(296382..296632,296674..296752)
                     /codon_start=1
                     /locus_tag="AO090120000121"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000122"
                     /protein_id="BAE62745.1"
                     /transl_table=1
                     /translation="MAATLQHAHPVLSAASSSGFRESGLQSLRCLEGDEGPSPIVAVR
                     SAGLSLESVIGYCEDSDADDETATGEPGIRSLVTEEYLQITKRKIPGEFAGFMLCESR
                     TKDEQED"
     exon            296382..296632
                     /number=1
     exon            296674..296752
                     /number=2
     CDS             complement(297507..297908)
                     /codon_start=1
                     /locus_tag="AO090120000122"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000123"
                     /protein_id="BAE62746.1"
                     /transl_table=1
                     /translation="MQILGNLVLTGWITKDNEAKARRAAAGPSSSTRHDQRRTLSGSV
                     ASSEEGLDPQTFSRLEIFATPSRRMTEAGPSYRQEREAGDETPRPFNDSDQSPWTRRL
                     LIFPPGTAREGFHFGHRNTKSSPGNLTPSGV"
     exon            complement(297507..297908)
                     /number=1
     CDS             complement(join(298122..298136,298163..298471,
                     298654..299061,299110..299661))
                     /codon_start=1
                     /locus_tag="AO090120000123"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000124"
                     /protein_id="BAE62747.1"
                     /transl_table=1
                     /translation="MATRRPVDPFTGHDSPGPYHGPYRARAGTVMQPVQTTQPGPSET
                     PHQQGQFPSLGGLYAHLPSTGEAPRGYYPYDTAQTPTPTPRNPRPFSQLRAVHSPLPA
                     PAPQHPFHYGPPGLLSPAFYPTEGTVAPQPMRAEVHGQPGNSEQIPDLDKPFSTVAMR
                     EEMPIGSSVHTRQAPCWGVIKISNIPYSVTKSEIAQFVGRPARLIKGCPIHIIMERST
                     AKTMDCFVETETQEAAQRTVDRINSIYETGRAPRLGLRRVDVEYSNQDALLKDLFPRA
                     KCISWEEGMPRELPNTDPYSTGFSGFITSEEIVGAIRHAEIPHRYPWYATRLYTVDDR
                     NQLFELTNRHLISLASRIDRTQTMGLDQNLLRDLLYAGINCPAFNERQKYTLCVNSNL
                     APEISRFPDISKWFPFDTLVQLPDFNKDTLSPTPN"
     exon            complement(298122..298136)
                     /number=1
     exon            complement(298163..298471)
                     /number=2
     exon            complement(298654..299061)
                     /number=3
     exon            complement(299110..299661)
                     /number=4
     CDS             complement(join(300684..300692,300757..300801,
                     300861..300986,301046..301122,301199..301448,
                     301497..301499))
                     /codon_start=1
                     /locus_tag="AO090120000124"
                     /note="actin-related protein Arp2/3 complex, subunit
                     ARPC4"
                     /old_locus_tag="AO070315000125"
                     /protein_id="BAE62748.1"
                     /transl_table=1
                     /translation="MSQSLRPYLQCVRASLTSALAVSNFASQTSERHNVPEIEAQSSP
                     ELLLNPLTVSRNENEKVLIEPSVNSVRVSIRIKQADEIEHILVHKFTRFLTQRAESFF
                     ILRRKPVKGYDISFLITNRNVEEMLKHKLVDFIIQFMEEVDKEISEMKLFLNARARFV
                     AESFLTPFD"
     exon            complement(300684..300692)
                     /number=1
     exon            complement(300757..300801)
                     /number=2
     exon            complement(300861..300986)
                     /number=3
     exon            complement(301046..301122)
                     /number=4
     exon            complement(301199..301448)
                     /number=5
     exon            complement(301497..301499)
                     /number=6
     CDS             join(301864..301879,301951..303591,303646..303707)
                     /codon_start=1
                     /locus_tag="AO090120000125"
                     /note="ubiquitin-specific protease"
                     /old_locus_tag="AO070315000126"
                     /protein_id="BAE62749.1"
                     /transl_table=1
                     /translation="MASIPVIVKHQGKRHEVELDLSSNGETLKYQLYSLTGVEPERQK
                     ILVKGGQLKDETPLSSLNAKPGQTFMMMGTPSGGQGSGDLGRPKEAVKFLEDMTEAEA
                     ARAEGAIPAGLQNLGNTCYLNSTLQTLRSVPELHQELLRYRPSTGAAGASNLSDLSSF
                     GLGGLGASMDLTSSLRDLFKQMSETQEGFPPLMFLNALRNVFPQFAQRDRNGHGYAQQ
                     DAEEAWSQIVTQLRNKLMIKEGEGESSNEVSFVDKYLAGRFESVTECDEPGAKEAGEQ
                     PTPSSDVFYKLDCHIGKETNHLHDGIKAGLEEKIEKRSPTLDRDAIYTKRSRIARLPK
                     YLTVHFVRFFWKRETQKKAKIMRKVTFPAELDAVDFCTDELKKELIPIRDKVREIRKE
                     ELDVERARKRQKLDRQRDEEKKTEAEPEPLEPMQKKKAAEERKDASKATEKDGDSAMT
                     DVFKSDAEYEAEKAASILAAKKELSELIDPKLRSDEGTNKSGLYELRGVITHQGASAD
                     SGHYTAYVKKQAQGNKEEDGKWWWFNDEKVTEVEAEKIETLSGGGESHSALILLYRAI
                     DLPTAN"
     exon            301864..301879
                     /number=1
     exon            301951..303591
                     /number=2
     exon            303646..303707
                     /number=3
     CDS             join(304114..304539,304697..305074)
                     /codon_start=1
                     /locus_tag="AO090120000126"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000127"
                     /protein_id="BAE62750.1"
                     /transl_table=1
                     /translation="MFGTRRALQSRLRSLGTQSQLSLRFNPHISRSTSTVADQSAPER
                     SKWGRRLIYAGIFGGLGVAAGKWMDNKVSAPVEPETTEDVLKLEEIRRVYETGLPIVQ
                     ELRNNPDYLEADVYGNYSEEDKKQRFTSGPLKGSRGLALQKVFWNDKERKAVSIVYLG
                     NGLEGWPTVVHGGALATVIDENLGRVAIRHFPERTGVTANLEIKYRAPVYSGNFYTFH
                     SSIDRERTTDRKAYVTGEVRDPVGRLCIQATALFVVPKKYKLEEIGERY"
     exon            304114..304539
                     /number=1
     exon            304697..305074
                     /number=2
     CDS             join(305805..305960,306046..306124,306178..306236,
                     306302..306458,306512..306958,307018..307332,
                     307392..307522,307591..308001)
                     /codon_start=1
                     /locus_tag="AO090120000127"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000128"
                     /protein_id="BAE62751.1"
                     /transl_table=1
                     /translation="MELTNNFTQSQADEKASGHTDNSHDKQGYSHQEDVGSGGYADES
                     GEQGSEPPMTFRRFMGFTAMAFLWTGSQIPVYLFGGIPPYIYGDIGGSDRWVWFVLAN
                     LLALAGVCPFVGSLSDLIGRRYVALIGVTLICIGMIVSSTAHTMNTFIGGMAIAGAGA
                     GVNELTALAATSEMAPTRQRGKYVAVLIFTIVPFCPSVLWAQLIAAHSGWRYVGAFCG
                     AWNGFGLLITALFYYPPPRINSEGLSPKEVMSRVDYVGGFLSIVGLILFMAGMQWGGY
                     QVSRSYITSLLQCRLNSETNLYYIIFGVWEVYGARYPIFPSRLKQEPRTLGLTLVITF
                     ISGANFFSVIMFWPTQSFNVYGHDPVEVGVRSLPIGFGIMGGACITLWLLSLLRGHNK
                     ELLIISSILMTAGCGAMSIARPDNLHQLWGLLTLAGLGIGGIVVPASIMTTIICPDDL
                     IATISALTLSIRVVGGSIGYTIYYNVFISKFIPNAKHYIGGVMLTQLNITNTTYIAEA
                     IELTGASLLDGLREIPGIAGNETAYQAVVAAGQMAYSEGYKWVYYVSIAFGGVSILAA
                     CFLGSIGDYMDDHVAVVI"
     exon            305805..305960
                     /number=1
     exon            306046..306124
                     /number=2
     exon            306178..306236
                     /number=3
     exon            306302..306458
                     /number=4
     exon            306512..306958
                     /number=5
     exon            307018..307332
                     /number=6
     exon            307392..307522
                     /number=7
     exon            307591..308001
                     /number=8
     CDS             complement(308264..312619)
                     /codon_start=1
                     /locus_tag="AO090120000128"
                     /note="conserved WD40 repeat-containing protein"
                     /old_locus_tag="AO070315000129"
                     /protein_id="BAE62752.1"
                     /transl_table=1
                     /translation="MVDPNEPRPLTSAFESPTFGEDSSFHVEQPVGSMSISPCGRDVV
                     LASKEGLHIIDLDSPYSPPRYLPHHTPWEVADVQWSPFAARDYWVVSTSNQKALVWNL
                     ATKSCQNSIEHVLHAHTRAITDINFSAHHPDTLATCAVDSFVHCWDLRSPSRPAISFS
                     DWFAGATQVKWNRQDPNVIASSHDKFLRIWDKRKGAYPIRSIEAHDTKIYGVDWNRVR
                     PGAVTTCALDKTIKFWDYTVEGEEPEKIIRTPFPVWRARNTPFGWGVLAMPQRGNSDL
                     HLYSRRAGEGEDPSKDLPLVHSFPGHKGQVKEFLWRARGGVVDGADHRDFQLVSWGTD
                     RELRLHRVDPDVMRGVGYEKGKSFISNINITRNGAVYKSFRDEDSSRGHDETDSLSAF
                     QESVSGSSRALGLNTISVPYTRPWTQGGNTDSRIGMQGRSNIRNDTNPISWMRGVKIS
                     GWDVETLGDEITHVGEKFTKVDFDSVDVRQRKATISLHGPWGPEGDSLFLKVDIKFPA
                     DYPRTAMPTFSVQKTSAVTDELADKLVAELRTIAETFLSHKRGCLEGVVRYLLGETSL
                     EESIAWILGETTETVKSPISGQLEAGESSDEDEVGLSQSQELGMSSELLRPVNANVMV
                     PVAKACGALWANDGRLVCFFPTKKDKSASLLENLGFKEMTRLSRADKVFEGFGRLQTS
                     SPGPRGSGTMTSTDDGTSDYSDDSDAETSSSSGSSGILSTLQHRFPTPQTWRSAGSLG
                     LYKPRSTDNSQRSTVGMMTSKASENPQNTVSIHDFTELLPAKRELANNYRICGKGTDV
                     CAHNAAVALDHGFYELARIWGLVKLVLHNNNKSGQISGLDTGERPQRMQRKDSAVDLS
                     YDLGNQDQRPKDTANSVIQWGDHPFGGQWLVPALFEHFERVGDVQMVAMLSCVLHESN
                     HEKYPPREEYGQSKTVSKRVDDQPLSLNNYSTQAASHSKSHTTTPLGSTPKDSHTTPI
                     TQSSGRSSSEIWRPDSTPPYSTGTTPPLASRAAGFAAERKAMSHTASIAASPDQQSQP
                     RSASGLGSVLASSLSRSFTFGPSSASPPASALSRKKQTPSGSPNTTGGIWPTSTFISK
                     PVSAVPDYLTTPTAPTSQTHSDTESERLEKTQASKPRAKLRVTLKHRDAFEGDKATQN
                     TFIDSKKDGLYRSYRQAYAHLLSIWGLHIQRSEVLKIGRVNNHSSDTDFRQWGYNSPR
                     SSLSLPTLRHRGSVNSNLEAGNQGLEIQRHCIRCGRPLQMSIFISEPMTETPVQKQMK
                     GDPTPAICQGCNPKQPLSLKLPCVICGEVVDGMLTPCLNCGHVSCFDCHQGWFSGLSP
                     ELQDDKANGAIDMHDSDQEHQYCPTGCGCKCPEHIVSNIPRPWSPSSPTPDGETSPLT
                     RSRKQPDILSNVGQHEDDLDQWHTSPFASLARGLGGGLSRGLRPKEDRRKSKSSISGF
                     VPKRTAMNQVESTWQ"
     exon            complement(308264..312619)
                     /number=1
     CDS             join(313407..313459,313519..313607,313672..313803,
                     313860..314035)
                     /codon_start=1
                     /locus_tag="AO090120000129"
                     /note="ubiquitin-protein ligase"
                     /old_locus_tag="AO070315000130"
                     /protein_id="BAE62753.1"
                     /transl_table=1
                     /translation="MALPKRIVKETERLMAEPVPGINAVPHEDNLRYFDVSIHGPAQS
                     PYEGGIFRLELFLPEDYPMTPPKIRFLTKIYHPNIDRLGRICLDVLKNNWSPALQIRT
                     ILLSIQALLGAPNPDDPLANDVAQRWKEDEPAAIQTAREWTRTHAMT"
     exon            313407..313459
                     /number=1
     exon            313519..313607
                     /number=2
     exon            313672..313803
                     /number=3
     exon            313860..314035
                     /number=4
     CDS             join(314899..314990,315045..315582)
                     /codon_start=1
                     /locus_tag="AO090120000130"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000131"
                     /protein_id="BAE62754.1"
                     /transl_table=1
                     /translation="MKNKSKGRSKGKGMNKLKKDHTNNNNNNKDSTWLKHLSIGFTSS
                     SETITEVNSGRLSEITTQIETSLRIEDDALNKSLLSKTEDINAETTKKENEANTNGDG
                     GLPRVGSLKRRLKMTFTGSPLKLPGDSDRHSCHIHSQDKVTRSERSGSGTASLTDSNT
                     IGTHGSIHSPTKQSPTTPPTPKYLKYIRATNGKSVQSFYEVSYLWLVSD"
     exon            314899..314990
                     /number=1
     exon            315045..315582
                     /number=2
     CDS             join(316843..316893,317068..317211,317429..317713)
                     /codon_start=1
                     /locus_tag="AO090120000131"
                     /note="60s ribosomal protein L24"
                     /old_locus_tag="AO070315000132"
                     /protein_id="BAE62755.1"
                     /transl_table=1
                     /translation="MRTYDDSFSGQKIYPGKGKLYVRGDSKIFRFQNGKSESLFLQRK
                     NPRRISWTVLYRRQHKKGISEEVAKKRTRRAVKSQRAIVGASLDVIKERRNQRPEARA
                     AARQQAIKDAKEKKAASEKAKKAEKAKNAAAGKGTAQRIQSKQGAKGSAPKVAAKSR"
     exon            316843..316893
                     /number=1
     exon            317068..317211
                     /number=2
     exon            317429..317713
                     /number=3
     CDS             complement(join(318619..318708,318771..319193))
                     /codon_start=1
                     /locus_tag="AO090120000132"
                     /note="glucosamine-phosphate N-acetyltransferase"
                     /old_locus_tag="AO070315000133"
                     /protein_id="BAE62756.1"
                     /transl_table=1
                     /translation="MNSQTDDAPLFSSSLISPEVVAALPEGYTIRPVRRSDYKRGFLD
                     VLRVLTTVGDITEEQWSQRFDWISARNDEYYLLVICDNTDRVVGTGSLLVERKFIHSL
                     GMVGHIEDIAVDQSQQGKKLGLRLIQALDYVAANVGCYKSILDCSEHNEGFYLKCGFK
                     RAGLEMAHYY"
     exon            complement(318619..318708)
                     /number=1
     exon            complement(318771..319193)
                     /number=2
     CDS             complement(join(320141..320327,320384..321401,
                     321468..321583,321660..321697,321760..321804,
                     321939..322184))
                     /codon_start=1
                     /locus_tag="AO090120000133"
                     /note="fumarase"
                     /old_locus_tag="AO070315000134"
                     /protein_id="BAE62757.1"
                     /transl_table=1
                     /translation="MLAPSNSRAAVRSMASLAHAASRASASSPAVARSALACAARSPA
                     SLGCRRALSTNSRQLQFPRLQSLNTISSKRTFGTTARMASETRVETDAFGEIEVPADK
                     YWGAQTQRSLGNFDINQPQDRMPEGVVKAFGILKGAAATVNMKFGLDPKIGEAIQKAA
                     AEVAEGKLMDHFPLVVWQTGSGTQSNMNSNEVISNRAIEILGGKMGSKKPVHPNDHVN
                     MSASSNDSFPTAMHIAAVLELEGTLLPSLKSLRDALQVKVENFEKIIKIGRTHLQDAT
                     PLTLGQEFSGYVAQLDRNIERVQNSLPHLRYLAQGGTAVGTGLNTFKGFDEAIAAEVT
                     KMTGTEFKTAPNKFEVLAAHDAIVEASGSLNTLACSLFKIAQDIRYLGSGPRCGLGEL
                     ILPENEPGSSIMPGKVNPTQCESLTMICSQVMGNHVAATVGGMNGQFELNVFKPVMIR
                     NLLHSSRILSDGMKSFEKNLVHGLEANEPRINSLLHESLMLVTCLNPVIGYDMASKVA
                     KNAHKKGLTLKQSAMELQALSEEDFDTHVRPELMLAPKEKK"
     exon            complement(320141..320327)
                     /number=1
     exon            complement(320384..321401)
                     /number=2
     exon            complement(321468..321583)
                     /number=3
     exon            complement(321660..321697)
                     /number=4
     exon            complement(321760..321804)
                     /number=5
     exon            complement(321939..322184)
                     /number=6
     CDS             join(325070..326149,326221..326326,326392..326456)
                     /codon_start=1
                     /locus_tag="AO090120000135"
                     /note="aspartate aminotransferase/Glutamic oxaloacetic
                     transaminase AAT2/GOT1"
                     /old_locus_tag="AO070315000136"
                     /protein_id="BAE62758.1"
                     /transl_table=1
                     /translation="MTVLSTLAPVPADEIFALNRAYANDDYPQKVSLGVGVYRTDDGK
                     PWPLPVVREAEKRLLAEDNLFRHEYTAIEGDIPFLELARDLMFGFDAKDTSDKVKSTK
                     GRIGSVQAVAGTGANHLGALFLSHLMKPKNVWLSNPSWANHLTIWELAGVPRKTYPYY
                     KAATRSFDFEGMMSTLEAEAQQGDVILLHACAHNPTGLDPNKEQWKAIADLCERKKLF
                     PFFDSAYQGFASGSADEDAWAVRYFLNEKPQMEMCVAQSFSKNFGLYGQRVGAFHYVL
                     NDGAQNLRDIVVNNLCHFIRGEYSMGPTGGCSIVKKVLTDEELTAQWHEDLKVMSSRI
                     RTMRQALYNELIKLETPGTWRHIVEQNGMFSYTGLTPSQVYALKDKYHIYLLKSGRAS
                     ISGLSEKNVTYVAQAINDVVRNVN"
     exon            325070..326149
                     /number=1
     exon            326221..326326
                     /number=2
     exon            326392..326456
                     /number=3
     CDS             complement(join(327056..328267,328426..328497))
                     /codon_start=1
                     /locus_tag="AO090120000136"
                     /note="low-complexity"
                     /old_locus_tag="AO070315000137"
                     /protein_id="BAE62759.1"
                     /transl_table=1
                     /translation="MLVSLTVGKVDAGVAVLLTQDNRLIEFPSVLLPNNITSGSIVDI
                     TVARNHSAEEASATGFQSLQKRILSTYGVKTPSPPILRLRNATQTSLVLEWDPIDLAT
                     ASLKSLSLYRNGSKAGSIPRPLETRSTKISGLAIHTEYTFHLVLRTTAGTYQSEKLTC
                     RTHKMTDLSGITVTAGVLPEQQKEALGAALDRIGGKLIDTVRIDTTHFVCTEGKGPLW
                     EKAVEMNIPVVTPEWVDACEAEGTIVSVRGYYLNADPKARQLGPIHASTQHQRTMSTM
                     TANTQNHIQSQSQSQSRLSLQPQPTRERQESIAEPPITPFPGAGMSGQPRAEDSEGPS
                     DDEDEQPPPPPPKDESEAAASPEPTPNGHAEQNGDADAAETAGSSEKEDKADNEEKEE
                     DAQEKVEETKEESSGDEVKKGKGKEGEGDFNEVPL"
     exon            complement(327056..328267)
                     /number=1
     exon            complement(328426..328497)
                     /number=2
     CDS             join(330007..330027,330241..330669)
                     /codon_start=1
                     /locus_tag="AO090120000137"
                     /note="translation initiation factor 1A (eIF-1A)"
                     /old_locus_tag="AO070315000138"
                     /protein_id="BAE62760.1"
                     /transl_table=1
                     /translation="MPKNKGKGGKNRRRGKNESDKEKRELVFKEEGQEYAQVVKMLGN
                     GRLEALCFDGEKRLAHIRGKLRKKVWINQGDIILLSLRDYQDEKGDVLLKYTADEARS
                     LKAYGELPEHAKINETDTYGQEGFEDNVEFDEDRESEDEKEIDVDEL"
     exon            330007..330027
                     /number=1
     exon            330241..330669
                     /number=2
     CDS             complement(join(331326..332252,332311..333406,
                     333467..333943,333996..334047,334106..334244))
                     /codon_start=1
                     /locus_tag="AO090120000138"
                     /note="structure-specific endonuclease ERCC1-XPF,
                     catalytic component XPF/ERCC4"
                     /old_locus_tag="AO070315000139"
                     /protein_id="BAE62761.1"
                     /transl_table=1
                     /translation="MSKTPFARGLKVINTERASVSMRERIYAEGGILSVTSRILVVDL
                     LSKLLDPEKITGMVVLHADKIMATSTEAFIIRIFRQINKNGFLKAFSDSPEPFTTGFA
                     PLANSMRNLFLRKASLWPRFHVTVAESLEGHRKAEVIELEVPMSDKMREMQNAVLECV
                     EICIGELKKANTGLDMADWTLDSALHRSFDIMIRRQLDPIWHRVTFRTRQIVSDLSDL
                     RAILHALLTYDSVSFVKYLDTIVTAHSPPPGSTRHNYSPWLFLDAAHVLFQTAKSRAY
                     QGKISNDVARSSLNSFPTTLQPVLEEQPKWEVLAEVLEEIENDAYLNPVNVDESNSTI
                     LIMCTDQRTCRQLREYLGTMHAHVNDENEDDKDIGDNIKKGSAQVMMRRRLREYLNWK
                     TSLSNVTKNLTSKPTNDESQAGKSQDSPRPSAPQGRAPPNKRRRVRGGGAVTSASGRV
                     PNSSVQTDVELPGQVSNLLEEIQPTEIEEVQKEDIIIDDLEDMEDFYELYDMDDLIMI
                     HPYDGDMDEHILEEVRPRYIIMYEPDSAFIRRVEVYRSSHVGRNVRVYFMYYGGSVEE
                     QRYLSAVRREKDSFTKLIKEKGNMAVTLTHDKGFEDPQEQFLRTVNTRIAGGGRLAAT
                     ASPPRVVVDVREFRSALPSLLHGNNMIIVPCQLTVGDYILTPDICVERKSIRDLITSL
                     RNGRLYNQAETMLQHYKNPLLLIEFDQNKSFTFDAFASATTPGTTFLTDYGFSSSGTA
                     TTTLSASSSLVNPSSPKSAQHLLVLLTLAFPRLKVIWSSSPYQTAEIFAELKKNNPEP
                     DPIRAVQIGLDMDIAAGSDSSNVMAAAGIEHRTFNLLPQDMLRAVPGVTPSVLERLIL
                     ETGNISEIANMTVEQLDPLVGIEAARKIVNFFQKSVFDEN"
     exon            complement(331326..332252)
                     /number=1
     exon            complement(332311..333406)
                     /number=2
     exon            complement(333467..333943)
                     /number=3
     exon            complement(333996..334047)
                     /number=4
     exon            complement(334106..334244)
                     /number=5
     CDS             join(336220..336429,336508..338263,338317..338348)
                     /codon_start=1
                     /locus_tag="AO090120000140"
                     /note="actin regulatory protein (Wiskott-Aldrich syndrome
                     protein)"
                     /old_locus_tag="AO070315000141"
                     /protein_id="BAE62762.1"
                     /transl_table=1
                     /translation="MPSILSDADKETVKRTVPKPANKIHAVAVARLYVAYPDPQKWTY
                     TGLQGAVVLANDLVGRTFWLKLVDVSPAGRGVIWDQEIYDNFPYNQDRTFFHTFELEE
                     CPAGLSFADEKEAKTFMKKMQDREKNASKETRQTPFASTRGQGPAPIANGKHGVGRSI
                     FGSLLGHRSTSGSNAPPPVAHTEPPSAPSIQVAPPPPSSPPRKPLPFDTSDPSWKGLL
                     DELLQMGITEDQIAENSDFIKAYIEQKQSNGVDSTPSPAEDKRGKAPPPPPPSAPPAP
                     KSSSISPQHTGNSTGSRRGAPPPPPPSRRTRTEAEEESPASTREPSPPRPRFRAPPPI
                     ADAGKFAHTNGPPLPGRQRASSGATPGPPPPPRPPKTPVDDSQPRFGVPPPFQGERKV
                     SAPPAPPSRNNAPPGPPPRPPPRTSSPAVPPQLPPKVPHGAASTPAPPPPPPRSPASQ
                     PPPPPVPAASRPTPPPPASSAVPPPPPPSSSVPPPPPPPPPPTSSVPPPPPPPPLPSS
                     RGPPAPPPPPPSSSIPPPPPPPGRGPSAPPPPPPPAPAGGAPPPPPPPPGAGAPPPPP
                     PPGGAAPPLPTPSGGRDDLLAAIRASGGKGGGGLRKVKESDKKDRSAAMVPGSANETS
                     AASAGGGAAQGGMAGALKAALDKRKQKVSGSDDEKEDDDDW"
     exon            336220..336429
                     /number=1
     exon            336508..338263
                     /number=2
     exon            338317..338348
                     /number=3
     CDS             join(338774..339343,339413..340041,340104..340662)
                     /codon_start=1
                     /locus_tag="AO090120000141"
                     /note="magnesium transporters: CorA family"
                     /old_locus_tag="AO070315000142"
                     /protein_id="BAE62763.1"
                     /transl_table=1
                     /translation="MLSPPHLKPAVPSASLLRYLRSQSENTHVFISACGTSRKPQVHN
                     QPSRMLALRNTSSWANIKPLRCRAALETNLLSVSTISRSRGSSRCRASLGQSPSPITV
                     FSRATHTKSRPLLRRLFDLRRSKAAAEAKLNRAGSPALVDEGAEGLNFGRGLAAKASN
                     ELRLRCTEFDNNGNVTLVNGEFRKSELIAKYGLLPRDLRKIDSSTLPHILVRPSAILI
                     NLLHLRVLIKADRVLVFDAYGSTDSYMQSLFVYDLEGKLRQKQSQGAQALPYEFRALE
                     AVLISVTAGLEEEFNGVREPVVRVLRALEEDIDRDKLRHLLIYSKKLGSFEQKARLVR
                     DAIDDLLEADDDLAAMYLTERAEGVQRQEHDHQEVEMLLESYHKVCDEIVQESGNLVT
                     GIRNTEEVVKAILDANRNSLMLLDLKFSIGTLGLATGTLFSALYGMNLKNFIEESDFG
                     FGGVSVICFAITAVVCVYGLAKLRKLQRVRMWGEAGVGGSPMVSLPTRNSALTAHRSN
                     WRADSIEPVWGSLPGEGRAERIRRLKDSAAAAAAKSAATEPTAQRAAASWNAAKSQPK
                     QSGESATNEAAANIGGDSA"
     exon            338774..339343
                     /number=1
     exon            339413..340041
                     /number=2
     exon            340104..340662
                     /number=3
     CDS             complement(341148..343055)
                     /codon_start=1
                     /locus_tag="AO090120000142"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070315000143"
                     /protein_id="BAE62764.1"
                     /transl_table=1
                     /translation="MKNHRNKTVRDVTKLSGKPLPETLEPSSILQGTPTEQWVTSKDL
                     LEDGLPFIPEVMKDLTVFLLGNININSTHLFRADILYDSQGVLSTPQQKELSFAQTGN
                     TSVETTTDAEDRVEPIVAAEVAGFNLTRTVVRRLIPRNPKLDRPLEQTCHFYEADIAP
                     GSEGATQESRLRRFLAVYTPHVASKEEIPFYHPLLRALAYLYDFTDDAAEATEAGSGS
                     GALSLHFLPYPEEALPTRLERTLHALLNTQIRLARNTRLSETTEGGNYNPSKDNVIPQ
                     HLVQNTYSRLKFKYGKDLCRDWVEDTEPTKHVFEDLAITAFLIELWRSMYGAVPGEER
                     NEDGPEKYDPNFPGFVDVACGNGVLVYVLLMEGYRGWGFDARRRKTWKILPEFVQARL
                     KEEIYIPKPFTDAMAERGGVPDLGVETHSGLFEKDTFIISNHADELTVWTPLMATLAC
                     PESPLPFIAIPCCSHALSGAKYRYPPPKASKPDSDKESSQHEDVDSEQPATGDLKALR
                     KAKQEAQTDVGFYKSMYGSLTMKAISIAEEIGYDVEKTLLRIPSTRNMGVIGGRKRVT
                     KEWRARNQQQPASDCNGDAVTESALDKAMAAVQRECSRDGGVEGAAKIWVERAKGIHK
                     GQGPGNQRGHC"
     exon            complement(341148..343055)
                     /number=1
     CDS             join(344871..345406,345471..345809,345878..346427)
                     /codon_start=1
                     /locus_tag="AO090120000144"
                     /note="cystathionine beta-lyases/cystathionine
                     gamma-synthases"
                     /old_locus_tag="AO070315000145"
                     /protein_id="BAE62765.1"
                     /transl_table=1
                     /translation="MVFSSGAAGHQCATVLKTLPSENPFTIKVVRFVMPLESNLGDTS
                     SHWANFTAVLYPSDLLKAAMAFWRDTGSGLSTRHAEFCLEEFDYLDSDSSTPAYRTPA
                     SRKRCRGKTPESLIWMRAAARDSHEVKSFLADLATSEQPGQPTVNPDEVFLYPTGMNA
                     IYTLSQALVSPEYKVAMYGWLYPETVDVVRRDTWAECLSYKYGTEEELDRLEALLQSG
                     QQIRALFCELPSNITLASPNLCRIRALADIYGFVVACDDTVAGYVNIDALPYVDVMMS
                     SLTKTFSGASNVTGGCLVINPNSRHHDQIHTTLSKNQDTYFPLDVNTLRQNSKDIVWR
                     VKQCNPNTLPLIELFQAHPAIAAVNDPSIAPTSALYKSVMRKDGGYGNVLSIVFHDPR
                     TAEHCYNVFNVCKGSSFGANFTLAIPYVRLANYWNQDKVAKHGVPRHIIRISVGLEDT
                     RQIVETAKRALKSVDEFEMKKDLN"
     exon            344871..345406
                     /number=1
     exon            345471..345809
                     /number=2
     exon            345878..346427
                     /number=3
     CDS             join(347034..347209,347340..347603,347709..347921,
                     347969..348035)
                     /codon_start=1
                     /locus_tag="AO090120000145"
                     /note="phosphoglycerate mutase"
                     /old_locus_tag="AO070315000146"
                     /protein_id="BAE62766.1"
                     /transl_table=1
                     /translation="MAPRCFIIRHGETEWSLNGRHTGITDLALTPNGEKRVKATGKAL
                     VGNDRLIAPRKLVHVYVSPRARAQRTLELLEIGCRERLPWNEERKSEDEEPIRTEAKV
                     EITEAVREWDYGDYEGLTSKQIKEMRKENGEEPWDIWRDGCPGGESPEDVVRRLDALI
                     TDIRKKFHGPCFDGEGGQGDVLIVAHGHILRAFAMRWVGKPLTETALILEAGGVGTLS
                     YEHHNIEEPAIILGGGFVVEN"
     exon            347034..347209
                     /number=1
     exon            347340..347603
                     /number=2
     exon            347709..347921
                     /number=3
     exon            347969..348035
                     /number=4
     CDS             complement(join(349756..351382,351442..351871,
                     351950..351990,352048..352168,352316..352349))
                     /codon_start=1
                     /locus_tag="AO090120000147"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000148"
                     /protein_id="BAE62767.1"
                     /transl_table=1
                     /translation="MAPPPRLRILSVGSNAISAFLSWRLQATTSCDVTLVWKSGYEAV
                     SQYGVSFKSKAFGNERFKPRHVVRTPEDAASRENAFDYVILCVKALPDVYDLASVIES
                     VVTPQHTCILVNTTNTLGVESHLEQRFPTNVVLSLVSGVEISQIGASEFEHLNSSEIW
                     VGATNKQTSIPSTIQNDMAAALAMTLASGQVDCKVSDNIRQEQFERMIGPIAFYPTSV
                     MFETSNHTQLLEKVGVRQLVSDIIEELLELARANGCSFPNDFAKKTIETMTANGAPST
                     MYQDFQARRPMEIETYLGSPIKLATESGVRIPRIETLYAVLHHVNATNLSKPRTNESP
                     PPVLAQPPPRMSSAPPRGPMNGPMRGGRVPSGMMPRRGPPHPGMSRPPSAHPQAGRMP
                     RDPSVEGLEEFSHLVMYDDAASAAAVAAENGVPPQNGTNGYPDMPPGPPPSAADLALR
                     ERELAIRQRELQIREQEMGMRRGPRRPPPPRSTFDEEDEDDYFDPMDTLPIPSIDPDQ
                     VDMLSITSRRTKKSAPSASQLRKNPEITLNNGGGSRPGSSFSRYFGGRKRTSDRIMQE
                     IPGLHDSLMDNPMMAYSSNRYGAVDRNHIQAGSRANSLTASRMGDYPPHPYPASRRNS
                     QSPATPPYGPPGPRMGRPGTSQDPSLGPPNGPRGGQPSPPGQMRAPVPRHPPGQGNAV
                     GPQQIEQQYGVSNSSLAKGTPKHRSLTGSASASAESGDSGASANLDSENSAHSSQISL
                     NAHQAATPVR"
     exon            complement(349756..351382)
                     /number=1
     exon            complement(351442..351871)
                     /number=2
     exon            complement(351950..351990)
                     /number=3
     exon            complement(352048..352168)
                     /number=4
     exon            complement(352316..352349)
                     /number=5
     CDS             complement(join(357918..357963,358027..358284,
                     358341..358701,358758..359168,359736..359985))
                     /codon_start=1
                     /locus_tag="AO090120000149"
                     /note="ATP-dependent RNA helicase"
                     /old_locus_tag="AO070315000150"
                     /protein_id="BAE62768.1"
                     /transl_table=1
                     /translation="MSHEEDLIDYSDEELQTTDAAATTAAPAANGDAAKKGDLTVSGG
                     RPDKKGSYVGIHSTGFRDFLLKGELLRAITDCGFEHPSEVQQVCIPTAILNVDVLCQA
                     KSGLGKTAVFVLTTLHQLEPVPGECSVLVMCHTRELAYQIKNEYARFSKYLPDVKTAV
                     FYGGTPIQKDVEVLSNKESYPNIVVGTPGRLNALVRDKKLSLRNVKAFVLDECDKMLD
                     QIDMRRDVQEIFRATPADKQVMMFSATLSQEIRPVCKKFMRNPLEVYVDDDTKLTLHG
                     LQQYYIKLSEAEKNRKLNELLDSLEFNQVIIFVKSTLRANELDKLLRECNFPSIAVHS
                     GVSQEERIKRYKEFKEFNKRICVATDVFGRGIDIERINLAINYDLPADADSYLHRVGR
                     AGRFGTKGLSISFVSNEEDEKVLKDIEKRFEVALPEYPEGGVDSSTYMA"
     exon            complement(357918..357963)
                     /number=1
     exon            complement(358027..358284)
                     /number=2
     exon            complement(358341..358701)
                     /number=3
     exon            complement(358758..359168)
                     /number=4
     exon            complement(359736..359985)
                     /number=5
     CDS             364975..365826
                     /codon_start=1
                     /locus_tag="AO090120000151"
                     /note="predicted protein"
                     /old_locus_tag="AO070315000152"
                     /protein_id="BAE62769.1"
                     /transl_table=1
                     /translation="MPKERNFNPVQAQRKADKQKSLKKAKSEAQARQNEKLARRNPER
                     IQRQIDDLKAVEESGQKLRPRDKEVLEALERDLRAVQKAREALGDKAPKFDNHQSRRG
                     GFGGRGRGDGVLGKRRRDDRGHFGQDSESSETDEEVRRIPMPRDTPPPIPRQYQKKRE
                     GDADTGPRGPHGLPAKPPVVEFRTVYEAKPEIKDLRQEAVKKFVPAAVRVKQDAIRGQ
                     GKLLEPEEMDRLEKAGYNAGPSEAVGQESSDQPDDVAQQRLLEEEKRFDQELRSVQIE
                     DVEDEDA"
     exon            364975..365826
                     /number=1
     CDS             complement(join(366613..368619,368678..368730,
                     368796..368847))
                     /codon_start=1
                     /locus_tag="AO090120000152"
                     /note="NIMA (never in mitosis)-related G2-specific
                     serine/threonine protein kinase"
                     /old_locus_tag="AO070315000153"
                     /protein_id="BAE62770.1"
                     /transl_table=1
                     /translation="MAIALAEADKYEVLEKIGCGSFGIIRKVRRKADGFILCRKEINY
                     IKMSQKEREQLTAEFNILSSLRHPNIVAYYHREHLKASQDLYLYMEYCGGGDLSMVIK
                     NLKKTNKYAEEEFVWRILSQLVTALYRCHYGADPADVGSNILGPAPKPSGLKGKQAQM
                     TILHRDLKPENIFLGHDNTVKLGDFGLSKLMNSHDFASTYVGTPFYMSPEICAAEKYT
                     LRSDIWAVGCIMYELCQREPPFNARTHIQLVQRIREGKFAPLPEFYSPELKNVIASCL
                     RVNPDHRPDTTALINLPIIRLMRKEKEVVDLSSKLRKREESALQKAKEVEQTFAKLEK
                     ERQQMKSDIESSLRREWEVKARLEIDRQVQNELERLRKRFETEVQDRVAIELEKQRKS
                     QNVRDDAALRSSVYGSRSSTSNGEDTDFPSTTDISQLSMESPVNKPLRRETRTPFNRS
                     KTVVESPVDVQMAEPSPISIASLSLSPRRTSATSSGKNIFAEAERQRAKWEPTLAYSD
                     DEDDTPDLPSPTRPKVKPDPFKAPSRPLLRQNTAALMQKLSTQPPLFPSNPSRLPQAS
                     GSGQNEARHGEPKARSPHRRLSKIPSSANLAADAGSPTRKSGLKQHPTKVNGGGEEMF
                     KAVMQRNMGGRTLVELAQARAGGRPVEDLKRCASDSRTSNCSSGLKSSDRDPPAVWDP
                     EKDEMPSPFLARGRKVIRNLR"
     exon            complement(366613..368619)
                     /number=1
     exon            complement(368678..368730)
                     /number=2
     exon            complement(368796..368847)
                     /number=3
     CDS             join(369513..369746,369849..369934,369995..371582)
                     /codon_start=1
                     /locus_tag="AO090120000153"
                     /note="ankyrin repeat protein"
                     /old_locus_tag="AO070315000154"
                     /protein_id="BAE62771.1"
                     /transl_table=1
                     /translation="MSEPTVLRKDQLEISLHNEKKLIKEGTIKDDNPLDLSEPFRELC
                     AACRKGDLKVCQEKITEGVNINARDPYDYTPLILASLCGHYEVAQLLLESGALCERDT
                     FQGERCLYNALNDRIRNLLLEYDYSKSTDPLQPLAAHISSLLTRDQPGTSDIVVTAED
                     ESLYLHKFILSARSPYFRSKLAASPSTATWKLPNTIPPQAFAAAIKYLYFGEAPRELR
                     SGPGTGFTESEVFAGINRIAKHLEIDTLVDSILDSGDRRLARQRRTTELTRGRDQLEE
                     WFRSNVLQNKMVVETIRAGDIKWDRNNAIFADVLLQADELPEETDEHSNGTLQPENGA
                     NAGTKEQTQKSVLFPCHRAMLLRSEFFHTMFSSPFREAHLKDHLHIINVDCSPDVLEI
                     ILTFLYTESVDFPLEVAVDVLFAADMLFIEKLKTKAAVVISTLGSGNMSQAEAAKTRG
                     TKEEEDLDIYAIIRAAWMTRVQRLEEFAARYLAYRLEAHIDSPEFAELIQESASRIQG
                     RQETDSIELLDDIRFYLGERFRLRFDDAGLEEMMEEEAEQHAPDAIANDETIEKVAHG
                     VEAIDLTDKGSPEVLNNAEHASQEAQENVPVMRNLNGEIVVDEFDKDSMNYHILMDKL
                     DKILESLNLEA"
     exon            369513..369746
                     /number=1
     exon            369849..369934
                     /number=2
     exon            369995..371582
                     /number=3
     CDS             join(386852..387095,387174..387889)
                     /codon_start=1
                     /locus_tag="AO090120000155"
                     /note="predicted protein"
                     /old_locus_tag="AO070250000041"
                     /protein_id="BAE62772.1"
                     /transl_table=1
                     /translation="MDLASLITPGPEPIYKSRASYSPPPSSAGSYKRPAEHDSYFSYS
                     RAPQAPLSPPVEDQPKCSLPSISTLLEGADSASTYAAKRQRTSPPPRRESEFRSPYDS
                     VSTPNGPPTPPLRPESGFHSGHHSPSASSVTSGKAIKLESYSQTPMTLPSPSDRSSIS
                     SQGSVHHVSAAPYASPAPSVASYSSPVESSAPSAMYYQRPSGSYQTPATVPSPSAAPM
                     PASATHQQMITPVTPAWQHHHYFPPSSSAPYQQNHDRYICRTCHKAFSRPSSLRIHSH
                     SHTGEKPFRCTHAGCGKAFSVRSNMKRHERGCHTGRPVATAMV"
     exon            386852..387095
                     /number=1
     exon            387174..387889
                     /number=2
     CDS             complement(join(390709..391794,391847..391974,
                     392025..392097,392154..393044,393095..394006,
                     394079..394546))
                     /codon_start=1
                     /locus_tag="AO090120000157"
                     /note="structural maintenance of chromosome protein
                     SMC5/Spr18, SMC superfamily"
                     /old_locus_tag="AO070250000039"
                     /protein_id="BAE62773.1"
                     /transl_table=1
                     /translation="MPSLATVPRRRQRSEEEDESDDSSSTPGNPTPASNSSKRIRLDA
                     NSSGDEHDTEDTSSGTSDEEEGAENGNNVNGVSKLSKIAKTRNPQPMQNGDGAVQEAY
                     KPGAIVRIKVTDFVTYTSAEFFPGPKLNMVIGPNGTGKSTLVCAICLGLGWGPAHLGR
                     AKDPGEFVKHGCREATIEIELAGGPHFRRNPVVTRTIKRDGNKSSFTINGKTASRTQV
                     LKLAQSFSIQIDNLCQFLPQDKVSEFAALTPIELLNSTQRAAAGAEMIEWHDNLKQLR
                     ARQKKLQADNKSDKDLLTNLEERQEMQRADVERMRQRAEIKRKIEMLELTRPMVKYKD
                     MHNDFKDKRRRKEEIALEYENLKAELEPSLRAVNAKQEYCLQIDNVVSYKKARVEEAE
                     RTASALGKKIEQYEEKMKNLEKEIDAEKKSNANSKEDGMRIQQTINKLNRQLAEGAIE
                     FDADWYNERIREKRREAREIEDKANQIKDDRRPLSEALKEKTDKVTELERHLQRLESQ
                     SGRQEEKLKQLSYESYKAYQWIQTNQDKFEKEVFGPPIVTCSVKDPKYADAVESLLQR
                     NDYIAFTVQCRNDFRTLQRELNIGQKLADISIKTSSVSLDSFRPPLTGDEIRNLGFDG
                     WAKDFINGPDPVVATLCSENRLHQTPIGHRAITDEEFRKIEQGSISSWVAGRQSYQIT
                     RRKEYGPSATSTRVRHLKPAKVWTSQPLDASAKQDLVRNIQVLKDEVRELQEKMDMER
                     ANLQQLGHDFDECERERLELEREKSEKQTALTNYRAIPERIRQQELRLRDIQKIFQDV
                     KTRVLDIRSRQDQLSIEKAEATLEYANAVEHLRVLHEELIKLKIRHIEAFSDLEILKD
                     RNIEHRDRLEAKNNELKDAMQEVKAMSVAVKEMMKQANKVVQLSERQPDLAALLSSLV
                     DHTVDQLEADIDSEKARLELTHGGSSNIIKEFEEREKQIQKLRGKLSEFEAQLAEFDH
                     AINEIRGKWEPKLDEIIKSISDAFSDSFARIGCAGQVTLDKAEDEAGADGEPGGSDFD
                     QWSIQIHVKFREHENLSLLDSHRQSGGERAVSTIFYLMALQSLSASPFRVVDEINQGM
                     DPRNERMVHGRLVDIACAPSENGGGGQYFLITPKLLSGLVYKPGMRVLCIYSGEHMPK
                     DYEQLDFGQAVQRMRAIRDRGRALEDPTQRSNGHVDVHA"
     exon            complement(390709..391794)
                     /number=1
     exon            complement(391847..391974)
                     /number=2
     exon            complement(392025..392097)
                     /number=3
     exon            complement(392154..393044)
                     /number=4
     exon            complement(393095..394006)
                     /number=5
     exon            complement(394079..394546)
                     /number=6
     CDS             complement(join(395048..396021,396077..396370,
                     396429..396842,396901..397051,397105..397142,
                     397197..397289,397338..397540,397768..397868,
                     397925..398396,398455..398499,398549..398571,
                     398628..398682,398752..398876))
                     /codon_start=1
                     /locus_tag="AO090120000158"
                     /note="beta-galactosidase"
                     /old_locus_tag="AO070250000038"
                     /protein_id="BAE62774.1"
                     /transl_table=1
                     /translation="MLISKTVLSGLALGASFVGVSAQQNSTRWPLHDNGLTDTVEWDH
                     YSFLINGQRHFVFSGEFHYWRIPVPELWRDLLEKIKAAGFTAFSIYNHWGYHSPKPGV
                     LDFENGAHNFTSIMTLAKEIGLYMIIRPGPYVNAEANAGGLPLWTTTGAYGKLRDNDP
                     RYLEALTPYWANISKIIAPHLITNDGNVILYQIENEYAEQWLDEETHEPNTSGQEYMQ
                     YLEDVARENGIDAPLIHNLPNMNGHSWSKDLSNATGNVDVIGVDSYPTCWTCNVSDTQ
                     PSFMPEFQGGSYNPWGGPQGGCPDDLGPDFANLFYRNLISQRVSAISLYMLYGGTNWG
                     WHASTDVATSYDYSSPISENRKLIEKYYETKVLTQFTKIAQDLSKVDRLGNSTKYSSN
                     PAVSVAELRNPDTGAAFYVTQHEYTPSGTVEKFTVKVNTSEGALTIPQYGSQITLNGH
                     QSKIIVTDFKFGSKTLLYSTAEVLTYAVIDGKEVLALWVPTGESGEFTVKGVNSAKFA
                     DKGRTANIEIHPGTNNVTVSFMQRSGMSLVELGDGTRIVLLDRSAAHVFWSTPLNNDP
                     AEAGNNTVLVHGPYLVRSAKLEGCDLKLTGDIQNSTEVSIFAPKSVCSVNWNGKKTSV
                     KSAKGGVITTTLGGDAKFELPTISGWKSADSLPEIAKDYSATSKAWVVATKTNSSNPT
                     PPAPNNPVLYVDENDIHVGNHIYRATFPSTDEPPTDVYLNITGGRAFGYSVWLNSDFI
                     GSWLGTATTEQNDQTFSFSNATLSTDEDNILVVVMDNSAHDLRDGALNPRGITNATLI
                     GPGSYSFTEWKLAGNAGFEDHLDPVRAPLNEGSLYAERVGIHLPGYEFDEAEEVSSNS
                     TSLTVPGAGIRVFRTVVPLSVPQGLDVSISFRLTAPSNVTFTSAEGYTNQLRALLFVN
                     GYQYGRFNPYIGHQIDFPVPPGVLDYNGDNTIAVTVWSQSVDGAEIKVDWNVDYVHET
                     SFDMNFDGAYLRPGWIEERREYA"
     exon            complement(395048..396021)
                     /number=1
     exon            complement(396077..396370)
                     /number=2
     exon            complement(396429..396842)
                     /number=3
     exon            complement(396901..397051)
                     /number=4
     exon            complement(397105..397142)
                     /number=5
     exon            complement(397197..397289)
                     /number=6
     exon            complement(397338..397540)
                     /number=7
     exon            complement(397768..397868)
                     /number=8
     exon            complement(397925..398396)
                     /number=9
     exon            complement(398455..398499)
                     /number=10
     exon            complement(398549..398571)
                     /number=11
     exon            complement(398628..398682)
                     /number=12
     exon            complement(398752..398876)
                     /number=13
     CDS             complement(join(399861..400004,400062..400265,
                     400277..400405,400456..400491,400539..400636,
                     400698..400709,400734..400869))
                     /codon_start=1
                     /locus_tag="AO090120000159"
                     /note="mitochondrial carnitine-acylcarnitine carrier
                     protein"
                     /old_locus_tag="AO070250000037"
                     /protein_id="BAE62775.1"
                     /transl_table=1
                     /translation="MASELKANEPNVAVWRETVTDFTAGAAGGAAQVLIGEYHLLYNS
                     YDQPFDLVKVRLQTQNGGNTLPTARNIWAKEGPLAFYRGTLMPLLGVGACVSIQFGAF
                     HGIRQAIESYNTDKRPGHDSTLSIPQYYLAGAGAGHHLGPVEHIRIRLQTQPHGAARI
                     YNGPLGCALKLIGTAGIASIYRGQAVILLREIHGYGVWLAAYEGLIALCGGLAGEALW
                     LLSHPLDVLKSKMQSDGFGAEKKHRNMRDAFRHT"
     exon            complement(399861..400004)
                     /number=1
     exon            complement(400062..400265)
                     /number=2
     exon            complement(400277..400405)
                     /number=3
     exon            complement(400456..400491)
                     /number=4
     exon            complement(400539..400636)
                     /number=5
     exon            complement(400698..400709)
                     /number=6
     exon            complement(400734..400869)
                     /number=7
     CDS             complement(join(400958..401016,401095..401161,
                     401201..401234,401343..401943,401996..402104,
                     402235..402576))
                     /codon_start=1
                     /locus_tag="AO090120000160"
                     /note="predicted protein"
                     /old_locus_tag="AO070250000036"
                     /protein_id="BAE62776.1"
                     /transl_table=1
                     /translation="MSDSCAPSCLDKPSGFNPPLLWLSMSALHVPQTRSCHVCVNPDE
                     QAIRSDSDEIQALYGNTSITQLELVYKIQKILQNLYETGRSFPPALVLDFNRPLQTVT
                     RTGASLYLMLFQALQPLPAALGRLCETCNEAATKSLAILHALKRQQTIPRYGFFDLDA
                     TFSGAFVLVMMGLIDKTRDQPPPALDQAFDVLRFLSRAGNLAAERRLQDITHSCMHVW
                     PNHILGADRQQGEQVDSGSLSAISLSSLGPRGDASVPHTSASAIPPQPPQYTTVAAEG
                     WEQGRDESRLLETWMHPDTANATFDMQVDWDWHLDLSVEAEGIYSSFFDPSLPLTGVD
                     HLDWQEIEKIFNGQNDPYVKVQIHLYSFLRIGGVERCQMTACSPLNSLQGCRYCIFSF
                     GMQYRSIHTSV"
     exon            complement(400958..401016)
                     /number=1
     exon            complement(401095..401161)
                     /number=2
     exon            complement(401201..401234)
                     /number=3
     exon            complement(401343..401943)
                     /number=4
     exon            complement(401996..402104)
                     /number=5
     exon            complement(402235..402576)
                     /number=6
     CDS             complement(join(402837..403387,403435..403473,
                     403539..403560,403583..403612))
                     /codon_start=1
                     /locus_tag="AO090120000161"
                     /note="predicted protein"
                     /old_locus_tag="AO070250000035"
                     /protein_id="BAE62777.1"
                     /transl_table=1
                     /translation="MKSNLVPFRKSHGRIMTSMPYQESDTGISPATDLTSGPAFESQV
                     KSLLDRNHPANSALLRAPGNSGSTEAVTQWTSARPLVSDDAVPTIPSLEESQDLLDRF
                     LFYLGVSQHFFDPRTFSDSMVLLFQDEQTQEHQMHTIWFTEYLLVMAMAKLMDVEDPS
                     SQPPGASLFAEAMRRLPPLHQLGEEGAITVEILTLIATYLQWCDRKHDAYLYV"
     exon            complement(402837..403387)
                     /number=1
     exon            complement(403435..403473)
                     /number=2
     exon            complement(403539..403560)
                     /number=3
     exon            complement(403583..403612)
                     /number=4
     CDS             404802..406148
                     /codon_start=1
                     /locus_tag="AO090120000162"
                     /note="Xaa-Pro aminopeptidase"
                     /old_locus_tag="AO070250000034"
                     /protein_id="BAE62778.1"
                     /transl_table=1
                     /translation="MEEPPFSIPPHSRRIDPTQPRTATFKPDGSDNDNDRVEVGPTPL
                     AFAEWQHLGLQPPHLPTMRAYRLQRICDQLISRDLGGILLFDPLNIRYATDTSNMQLW
                     TAHNPSRACFVAASGYLVLWDFHGCNHLSAHLPLIKETRSGASFFYFETGNRTDEHAA
                     RFCAQVDELLRKHAGNNRRLAVDRIEVAGLRALDALGVEVCNGQAVTELARMIKGPDE
                     IRAMRCAVASCEAAVGEMRQAMRAGATENDVWAALHAGNIRRGGEWIETRLLSSGPRT
                     NPWYQECGPRILRDGDLVSFDTDLIGVYGICVDMSRSWICGDLEPTAEQKRLYRIAHE
                     HITNNIEMVKPGVRFTELTRNGHRLPESCRAQRYSVMFHGVGLCDEYPTIRYPEDLES
                     YGYEGELQAGMVLCVEAYVGEVGGKDGIKLENQLLVTETGYELLTRYPFEESFLRD"
     exon            404802..406148
                     /number=1
     CDS             complement(join(407886..411083,411141..411497))
                     /codon_start=1
                     /locus_tag="AO090120000164"
                     /note="predicted protein"
                     /old_locus_tag="AO070250000032"
                     /protein_id="BAE62779.1"
                     /transl_table=1
                     /translation="MPNIFGLVPMLRRAEAQPDLEVAQGDGASHIPATSGATLLPRPV
                     ASIVSFVTQSTSLSLRVGTFFGGVAIDGARATTLTGLELSRAVIEGVLTRAGRDVATR
                     SSGEHGRVEAESILERSLAALHKSVTSASFFVAATFHFSSTTLSSASNMSQALLSTLD
                     AILGSTESSRAIAAIITLIRREFRNPRVESMTDDNIGVGDLLIGTVGFAMLQRWGRKN
                     TERQIRTNGGEEAIWDVVILDNGVRADVVGMHQIELTRRPRSEFHDETRRSSFISPGN
                     DEEAFDAVQRPASRGDMAEKHPLSLPPGDHQMSDDDIRLYIMKQLPQGCRASIKTDLV
                     TARTITVDIYDDDSAEIAAPPGTMVIEERFRNDQCLGSSGGSSPPQFPKHTVVFRTAF
                     NKSQSADVRLSRGDDISGIYEISSDHGDQSPYLSQGIAITDSLPDAESTVADHRHAKP
                     QDKPIQTIQTEIEDGSHRNSRFPGTNGLGKSSYEPTLLADSNSSKRYSTESTRTASNE
                     ADTISKGSFGKGSLTRIAQKVKPASVERSGQSKRLSVKEKSSTPPVHSVQRSKGSKGY
                     VPERKPSAPKQSPKPTAEAKSEKPPLPSKARVSSVANRGSPRSPLQSSRLSVPSTARG
                     TSVREMPPERGPMPEFYAIHEKNEESFMKQTDAYSTNVRPRSSAGVRTHVRSSSSMSV
                     TRSEADMSVSVNDGRPSSSHLHRSSHTFTPSIYSLATAGSETSLILAHRSRKSAYDDM
                     ETIQALSRDGLVPGIFPEKHFVQNIRRFLRFSSASYGSNALKVMGVPPTTKALAYQES
                     DSREHSDFSDHTGLPASTILLSSFVDPAGGSKAAGETETGFPLVHYLFLDHESKAVVL
                     TLRGTWGFEDILTDMTCDYDDLEWQGKSWKVHKGMHASAQRLLMGGGGKVMITIRAAL
                     EEFPDYGVVLCGHSLGGGVAALLATMISEPTNDGYGTSFVTASYQATAQRLLLTGSSD
                     TNQTACFLPSGRPIHVYAYGPPAAMSPFLRRATRGLITTIVNGHDVVPSLSLGILHDM
                     HTVSVAFKSDVSGTKSHVQGRVWNSLRQSIVNKFYVNEPPIVQHAGDGIGEDAWAWKT
                     LKMLREEMLAPKLMPPGEVFVVETMRVLQRDAFTSGMGDDGHPRLGRPATRVQLKFIR
                     DVESVFGEMRFGSGMFSDHNPARYEASLAALSRGILDD"
     exon            complement(407886..411083)
                     /number=1
     exon            complement(411141..411497)
                     /number=2
     CDS             complement(join(412077..412414,412473..413115,
                     413172..413193,413246..413454))
                     /codon_start=1
                     /locus_tag="AO090120000165"
                     /note="glycolate oxidase"
                     /old_locus_tag="AO070250000031"
                     /protein_id="BAE62780.1"
                     /transl_table=1
                     /translation="MPERYGDYQSVIYGRGAIESVQPNVTTDPRLLEEQARKALGVRS
                     FNYVAGGAGEKATMDSNRLAFRQWKIIPRMLRQVDNQDLSVELFGQKYPNPVLMAPVG
                     VQSLFHEDKETGLAESCAEVGVPYTLSTASTSSIEEVAETNGDGKRWFQLYWPQDDDV
                     TLSLLKRAKDNGFSVLVVTLDTWSLAWRPADLDNAYVPFIKGVGNQIGFSDPVFRAKF
                     EKESGSKLEEDIVGASRAWISDVFPGRPHTWEHIAFLRKNWDGPIVLKGIQHVEDAEL
                     ALQAGCDGIVVSNHGGRQVDGAIGSLDVLPEIVEAVGDKMTVLFDSGVRTGADVVKAL
                     CLGAKAVFVGRPVIYGLAINGREGAKSVMKGLLADLWQTMSLSGICTVAECTRDRVRK
                     VQYPGDMKAMM"
     exon            complement(412077..412414)
                     /number=1
     exon            complement(412473..413115)
                     /number=2
     exon            complement(413172..413193)
                     /number=3
     exon            complement(413246..413454)
                     /number=4
     CDS             join(414729..414921,415015..415115,415172..415319,
                     415371..416416)
                     /codon_start=1
                     /locus_tag="AO090120000166"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070250000030"
                     /protein_id="BAE62781.1"
                     /transl_table=1
                     /translation="MEYRSEPKPDVESPRQGNTMMVPQDTDTGSSFLEGESEKHLLWK
                     IDIHILPMVVLLYLFSFLDRVNIGNARLYGLEDDLGLVGNQYQVAVSILFVTYCLFEV
                     PSNLVLKKLRPSRYIASISVIWGIIATLTGITQNYGGLIACRLLLGVVEAGLFPGLIT
                     YLTLFYSKRELALRTGYLFSSAAAAGAFGGLLAYAIGFMDGISGLRGWRWILILEGIP
                     TVLLGVVAWFVLADEPDTAYYLNEEEKALVLRRRMRYVGQTASAQKFHWADVKEGALD
                     WRIWAFSIAQFGIDTMLYGYSTFLPTIIKGMGSWSTPEVQALTIPCYALGALAYLVTA
                     WVSDRTQRRGLFICIFSAVSVVGYGILISDTSSGVHYFGALLIALGLYVAVGLPLAWL
                     PTTLPRYGKRTFATGLQLTFGNISGVMSPFLYKNNEAPRYVRGNAVTLGLVGFAGIVY
                     GLMWFYYHQKNMRRVQGFEDEKVAGMTDEEIEELGDKSPRFIYST"
     exon            414729..414921
                     /number=1
     exon            415015..415115
                     /number=2
     exon            415172..415319
                     /number=3
     exon            415371..416416
                     /number=4
     CDS             join(416804..417094,417184..417229,417289..418051,
                     418114..418507)
                     /codon_start=1
                     /locus_tag="AO090120000167"
                     /note="multiple inositol polyphosphate phosphatase"
                     /old_locus_tag="AO070250000029"
                     /protein_id="BAE62782.1"
                     /transl_table=1
                     /translation="MLNVTSPWALILSLLTAIVSISYYNNNPSAPEIRSPHCASWNAW
                     YNPLRSGQVGYQANDWNILYHLGGNGPWIEKIDELETPGLEPPKGCVIDQVHMISRHG
                     ERYPTKSAGSRHLALLNRIKEANVVLNGSLSFLNNWTYFTDEPQKDFDQLTKTSPYAG
                     TLQAFSTGVRFLTRYGHLLPLHGTTRLWASECNRVIETAQHFASGFFGLDWEKTEKAA
                     LEIIPETLERGADTLTPGDTCPKYIEDPAKGHDNGVNMLALFQDVYIPAIAERLINDE
                     NNSALGYLTNLEVYGMQEMCGFETLSRGSSPWCDIFTHDDWENFEYARDLIHYYRAGP
                     GNPYAGAMGWLWLNATTGLLRSGPEAGTMFFSFVHDGDIAPLVTAMDILKDPKYDPFL
                     PTTHRVEDRVWRTSSVMPMGGRIVFERLTCPTSSAKDPSGEEAFLRVNINDKIVPLPY
                     CKSGPGLSCPLKEFVDHVERRRSEVGDFGEVCGLEKDVGYITFLRQG"
     exon            416804..417094
                     /number=1
     exon            417184..417229
                     /number=2
     exon            417289..418051
                     /number=3
     exon            418114..418507
                     /number=4
     CDS             join(418975..419057,419139..420288)
                     /codon_start=1
                     /locus_tag="AO090120000168"
                     /note="predicted protein"
                     /old_locus_tag="AO070250000028"
                     /protein_id="BAE62783.1"
                     /transl_table=1
                     /translation="MEYHFVPPEERAKDDKGNLLPWGYVYKDESRNPRRPPEESGPFG
                     KRRNARYDHARSRTRTGTPAKKENPNVAEFGRLFAMQQEEEKTRSNTLPKSTSSSNLD
                     NARKQTDKVATECILYGYKSKDSEWKVIDKYERVSRGVICEDYPRSDPNSTSGYSQLL
                     SGGDVVIHSNLSADANRKSKRYAGGFHWIKVTFDSTIAADRACFYSPQEIDGHFVFCE
                     LYHGQGPAEDVPILADSSAAEQQKSKATRTLTTSRSTNFLQTNERSTLPRSFTVNNLS
                     SVPDTEEGQSLGSTPTASSTTATGVDVPSTASLQQRNIPQEPKPESEFMTHIPTVRRA
                     KLRPINEALPPQPTVTERVLRSIPILSWFTGDIVGDGPQLKEDGTFDYDKSNTYWRFW
                     YMIDMVLGTDICGLREES"
     exon            418975..419057
                     /number=1
     exon            419139..420288
                     /number=2
     CDS             complement(join(421100..421347,421493..421823,
                     421856..421867))
                     /codon_start=1
                     /locus_tag="AO090120000169"
                     /note="RNA polymerase II general transcription factor
                     BTF3 and related proteins"
                     /old_locus_tag="AO070250000027"
                     /protein_id="BAE62784.1"
                     /transl_table=1
                     /translation="MLNRSPSGTAFDHENGKLTHTYPQCIISPSSSHTRSTPNSYKPD
                     HESTRLTNSLKNRGKGTPRRKVKKVHKSSGADDKKLQATLKKMNVQPIQAIEEVNMFK
                     EDGNVIHFGAPKVHASVPSNTFALYGNGEEKELTELVPGILNQLGPDSLASLRKLAES
                     YQNMQKNQAGAEGKKDDDEDDIPDLVEGENFESNVE"
     exon            complement(421100..421347)
                     /number=1
     exon            complement(421493..421823)
                     /number=2
     exon            complement(421856..421867)
                     /number=3
     CDS             complement(join(423240..424081,424162..424348))
                     /codon_start=1
                     /locus_tag="AO090120000170"
                     /note="dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /old_locus_tag="AO070250000026"
                     /protein_id="BAE62785.1"
                     /transl_table=1
                     /translation="MSLYQNIALNGSFALHGLRHPLDMYSSLGPTLSEATFGLLGYSF
                     EPSRDIGDLSGKVLFVTGGNAGLGKETVLQLAQHNPSRIYLAARDATKAREAISSIQD
                     IISASVDIRHIQLDLSSFQSTRDAAEKFCSECDRLDILILNAGTMANPPELTKEGFEI
                     QFGTNHIGHFLLTKLLLPTLKKTVGSPASDVRIVTLSSVGSHAAPSLDVMTSTSALLD
                     SHTLVRYSASKAANILFASELARRYPEILSVSVHPGVVSSELYRHTGAMNAISKFGVG
                     LLSTVFRSIRTGAMNQLWAAGTKREQLVNGAYYVPIGVRGSSRFTDDADMARKLWEWT
                     ENQIAEKS"
     exon            complement(423240..424081)
                     /number=1
     exon            complement(424162..424348)
                     /number=2
     CDS             join(424962..425003,425066..425084,425176..425256,
                     425305..425798)
                     /codon_start=1
                     /locus_tag="AO090120000171"
                     /note="predicted protein"
                     /old_locus_tag="AO070250000025"
                     /protein_id="BAE62786.1"
                     /transl_table=1
                     /translation="MRFLCLHGSGTSGEIFEIQSGGISQALEAKGHRFTYIDGRLDSE
                     PEPELKGILDPPFYKHYPRDIAPGEDLARAIEYTMDIIKKKGPFDAVMGFSQGAALAG
                     SMIINHAKTHDVPLFKAAVFICGAAPYESSGKETIQPTPGEYLVNIPTTHIVGKQDEI
                     YDLSMQLYGLCEPSKAEFYDHGSRHLIPFDGKNTEAMIAAIEKTIKRARTG"
     exon            424962..425003
                     /number=1
     exon            425066..425084
                     /number=2
     exon            425176..425256
                     /number=3
     exon            425305..425798
                     /number=4
     CDS             complement(join(426070..426169,426223..426611,
                     426673..426726,426789..426863,427001..427105))
                     /codon_start=1
                     /locus_tag="AO090120000172"
                     /note="lysophospholipase"
                     /old_locus_tag="AO070250000024"
                     /protein_id="BAE62787.1"
                     /transl_table=1
                     /translation="MATRAPFVVPALKKHTATVIMAHGLGDRFGAYACKNWRRRGLFE
                     EVTFIFPNAPMIPITVNFGMSMPGWYDLSKLGRDLDFEEAIRSQDEPGILRSREYFNT
                     LIKEQIDQGINPSRIVLGGFSQGGAMSVFTGVTNKEKLGGVFGLSCYLLLSDRIKNQI
                     PEDWPNKKTPFFLAHGTDDDVVKYEFGKTSSKLLQDLGLENVQFNSYSDLGHSADPQE
                     IEDLEKFLQQVIPAEGEVSAGL"
     exon            complement(426070..426169)
                     /number=1
     exon            complement(426223..426611)
                     /number=2
     exon            complement(426673..426726)
                     /number=3
     exon            complement(426789..426863)
                     /number=4
     exon            complement(427001..427105)
                     /number=5
     CDS             complement(join(428756..430111,430168..430194))
                     /codon_start=1
                     /locus_tag="AO090120000173"
                     /note="predicted protein"
                     /old_locus_tag="AO070250000023"
                     /protein_id="BAE62788.1"
                     /transl_table=1
                     /translation="MDQFPKLRPVGRIELCSTARHHLRFYYNVAVAATYSLPGTFTLP
                     IKDYVYKACEILIAQHPILSAVPIGEETKDPYFARLPSIDLSQSVFFQKREHGFPDAE
                     DRDEDLDTLLSTQHNTPFELPLPFWRIFVLTDDADDTERRFTVVFVFHHAISDGTSGK
                     VFHRSFLQALQSLSSLAVDDVKEVIPSPDSSLLPPGEAVHPKPVSYTYLAVQLFKAKI
                     YDPRDPGLWTGSEVKLPLETKLKHIVFPKHLSSTFRDRCRENKTTITAALQTIIARSL
                     FTHLPESSTKVRCSGAMSNRHWLPGPITEDSMGVFVQEYTEDYSRKDLSETSFPWSVT
                     VRSRATIERELSKEGRDTSANLLRYVNDYHNELYLSKVGRPRSSTYEVSNVGAFTSTT
                     PAEGMPRVGRVVFSQSASVTGNAFEVSVASGGDGCLVLMFTWQKGVVEDLFILNVIES
                     VRKEVYDLCV"
     exon            complement(428756..430111)
                     /number=1
     exon            complement(430168..430194)
                     /number=2
     CDS             complement(join(430733..431008,431066..431482))
                     /codon_start=1
                     /locus_tag="AO090120000174"
                     /note="predicted protein"
                     /old_locus_tag="AO070250000022"
                     /protein_id="BAE62789.1"
                     /transl_table=1
                     /translation="MKLSILSLASLAPLVSAHFKLNYPTSRGFDEDKMSQFPCSGLSQ
                     SSERTKVSLSAGDFPVALTMGHSQTAVEVLLALGNDPGTNFNITLHPTFRVEGLGAFC
                     LPNVTFDESIVGVKLTDGMNATLQVQSNGDPSGGLYACADIQFTDVDYSAPSSCSNNT
                     GVKATSFTGDAAKRNANESTADGEAQSGSSSSSTSSSSTGSATSTAGAVALETAAWGM
                     LGAAVVGGMAIL"
     exon            complement(430733..431008)
                     /number=1
     exon            complement(431066..431482)
                     /number=2
     CDS             complement(join(432409..432523,432584..433047))
                     /codon_start=1
                     /locus_tag="AO090120000175"
                     /note="predicted protein"
                     /old_locus_tag="AO070250000021"
                     /protein_id="BAE62790.1"
                     /transl_table=1
                     /translation="MDMSSMDHSSSSSSSSSSSMTMSMAMVFVNAQDTPLFSNQWTPS
                     SSGAYAGTCIFLIILSIIGRLLVAFKGVMEQHWLNAHLNRRYVAVAGKSTEAGRIDAD
                     PDAKVASLVSAQGVEESVKVVRRATHEPLPFRFSVDLPRAFLFLLITGVSYLLMLAVM
                     TMNIGYFCSVLGGAFLGELAVGRYIQWNEHSH"
     exon            complement(432409..432523)
                     /number=1
     exon            complement(432584..433047)
                     /number=2
     CDS             join(433899..434062,434120..436088)
                     /codon_start=1
                     /locus_tag="AO090120000176"
                     /note="ferric reductase, NADH/NADPH oxidase and related
                     proteins"
                     /old_locus_tag="AO070250000020"
                     /protein_id="BAE62791.1"
                     /transl_table=1
                     /translation="MSMGGMDMGPMGHMSMGDGVPGLFYLQKMYWAVVGSAIAAGTVV
                     NAFNNFLAFQRLRDSTLTPSKPKSLFFITCATLTAIVREASYATLPPWSLGGRIIHFA
                     PLGPLAIILANLVVVLVFCFYKLDTTDQWKWEDVGYRTGFVAIAQLPLIFLLAGRQNI
                     IGLLVGMSYERLNWFHRWISRTLWLTVTIHMGFWFRSWGRYDYITYQLKNDPLSKRGF
                     AAWCILTFIVLSSMAPIRRLSYEFFVLQHLVTFVGFIVAVWLHAAEEVKVWVWISIGL
                     LVFDRVARYAWATYANLSIFHRSTSNTKHALWANRASFTPLPGNVTRITIDNPGIRWE
                     PGQHVFLTCHSIVPLQSHPFTIASISADNKMEFFVRSEKGGTRRFFRYASKHHHVLGS
                     RDTSPVKPARAVFIDGPYGKMRPLRQFDSVILLAGGMGVTFVIPCLRDIVSRWKMECL
                     GDNEQSKKSPRLTPTKRIRFVWVIKSRAQLSWFETQLQSVLSDVEECRRAQPDINREI
                     ELSIYVTCDEKLEPQPQPAQPLCSQAQPESTIVGTRQDANSIELAAVTDEKRSKKDDV
                     SIHSISNVSSGDSTPQSGCLPNGGCCCTTAIEDEDNNSITVHNCSCSGHAAASQAPGP
                     EPEKLDVKAAPIKVPELPMFSGRPQPRTIIRKVLEKAEGESAVVVCGPQGLSDDVRRS
                     VVYLSDERAVHKGTGAQGIYLHAEKFGW"
     exon            433899..434062
                     /number=1
     exon            434120..436088
                     /number=2
     tRNA            436347..436438
                     /locus_tag="AO090120t00002"
                     /note="tRNAscan-SE"
                     /product="tRNA-Arg"
     CDS             join(438015..438083,438199..438657,438720..439040,
                     439096..439390,439444..439472)
                     /codon_start=1
                     /locus_tag="AO090120000178"
                     /note="predicted protein"
                     /old_locus_tag="AO070250000018"
                     /protein_id="BAE62792.1"
                     /transl_table=1
                     /translation="MGRTVDQEVHAAFVEFRAKEDDKIRAKNTSRQKQHLLECPGLRG
                     HTNPQAQSQTAQSAPNGIGATNGYPPTPNGATATAPGAGPGPGALPTPNGPMMTNGVN
                     PHATPMQTPLQNMQGRASLPTSGPTGTSSAPPSQQAPRATPKSKPKTSSSSLPAPPLD
                     DVHAAFVEFRAKEEDKCLSVQCIYCQQVRAKNTSRQRQHLLECPTYLSVMKDSIPANN
                     LLHTFPEGDVARSLQIPAPTLELDFRMSIKMNPKVAVGQSLWGQRDWVTFVGGQWAGR
                     WGKGIVLPGGQDSQIVTKESATSLRASYMLQTADDPPAFIIVKTNGWLTGAKDVLDKV
                     NDPGVADTINPNTYKYRINLTMETGDERYAFLNTLMWVGSGCRRGHEVIFDSFRVN"
     exon            438015..438083
                     /number=1
     exon            438199..438657
                     /number=2
     exon            438720..439040
                     /number=3
     exon            439096..439390
                     /number=4
     exon            439444..439472
                     /number=5
     CDS             complement(join(440363..440373,440968..441221,
                     441272..441695,441745..442157,442214..442502,
                     442559..442967))
                     /codon_start=1
                     /locus_tag="AO090120000179"
                     /note="isocitrate lyase"
                     /old_locus_tag="AO070250000017"
                     /protein_id="BAE62793.1"
                     /transl_table=1
                     /translation="MFRSIPRRIPRRLPTPSSTSRLALRSFTCGYPRMSVPPLSAVEP
                     PVSTALPCDSYQLLSTADKAGAAEDALYEQQIKDVEAWWKSPRFEGIKRPYSAADVVS
                     KRGSLQQTYPSSLMARKLFNLLNERAAEGKPVHTMGAIDPVQMTQQAPNQEVLYISGW
                     ACSSLLTTTHEVSPDMGDYPYNTVPNQVQRLFKAQQLHDRKNWDARRKMTPEERKSTP
                     YVDFMRPIIADGDTGHGGLSAVLKLAKLFAENGAAAIHFEDQLHGGKKCGHLAGKVIV
                     PVGEHINRLVAARFQWDMMGSENLLIARTDSESGKLLSSAIDVRDHEFILGVTEETEP
                     LAETLQAMEREGAAPAEIDAYEMDWVKSHKLVTFDEAVDAHLEREGAAQSVRDAYKKR
                     VQENPDLSITRRRALANDYTKTPVVWSWDIPRTREGYYHYKAGFPAATKRAKEFAPYA
                     DLLWVETGNPNVEKAAKLAGDVRSAFPGKKLVYNLSPSFNWMGQGFTEETLKSFIWDL
                     APHGFVLQLISLAGLHTNATVTTELSRAFKDEGMLAYVRQVQAREKELGVEVLTHQKW
                     SGAPYMDGILGAIQSGNSSNKSMGDGNTEKEKI"
     exon            complement(440363..440373)
                     /number=1
     exon            complement(440968..441221)
                     /number=2
     exon            complement(441272..441695)
                     /number=3
     exon            complement(441745..442157)
                     /number=4
     exon            complement(442214..442502)
                     /number=5
     exon            complement(442559..442967)
                     /number=6
     CDS             join(443743..443908,443964..444421,444515..444547,
                     444636..444897,444952..445143,445207..446087)
                     /codon_start=1
                     /locus_tag="AO090120000180"
                     /note="asparagine synthase (glutamine-hydrolyzing)"
                     /old_locus_tag="AO070250000016"
                     /protein_id="BAE62794.1"
                     /transl_table=1
                     /translation="MCGLTAFLTVGGIPGCVHYANNCPGLEKQLEESLDLVNHRGPDA
                     RGRWFSTDHRVGLGHVRLSIVDLSSAGNQPFHDSEGAIHAVVNGELYDHEEHRTELAQ
                     EYDFKSNSDCEIVIALYRHYGISFLNKLRGEFALVLYDANRKLFLTARDRYGIKSLYY
                     TMVGNRLLVATEMKSFLPFGWKPEWDVTAIREGAWMNGSQMLFKGVQRYMVSQNFNPP
                     ERTVYPHSEEEVIERVRELMLDAVRVRLRADVGLGIYLSGGLDSSAIAGMAVKLVQEG
                     TKLGNDTSGERSKIDCFTVQFEKDSGFDESDIARRTAEWLGVGYHPVYLDEEAIAARL
                     EDTVWYSEIPAANVNGMGRLAVAEAAHAMGKKVILTGEDSDEHFSGYSDLLPNFLLEP
                     DYSWPQSLAKQSDFAEAWKVMEERNQILAMGMDEVAGPTKRMLNNTTLCARLSTFTTL
                     PYSSWTDQLALRSPATAFAENFGVQVLHKMMEKWHPLHSTQYQWMKSVLANYILRYIG
                     DNVDMVHQIETRPPFLDHYVTEYANNIPPSLKIKYDPESKTFREKNILREAMKPFVTE
                     EIYNRTKHPFVGPFTYQEDGPVHKSLKRLLTEENVNQLGFFDNDRVQSNLVKAFRDKD
                     GVCFQRALAVAQYVVLGQRFGVKKAQDPGCSETSSGPYV"
     exon            443743..443908
                     /number=1
     exon            443964..444421
                     /number=2
     exon            444515..444547
                     /number=3
     exon            444636..444897
                     /number=4
     exon            444952..445143
                     /number=5
     exon            445207..446087
                     /number=6
     CDS             join(449517..449537,449596..449656,449714..451669,
                     451789..451808)
                     /codon_start=1
                     /locus_tag="AO090120000182"
                     /note="predicted protein"
                     /old_locus_tag="AO070250000014"
                     /protein_id="BAE62795.1"
                     /transl_table=1
                     /translation="MRRVKANWRPFEETNVAGRVSTAKIKKADSSPPSRRENLSISTS
                     SPTTEHSAAQVKDQPAASQSLPLDASDFAQFLAPQLNGSSSPSNKRRVTQKNLSFCAD
                     SLLDNTDVAHIDEDVFVPPLEEIVPPDESPWPSDISLPTAEFDTSPGETTLAIPGEET
                     VHESDDFSFAALLEGDTEDLEAIVRQSDPSVSPNLFQFAGTSVSPRSRHTDISLGLFK
                     EPAISAGSPERLILHFDRYTCGILSVKDGAHENPWRTLIWPLAKDTPALYHAIFSLSA
                     FHCSKKNPSLKVYGVEHMRRSIACMVQDIQNMRADAALATSLALAFADTWDRDTRSCI
                     QHLRGAKALVAQVVGLGLQAGLCAADLDRIRFLYNTWLYMDVIARLTSLEESGDQKID
                     LSILQLPKGAVHEIDPLMGCATTLFPLIDRVAQLIQRVRKTNSNSISLVSEAIELKRH
                     VEQWEPPDWFEPPEDPTSEVQHSIQIAHAYRWATILYLHQAVPEMPCEPASELAKRVL
                     LLLATVPPSSRTTIIQMFPLLAAGCEADQEEDRQWVLGRWRSIQTRLMLGSIDRCIDV
                     VHEVWTRRDQFEAEKQRRQFRGAGRSNSLDDREPVGRDGLPYRNMVHGDLNNPAMFAK
                     ESYRRPAADDRAISSRGTGNPRRSSAVSPLENIEFEKTVRGNLHWVSVMQEWDWEVFI
                     TLL"
     exon            449517..449537
                     /number=1
     exon            449596..449656
                     /number=2
     exon            449714..451669
                     /number=3
     exon            451789..451808
                     /number=4
     CDS             join(453898..454045,454120..454231,454331..454490)
                     /codon_start=1
                     /locus_tag="AO090120000183"
                     /note="predicted protein"
                     /old_locus_tag="AO070250000013"
                     /protein_id="BAE62796.1"
                     /transl_table=1
                     /translation="MDLVTKWGHFSKEYKQRRKSTSSTEEHKGGEEHKGGEEHKGGEE
                     HEEQRAFNWLLGKFGRPHNDHPDRRSSGAGNMATDIDEWRRSQKKSTSSQQGVPDLKS
                     QEGVSDLRPQEGVSDLHPQEGISDLRTHEQVSDLRRQ"
     exon            453898..454045
                     /number=1
     exon            454120..454231
                     /number=2
     exon            454331..454490
                     /number=3
     CDS             join(457698..458271,458328..459642,459696..459780)
                     /codon_start=1
                     /locus_tag="AO090120000185"
                     /note="NDR and related serine/threonine kinases"
                     /old_locus_tag="AO070250000011"
                     /protein_id="BAE62797.1"
                     /transl_table=1
                     /translation="MTLNFARESSDRPALRLPNPPPLLHTRSGNETLDRPSTPSQNGF
                     TSPIQTPQGSPSKNRFPPGALDLPNVFDKAMKLNPTSPNKGTYDHYSHPMFSPKKSVE
                     DFSESVIRQPPGSPTRKANKENTPPSPTRVGKDLGPNPAAAAISRHQTYQPRDVESIQ
                     RRQVQMRGLTPEEMEKLQNPRVKRLVNVTQLYFLDHYFDLLSYVHNRQTRYSQFRNAY
                     PEPPATPMDDYEPALLKYLGRERAHLRKRRTRLRQHDFQILTQVGQGGYGQVYLAQKK
                     DTREVCALKVMSKKLLFKLDEIRHILTERDILTAAKSEWLVKLLYAFQDEDQIYLAME
                     YVPGGDFRTLLNNTGVLHNRHARFYISEMFSCIDALHALGYIHRDLKPENFLIDSTGH
                     VKLTDFGLAAGMLNPGKIESMRVKLEEVGNTPVPFGRPMEQRTMAERRQGYRTLRERQ
                     VNYAKSIVGSPDYMAPEVLKGEQYDFTVDYWSLGCMLFEALAGYPPFAGATVDETWQN
                     LKNWQKVLRKPVYEDPNYFLSRRTWDLITKLVASKEKRFKNIHEIHAHDYFAEVDFNR
                     LREQRAPFVPELDSETDAGYFDDFTSEADMAKYKEVHDKQRALEEMAERDEKMGKGLF
                     VGFTFRHRKPAMDGGRSSPRKPIATDGSFGTMF"
     exon            457698..458271
                     /number=1
     exon            458328..459642
                     /number=2
     exon            459696..459780
                     /number=3
     CDS             complement(join(460066..460152,460227..460559,
                     460727..460741))
                     /codon_start=1
                     /locus_tag="AO090120000186"
                     /note="predicted protein"
                     /old_locus_tag="AO070250000010"
                     /protein_id="BAE62798.1"
                     /transl_table=1
                     /translation="MVFRFPKTLDPITLFHSPSAPASQNALKTLQRALAAAEAGEPQT
                     TKRGEFQLEVTTEAPTTDQLRNILDYVTADPAGAGSNRVVYGVEQVVKGARDAEDALK
                     KFKENGAQGIVRPITVDWTNGRAVLGDNESEILKMVHQLDVD"
     exon            complement(460066..460152)
                     /number=1
     exon            complement(460227..460559)
                     /number=2
     exon            complement(460727..460741)
                     /number=3
     CDS             461669..462775
                     /codon_start=1
                     /locus_tag="AO090120000187"
                     /note="C-3 sterol dehydrogenase/3-beta-hydroxysteroid
                     dehydrogenase and related dehydrogenases"
                     /old_locus_tag="AO070250000009"
                     /protein_id="BAE62799.1"
                     /transl_table=1
                     /translation="MSSIGPVLVTGGNGFIAYHIIAKILEEEPDCSIHSIDVNIDRNR
                     HPNPNVHYHHGDLACVEDVQRIMQIARPVTIFHTASPEFSDAPESAYQRIIVDGAHHL
                     LNAALKVNTVQALVNTSTPGVINDNHTDLIDATEEMPMLRPPQQKRVYCIAKADAEDA
                     IQAANRNGGQDDRGILTCAIRPGLVFGERDVGSLGKMFAVARQGKTRFQIGNGQNPYD
                     FIYVGNLADAHLLAAHALLNAWGKPPPADASTRVDGECFHLNNEDPWLFWDFQRAVSA
                     LAGNPIRPEDIVVIPKWVGLTLGFVNEWVAWIISGGTRPANMTREGIRFSTLIRTLNG
                     NKAKRVLGYRPKVGMQEGLERSVRWFMENAEREA"
     exon            461669..462775
                     /number=1
     CDS             463192..463764
                     /codon_start=1
                     /locus_tag="AO090120000188"
                     /note="predicted protein"
                     /old_locus_tag="AO070250000008"
                     /protein_id="BAE62800.1"
                     /transl_table=1
                     /translation="MDPDASITPDQPPVFNYILSFLLVGVAWGFTTPFIRRAAADFNA
                     RQEQLSQGQPQAQAQASQEPETDAQELQQTNPDHEPAPTPDSEPSDEEDDEDHPLPAA
                     GTQQQQQQQPAWMRPSQSWLKTKITTIFWTVINLLRTPAYSVPLIINLTGSIWFFLLV
                     GKHGMLLCLLYFLWLLSQLRLLGLCTILPS"
     exon            463192..463764
                     /number=1
     tRNA            complement(464078..464148)
                     /locus_tag="AO090120t00003"
                     /note="tRNAscan-SE"
                     /product="tRNA-Gly"
     CDS             join(464556..464710,464759..465332)
                     /codon_start=1
                     /locus_tag="AO090120000189"
                     /note="predicted protein"
                     /old_locus_tag="AO070250000007"
                     /protein_id="BAE62801.1"
                     /transl_table=1
                     /translation="MAEIILYDLACTKNVCFSPVVWRIRLMLNYKRIPYRTIFLEFPD
                     IEPTLKGLGILPSESTSTSKPKYTVPAIQHVPTNTYIMDSASIAHFLESTYLDPPVPL
                     TSELGREIEAKSRAVVGPIFFTSVMPREIGILSPRAQEYFRRTREASLGHRLEDLLDL
                     DKEEQSWDAVEDDVRAVGELMQMNRADGPFLLGARPTYTDFFIAGSLQSARVVEESVF
                     RRFFGYPGYREVYEACLPYMEKKD"
     exon            464556..464710
                     /number=1
     exon            464759..465332
                     /number=2
     CDS             complement(465630..467714)
                     /codon_start=1
                     /locus_tag="AO090120000190"
                     /note="predicted protein"
                     /old_locus_tag="AO070250000006"
                     /protein_id="BAE62802.1"
                     /transl_table=1
                     /translation="MGNELDNSGTGPLKVPGFNNHPLELTLDCEDRFHDTVPMDWFSS
                     PLTARELAMLNLMETLTDRPGWYNLIFDKHTVTKWKEEAMTRPIISRKAWDWCLAELR
                     DKAIRFKETGQILVLNSGSAVCKSDTIIPSSVGLKIQQFVSNLSDECGDGKDWEPSSN
                     KQIWNIIDPSLFPLVYGQTRVLVNGGCVPLEQTLETYGQGEVAPRHDQEREILEEFPD
                     SDDNARSLLFSHRFQWLPCEVEFCGPAGSTDVQITSYINNLHPSRHRSFYKTLEGVVS
                     RVIEPWNETLIKGTPIDSSLSSPPGRAPRRIQTFGVEWRNEYPKWAEDLPTEWDGDLE
                     AYRNALARVRDYVALPEYGVKVEWDGLETKEIPQDWESTVSLKDVVDAKYTRLFRFEH
                     SDPGLYSYEEWKAGKTAKSIVGPTEHDIQWEIDPKVWSSLHDMKDPMDRYKILEGSRK
                     RCRDHNYYTVKLQETFRDKGLQIIVKLEGIELTPESPSYPGEDWHTDGLLNEHIVGTA
                     VYFFDMENVTGSRLSFRQEIEMNPGVYQFEGWDVPYLEKLFGVKDETPAFQELGSVSI
                     GQGRLIVFPNAIHHRMEPFELISKCRAGHLRFLTLWLVDPYYRICSTRNVPPQRHDWW
                     AEEAQSLVTSAHSLPQELATMVINETHKWPMDLTEAQQHRLERGKDSAIAHGAMEYLN
                     QDAEINLFKPMY"
     exon            complement(465630..467714)
                     /number=1
     CDS             complement(468112..468900)
                     /codon_start=1
                     /locus_tag="AO090120000191"
                     /note="predicted protein"
                     /old_locus_tag="AO070250000005"
                     /protein_id="BAE62803.1"
                     /transl_table=1
                     /translation="MKYFLLILSCLLLLTETALASNTAGPAETLFFYNAYLIEFKTVS
                     NPKQRKLAKGCVGAQSPTPCTYKNFVKHILYRGEKLQVEDAKFRDTLDNAGTAGITET
                     SKRLRERGFKCVYDLSRLVEGAGKATPFSKVFEAVEEQIKEKLSFSSVESERNNMKTA
                     LKLIEQNRVADNMKYFIKELETRMGIEFVKSPRTTDDGRAWQAYETKETASKYPDHDN
                     LSKEAQDIVRKLRDGKIVVKDWSFPSHQAVIVKVKDLQKLINKC"
     exon            complement(468112..468900)
                     /number=1
     CDS             join(471134..471668,471746..472368,473948..473977)
                     /codon_start=1
                     /locus_tag="AO090120000192"
                     /note="predicted protein"
                     /old_locus_tag="AO070250000004"
                     /protein_id="BAE62804.1"
                     /transl_table=1
                     /translation="MKLAKEAHIDAFALNFAASLTDMYPLASAFQAAESTGFKLFLSF
                     DYAGAGPFEESVVIGIIKIFSSHSAYYKYKGKPFVSTFEGPGNAKDWEEIKEKTGCFF
                     VPSWSSLGAKDALELGTADGLFSWAGWPWGNKDMDTYVDASYLDYLDQDYGKPYMMPV
                     SPWFYTNLPGYDKNWLWRGDNLWTDRWEQVMVVQPSWLQIISWNDYGESHYIGPLRDI
                     DNYEAFKVGKAPFNYAHGMPHDGWRLFLPYWIDMYKKGKGTITKEGVVGWYRPNPVAA
                     CKNGGTTGNTASQLQLEFEPAQVVQDKIFFSALLTSSATVTVTVGGVSIPATWEFIPD
                     GGVGVYHGSAGYGAFLGDVKISISRSGATIAEFSGTAITTSCKDGYSNFNAWIQSQHP
                     WSS"
     exon            471134..471668
                     /number=1
     exon            471746..472368
                     /number=2
     exon            473948..473977
                     /number=3
     CDS             complement(join(475791..476224,476284..477057,
                     478834..478993))
                     /codon_start=1
                     /locus_tag="AO090120000193"
                     /note="checkpoint kinase and related serine/threonine
                     protein kinases"
                     /old_locus_tag="AO070250000003"
                     /protein_id="BAE62805.1"
                     /transl_table=1
                     /translation="MPFFPMGTGIQAENDTNTVSGAVPLSPATQVKNRRKRYLDTHPE
                     YFSADLELAATSSLKNLRLLLSQITSKYTPQVPITMPHLTIQDEIKKLRCSDSPTVTR
                     SPSPKKTEKYIVQKLRKQFELTKDTIGDGSFSRVKIVHRKEQGTLVKYAAKFLNREAK
                     VSEQLYEERAWKEFDIARNLHHPNIAEVISLCRHNPHLVFVMEHCQHGDLCDLMAKAT
                     LRHGAKKCFFKQMLRGVAYMHSHGIAHHDIKPENLVLADDNVLKLIDFGLSEVFADLL
                     PPDSKGERKLGPVREFPARLYGTPAYLPPELFQGVYSYDARALDVWSCAITAFAIFAG
                     DVPWDLADDEDKSYQAFRGSWQYLLEEYPDLPVTADNFPLTTFAKALPEKELATLLLR
                     MLHPFPEKRMTILEVLEDPWVQAIECCSPESNHSSTVRGDKDCGIPKMHDHRPLTDEL
                     ASNSD"
     exon            complement(475791..476224)
                     /number=1
     exon            complement(476284..477057)
                     /number=2
     exon            complement(478834..478993)
                     /number=3
     CDS             join(479477..480426,480476..480782,480829..481224)
                     /codon_start=1
                     /locus_tag="AO090120000194"
                     /note="predicted protein"
                     /old_locus_tag="AO070250000002"
                     /protein_id="BAE62806.1"
                     /transl_table=1
                     /translation="MSSLQEVIQQVNSRRLWRGAALLVLVAFSSPVFVLTLAPVYGSA
                     PSHIFHGYGVAITAALGWFLKDFIQQVTNRRAVYLLPVVAFWYPTIQYFLLQQSSSFG
                     NPTGAVITEVVAFYPFVLLSVACAAKLVQAGLNLERYGDLAKEHIPLISSYIVYSFGE
                     KLAKSFIVRFIGSFWLFSSTGLQLLVAILCSAVIPSKWLLLAIPSILFTLTSNVHLPL
                     GITTSGLKSALNEEGFSLVDRQESSTGYISVLDNLEDGFRVMRCDHSLLGGQWTKTYR
                     NYKPKVQDPIYAVFSLLEAVRLAETGHGAHRVDADSKALVIGLGVGTTPAALITHGIE
                     TTIVEIDPVVHKFASKYFHLPPNHIAAIEDATLFVDRALKSPQPNQYDYIVHDVFTGG
                     AEPIELFSIEFLGGLNSLLKEDGVIAMNYAGDLSLYPAALTVRTIQAVFPSCRYFRED
                     AGEEGNGDFTNMVIFCKKDSATPLRFRDPVPADFLDSKFRETYLVPKHEIDPAIFTTV
                     TGGQRVLRTKDTGKLYRWQDQGALEHWGIMRKVLPDAVWENW"
     exon            479477..480426
                     /number=1
     exon            480476..480782
                     /number=2
     exon            480829..481224
                     /number=3
     tRNA            complement(481506..481577)
                     /locus_tag="AO090120t00004"
                     /note="tRNAscan-SE"
                     /product="tRNA-Ala"
     tRNA            482653..482724
                     /locus_tag="AO090120t00005"
                     /note="tRNAscan-SE"
                     /product="tRNA-Ala"
     CDS             complement(join(483372..483637,483662..484646,
                     484706..484855))
                     /codon_start=1
                     /locus_tag="AO090120000195"
                     /note="predicted protein"
                     /old_locus_tag="AO070250000001"
                     /protein_id="BAE62807.1"
                     /transl_table=1
                     /translation="MRMTSKRRFQCRTSTAPLIYTSSTSSTMAKRLWPSPTENMKSPW
                     TRWIVLINYVWDGVDKVALSESVTVNKETPPVGPPGWDYVHINSIDKNDDGDYIISYR
                     FTNTIYMISGQDGNIMWRLGGQYTDFEQDFTFSKQHDAKFIESNGTHHVISLLNNASD
                     EISNDEDVSSALFIELDTSAFPKTAKVIRRHNRPDGGLTRLRGNTQLLPNNNVFVGWS
                     ERGYISEFSPEGDTLLNANFVSSRYSTYRAYKFEFTGRPSAPPDLVASVWGTDQTDLS
                     TTFYVSWNGATDIAGWNFYARAAKNGHPILIGNATKTDFETMFIARGYLDWVTAEAVD
                     HEGRVLGTSRVQRSKIPDNWAAAGFRGDLKTLKPDDPKAPKSNGEADNKNNNNLQSPR
                     PADAEVKEIAQLAHETYDLVRNVSGVFVLIVLCGIVSGIAASIYLCFRRRITQPYKHV
                     PSDDIPEEEIRLHSVE"
     exon            complement(483372..483637)
                     /number=1
     exon            complement(483662..484646)
                     /number=2
     exon            complement(484706..484855)
                     /number=3
     CDS             join(486782..486949,487005..487043,487129..487244,
                     487314..487422,487491..487719,487778..487940,
                     488006..488152,488218..488458,488538..488825)
                     /codon_start=1
                     /locus_tag="AO090120000196"
                     /note="alpha-amylase"
                     /old_locus_tag="AO080601000001"
                     /protein_id="BAE62808.1"
                     /transl_table=1
                     /translation="MMVAWWSLFLYGLQVAAPALAATPADWRSQSIYFLLTDRFARTD
                     GSTTATCNTADQKYCGGTWQGIIDKLDYIQGMGFTAIWITPVTAQLPQTTAYGDAYHG
                     YWQQDIYSLNENYGTADDLKALSSALHERGMYLMVDVVANHMGYDGAGSSVDYSVFKP
                     FSSQDYFHPFCFIQNYEDQTQVEDCWLGDNTVSLPDLDTTKDVVKNEWYDWVGSLVSN
                     YSIDGLRIDTVKHVQKDFWPGYNKAAGVYCIGEVLDGDPAYTCPYQNVMDGVLNYPIY
                     YPLLNAFKSTSGSMDDLYNMINTVKSDCPDSTLLGTFVENHDNPRFASYTNDIALAKN
                     VAAFIILNDGIPIIYAGQEQHYAGGNDPANREATWLSGYPTDSELYKLIASANAIRNY
                     AISKDTGFVTYKNWPIYKDDTTIAMRKGTDGSQIVTILSNKGASGDSYTLSLSGAGYT
                     AGQQLTEVIGCTTVTVGSDGNVPVPMAGGLPRVLYPTEKLAGSKICSSS"
     exon            486782..486949
                     /number=1
     exon            487005..487043
                     /number=2
     exon            487129..487244
                     /number=3
     exon            487314..487422
                     /number=4
     exon            487491..487719
                     /number=5
     exon            487778..487940
                     /number=6
     exon            488006..488152
                     /number=7
     exon            488218..488458
                     /number=8
     exon            488538..488825
                     /number=9
     CDS             489154..490134
                     /codon_start=1
                     /locus_tag="AO090120000197"
                     /note="predicted protein"
                     /old_locus_tag="AO080601000002"
                     /protein_id="BAE62809.1"
                     /transl_table=1
                     /translation="MAPNLAPSQHQIICDMIKCDPSLTNAQIAEAANCSTRAIPRIRS
                     NLRLFGSSKAPPNKGGRPRSISPIMLEALCDHLLEKPDLYLDEMAIFLWDEFQIYATT
                     SSIRRALSSKGWSKKAARQKAKERNSDLRDMYFHLISDFHSYQLVYVDESGCDKRAGF
                     RRTGWSPLGTTPIQVSKFHRDQRYQILPAYSQDGIILSRIFRGATDTSVFEDFIEELL
                     LQCGKWPEPRSVIVMDNASFHYSERIDQMCLEAGVKLVYLPPYSPDLNPIEEFFAELK
                     AFIRRHWSVYEDSPEQGFDTFLEWCIDVVGARKQSAKGHFRHAGLTVEES"
     exon            489154..490134
                     /number=1
     CDS             complement(join(491425..491561,491737..492184))
                     /codon_start=1
                     /locus_tag="AO090120000198"
                     /note="predicted protein"
                     /old_locus_tag="AO080601000003"
                     /protein_id="BAE62810.1"
                     /transl_table=1
                     /translation="MFFYRVTDKDSVAAFEPGQGFIAGNTSSRVTLDPLIQDDAIELV
                     EYIQRHLNWKNRYPTPFISAYLDFDTAKTEALRRVNDGKKSVVLWKICLDEDDDLEWA
                     TIYDLKRELGFWIQDNAFHNAKYEALFVRKIPRDYVVGGERYTNRQGNGFRTGLEFKS
                     KAIIVMAVEKKQKKERKMEVGDKPSSTLGFIFVA"
     exon            complement(491425..491561)
                     /number=1
     exon            complement(491737..492184)
                     /number=2
     CDS             complement(join(496191..497559,497643..497668))
                     /codon_start=1
                     /locus_tag="AO090120000200"
                     /note="predicted protein"
                     /old_locus_tag="AO080601000006"
                     /protein_id="BAE62811.1"
                     /transl_table=1
                     /translation="MNLIILLVLLLSGIYCLEGMTFSPYYDDDASQLQPPDPWIQTPS
                     YAPTPGDFGRDRTPSVFCPSPEHVLDEPYTPLHQSQPNHLGFFQEPEERTTRQHRGKP
                     CIHYTIEWKVTLNNRTVSKDTEQDLAVAPSSHWAKITQDAENVMRRKIRHNQRVRSDD
                     TTVRVSVNERGQSDLNKRFDGTNIDWKPIEKQLLMWGNLFHIGKKLKLFISINYIEDS
                     GPPLSRNTDKRGKSSVTRRMLTERDAQIDAEQASGQRPYWREVYQTMRCPGPPCRHEG
                     QYCWLDPVGKKHYKLRTHHLRRLVKYVEGGGILDTHDDIPDDVREQLYAEEALRLEKQ
                     KNPKHSASGSICPPININVLPAQSSQSLTDRSVTAEQSSSSPNCIDSVDIPGFLDDAV
                     EEYANWHLSRVGREIYRDHIKKARDVALENGLDLQQVSKEDPDFFVKQGVIIGVARRF
                     VSDIRDWANQYRHD"
     exon            complement(496191..497559)
                     /number=1
     exon            complement(497643..497668)
                     /number=2
     tRNA            498736..498807
                     /locus_tag="AO090120t00006"
                     /note="tRNAscan-SE"
                     /product="tRNA-Ala"
     CDS             complement(join(499348..499491,499547..500178,
                     500243..500336,500415..500797,500871..501032,
                     501098..501254))
                     /codon_start=1
                     /locus_tag="AO090120000201"
                     /note="dynein light intermediate chain"
                     /old_locus_tag="AO070172000003"
                     /protein_id="BAE62812.1"
                     /transl_table=1
                     /translation="MFTSSHNPGPKLGSGNNSRPSSKDGPKKNIWSSMLDSVANGKRL
                     PEKNLLILGGTPESQREFLDTLSADTSDPSLSNDRRKGRLPPVANQFALGYTYQDVLD
                     ADQEDTLARVSAYLLSEPSLSFAPLLKPLLTAQSVPETLVVILLDWSDPWTWVRRLRE
                     WVRLLRHVLISLDDETKIVMEETMTEWRDRKRGMDPSSTGAQGLTSSGGPVTIPLGPG
                     EWDEGLGIPMCVVCQGADKIEKLEKDHGWHEEEFDFILQFMRTILLKHGASLIYTTPF
                     LVNSLQSLLHSSLGIHSLLKRQSLKHNVIDRDKILVPSNWDSWGKIRIIREGFDMEGV
                     STAWSIEIQDPPEPLSGSSMDDAKPQGENAAGLDDGTSAVAIFEQTIKDPKRDASMTH
                     PGSQHSKSKVEVDTSDMQSFLTKQLEVLEQLKIEDEKDRTAKPVPQLEMSPLDDNGRV
                     NEHIGPVQFNMGGIQVDADDMLRKLKEREANRSQRKDTLSAPPGEKSHNQALANFFAG
                     LVKKPGGSPRGSPSA"
     exon            complement(499348..499491)
                     /number=1
     exon            complement(499547..500178)
                     /number=2
     exon            complement(500243..500336)
                     /number=3
     exon            complement(500415..500797)
                     /number=4
     exon            complement(500871..501032)
                     /number=5
     exon            complement(501098..501254)
                     /number=6
     CDS             join(501815..501870,501948..502767)
                     /codon_start=1
                     /locus_tag="AO090120000202"
                     /note="predicted RNA-binding protein (RRM superfamily)"
                     /old_locus_tag="AO070172000002"
                     /protein_id="BAE62813.1"
                     /transl_table=1
                     /translation="MNAIRQIQSLNKRELENAIPPEASWHADYRDTAYIYIGGLPFDL
                     SEGDIVTIFSQYGEPVHVNLVRDKETGKSRGFAFLKYEDQRSTDLAVDNLGGSTVLGR
                     ILRVDHVRYKRRDDEEEGDNVAKLMGDAVVKSAGDGDTDDERRRRRKGRTGEDESQRR
                     PLLKEEKELEELMVNHDEEDPMKEYLIQEKKEEVARALEKLNREKSSRRRESSRERSS
                     RHHRHRHHRRRHDEDRSRSRERGTRNRRSRSREDRSYRNRSPARKERTYRDRTPVGSR
                     SPEPRRNRDREDRHR"
     exon            501815..501870
                     /number=1
     exon            501948..502767
                     /number=2
     CDS             complement(join(503144..503674,503728..504084,
                     504151..504248,504329..504367,504441..504549))
                     /codon_start=1
                     /locus_tag="AO090120000203"
                     /note="uncharacterized conserved protein, contains WD40
                     repeats"
                     /old_locus_tag="AO070172000001"
                     /protein_id="BAE62814.1"
                     /transl_table=1
                     /translation="MNTRQVIDESVGPFSLSATFNNDNSCFSVGLDTGFCVFNADPCE
                     LKVSRDFNAGIGVAVMLGQTNYLAIVGGGRQPKFPQNKLAIWDDAKQKAVITLEFRTS
                     VLGVRLSKSRIVVALLNSIHIFAFSNPPQKLSVFETTDNPMGLACLGQKLLAFPGRSP
                     GQVQLVELETGNVSIIPAHSSPLRAMTLSPDGEVLATASEMGTLVRVFSTSNCTKMAE
                     LRRGVDQAVIFSLAISPSNNLLAVTSDKSTLHVFDLPHPLNPSHRNPLASPPSEEGTN
                     QKWGILGKIPLLPRVFSDVYSFASAPFEIGDESAPGSHYVPPLGTSFGRPLKGVIGWP
                     DDQTILVLGSGRDGRWEKFTLREGGDGKRYCMREGWKRYLGGG"
     exon            complement(503144..503674)
                     /number=1
     exon            complement(503728..504084)
                     /number=2
     exon            complement(504151..504248)
                     /number=3
     exon            complement(504329..504367)
                     /number=4
     exon            complement(504441..504549)
                     /number=5
     CDS             join(507014..507027,507080..507682,507741..507972)
                     /codon_start=1
                     /locus_tag="AO090120000204"
                     /note="septin family protein (P-loop GTPase)"
                     /old_locus_tag="AO070311000001"
                     /protein_id="BAE62815.1"
                     /transl_table=1
                     /translation="MKQGIFGEIVGYLERQYDDILAEESRIKRNPRFRDNRVHVLLYF
                     ITPTGHGLRELDIELMKRLSPRVNVIPVIGKADSLTPAELAESKKLIMEDIEHYRIPV
                     YNFPYDIEEDDEDTVEENAELRGLMPFAIVGSDDFVEIDGRKVRARQYPWGVVEVENP
                     RHSDFLAIRSALLHSHLADLKEITHDFLYENYRTEKLSKSVDGATPTQDSSMNPEDLA
                     SQSVRLKEEQLRREEEKLREIELRVQREIAEKRQELLARESQLREIEARMARESSSQD
                     VANGDA"
     exon            507014..507027
                     /number=1
     exon            507080..507682
                     /number=2
     exon            507741..507972
                     /number=3
     CDS             complement(join(509323..509400,509455..509886,
                     509952..513035))
                     /codon_start=1
                     /locus_tag="AO090120000205"
                     /note="RhoGEF GTPase"
                     /old_locus_tag="AO070311000002"
                     /protein_id="BAE62816.1"
                     /transl_table=1
                     /translation="MADLGGHQGRNYRPYGHPSSFQRDAAFSEIFGGAPPPGRSQTMT
                     SQTPQFSQDRAHTMSSHVPHPQMQRDPPPPTRQVPNGHPAGAPNGYYQAYPGSATMTS
                     HSSQNAPRPYPGRFAYPQPQRLDSRQSPGPQYPDAKGYSRPMPPPALNSDAYRSRSMA
                     RMGGPPLYHPPPSSFNHTSASAFRQQPYNAAAPMTAQGRVVPERHGNERAMSLTSYSA
                     DRPDYNKTTSTGRVIPARRQPSGSSQPPFSRPDMDPAAVHNVDGRPRPPSDGSTTSRS
                     MSMASTVPDRTMSMQSQAPPKPAGQPTLVASNSRRSKVPLVYPALLSRVADAFREKIV
                     LAKREKNGVTYHYAFSGADAVDLISYIIKTNDRNLALLLGRALDAQKFFHDVTYDHRL
                     RDSPGEVYEFNDFKETMGEEAPSSEVNGVFTLLTECYSPTCNRDSLCYSIACPRRLEQ
                     QARLNLKPQPGLRSSASKGSLHGDDDDNDNQKLWINMVPKEVSDSIDDREKKRQEIIF
                     EIMYTERDFVKDLEYLRDFWIRPLRSAGNKNISPIPEHRREKFIRTVFGNCLDVLAVN
                     GGLAEALNARQKESHVVKTVGDIFLQHVPRFDPFIKYGANQLYGKYEFEKEKASNPDF
                     ARFVEETERLKESRKLELNGYLTKPTTRLARYPLLLEQVVKNTADDNPDKEDIPKAIK
                     LIKDFLSRVNTESGRAENHFNLVQLNGALKFGPGDYVNLKLTEENRQMLTKMAFRKTP
                     TDTSEVTAYLFDHAVLLVRIKTVNKREEYRVYRKPIPLELLVIAQMDEVIPRAGIAKR
                     PSSSLLPNKATANPPNTKDGLPITFRHLGKGGYEQTLYATNPTQRRKFIELVDEQQRK
                     LRERNSNFYNKTVLCENFFTSINRVNCLVPVDGGRKLVYGTDSGIYLSERWPKDKSAK
                     PRRVLDVSQVTQIDTLEEYQLLLVLANKTLSSYPMEALEIGEGQNTVAKRPKKIQGHA
                     NFFKAGIGLGRYLVCSVKTSALSTTIKVYEPMDNLGKGKKKYKMFQSGQDTLKPFKEY
                     YIPAESSSIHFLRSTLCVGCARGFEVVSLETTETQSLLDQADTSLDFVARKENVKPIH
                     IERMNGEFLLNYSDFSFFVNRNGWRARPDWRISWEGNPNAFALSDPYILAFEPNFIEI
                     RHIETSELIHIMTAKNIRMLHASTREILYAYEDEAGEDVVASLDFGKPQRS"
     exon            complement(509323..509400)
                     /number=1
     exon            complement(509455..509886)
                     /number=2
     exon            complement(509952..513035)
                     /number=3
     CDS             join(514340..514401,514453..514463,514524..514635,
                     514660..514744,514802..514981)
                     /codon_start=1
                     /locus_tag="AO090120000206"
                     /note="vacuolar H+-ATPase V0 sector, subunits c/c'"
                     /old_locus_tag="AO070311000003"
                     /protein_id="BAE62817.1"
                     /transl_table=1
                     /translation="MGAAYGTAKSGIGISGVGTFSDTIVYGLVIAVLIAQDMQPPPLP
                     RQSLYTYVQSAICVSIWNGFMHLASGLSVGLAGMAAGYTIGIVGDAGVRAYLQQSRVY
                     VGMILILIFGEVLGLYGYVTIVIPKYGFDANCDRLIVGLILNSKSHP"
     exon            514340..514401
                     /number=1
     exon            514453..514463
                     /number=2
     exon            514524..514635
                     /number=3
     exon            514660..514744
                     /number=4
     exon            514802..514981
                     /number=5
     CDS             join(515723..515975,516045..516137,516193..516317,
                     516426..517145)
                     /codon_start=1
                     /locus_tag="AO090120000207"
                     /note="cAMP-dependent protein kinase catalytic subunit
                     (PKA)"
                     /old_locus_tag="AO070311000004"
                     /protein_id="BAE62818.1"
                     /transl_table=1
                     /translation="MATGTVDPSAPKDVQGTSAPAGDIDTGSGNLHEKEKQMVSAIRP
                     PHQRHLSPFVITERPEEKQLGVSTRTLTVDDFALLKTLGTGTFARVWLVRLKDEIRQR
                     DKVYALKILRKADVIKLKQVEHVRNERKTLSAVAGHPFITTLIASFSDDQSLYMLLDY
                     CPGGEIFSYLRRARRFNENTAKFYAAEITLTIEFLHDVEGIVYRDLKPENILLDAEGH
                     IRLVDFGFAKKVDNRETYTLCGTPEYLAPEVIHNSGHGLAVDWWALGILIYEFLVGQP
                     PFWDQNPMRIYEQIVEGRIRFPQNMSPAAQNIISLLCKTNPTERLGYISGGSARVKSH
                     PFFEDIQWDDLFYRRIKGPIIPRVDHPADTGNFEEYPDPDVRSQNVYTDDLKKKYEAL
                     FSDF"
     exon            515723..515975
                     /number=1
     exon            516045..516137
                     /number=2
     exon            516193..516317
                     /number=3
     exon            516426..517145
                     /number=4
     CDS             complement(518613..519683)
                     /codon_start=1
                     /locus_tag="AO090120000208"
                     /note="predicted protein"
                     /old_locus_tag="AO070311000005"
                     /protein_id="BAE62819.1"
                     /transl_table=1
                     /translation="MLTYRKSLIAALFLITFVVLLRSSHSASSPSPPAPAHLPDEVAY
                     NTNEVTEEHLSGQKKEAIPQQQPLKPSPSAPLRERLRYHFPYDLDKKFPAYIWQTWKY
                     TPDSVWFGQELRGAEASWTELHPGFVHQVVPDDTQGYLIKYLYSSLPDVFEAYESLPL
                     PVLKADFFRYLILLARGGIYSDIDTSALKPAADWLPSTYDLSTIGFVVGIEADPDRPD
                     WHEWYSRRLQFCQWTIQSKPGHPILRDIVAYITEETLRMKKAGILKVGKMDKTIVEFT
                     GPGAWTDAIFRYFNDPDYFNIEPDSNHNITYEDFSNQKDWRKVGDVVVLPITSFSPGV
                     MQMGAGDYDDPMAFVKHDFEGT"
     exon            complement(518613..519683)
                     /number=1
     CDS             522515..524086
                     /codon_start=1
                     /locus_tag="AO090120000210"
                     /note="homoserine acetyltransferase"
                     /old_locus_tag="AO070311000007"
                     /protein_id="BAE62820.1"
                     /transl_table=1
                     /translation="MGSIHGVARSARSLSALLRHESVSTRNRLAAVCSSTQYATARRS
                     LHNGRPRKSQSAAASNNSSNPALSFPCLDAQDAKSALLSARSIESGPEPSYTTGHHEQ
                     FRCEDPLLLDWGGVLPEFDIAYETWGQLNADKSNAILLHTGLSASSHAHSTEANSKPG
                     WWEKFIGPGKPLDTNKHFVICTNVIGGCYGSTGPSSIDPSDGKRYATRFPILTIDDMV
                     RAQFRLLDSLGIQKLYASVGSSMGGMQSLAAGVLFPERVEKIVSISGCARSHPYSIAM
                     RHTQRQVLMVDPKWARGFYYDSIPPHSGMKLAREIATVTYRSGPEWEKRFGRKRADPS
                     KQPALCPDFLIETYLDHAGEKFCLEYDPNSLLYVSKAMDLFDLGQAQQTETKKRRAEY
                     EANIAEGGKTVDASNIACSLTLPEKPYEEQPSVAASTPAMDQSVAGGAEAPPQDLVAG
                     LAPLKNHPVLVMGVASDILFPAWQQREIAETLRAGGNEKVQHIELGEDVSMFGHDTFL
                     LDLKNIGGAVEEFLR"
     exon            522515..524086
                     /number=1
     CDS             complement(join(524126..524184,524949..527384,
                     527450..527558))
                     /codon_start=1
                     /locus_tag="AO090120000211"
                     /note="transcription-coupled repair protein CSB/RAD26
                     (contains SNF2 family DNA-dependent ATPase domain)"
                     /old_locus_tag="AO070311000008"
                     /protein_id="BAE62821.1"
                     /transl_table=1
                     /translation="MGSGWELENPDATTASSDDDDLDVSRPARPYKADLSRTTSKSEV
                     TPRPTPKSEIPVEERSSPLNNPTPVIDLEVQTDSDDTSFNDGEAAYQAFKNRKALKRK
                     RTSMSARKSKTPKVVHPESFVGRRPRQGGRPTPRRPLREYGDEVPSEDDLMEYTLPEY
                     LQKRRQQFERRAEHLKESGLKLPPGYEDIEFSDDERLEFLEEKPAFTNIKPCSAYKDI
                     TLPYSLGLIPAPIAQWLRQYQVDGAAFLHELFVYQKGGILGDDMGLGKTVQVIAFLTA
                     AYGKTGDERDAKRMRKMRRSGKDQWYPRTLIVCPGTLIKNWMSELTRWGWWHVDTYHG
                     DNKELALHAARSGRVEILITTYGTYLQNKDSVNMVDWDCVIADECHIIKERTSETTKA
                     MNSVNALCRIGLTGTAIQNKYEELWTLLNWTNPGKLGPVTTWKKTISDPLKIGQSHDA
                     TLYELSKARKTAKKLVENLLPQFFLRRMKSLIADQLPKKIDRVVFCPLTETQSDAYEN
                     LLDSDIIRYIKESSELCSCGSRKKAGWCCQQYLQSGLRWQSYVFPAMNVIQKLSNHLA
                     ILIPQGVDSKEKQDKDREWLEIASPDKWEQLYRTRDSIVNYANPEFCGKWKVLRRLLK
                     WWHSNGDKVLVFSHSVRLLRMLQMLFHHTSYNVSYLDGSMSYEDRATAVDEFNSDPRQ
                     FVFLISTRAGGVGLNITSANKVVVVDPNWNPSYDLQAQDRAYRIGQVRDVEVFRLISA
                     GTIEEIVYARQIYKQQQANIGYNASSERRYFKGVQEKKDQKGEIFGLNNLFEYQNNNI
                     VLREIVNKTNVAESRAGVQVMDIDVDESQTHEDSKNTDDEVMSQLAAMIRGVGFNPLD
                     FTFIYYNHQYK"
     exon            complement(524126..524184)
                     /number=1
     exon            complement(524949..527384)
                     /number=2
     exon            complement(527450..527558)
                     /number=3
     CDS             join(527969..528267,528339..528849)
                     /codon_start=1
                     /locus_tag="AO090120000212"
                     /note="exosomal 3'-5' exoribonuclease complex, subunit
                     Rrp41 and related exoribonucleases"
                     /old_locus_tag="AO070311000009"
                     /protein_id="BAE62822.1"
                     /transl_table=1
                     /translation="MPLDTSTTYPLTKLRLDGRRWNELRLLQAQISTNPASSGSSYLA
                     MGNTTIMCSVHGPAEGRRGDATGGAAGSSGAVVEVDVNVAGFAGVDRKRRAGGSDKQS
                     SRIATTLRAAFQSHLHTYLYPHSTISIHVSVLSADGSLLAAAINACTLALVDAGIPMP
                     GLLCGCTAGMSGSASTPRDPRNDELDPLLDLSLPEEQELPFLTVGTTTSVPVGENAMD
                     DDEEDMKVSMLNMDSKVHCTYVETMLAVGIDGCNQIREILEGVIKGSNKLR"
     exon            527969..528267
                     /number=1
     exon            528339..528849
                     /number=2
     CDS             join(532735..532872,532953..532983,533073..533551)
                     /codon_start=1
                     /locus_tag="AO090120000214"
                     /note="copper transporter"
                     /old_locus_tag="AO070311000011"
                     /protein_id="BAE62823.1"
                     /transl_table=1
                     /translation="MVAHGDMMMDMSMATATSTGAMSSSTASHSMSMGGMHGGSNSCK
                     ISMLWNWTVKDACFLSKQWHITSNGMFAGSCIGVILLVICLEFLRRVGREYDAFILRR
                     ARLRAQYLTVQSQPSTPAAASDAEDVATGTKASSSAQPSAGKAPNCPAADVPVRPTLV
                     EQLIRALMHMLQFAVAYFIMLLAMYFNGYIIICIFIGAFLGSFLFTWEPLQLGKE"
     exon            532735..532872
                     /number=1
     exon            532953..532983
                     /number=2
     exon            533073..533551
                     /number=3
     CDS             complement(join(534469..534655,534713..534819,
                     534889..535058,535248..535305))
                     /codon_start=1
                     /locus_tag="AO090120000215"
                     /note="cyclophilin type peptidyl-prolyl cis-trans
                     isomerase"
                     /old_locus_tag="AO070311000012"
                     /protein_id="BAE62824.1"
                     /transl_table=1
                     /translation="MVNTKAFFDVEYAPVGTSAKKVGRINFNLYEDDVPKTSKNFREL
                     CTGKHGFGYKGSSFHRVIPSFMLQGGDFTRGNGTGGKSIYGEKFPDENFKFKHNKPGL
                     LSMANAGPNTNGSQFFITTVVTSWLDGKHVVFGEVADAESMNVVKEIEALGSNSGALR
                     SNVKPTIVDCGEL"
     exon            complement(534469..534655)
                     /number=1
     exon            complement(534713..534819)
                     /number=2
     exon            complement(534889..535058)
                     /number=3
     exon            complement(535248..535305)
                     /number=4
     CDS             complement(join(536649..537050,537106..539475))
                     /codon_start=1
                     /locus_tag="AO090120000216"
                     /note="predicted protein"
                     /old_locus_tag="AO070311000013"
                     /protein_id="BAE62825.1"
                     /transl_table=1
                     /translation="MSPVSVDGSDWSGINQYQKPDGPFSPTLSSRGNLATPPIPGAAN
                     GPNGAELPNGTLSGRMSDSGNPPSPTSVAARSSDGTLSDQRSKRYRQMEEILRNHYVV
                     LKRFLSAPYREDRNGRPSKARDKLLRLSATQFHELSTDVYDELRRRQQAMPSPNRPPR
                     PDVPPFLPPRQDFHEKRNQARQKLASLQHVRFRDLATDVYTELERRFPQFPEKESRRA
                     SPAPSFRGHPSNGYPSPNGYGPGGYPPPRSQSRGPPRRGYPSGGPPGSPMSGVFPPRQ
                     GSLGGPPSVNGDHGPMAKSFQSNTIVPNKSTMVEDDDDMTGVDDDYDARSDAFALDAV
                     LQSRRGTTTTLGEGERKLLADTQSQVSVLQEKVNKLEELLKSKDEELSKHHGDQTKVD
                     ELEDLLKAKDEQLFKYQEGHKKAQLGESERKDWEDLKSDLESKISKAEDLNSSLQTEL
                     DKVRTEHDAMERELRSQIDGASREGAGDAELQARFADLEIKHKSLQAELQEQQQVTEE
                     VKREAAGFLTEMKALSEQSHSRWEHEERLSSEVHRLEEEVKQWKSRYAKAKTQLRHLR
                     ASSTGIELRSDVNAIAKDNAFLQEDGLVKDVHVTKFQISIDELLRIARFDDYNLVMQQ
                     IKSVVIAVRHVLRDVEVASDREDSLSASHTKATRRVSATANNLITASKNFASSCGLSP
                     VSLLDAAASHLSTAVVELIRLVKIQPSPAGDLNEDDEEQLAHMKSPDYFSVAPSHGRF
                     SNNGSVYSAMSPPSNHSRNHTESHAANGMTAATKTSYPGPSRDHELQELKLYVEDQTE
                     GLVQSIQALVASIRAEDGLTTIRTHVSAISSIVTNVSSSTEHFIHKPEANPVLRQRAG
                     PIIEKLDQYRARLMGTATEGEEATSAEQVQVIINRLPPIAFEVARETKELVQRLEPVD
                     QEESEDDFR"
     exon            complement(536649..537050)
                     /number=1
     exon            complement(537106..539475)
                     /number=2
     CDS             complement(join(541346..541685,541747..542821,
                     543671..544055))
                     /codon_start=1
                     /locus_tag="AO090120000217"
                     /note="3-hydroxy-3-methylglutaryl-CoA (HMG-CoA) reductase"
                     /old_locus_tag="AO070311000014"
                     /protein_id="BAE62826.1"
                     /transl_table=1
                     /translation="MTLGYLSMHLSFVSLFFSMRRLGSKFWLAGTVLLTGAFAFLFGL
                     LVTTKLGVPINVLLLSEGLPFLVVTIGFEKPIILTRAVLNASADNKRRGGAGPSSQSS
                     PTTAKSIQDSIQTAIREQGFEIVRDYYSSKRSAEECEVFLKEKRAPYLSDEDLIELCL
                     RGKIPGYALEKTMENEDLMSRVDAFTRAVKIRRAVVSRTKATSAVTSSLEASKLPYKD
                     YNYTLVHGACCENVIGYLPLPLGVAGPLTIDGQSYFIPMATTEGVLVASASRGAKAIN
                     AGGGAVTVLTGDGMTRGPCVGFPTLARAAAAKVWIDSEEGQSIMKAAFNSTSRFARLQ
                     TMKTALAGTYLYIRFKTTTGDAMGMNMISKGVEKALHVMSTECGFDDMATITISGNFC
                     TDKKSAALNWIDGRGKSVVAEAIIPGDVVKSVLKSNVDALVELNTSKNLIGSAMAGSL
                     GGFNAHASNIVTAIFLATGQDPAQNVESSSCITTMRNLNGDLQISVSMPSIEVGTIGG
                     GTILEGQSAMLDLLGVRGSHPTNPGDNARQLARIVAAATLAGELSLCSALAAGHLVRA
                     HMAHNRSSAPTRSSTPVSAAVGAARGLTMTSSK"
     exon            complement(541346..541685)
                     /number=1
     exon            complement(541747..542821)
                     /number=2
     exon            complement(543671..544055)
                     /number=3
     CDS             548641..549777
                     /codon_start=1
                     /locus_tag="AO090120000218"
                     /note="predicted protein"
                     /old_locus_tag="AO070311000015"
                     /protein_id="BAE62827.1"
                     /transl_table=1
                     /translation="MNLKLTTWKSGLGLLSFLFLTPTVVAHSWVEQLMVIAPNGTFVG
                     SPGYSRGNVLRSDPGYSDSKMQNLVPDGRNELLPTDLLCKNTQQKQVQSEGSPRLQAS
                     AGAAIALRYQENGHVTQPGNQLGKPENRGTVYVYGTTEPKEDEKIMDVHKVWNKDGTG
                     GDKRGVLLATRNFDDGRCYQVNGDSISKQRQSEFPHTADQLMGVNLWCQSDIALPSNA
                     PSGKPYTLYWVWDWPTLPGVDPNLPKGKQEIYTTCIDVDVVANTGAQSHVAAGYVKDQ
                     SLNNAAIPSQLADIFGSGASSGSAQSSPIAGVSMAPSGHGPAAPSSSQAVIKSSSSWS
                     SPTVAATPTSPVQDPMAPQRVTVTSFVTMMKTVFPGCSASASPQ"
     exon            548641..549777
                     /number=1
     CDS             join(551460..552680,553491..554162)
                     /codon_start=1
                     /locus_tag="AO090120000219"
                     /note="predicted protein"
                     /old_locus_tag="AO070311000016"
                     /protein_id="BAE62828.1"
                     /transl_table=1
                     /translation="MTTTMTSTASPPPPQQDDSASNLAVLPPIVTDATVKRPIRQRSS
                     SYAKDRLSTHSNVSLASQNRSRPGSHVFPVFHSSLPYALVRDFAYPSIHPLHYGPLPP
                     RASGVSTPVSEQRRLSDPPAPWDSSRGQWSTGPWSTDHSYGHQQLPAMSFGDGPPYSE
                     DEDLHSPVFSAPRHRKNKSTGTDLNGGRKRSPSRPGATGYLGDTDRGMYVSTNADGSE
                     TYYVNDEDEIDDGPGGEYVTYPVNESRYSYAGTYGNYASYGPDVEYESEDGCADDRYN
                     GDFQFAVGCPDEEMHGKAVALFDFTREHENELPLTEGQVIFVSYRHGQGWLVAEDPRT
                     GESGLVPEEFVRLLRDIEGGLTSLNGDPEFLDDTHPNHDSTEIHQAMAPAQDDHPSYV
                     ANGEKKDDNEQGVDTKERQEKVYTHSPNTITIHPPEPRTTDPPSNSATTVLWPSNSDT
                     IPARFSPPTPTNPPALLTPSISCSAAAPCASISCLILPSSIGTSFPPSSPITGLSAAE
                     TGPWTSGPSCTTSPSFFRLRKKRNKAITPRRNTAPTTPPTIPPIWDPESPCVDCVAGA
                     VADVVGDEVDGVVVVEVEFDVDVGEVEDVDAEDVVEVPFVMLSYATQHWMELIPGHGQ
                     EGYCHH"
     exon            551460..552680
                     /number=1
     exon            553491..554162
                     /number=2
     CDS             complement(join(555706..557028,557096..557177,
                     557327..557379,557427..557458,557553..557634))
                     /codon_start=1
                     /locus_tag="AO090120000220"
                     /note="equilibrative nucleoside transporter protein"
                     /old_locus_tag="AO070311000017"
                     /protein_id="BAE62829.1"
                     /transl_table=1
                     /translation="MDLSNLKEQVSNLTLYDLKAGVRKVQNAVMNYTEMEAKNYTYMH
                     AEWLSTAVAYDHQLLNEIMPMIYRRFTDKTAEEWRQIYKGLQLLEFLVKNGSERVVDD
                     ARSHMSLLRMLRQFHYIDQNGKDQGINVRNRSSELVKLLGDVDQIRAERKKARTNRNK
                     FGGFEGGSHVGGGMSNSRYGGFGSDSMSFGGYSGGVYGDGGGFGGNTSDFQDTGRRGN
                     RFEEYDEYDEADASPSVRRAASPPRARATKQPEPPKPKAPEPDLFDFGEEEVVTTVST
                     SAGKKPAGNNGLDVLDSKPIDDDDFDDFQSATPAPAPAASNQFSIPPPANTVSTTSST
                     QFAAPKPVSATQGTNLNGLVGFTSMTPTPTSSTVASPTLSQSSMVQPQQQKPAQPKPT
                     GFQAATPNYFTSVSVMQPQAGVSNHRPGMASTSSFTSATSSSPAAAKPAASKSSNGDV
                     FGSLWSSASASAGLQKSNANANKGPNLASMAKEKASAGIWGAPATPSLASPSSSQASQ
                     QGAKTNSSGLDDLLG"
     exon            complement(555706..557028)
                     /number=1
     exon            complement(557096..557177)
                     /number=2
     exon            complement(557327..557379)
                     /number=3
     exon            complement(557427..557458)
                     /number=4
     exon            complement(557553..557634)
                     /number=5
     CDS             complement(join(558301..559190,559247..559525,
                     559577..563732))
                     /codon_start=1
                     /locus_tag="AO090120000221"
                     /note="Ras GTPase-activating protein family - IQGAP"
                     /old_locus_tag="AO070311000018"
                     /protein_id="BAE62830.1"
                     /transl_table=1
                     /translation="MSSHSAPIRRTQTDFPTQTSSPLRHGSTASTNSSIYSISTDSLA
                     PSRTSTVSSTGSMGSTPSFGHKRGKSEVNTMSADRFKADSRWSNAGTTYENVRRSLRP
                     LSQAPNASPSAVKQVAYGHSRSRTIYNPQFWKENRPQTPERRNGYHGEIEPLKEIESH
                     DVYAPPSPKSPQDFSPLAVSPQTRSPSKTQHSHSLSTPQPPPLTTTLSTPELETFQKS
                     STGHLRTLSKFAQSGETEEFALDSPSVVGLVGRRRLKRTDSVAGSGSANINRRKNASS
                     WAAGNWMDKQRQFLQAYEYLCHIGEAKEWIEEVIHKQIPPIVQLEEALRDGVTLAEVV
                     QAMYPNRMLRIFRHPKLQYRHSDNIALFFRFLDEVELPELFRFELIDLYEKKNIPKVI
                     HCVHALSWLLFKKGLVDFRMGNLVGQLEFEHHELEKTQKGLDKAGVSMPSFSGMAANF
                     GADPEPEPEPEPESEEDRIERELHENEASIADFQAQVKGAMLRLKLGNLMNNLWDFEP
                     FLIDLQSRIRGDWARQIVQYCLDMRAFAINLQAICRGFIVRCRQNDDMESYQAQEPGI
                     LELQTLIRASKARAQVQYLQSQMRKEESGIKEIQAAIRGALQRKSVSALYYDTRDAED
                     HVRLLQAAIRGALQRKTVGALYDDIRDAEDQVRLLQSIIRGGLLRNKLSKQCEETKSA
                     EDAIRDLQSLIRGFFTRRQMNAQYADMDSVQGNVELLQAAIRGSLARNSLSQMRDLLD
                     QQAPSIIAIQSGARALAVRKQQTILAEALGKAEDRFITLQAMARGNAARERLDCLRKD
                     LMEHVELLISLQSILRGRATRSFLASQQKALRDEEASILELQSMARGSLVRRRLEADA
                     EALQAEELTIIDLQALARAAVLRIEVGGILEQLDDCDDEVSQLQAHIRAMLVRVEVGQ
                     SLADLAAEEDVITDLQSHIRGHIIRSKFEEKRRYYRENMEKVIKAQSFVRGRIQGQAY
                     KSLTSGKNPPVGTVKGFVHLLNDSEFDFDEEIEFERMRKLVVQQVRQNELAEQYISQL
                     DIKIALLVKNKITLDEVVKHQKHFGGHVGSLLPNREIASKDPFDLKALNKTSRRKLEQ
                     YQVLFFLLQTQSQYLAKLFRRLRELNTSEKEYERTRHLMMGLFGYSQKRREEYYLIKL
                     LARSAREEIESFDSLHDYLRCNSFWTKLFASYIKSPRDRKFMRDVLGTVVKENIIDNP
                     ELDLESDPIQIYRSAINNEELRTGKRSRRPLDIPREDAIRDPETRATFIQHLQDLRDI
                     ADQFFTAFEELLYRMPFGLRYIAKEMYESLLSRFAGDDPGFILQTTGHWVWKNYFQPA
                     LIEPEKHGVVDRGLTQEQKRNLSEIAKVIAQVASGRLFGTENVYLQPLNSYIGDSIQR
                     LGHIWGDMISVQDAEAYFDIDEFNDLYAKTKPTLYIKLSDIFSIHQLVASEIHYICPN
                     PDDILKEVIRDLGNVKSNENELMSVNTSEISLTLNPKLAQVEDPEADVKALFMETKRC
                     ILYIIRVQSGANLMEIMVKPPTEEDEEKWMTLVRDELSANNTRRSAYSEAHTVVDIAS
                     MTYSELKRTALENILQLEQTGKIRRDNQYQDLLNAIAIDIRTKHRRRIQRERELESSR
                     STLARLNDQAAWLEQQFKTYNDYIEQAMVTLQNKKGKKRFLMPFTKQWDHQRELQKSG
                     KVFKFGSYKYSARNLADKGVLVHWKGYTERQWDRVDLTISSNEVGVFTIDGSSGPMMV
                     PGANAQVPLDDLLQAQFNNMQFLDFFEGQLRVNVNLFLHLIMRKFYNE"
     exon            complement(558301..559190)
                     /number=1
     exon            complement(559247..559525)
                     /number=2
     exon            complement(559577..563732)
                     /number=3
     CDS             complement(join(565905..565942,566013..566167,
                     566236..566346,566437..566601,566698..566898,
                     566953..567045,567137..567207))
                     /codon_start=1
                     /locus_tag="AO090120000223"
                     /note="dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /old_locus_tag="AO070311000020"
                     /protein_id="BAE62831.1"
                     /transl_table=1
                     /translation="MASAIGKEGTFQAPQEPQAQQKPGEATKLESSGTFVEYVGSGKL
                     KDKKVLITGGDSGIGRSVAALMAREGADVTISYLPEEQEDAEETKKLVEAENRTCLLF
                     PGDLSNRETCRQAVEEHMKKFKKLNVLVNNASKQYMCKDLAQIDLDQVEHVFQTNIIQ
                     MFALSKFALPHLSRGDSGTSGMVDYAATKGAIVGFTRSLAKQLMPKGIRVNAVAPGPV
                     YTPIQVDTRAPEEMEDFGAGSSIGRPGQPSEVATSFVFLASSDASLYYGQILHCYPLG
                     D"
     exon            complement(565905..565942)
                     /number=1
     exon            complement(566013..566167)
                     /number=2
     exon            complement(566236..566346)
                     /number=3
     exon            complement(566437..566601)
                     /number=4
     exon            complement(566698..566898)
                     /number=5
     exon            complement(566953..567045)
                     /number=6
     exon            complement(567137..567207)
                     /number=7
     CDS             join(568282..568471,568526..568834,569041..570182)
                     /codon_start=1
                     /locus_tag="AO090120000224"
                     /note="IMP dehydrogenase/GMP reductase"
                     /old_locus_tag="AO070311000021"
                     /protein_id="BAE62832.1"
                     /transl_table=1
                     /translation="MPISNGDALGRAMKAEIEDHTKALEVLEKDYTTRDGLDVDTLLD
                     SDKHGALTYNDFLILPGYIGFPASDVTLDTPVTKRVSLKAPLLSSPMDTVTEHNMAIH
                     MALLGGLGIIHHNCSPEDQAEMVRKVKRYENGFILDPVVLSPKATVGEAKELKSKWGF
                     GGFPVTESGNLRSKLVGIVTSRDIQFHPNLEDPVTAIMSTDLVTAPAGTTLAEANEVL
                     RSSKKGKLPIVDNDGNLVSLLSRSDLTKNLHYPLASKLPHSKQLICAAAIGTREEDKR
                     RLQLLADAGLDIVVLDSSQGNSMYQIEMIKYIKKTHPEIDVIAGNVVTREQAAPLIAA
                     GADGLRIGMGSGSACITQEVMAVGRPQAISVRSVSSFAARFGVPTIADGGVQNVGHIV
                     KGLAMGASTVMMGGLLAGTTESPGEYFVSNEGQLVKAYRGMGSIAAMEDKKAGAGSKD
                     SKASNAGTARYFSEKDRVLVAQGVSGSVLDRGSVTKFVPYLVAGVQHSLQDIGVQSLD
                     ALHEGVNNGTVRFEMRSASAMAEGNVHGLHSFDKKLYS"
     exon            568282..568471
                     /number=1
     exon            568526..568834
                     /number=2
     exon            569041..570182
                     /number=3
     CDS             complement(join(573822..573915,573968..575430))
                     /codon_start=1
                     /locus_tag="AO090120000226"
                     /note="Phenylalanyl-tRNA synthetase, beta subunit"
                     /old_locus_tag="AO070311000023"
                     /protein_id="BAE62833.1"
                     /transl_table=1
                     /translation="MASDLTNPLLDALSASDAPILSSEAFPSHPSLNVKSALDRLASR
                     QMVEYETIEREVAALTKEGEEIAANGSHEAKVFQAVVAAMEGLKIGDLPGIVGKDNAK
                     VGQGNAFKRGWIKKDGQLLRANTDSIVDETREQLLTVKKTQTLEDQKALGDLKRRKLV
                     AFQKELNFKISKGPKFAKEFVKEETDLTAEMLMNGSWKTAQLKPYNFKAKGAPTSSGA
                     FHPLNKVRQEFRNIFFEMGFEEMPTNRFVETGFWNFDALFVPQQHPARDLQDTFYISD
                     PPKADPPREDPEFDPHRPKSVQPASAASQEMPLDYKQYWEDVREVHENGKYGSIGYRY
                     PWSADESLRLVLRTHTTSVSTYVLHKLAANPRPARYFSIDRVFRNEAVDATHLAEFHQ
                     IEGVIADFGLTLGGLIGFMEVFFAKMGIHQLRFKPAYNPYTEPSMEIFGYHEGLGKWV
                     EIGNSGMFRPEMLEPMGLPKDMRVYGWGLSLERPTMIKYGVSNIRELLGHKVDLNFIE
                     TNPAVRLEKD"
     exon            complement(573822..573915)
                     /number=1
     exon            complement(573968..575430)
                     /number=2
     CDS             580656..584744
                     /codon_start=1
                     /locus_tag="AO090120000228"
                     /note="HAMP domain"
                     /old_locus_tag="AO070311000025"
                     /protein_id="BAE62834.1"
                     /transl_table=1
                     /translation="MAGADETLAAAAAILRGLARETPRSGSAPPFDFPLSHASSNGYD
                     TKVTKLPGDASSSKAAFENELEALVRRVQRLESQAVSHQTSPGTFPESSQSSLGSTER
                     EADFLWSFGLSRSSSQQLSNFSSTLQQQNSHRPHHPRRIEEPDEDIEEEESDEDEDLD
                     SRTRLVREEDISYLRNHVQKQAEEISFQKDIIAQVRDELQQQEEQTRRALTKVENEDV
                     VLLERELRKHQQANEAFQKALREIGGIITQVANGDLSMKVQIHPLEMDPEIATFKRTI
                     NTMMDQLQVFGSEVSRVAREVGTEGILGGQAQITGVHGIWKELTENVNIMAKNLTDQV
                     REIAVVTTAVAHGDLSQKIESRAQGEILELQQTINTMVDQLRTFATEVTRVARDVGTE
                     GVLGGQAQIDGVKGMWNELTVNVNAMANNLTTQVRDIATVTKAVAKGDLTQKVQANCK
                     GEIAELKNIINSMVDQLRQFAQEVTKIAKEVGTDGVLGGQATVNDVEGTWKDLTENVN
                     RMANNLTTQVREIADVTTAVAKGDLTKKVTANVQGEILDLKSTINGMVDRLNTFAFEV
                     SKVAREVGTDGTLGGQAKVDNVEGKWKDLTDNVNTMAQNLTSQVRSISDVTQAIAKGD
                     LSKKIEVHAQGEILTLKVTINHMVDRLAKFATELKKVARDVGVDGKMGGQANVEGIAG
                     TWKEITEDVNIMAENLTSQVRAFGEITDAATDGDFTKLITVNASGEMDELKRKINKMV
                     SNLRDSIQRNTAAREAAELANRTKSEFLANMSHEIRTPMNGIIGMTQLTLDTDDLKPY
                     TREMLNVVHNLANSLLTIIDDILDISKIEANRMVIESIPFTVRGTVFNALKTLAVKAN
                     EKFLSLTYQVDNTVPDYVTGDPFRLRQIILNLVGNAIKFTEHGEVKLTIRKSDREQCA
                     ANEYAFEFSVSDTGIGIEEDKLDLIFDTFQQADGSTTRRFGGTGLGLSISKRLVNLMG
                     GDVWVTSEYGHGSTFHFTCVVKLADQSLNVIASQLLPYKNHRVLFIDKGENGTQADNV
                     MKMLKQMDLEPLVVRNEDHVPPPEIQDPSGKESGHAYDVIIVDSVGTARLLRTFDDFK
                     YVPIVLVCPLVCVSLKSALDLGISSYMTTPCQPIDLGNGMLPALEGRSTPITTDHSRS
                     FDILLAEDNDVNQKLAVKILEKHNHKVSVVSNGLEAVEAVKQHRYDVILMDVQMPVMG
                     GFEATGKIREYERESGLSRTPIIALTAHAMLGDREKCIQAQMDEYLSKPLKQNQMMQT
                     ILKCATLGGSLLEKSKESRISSSGEMHPVHHGPDGKGSRPGMEGRSITASSTVNRGSL
                     ASPNVEKAEDLSMERVSQLNLPRLSKRTDLTNKQALLRSNSS"
     exon            580656..584744
                     /number=1
     CDS             complement(join(585801..587323,587385..587517))
                     /codon_start=1
                     /locus_tag="AO090120000229"
                     /note="predicted protein"
                     /old_locus_tag="AO070311000026"
                     /protein_id="BAE62835.1"
                     /transl_table=1
                     /translation="MSLVTLAVASWSLVYGVTAGVIPSGSMPTVSGITTSPRPSSSYP
                     GPCSPCPSLPSCPAATTVTVTVTATACVPTPTPSGGGGVTQPHPSPSFPVPPGTPGAG
                     TSQTSGISGSQPGPGPGPGPSPSLPGQSPCPTIPVGPGGGGSTSGGPPASTTVPVPTI
                     SSSVKPQPTSAVPSTITPIHPPTSTPVQPSPAQSTPPSSSPGKTKPIPPPVTPGKTKP
                     VPPTSTPVQPPPSVHPTTQPIPPSSSPGETKPMPPPSTPVQPPPTQSIPPSSTPGATL
                     PGTPGTPGTPVQPPPSVHPTTQPVPPSSTPGKTKTKPASPPGTPVQPPPSVQPPTSTP
                     EGTKPASPPGTPVQPPPSEHPTTHPASPPGTPGTTKTKPASPPGTPVQPPPSEQPPTS
                     TPEETKPAPSTPVQPPTSEQPTTKPIPPIGITTKPPTETPTETPTETPTGSPPGPPVP
                     TASPPGSVTPTQPSSSSEEGVKPTTTVPTVPPTETPEDDPPGDDPPGDDPPPKTTLVK
                     RAYPRWHIKGGKHWNFTKPKTGKKPKTTGRPFEPDYDQDEDEE"
     exon            complement(585801..587323)
                     /number=1
     exon            complement(587385..587517)
                     /number=2
     CDS             complement(join(588171..588336,588416..589797))
                     /codon_start=1
                     /locus_tag="AO090120000230"
                     /note="monocarboxylate transporter"
                     /old_locus_tag="AO070311000027"
                     /protein_id="BAE62836.1"
                     /transl_table=1
                     /translation="MSTNVRLHGDSHTGAIEQDSSRVSTTQGTPLDVAPLGLSAKPST
                     DAPNVPLSSVEDAGYRIPPAAQPGYDLPPEGRTTLEDGHDRPSLESQTDHSAHSAPMS
                     RVTTDADGNTYPEGGLEAWLVVFGSWAGLFAALGLVNTIGTFQAYLDNHQLEDYSSGS
                     TGWIFGMYAFLTFFCGVQIGPIFDAKGPRFLVFAGSVLVVVQMATLGLCTQYWHFMLV
                     IGVTGGLGASLIFTPAISAIGHFFNEKRGVATGIAATGGSVGGVTFPLILEKLFPMIG
                     FAWATRVVGLICLILVIISCLLVKSRLPKKPASKENVLPDFRIFREPKFALTTAGIFF
                     VEWGLFVPISYISSYALAHGVSSQFSYQLLAILNAGSFFGRWIPGFVADSLGRYNTLI
                     ATVALCLVCNACLWLPAGDSVPVMVVYSVIFGFASGSNISLTPVCISQLCKIENYGRY
                     YATSYTIVSFGTLTGIPIAGEILSRCNGEYWGLIVFTTCCYAVGLACVTAVKIIHVGW
                     RQPWALY"
     exon            complement(588171..588336)
                     /number=1
     exon            complement(588416..589797)
                     /number=2
     CDS             join(591747..592109,592126..592137)
                     /codon_start=1
                     /locus_tag="AO090120000231"
                     /note="predicted protein"
                     /old_locus_tag="AO070311000028"
                     /protein_id="BAE62837.1"
                     /transl_table=1
                     /translation="MSDTPSLHIALIAEQRSTFHNQGYSEEECAALPHSGETGSVLTT
                     LRELGHHVTLVPGVQSLVKHLAAGTYKDWDLAFNIAQGFHGSSREAQVPALLDAYQLL
                     YTFSDAATMALCQNKVHTKVVT"
     exon            591747..592109
                     /number=1
     exon            592126..592137
                     /number=2
     CDS             join(594062..594257,594314..594596,594647..594873,
                     594944..595836)
                     /codon_start=1
                     /locus_tag="AO090120000232"
                     /note="serine carboxypeptidases (lysosomal cathepsin A)"
                     /old_locus_tag="AO070311000029"
                     /protein_id="BAE62838.1"
                     /transl_table=1
                     /translation="MRFQGVVPTALLAISCTDKACASKHGRSDQPVHEPSVLDRRTSL
                     SSEERQLRSHDNFRFLNDETRPYLVESLPDVPFDVGELYSGSVPIEKGNSSRTLFFVF
                     QPTVGEPVDEITIEVNGGPGASSLEGFLQETGRFVWPPGTYAPVINPYSWVNLTNMLW
                     VDQPVGTGFSTGTPTATTEEETSRDFINFFKNFQDIFGIKKFKIYVTGQSYAGRYVPY
                     IAAAMLDQNDKDYYDVHGALVYDPVIGQFDYVGQQVAAVPTVQENANIFNFNASFMNQ
                     LQSLHKSCGYQDFIDEYLTFPPSGVQPPKSFDPTSDADCNIYNMITDAAYRVNPCYNV
                     YAINQMCPFLWDVLGGPTKLHYLPAGATVYFDRDDVKKAMHAPNMTWSLSSLQPVFVG
                     GDAGVGRLGDLSANPIERVLPQVIEATNRVLISHGDYDFILQTNGTLLAIQNMTWNGQ
                     LGFQSQPSTPIEIGLPDLQYAEVFEENDLFSWRSGQGVMGIQHYERGMMWAETFQSGH
                     MQPQYQPRVAYRHIQWLLGRIEEL"
     exon            594062..594257
                     /number=1
     exon            594314..594596
                     /number=2
     exon            594647..594873
                     /number=3
     exon            594944..595836
                     /number=4
     CDS             join(600265..600538,600658..600757,600816..600828,
                     600886..601103,601158..601307,601361..601794,
                     601856..602421)
                     /codon_start=1
                     /locus_tag="AO090120000234"
                     /note="synaptic vesicle transporter SV2 (major
                     facilitator superfamily)"
                     /old_locus_tag="AO070311000031"
                     /protein_id="BAE62839.1"
                     /transl_table=1
                     /translation="MVFNPFKKHDHDFPGVVVPLGSAPAHSHPNPSLHEKDSGHDEKH
                     DARSDKAPSEENGVATSLPDNAHLTLESLRAEVETDIAASGHDSAYDRKAKVINRAIQ
                     DIGMGRYQWELFALCGCGWLADNLWLQGVALTLTQMSAEFGVSESRVRFTTCALFLGL
                     CLGASFWGVASDVIGRRPAFNLTLLITSVFGLAAGGSPNWIGACALFSCLGLGVGGNL
                     PVDGALFLEFLPFASGNLLTMLSVWWPIGQLISSLLAWAYIPTYSCASDLPACNSVAD
                     GVQCCTKQDNMGWRYLVLTLGALTFAMFFCRFFLFHLYESPKFLLSRGRQTEAVHAVH
                     GIAHKNKKQTWLTEDILNEIGGYPEEVEKQTLTVKEIIARYLSKFSLERIKPLFGTKK
                     LGINTVLLWFCWATIGMGYPLFNAFLPQYLKQSGGGAEQSTYTVYRNYAITSIVGVPG
                     SILACYTVDIKYIGRKGTMIISTLITGVLLFCFTASTDPNVQLVCSSLEAFFQNIMYG
                     VLYAYTPEVFPAPNRGTGTGIASCLNRIAGLCAPLVAIYSGSANPNAPIYASGALMLA
                     SFVAMCCFPIETRGKQSL"
     exon            600265..600538
                     /number=1
     exon            600658..600757
                     /number=2
     exon            600816..600828
                     /number=3
     exon            600886..601103
                     /number=4
     exon            601158..601307
                     /number=5
     exon            601361..601794
                     /number=6
     exon            601856..602421
                     /number=7
     CDS             complement(join(603462..604626,604684..604928,
                     605249..605692))
                     /codon_start=1
                     /locus_tag="AO090120000235"
                     /note="Ca2+/calmodulin-dependent protein kinase, EF-Hand
                     protein superfamily"
                     /old_locus_tag="AO070311000032"
                     /protein_id="BAE62840.1"
                     /transl_table=1
                     /translation="MSTIQNLKNFIRHGKQARLVTPHAEPTTNVSPIHAEHQRQPQGS
                     YPPAAGNLDAIDSRLGNGQAQAPQKSSAETQSRRARDLEIEQIVAEERSQRNKMPKYP
                     GLERWILTDKMGDGAFSNVYRAKDSTGEHNEVAIKVVRKFEMNSNQRANILKEVQIMR
                     QIDHPNIVKLISFSESRQYYYIILELCPGGELFHQIVRLTYFSEDLSRHVITQVAKAI
                     EYLHETSGVVHRDIKPENLLFYPIPFVPSKNPKPLQPGDEDKVDEGEFIPGKGSGGIG
                     VIKIADFGLSKVIWDSQTMTPCGTVGYTAPEIVKDERYSKSVDMWALGCVLYTLLCGF
                     PPFYDESIQALTEKVARGQYTFLSPWWDDISKSAKDLISHLLTVDPEQRYSIKEFLAH
                     PWIRGSDEETQAATDAPPLTTPLPSARQQPLDAFAADQAPYAPASARLSDQPSAGLER
                     PMDFRSPGAINLREVFDVGYAVHRQEEESKRLKTSRGRGANPTTGFQSALNPLNEDYD
                     EDGPQVTYQPIHQNEYAAPKVHKGSQQSREVAAMEAKLRSTNLGAPPSAAAQVRQSHQ
                     PRQPQQGYGTHSAKVAAAAKQNIARSSRQPFELSLDNATLLERRGRRHQVV"
     exon            complement(603462..604626)
                     /number=1
     exon            complement(604684..604928)
                     /number=2
     exon            complement(605249..605692)
                     /number=3
     CDS             608512..611172
                     /codon_start=1
                     /locus_tag="AO090120000236"
                     /note="predicted protein"
                     /old_locus_tag="AO070311000033"
                     /protein_id="BAE62841.1"
                     /transl_table=1
                     /translation="MPGIAGTSPASLEHLGRPLFRAHKSLPRRPNGDPSVHVINASPS
                     DPIVDTSNGGAHATAPTLPLTPPGVPSDESPTPKELEMQKLASPHSMSGTVTPSKPSH
                     PPTPETTPPRLPATTYRPTIGGQFRQASCSSRAESFQTACEMISDGETETPHRSSPSS
                     RQSTRQRSLQKSVHSEPNEARPEDTTPVGDHSDAILLKPSRYEGINGEWATENSDRYA
                     ASRQRRRRSRNHSSDTLPTANVPELPQDTYSTSARDLDVPRTRERNVRVRVRDAQDTG
                     ASPYPEQYPEQIDWNPPEGRTDSYNHDDTRRFSGVSTSSTIEVMIVDTPEPYKPSLRH
                     TEKRVSLRSTSSPITKSERGSLVSNPESQHRLVHKAARISEHDRRSIASEMSISESST
                     QGGPRQHVEVVPVVVIPERHSSLRSSASTSRKPSNASSRPSSRRTRTRSGSRPESLDR
                     PPQKKRTLSNSSAPAHQDTDFRGRSLGRPIIPPRSSSLSAPTSQNNSRATSLTSMSSR
                     NHPSAMENEKQNQQPEPPMPEPTKAPQVRDRADVLKTQSIIIGVEDMAHLRSPSGAFT
                     LGSIPSSSPGLVEISEATLVPFFPHNNESLLLVDPQHRSGPQGLAIRVEYQGSPAKPE
                     LPQSPGPVEVDSPLQNPRQPPNPPVCKVSPPTPVNEADREPERATGNGQTGEQLPRRF
                     GSVRRPWKLRPRSDSFNSIARSFSVTSAKNRMAGKDIDSKLHPFWRPRRFWEDTSESE
                     DHSPREQNFCSPALEADQVISNSLGMPQQRVVFQGPPISPRSIDTKRSFDEAASRRQA
                     RDSLVGSRVFMPEALYSQTSLHQRRYRSLSWWRLRLRFGSVRSFRKRLRRSWQQRGEG
                     KRQARREALKQSIGEAVLVDSSMQTRSMVQ"
     exon            608512..611172
                     /number=1
     CDS             complement(611603..612046)
                     /codon_start=1
                     /locus_tag="AO090120000237"
                     /note="predicted protein"
                     /old_locus_tag="AO070311000034"
                     /protein_id="BAE62842.1"
                     /transl_table=1
                     /translation="MTFQTTRPSSTLLVPSKRPLSAPRNPTLSNTTATYPPIHIRSTS
                     TSTSTPAVAESKSKSKSISENQHVELNSRPTTVEYDFSSGPQPFLDPALWENVKAVDR
                     LRREGEGLGEGDVYVKEKEEELRREREREAEFGGMAVRGRMGRWK"
     exon            complement(611603..612046)
                     /number=1
     CDS             join(612333..612375,612435..613225,613279..613542,
                     613597..613761,613812..613898,613952..614008)
                     /codon_start=1
                     /locus_tag="AO090120000238"
                     /note="metallopeptidase"
                     /old_locus_tag="AO070311000035"
                     /protein_id="BAE62843.1"
                     /transl_table=1
                     /translation="MGSKTFEGEGQRGGNDPSNSTSPNSAGGEPRGAHLSRDGDGSLG
                     DGDGDDGADGDEKDGAVTTTPLTEQQPSSETTSKKKKRRKPKKKISALKQSSPPRVPL
                     DDLFPTGQFPVGETHEYGSVVEGTARTTSEEVRYLSRNYLQDDSVLTDYRKAAEIHRQ
                     VRHWTQENVRPGQTLTEIAVGIEDGVRALLDNAGLETGQCLQSGMGFPTGLALNDCVA
                     HYTPNPGQKDIVLQASDVMKVDFGVHINGWIVDSAFTMSFDPTYDNLLAAVKDATNTG
                     IKNAGIDVRISDVSAAIQEAMESYEVEIGGKVFPVKPVRDISGHNINRYQIHGGKSIP
                     FVKNSSQTKMEEGEIFAIETFGSTGRGSTVEGFGVYGYGKDPNAPKKVSSPLASARSL
                     YKTINENFGSIVFCRRYLERLGVERYLAGMNSLVNNGIVEQYAPLMDMKGSYSAQFEH
                     TILLRESCKEVVSRGNDY"
     exon            612333..612375
                     /number=1
     exon            612435..613225
                     /number=2
     exon            613279..613542
                     /number=3
     exon            613597..613761
                     /number=4
     exon            613812..613898
                     /number=5
     exon            613952..614008
                     /number=6
     CDS             complement(join(614174..614209,614270..615700,
                     615759..615881))
                     /codon_start=1
                     /locus_tag="AO090120000239"
                     /note="predicted protein"
                     /old_locus_tag="AO070311000036"
                     /protein_id="BAE62844.1"
                     /transl_table=1
                     /translation="MQRGTSPFTPEFDDLVNTLLAEWHVPGTSIAILDGPDTFTKGYG
                     ISKYPDTPATPQTLYYTASTTKSFTAAALSLLIDDNTNTTNPLTWTTTLTTLIPSDFI
                     LPNTHATETITLEDALSHRTGLPEHSYHFCPDNSLSPKDEVRRLRHLPMTAAIREKYM
                     YNSFMYTAVSHAIETLTGIELGVFLREEIWGPLGMDATFWKLSDVPDGGLDGEVMAGG
                     YVWDDSSSSPSSGSTSGSTSTSSGFVEIDYPEYTELSGAGCMISNVEDYAKWIRCMMY
                     QNEPLSKKGHAALTEPRIASMSGATNPFPGPHLYALGWRVDYYRGEKIVWHTGSIRGF
                     GSVMMYLPDREWGLVIMGNSTMTSNQMQQVLYMDLLDGLLGTPVRERVDWGAVIREKK
                     SRRQEELACARERLYPELPGPVLRPALEVREYVGSYWHPGYGGMDLGLDGEGTGLVAD
                     RRSQEFSMLIALEHVSGELWLARLQEMYKDPRDYEVVRAEFRLGSDGVREVGVDLEPT
                     MDGKLIWFRRERAECKSSWLL"
     exon            complement(614174..614209)
                     /number=1
     exon            complement(614270..615700)
                     /number=2
     exon            complement(615759..615881)
                     /number=3
     CDS             complement(join(616612..616919,616976..617509,
                     617560..617825,617889..618326,618379..618833,
                     618907..619104))
                     /codon_start=1
                     /locus_tag="AO090120000240"
                     /note="predicted protein"
                     /old_locus_tag="AO070311000037"
                     /protein_id="BAE62845.1"
                     /transl_table=1
                     /translation="MGGVSHPSASATGGPDGVGPARKRTVAMAGLDSSPGSVDDVEEN
                     DLREEKKRQPVKRACNECRQQKLRCDVVQDPWMDCSRCRRLKLDCKIESNFKRVGKRS
                     RNAEMEREIIELRKQIASVQANAATSMPQQQPPSIQSTQHTPKQEHSSHVSPAGVYHT
                     PSGMSSDQYMGSHEAVASLLDLRSGFDGSNYMRNGSQHFKRIEDVVVVPERVTELFDL
                     YFTFYHPFLPFLERGQSPDEYYNTSPLLFWTIISVGARRYQPDTHLLNSLAGPVSRLV
                     WSTLADIPQSYHVVKALCLLCTWPFPTSSTSTDPTFMLCGMMMQVAMQLGLHRPSYAQ
                     DFSKFRVELIEEELKDKVRTWAICNIVAQRVATGYGQPPSTLYDWTLSSESLDPNYKL
                     PEGIRARLQIEKFCDQVTRALYTNHRDPVGLCNDQERSTLISFFSRDFDELESQLKAQ
                     NDCITDLYLRAANLHLHLSVFFDDTSEKDYRDRLLSLYVATRTFLEAAMNLETEVGPV
                     LSYTPYYIYQMMVAAGCTLLKLGTSFFAAHINMDYTKALFNRTIWAIRGVSVSSNDLP
                     ERLAEVLAQMWRLQSTPSPKPTTESSEMDDSLMLKVRCRMSMSLLFDSVWRWREDART
                     KDRNLEAYLKNPTNPDSNAESSAASSVGAAHTSNSTPGIGGDPSLAPAPILPQATLGV
                     QSGSSVPGLPSGLMEPNYEVFDPLNWLLDGLVDLPYSYSTISGMEAQGIA"
     exon            complement(616612..616919)
                     /number=1
     exon            complement(616976..617509)
                     /number=2
     exon            complement(617560..617825)
                     /number=3
     exon            complement(617889..618326)
                     /number=4
     exon            complement(618379..618833)
                     /number=5
     exon            complement(618907..619104)
                     /number=6
     CDS             join(620315..620792,620855..622674)
                     /codon_start=1
                     /locus_tag="AO090120000241"
                     /note="predicted protein"
                     /old_locus_tag="AO070311000038"
                     /protein_id="BAE62846.1"
                     /transl_table=1
                     /translation="MKSSPFEKITEDVSEAEPPAYGQVDQPPLVLPPLDLFQTAGPPV
                     CSTVTQDQCIAHLRFLAALADLRDNITNINPLFQINDPDPAIFGDSTNEAFARVKEKR
                     WAVYTARAVDRYTTWWQECIQSPDRAPKLHDLEDDSYDSITEHHKPYNWSPKTMPPLD
                     ILMVWHAHMLNPRVFLEDCIRGGAMGFWTAGFPWELVNSCIDDQSLEYHAGQAAVAHF
                     QQKTGLPWDNLKCSSKKPLSCPSCKHELSVPWTEAQISAPVDEAFENCRGFADKNFQK
                     KCPVCKFEITHETLKTEKFRKDVRAFWASDVPMPGTFYDVRGVPKAATISSRKKRQSL
                     FPNRLIKAIGTIFLSQTDPTDDDWKSMAALRDKLQSRIKSRDVMRRVNPDSGISSLFP
                     EEKVAFRRMMARYWDNHTPFALDLVGAVIRQGTFVQKMDNIDWLHSPTVKATMDRLIK
                     KYEVFFQIMAQNPRNMAVPTLDVDLAWHTHQLSPSRYFDYSVFTTRQHTRVPKFIDHD
                     DKVEETKLSDGFEWTSKMYKKLTKGDIYSECTCWYCEAIRAPDLSDGIFVSSSTSRAR
                     EAAANLHNRPDISSDPEKNPHISAHSAVPAETKKTRAGFDPRYVKHLKLQSNYQKARR
                     RAEKRDRKQGNKEQDRSSDATLYAMAYGYPVYVPYYAPYVADPCVHSNAYPSNPGCMS
                     FVSGAHGNCAAGTCGGAVAAGGCGGMGGGCAGGCAGGGGGGAAGGCGSGGGAGCGGSS
                     SGGGGGGGCGGGGGGGGCGGGGGGC"
     exon            620315..620792
                     /number=1
     exon            620855..622674
                     /number=2
     CDS             complement(join(624666..624691,624741..624792,
                     624869..627437,627477..627658))
                     /codon_start=1
                     /locus_tag="AO090120000243"
                     /note="predicted protein"
                     /old_locus_tag="AO070311000040"
                     /protein_id="BAE62847.1"
                     /transl_table=1
                     /translation="MEEDVRLPSAERLDGPHNDPEQLPSTGPSQQQNGSLGKSQSRSG
                     ELISSLFNSLPRTVIEQATFCARQQRRLLYSLFSQDKSCFNRLCSILYAVDANTFASL
                     AFLNRKWRRISDSPLLYAHHLSRCPSFSLTAKATSDVVTSDDLAILKLKFGAEIRRNA
                     FEVFLRPRQTLVKLISTSMSSSTAFPHGEAFRFAFSPNAQLVLCISSSRIIVLDVASG
                     SAVVRHELKTWRRPLNATILDDGSLLAVVSSSHQVNIYSLSNEEARHVQNIKLNDVPQ
                     ALALSPTGGVLAIAYTDRIEVYAIGEGTLATERRAVRCTGVDSITFSSDGVMLLGSSG
                     DSQNTSLVTITVPFYSEPVTDISAREAHTRMWTTQILFPEIIQNYSHACLLPLHAEGD
                     GSWILGFDKEAAAFRAVGANNVNSGTVYFVSPTSGSGLQESPPIMLPTVDCTGELAAL
                     GFQGSGLWVYGIPDRLDIAPSSTFAAALCVSDNGPSHREEEMMPLPDNARRLQHSIAK
                     PKMLIRGHRISDISGITAASWVRHADTSADHRRLVAVAPGGISPPTIGEEDVPVDGGR
                     VLLLDFERSPKDGESTEISIEIGETEPKMLHEPNTSLDTEVELERRRTRLHRGNSSHR
                     ARTLARESYPAAISMSQSPPLVIRRNSSYFSVSSNDVGDGDTPPVPDTPYDNTQPRSQ
                     DTLRRAATAAATSRTRYNPRYRDEPRRVLDARQVPPIFQVPHESDADNWVPPPPPYTR
                     EPDAPLPEYLRRTLLPTRTEPVQRVSDAPDQLQRSQTTRLEDMAEEPLPRSPLQRLNT
                     ISGSRLASLVRRTTRASEAPGLSRTQSNLVRRASTHPYSQNGDVPNVPSVPLHLQPQT
                     TATSQEIDQNTAGILDAANLDYAAAATTTTTLPAPAQQASLQETQTESVVNPAELLEW
                     QDAARSTLLPRFHAIHGYIPGVGNYTTA"
     exon            complement(624666..624691)
                     /number=1
     exon            complement(624741..624792)
                     /number=2
     exon            complement(624869..627437)
                     /number=3
     exon            complement(627477..627658)
                     /number=4
     CDS             join(630213..630292,630355..630438,630485..630776)
                     /codon_start=1
                     /locus_tag="AO090120000244"
                     /note="predicted protein"
                     /old_locus_tag="AO070311000041"
                     /protein_id="BAE62848.1"
                     /transl_table=1
                     /translation="MPTLRRRNRAIYLFTPERELPGILAALQRLPPHIHRHSSRPLRV
                     RNHRHGRSSLLEEEDWDVADMCLDHCDRILNRLPGNGSTPDLNFSGVVQPDNCLVNPA
                     AISLPETQTNNDIVDDMMSISGTFGTMDGFPFDMTGIWDVSVFQDVNLP"
     exon            630213..630292
                     /number=1
     exon            630355..630438
                     /number=2
     exon            630485..630776
                     /number=3
     CDS             complement(join(631120..631704,631766..632497,
                     632556..632810))
                     /codon_start=1
                     /locus_tag="AO090120000245"
                     /note="TFIIF-interacting CTD phosphatase, including
                     NLI-interacting factor (involved in RNA polymerase II
                     regulation)"
                     /old_locus_tag="AO070311000042"
                     /protein_id="BAE62849.1"
                     /transl_table=1
                     /translation="MLSRAVLPLTRPNTLASAVRLSALPITHSRWYAKNNKPKAPYKL
                     PESVKSPKADQSSQQEYSASQAEFDTNADAQRNTANQTAESAESSQTGAEKAAPQQPL
                     PDLTQGIPSTLAAELEARSKGRGPTALNLTEDPSRSEDYTDDGHGGDIPKDGYVSSLD
                     RRRARMANLMYALFLLAGAGGAAYLGRNWDTEEEARLHPDVPSGWSFGLWYSRVKARF
                     GDITSYYKDPAFPKLLPDEDPNLRQPYTLVLSLEDLLVHSEWSREHGWRVAKRPGVDY
                     FLRYLNQYYELVLFTSVPSMMADQVLRKLDPFRIIRWPLFREATRYKDGEYIKDLSYL
                     NRDLSKVILIDTKEEHARLQPENAIILNKWHGESKDKTLVALIPLLEYIAGMGVEDVR
                     PVLKSFEGTDIPVEFAKREKAMRERFQKELGEEQQKRPKFSMGSLASAFGLKSTRTLD
                     GETTPSEGLAQGKMLWDQIRERGQKNYEMMEKEIRENGEKWLAEMAAEEEKARQEQMN
                     QMKGSLTSVFGAGKQ"
     exon            complement(631120..631704)
                     /number=1
     exon            complement(631766..632497)
                     /number=2
     exon            complement(632556..632810)
                     /number=3
     CDS             633503..634399
                     /codon_start=1
                     /locus_tag="AO090120000246"
                     /note="predicted protein"
                     /old_locus_tag="AO070311000043"
                     /protein_id="BAE62850.1"
                     /transl_table=1
                     /translation="MDSISEALQKVHLESPPPKSDQVELREAEGEENEEDIEKTAPLG
                     PFPFFDLPSELRLRIYHILLFTPRRKRAHLHTKGSVGASSKKNPPLSPTSHRINLFLV
                     SRRVHNEASDYFYTTQTFRLFSLQDYSRMPTVSMIPPRYRPSIATIELILGSSWTAPP
                     SSWKVTRRLGLEDMVRAKTFKVFIEVDPSHPVFEGFRISKNFYTEFSGGILRDVLAKM
                     PSLEYVEFDGWPSVRKNGALMQRLLHEAKAAKKKIAWGPERGWTDCDEEDMETPMVYE
                     LKSMERGRVNDVPPQTDSLFGP"
     exon            633503..634399
                     /number=1
     CDS             complement(join(634769..634917,634977..635512,
                     635573..635826,635968..636087,637459..637635))
                     /codon_start=1
                     /locus_tag="AO090120000247"
                     /note="26S proteasome regulatory complex, subunit RPN11"
                     /old_locus_tag="AO070311000044"
                     /protein_id="BAE62851.1"
                     /transl_table=1
                     /translation="MSSHTKVEAPQTVPGKTVTTALENHCFWSVPFHNTLDDGLKNTL
                     IRNVVDTIAEWKVYGEAILYLYIADTYIPSAAMERLGRMLQAAQSMGMGGAAPGGDTP
                     NLIDNSETVHISSLALLKMLRHGRAGVPMEVMGLMLGEFVDEYTVRVVDVFAMPQSGT
                     GVSVEAVDPVFQTKMMDMLRQTGRPETVVGWYHSHPGFGCWLSSVDINTQQSFEQLTP
                     RAVAVVVDPIQSVKGKVVIDAFRLIQPQTVVMGQEPRQTTSNLGHLNKPSIQALIHGL
                     NRHYYSIAINYRKTGLEENMLMNLHKHVWTEALQMKDFHEEGEHNVDRMKQLVSLAEG
                     YEKRVKEETELSKEQLKTRYVGKVDPKKHIEDVSQQLIEDNIVAVSRQMIDKEASVAR
                     QSNGKGAQNGASMEVDEDL"
     exon            complement(634769..634917)
                     /number=1
     exon            complement(634977..635512)
                     /number=2
     exon            complement(635573..635826)
                     /number=3
     exon            complement(635968..636087)
                     /number=4
     exon            complement(637459..637635)
                     /number=5
     CDS             637986..638873
                     /codon_start=1
                     /locus_tag="AO090120000248"
                     /note="predicted protein"
                     /old_locus_tag="AO070311000045"
                     /protein_id="BAE62852.1"
                     /transl_table=1
                     /translation="MTDVPRDPLVEGMDDEADAILDDLDEDENKDKRFTKRRFDQYVE
                     KPGELSDSEDEEENAANGVRRQPGIMKRRNQVNYRNLDVESGLESGMATPADASSVPD
                     DDMDTTADAKMGDAPQTETEAPATPSVAEPPSRAEEASAAVPTEMAIDGQEQAAPSAP
                     ISRQPSPKAQDEDITMEDAGNAAPETEQQEQSVAPSEAQAEEKKPAEEKPATDKPATE
                     PSSPADAQAPQKESVEDSGPAEASEVAETVEITETKEKSPEAPKDVPEPAKAEQESPK
                     EVKESTGEPQEKEPTKSEA"
     exon            637986..638873
                     /number=1
     CDS             join(639418..639431,639759..639806,639941..640187,
                     640263..640340,640402..640434)
                     /codon_start=1
                     /locus_tag="AO090120000249"
                     /note="60S ribosomal protein L14/L17/L23"
                     /old_locus_tag="AO070311000046"
                     /protein_id="BAE62853.1"
                     /transl_table=1
                     /translation="MSGRGRGSSGNKLKMSLGLPCGAVMNCCDNSGARNLYIISVKGT
                     GARLNRLPAAGVGDMVMATVKKGKPELRKKVMPAVVVRQSKPWRRPDGIYLYFEDNAG
                     VIVNAKGEMKGSAITGPVGKEAAELWPRIASNSGVVM"
     exon            639418..639431
                     /number=1
     exon            639759..639806
                     /number=2
     exon            639941..640187
                     /number=3
     exon            640263..640340
                     /number=4
     exon            640402..640434
                     /number=5
     CDS             complement(640934..642610)
                     /codon_start=1
                     /locus_tag="AO090120000250"
                     /note="cell division control protein/predicted DNA repair
                     exonuclease"
                     /old_locus_tag="AO070311000047"
                     /protein_id="BAE62854.1"
                     /transl_table=1
                     /translation="MFLRRLLSRVLSLLLPLAIASSLYLYFYPVFHGCAFPLPRDDHT
                     GLLSNSFTSALRQHFSPQSAENPAIFRLLVLADPQLEGDSSLPKPEDELSARIQHHWA
                     TVKSSVNKTEPRQILTAISTAVDSLASEDIPRAFRAARKRLDLLGNDYYLAHIYRTLH
                     WWSRPTHVTVLGDLIGSQWVTDEEFDRRGRRYWERVFKGGERINDDITATGARNYSGS
                     EGQSTELETLNATHSAWTQRIINIVGNHDVGYSGDASEARIERFERVFGRANWDVRFQ
                     LPLEQVDNATAPLSAPPTLHLINLNTLTLDSPALSSDIQSHSYAYINDLISHRLYPVE
                     DRTTFTLLLTHLPLHKKEGICTDGPYFTFHESDDEDGPDDVPRFKEGGLKEQNHLSDH
                     ISSSGVLQGIFGMTGDESGPGGGRGRNGLILTGHDHTGCDVVHFVNRTIDTTTAEDSE
                     PRSWKWDAKRYDNAVDNSTPAIREVTLRSMMGEYGGNAGLLSLWFDTTVNEWKYEITM
                     CMAGVQHIWWAVHIVDLLTCILLVGYILAGSGSKPSVTKKIEVGQEKKRN"
     exon            complement(640934..642610)
                     /number=1
     CDS             complement(join(643117..645761,645921..646064,
                     646137..646194))
                     /codon_start=1
                     /locus_tag="AO090120000251"
                     /note="predicted protein"
                     /old_locus_tag="AO070311000048"
                     /protein_id="BAE62855.1"
                     /transl_table=1
                     /translation="MALATPPRNVHPGDLLLVVHDFEARGPDELNLRRGEKIELVELD
                     DGFGDGWYLGKDLNTGTQGLFPGGQEIFASPISGESTPQASRRASTSDMSAPDIDDST
                     APTPSPKQQQRSSSSPLPTSKMAIDIQKSIRQSIDGHLSGQDSPVMNETLSVIDEHIT
                     DLSTPRHSVTASQDSKTVNDSASEYSSTFEHRMSYINGHETDEEEEKQPTEEQVRRWN
                     HLETAKHLRQLGLEAKHCDIFEDQEITGDVLLDMNQDFLFMKEFDFGVMGRRLKTWHK
                     VKAFQEEVKGIPQQQSSRGSSFATPQDERAPSRASHTGPLFPRIPNLRGPNGPTQHPR
                     LVSSTMQSNTGSPLTSQAPVWMDHSRRPSAASVREINHSRRHSSIDTTNRYSGVGDSS
                     PASHHKKSSFDRGWTLNGASGSQRRPGSALGAPNETALPQSVFHVAESNGSDSATAVS
                     DDLDRGYFSGPEGDTRKNRRVLQKRSSTYGSVSTPSSIPDEHFQLKVNKRHSRINSAD
                     SIRDAAQMTPPTAKASPPRGRFRSLSTRASDRHGQQSSNPPSAEEKSSGSGFFAAFSL
                     GGKNNEEQSQRSSTLPLQGIKNAGPKFRRAVGLRAMSEAVKGIDTSVAPPSPSKDPES
                     PSTRTGSTTPSTTKSSERHSTDGSGKAVEGGASMPRARTLRSGTKSKKDTSAYTQGLE
                     KKTPKEQMKGCDFSGWMKKKSSNLMTTWKPRLFVLRGRRLSYYYSEDDTEERGLIDIT
                     AHRVLRADNDPLIALHATLTGSTASPTSPSGSTADGPSSDKASGSESSLRGSKPVGEG
                     PFFFKLVPPKSGTSRTVQFTKPAIHYFQVDSIQEGRLWMAALMKATIERDMELPVETT
                     NKQKTVSLKEARLMNQRPPALLPTTPATQGTEEKDEHLTTTTEESGLMIQGLGDEQVP
                     THGDDDEKKRVSSPLGGLGVGPPSLLPESVAKVD"
     exon            complement(643117..645761)
                     /number=1
     exon            complement(645921..646064)
                     /number=2
     exon            complement(646137..646194)
                     /number=3
     CDS             join(648784..650581,650845..651188)
                     /codon_start=1
                     /locus_tag="AO090120000252"
                     /note="predicted protein"
                     /old_locus_tag="AO070311000049"
                     /protein_id="BAE62856.1"
                     /transl_table=1
                     /translation="MSPTTHLPNVNSNPNSVESSNSTANIFLGGVRRSWMLNAANCSS
                     SLSCHSELPDGSATTAPSDKVVTDTDAAAAAGRTRQQGMRESSSLRVLPVPSQSQENA
                     ASVTTAAAAPLPPQSQPNVMSPVTPGHAQQQFQQQSPISQDSSWHVVSDRAGPDPPLA
                     ATATTTVVSRRSASRTLQTPIVVPSPIYDSSSNIVNRNGASPSVTSFPSPHTVGPAPL
                     PHQPQVGAAVSTSSPVGVGAVNIIAGNPTRAGHQRERSNISLQLQRRDSHASHSHSPA
                     LSPAFPPSAASPRQQMVQPPNTSRRNPFHNPLLDDAFYEQSLRTLENFQHQLKQRDCL
                     GNVEQPRTQLLYQACAERDPMFLAIHQVYCLHSLAPQEFFQLPGYSVPQECGLDVIRR
                     LLVENSRVSGGFLRWSAQFPAPLAGLIQSSRYGQAVEQAGQCLRLLGEKWPMYVKEVR
                     KREFPPLVDELVKNFGITSGALAYTVFLSTCRTLPGSKSEEHLKAVWELDLRYYQQRC
                     ASPRLVSNAQIQEETQKVVQAYRSVCAAAVTHQPGPPPNLPYGPMSIGSERDSMLHPV
                     ARPTSTGSPQVRNPQMTLPLPNQPGPLVSQGTMIVRSNVESNRCSNPSNCSAHGISVP
                     NCASSTGRQNSVNATRGPSPTTGNCRATSARATKQWGWAVHATSESEASYSTPNLSIV
                     SATASSTSPACPSSSPSRLPSIEYNTAPTAS"
     exon            648784..650581
                     /number=1
     exon            650845..651188
                     /number=2
     CDS             complement(join(653280..653990,654073..654326,
                     654386..654601,654649..654673))
                     /codon_start=1
                     /locus_tag="AO090120000253"
                     /note="predicted protein"
                     /old_locus_tag="AO070311000050"
                     /protein_id="BAE62857.1"
                     /transl_table=1
                     /translation="MERYLVPKPSDSDARSPSHSPELNERGLKEGISTDADVPETVLQ
                     RVDTLPNEDTGSSPRAHQRRPSDALPDVTETVPDGPDAPSPLQDSLPQQSHDKQETPV
                     AGDDSANQAATDDFDDFAEEQDMGEDDFGDFDDFDDGFQEPSTEVSDEEPVVQTPQLH
                     TLPTVPPLVDFDSCQSLPDVFAALDEPLDRLFPASNEVSSLPPIEPLRNNSAIFNTER
                     SLSLWSQLVAPPPLQPQNWVKSRIRRLFLVSLGVPVDLDEILPASKQKKLVLPSINPG
                     GPDATSGTHSRSGSQVRKDDVQSGANSPSTSGPPRNRASWRREPSPPPQLDLPAVRRL
                     CSTTDAALDGLTDGELQGHVKELENVTLRASSVLEYWLKRRDGLVSEKEAFEGVIENL
                     VNHARRVRK"
     exon            complement(653280..653990)
                     /number=1
     exon            complement(654073..654326)
                     /number=2
     exon            complement(654386..654601)
                     /number=3
     exon            complement(654649..654673)
                     /number=4
     CDS             join(655629..657382,657462..657585,657636..657845)
                     /codon_start=1
                     /locus_tag="AO090120000255"
                     /note="nuclear porin"
                     /old_locus_tag="AO070311000052"
                     /protein_id="BAE62858.1"
                     /transl_table=1
                     /translation="MSFSFGAPASNGGSGKSLFGTAGNSNTGSSPGSLFGNIGASTSG
                     SSSPSMFGTSSATGGQGSTLFGGATGSAATPSSGTTAFSFGTQNKPAGTTQAPSLFGS
                     GSQTPKTNETPSSGQTPAGGLFGNAAKPAGGLFANATSTPGQSGGSIFGNTASTTPAG
                     PPPQGGATGQPQSLFGQTAQKPGGLFGNVNTTSSSSTTPTTATAPSTNPLFGGAPQTQ
                     TQSNGGGGLFGSNTQNTQQKPLFGSTPAAPAGGNLFGNANKPAESTTPTTSADTAPKP
                     LFGAAPTPSTGGTTSAQTPSLFQKPAAGTDSAPKPAFSLGTTNTSAQPSTTSAASSAT
                     PQKSLFPAIGGTTSSTTPSTTPAAAPSGGMFSALGAAKPTGTTAPSTTATAPPATQPA
                     APTGGLFGNKPAGTTASSQPSTTSATPAAATDASKPSLTTPSAPATSTATGTTGATAT
                     SNAATGGAALGASTAGPTPPAQSRLKNKTMDEIITRWATDLTKYQKDFKEQAEKVAEW
                     DRMLVENGTKVQKLYGSTVDAERATQEVERQLASVEGQQEELGSWLDRYEREVDEMMS
                     KQVGPGESLQGPDQERERTYKLAEKLSERLDEMGKDLTSMIEEVNGASATLSKTNKAD
                     EPISQIVRILNSHLSQLQVIDQGTSELQTKVSAAQKAGQSLSSRFGYGFSSSGMANST
                     AADDFYRSYMGRR"
     exon            655629..657382
                     /number=1
     exon            657462..657585
                     /number=2
     exon            657636..657845
                     /number=3
     CDS             complement(join(658213..658252,658329..658394,
                     658538..658603,658724..658854))
                     /codon_start=1
                     /locus_tag="AO090120000256"
                     /note="predicted protein"
                     /old_locus_tag="AO070311000053"
                     /protein_id="BAE62859.1"
                     /transl_table=1
                     /translation="MLRQSIRPLTTANRALVSRSFSALAPKMAAGDTGAPRPGGSQHA
                     DQFTKREAAQENLYIHEKEREKLLALRNKVKEQRKHLDELDKHIEELTKNQGGEQN"
     exon            complement(658213..658252)
                     /number=1
     exon            complement(658329..658394)
                     /number=2
     exon            complement(658538..658603)
                     /number=3
     exon            complement(658724..658854)
                     /number=4
     CDS             join(661085..661145,661202..661508,661575..661816,
                     661879..661949,662006..662110)
                     /codon_start=1
                     /locus_tag="AO090120000257"
                     /note="multifunctional chaperone (14-3-3 family)"
                     /old_locus_tag="AO070311000054"
                     /protein_id="BAE62860.1"
                     /transl_table=1
                     /translation="MGHEDAVYLAKLAEQAERYEEMVENMKVVASADVELTVEERNLL
                     SVAYKNVIGARRASWRIVTSIEQKEESKGNESQVTLIKEYRQKIESELAKICDDILEV
                     LDKHLIPSAQSGESKVFYHKMKGDYHRYLAEFAIGDRRKGAADASLEAYKAATEVAQT
                     DLAPTHPIRLGLALNFSVFYYEILNSPDQACHLAKLAFDDAIAELDTLSEESYKDSTL
                     IMQLLRDNLTLWTSSEAEPAAENASTEKKEEAPAAEGEKPAAE"
     exon            661085..661145
                     /number=1
     exon            661202..661508
                     /number=2
     exon            661575..661816
                     /number=3
     exon            661879..661949
                     /number=4
     exon            662006..662110
                     /number=5
     CDS             complement(join(664518..664524,665232..665551))
                     /codon_start=1
                     /locus_tag="AO090120000258"
                     /note="predicted protein"
                     /old_locus_tag="AO070311000055"
                     /protein_id="BAE62861.1"
                     /transl_table=1
                     /translation="MASTSDVHGSSPVPTMPQPNDNGRAHMSSLSSSSSISDAENERR
                     GRSERPRMASRKPSASILVPRDHPEIEIEEEEFPPDDARAMSPRRNSADLERLGKEAR
                     QTLQEQ"
     exon            complement(664518..664524)
                     /number=1
     exon            complement(665232..665551)
                     /number=2
     CDS             complement(672932..674779)
                     /codon_start=1
                     /locus_tag="AO090120000260"
                     /note="predicted protein"
                     /old_locus_tag="AO070311000057"
                     /protein_id="BAE62862.1"
                     /transl_table=1
                     /translation="MAAFSYIIRLICIFMLLCHTHALALRSQDILAPPPEAPLVLDAP
                     AESPSRQSGLPPSESPPEPSKSVGSTLQDLLHALNVMQDTYFELWQGTWPSSIDWTAA
                     VIGTHLSASVASLSSSTEDVSSSIFSDADVLTGKHRSLSFENLINHFFDQTVAFYFGE
                     DAFAVRNQAYDDMLWVVLGWLENLKLQVLHSDLHFDGPSGSNLSRNHHWHGAQFRTPA
                     AHRARLFYGLASGGWDISLCGGGMIWNPRLTPYKNAITNELYISASIGMYLYYPGDVI
                     DSPFVPNSVDDQLWSDGYPHHPAHLQAAIEGYKWLNASNMMGIGGLYGDGFHISGWKS
                     AEEPGTRKCDVLNKMVYTYNQGVILSGLRGLWLATASWQYLYDGHDLVRNVITATGWH
                     NKKSKKWAGLGRGGVLEEACDSGGSCSQDGQTFKGIFFNHLAEFCRPVRPQEERFLAS
                     ANQTTGPGSDWEYIYDWHQAQCRKYRPWIEHNAEAALMTRDKDGKFGMWWGRRYGQTD
                     HAVIYESPLPPDATDYRNYGDHAQGSQPLQGASRLSGDSIFGVERPVYPAYAPGQTRS
                     TGDAIALGLHPTDYNDRGRGRTVETQSGGVAVLRALYQWKVSASRPSAA"
     exon            complement(672932..674779)
                     /number=1
     CDS             complement(join(676069..676299,676410..676661))
                     /codon_start=1
                     /locus_tag="AO090120000261"
                     /note="RNA-binding protein RBM8/Tsunagi (RRM superfamily)"
                     /old_locus_tag="AO070311000058"
                     /protein_id="BAE62863.1"
                     /transl_table=1
                     /translation="MSGEMEVDPPVSHEQEEAPAQSGGGFEPRTQAGAVAVRSIEGWI
                     VIATNIHEESSEEDVTDLFAEYGEIKNFNLNLDRRTGYVKGYALIEYSTLPEATEAIK
                     NLNGTKLLDQTIQVDYAFVRPPPSNKGKAGGQRGGGRGGRGRSRSRERSRSPGADERD
                     "
     exon            complement(676069..676299)
                     /number=1
     exon            complement(676410..676661)
                     /number=2
     CDS             join(677662..677669,677735..678390,678564..678625)
                     /codon_start=1
                     /locus_tag="AO090120000262"
                     /note="predicted protein"
                     /old_locus_tag="AO070311000059"
                     /protein_id="BAE62864.1"
                     /transl_table=1
                     /translation="MRCDDPKCGCQPYPRKNRKVEIVLYGDQPDQFCPLNQQGSSIDV
                     IFDPIGNAMILREIINDPTRKYTFWNFSVQLDAANLHFMNLEGLADGSLILTVRIRSS
                     ACAVRGSMISVKEKISGFAPPRLKSKLYNDLYVVVYLCDWPRQTLQLFLPEERLVEWK
                     TVALILKSFGRITADQWSDMVWMKDRPSVAGLNWRAIERDVKIYKNRLAELKAKGKQK
                     YAIEASRDNLPKRNRSNSIGRLS"
     exon            677662..677669
                     /number=1
     exon            677735..678390
                     /number=2
     exon            678564..678625
                     /number=3
     CDS             678989..679696
                     /codon_start=1
                     /locus_tag="AO090120000263"
                     /note="alpha-amylase"
                     /old_locus_tag="AO070311000060"
                     /protein_id="BAE62865.1"
                     /transl_table=1
                     /translation="MAFAQKLTHWICAVSALTLLLPALAADTEAWKSRSIYQAMTDSF
                     ARTDGSKTHACNITAGLYCGGTWRGMIDRLDHIEDMGFDAVMVSPIVKKIEGRVSYGE
                     AYHGYWVQDMYALNPHFGSSEDLLDLSKALHDCGIFLMTDTVINSMAYITNGTSPEGN
                     INFTRLNPFDDPKYFHSYCEITDYDDYPLARKCWTGDDIVPLPDLKMEDKVVQTMLEK
                     WIKETMGKTRFLSKNTV"
     exon            678989..679696
                     /number=1
     CDS             complement(join(680295..680778,680843..681372))
                     /codon_start=1
                     /locus_tag="AO090120000264"
                     /note="growth hormone-induced protein and related
                     proteins"
                     /old_locus_tag="AO070311000061"
                     /protein_id="BAE62866.1"
                     /transl_table=1
                     /translation="MAFFLRRPFAVPTALRQVPKTANTARFFHNSPIKPSQSKPLGPA
                     TSSIFAKSRQTFQNAFRRTYMQPTYDATQGGNLTQRLLYGAAIVGGTILATNMIFNRE
                     TREDGGMAPYERSYLNETFMHTGLGIAIIGIAARAMHMNGWSYRLMAMNPWLVAGLGL
                     VGSIGTMYGTYYTSPDNYLAKYGLWTAFNVTQAALLSPLMFMHPALLARAGLYTVGMM
                     GSIAFVGATAKQDKYLYLGAPLLAGVTIVALSGLAPLVLPATATRTLMWSEKIWLYGG
                     LAVFGGFTLYDVQKVLHHSRMAERGLIRRDVVNESISLELDFINIFIRMVQILAMQRN
                     NRK"
     exon            complement(680295..680778)
                     /number=1
     exon            complement(680843..681372)
                     /number=2
     CDS             join(683248..683969,684128..685766)
                     /codon_start=1
                     /locus_tag="AO090120000266"
                     /note="predicted protein"
                     /old_locus_tag="AO070311000063"
                     /protein_id="BAE62867.1"
                     /transl_table=1
                     /translation="MSAAADVIVLSSSPDRIPNGSPVLPAHDPAKLFDLSPPSASSSP
                     VRSPSELFQISTRSRFFELETPSRNKENKTPKEPPVRKVNTTSKAKSASSQDKPKRRG
                     RKPASESQTVLGDSGLAGLAQQSAPKKTAGARKKRVDSEGKRGKATNRTIMGRVAKSG
                     NVQAKPPQEKIMDVSTPNALPPTKPASGVVSLEIDGLQLETAMKRRIDWTPTKDTTAR
                     TVESSQQEVAEANPQSFGSLLSELFGSSKPASHDIDDKNLTEDSQQKQPEPKQKPKKQ
                     TKKFTTLTARVTASYLNNSHEGSDSSSKETTTSRENAATSRTRGSKRKGKATSKPKEP
                     EFIVLSPEAAAKSLENQELIFGTCSQLEREDSPTSLKELQAAISESERYAVAEPSPLS
                     STLCATPTSRFTTARGLWSVAARDLEGSLIRQTEVVDLVDTPEPAKMTTSTNDSRNEK
                     ALEDAATVPPKEPFDLPKSEPPKLKAIPAAKKEPSPAPGMPTIKASDNLKGTTSQHSK
                     PQPKMPNYNGFTDAELSRQVASYGFKPVKNRKAMIDLLQKCWVSKHGKGTTFETQAGS
                     QNTSTEPTPVLTSSEPNTSQKQPRKTATSRKTAAKSKTNPDSNPPPKINSRKTPSSSD
                     ATKAPSIQSKPTQPPPIQSLSNVEEIEDSEEETLPSPFRIQNRYTPQPPETRQALPVS
                     KTLYSPSRPKPRTTKSTTNNSATLNQKQPDLADQIFKAMHAQPAGTPSRPSWHEKILM
                     YDPIILEDFATWLNTEGLGLVGEDREVSAAFLRKWCESRGICCCYR"
     exon            683248..683969
                     /number=1
     exon            684128..685766
                     /number=2
     CDS             complement(join(686262..686963,687076..687306,
                     687432..688037))
                     /codon_start=1
                     /locus_tag="AO090120000267"
                     /note="predicted protein"
                     /old_locus_tag="AO070311000064"
                     /protein_id="BAE62868.1"
                     /transl_table=1
                     /translation="MSNKRSFDEAALEGYGNNELLISNAGDTVDDALLFENIQLSPPN
                     PELIEQTISQQVETAEVPSAAVDPEETSTTTIPRPPVEDNDAAITTALGAADPSTATS
                     DATQESEAVTAQQTAQRPPKKKARKNHVPTINRGKKDWRDAYLTNHHKRKNNMMAEWV
                     AAKERHKKYEEATWPNGDVPADKKFKKREPLTRAPTACDFCRLFKSRCNSDKDTECSN
                     CVKSNSWCGETNASTEVTHYRGLSKDQEEKIQTLQEELDGLKRREQKYRNEIEELKKQ
                     LDDPPSALLPNFPARNNSRASYSWGNNQVPPLPTLSTSYGSWENPGGTEYGRNYGGKG
                     ITQVPAAGSLGPNQSNHQPGLGTVASGSSQTALGYPPQQNGVGPTSLTNYSQIGRLQP
                     DTLLRQGTAVNSYHERIHQPLDGQLDGMTHGLSTLQYGGFNPSLGQGLPHMPSLASQY
                     PAPLQIQSLHNNQMDYYASPSPATVIAQGAHQIKTDSSYAYGNPQTEEIPSNLQRSAE
                     DDEL"
     exon            complement(686262..686963)
                     /number=1
     exon            complement(687076..687306)
                     /number=2
     exon            complement(687432..688037)
                     /number=3
     CDS             complement(join(689341..689685,689760..692174))
                     /codon_start=1
                     /locus_tag="AO090120000268"
                     /note="leucine rich repeat proteins, some proteins
                     contain F-box"
                     /old_locus_tag="AO070311000065"
                     /protein_id="BAE62869.1"
                     /transl_table=1
                     /translation="MRRHGRSGGGSTKALAPVSDTVSLIHSFDSVMNPNRPVRPSPLA
                     FSNIQALPLDLVDRLRSFPLFQSTPESFLSAVGRHLRPQLHQANDYILTEGDEAKAIY
                     WLVRGAVSVTSRDGESVYVDLEPGAFFGEIGVLMDRPRTATIIARSRCLLIVLTKEDF
                     RNILPHFPDVEQAIRDEAQERLMLLEKKKKETSAPPVDDIISRRGNKRLRETFSKDMS
                     LAEQEGTALNWKSVNKKRKSPSPGLTDGVSSSALANGLVNVRLLLKELPLFAGLPGDI
                     LHFLGLNAQPRSYPPFTDIIKQDSQGREIYFIVRGEVEVLTERTHTEDVSHSVPNTIE
                     HPGFEVKARLKAGQYFGEVVSLSLAPRRTATVRTINAVECLMISGDVLAEFWEKCPHD
                     VRQQVEETAKERLQSAADGDVVMAEADGVGQFVGDSNFKVSASRRRSMPLLTLTETEL
                     DGPHTNKADDQAVLRPSDPDPFLNVGLDKVRLKSRRGSVAPLTPEEVSGEQQRPSPPS
                     EPRSTSSSFLTLPEAAVSTTLKTQRESHKVNRGVLPDNILVRILNLLELHHLFRVRAV
                     SLHWSEIINTSTDLLHDLDLSMYNRQITDDVLVKIICPFVGNRPRYVDISNCFHITDE
                     GFNKLAATCGSNVVAWKMKSVWDVTASAILDMASTANGLQEVDLSNCRKVGDTLLARI
                     IGWVMPGQHKDEPVKTSKGVLKPTMQTAAGAVFGCPKLTKLTLSYCKHVTDRSMHHIA
                     SHAAHRIEQMDLTRCTSITDQGFQYWGNARFTNLRRLCLADCTYLTDQAIVYLTNAAK
                     QLQELDLSFCCALSDTATEVLALQCSQLTYLNMSFCGSAISDPSLRSIGLHLLHLKRL
                     SVRGCVRVTGAGVEAVSDGCNQLESFDVSQCKNLTPWLEDGGHFKYQNKIRFETVAQN
                     GKVFR"
     exon            complement(689341..689685)
                     /number=1
     exon            complement(689760..692174)
                     /number=2
     CDS             complement(join(694255..694391,694478..694934))
                     /codon_start=1
                     /locus_tag="AO090120000270"
                     /note="predicted protein"
                     /old_locus_tag="AO070311000067"
                     /protein_id="BAE62870.1"
                     /transl_table=1
                     /translation="MDSHRSSDAHPRGSTTLMEILHWDKLFESDAPPRLGIEVGRRLP
                     YTAMSAFSVGMVIGSSHGSKKSAYRFRAENAHRFPTTSTGWFQYHKTKNYTAIVGGVK
                     EGMKMGLKLGFGALAFCLFEETVDYARHDRRDFLSTVTAGLSFSGIYSLLAARTTKLG
                     LKLSLVYGLMQDALESLKGNRPAYVNFLLGNRRSKTE"
     exon            complement(694255..694391)
                     /number=1
     exon            complement(694478..694934)
                     /number=2
     CDS             join(696077..696124,696139..696612)
                     /codon_start=1
                     /locus_tag="AO090120000271"
                     /note="predicted protein"
                     /old_locus_tag="AO070311000068"
                     /protein_id="BAE62871.1"
                     /transl_table=1
                     /translation="MTRYLCMKGEHDFADFSQPDPLSWTLLFKKHKMTVLLMLPPSAT
                     IPSVQATLLRALQSRGLTEINGDPVPEDSSDIEFGVAVDRNDLGKGWTKLEFQTPQFD
                     EDEAPKRGAGRRSAAPLSLQAAEIRNGQPVAFRFRKRGEETETAEELIDLELEDPGWD
                     VVLPSLDDEEEEN"
     exon            696077..696124
                     /number=1
     exon            696139..696612
                     /number=2
     CDS             join(697744..697943,698006..700068,700388..700470)
                     /codon_start=1
                     /locus_tag="AO090120000272"
                     /note="kinesin-like protein"
                     /old_locus_tag="AO070311000069"
                     /protein_id="BAE62872.1"
                     /transl_table=1
                     /translation="MAIPSDASSITVAVRVRPFTIREAAQISKCEDGPLFLGDGSLAG
                     APTPKLNQKGIRSIIKVIDDRCLVFDPPEDSPVQKFSKSVVPNGKRVKDQTFAFDRIF
                     DQNASQGEVYEATTRTLLDSVLDGYNATVFAYGATGCGKTHTITGTAQQPGIIFMTMQ
                     ELFERIDERSGEKATEISLSYLEIYNETIRDLLVPGGSKGGLMLREDSNKSVSVSGLS
                     SHHPQNVQQVMDMIMKGNECRTMSPTEANATSSRSHAVLQINIAQKDRNADVNEPHTM
                     ATLSIIDLAGSERASATKNRGERLFEGANINKSLLALGSCINALCDPRKRNHVPYRNS
                     KLTRLLKFSLGGNCKTVMIVCVSPSSQHFDETQNTLRYANRAKNIQTKVTRNVFNVNR
                     HVKDFLVKIDEQMNLINELKAQQKDYERIAFAKFKKQTEKKDAVVREGISRIRNAYEH
                     SLPERQERTANMLKSRQISRRIGILSSWIAAFDSVCANSENEVPLANLQAIRKTAQGV
                     LLELESSRQHYHQRLARSTWDRGINSAVEHAVRQLHDFGINDNGDLANLHREAELLKS
                     NTERDAFSAVAEQEKAGEAETVQLLLQAQFEAISAIEDIMQMSEEEAVEAGKSILSKM
                     LDSCSTATSSLVKPDGSLPAAQPFSPSKAMSPKPKKRVSLAALPAGKTLAAPISLAST
                     APASPGKGSPRRRRLGGGRKSVTFSPKKPQAKSTKRSVRWKDDEQDGSLAEFQKTPQK
                     PRAQLFPEGPQGSPTTPAVPHRTTRKAGRQTKTTPSGSVRR"
     exon            697744..697943
                     /number=1
     exon            698006..700068
                     /number=2
     exon            700388..700470
                     /number=3
     CDS             join(701707..701881,701964..702282,702358..702391)
                     /codon_start=1
                     /locus_tag="AO090120000273"
                     /note="peptide methionine sulfoxide reductase"
                     /old_locus_tag="AO070311000070"
                     /protein_id="BAE62873.1"
                     /transl_table=1
                     /translation="MSNNTQIATLAAGCFWGVEHLFRKNFGNGKGLLDAKVGYCGGET
                     ASPSYRAVCTGDTGHAEAVQVTFDPSIVTYRSLLEFFYRMHDPTTLNRQGPDVGTQYR
                     SAIFTHGDEQEQIAKDVSEKVSKEWYKQPLSTDIVRAGQWWDAEEYHQLYLNKNPTGY
                     ECPAHYVRTFPPLSA"
     exon            701707..701881
                     /number=1
     exon            701964..702282
                     /number=2
     exon            702358..702391
                     /number=3
     CDS             join(704000..704627,704996..705072,705148..705168)
                     /codon_start=1
                     /locus_tag="AO090120000276"
                     /note="predicted protein"
                     /old_locus_tag="AO070311000073"
                     /protein_id="BAE62874.1"
                     /transl_table=1
                     /translation="MTGSWAQVASSTSSLPVQPQGVGQFMTPLPLGPASLSKQTSNND
                     ENGDTRMSGISDVTLSAPMFPEIPEAKAGVLRIYGKTSKEIIQYLTTRIHEGPLQDIR
                     LETNGRTRVTFQHASQALAFLMSNQEMEQMLGYGRFGCGYRVELAEIIDWNDDHRRMN
                     QPIRERRRLSFTRKRLFADNMSPEKWKQDIRTLAGPGNIDFLWVFNSGNGRKISKVKK
                     ERKKERKKKDKKKEKIKAIRATW"
     exon            704000..704627
                     /number=1
     exon            704996..705072
                     /number=2
     exon            705148..705168
                     /number=3
     CDS             join(708371..708488,708548..708985,709047..709807)
                     /codon_start=1
                     /locus_tag="AO090120000279"
                     /note="predicted protein"
                     /old_locus_tag="AO070311000076"
                     /protein_id="BAE62875.1"
                     /transl_table=1
                     /translation="MVRIVSSLLLASLASTFAWADTIKCDANNQCPEKYPCCSQYGEC
                     GTGAYCLGGCDPMQSFSLDSCMAEPICKSKTYKWDNLDSAALNTKYLGNASAADWVYS
                     GFPKVEDGNLILTMPKNSVGTLFANNHYVWYGKIKGKVKSSRGKGVVSAFILLSDVKD
                     EIDFEFVGYDLDNVQTNYYWQGVLDYNNGGKAPAGSSTFDDWHEYEIDWKPDAITWSV
                     DGNVKRTLTRESTWNETAKRYQFPQTPSRMQLSLWPAGQASNAEGTIEWAGGEIDWDS
                     EDIKDKGYYYASFGEITVECYDPPSNSGDGKKSYILTNKDGLEGSFKLSNNDTVLASL
                     GATGLDPDLGASSSSSSSSSASTNNSVPENRGGSGNEPGATSSNSTSSSSGSSSSGSS
                     DSGFSQGSNNDSNNSNNSNGAASANERVMKGSFFAVLVAVVVLVTL"
     exon            708371..708488
                     /number=1
     exon            708548..708985
                     /number=2
     exon            709047..709807
                     /number=3
     CDS             complement(join(711310..711629,711689..713189))
                     /codon_start=1
                     /locus_tag="AO090120000280"
                     /note="alkaline phosphatase"
                     /old_locus_tag="AO070311000077"
                     /protein_id="BAE62876.1"
                     /transl_table=1
                     /translation="MARDEPLLAPRPSSDHSSIRNAEEEDALLTGERTHREQQRSKWA
                     FWKDVGLFSWAFIATIAVIVLAVVYQHETSKNHSAKQPWGPGGKPTGKRNLIFMVSDG
                     MGPTSLTMTRNYRQFTEGLPVDQTLVLDDHIIGTSRTRSSNSLVTDSAAGATAFSCAH
                     KSYNGAISVLPDHSPCGTVLEAAALAGYKTGLVVTTRITDATPACFASHVNLRGYEDR
                     IAEQEIGEHPLGRVVDLMFGGGRCHFLPNSTEGSCRGDDRDLIEIAGQKGFHYLNDRK
                     AFDSLNGGSEAKLPLLGLFAEKDIPYEIDRRSQDGVYPSLEEMTRTALKTLSQATADS
                     DKGFFIMIEGSRIDHAGHGNDPAAQVHEVLAYDRAFAAVLEFLEQDSTPGVVVSTSDH
                     ETGGLAAARQLHDAYPEYKWLPGVLANASHSSEFAGATLREYLSKNPDAKSQRKFVHE
                     LLEKSLGVFDATDEEIDHLLDPKLPYTNNYVFADIISRRAQIGWSTHGHSAVDVNIYA
                     SSTKDAWRLVGNNENTDVGAFLSDYLEVDVEDVTRRLQTPSEWTWKPEVEPSTSTSLS
                     WLGDPLGEAVRTDGLDTYHGEFKKRSMDLETRECGCGELH"
     exon            complement(711310..711629)
                     /number=1
     exon            complement(711689..713189)
                     /number=2
     CDS             complement(join(713558..713754,713828..714332))
                     /codon_start=1
                     /locus_tag="AO090120000281"
                     /note="predicted protein"
                     /old_locus_tag="AO070311000078"
                     /protein_id="BAE62877.1"
                     /transl_table=1
                     /translation="MHSPSPQLLRALRTSISAPNVTNRLCANTRSVSPISRITPHVQT
                     YRNNSSHARPVRMVPRAHTAKPASRDRGPQSTEDTQTDFAALNVLGNIPAPTTAIDAC
                     LDNGFHLDNGLKLTNGDGLLLVGGEAFSWRPWTAMGGEKNAMVNKKGQFEVDEQAWGL
                     LGLVWPRPDLLIIGMGASVFPLSPETRRQINSLGVRVEVLDTRNAAAQFNLLATERGV
                     SEIAAAMIPIGWKGR"
     exon            complement(713558..713754)
                     /number=1
     exon            complement(713828..714332)
                     /number=2
     CDS             complement(join(714837..715216,715286..715810,
                     715863..715935,715990..716007))
                     /codon_start=1
                     /locus_tag="AO090120000282"
                     /note="casein kinase (serine/threonine/tyrosine protein
                     kinase)"
                     /old_locus_tag="AO070311000079"
                     /protein_id="BAE62878.1"
                     /transl_table=1
                     /translation="MKPLLVKKFINNRFELIRPISGGSEGSVYIARDHHTGKELAIKL
                     YHEPSGHKSYHREVNGYRYLAGLMGVPKFYWAGQDQRYHATAIELLGPSLAHLWRDCG
                     RRFSLKTVLLLADQLICRFQELHSRNCVHRDIKPENLLIGVGRKANRVYVADLGFVKR
                     YSALSDRQILKRERHDRRECEKNPGIGVGLQGTEVYAAWRAHYAKPQSPRDDMESLGY
                     VLVRFLKGHLPWERLWASACTDLERQIAVAEMKRNIRTETLCKGLPSAFNLYFLHILL
                     KATPDYTYLREIFLRLFRREGFKDDQIYDWTFKQEAELLRQHCNNRLKEQVKKFL"
     exon            complement(714837..715216)
                     /number=1
     exon            complement(715286..715810)
                     /number=2
     exon            complement(715863..715935)
                     /number=3
     exon            complement(715990..716007)
                     /number=4
     CDS             complement(716265..717623)
                     /codon_start=1
                     /locus_tag="AO090120000283"
                     /note="putative methyltransferase"
                     /old_locus_tag="AO070311000080"
                     /protein_id="BAE62879.1"
                     /transl_table=1
                     /translation="MNQETTTTTSSSQPPTTKKPSRHEKGSKKAPQKTFNPLQIGIQD
                     FVTNNISPETLSQYGFSSETLHSSLPKRFTVYEPMLLLPVNAFSSPPAWSALYQSLTA
                     PQQQTLYASLVKAFSRMGVTHVAINAPIALTDTQGQENRMRSPAGLVPLYGDFGPPPP
                     AAASTASSSAEEEGQPSDEDLERAFWVHTMQNHGIVQIWAPLYTMFSRGNVTEKARVL
                     GHGASPFEGLEVGQLGGQAVSDVGVVDMYAGIGYFVFSYLKRGVRRVWGWEINGWSVE
                     GLRRGCEANGWGCRVVRVREDGGLSEGLLDLVGSLKDTDRVVLFHGDNRFAAEILGEI
                     RRVMEEKGEWNRIRHVNLGLLPTSVDAWENACRMVDAQLGGWVHVHENVDLREIEQKK
                     EDITVEFGRLRAEALGLQDTIASAECRHVEQVKTYAPGVMHCVYDMKLLACSELQQKT
                     AG"
     exon            complement(716265..717623)
                     /number=1
     CDS             complement(join(718602..719476,719534..719693,
                     719848..720002,720061..720112))
                     /codon_start=1
                     /locus_tag="AO090120000284"
                     /note="uncharacterized conserved protein, contains WD40
                     repeats"
                     /old_locus_tag="AO070311000081"
                     /protein_id="BAE62880.1"
                     /transl_table=1
                     /translation="MAMNFVTFNQDYSYLAVATAKGFRIFTTDPFAKSYETKEGNIAI
                     IEMLFSTSLVALILSPRRLQITNTKRQSTICELTFPTTVLAVKLNRKRLVIVLEDQIY
                     LYDIQTMKLLYTIETSPNPSAICALSPSSDNCYLAYPLPHKAPPTSFTPPSHAPPGNT
                     HISPTSGEVLIFDTLKLEAINVIEAHRSPLACITLNSDGTLIATASDKGTIIRVFSVP
                     DGHKLYQFRRGSIPSRIYSMSFNTTSTLLCVSSSTETIHLFKLSQGQSSESSLPSPSA
                     PQRSMSQSSLSNSPDEDETSGDKDSSEFHSRKHNGTLMGMLRRTSQTVGSSFAAKVGG
                     YLPKGVSEMWEPARDFAWIKLPKSNPGPGGNGNTGPLRSVVAMSNNTPQVMVVTSDGN
                     FYVFSIDLSKGGEGTLTKQYS"
     exon            complement(718602..719476)
                     /number=1
     exon            complement(719534..719693)
                     /number=2
     exon            complement(719848..720002)
                     /number=3
     exon            complement(720061..720112)
                     /number=4
     CDS             join(720140..720203,720318..720391,720661..720756,
                     720838..721055,721129..721493,721563..723259,
                     723322..723612,723676..724128)
                     /codon_start=1
                     /locus_tag="AO090120000285"
                     /note="carboxymethyl transferase"
                     /old_locus_tag="AO070311000082"
                     /protein_id="BAE62881.1"
                     /transl_table=1
                     /translation="MTSNPVLFSKVYCRVEKAAKNGQLHVTDDRRRTSLVLKRRSRQS
                     STSRESHCIMGPAKKPAMAGVNSKAEREADLVMGTNNSSIVSKRSVEMLYYSKPHFFR
                     YFVKKPQRRSPLINRGYWLRMHAMAETVRKFMREPSDKPKFVLNLGCGFDPLPYMLLS
                     ADNDLCRDTTFVDIDYEKLMVNKKTAIRKTDEITQLLEDVEFLPDDSAVQIRSKPYLA
                     IGCDLKNLTKLDTVLRAEVLPSECAVLFLAEVSLTYMDVKSANAVVSWASGLSNDAQF
                     CILEQFFPDGPDHPFASTMMKHFKKLGAPLYSIHEYPSLNEQEQRFKDAGWNHAHARS
                     LWDLWSDDEFVDGSLRASLDAIEPFDEWEEFALFGSHYFLLHASTRPRVSETATRTLT
                     GLDPQTDKSGHFRLLAKCPPGSGQRRFGAVIPDSDKAVGHHSGLGRQTRLSSTELYTK
                     SEGTTKTHEFPPGDIPARMCHTVTCLSNQDCLLVGGRASPASGFKDCWVRQGNQWRST
                     QSLPVPRFRHSAVKVTLDSEYVLVYGGKTSDGTTLNTWLAWSSKKQDWQQVETNSIHI
                     KARFGACLGSINDTSGVLFGGIGAEGTILGDFFTWKLHQRSDGSLFMELTDHTDDLRR
                     TSSLFNQIHRFGATVNQTAWGLVIVGGIVPRGIITHDKEIMLLDSTELTKCIASGWPS
                     NHTIISALGLGNRLDGPRPLLVGHVSCAIDSKEILILGGGAVCFSFGTYWTEGTWLLQ
                     DVSSTTENDWTLIPESVEPNKSQSEKATSKPSAQSQNEPYRAAEVITPIPRVCVQNPA
                     QFQDILAEGRPVIIEGSDVGPCTELWTKEYLTSAVGGDRKIVVHEAQSAHMSFQTKNF
                     SYATKTFGTFMDEVYAGDRQYLRSISAEQPTKLPANLAVDFPSLSHDFRLPESLSIVT
                     DNTHSSPLRISGPVTLWLHYDVMANVLCQIRGEKRLILFPPSDVQYLQVPPGASSSTI
                     NIFQSNGSVASIPHTSPQEAVLKRGDILFIPPLWLHTASPTGDVSVAVNVFFRNLSKG
                     YAAGRDVYGNRDLQAYEKARNDIQKMAKSFDGLPSEMARFYLLRLAQELKDKAEK"
     exon            720140..720203
                     /number=1
     exon            720318..720391
                     /number=2
     exon            720661..720756
                     /number=3
     exon            720838..721055
                     /number=4
     exon            721129..721493
                     /number=5
     exon            721563..723259
                     /number=6
     exon            723322..723612
                     /number=7
     exon            723676..724128
                     /number=8
     CDS             join(725958..726046,726126..726291,726427..726458,
                     726529..726631)
                     /codon_start=1
                     /locus_tag="AO090120000286"
                     /note="predicted protein"
                     /old_locus_tag="AO070311000083"
                     /protein_id="BAE62882.1"
                     /transl_table=1
                     /translation="MLRLSRNGGPSVERVSRELLGFTPPHPRTYSYSSPFFHFLILLW
                     FRILPYFQFFLPVVFVIRTYLKTFSGTYQSSLIAVGRSLVTACRIIFLKRAIQLSRMW
                     IQLHLDRFCKGCVVDRSSLRLSGYTQS"
     exon            725958..726046
                     /number=1
     exon            726126..726291
                     /number=2
     exon            726427..726458
                     /number=3
     exon            726529..726631
                     /number=4
     CDS             join(726699..727455,727515..727601,727652..728548,
                     728621..728741,728790..728846,728932..729055)
                     /codon_start=1
                     /locus_tag="AO090120000287"
                     /note="dual specificity phosphatase"
                     /old_locus_tag="AO070311000084"
                     /protein_id="BAE62883.1"
                     /transl_table=1
                     /translation="MATVVVQQQQQTLRHSTPPPTGISPALSLNRNPSPIPNKHLPFC
                     PEGPTPIITHNASPLHKEEVTDQTSSLLYPPDSYKQLSSSPAVYSIDAVTLEAALDHW
                     ASQPLPDPSKVFPWLHGLHPENHLQLGFFTNRKRSLRRIPRVWRGITIIKVGGDLISG
                     RLKGAVSLDEVLAPSTTEFLAVDPREGFSVRNFQIQTAKLAPLSDIVIYGEDGVTRKQ
                     LLDVAGRVAAAQHRWRSKNDPEQVLPVYNTFVLSSTFSEVQQRAPGIVAIHARGQLTG
                     QIMDFFQWERWEMCDMSRASEISTNIWQGPTPDYLLRPGTLEPTTGEYFDLLIEASDF
                     ASLPGPRFLAKLNKQLDDGPQRLEFPSSGSILPPSGDDREVDDLVNTVRWLYYLANPD
                     EPENRRDSDGDIAMDPMPKKPRKILIHCPDGYTESSLLVIAYVMFAEGVTAPDAWLKL
                     HCDKKRNFFAYPSDVTFLSAVQARLLHESPATPIGSLTGLEDPHWFKFFDGSLPSRIL
                     PYMYLGNLSHANNPEMLWALGIRRILSVGESVTWTNSEVAKFGAENIMHVTQVQDNGI
                     DPLTQELERCLDFVRKGKKDGTATLVHCRVGVSRSATICIAEVMASLGLSFPRAYCFV
                     RARRLNVIIQPHLRFVYELLKWEELQLQKQNKPPKRELEWPTVAREIALMNKPYSR"
     exon            726699..727455
                     /number=1
     exon            727515..727601
                     /number=2
     exon            727652..728548
                     /number=3
     exon            728621..728741
                     /number=4
     exon            728790..728846
                     /number=5
     exon            728932..729055
                     /number=6
     CDS             complement(join(729677..731338,731392..731658,
                     731712..731891,731948..732043))
                     /codon_start=1
                     /locus_tag="AO090120000288"
                     /note="DNA mismatch repair protein - MLH1 family"
                     /old_locus_tag="AO070311000085"
                     /protein_id="BAE62884.1"
                     /transl_table=1
                     /translation="MDPEMDVDAPEPRGTKRAAEEDEASKKPKRIRALDPDVVNKIAA
                     GEIIVAPMHALKELIENAVDAGSTSLEILVKDGGLKLLQITDNGHGIDRDDLPILCER
                     FTTSKLKQFEDLSSIGTYGFRGEALASISHIAHLTVTTKTAGSSCAWRAHYSNGKLVA
                     PKPGQPAAPKATAGRGGTQITVEDLFYNVPTRRRAFRSASEEYAKILDVVGRYAVHCS
                     GVAFSCRKHGDSGVSISTPVTANTIDRIRQIHGSAVANELVEFKSEDRKLGFRSSGYV
                     TNANYHVKRTVILLFINHRSVESTAVKRAIEQTYSSFLPKGGHPFAYIDLEIEPHRVD
                     VNVHPTKREVNFLNEDEIIECICQEIKSNLTQVDSSRTFLTQTLLPGVRTMEPAPRDP
                     DSTDAEGRTPKTPATTKKPYEHNLVRTDSKVRKITSMLSPAVLSATEAETTSGILDEG
                     LQYETTDREPLRIALTSVKNLRASVRNAMHNTLTETIASHTYVGLVDERRRITAIQSG
                     VKLYLIDYGMFCNEFFYQIGLTDFGNFGVIKLDPAPKLIDLLQIAADAEREAPSSRKA
                     KSSEKNEIFDNAPDLVARALIDRREMLNEYFSLQISAEGELLSLPLLLKGYLPCLGKL
                     PRFLLRLGPYVDWTSEEDCFRTFLRELAAFYTPEQLPPPPPPAENDGNEVSPDVDMEE
                     ELTKNRRLQIARMLEHVVFPALRSRLVATNRLLRGVVEVADLKGLYRVFERC"
     exon            complement(729677..731338)
                     /number=1
     exon            complement(731392..731658)
                     /number=2
     exon            complement(731712..731891)
                     /number=3
     exon            complement(731948..732043)
                     /number=4
     CDS             join(732516..733125,733185..733436,733508..734367)
                     /codon_start=1
                     /locus_tag="AO090120000289"
                     /note="predicted protein"
                     /old_locus_tag="AO070311000086"
                     /protein_id="BAE62885.1"
                     /transl_table=1
                     /translation="MLTTKRPFLADEELGKKDDDHRPQKPSHFWRSSKRWKLPRLRRI
                     ILGAAAFYMLYLFFRNMPTDLSPAPERFNPTFAEPRQRAGMPWSPPAPSPAIPQRGPP
                     PRDDFAPEGSFYYEGSVHFHSLGKTLYRFRKFAHGLPASRAVVFAGASLKSISDLLPL
                     ACKMANQRANEVHLVLMGRDDVSIEGIQHVNGIDDSDCPIYWHDGRVDYAQWSTDARM
                     ERAVASGLTYVQAYLSPQAVITQGESSEEVFFLQGIEKKARELGTAHIVLPTATRDIM
                     WISSLDSHSLQAWNDMRIEILIQAPTESSGSFIRLIRSLKDADYLGSAPGLTIELPHD
                     VDPQLLQFLKTMKWPSNTSNKVTLRRRVRHGVLDAAEASLRTAEAFYPQDPNMTHVLM
                     LSPQAELSASFYHYLKHTVLKYKYSTNAGQVASDLLGISLELSSSLPTSDESVNFPTL
                     DTNRFPGLDEREAMLVSLGQVPNSNAALYFGDKWVEFQSFLSERLAKEVTSPHEKVIS
                     ERYPAVMEYLLEFMRAKDYYLLYPAARGTQTLATVHSDLFQPPEEYSDENWAKSTKPD
                     NVKDQSN"
     exon            732516..733125
                     /number=1
     exon            733185..733436
                     /number=2
     exon            733508..734367
                     /number=3
     CDS             join(734866..735013,735102..735166,735235..735399,
                     735471..737780,737836..737871)
                     /codon_start=1
                     /locus_tag="AO090120000290"
                     /note="26S proteasome regulatory complex, subunit
                     RPN1/PSMD2"
                     /old_locus_tag="AO070311000087"
                     /protein_id="BAE62886.1"
                     /transl_table=1
                     /translation="MAKEGERSAPADKGKGKVDDVKDLPGAKKSPTDEKPQADGKKKD
                     EEPKEEELNEEDQQLKNELEMLVERLKEPDTSLYGPALDAIKNFIKTSTSSMTAVPKP
                     LKFLRPHYDELTELYENWSAGSVKDSLADMLSVLGMTYGDEEKLETLKYRLLTKSEDL
                     GSWGHEYIRHLALEIGQEYQNRLNAEKGVQDLIDLSLSLVPYFLSHNAEADAVDLLSE
                     LEIIEEIPRFLDENTYSRVCLYMVSMVNLLTYPEDQQFLRTAHEIYVRYKEFTKAVVL
                     AIRLNDTELIKSDINATSDRSLKKQMAFLVARQQIWLDMPDEEEDQSFMDCLNNTLIP
                     SHFKSLGKELNILDPKMPEDIYKTHLESSRGAGLTNVDSARHNLASAFVNSFANAGFG
                     NDKMMLVEGDKGPWVWKTKDDGMLSTTASMGMLLHRDVDVGLDKIDKFTYATEDQIKA
                     GALLSIGILNSGVRLDSDPALALLSDPDNLEAKNVPMRVASIMGLGLAYAGSNKEELL
                     DVLLPIVEDVSLDMQLSAMAAVSLGLIFVGSSNHQVSEAIATTLMDEDRQKQLKNKWT
                     RFMALGLALLYFGRQEEVDVILDILKAVDHPMAKPTSVLASVCAWAGTGTVLKLQELL
                     HICNDIIEESDENKGDELVQSYAVLGLSLIAMGEEVGQDMILRQFGHLMHYGASNIRK
                     AVPLAMGLITPSNPQMKVYDTLSRYSHDNDNDVAINAIFAMGLCGAGTNNARLAQLLR
                     QLASYYHRDQNSLFMVRIAQGLLHMGKGTMTLNPFHTDRQVLSRVSAAGLLTVLVSMI
                     DAKQFILAEHHYLLYFLITAMYPRFLVTLDEDLQPLTVNVRVGQAVDVVGQAGRPKTI
                     TGWQTQSTPVLLAYGERAELEDEQYIPLSSTLEGLVILRKNPNWEGEQSTA"
     exon            734866..735013
                     /number=1
     exon            735102..735166
                     /number=2
     exon            735235..735399
                     /number=3
     exon            735471..737780
                     /number=4
     exon            737836..737871
                     /number=5
     CDS             join(738397..738459,738536..738680,738749..739761)
                     /codon_start=1
                     /locus_tag="AO090120000291"
                     /note="serine/threonine protein kinase"
                     /old_locus_tag="AO070311000088"
                     /protein_id="BAE62887.1"
                     /transl_table=1
                     /translation="MKLDAKAIRYLTSEDFRVLSAVETGSRNHEVVPTPLIANISGLR
                     GSSGVNRAISNLAKTNLIAKVKNAKYDGYRLTYGGLDYLALNAHQKQKCIYSVGNQIG
                     VGKESDIIVVANHQGTQRILKIHRLGRISFRTVKTNRDYLRHRQTGSWMYMSRLAAMK
                     EYAFMKALGENGFSVPEPIAQNRHTIVMSLIDAFPLRQISTVPNPALLYSELMDTIMR
                     LARYGLIHGDFNEFNILIKEEEDPDAKGKARADAENDENIRLVPVIIDFPQMVSIDHA
                     NAEMYFDRDVNCIKRYFQRKFRYVSDEPGPFFADAKKQLLENPGKRLDVEVEASGFSR
                     KMARELEAYMKEVGANEEEERGSDDEDDHSGPEEEAEDDVNADEESGAEKLKESESDA
                     VDESSRKLGELHVS"
     exon            738397..738459
                     /number=1
     exon            738536..738680
                     /number=2
     exon            738749..739761
                     /number=3
     CDS             complement(join(741401..741488,741542..743783,
                     743852..744323))
                     /codon_start=1
                     /locus_tag="AO090120000293"
                     /note="ATP-dependent Lon protease, bacterial type"
                     /old_locus_tag="AO070311000090"
                     /protein_id="BAE62888.1"
                     /transl_table=1
                     /translation="MGSNNGRTTKLALVPLPKGSVLLPGATLRIPVANRPDLSNLLSS
                     LVDRSSVVKREGNVITFGCVPLNSPFLSKDGQKLIDNGALDEDRREEYDAIDAGQARK
                     DDLFRYGTIGKVVGVQRRAYSEASLVVQGIQRFTVKRILKERPYFEAEAILHDEKDYV
                     SNNSETVELFQQLRRLSRELLTLLRLSSLLPSSSTRLSPLIARKFELFISKTDLTQAG
                     RLADFMADIAESGIEDKLRVLAALDHKARLEKVVEMLHRQVQSIKSNVKVTTITTNSF
                     PPSGFDINQIDPRDRELLARRAMAGLTGLTPPGVAGGRNNDGDDKEANEVDELQQKLQ
                     EAQLSPEARKVADKELRRLRKMNPANAEYGVCRTYLENILEIPWTKVTEDQLGPDTLK
                     RARQQLDDDHYGLEKIKKRLLEYLAVLRLKQSTNQNVEQQIAALSKDLDSSSDAGDIE
                     KDLPGLSEADRVAVESKLHLLKSKRMTDKSPILLLAGPPGTGKTSLARSVATSLGRKF
                     HRISLGGVRDEAEIRGHRRTYVAAMPGLIVNGLKKVGVANPVFLLDEIDKVGGANFQG
                     DPSAAMLEVLDPEQNHTFTDHYINIPIDLSKVLFIATANSLDTIPPPLLDRMETISLS
                     GYTTVEKRHIAKRHLIPKQIEVNGLSEGQVILSDEVIDKTITSYTRESGVRNLERELG
                     SICRHKAVQYADAGDAGHPETYNPVVTMDDLEEILGIERFEEEITEKHGRPGVVTGLV
                     AYSTGGQGSILFIEVADMPGNGRVQLTGKLGDVLKESVEVALTWVKAHSYELGLTPDL
                     SEDIMKSRSLHVHCPSGAIPKDGPSAGLAHTIGLISLFSNKAVPPKLAMTGEVSLRGR
                     VMPVGGIKEKLIGALRAGVKTVLLPYQNRKDVKDVPQEVSDGLEIIYVSHIWEAIRQV
                     WPDAHWPGQHHENFVESRL"
     exon            complement(741401..741488)
                     /number=1
     exon            complement(741542..743783)
                     /number=2
     exon            complement(743852..744323)
                     /number=3
     CDS             join(745083..745374,745439..746175)
                     /codon_start=1
                     /locus_tag="AO090120000294"
                     /note="porphobilinogen deaminase"
                     /old_locus_tag="AO070311000091"
                     /protein_id="BAE62889.1"
                     /transl_table=1
                     /translation="MASMSNPASGAANPSSRKTFTVGTRKSKLALSQTDLVVSALKKV
                     YPNYEFKIHSQETAGDLNTTIAFREFTTKNLWTEELEEHLMAGNVDFIVHSLKDVPTT
                     LPPACTLGPMMEREDSRDVLVIKQGLPNMSLSDLPAGSVVGTSSIRRTAQLALKYPHL
                     KVIDVRGNIGTRLAKLDAEDSPYTCIILAAAGLLRLGLDDRISQYLDSKNGGMLYAVG
                     QGALGIEIRKDDQVMRDMLNNIGHNETTFASTAERSLLRTLEGGCSAPLGVETEWIKS
                     SDGSKKLRMRSIVVSVDGKESAEVEIDGSVDSVQAAEDFGVTVAKELVTKGAEKILED
                     IQRSKQAA"
     exon            745083..745374
                     /number=1
     exon            745439..746175
                     /number=2
     CDS             complement(join(747106..747403,747468..747679))
                     /codon_start=1
                     /locus_tag="AO090120000296"
                     /note="predicted protein"
                     /old_locus_tag="AO070311000093"
                     /protein_id="BAE62890.1"
                     /transl_table=1
                     /translation="MEQPQSLRALFAAAKSEKSALESRFDTNTEQYRNDVNATIAKLE
                     ECARLVAVLSLFSSNEPLEDIATGDLPYLTVSYHLAELLQRSYTSDRVSSLRRALEQY
                     ERYLTRLDDYELLNDKDKKLYERYTANPASFSLTPVNDAAARREVKINRFREEKELKQ
                     RLQVKYTLF"
     exon            complement(747106..747403)
                     /number=1
     exon            complement(747468..747679)
                     /number=2
     CDS             join(748668..748910,748963..749228,749299..749406,
                     749455..750133,750184..750242,750287..750356,
                     750416..750484,750534..750728,750780..751847,
                     751908..752308,752359..753130,753177..753371)
                     /codon_start=1
                     /locus_tag="AO090120000297"
                     /note="dsRNA-specific nuclease Dicer and related
                     ribonucleases"
                     /old_locus_tag="AO070311000094"
                     /protein_id="BAE62891.1"
                     /transl_table=1
                     /translation="MLDPREYQVELFERAKSQNTIAVLDTGTCIQAQLDVIPFFSPNC
                     TTGSGKTLIAVLLLKHIIQNELIDRANGKPPRISFFLVDSVTLAFQQAAVLRNNLDQN
                     VAQFFGAMGTDLWSKQTWDHQFENNMVIVCTAEILNQCLLNSYIRMDQINLLIFDEAH
                     HTKKDHPYARIIRESYLKADPTKRPRIFGMTASPIDTKGDIIESATKLEVLLDSKIAT
                     TSKPNLLREVVRRPIEESWEYDKLDPPFATKLYQILQARFGDISSLQPVFRFTLQASS
                     ELGPCCADRAWAYALADDVLPKLEGNVRKLAQSISSPIPQCALKEISRIQEASDIVKN
                     HSFNSPNVPGELSPKVQLLRQKLIKYFEHPTKTKCIVFTQKRYTAKMLFDLFSTLEIP
                     YLRPGVLIGVRSGDIVGMNVSFRQQFLALVKFRSGEINCLFATSVAEEGLDIPDCNLV
                     VRFDLYNTLIQYVQSRGRARHSSSTYASMIERYNADHAARLVEVREAEKLMQSFCETL
                     PEDRILHGIDSEIDSILQGEEEKRTFIIRATGAKLTYHSALAILARYASSLVRTVQYE
                     KETSAQATYVVLPQNNSFVCEVILPEKSPVRGLTGVPASKKSAAKQSAAFDTCVLLRK
                     HKLLDDHFNSVYHRRLPAMRNARLAITSSRTNQYDMLSKPSLWGKQQGTLPEKLFATV
                     ISFIPSEPLRRRHRSIILLTRERLPDFPSFTIFLDDDIETIVVTESVEEALHISSQEL
                     EYLSTFTFRIFHDVFHKTYAEEPEKLPYWVAPAETKKSKNVSDSKSLTDWELLHLVHE
                     NEEIPSTLHPSSEALINRFVFDPWDGRYRYFTMAIDNTLHPSDPPPSFLPRRKFMESI
                     MSYTLSGSKNARAGFLSRCNWQQPVLEVELVRLRRNLLDKMTDTEKDVETRCFVCIEP
                     LRISAIPEEIAASCLAFPAIINRLDAYLIALEGCKTLDLSVKPEYALEAFTKDSDNTE
                     EHRVQQIHVQRGMGKNYERLEFLGDCFLKMATSISLFVQNPDDDEFDFHVNRMCLICN
                     KNLFNTALKKELYQYTRSRGFSRHTWYPDGLTLLHGRDHRKKISAESKHALREKTVAD
                     VCEALIGASLLSGGLHNQFDMAVKAVTAVVDSPNHKALCWADYTSSYMLPKYQTQSPD
                     GYELDLGRKVEEKLGYRFKYPRLLHSAFTHPSYPSTWAKVPCYQRLEFLGDSLLDMVC
                     VDDLFYRYPDKDPQWLTEHKVSVRLFVSTKHLLTITLQMAMVSNKFLGALAVKLGLHT
                     HLRHFSNPLQSQITHYAEEIQAAENESQGAVDYWLVTKDPPKVRRCPGCLPDMVEAYL
                     GAAFVDSDFQFRVVEDFFQRHVKSYFHDMTIYDTFANKHPTVRLFLRLLMFLYG"
     exon            748668..748910
                     /number=1
     exon            748963..749228
                     /number=2
     exon            749299..749406
                     /number=3
     exon            749455..750133
                     /number=4
     exon            750184..750242
                     /number=5
     exon            750287..750356
                     /number=6
     exon            750416..750484
                     /number=7
     exon            750534..750728
                     /number=8
     exon            750780..751847
                     /number=9
     exon            751908..752308
                     /number=10
     exon            752359..753130
                     /number=11
     exon            753177..753371
                     /number=12
     CDS             join(754259..754538,754603..766916,766975..767421)
                     /codon_start=1
                     /locus_tag="AO090120000298"
                     /note="dyneins, heavy chain"
                     /old_locus_tag="AO070311000095"
                     /protein_id="BAE62892.1"
                     /transl_table=1
                     /translation="MEVASAGISNGVSAPTQASFVDSSAIIQYLSDVLQVTLGALRTE
                     LERTGSLLSEAKYNETVQRCTRFASESQVALYVQKDLVGSEESAGADEEAMSTHYIYN
                     LSAEISSSSTTVATVAFIKRPAAIDPALPIPSQIQVMNFPGPASLSNTQAQQNTSLSP
                     YEILHLLVHHGLSPYFEANSRNQDAAGGLKPRTDTEAKTGVPMTKKKFAELELGLLHL
                     QQNVEIPALSLPLHEVVQAALTEAEKRGVKPSVELIDPTILESSTFINSIQTNVNTWI
                     KSIQTITKMSRDADSGSAAQEINFWLSMETALEGIENQLRGDGVSLTMDILRHAKRYQ
                     ATLSFVADTGLREAADLVQKYNQLMRDFPLDELLSATTLQKVQESLNLIFNHLNKKLK
                     ICPYPIKRALALVEAISGDLDSQIHSLLHGRTILHLDYREFRSLMKTCGAIWRTWDEN
                     LKEFTNVARESTRRRNEKFIPIKIAARHEKTQERLKYINTFRVNHEQLQRTIVNVLGP
                     KSSSTGEPAAGASSDGAVIVEEIGDVDAVEEVAQAYAALKNVDVLDVSDEGTQQWIQE
                     EIAYNERTSRVENSIIARLRDRLATAKNANEMFRVFSKFNALLVRPKIRGAIGEYQTQ
                     LIDNVKQDISSLHERFKQQYGHSEAHAMAQLRDLPPVSGAIVWARQIERQLDAYMRKV
                     EDVLGEDWHLHSEGQKLQAESNLFRKKLDTRPVFESWLHDVQRRHITISGRLFNIVRN
                     RAAGNTLELTVNFDAQVIALFKEVRNLIWLNFQVPHAVSNISKEAKRVYPFAISLMES
                     VRTLLQTNRSIASMTEVAILLNGYVNDAQGMIVKGIPLRWESFVHSYELHVKQSALAN
                     GAIESTIPSRGESKHVQFVREFAGSASVLQSKTAVLASINENIQKAIHELKTCPYDAS
                     AFKQRLDAIQVAVDKLNLENYVNLGYWVANLNQKIEAILRDRLHRAIREWINSFQEAK
                     NGDHSSQLLNGSQQLVTGEGEAMAYNIEFTELVHEISMRNQVLHLDPPLQFARASWFS
                     QFDNWLGVVCNLEKIKSSRYQISIDVQKVQLSESCFATLPQHCTDELNQVYNAIEARL
                     KEVSNYVDKWLQFQSLWDLRSEQVYDILGDDLSQWLQLLQEIRKSRATFDTSEVSRSF
                     GNIKIDYEQVQTRVNAKYDQWQHEILLRFGSKLGGRMREVHSEIASARRDLEGQTLEA
                     ASTAHAVSFITIVQQCKRKAKVWEPEVDLFRQGQATLARQRYQFPSDWLHVENVDGEW
                     AALNELLARKSKIVQDQTEGLRAKIVAEDKVIGDKITEVIAQWNDEKPVSGTIPPDEA
                     SRTLSLFQSRLEGLKSEYEMVSKAKEALDLPAGVESALPAILEEVQDFMSVWAALSTI
                     WKSLNDLRDMLWTSVQPRKLRQSIDGLIKMTKEMPSRMRQYAAFEHIQNVLRQLLKVN
                     PLLSDMKSEAVRERHWHKIYKSLKPGQRFSLVSLTLGDVWDLQLTASESVIRNIIAQA
                     QGEMALEEFLKSVRETWQNYSLDLVNYQNKCRLIRGFDDLFAKCSENLNSLQAMRHSP
                     YFKEFEEEATSWEDKLNRVHVLFDVWIDVQRQWVYLEGVFTGNADIKHLLPLESSRFQ
                     NINSEFFAVMKKVYKSPFVLDVLAINGVQKSLERLAELLNKIQKALGEYLERERVSFP
                     RFYFVGDEDLLEIIGNSNDIFRVAKHFKKMFAGLSGVLMDDDNNIVGFTSKEGEEVRL
                     KKEINLVKTPRINDWLTAIESNMKLTLAELLAEAVEQFEPLYHATEVDQSAFNDFLAN
                     YPAQIVVLASQVVWTNAVQKSLEEDGTTLSALYDSQVRVLELLAATVLGDLDAISRKK
                     CEHMITEFVHQRDVISKLIKANATTPTHYLWLLQMRYVYQPEGDFLQRLYVHMANAKL
                     NYGFEYLGVPERLVRTPLTDRCFLTLTQALCQRLGGSPYGPAGTGKTESVKALGLQLG
                     RFTLVFCCDDTFDFQAMGRIFLGICQVGAWGCFDEFNRLEERILSAVSQQIQNIQIGL
                     KNGETDEKAQIELVGRQLSVNPNTGIFITMNPGYAGRSNLPDNLKKLFRSVAMSKPDK
                     ELIAEVMLFSQGFKQAKRLSTQTVPFFDRCSTQLSKQAHYDFGLRALKSVLVSSGGLK
                     RVRIASNDGELGPDEIIEPQIIVQSLRETIAPKLVREDVDRMLDIQSDVFAGVEYVPA
                     NYSKLTAAIREIAQELHYVDSEMWITKALQLYQIQTIHHGVMMVGKSGSGKSAAWKIL
                     LQALQRIEGVEGVSHIIDSKVMSKEALYGNLDSTTREWTDGLFTGILRKIVDNLRGED
                     TKRHWIVFDGDVDPEWVENLNSVLDDNKLLTLPNGERLNLPPNVRIMFEVETLKYATL
                     ATVSRCGMVWFNDDTVTPAMMISNYVESLRTRTFEDLDDDSAPAGQAAIKTQDAQDMV
                     SNVLKHLMQSSDIIMKSLEEAKKHNHIMEFTDIRALNTLFSLLNKACRNVLEYNIQHV
                     DFPLDSEQIESYISKKLLLALVWSFTGDCPLVDRQAFGQFVSALSTTDLPLDGSSSLI
                     DFDVTLPTAEWSSWQSQVPTIEINTHSITQTDVVIPTVDTVRHEDVLYSWLAEHKPLL
                     LCGPPGSGKTMTLFAALRKLPNMEVVGLNFSSATTPDLLIKTFEQYCEYRKTLNGVIM
                     SPNQIGRWLVVFCDEINLPAPDRYGTQRAITFLRQLVEQNGFWRTSDKTWVTLDRIQF
                     VGACNPPTDAGRTPLAERFLRHSPLIMVDYPGEISLTQIYGTFNSAVLKILPLLRGYS
                     ESLTKAMVQFYLESQSRFTSKIQPHYVYSPRELTRWVRGVYEAIKPLESLSIEGLVRI
                     WAHEALRLFQDRLVTEEERNWTSDAIRRIALDNFPTIDEEQALKGPILFSNWLSKNYV
                     PVEQERLRDFVKARLKTFCEEEVDVPLVLFNDVLEHALRIDRVFRQPQGHLILIGVSG
                     SGKTTLSRFVAWMNGLKVFQIKVHGKYSSEDFDDDLRIVLRRAGCKGEKICFIMDESN
                     VLDSGFLERMNTLLANAEVPGLFEGDEFSSLMTACKEGAQRQGLLLDTQEELYKWFTQ
                     QIVKNLHVVFTMNPPEEGLSSKAATSPALFNRCVLNWMGDWSDQALFQVGSELTQSVD
                     LDKPNFVAPDSIPVAYRDLSLPASHRDAIVNAMVYIHHSLQRFNQRLQKQQGKTTYLT
                     PRHYLDFVAHYVKLFNEKREDLEEQQRHLNVGLEKLRDTVDKVSDLRASLAQKKTQLE
                     QKDKEANEKLQRMVADQQEAERRKAASLEVQAALEKQEQEVASRKEVVLNDLARAEPA
                     VLEAKKSVSNIKRQHLTEVRSMGNPPASVRLALDAVCTLLGHRVDSWKTIQGIVRRDD
                     FIASIVNYNNEEQMTTKLRVRMQNDFLSNEDFTYERVNRASKACGPLVQWVEAQVNYS
                     EILDRVGPLREEVGKLEEKALNTKAEAQAIENTIQDLESSIATYKAEYAALISETQAI
                     KTEMSRVQFKVDRSVRLLDSLASERTRWEEGSRSFETQINTLVGDVLIAAAFLAYAGF
                     YDQQFRKAMVDDWVNQLVQSGISFKPHNPITEYLSNADERLTWQDHSLPVDDLCTENA
                     IVLKRYNRYPLIIDPSGRVTEFLQKESTERKLTVTSFLDDSFVKQLESALRFGNPILI
                     QDAEYLDPILNHVLNKEYQKTGGRVLIQLGKQEIDFSPSFKLFLSTRDPSAAFPPDVC
                     SRTTFVNFTVTQSSLQTQSLNEVLKFERPDVDARRTDLVKLQGEFKIHLRQLEKRLLQ
                     ALNESRGNILDDDNVIETLETLKNEAAEISKKMVETEGVMTEVENITHNYSIIARSCS
                     AVFAVLEQLHHVNHFYQFSLQFFVDIFHSVLYHNKRLAQEKDHATRVQIILRNLFITT
                     YQRTSLGLAQKDRITLAMLLAQAAPYPMEKDIIDIILDESTEGADLSTSPELKDPVMS
                     RISNMTLFKSKFPEVPTEQWDQFLSEELAENYVPAVWEDNTEPINRLLRSLLLVKLCR
                     MDRFVPTAERFVETVFGRELFEGSTDLRDIVDQVTATTPISLSSSPGFDASYKVDALV
                     ERMQATCANIAMGSDEGLKSADKAISNAATAGTWVLIKNVHLAPSWLQSLEKRLDSLK
                     PHKDFRLFLSMESSPKIPVNLIRASRVLMYEQPAGVRANMKDSLSSLSVRAGKPPVEK
                     ARVYLLLCFLHAVVQERLRYAPNLGWKGFWEFNDSDYECCAFIIDHWVDSVTQGRSNV
                     APQKLPWDMIRTLVTETYGGKVDDIGDFQQLESLVNSFFTPVAFEDDYKLVSGVENDE
                     CLTLPGTTGIRDFVEWVNRLPEREPPTYLGLPANAEKLLLVGHGNKVISDLSRVTTLL
                     DEGEQLMVDA"
     exon            754259..754538
                     /number=1
     exon            754603..766916
                     /number=2
     exon            766975..767421
                     /number=3
     CDS             complement(join(769644..769961,770051..770433,
                     770487..770596,770650..771038,771097..771433,
                     771488..774660))
                     /codon_start=1
                     /locus_tag="AO090120000299"
                     /note="pattern-formation protein/guanine nucleotide
                     exchange factor"
                     /old_locus_tag="AO070311000096"
                     /protein_id="BAE62893.1"
                     /transl_table=1
                     /translation="MSSSSLPIAVDPVALVTTECITVTSAMRKHARWAHSSVSAILGG
                     GAASRVYDRDTSAPPSPRNGTSTSRSKSRPSAVDEDHALANRWGLRGKKGKSMQDNPL
                     ISAFSRLRSDLKDCRDIRTFDTPALLHPFLQVIRSSSTSAAITSLALVALTKFFAYNI
                     ISQDSPRLSMAMQLLSAAITHCRFEASDSAADEIVLLRILKLMEGILSRPEGDLLGDE
                     SVCEMMETGLSMCCQVRLSEVLRRSAEMAMVNMCQVIFMRLSHLDVAADLDAPDPAVG
                     DSEPTNLKMDPSVDGNTVTSQHLSAMGADTATPDRERNSGDEPSEPALSGTAVTAPPN
                     PQDDLGDEVKPYSLASIKELFRVLIDLLDPHNRQHTDPMRVMALRIIDVALEVAGPSI
                     TRHPSLATLAQNDLCRHLFQLVRSENMPILTGSLKVAGTLLLTCRSALKLQQELYLSY
                     LVACLHPRVEIPKEPGIDPALYSGVPQAPKLVKPSPSQTNSGRSTPVPVKDRQKLGLE
                     GGSRKPEAREAMVESIGVLARIPSFMVELFINYDCDVDRADLCEDMVGLLSRSAFPDS
                     ATWSTTNVPPLCLDALLGYVQFIFDRLDDEPVHEGFPSIELLRSQRRTKRTIIHGAQK
                     FNEDPKGGIAYLAAQGVVENPDDPTSVAKFLRQTTRISKKVLGEFISKRNNEQLLDAF
                     VDLLDFSGKTVVDGLRDLLGAFRLPGESPLIERIITTFTEKFMQKAQPPEVADKDALF
                     VLTYAIIMLNTELYNPNVKSANRMSCADFSKNLRGVNAGKDFAPEFLQQIYDSIKQNE
                     IILPDEHDNKHAFDFAWRELLLKSTTAGELAIGETNIYDAEMFEATWKPVVATLSYVF
                     MSASDDAVYSRVVTGFDQCAQIAARYGLTEAFDRIVFCLASISTLATDKPPSTSLNTE
                     VQAGKQRVMVSELAVKFGRDFRAQLATVVLFRVLAGNEATVQRSWEYIVRILSNLFIN
                     SLIPPFDTSLNAELEIPPIPLQPPSQVVDRDVRGNEAGLLSAFTSYLSSYAADDPPEP
                     SDEELDNTLCTVDCVTACSINDVLANIKSLPLSTVSTVVDTVLTLLPEESAPAVIVVK
                     SERPSRSANGRLDANKSNYDPGMIYLLELATILALRDQTTLEAVGERLLASLQAFMRD
                     ARNLHPLALSRIIYYLLNLLRLSHDQPFMRVPVILHGISGFDQDILESVALPVIEGLS
                     RCVSHAGLLGNEITISPDFWSILQRLHQHKESAPFVFGLLQTIVNATPPIITGDNYES
                     AVSLANDFVSAGSVGYLEERQRDAHSRRSKGVKPPKSSTENEVVTRGLTAINMIYHLS
                     QRAPALIKQSHLEEDEAWSAYWSPIFHSLTAQCINPCRDIRHNAVSTLQRSLLSVDIN
                     SSNEKEWTAIFEQVLFPLTLRLLKPEVFHSDPLGMGETRVQVATLVCKIFLRYLDQLP
                     NPSGMLDLWLKILDILDRMMNSGQGDSMEEAIPESLKNIILVMADGGYLVPPSQDADK
                     EQIWTETRKRLERFLPDLFKEIFPEMPPAQSTLTPTAPSPDLPMDDTPADEQPKEDQR
                     SSDITEGGDGNDEQKDE"
     exon            complement(769644..769961)
                     /number=1
     exon            complement(770051..770433)
                     /number=2
     exon            complement(770487..770596)
                     /number=3
     exon            complement(770650..771038)
                     /number=4
     exon            complement(771097..771433)
                     /number=5
     exon            complement(771488..774660)
                     /number=6
     CDS             join(776778..779004,779070..780901,780982..781542)
                     /codon_start=1
                     /locus_tag="AO090120000300"
                     /note="predicted protein"
                     /old_locus_tag="AO070311000097"
                     /protein_id="BAE62894.1"
                     /transl_table=1
                     /translation="MATVTNAPSDLPLEQLTLYQASDPYLSSIFVFYGPVATANATVS
                     SSRIQAHILTPAGFQSYPRITISPAAPLYAAVNHLPREKQGDEVCRGLAVSMLKYFAE
                     LSEPAKECLQAIARAGKAGGNIPKMFDEMHAADLANRMVKVEHKTDILRDIRGAFQER
                     KVPWVDIDVMLPPGTIQPPSRPDNDGLDDDNADFEDTPDLQYGQYTSLIRGLGAPMFL
                     PTSRLKRAPSQPTNVSKSKVFTKSQKQDFRLKMCEFVDTEERYVNKLYTLVRHVAEEY
                     RLKAQGRGPSSTSPDEAALATLFPPCLNEILDVNMGFLEVIRQVLEDTEKEAIEDITV
                     DTELLSSVSQRHSSKEEGDAVGAVAFAHALIEWFPRFSDPYADYMRAHTGFTQTLNSF
                     MRDKQSSFSRRVHDTGEQLLRSLLMEPVQRLPRYSLLIDTMTSSLPLIHPAVRPFLKA
                     RDIIKDICSLDDPSSTNHDQSFRRLKELVDGWPSTILPTGRLITAVDFYELSPPYQLD
                     NPGSDPTAGIMLIYKNCLVLLSKIPGSKTTARGLLAELDNAASAANGPGGSLPSTDIR
                     VVQVYDLHTVRCMQSTCGRILFLSPTSVKSRPNQNTTVDLLALEPASMYEGRASRVIE
                     EIVKAKIEGRFSESERESGKWSLRSPTGTVGNIGILACVFEEEPSAAVNRTGLSKVRV
                     EFDIPKPLRSKLLNSPDLEVIVSVSLSSEDQYRVDIDSVVGIASSDIVTVDSFVPVLS
                     KRLLNLLLPLHGTQNRTMTESIVLSNFDILRYLSGHLIAQLKVPRTFRPPSPSKLLSS
                     LLGGNQSREGTPSVKAPNSATLLGEFPKMPPPRSSVSRSNTLPSVFPGKEEKKEDPVP
                     KISVVGTTSSKGSESPFSVLEQSFAAYVLSLQSRSGNIVGRTLRGRDNVDRAAVNELY
                     NVLLEDPGQIQAAAEVPVDTLFVAFETFMANAWQEQMGPVLESSTLKSLQSQFDTMYP
                     REFEENFRKFIADMSPQNRRALASLVRLLAELLDASGNDGDRGALTAAFAEILTAEGD
                     PMQHISLLDRLVDDFDNLFDEFVPGGASLEGILNCDQSKPVSQTMGSINSNASSFRKR
                     FGFSLHRENQRSEGESKVSSILRTLSKSKGTGDSEPGTPRGSLLRSKSIDIDTSLGHL
                     LRPGSRDRPGASTSQEYLRRPGSSQEETASLSSIREMPTNGVVKVRRKRRSSLSDLRP
                     GTASTDTSAVSPEQEERPTTAGSSSDVVTPTKQTRPQISHGSGSTQRSTSPTKSGSPT
                     RMTSPSRRSPTRPATPSRKENIDPKLSQVERGTSLRKKGDASVSPTQDSKRRSRATSV
                     PSSRAPGLKERSLPVNGASVQKPQKLRMQSPQKLRDRLQNEKKAQSAAQLGLKDELFL
                     IGEELRSLKIAPPQQTRHARQDSEHLDEPFSPTNNAALVSRVRHLEMRFDTLSSEFNS
                     RTSAIEKDLESSLVVSEKRAKKLDELYREASAENEALYDRFNSELSKVAKDVRAGDAE
                     DALKSQLSSALEEIGRLKKENFRLKREVGGLRAQQAAVALLKASE"
     exon            776778..779004
                     /number=1
     exon            779070..780901
                     /number=2
     exon            780982..781542
                     /number=3
     CDS             complement(782144..783904)
                     /codon_start=1
                     /locus_tag="AO090120000301"
                     /note="predicted protein"
                     /old_locus_tag="AO070311000098"
                     /protein_id="BAE62895.1"
                     /transl_table=1
                     /translation="MALAYLSKQWEKSRPNDISVTAFVVDHKAREESTREANTVSQWL
                     QDIGIYASPYTLAFNTKQMLTRKLGVKSEILELTWPESTKSPSKVTAFETHARRLRFQ
                     ALGKACRDRQIEALLMGHHQDDTVETTLWRLCTGAKGAGLAGIPEVTRIPECHGIYGV
                     SESGSSYTIPSRPQRSSAQARNDTTVSTGGILICRPLLPFPKSSLLATCHENNIPYVS
                     DPTNFDPTLTPRNAIRSLLAEDKLPKALQGPSILSLIKSSQSLLRNSTSLSNTLLTFC
                     KINHLNLPAGTITLTFPSNPINPTSFLNTVPNKAETKGKETQRTHQIKCLTLRRITDL
                     LAPFPENHFPLRSYESFTDLVFPPQDQPVPQKRKPFTLGGVMFQPVNTKGDQDTTSTE
                     ADQSVQSGNTWLLSRQPFMRNRLPSLRVEVPVSGLSVGYTSWMLWDNRFWVRFGFTPG
                     QGSCGAGVEVAEDTSKGEVMSLLVRPLQPSDLQVIRRVVDERGGRSEKKKKKMDPALA
                     GLLDRLGQEAPGLTRFTLPMVVIEKGFCGLEYDLPVGLPTLDLWFPGMWESLQMSGRL
                     RWEWMYKMIDNEPVELMGWL"
     exon            complement(782144..783904)
                     /number=1
     CDS             complement(join(784480..784758,784818..784989,
                     785053..785141,785192..786171,786236..786446,
                     786518..787787,787919..787997,788123..788159))
                     /codon_start=1
                     /locus_tag="AO090120000302"
                     /note="conserved WD40 repeat-containing protein"
                     /old_locus_tag="AO070311000099"
                     /protein_id="BAE62896.1"
                     /transl_table=1
                     /translation="MARKLSHQRITYVLPLPDAPGGHRLGVNGLEIDTDNSILYSAGR
                     DGVICSWDLNLSLKSSSPPTFGASKPAPTTFRNQVQAHSHWINDIVLTKNNSALVSAS
                     SDTTVRLWRPHSECTEVSDPIGKHADYVKALATPGSHASWVASGGLDHKVYLWDLNGG
                     GEVLNIDACGGDSTAKGSVYALGAVSSVIASGGPESVVRVWDPKSGKLITKFVGHTDN
                     IRDILVNRDGDTIMTASSDQTVKIWSLTAGRCMHTLTMHNDSVWSLYSNHPQLSVFYS
                     SDRSGLVAKTDTRYSADIEQGLCVATLQEHDGVVNVVAAGDYIWTATPKSSINRWNDV
                     DTTADIEPPSSRERETASGTETATTEKSKTADNRPEKIPYDSVLLLSNTSTFPKARVP
                     ETAQPHSNANAQSPSSEIDDDLGLTLPVHTLPDDTIEGQHGLIKYFFLNDRKRTLTQD
                     SAGEVVLWDLLKCVPIQSYGKRHIDDVASELNTIESIAHWCTIDIRTGRLSVILEPGR
                     CFDAEVYADEAELSDYSQIRDDQRINLGKWILRWLFAPLIEEELKRDSEYRSAALAKA
                     EEIAKLNLSNTSAPMDIPFADGSRNLATSFDPSISSLRLGYESIGSPSTPGFGIGFAN
                     SPGSLATPTLNPNASNNSHLGTSPGEFSDYLTSHPTADMTRSSLSDKSSDYLSSPRTH
                     GLPPLDTDKALPTPGEPTPTALPQSPMEPDKEERKKGSSLFGKKFRMDFPKKLGRTSS
                     EVKPQIQEEKVEESDKSSVKEEKVFENNLGGFIERIRSEYDEHISAHPGQELTPAFAP
                     SQENETPALNIPDRVAVLIQEETGETAVASDLYRGSVGSIREEIDKLEKSIPLWLADL
                     LLKNQVPFKEPVKIAFTLKPYDDLLPPVVKPEVNVANGNTTNNRLNANRMLRAKKILA
                     YVAERIDPPNPDEPEENAMKPEEYLELYCHKVLIPPNMTLATIRTHIWRSSGDMVLHY
                     KANGKKEIRMPGPGQEDERDNQNAGAGSHPPAEAGGMPQGEGGSAPPGSIHSQTASGS
                     ASVSIHNP"
     exon            complement(784480..784758)
                     /number=1
     exon            complement(784818..784989)
                     /number=2
     exon            complement(785053..785141)
                     /number=3
     exon            complement(785192..786171)
                     /number=4
     exon            complement(786236..786446)
                     /number=5
     exon            complement(786518..787787)
                     /number=6
     exon            complement(787919..787997)
                     /number=7
     exon            complement(788123..788159)
                     /number=8
     CDS             join(789325..789876,789939..790055)
                     /codon_start=1
                     /locus_tag="AO090120000303"
                     /note="predicted protein"
                     /old_locus_tag="AO070311000100"
                     /protein_id="BAE62897.1"
                     /transl_table=1
                     /translation="MDIPIISIKPFYQPPSRNENRAPESPTIQKTIQALQLQPHPEGG
                     YYCETDRHPLRIPNPYCDDMDNRKTVTETDGEKATRSASTTIYYFITPGSPMGYFHRN
                     RSRTVHTLHRGRGRYVILHADRAKENGGIAPIESFVVGHRIEKGERLQWVVDGGKYKC
                     SYLLPDSDGDLPDDNKSEGLLISETVVPGFEFYDHDFLTAEKMEQLLTTEQVEELKWM
                     VRET"
     exon            789325..789876
                     /number=1
     exon            789939..790055
                     /number=2
     CDS             complement(join(790145..791062,791132..791188))
                     /codon_start=1
                     /locus_tag="AO090120000304"
                     /note="mitochondrial carrier protein PET8"
                     /old_locus_tag="AO070311000101"
                     /protein_id="BAE62898.1"
                     /transl_table=1
                     /translation="MVQSPEAEPLVSLWTRSLLSGAVAGLTVDCSLYPLDTIKTRLQK
                     ARHHAPSAPAASLSLRQTIRGIYAGLPSVLFGSAPSAASFFIVYDGVKRSLLPTSSSE
                     APSRTHIILTHSLASSMGEVAACAVRVPTEVVKQRAQAGLFGGSSLLALKDILALRHS
                     DAARGISGGYGQVIRELYRGAGITIAREIPFTVLQFTMWESMKEAYAKRMRHASKSGS
                     DSSIDQVPASTSAMFGSVAGAIAAGLTTPLDVIKTRVMLARREDGAEGGRVRIKDVVQ
                     DISKEGFGAFWRGIGPRVAWIGIGGAVFLGSYQWAWNSLERKSRSQDE"
     exon            complement(790145..791062)
                     /number=1
     exon            complement(791132..791188)
                     /number=2
     CDS             complement(join(792323..793092,793165..794533,
                     794628..794941,795014..795062))
                     /codon_start=1
                     /locus_tag="AO090120000305"
                     /note="checkpoint kinase and related serine/threonine
                     protein kinases"
                     /old_locus_tag="AO070311000102"
                     /protein_id="BAE62899.1"
                     /transl_table=1
                     /translation="MTSEATGFAHTNNMNSDSLTTQQPVPAPAGQGVSTADQENKSKT
                     QPSQVRFSSTTEEIEPSAATGGPGLTPIETPKQMDDLRSLAASLQKSQLQESRLGSFS
                     YDPVSLPSSRVCIQGICRHVASRESSDRSTRGANGSGLPSPHASPPVSVMQSPPLTPA
                     ATHSRESKTNGTSSMSNATDRGTGANSAAMTPEMSPPIGGSTKSQAPQSAPTSRPGST
                     DHLAKQSNVAQTSSHPQNGAKHRAQFFIGPDANSQEESPPATPRVDYTPPGAITPVGE
                     PDDPYARSKRPPQPKNLSQLDQRFIFGGRDFKRRAQTSSFGRPSTPRSASASDLKASD
                     RQRSGFFGSKKDSKQQEPEGKHHGHMAELKRFFKMGHHKHKRAESPSSAVKRSSRSSG
                     KSTPYQLAPDSVPFADDHGLNSKYGKLGKVLGSGAGGSVRLLKRNSDGVTFAVKQFRD
                     RHSWETLKEYSKKVTAEFCIGSTLHHGNIIETLDIIQEGNHWYEVMEYAPFDLFAIVM
                     TGKMQKEEVACAFKQILSGVAYLHGMGLAHRDLKLDNVVVNEHGIMKLIDFGSAVVFR
                     YPFENDIVPASGIVGSDPYLAPEVYDEKKYDPRPTDIWSLAIIFCCMSLRRFPWKQPR
                     VSDNSYRLFVSSPTPGTPVPDADPKRHRPIKSAPDLSSSARESQSSESKNGVSGPPPE
                     QSKSQDAPTAQPKPESTTQDENRPPESPQEKTPSDNQKNGNIDNKPRRTTSKEAPPLP
                     PGSAPPQGQRQEVIKGPWRLLRLLPRESRYIIGRMLKVSVKERAILDDVLTDEWIRNI
                     DACRQEVTGELYRAPGHTHILEPPSPSPAVASKAK"
     exon            complement(792323..793092)
                     /number=1
     exon            complement(793165..794533)
                     /number=2
     exon            complement(794628..794941)
                     /number=3
     exon            complement(795014..795062)
                     /number=4
     CDS             complement(join(797996..798328,798422..798550))
                     /codon_start=1
                     /locus_tag="AO090120000306"
                     /note="mitochondrial/chloroplast ribosomal protein L11"
                     /old_locus_tag="AO070311000103"
                     /protein_id="BAE62900.1"
                     /transl_table=1
                     /translation="MAKKALAKDQIVKLIVGAGQASPSPPVGPALGSKGVKSMDFCKE
                     FNARTAHINTGVPVPARVTVRPDRSFTFDLRTPTTTWLLLQAANVEPRKNRIRGAMNP
                     GHEIVGKVSLKHVYEIAQIKHSETRLSGLSLQGLCKSVIAQAKSIGIQVVP"
     exon            complement(797996..798328)
                     /number=1
     exon            complement(798422..798550)
                     /number=2
     CDS             join(799115..799134,799211..799426,799532..799956,
                     800013..800389,800438..800536)
                     /codon_start=1
                     /locus_tag="AO090120000307"
                     /note="predicted protein"
                     /old_locus_tag="AO070311000104"
                     /protein_id="BAE62901.1"
                     /transl_table=1
                     /translation="MNWLKSTLASVAGTQEPIYGPEAIRSVAQQAQEVPYTVLSKEDL
                     RWRAYQYTNVETKTFYIMADNGTLVFVQIIYSNIVGIHTTAQFNAKIFNLTGDAPHKW
                     YSDPLYNFMFDESMLSFGADNLSLTLNEEGDAYTLKSAVNEDCLVNITFNRSSPGFVI
                     GKDGTSYFGTDAQNPWGSMSHAFWPRCGVEGTITTKEQTYDLKGRAMFIHGLQGMKPH
                     HAAARWNFVNFQTPTYTAVMMEFTTPPSYGSTVVNVGGIVKDGEIIYAGVTNSATHTE
                     AAQDKDSDWPEPKSIKWVWDGKSKDDKTVHAELDGALGRRLDRIDVMAEVPGFIKTIA
                     GSVAGTRPYIFQFAPQEKLTLKLKVGDEEVSEEGVMFSESTFIS"
     exon            799115..799134
                     /number=1
     exon            799211..799426
                     /number=2
     exon            799532..799956
                     /number=3
     exon            800013..800389
                     /number=4
     exon            800438..800536
                     /number=5
     CDS             complement(802564..804504)
                     /codon_start=1
                     /locus_tag="AO090120000309"
                     /note="choline dehydrogenase and related flavoproteins"
                     /old_locus_tag="AO070311000106"
                     /protein_id="BAE62902.1"
                     /transl_table=1
                     /translation="MFVRQLLGLLAVGTGLTTAVNLTGYEYVVVGSGAGGGPLAARLA
                     LAGHKTLLIEAGDDQGLNLNYSIPAYSAKASEDEEMSWNFFVRHYADEERQARDYKTS
                     YETPDGEIYTGLNPPEGSTMKGTLYPRTGTLGGCTAHNALIAIYPHQSDFEYIATLTG
                     DGSWSPDNMRKYFAKLENNNYLLPGQKGHGYDGWLHTETAPLSLVLEDPQLLSLLLGG
                     AFALGNHTNTIFNVGTLLAGDANADKKTRDTKPGYYQIPISTNDAHRNGPREFILAVR
                     DAKNDDGSKKYPLDVRTNCFVTKVTFDESENPPRATGVEFLDGQHLYRASPLANDYSK
                     GTPGTAQASREVIVAGGVYNSPQLLKLSGVGPAEELQKFGIKVISDLPGVGTNLQDHY
                     EITVQGHVPKDWAVLDGCTFSENGEADPCIDRWETPTPILKDRGIYSSSGLAATMFYK
                     SSVTADDSYDVFVFGGPVNFRGYFPNYSINATSEHDWFTWAILKGHPRNSAGSVTLRS
                     ADPLDMPDIVFNYFDTGVGDYDADLQALYEAVELSREAFDRQLVEVTEVLPGADVKTK
                     EDIQQYAKDTAWGHHASCTCPIGADDDPMAVLDAKFRVRGVSGLRVVDASVYPKIPGT
                     FTAVSTYIVAEKAADEILSELN"
     exon            complement(802564..804504)
                     /number=1
     CDS             join(807668..808496,808546..808820)
                     /codon_start=1
                     /locus_tag="AO090120000311"
                     /note="predicted protein"
                     /old_locus_tag="AO070311000108"
                     /protein_id="BAE62903.1"
                     /transl_table=1
                     /translation="MTLRVAEKTSKTIKSESPLADGFNPTPGNSWGVEISNRASETDK
                     LRQKVEQMNEKLDKLLKQNETYHATSEFGGTGQDDTYNKSGWPADPNDEYLGQAVEDD
                     GCQDAYCEHSWTEEDEMPELENVNGDSGLGHEWTAEDSWGLGRAHDDSGLGDEVALTE
                     TNVEADELRDQVKCLQARLADLLAENTQLTMKVKELVGERDDLIPSRNCFLSLYKCQK
                     LQRALTLDECEHLVHASTKVASGDVMADSELYISGERKDYDVFVDLYGVDPHAVPSVL
                     KDQHTIELVNAHATILASKHKTYTSKFEERFARFITNLRRTGYPEDYLIGFMDDVGIL
                     ELQASYTAFRNALLTEVSDALKAEVMNDPVNSW"
     exon            807668..808496
                     /number=1
     exon            808546..808820
                     /number=2
     CDS             complement(join(809578..809854,809913..811924,
                     811981..812034,812087..812203,812262..812303))
                     /codon_start=1
                     /locus_tag="AO090120000312"
                     /note="mRNA splicing factor"
                     /old_locus_tag="AO070311000109"
                     /protein_id="BAE62904.1"
                     /transl_table=1
                     /translation="MDRTSASGPDLYLIADQDTVYEQDLLRDTGSIKPWLAYIEYKQQ
                     HGTLYEQAFVMERACKQLPRSYKLWKMYLEFRTKHLKGRNPTIYRPEYQKVNALFERA
                     LILLNKMPRIWELYLSFLLHQPLVTQTRRTFDRALRALPITQHNRIWKLYKAFARSAS
                     GQTAVKIWARYMQIHPENAEEYIELLVEMGQYTEAVKRYMEILDNPRFQSKEGKSHFQ
                     LWTEMVDLLVSKAKQIETGPHVGIDVDAILRSGIDRFADQRGKLWAGLATYWITKGSF
                     EKARDTFEEGITTVMTVRDFTLIFDSYVEFEESIIGNLMEAAAVRADKGQSDEEADFD
                     LDLRMLRFEQLMDRRPFLVNDVLLRQNPNNVIEWEKRVALWGDNKQEIVNTYTAAIAA
                     ISPKKAHGKFSELWVNYAKFYESGGDLDTARVIFEKAVKVPFKSVAELAETWCEWAEM
                     ELRSENFDKAVEVMAKATQAPKKSTVDYFDENLSPQQRVHKSWKLWSFYVDLVESVAS
                     LEETKKVYERIFELRIATPQTVVNYANLLEEHKYFEDSFKVYERGLDLFSYPVAFELW
                     NLYLTKAVDRKIGIERLRDLFEQALDGCPPKFAKPLYLMYGNLEEERGLARHAMRIYE
                     RATRAVSDEDRFEMFEFYITKSASNFGLPSTRPIYERAIAALPDQEAKEMCLKFAEME
                     RRLGEIDRARAIYGHASQFCDPRTNAPFWQKWEAFEVQHGNEDTFKEMLRIKRSVQAQ
                     YNTDVNFIASQAIARSQQRAQDGDEKGAEEGDVDGSTADAMAALERQARAPVGFVAAS
                     TGPEGGNRPPPPGQEQPAAPANPDAIDLDEDMDAE"
     exon            complement(809578..809854)
                     /number=1
     exon            complement(809913..811924)
                     /number=2
     exon            complement(811981..812034)
                     /number=3
     exon            complement(812087..812203)
                     /number=4
     exon            complement(812262..812303)
                     /number=5
     CDS             join(812623..812637,812942..813271,813324..813372,
                     813430..813439,813490..813530,813579..813802)
                     /codon_start=1
                     /locus_tag="AO090120000313"
                     /note="vacuolar H+-ATPase V1 sector, subunit D"
                     /old_locus_tag="AO070311000110"
                     /protein_id="BAE62905.1"
                     /transl_table=1
                     /translation="MSGAVPEITRRIDEAKQKMGRVMQIAAFSLAEVSYAVGGDIGYQ
                     IQESAKQARFRVRAKQDNVSGVLLPHFESYTEEGINDFGLTGLGKGGQQVQRSRETYA
                     RAVETLVELASLQTAFVILDEVIKVVNRRVNAIEHVIIPRTENTIKYIMSELDEVDRE
                     EFYRLKKVSNKKQRDIAAADAEMEARRAAAQEKEGQKALEPEKEAPDAPDVLGEQEDA
                     DVIF"
     exon            812623..812637
                     /number=1
     exon            812942..813271
                     /number=2
     exon            813324..813372
                     /number=3
     exon            813430..813439
                     /number=4
     exon            813490..813530
                     /number=5
     exon            813579..813802
                     /number=6
     CDS             complement(join(814087..814481,814583..814900,
                     815862..815895))
                     /codon_start=1
                     /locus_tag="AO090120000314"
                     /note="spliceosomal protein snRNP-U1A/U2B"
                     /old_locus_tag="AO070311000111"
                     /protein_id="BAE62906.1"
                     /transl_table=1
                     /translation="MSAPSPNLQSQAPAQVRNLEERVKVDQLKEALEEIFSEYGNVID
                     IVAKTNLKAKGQAFIVFDSVESASNAIDEINGFELFDKPMVLDFAKTRSDATVLREGG
                     EDELEAHKRRRLAEKERKQAHEALEAQKKLKRPPGAPDSTRPAKTAKGAGLKPTSGAT
                     AAVIPDEYLPPNKILFLRDLPDTADQESLTAVFGRFEGFQEVRLVPGRKGIAFVEYEN
                     ESGAISAKEATSGMPMGESGKPIRVTYQRQ"
     exon            complement(814087..814481)
                     /number=1
     exon            complement(814583..814900)
                     /number=2
     tRNA            815224..815294
                     /locus_tag="AO090120t00007"
                     /note="tRNAscan-SE"
                     /product="tRNA-Gly"
     exon            complement(815862..815895)
                     /number=3
     CDS             complement(join(819787..820412,820483..821398))
                     /codon_start=1
                     /locus_tag="AO090120000315"
                     /note="predicted protein"
                     /old_locus_tag="AO070311000112"
                     /protein_id="BAE62907.1"
                     /transl_table=1
                     /translation="MKTRRSCNLITDSDGLNQHLNTNVQPLTSNKTKVRKRRSLDPKH
                     TPPKHDTYKDEVRTGLHTPRRTPPKEKNVPDDASSPKDIACGQSFKRRKLDGQPNKMA
                     HCLAGLVCDPVEETKNNNVNVHAWHQAKSLLEAGLSIFAPTSDILTVTHDNKRSFSEP
                     TGNLSSPLPEYSENTTVDSEKAIASKQLVVRKRSHSPNVVLTTPQIKEEIFDDSDFRV
                     SQTRHSTVVFSLSVEKARRWADAIDIPEGLYNEEEKDLFFRLAMRGFEPLIPEQWRSD
                     FPTLPYTLFSDAEGDSRPVIHTFKSSKTYAIRSLAALFSLGGRVRDCRILKKGPEILI
                     KTTISQYFRWALRDTDIHINRDAIPVHVIYAKKKGETTLDAVKKLNLHLQLLASRHRE
                     ALSAAAPDGDHGSINLQLNEKDDGYSAPSRFYPLLIGFIICGPIIAILTLGTDLSSTT
                     DDTDSKYICQFDLEDAGHDVWNSLAVAITVMKIRETMMQLVDIGSAGFVRHPLDTEST
                     PDVDS"
     exon            complement(819787..820412)
                     /number=1
     exon            complement(820483..821398)
                     /number=2
     CDS             complement(join(822417..822478,822541..822946,
                     823010..823211,823301..823841,823921..824334,
                     824396..824791,824850..825431,825488..825754,
                     825835..826243))
                     /codon_start=1
                     /locus_tag="AO090120000316"
                     /note="serine/threonine protein kinase"
                     /old_locus_tag="AO070311000113"
                     /protein_id="BAE62908.1"
                     /transl_table=1
                     /translation="MDGDDLIASVYRKIEREKALITAASNMRQSTNNPLVQQRVDANI
                     RDGRKNIAYLEEKMRELQLRRDGESPTDKRLPPEPGAGPAPPPKDYGTGYDEYDASGA
                     YPQGGSGSMPTGAPFADPRPFAPVPKARPNFTKLDLIKYDTPYLGPKIQLMLSQLEFK
                     LSVEKQYKAGIEKMVRLYQDEGDRKSRADAEGRRIESNQKIQLLKQALKRYEDLHVDI
                     ESTDDPDDESLNTPNMRKPLTGLLTLRIQAVTDVDHATSSRFSRGPETFVIIKVEDTI
                     KARTKATRTDRWQDETFTIDIDKANEIELTVYDKSGDRPTPIGMLWVRISDIAEEMRR
                     KKLESELNASGWVSADKMEHGGSSGRPDTAGQPGSPHAPGSAGHSGPTAQGYAGAPGG
                     APSLNSVMIESWFALEPVGRIHLSMSFAKQLKDRRPFDIGLNRQGAVRQKKEEVHEMQ
                     GHKFVTQQFYNIMRCALCGDFLKYAAGMQCADCKYTCHRKCYPKVVTKCISKANYETD
                     PDEEKINHRIPHRFEGFSNLSANWCCHCGYLLPFGRKNAKRCSECGLTCHAHCTHLVP
                     DFCGMSMEAANQILETLIHARNHNKSLSVSSGLSGRTLRPGGPPQTPQDPALAYPQKP
                     VESPYGLPQREPSAEAVSAATNSYIPPQSPTAAQRQQMPPRTSSAGPAAAAAAAATGM
                     RTPQQIPTGPVQTLPPSHAHYDPAAYVSYQQSMAPPPQQQMPQKVASPYGVPPQQQPV
                     PVMQQQVAMKEDAPPQQPKVRIGLDHFNFLAVLGKGNFGKVMLAETKSTKKLYAIKVL
                     KKEFIIENDEVESTKSEKRVFLVANKERHPFLLNLHACFQTETRVYFVMEYISGGDLM
                     LHIQRGQFGLKRAQFYASEVLLALKYFHENGVIYRDLKLDNILLTLDGHIKIADYGLC
                     KENMWYGATTSTFCGTPEFMAPEIILDKKYGRAVDWWAFGVLIYQMLLQQSPFRGEDE
                     DEIYDAILADEPLYPIHMPRDSVSILQKLLTREPELRLGSGPTDAQEVMSHAFFRNIN
                     WDDIYHKRVPPPFLPTITSPTDTSNFDQEFTSVTPVLTPVQSVLSQAMQEEFRGFSYT
                     ADFA"
     exon            complement(822417..822478)
                     /number=1
     exon            complement(822541..822946)
                     /number=2
     exon            complement(823010..823211)
                     /number=3
     exon            complement(823301..823841)
                     /number=4
     exon            complement(823921..824334)
                     /number=5
     exon            complement(824396..824791)
                     /number=6
     exon            complement(824850..825431)
                     /number=7
     exon            complement(825488..825754)
                     /number=8
     exon            complement(825835..826243)
                     /number=9
     CDS             complement(827924..829411)
                     /codon_start=1
                     /locus_tag="AO090120000317"
                     /note="predicted protein"
                     /old_locus_tag="AO070311000114"
                     /protein_id="BAE62909.1"
                     /transl_table=1
                     /translation="MSTSAFGALLQLESSPPIANPAAAVHRDKHGLANASFDLELNEV
                     RHGSSPTSKTTKANSGIATPLTPTGVENHSPAPDVYESAYPNANQASSSKTKWRLLSA
                     CLMNLGGGLNDSAPGALIPYIEEDYNIGYAVVSLIFVTNALGFILAAPFTHALEAKLG
                     RPKAYALSMAVLAAGYVIIVCKPPFPAIVASFFLLGFGLALQLALNNVFCANLVNSTT
                     ALGFLHGSYGIGGIIGPLIATALASHGVQWSFFYCISLALALFNAALAAWTFRGYEKE
                     LPVQLLATFQQSTSQQDHDHGVASKTQSLKQAVKNRTTLLGALFIFAYQGAEVSISGW
                     VVSFLISSRDGNPSQVGYVSAGFWAGITLGRFALSHPAHMIGEKLSVVLLVIGSVAFQ
                     VMTWLIPNVIGDAVAVSIVGLLLGPVYPCATAVFSKLLPRSMQMSSLSFISALGSSGG
                     AVSPFFTGLLAQNVGTFVLHPICIGLYGVMLTGWACHPRISKRSE"
     exon            complement(827924..829411)
                     /number=1
     CDS             join(830174..830484,830540..830645)
                     /codon_start=1
                     /locus_tag="AO090120000318"
                     /note="predicted protein"
                     /old_locus_tag="AO070311000115"
                     /protein_id="BAE62910.1"
                     /transl_table=1
                     /translation="MAPPRRKVLATAEETMTPPDELQQGQQIARVIKATGNNLYVVEL
                     PSKDTVLVELPSRFRSRIWMKRNSYVVVDTNALEDRDNKLAGEIINIVRDEKVWRKAP
                     FWPKEFVKQSTVVASDSEDEEESNVGKMPPSDDSDA"
     exon            830174..830484
                     /number=1
     exon            830540..830645
                     /number=2
     CDS             complement(join(830772..831368,831427..831950,
                     832015..832135))
                     /codon_start=1
                     /locus_tag="AO090120000319"
                     /note="mannosyltransferase"
                     /old_locus_tag="AO070311000116"
                     /protein_id="BAE62911.1"
                     /transl_table=1
                     /translation="MELKHFIHELCLNPRHTKWIAPLLVIGDAFLCALIIWKIPYTEI
                     DWTTYMQQIALYISGERDYTLIKGSTGPLVYPAAHVYSYMALYHLTDEGRDILFGQIL
                     FAVLYLVTLAVVMVCYRQSGAPPYLFPLLVLSKRLHSVFVLRLFNDGLAVCAMWIAIL
                     LFQNKKWTAGVTAWTVGVGIKMTLLLLAPAIAVVTVLSLSLVPSIRLGILALLIQVLL
                     AIPFLQGNPIGYVARAFELTRQFMFKWTVNWRFVGEDLFLSKQFSLALLGLHIFLLGL
                     FVTTGWLRPSGSNVPDFLRSLLQGRQRTVVLSKSFIMTVMLTSLAIGLLCARSLHYQF
                     FAYLSWATPCLLWRARLHPILIYAIWALQEWAWNVYPSTNASSSVVVFSLAVQVFGVL
                     LNSRNALSDAPPRRKGKEHIQ"
     exon            complement(830772..831368)
                     /number=1
     exon            complement(831427..831950)
                     /number=2
     exon            complement(832015..832135)
                     /number=3
     CDS             join(833643..833659,833727..834224,834441..834984,
                     836029..836031)
                     /codon_start=1
                     /locus_tag="AO090120000320"
                     /note="serine/threonine specific protein phosphatase
                     involved in glycogen accumulation, PP2A-related"
                     /old_locus_tag="AO070311000117"
                     /protein_id="BAE62912.1"
                     /transl_table=1
                     /translation="MSDLDRAIAQLRACRLIPETQVRELCYKARELLIEEGNVVCVDA
                     PVTICGDIHGQFHDLMELFRVGGDVPDTNYLFMGDFVDRGFYSLESFLLLLCLKVRYP
                     DRITLIRGNHESRQITTVYGFYDECIRKYGSANVWRYCCEVFDYLALGALVLGTSSEL
                     EPTGPVMNDSTQTGAVLCVHGGLSPLIDTVDKIRLIDRKQEVPHEGAMCDLLWSDPDE
                     IDGWGLSPRGAGFLFGGDIVKQFNYRNDLSLIARAHQLVMEGYKEMFDGGIVTVWSAP
                     NYCYRCGNVASILELGEDTSNGGTVTRSNGDYGRSNGIMTVDRPGVRSPGRRYRVFEA
                     AAQDTRGMPAKKPVADYFL"
     exon            833643..833659
                     /number=1
     exon            833727..834224
                     /number=2
     exon            834441..834984
                     /number=3
     exon            836029..836031
                     /number=4
     CDS             841558..843027
                     /codon_start=1
                     /locus_tag="AO090120000321"
                     /note="predicted protein"
                     /old_locus_tag="AO070311000118"
                     /protein_id="BAE62913.1"
                     /transl_table=1
                     /translation="MMVPRAFLFSSVPPLHNGKKSQLSKSEIDFIAVQDVPGLELHDK
                     ESPHTSPVIIPPKRGPRVTPVQRDSVRKGPKTPRCAKTVHRTSSAASGDRPIPSSIAS
                     ILEATAIPVPRRKRNAREPRRIPQVNHVQDFSKLLLEGVKSRDDSLTEGTGNTMLDIL
                     LSPPEDNDRFASGSNCDSDSEAPSLSAHSLSIESVPSLDAEFESPFGSPIPSTPSSQR
                     SPCERRYLRLSQYESCASDHPLLEEDELSDTEWEPVQQPAFLDSTPTKSSPSRSFPRL
                     GSTFKSNLTASLRAIKSAAQTVSTFATPSVQPDDFLTRSLLTITPKMTDDRRPPPMNE
                     PPSPALRRYFNPVTVSPAEIYAYQDHPHENLDTNNCPVSVQMQTYHRSGKRGSRKSRF
                     HLSGSKGRGRYSPFDPEVPPMSRQREPRENSDFLRMVVMEMNMRRSGKLRDDIPTRAR
                     VWLPPRKGNQARNSPYDYYEDEAEHAIPSRWVGISADSM"
     exon            841558..843027
                     /number=1
     CDS             complement(join(846816..846841,846907..847345,
                     847394..847499,847552..847684,847742..847873,
                     847926..850030,850099..850178))
                     /codon_start=1
                     /locus_tag="AO090120000322"
                     /note="ATP-dependent DNA ligase IV"
                     /old_locus_tag="AO070311000119"
                     /protein_id="BAE62914.1"
                     /transl_table=1
                     /translation="MDSDDDYNGPADTNPRLEDEESDLDEKYPNRPRNHSTTLPFHVL
                     FQTLFYPLSEIKKKPAGPARKKVGPHGLSSVNLTPLEKRRDIIDRFISRWRKEVGDDI
                     YPAFRLILPDKDRDRAMYGMKEKAIGKLLIRIMKIDKNSEDALNLLNWKLPGQTTTSS
                     MAGDFAGRCFGVLSKRPMRTEVGDMTIEEVNEKLDHLSAASKENQQLPILTEFYRRMN
                     PEELMWLIRIILRQMKVGATERTFFDVFHPDAENLYSISSSLRRVCWELHDPNIRLEA
                     EDRGITLMQCFQPQLAQFQMHSLDRMISRMRLTEDDPVFWIEEKLDGERMQLHMDSND
                     SVPGGRTFRFWSRKAKDYTYLYGNGIQDENGALTRYLSDAFADGVESLILDGEMITWD
                     TEQDAIAPFGTLKTAALSEQRNPYSSTTRPLFRIFDILYLNGRDLTRYTLRDRRNALQ
                     KSIKPVYRRFEIHPYEEATGKTEIEEALRRVVEEASEGLVLKNPRSPYRLNERHDDWM
                     KVKPEYMTEFGESLDVVVIGGYYGSGHRGGGLSSFLCGLRVDDAHSSQGMVASKCYSF
                     CKVGGGFTAADYANIRHHTDGKWHEWKSRKPPTTYIELAGGDAQYERPDMWIKPEDSV
                     VLCVKAASVAVSDQFRIGLTLRFPRFKKLRMDKDWKSALSVQEFLDLKANAERERKEK
                     EFNVDNSRKKRAKRDNKKPLAIVGYSAEAEAQYTGPSGNIFEGLNFYITTDSNTPVKK
                     SKAELEQLVKANGGKFFQTSNAAPSTICIADRRTVKAASLQKSGNVNIIRPSWILDCI
                     RQSEIDAGLPDSLLPLEPRHVFFATQDKKEEIAASVDRFNDSYARNTTNDELKEILKQ
                     MSKDHHFHASQNPKIVRKLNERIQEKVNAGWEMPSGWLFKGLTILFPQNDKVDDAEVD
                     ETSQTHQQYRLNLARNTVRFAGANVVDSKSSSVTHIVVAPGSSSSDVSSIRKSHSAKP
                     GKKVPHLVTAEWIEECWKQRTLLGEEGFQPSRGT"
     exon            complement(846816..846841)
                     /number=1
     exon            complement(846907..847345)
                     /number=2
     exon            complement(847394..847499)
                     /number=3
     exon            complement(847552..847684)
                     /number=4
     exon            complement(847742..847873)
                     /number=5
     exon            complement(847926..850030)
                     /number=6
     exon            complement(850099..850178)
                     /number=7
     CDS             complement(join(854577..854646,855096..855340))
                     /codon_start=1
                     /locus_tag="AO090120000323"
                     /note="predicted protein"
                     /old_locus_tag="AO070311000120"
                     /protein_id="BAE62915.1"
                     /transl_table=1
                     /translation="MYREMFRSKPGGDLLRRLRSKSCRALANALESIVRMGSIPPNLV
                     LYGTNFGWLFGFNIGMGTRAEIMSVDISGSSGSVCDCSNHILTDRLMASILLGKTNSM
                     TL"
     exon            complement(854577..854646)
                     /number=1
     exon            complement(855096..855340)
                     /number=2
     CDS             join(860148..860219,860276..860314,860404..860472,
                     860556..860815,860868..861511,861576..861619)
                     /codon_start=1
                     /locus_tag="AO090120000324"
                     /note="predicted protein"
                     /old_locus_tag="AO070311000121"
                     /protein_id="BAE62916.1"
                     /transl_table=1
                     /translation="MSLHSLGEEYDEFAEARRRAWWMTYYCVLQGSIVSTTPLAIVAN
                     DPQFVTPYPRFAADPDGWAVLMQAQQVLVSATQFVIDLNKCISTRTNMPYIYERMQQL
                     DTWASSALAQSNLLPIVPPSMNCGDGMEFTTAQSIRSISRIKLSSAQIKTHRFRAFSD
                     IPIFIKKHCDLTAANSNNSAACNSAKDSRVQNGITDIRCSCGGLEPFQQSSSEYTPST
                     ASSTSSDYQSISQYSFTSGFPFSIQHSAKVCLRAALLISRMFPSLPIPQPIINEPKSP
                     QGMTLQPPNQLPRTMPSFACCLMQGSYAMLMIFYKARVEKQLSPDYGNKTTPSDRLIE
                     ELRQGLERIIATVTNYAAAFEALDGMRDEIEGAYQTAFPQL"
     exon            860148..860219
                     /number=1
     exon            860276..860314
                     /number=2
     exon            860404..860472
                     /number=3
     exon            860556..860815
                     /number=4
     exon            860868..861511
                     /number=5
     exon            861576..861619
                     /number=6
     CDS             complement(join(862230..862488,862540..862689,
                     862754..862833,862898..864760,864862..864996))
                     /codon_start=1
                     /locus_tag="AO090120000325"
                     /note="predicted protein"
                     /old_locus_tag="AO070311000122"
                     /protein_id="BAE62917.1"
                     /transl_table=1
                     /translation="MAPTGSRKRVKSIPSVADSQSSNDGTTLPSKDRGRSGSLKQRGS
                     GNWHPGAWPVSKSSKAAPVTEVARESISVAQNVASSLTSSPVSQLASPKHPRNPSLQL
                     TRKVGASTRSLPANATTTRINIASDGTASSPAIEAQPNPTASATESTNKESSNDEGAG
                     TGQTIDKDQSDVTTETNAGSGEVEASQEQTPSQPSGWFAWVWAPSRTEPPPDNPREDS
                     APAPVDQTAENQTSKEEDIAPANQDQADETKPPVTAEIDDTVQKRSWLQMWYGSSSSK
                     GLEEPHRENPPATDESNPPADIPPTSNENVDEPTADSSAGAPSSTDVPTKTAKPSGWS
                     FWFRETSQDTSQVKSQEVQSVEASTTQDSIIKKPKDDPESEPEQKAELSKKGTLKIKS
                     PKSSSALPEQIVSGLESSSASPAVNTSEATASKHLQKILPNQVLPRFRDTFALQEKPS
                     LFQTIGRFLHYNKEPDNRHVYMIKDPPPIKRALAIGIHGYFPAPLIRTVLGQPTGTSI
                     RFSNMAADALQTWADDHAYTCDIEKIALEGEGRIAERVDLLWKLLLNWMEKIRRADFI
                     LIACHSQGVPVAIMLVAKLISFGCLNAARVGVCAMAGVNMGPFSDYRSRWISGSAGEL
                     FEFALPHSQVSKDYEAALKTSLNFGVRISYIGSIDDQLVSLESSLFSPVAHPYVYRAV
                     FVDGRVHAPSFLSHLVGFALKLRNLGLPDHGLIRELSSPLAGSLYSGEGHSRLYDDEA
                     VYRLAIEFALETSNVQDATLNIKRSPPASSVNPYILPFAMRGLLEEEYVRRELYEETM
                     ELLRQFDDWKPTSKVLKDVKFRLEGIRSKL"
     exon            complement(862230..862488)
                     /number=1
     exon            complement(862540..862689)
                     /number=2
     exon            complement(862754..862833)
                     /number=3
     exon            complement(862898..864760)
                     /number=4
     exon            complement(864862..864996)
                     /number=5
     CDS             join(865460..865477,865539..865688,865740..867423,
                     867483..868039)
                     /codon_start=1
                     /locus_tag="AO090120000326"
                     /note="putative SAM-dependent rRNA methyltransferase SPB1"
                     /old_locus_tag="AO070311000123"
                     /protein_id="BAE62918.1"
                     /transl_table=1
                     /translation="MAIQKKHGKGRLDKWYRLAKEKGYRARAAFKLIQLNKKYGFLEK
                     SKVVLDLCAAPGSWCQVAAECMPAQSIIIGVDLAPIKPIPRVITFQSDITTEKCRTTI
                     RQHLKHWKADTVLHDGAPNVGTAWVQDAFSQAELVLQSMKLATEFLVEGGTFVTKVFR
                     SKDYNALLWVFKQLFTSVEATKPPSSRNVSAEIFVVCRGFKAPKRLDPKFLDPKHVFA
                     ELADPTPNNEARVFDPEKKKRKRDGYEEGDWTQFKEIPVTEFINTTDPIAILGQYNKL
                     SFQQPLNGDIALSTLNRLEETTDEIRKCCEDLKVLGKKEFRNLLRWRLKVREKFGLVV
                     KKGGQAKKDEPEEVAEIAPMDEELAIQEELQRLREKESSKAKKERRKENEKKRKEIVR
                     MQMHMTTPMDIGMEQIGPLGDDAPFSLKRVEREGARDTIAAGKEVTVESESEDSESDV
                     DAESDDEGDLLERELDSLYEQYQERKEDKDTKLRAKKARKDFEADEWEGFSESGNEES
                     DNEDSEFGAANATSVAPPKNGTLSNNAALFFDQDIFQGLEDIDDVEDEDEDEDSVIEM
                     DEDDNDYTESKNSVAKKQKAKDAKAVTQMVLDSSDEEPEELDEPRKENGQLDIDIITA
                     EAMALAQQMASGEKKSHDVADDGFNRYAFRDVDGLPEWFLDDETKHSKPNRPITKAAA
                     AAIKEKLRAINARPIKKVMEAKGRKKFKAAQKLEKLRKKSALLADDEALSERDKSQAI
                     SKLMSKATKKKPKQQVKLVVAKGNNRGISGRPRGVKGKYKIVDSRMKKDVRAQKRLAK
                     KKQK"
     exon            865460..865477
                     /number=1
     exon            865539..865688
                     /number=2
     exon            865740..867423
                     /number=3
     exon            867483..868039
                     /number=4
     CDS             869232..870239
                     /codon_start=1
                     /locus_tag="AO090120000327"
                     /note="putative protein methyltransferase involved in
                     meiosis and transcriptional silencing (Dot1)"
                     /old_locus_tag="AO070311000124"
                     /protein_id="BAE62919.1"
                     /transl_table=1
                     /translation="MVLARFANESTSYNRYNLVVPRDKDDFRPIDDIFQVIETVSQNY
                     IPEDEADYFDNESTGIKRRLRRALAHASEAEFRNVVTDYNEAIERLRRDGSIAQKLDS
                     THRLNLPLVERILTQIYSRTVSPRVESLRQYENGTDNVYGELLPRFISTIFKETGLKS
                     GQVFVDLGSGVGNVVLQAALEIGCESWGCEMMQNACELAELQQTEFRARCRLWGIAPG
                     KTHLVRGDFLKEQSIIDVLKRADVILINNQAFTPQLNNELINHFLDMKEGCQIVSLKS
                     FVPAAHKIQSRNLNSPINLLKVKQREYWSNSVSWTDVGGTYFIATKDSSRLRAFAESM
                     G"
     exon            869232..870239
                     /number=1
     CDS             complement(join(870775..870933,870987..871556,
                     871705..871797))
                     /codon_start=1
                     /locus_tag="AO090120000328"
                     /note="predicted protein"
                     /old_locus_tag="AO070311000125"
                     /protein_id="BAE62920.1"
                     /transl_table=1
                     /translation="MTLGRWSRRCARVAAASDHITNGLPLSVQEISTSLIVIINGPLE
                     RGVLRRSGGSRSTRKSQCCYPKCLYAFKRQLCLERNIPMWFLFLTDISSIATDTQLAD
                     RTGRIATAVKSAQSSTPTESHNEIPQSLVPDHKKQAVVSSELSLQDALAAARTDLSEA
                     QRSRSELQDRLTRTTAELEKLRKRSSQDSRRIGVLEKEAAQLQLRLKDRDEELKGKAK
                     LLDDFQDELASLNLQLNMAEERSNRLQKENQELVDRWMARMGKEAEAMNKASRFS"
     exon            complement(870775..870933)
                     /number=1
     exon            complement(870987..871556)
                     /number=2
     exon            complement(871705..871797)
                     /number=3
     CDS             join(872076..872105,872165..872218,872289..872384,
                     872443..872622,872725..872872,872941..873050)
                     /codon_start=1
                     /locus_tag="AO090120000329"
                     /note="Ras-related GTPase"
                     /old_locus_tag="AO070311000126"
                     /protein_id="BAE62921.1"
                     /transl_table=1
                     /translation="MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSASYKATIGAD
                     FLTKEVLVDDRLVTMQIWDTAGQERFQSLGVAFYRGADCCVLVYDVNNSKSFEALDSW
                     RDEFLIQASPRDPENFPFVVIGNKIDVEESKRMISSKRAMTFCQSKGNIPYFETSAKE
                     AVNVEQAFEVIARSALAQEEAEEFSGEFSDPINIHLDSERDGCAC"
     exon            872076..872105
                     /number=1
     exon            872165..872218
                     /number=2
     exon            872289..872384
                     /number=3
     exon            872443..872622
                     /number=4
     exon            872725..872872
                     /number=5
     exon            872941..873050
                     /number=6
     CDS             join(873845..873952,874046..874384,874509..874581,
                     874640..875055,875126..875403,875505..875545,
                     875643..875806)
                     /codon_start=1
                     /locus_tag="AO090120000330"
                     /note="predicted membrane protein"
                     /old_locus_tag="AO070311000127"
                     /protein_id="BAE62922.1"
                     /transl_table=1
                     /translation="MDTFTRLSTGVARRTLGIGLLLIVVVLWTASNFLASTIFADDTY
                     SKPFFVTYVNTSLFMLPLFTIIFGRTWRLWRSGKLSQIHSFQSFLWHIDSHDPDAETT
                     GRDNAYEPADPETWNTAMLDSRGKEEESVKLGLRATAKLSLQFCMLWANYFAMACLQY
                     TTVGSTTILTSTSGVWTLIFGALIGVEKFTVRKLAGVVASLVGIILISRVDLSASEAP
                     PADDGSGGRFPNKSSTEIALGDAMAGFSAVMYGVYTIVLKKQVGDESRVNMQLFFGLV
                     GLINMLLLWPGFIIMHFTGIETFALPDTGTVWTIILVNSVSSLLSDICWAYAMLLTTP
                     LVVTVGLSLTIPLSLVGQIFLQGVTSSALYWVGAAIVFLSFLVVNHESKEKSNEETSV
                     GDYDAVPGEETERTILGCEKNIKDDYKTLVNPTLSALSKARGFTDRKGKKRKKIYIIS
                     NVGYVCRKKVTKRKENAVDEGI"
     exon            873845..873952
                     /number=1
     exon            874046..874384
                     /number=2
     exon            874509..874581
                     /number=3
     exon            874640..875055
                     /number=4
     exon            875126..875403
                     /number=5
     exon            875505..875545
                     /number=6
     exon            875643..875806
                     /number=7
     CDS             complement(join(875930..876187,876285..877028,
                     877083..877322))
                     /codon_start=1
                     /locus_tag="AO090120000331"
                     /note="predicted protein"
                     /old_locus_tag="AO070311000128"
                     /protein_id="BAE62923.1"
                     /transl_table=1
                     /translation="MMHQPLTSSCPSTSEGHVKAPAIHFPDGTVKQSTLLRSPTVHRN
                     GHVNLDTFSPVNENGSFEFDRVLKTGKVHRRVKHKHAFRASWKQAYLVLRPNLLSVYK
                     DEEATRLRLSITLSEVTAIAPVKSPRSNRQHVFGIFSPSKNYRFQALSEKDAQDWIER
                     IRAETRMDEEEEAFLALSMKGNNTATSKQQIDDTTDFSDVEHIARASSPEFGRASSPG
                     GRLTAHQNFSGHDITSYSEWSDGPASNSSVRPVSRTSTIPNLSVSTPASAQPASARDT
                     DRTQESGARRDPERVICNGYLQCLRIKGGVRQWKRLWVVLRPKSLGFYKDEQEYSAVK
                     ILPMDQVFDAAEIDPISRSKLYCLQVIAEEKSYRLCTDNEESLAKWLGSLKSVLVARK
                     KLESETVPGAAAATAAAAAAA"
     exon            complement(875930..876187)
                     /number=1
     exon            complement(876285..877028)
                     /number=2
     exon            complement(877083..877322)
                     /number=3
     CDS             join(881785..882056,882141..882536,882590..882676,
                     882740..883148,883206..883547)
                     /codon_start=1
                     /locus_tag="AO090120000333"
                     /note="glycolipid 2-alpha-mannosyltransferase (alpha-1,
                     2-mannosyltransferase)"
                     /old_locus_tag="AO070311000130"
                     /protein_id="BAE62924.1"
                     /transl_table=1
                     /translation="MGLTQRISKWLPSSPSLPVDDVSREKGRNISRFAFFKRRIRLKG
                     NSSISIPLGFVLLFPCLVIVLVLLLFVRHPSSPGGILIPAGTPPSISEKHDKVFASGC
                     LQVEKEVEGKRANAAFVVLARNKELDGVIQSLKSIERHFNRWFHYPYVFLNDGDFDDT
                     FKDTVKNYTSAPVEFGKIDDTMWGYPKWVDHEVAKEGIRKQGDAAIMYGGMESYHHMC
                     RFYSGFFYKHPLLMKYEWYWRLEPEISYFCDITYDPFVKMAEANKTYGFTIAVKELRE
                     TVPNIFRYASAYKRKHNLESKGLWEMFLERPPEEEPKPEEGKQDKLPEEILQNEPGEN
                     TVPDVDPEAMEGEKYNMCHFWSNFEIARLDWFRSKEYEEFFEMMDRSGGFWMERWGDA
                     PIHSLAAGVLLSPSDIHYFRDFGYRHTTIQHCPANAPARQLPRIPWLEMTTEDEKARF
                     EEDEYWANADPVKENGVGCRCRCDTDIVDVEGKQGSCLAEWVEVAGGWASP"
     exon            881785..882056
                     /number=1
     exon            882141..882536
                     /number=2
     exon            882590..882676
                     /number=3
     exon            882740..883148
                     /number=4
     exon            883206..883547
                     /number=5
     CDS             885336..887858
                     /codon_start=1
                     /locus_tag="AO090120000334"
                     /note="predicted protein"
                     /old_locus_tag="AO070311000131"
                     /protein_id="BAE62925.1"
                     /transl_table=1
                     /translation="MADSPRPRSRRPSLTSSSAHLRYPTFPPLSGSVEEWLSRSRPIS
                     MTSSHLADYTPRPLSESWATLSASDVHSEDGSRSEQTDVGSLIDQAGPDDVASIDEQY
                     SGSEVDGNEDDDYDSKSNVFGSQELPALFPQIRGSIDDSNITTKTAFRQSTESIEFAE
                     PEKWPEVEQVELKHTIRMFEGIEADELKSQFSINLRDSILTATVQQTMTKKSLDTDKP
                     FRVLYIGDPEFRNIILDKIGDVLVSSTCSDFESSSTESSRYHVVPTSFGTGAVPNFAE
                     LLPIHVQLIVDECPGASVGFRNDKPDTIRLDFKNRPSCMSFWTGGEYCVSSPTEWTLP
                     DVAILFISSRDSATVMETQKLARIFMERHGIPAMVISEKPLWDLAEVIPLNHHSLHMC
                     LESRHSLTGKVTVLRRYPIDLATFESITPGQLNRNLASLVSISTKKSDNITLETTGNF
                     QRKSLFAVEKWTTKMPFIPYLNDDRGLTPMLRLITLTVLLSVATILAHSALRATSILF
                     SQKFPRSVISNIVSNAPSSTSTSIITANDLKQTSLSTLSSSVTDVQNFGNQLQGHSQL
                     DNLMSGLLSPPKKQEFSGFEIQAVGDCHLVIKPPNRTLTGKKQPKFEVQVSRGVKPLE
                     YELSRLFDGVYTLKLDRGDAYGIVNVTVTMASRPPLHQTTSVDFGTPWLKIANWRRAA
                     QVISSQFMGDFNTAQVGLSEVYSRICTDLQVLMGDVVKKAHLLRGEANVLRHGTGQLS
                     ETKDVVITRSKQLSEVVRCTAVQPFLAVSSVLQEKTNKVNQETREIIGGTWHRISNQA
                     HGFELKSVKDHIRNARKSYTLDKAQRRAKRLMTRKCRHSECL"
     exon            885336..887858
                     /number=1
     CDS             join(888492..888773,888942..889200,889263..889391,
                     889452..889522)
                     /codon_start=1
                     /locus_tag="AO090120000335"
                     /note="Ran-binding protein RANBP1 and related RanBD
                     domain proteins"
                     /old_locus_tag="AO070311000132"
                     /protein_id="BAE62926.1"
                     /transl_table=1
                     /translation="MSDVPETKPDPTTSAPEAAEKPEETTTSTEAPKTEEDKSATETV
                     VETAKEAATKTTDSVFSMFGGGPKKEKKEEPEDNNDEPSGSSKAQKTEEEDEAPESPD
                     VHFEPVIRLTEKVETKTNEELEEQTFKMRAKLFRFDGESKEWKERGTGDVRLLKHKEN
                     QKTRLVMRRDKTLKVCANHYIVPAMKLSPNVGSDRSWVWNAAADVSEGEPEAQTLAIR
                     FANSENANLFKEAFEKAQQENEKLLASQ"
     exon            888492..888773
                     /number=1
     exon            888942..889200
                     /number=2
     exon            889263..889391
                     /number=3
     exon            889452..889522
                     /number=4
     CDS             join(890474..890482,890592..890632,890895..891046,
                     891203..891345,891417..891557,891629..891749,
                     891867..891919)
                     /codon_start=1
                     /locus_tag="AO090120000337"
                     /note="transcription initiation factor IIF, auxiliary
                     subunit"
                     /old_locus_tag="AO070311000134"
                     /protein_id="BAE62927.1"
                     /transl_table=1
                     /translation="MPDVKRNVRLITEQHVVNKDSGVEGFPLRAWSIEIYLVNDHGEQ
                     VPANVFDKVTYTLHPSFGDRAIQTFKNPPFRISEEGWGEFDMQITLHADKDHYVTHDL
                     NFAQTRYESKHVITFKNPKPALLAALRESGPVPGDENGVKSKRSAASEEGSKKKKRTE
                     KSVDMDKLADGLQRLGEDDLLQVVQMVHDNKAPDSYTKNDVEHTLIKMLWDFTQEKGA
                     L"
     exon            890474..890482
                     /number=1
     exon            890592..890632
                     /number=2
     exon            890895..891046
                     /number=3
     exon            891203..891345
                     /number=4
     exon            891417..891557
                     /number=5
     exon            891629..891749
                     /number=6
     exon            891867..891919
                     /number=7
     CDS             complement(join(892702..892735,892773..892892,
                     893158..893636))
                     /codon_start=1
                     /locus_tag="AO090120000338"
                     /note="predicted protein"
                     /old_locus_tag="AO070311000135"
                     /protein_id="BAE62928.1"
                     /transl_table=1
                     /translation="MSSAQDEFNLLVQSNREKYSTHPEDRDNDSGHDSNPSEDEQDHP
                     QFSDSEDHDPTMRTGSSTYRVPNIVFDANTGPKGVIADAQAFERARASSFRKTLHHND
                     HAKYVADDSHLLHHTPPPDGSLSDEDEEHFLRQWREERIQELRNRSFRRPSPRRRMYG
                     APALLAYRGGDVFETIVEIVRQIPKGRDCTSHTLEDLLKLYADCPRYRVL"
     exon            complement(892702..892735)
                     /number=1
     exon            complement(892773..892892)
                     /number=2
     exon            complement(893158..893636)
                     /number=3
     CDS             complement(join(895834..895854,895917..896036,
                     896098..896187,896254..896966,897063..897180))
                     /codon_start=1
                     /locus_tag="AO090120000339"
                     /note="G-protein beta subunit"
                     /old_locus_tag="AO070311000136"
                     /protein_id="BAE62929.1"
                     /transl_table=1
                     /translation="MAADMSGEQMQAKITAARREAEGLKDRIKRRKDELADTTLRQVA
                     QNQTDTLPRIGMKPRRTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVH
                     AIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLSSREGPTRVARELSGHSGYLSCC
                     RFINDRRIITSSGDMTCMLWDIESGSKVTEFADHLGDVMSISINPTNQNIFVSGACDA
                     FAKLWDIRTGKAVQTFAGHESDINAIQFFPDGNAFGTGSDDTSCRLFDIRADRELNIY
                     QSDQILCGITSVAFSVSGRLLFAGYDDFECKVWDVLRGDKVGSLSGHENRVSCLGVSN
                     DGISLCTGSWDSLLKVWAW"
     exon            complement(895834..895854)
                     /number=1
     exon            complement(895917..896036)
                     /number=2
     exon            complement(896098..896187)
                     /number=3
     exon            complement(896254..896966)
                     /number=4
     exon            complement(897063..897180)
                     /number=5
     CDS             903346..905163
                     /codon_start=1
                     /locus_tag="AO090120000340"
                     /note="predicted protein"
                     /old_locus_tag="AO070311000137"
                     /protein_id="BAE62930.1"
                     /transl_table=1
                     /translation="MREVNFSIPNVNKASVNITTTLYDRRALDCTSTLPLINSLNHLA
                     YLTTSSARIRDILTVDGGIERLVCILKEGRSRDLMEMWKWSLAFQCVVNIGVRGSESV
                     RTRVVEADMVPVIATILDNYIKVVDKARARADSENQRHSSRHHPKAAPAAGDVTGRPS
                     FPDQSSNSEQRTSRRQAPPPSIEIPAFLHQNTNAPDTNAMDVTSSPRAPMTSPPERST
                     FGQEAHIHRSHDGRHLHTGHRHRAMQPLATALPPMDTADGFGLRPVRDTERLPSMLPT
                     LHNGITSQPDSPTTPNGPVQPRSHAQTSAARQRPTLRQQQSASGDSDDGNGEGSTLGD
                     NAGSAETSEPIVGLQNEMEIDEVSDRQTMIDGVSNSHDLTVTDPSESQEAETFNISHR
                     STVDGSIINNDTTQTNTALGLSPTQAANNANSPALVPSPYTLYFRDRSAVPQNVLTTM
                     PRDEDVLMSLQLLAYVSKYCNLRSYFQHSHLVPKLKVDRELQMLEEGASPIEPPEEEE
                     EYMLPDDVNIFPLVEKFTVRHHSKDMQYWACVVMRNLCRKDESRGGIRQCAYYKCGKW
                     EEFQRQFAKCRRCRRTKYCSKDCQKAAWVYHRHWCHTTP"
     exon            903346..905163
                     /number=1
     CDS             complement(join(905937..906723,906776..906792,
                     906865..906918,906982..907041,907131..907313))
                     /codon_start=1
                     /locus_tag="AO090120000341"
                     /note="iron/ascorbate family oxidoreductases"
                     /old_locus_tag="AO070311000138"
                     /protein_id="BAE62931.1"
                     /transl_table=1
                     /translation="MAGDNTPVGPLIQLPILDISNPNDPAVGKAMLDAAAKYGFLYVS
                     SKGTDFTVSDVEKAFDLSRQFFKSPVEEKAACRIQPNNYGWSGMHVETLDPEHQRTGD
                     FKEAFNFGEFKDGKAQHPLPRSLTSHEPEIAHFADLCNKTCDRILKLLALGLEIPEDF
                     FTARHDPSQGPTGCNLRYLYYPSIASPTTSSYQHGTDVRAGAHSDYGSVTLLFQRPGQ
                     PGLEILTPEGTWAPVPVQPGQTAEEDRDAAFPFPPILVNIGDLLSYWTDGLLKSTVHR
                     VVFPLSEQQSPNPQDRYSIVFFCHPLDKTELVPVPSDIVTAHRQKCKESGVQDEKVGF
                     GGGAGSLEPGKRTLTAQEHLEARLAATYKFDK"
     exon            complement(905937..906723)
                     /number=1
     exon            complement(906776..906792)
                     /number=2
     exon            complement(906865..906918)
                     /number=3
     exon            complement(906982..907041)
                     /number=4
     exon            complement(907131..907313)
                     /number=5
     CDS             join(908134..908140,908217..908585,908755..908771)
                     /codon_start=1
                     /locus_tag="AO090120000342"
                     /note="predicted protein"
                     /old_locus_tag="AO070311000139"
                     /protein_id="BAE62932.1"
                     /transl_table=1
                     /translation="MPIRPLDEWAAARTQSLPLSALKGAVVGIDASHYIKQHLLHPST
                     REPLLVALGGFPFALRNNIERELQTFKDSGVTCVFVFDGLDFGTKNQRPHVSPESVRA
                     FEQAWDLYDQQQADQVVDAFSGAVLRLR"
     exon            908134..908140
                     /number=1
     exon            908217..908585
                     /number=2
     exon            908755..908771
                     /number=3
     CDS             join(908906..909682,909736..909822,909877..910123,
                     910182..910413,910464..910656,910717..910806)
                     /codon_start=1
                     /locus_tag="AO090120000343"
                     /note="predicted protein"
                     /old_locus_tag="AO070311000140"
                     /protein_id="BAE62933.1"
                     /transl_table=1
                     /translation="MFDVDKLITRIDADPAQFCWITKQTCQEELGRLSNEQFLDFCLL
                     LGSLFLPTFPIFENPAFPGKGATIRDALPMFNSAGRSALSLCAQFEEDRRMQELQYTD
                     RYKRAFMTVKHHVFIDAEGRVGPMDPENTSSDMHELIGQRLPEELYFYLSKGVLGADV
                     PNYLTSGEVVVSRPLGVEDTEIYRQVAGTTLTPIRTQAICLLSNSLHRFYQTKVIQVR
                     TWYDERSDTSVNLKSLPSVKDTIQSWKIRIDQLPEGLKKLQRSTGPFKFAVQSLKDSE
                     FVSKSLSARESQPLSSQEETLANVFWRFLQLRGYIDEKHQLTSWGLCLEQALSVLDPA
                     DNLEEATFLAIEMVRFGVLNAKQWFAHVSGGPMRGSDEDKNFNILVSRVACIAKLQHK
                     SIGYSGPLSRQLLCYRSLVSEVRATLRNLIEVVLTGLLLSGDADRDRDDWTGLSVKLP
                     FIDDNDCGLGIAVRTYLDDLPLQSDPTSPEARAEVKSKGKEWFQHSDSFTGNLDLAFK
                     LWDAVYKGTQHAGKEFKDGKLFGDANSWLAERR"
     exon            908906..909682
                     /number=1
     exon            909736..909822
                     /number=2
     exon            909877..910123
                     /number=3
     exon            910182..910413
                     /number=4
     exon            910464..910656
                     /number=5
     exon            910717..910806
                     /number=6
     CDS             join(911293..911803,911872..912461)
                     /codon_start=1
                     /locus_tag="AO090120000344"
                     /note="thioredoxin/protein disulfide isomerase"
                     /old_locus_tag="AO070311000141"
                     /protein_id="BAE62934.1"
                     /transl_table=1
                     /translation="MARLSYLLVSCLSVVSAASAVVDLVPKNFDNVVLKSGKPALVEF
                     FAPWCGHCKNLAPVYEELGQAFAHAEDKVTIGKVDADEHRDLGKKFGIQGFPTLKWFD
                     GKSDKPVDYNGGRDLESLSSFVSEKTGIKPRGPKQEPSEVEMLTDSSFKTTIGGDKDV
                     LVAFTAPWCGHCKNLAPTWESLAKDFVLEPNVVIAKVDAEAENAKATAREQGVTGYPT
                     IKFFPKGSKEGIAYSGARSEEAFVEFVNEKAGTHRAVGGGLDDRAGTIASLDELVAKY
                     TSSQNVEELLGEVKKAAKGLQDKYAQYYVKVAEKLSQNKEYADKEFARVKKIIAKGGS
                     APEKVDDLISRSNVLRQFLSQEKADMDMKDEL"
     exon            911293..911803
                     /number=1
     exon            911872..912461
                     /number=2
     CDS             join(913668..913823,913913..914582,914655..914947)
                     /codon_start=1
                     /locus_tag="AO090120000346"
                     /note="nucleolar protein-like/EBNA1-binding protein"
                     /old_locus_tag="AO070311000143"
                     /protein_id="BAE62935.1"
                     /transl_table=1
                     /translation="MPKRSKLLQALDDHRGRDYEAEKQKKLVKAAEKRKAAKKAAAGE
                     DGVQVKDKAEDLKSKKREAEEEVEEEGSSDEEEEEEKEETSDKEEEEDDNDEEEEEEE
                     EEEEEDIPLSDLSDDEREDVVPHQRLTINNSAAINASLKRISFITPKTPFSEHNSLVS
                     QEPIDVPDPNDDLARELAFYKVCQAAASTARGLLKKEGIPFTRPGDYFAEMVKTDEHM
                     GKIKKKLYDEAAGKKAAAEARKQRDLKKFGKQVQVAKLQQRAKEKRETLEKINDLKKK
                     RKANPSGPTDNDNDMFDIAIDNSESKGRKRGREDGGGPNLKRQKKNEKYGFGGKKRHA
                     KSGDAMSSGDLRSFSVKKMKGGAKRPGKSKRAAAKGRM"
     exon            913668..913823
                     /number=1
     exon            913913..914582
                     /number=2
     exon            914655..914947
                     /number=3
     CDS             complement(join(919671..920777,920830..920901))
                     /codon_start=1
                     /locus_tag="AO090120000347"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000162"
                     /protein_id="BAE62936.1"
                     /transl_table=1
                     /translation="MLKGEEGIQWVDTDIFAHLREKFPEDYEQIKAELESPKAESEPE
                     EDKADDEPEEATHEPDPTAVSKTQTEAIYQVILDLKEAGHLAKRQLNLDLVASTIVGR
                     FEIDSADYAQDLIASKADAIIELMDEAKTYNFDWSRKVIYRELKAAAKKHDVQQIAFT
                     PLRPRLFNEAESSPEDSEHEEEQPRPRRRRVRKSVLRPKSTIASKKIGKRTRSAAAAD
                     DEYLSDDNPDAMDEFETPSKVRGHELVRDPLSTRAKRRTRSMLSNPETTPLQKVPALQ
                     EILQSRNTSVSIGDQAPSEPDTLNGNESTSDTWFCQARGCDKVIHRSNTKHGKELIRV
                     HSLEHADDAKVKMDLVLSEHQLNIGFRVDNLLDHIRGMGCLDIAAMDGTTNGTNGIGA
                     "
     exon            complement(919671..920777)
                     /number=1
     exon            complement(920830..920901)
                     /number=2
     CDS             join(922123..922156,922236..923443)
                     /codon_start=1
                     /locus_tag="AO090120000348"
                     /note="pseudouridine synthase"
                     /old_locus_tag="AO070314000161"
                     /protein_id="BAE62937.1"
                     /transl_table=1
                     /translation="MSGEKIYEGVFAVHKPQGVTSADVIRTLQHHFNPSKLFKPWLET
                     ERARRDRESKNQRRRRRTQRLDVKIGHGGTLDPLATGVLVTGVGKGTKQLNDFLGCTK
                     TYETIVLFGAETDTYDRLGKIVRRAPYEHVTREVVEKALEQFRGKIMQRPPIFSALKV
                     KGKPLYEYAREGKEPPIEIQERPVEVTDLRILEWYEPGTHDFKGPEQEAAAEEKAVAE
                     KLLAKEDALPIAPSSEAAGSAEKTAEQDTSASTKRKTPPPADSPKAAEDTAPAAAEGE
                     KSPAAKKQKAAEGEAVPAQTEQSSSNAPETAEEKSDALPEKAESAPQPQSAAVKIIMT
                     VSSGFYVRSLAHDLGKAVGSCAMMSELIRTRQADFELGADKVLEYRDLEAGEEVWGPK
                     VQQFLEQWEKKRAAEATVDQN"
     exon            922123..922156
                     /number=1
     exon            922236..923443
                     /number=2
     CDS             complement(join(924131..924174,924229..927512,
                     927624..927697))
                     /codon_start=1
                     /locus_tag="AO090120000349"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000160"
                     /protein_id="BAE62938.1"
                     /transl_table=1
                     /translation="MSLNGLDNPAVIEAYQTALSEAGGWFLLQYVSRDEVALLDRGTG
                     GVPDVRNAIDGYEEKSPLYGFLQYRRRKVVLSYLPEGISRLVQGISLLPITLTSTLTD
                     EILHPPLARTTVQFQSILDKFSPHDTVFSLSQPSELTESALSSACLLHTASGSITSSS
                     NSLRRRRLMEIAEDAEETPGSKDASPPPISTKDFRQRSFSQLSEATIVASPVASDAHS
                     IRHGTETSSPTKTPDDTQDNDRPPSIAGDHHSERPTSRKTSRDELSYSEPRRSTQSAR
                     PSLKDLERTGVYKQKVKLGPRPSVDESGRPRTAGNLSRSAEQRPVASLPAGMRSSSLR
                     RSNPSPARPRSQGSTVASMSGRMVPPVPPLLVPPLSMPISRPKLSPGAKSLSALSSSG
                     TSQERERLMKALQLRKTQMEKRAQEGKKIHRAVEERKESHIDPIEDKENISHVHDNMK
                     RVQADENKASVLEHSKGPLSETQPTVVPEPVEVHDEHTKAVSDAVISDSTPDLSINDL
                     QDSSETSAEILDDAQEPSETDQCQTAQSASVLEDDVVEEDLTKSINEETKSGPGSPSA
                     AKEVPLEEKSLNIPDEEIAVRSPPAENPLAPVEQETDATGEPAESALPQSIPVLSTPD
                     SRTSLTSDSPTTDETQVTETQNDLTPEVSVTEQKDVDTRKEKRRLHLEPIQVPTPDYS
                     DDDNLSDDSFMEELKSATLEEAKPISVGNSPLSPGYSNNGNDRSPPDAWKNSRAVSNP
                     SAIGRQSPNLHALAVGRSVSTPYNEADNSVLVAKKINVSSGISKRIAALEKFSSRGDA
                     QPTSNQNLAAPSSASFEALRKRASVSLNGNPDSAPGSRHGSFTPESFSRASSVRRPDS
                     QSSASVKRTNSVSVTARIIRDSNTTPGDSKVDPSENSVLNLHASPLTVEHDTCESPSP
                     DPSPEPMASKSKERSMSPSSVGSSNQPSALSMPRSESRMSISSASKNEDTSKPVVDAP
                     LSPEGKKESRASRLLRRMSSITSTSRKSPFSSLGPVVKEESTPLDTGAEIAQAVDIGE
                     VNVQFPDTLLWKRRFVRVDDKGYLVLTPGNIDSSNRNMVKRYHLSEFRTPALPDEDRQ
                     ELPNSILLDFLDGSTLQCACESRQGQAFVLQTLVDAHNAHQQLSQ"
     exon            complement(924131..924174)
                     /number=1
     exon            complement(924229..927512)
                     /number=2
     exon            complement(927624..927697)
                     /number=3
     CDS             join(931600..931763,931914..932463,932525..934216)
                     /codon_start=1
                     /locus_tag="AO090120000350"
                     /note="WD40 repeat-containing protein"
                     /old_locus_tag="AO070314000159"
                     /protein_id="BAE62939.1"
                     /transl_table=1
                     /translation="MQHIIKRTNTEKSIPLKLLGRASYEAEAGGTDGPPEQGPIRGDA
                     ALHRKPSKEKKKGVSFLSRIIGGKKKDQILDDDDDDVSEPDTARMDTAQQIGFFPRFP
                     RPPKYIRVRAHYKKEKTFSRIFVAQELEGADNVSNSSEKDGSSVAGARSSKTTGKAVW
                     ALVFSNDGKYLAAAGQDGKVRVWAVITSPEERHESEPEEDGSQDGEELPQLKAPVFKV
                     KPVQVYEGHTGSVLDLSWSKNNFLLSSSMDKTVRLWHVSRPECLCIFQHSDFVTSIQF
                     HPRDDRFFLAGSLDTKLRLWSIPDKSVAFVVTVPDMITSVAFTPDGRHSIAGCLNGMC
                     NIYETDGLKPITQFHVRSARGRNAKGSKITGIDTAIFPKGDPQGEVKLLITSNDSRIR
                     MYNFRDRTLEAKFRGNENTCSQIRASFSDDGKHVICGSEDRRAYLWPTAPIERDSDKR
                     AVEVVEPQSAMVTAAIMAPSKTKQILGFSEDPIYDLCNPPPVTLGSSKENGPHRNSVA
                     SKQAQESPGYLARSNHPGGNIIIVADYSGKIKVLRQDCAYLKRRFESWDTHSTISRRL
                     LRRTNSARHSIASSIGKESSHKTPSERIISWRNSVIGHTERKDGNHPGTRTRSPSPQR
                     LANRSQYSSPRRGGSRSGYTISPPPSAYKTSTEYKTSLDSAGSSTEVPGRNGAANAPK
                     TLQPAPSLVANKRQDQDNPLWLQGDHSYAFYKRIARDALAARNRDSPHHLDPNRLSVP
                     GRRQPSVGSVLSSDYASSNGEGEESEDVLRCDNCEGTNFRATKGRNGKQKLICVRCSQ
                     PID"
     exon            931600..931763
                     /number=1
     exon            931914..932463
                     /number=2
     exon            932525..934216
                     /number=3
     CDS             join(934703..934774,934880..935257)
                     /codon_start=1
                     /locus_tag="AO090120000351"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000158"
                     /protein_id="BAE62940.1"
                     /transl_table=1
                     /translation="MPYLPTSQAYLEQSALLLEAYPNDTRITTKYNFPSSQKPKPTEE
                     STTPTAPIASLTLKTYNPTSGICLKYRTNKAAEVGRLITSLGKLAGGANVAALGLGNA
                     AAAPVAQAGGDVEMTDAPEEGTGSAPAAKTEGSKGGKGKKKGGKGKR"
     exon            934703..934774
                     /number=1
     exon            934880..935257
                     /number=2
     CDS             complement(join(935966..936570,936623..936956,
                     937064..937312,937390..937419))
                     /codon_start=1
                     /locus_tag="AO090120000352"
                     /note="ribonucleotide reductase, beta subunit"
                     /old_locus_tag="AO070314000157"
                     /protein_id="BAE62941.1"
                     /transl_table=1
                     /translation="MSAQVTPSKQAASSFENLKMSDSPVKKLNFEAAGKENAPSSLQI
                     IDVPATKTTVEKPTEVSSKIASIKEMEANEPLLQENPHRFVLFPIKYHEIWQMYKKAE
                     ASFWTAEEIDLSKDLHDWHNRLNDDERFFISRVLAFFAASDGIVNENLLERFSGEVQI
                     PEARCFYGFQIMIENIHAETYSLLIDTYIKEPKQRTYLFDAIDTIPCIRKKADWAIRW
                     IQDQESTFGQRLVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHTD
                     FACLLFSHLNNRPDPQIVEDVIVEAVSIEKEFLTDALPCALLGMNSNLMCQYIEFVAD
                     RLLVALGNNKYFNATNPFDFMDNISLAGKTNFFEKRVGDYQKAGVMASTKKEAKQEES
                     SGSAGGLSFDEDF"
     exon            complement(935966..936570)
                     /number=1
     exon            complement(936623..936956)
                     /number=2
     exon            complement(937064..937312)
                     /number=3
     exon            complement(937390..937419)
                     /number=4
     CDS             complement(join(939071..939163,939222..939367,
                     939420..939891,939952..940081,940157..940231,
                     940295..940311))
                     /codon_start=1
                     /locus_tag="AO090120000354"
                     /note="mitochondrial oxaloacetate carrier protein"
                     /old_locus_tag="AO070314000155"
                     /protein_id="BAE62942.1"
                     /transl_table=1
                     /translation="MSTTTGAFIAGGIAACGAVTVTHSFETVKIRLQLQGELQAKSEA
                     VKKYKGVFHGVKVILQNEGPRGLFRGIGSAYIYQVLLNGCRLGFYEPLRKTLTTTIYQ
                     DPQVQSLGINVFAGAASGIIGAAAGSPFFLVKTRLQSFSPFLPVGTQHNYHNSFDGLR
                     KIYTSEGVGGLYRGVNAAMVRTGFGSSVQLPTYFFAKRRLVKHLGMEDGPALHLASST
                     ASGFVVCCVMHPPDTIMSRMYNQTGNLYKGALDCLYQTVRKEGLLAIYKGYFAHLARI
                     LPHTILTLSLAEQTNKLMRRVEDRFLSDSMKEAL"
     exon            complement(939071..939163)
                     /number=1
     exon            complement(939222..939367)
                     /number=2
     exon            complement(939420..939891)
                     /number=3
     exon            complement(939952..940081)
                     /number=4
     exon            complement(940157..940231)
                     /number=5
     exon            complement(940295..940311)
                     /number=6
     CDS             join(940899..941024,941085..941310,941363..942141)
                     /codon_start=1
                     /locus_tag="AO090120000355"
                     /note="histone H3 (Lys4) methyltransferase complex and
                     RNA cleavage factor II complex, subunit SWD2"
                     /old_locus_tag="AO070314000154"
                     /protein_id="BAE62943.1"
                     /transl_table=1
                     /translation="MAEAQQQQQPPPPPPPQSQSQQQTPSLCQKVSDILRSFRPTKAF
                     KPSKQDSSNYVTSLDFDDQGDYLVSSGDDETIQIFDIKEGKTTKSVPSKKYGAHLARF
                     THHSRQVLHASTKVDDSLRLLDLHNEGYVRYFSGHTDKVTCLAVSPGSDSFVSCSKDN
                     TVAIWDLSSRNAQGKLKLATPYLAAFDPSASVIAIASQSTSSVLLYDFRNYDKSPFST
                     FDLAPYEERYTPSTRGRAWTRLEFSNDGKHLLVGTDYHGHFVLDAFEGTMKAFLVGKN
                     GSPGRAAPVSTTGKPLGQGDACFTPDGRFVLGGSGDHPDILAWDLQQQPDSNNVLQPM
                     CKLPHRGRTALIEYNPRYNVVATADKDIVFWLPEEGSRAPEK"
     exon            940899..941024
                     /number=1
     exon            941085..941310
                     /number=2
     exon            941363..942141
                     /number=3
     CDS             complement(942331..943923)
                     /codon_start=1
                     /locus_tag="AO090120000356"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000153"
                     /protein_id="BAE62944.1"
                     /transl_table=1
                     /translation="MTNEDRYSPTSETYERSEALALSLVERCRDLINELDAFRALLEK
                     TQRNPQLVEIRSLRSNVVSELRTLEKVSGQIRALADAAVAAADGEEEEQEVEPRLMHA
                     LRSTNLPFYETVWQIARRSCTGLVAFGKRFYWDGDGVVEDEGKKRPNKDKRKSVFVDI
                     VADDGLEWVKVSTISETRLLFEMAKKGWEADSDAESGEERTVLRNFDDDGGSDDEDED
                     EIELVKLASDMRKAANRTRVRYRHPRLRLVIPKIEEGESREIDDLLKVLRNYDITVEC
                     GESALSSRVGGNDDDATSATAEGHLHHLLPAPFKSFTSTLNVDCTLLLALVSDVSHFK
                     NIEPSPEYHRAIIRQLEFERERPLLATELWPAMEGHDLVCTDEATRRMREIVNTIGTE
                     TEKRRTEILFGDTPSESRGTKSVIQEFQELSDYEIPPQLTMPVKTVKAKSLIDSAIEQ
                     GKLPPVFQKVAEVLSNINHSVFFYGWVTGMTTISSNRTVVKQIETIIEQHRNGDEDLE
                     GPQVWVCDTARSLIGKEKGRKS"
     exon            complement(942331..943923)
                     /number=1
     CDS             complement(join(946402..946567,946579..946789,
                     946847..947043,947096..947426,947479..947517,
                     947574..948022,948086..948297))
                     /codon_start=1
                     /locus_tag="AO090120000357"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000152"
                     /protein_id="BAE62945.1"
                     /transl_table=1
                     /translation="MNPEILQNSPNPERETISEAEALLSRFSSLSDIEQDRERATYVS
                     TIFPLLFGKDSVVQGSNGYESQRQAPWSTNCWLQPCVIVSPGSAQQVATALALCRFFN
                     VKFSIRSGGHLQNPGFTSNHGGVVISLSALKQLELSKDKSTVGLGPGLRWLDVYGDLD
                     AHGVTVTGGRVTTVGVSGLLLGGGISFHSHQYGVSAMGICNYEVNSLRSRSRYTRVTA
                     NHNLFWALKGGGPNFGVVTKFDMMTIPSKHWSEVRVYPITATDQILEAMMQYHAAIEA
                     DDKSSLIYNATHEVILLVFFYGEPVEHPPIFQPFYNIPHVATFVAPGIRTVYDLMNAV
                     DSVQEAGPALHDFRTMASLPSLEVYRAIEKTHAEQVDVLKDVEGLTLTTVIQPMSSSA
                     MKATLKSPLGLSSVGQQWFLVRADWKNAKDEERVREAVRKIVDVAESEAKQAGVHLPY
                     LYSNYASRDQDPLASYGVENAKRLKEIALKWRIPEVAKWGVVAFQYGVGGVRVNEYLT
                     QSVLLEMPYSKDIHSAMHGKARHQCW"
     exon            complement(946402..946567)
                     /number=1
     exon            complement(946579..946789)
                     /number=2
     exon            complement(946847..947043)
                     /number=3
     exon            complement(947096..947426)
                     /number=4
     exon            complement(947479..947517)
                     /number=5
     exon            complement(947574..948022)
                     /number=6
     exon            complement(948086..948297)
                     /number=7
     CDS             join(949200..949506,949558..949632,949680..950020)
                     /codon_start=1
                     /locus_tag="AO090120000358"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000151"
                     /protein_id="BAE62946.1"
                     /transl_table=1
                     /translation="MRLFPTRFIQVAGKSLLLFIAVFTISGTLALVFQCRPVQAAYDK
                     TIPDASCYPTETSYAILMMQGVIMFVLDVMILVLPMRPIWQLQMPLKKRLLVIGLLCI
                     GFTACVAALVRFSTLSFTNDTTNFTYSASTSLIWMEIEFNLGLMSGSLSSLRKLFKVH
                     APSSSADASQGESSQPANLELPRSRASRHSRLRGGIMKKTEIVRVYETSESQEHIAPM
                     NALGETTNTTKAYEARAKSTNL"
     exon            949200..949506
                     /number=1
     exon            949558..949632
                     /number=2
     exon            949680..950020
                     /number=3
     CDS             complement(join(950807..951088,951153..951763,
                     951816..951890,951939..951979,952035..952357,
                     952411..952608,952672..952746))
                     /codon_start=1
                     /locus_tag="AO090120000359"
                     /note="predicted membrane protein"
                     /old_locus_tag="AO070314000150"
                     /protein_id="BAE62947.1"
                     /transl_table=1
                     /translation="MKGWLQTFCLTALLAGRALANEVELTQDEAHRQRCSGMYSRKAW
                     GGDVDPFILTKFVRDGDAGDSDPLVSLVIFEWSDEALIGRTVSDDADEKETICDEKSV
                     NDKLCEPGDIGSFILAPNASESEFTIVTQAVHLNNPAAINYPVKKTGFYCVSTYGYSG
                     RDYKAVVEFRNAYGELPAAQIAKLPFYGGLTIVYALIGVFWAFLYVQNRHDILPVQNY
                     ITAILVFLIVEQLMTWGFYDYQNRHGLNVGAKVLMVIVAVLNAGRNAFSFFLLLIVCM
                     GYGVVKPSLGRAMIYVRILAIGHFIFAVIYAVASLSITPDSAGPLVLLIVLPLAGTLT
                     AFYVWTLNSLNATMKDLIDRKQKVKALMYKKLWWCILGSIIVIFGFFFINSIAFAGRS
                     EASFVPEHWKSRWFVLDGWLNLVYLFDIGFVAYLWRPTANNRRFAMSDEIAQDDDGFE
                     IRSFNSELDEEDALGGIPESSAHEQRRDLSPVPPKPVPAAPRQRESLDGETIFAVGED
                     GDKWSDDEDDLSRDSGERKRLTGKDA"
     exon            complement(950807..951088)
                     /number=1
     exon            complement(951153..951763)
                     /number=2
     exon            complement(951816..951890)
                     /number=3
     exon            complement(951939..951979)
                     /number=4
     exon            complement(952035..952357)
                     /number=5
     exon            complement(952411..952608)
                     /number=6
     exon            complement(952672..952746)
                     /number=7
     CDS             join(953188..953273,953340..954339)
                     /codon_start=1
                     /locus_tag="AO090120000360"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000149"
                     /protein_id="BAE62948.1"
                     /transl_table=1
                     /translation="MPGKELSDPCVDCRDAEAILTLRRRRLCKDCYIKFVSYKVFKRM
                     ENYRLNRGFAKDKPCKLLFPLSYGLSSSVLLHMLHDQLEVQRSKVHGSPGFDLHVLII
                     EPSTISPSNPAHDEGFELAQKCFPLCSFTKVPFHSIFALVPDIKETMSQFAGKGFEDD
                     PSLSDAERLNAFRSCIATSTSKADVDHILMNRLIVAFAKQMDCQAIIWGDSDSRLAAK
                     TLANVAKGRGSSVIWQVSDGMSPFGLEFNFPLRDLFTAELRDYASFFPELTKLIVPDE
                     PLPANTLTKNLSIDELMMRYVLTQGEKYPGVMLNVTRTANKLDVSQMPANLSHCTFCA
                     APLMNEVGGGHTQFCYACARSRPSTSS"
     exon            953188..953273
                     /number=1
     exon            953340..954339
                     /number=2
     CDS             complement(join(954491..955007,955062..955276,
                     955347..955421))
                     /codon_start=1
                     /locus_tag="AO090120000361"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000148"
                     /protein_id="BAE62949.1"
                     /transl_table=1
                     /translation="MSGPLVSLVGKRILAESARNHFGTEDPYFEEVPASRLHRAFGKK
                     TQKRRKAVPPGLSENDQKVLTQVKRRAYRLDLCLFSLCGIRFGWGSVIGLIPFAGDAV
                     DAALAIMVVNTCGKIDGGLPTRLRMMMLINVIIDFAIGLVPFVGDLADAMYKCNTRNA
                     VMLEKHLREKGAKALSKQRRRQENDTDPSLPDEFDRYDQTIVDGPSRRESHRHGSRHG
                     SRHRSSTRRTTNEPAHHSHDNRNHTKWFGGSSHREHDLENGVVDNFQDRR"
     exon            complement(954491..955007)
                     /number=1
     exon            complement(955062..955276)
                     /number=2
     exon            complement(955347..955421)
                     /number=3
     CDS             join(956234..956264,956505..958861)
                     /codon_start=1
                     /locus_tag="AO090120000363"
                     /note="decapping enzyme complex, predicted
                     pyrophosphatase DCP2"
                     /old_locus_tag="AO070314000146"
                     /protein_id="BAE62950.1"
                     /transl_table=1
                     /translation="MTETKMHLEDSFALRIFQHCPLMSQWSHYHHITAFSEFLAYKTR
                     VPVRGAIMLNQDMDEVVLVKGWKKGANWSFPRGKINKDEKDLDCAIREVYEETGFDIH
                     EAGLVKNEKDVKFIEITMREQHMRLYVFRGVPRDAHFEPRTRKEISKIEWYNLSELPT
                     LKKSKQQDQGFTVTNANKFYMVAPFMHPLKKWIAQQKKLDAKMQVGATQVLPNEGEMS
                     MDEGFAAPSQSLGLASSSDLPEVAPSQDASAHLKRLLNINDAFHTPSTAPSVDTLPAN
                     AFKSNALLELLRSGSSREPNPQTPRNEQTSPTHAITAAVPPQHPAYPAPTLFPGFPVQ
                     GQSSQPGYLSQFSTRQPPSASSHIPHTNNHVLDQHMSQRPLAQSSPAMNQHGHPTGYG
                     GMDAYHISTQPYNDAHLPSGPHATPANQAPAAPYQRTGDPFSQPAQPPQVQGASVRVP
                     PASKLPPPKLTSHSLALLSVFKDEASKTPKTSHASLTPQPDQVPMNGRKSSQHQDQLL
                     SLLRGSPVTSGSTPAELAGHSNSPTRKQILQRPRDSSPTQQALAYASALPKGSPLNSN
                     VASRPVHPLQPEATAKPPGKRNQNISSRKNKDRQPQGLSSPITILARPQSAKREQSPN
                     PAVASSSRTSSRTRKDSKPKSSEPPKPFQPQILRRPQNLDHILPVRTKEPQDSEQPDG
                     PQIPSTEQEASNFDRRPSQSAAQKETLLSLFGKQPASPSVSPARELNVHISGSKPVTS
                     SVVSPLSPLNLPTPTGMSRDSPAPEDNGSLNARVSSPDNKAFLLGFLQGVAKGNK"
     exon            956234..956264
                     /number=1
     exon            956505..958861
                     /number=2
     CDS             959160..960503
                     /codon_start=1
                     /locus_tag="AO090120000364"
                     /note="transcription factor, component of CCR4
                     transcriptional complex"
                     /old_locus_tag="AO070314000145"
                     /protein_id="BAE62951.1"
                     /transl_table=1
                     /translation="MRPSTSVRTICANCSNHTRLFSTTVRSRSQQKSDATPASPPQAG
                     YARLTNRGLISITGVDSTTFLQGLITQNMLITNDQNRATRQTGSYTAFLNSQGRVLND
                     AFLYPLPQADLTSPDEPAWLIEVDRNEVASLMKHLKKHKLRAKLKLRALEDGERTVWA
                     SWKDHEQPRWAAYNLESPSSSPFSPSSSIAGCIDTRAPGFGSRIITPGAEDLRTHVPD
                     ETQIAGSEVSLGAYTVRRMLHGIAEGQSEIIRESALPLECNMDMMKGIDFRKGCYVGQ
                     ELTIRTHHTGVVRKRILPVQLYTGDQDALESAGAPVYDPTAELPLPPSAANMYKISAR
                     RARSTGKFLGGVGNIGLALCRLEMMTDVTLTGERTQYSPEQEFKVSWDAAEEGSSEHQ
                     EPGEVKVKAFVPSWTRDFILNGGVKKNTRGREAEGHRAREFLEQLEEEESLRQKE"
     exon            959160..960503
                     /number=1
     CDS             complement(join(960616..960683,961309..962068))
                     /codon_start=1
                     /locus_tag="AO090120000365"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000144"
                     /protein_id="BAE62952.1"
                     /transl_table=1
                     /translation="MASNDDLKAHAASNQDFYALLDISPAAAENEIRRAYRKTALKYH
                     PDKIANPTPADIDKFHTLQIAYDVLSDPSVRQLYDNAREARQRKQRERDMMDAAKRKM
                     REDLEARERAGAAAVGGAPRGVKRTWMSGTGDDDAEEKLQREIERIAEDGRRRRREAE
                     ERLKQKVDEEEKQMRQEEEEAQKAADKSSQRVDRSQEGGANVPELERAVKARWVREGR
                     GVDLDKDRLTSLFTPFGKVESVVVLKDKRQRIGDKRSSSNLRLRFNRANNWRCGDYV"
     exon            complement(960616..960683)
                     /number=1
     exon            complement(961309..962068)
                     /number=2
     CDS             complement(963363..964031)
                     /codon_start=1
                     /locus_tag="AO090120000366"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000143"
                     /protein_id="BAE62953.1"
                     /transl_table=1
                     /translation="MRLDGQPLPAGTPARGTVPVWLGKKANEVTLAEAHLLLSDFGEA
                     FSPTDSQQKRRGDQCHAPLSVLPPDAYFEPDKPLSFPTDIWTLACAIWSIFSSRPLFD
                     ATLATHDDISSQQVDILGPLPLEWWDSWEVRHEYFEERGEPKKDRFIFPSLEHCFEKE
                     IQAPRDKIGMGGFDRDEMVAILTMLRSMLAFKPEERATAKAVLGSDWMVTWGLPEFEK
                     IRQT"
     exon            complement(963363..964031)
                     /number=1
     CDS             complement(964185..964727)
                     /codon_start=1
                     /locus_tag="AO090120000367"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000142"
                     /protein_id="BAE62954.1"
                     /transl_table=1
                     /translation="MPSIENVPYFEYQPIEGVERLERYRPGGYHPIHIGDVLKGRYRV
                     VHKLGHGAYSTIWLSRDEHQAVYVAVKISTGDSSPHEADILCAIANSPGVDDPGRSII
                     PIIQDRFEIQGPNGCHKCYVTPPAQSSVAAASFSHLFKIETARALVAELVLAVAYIHA
                     QGIVHGGKPVGWEFVWFSVP"
     exon            complement(964185..964727)
                     /number=1
     CDS             965342..965824
                     /codon_start=1
                     /locus_tag="AO090120000368"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000141"
                     /protein_id="BAE62955.1"
                     /transl_table=1
                     /translation="MEIIIFHKYIMLSYSAGGPYKPDQPPRSKTFSHTASYKPPKKMK
                     SLTIFLFSLLVLIATTAADEITKRKRLIECANKELDKENAGWKLQGDELEKLKKIIDD
                     EVLKEPLKSHTAEEQAKVLKEIEDAGKKDLPKVSVKQLDKIMAKLKEHSMHCAKEMRS
                     "
     exon            965342..965824
                     /number=1
     CDS             join(966139..966226,966291..966671,966732..967732,
                     967782..967829)
                     /codon_start=1
                     /locus_tag="AO090120000369"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000140"
                     /protein_id="BAE62956.1"
                     /transl_table=1
                     /translation="MDDETMPSPAQLALAIAIVKQKPADLSVREYILRIRQHIKDTRD
                     ADKSYTQDKDRFFDSVSFWQQAYEKSEAEQSKLLDRIYDLERHNEALSAKLQVRNTQF
                     EEEQSSTKRKATVGEKAFGGATTRKRAKTQMVNGALGHASAPWNGLVRLDHTGESIGP
                     VMRHYYTLQKTLQKKSNGFDIVQAAVKLCETTANELSKVISEKRAAPCASRNKGSTRT
                     EMPTTDEVLRCVSCTFQLLLRVIKSLSGTDNGMQYSNRVIYHIVHLYESTMNALEQWC
                     KAKSEQTQSAKQKHATSNRKAKDKQLHDSNMNTDDEDFTQMAQLLNAMTSSLDTGCAG
                     HQDLLEGFLFILLNRVGKLLCLFVFQDLQLKPDLRADLTKLPHPRGLTELDLSDKSLC
                     SAEMEAKCLVWLLERTLAVFRSFTSSSSSASRDSDGSIIFAAKIKERLQSTLLQAVFG
                     TDSTWGKSLRRPAPTDGDLHNLRLPSQNSDQSVPDWFTQESFEYRFATSYYYSIN"
     exon            966139..966226
                     /number=1
     exon            966291..966671
                     /number=2
     exon            966732..967732
                     /number=3
     exon            967782..967829
                     /number=4
     CDS             complement(join(967939..968099,968156..969143))
                     /codon_start=1
                     /locus_tag="AO090120000370"
                     /note="predicted metal-dependent hydrolase of the
                     TIM-barrel fold"
                     /old_locus_tag="AO070314000139"
                     /protein_id="BAE62957.1"
                     /transl_table=1
                     /translation="MSPLIVDIHTHVYPPAYMEMLRARKSVPYVHDPANGTDPRLIIL
                     SSDDDPSIPLDERGRPVDSSYWNIEVKLAFMRRHGINCSVISLANPWLDFLEPEEAQT
                     WAQRINDDLENTCARVNKAGDPDKSLALHEKESLFAFGALPLSAPRADIVVDEIKRLK
                     TLPHLRGVIMGTSGLGKGLDDTQLDPVWGALQDTESVLFLHPHYGLPDEAFGGSDAMN
                     RYGHVLPLALGFPLETTIAVTRMLLAGVFDRFPRLKILLAHSGGTLPFLAGRIESCIH
                     HERKFVANGGDVPGPQRNVWDVLKTNIYLDAVVYGTAGLQAAMAASGTDRLLFGTDHP
                     FFPPLDDKEGEWPSVTTNYKAIHATFDNDGGAAAAVLGGNAARILDLN"
     exon            complement(967939..968099)
                     /number=1
     exon            complement(968156..969143)
                     /number=2
     CDS             join(969767..969841,969947..970927)
                     /codon_start=1
                     /locus_tag="AO090120000371"
                     /note="isopenicillin N synthase and related dioxygenases"
                     /old_locus_tag="AO070314000138"
                     /protein_id="BAE62958.1"
                     /transl_table=1
                     /translation="MEGNLPQQSCHPATTAVDKDDIVIPVIDFGPFLNGTPADKHAVA
                     VSIVEAFKTSGFLYLKEHGLPPSVVSRVFGSSARFFARPQDQKDSLCWTTPQANRGYV
                     KTGQEKLSNVDDPTAPEVLRATPDLKETMEIGRDNLDNQPNRWPDQIDDEGKDFREVM
                     TSFFNMCRSLHTEVMRAIALGMNLPEHYFDSYVDAGDNNLRLLHYPAVSKEVFKKNPS
                     QVRAGEHSDYGSITLLFQDRRGGLQVRSPKDTYVDVTPIADTVVVNAGDLLARWSNDL
                     IKSTRHRVVEPPTPIGEEDNSDTYPDRYSIAYFCNPNNNRLIEAIPGTYGDDIKEAKY
                     PGIVAGDYLVQRLTATY"
     exon            969767..969841
                     /number=1
     exon            969947..970927
                     /number=2
     CDS             complement(join(971136..971977,972155..972227))
                     /codon_start=1
                     /locus_tag="AO090120000372"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000137"
                     /protein_id="BAE62959.1"
                     /transl_table=1
                     /translation="MSHLQPSSLFSVKGLVVVLTGGGSGLGRMMAHTLDANGASKIFI
                     IGRRQEALQETITQSPNSSSSAIIPIQADISSKASLEAAYQTISAQTDHVDLLIANSG
                     ILGPNSSPPPPKPDGSLPSLAEVRDALWSVPMEDFTKVLDVNVTGAYYTAVAFLPLLE
                     AANKRRPAPVKNQIATPTAQVIITTSIAGFNRKVPISAAYNLSKSAANHLVKLLSTTL
                     ASYDIRVNGIAPGIYLSEMSTRNFQEGDKGISDGSFKREVIPLTRAGGEEDIAGLILY
                     MASAAGGYLNGNITITDGGRLSTAVATY"
     exon            complement(971136..971977)
                     /number=1
     exon            complement(972155..972227)
                     /number=2
     CDS             join(973337..973415,974010..974299,974354..975379)
                     /codon_start=1
                     /locus_tag="AO090120000374"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000135"
                     /protein_id="BAE62960.1"
                     /transl_table=1
                     /translation="MSGTRDCQISQNSNSRTIPINADLPTFPQAKVRSTTIPPVVSHP
                     TSLTHTPFSGTPTTTGALHASSIGTGIRSLGIPPTATTYPSDGQLHDPQPGPYIPAGG
                     IGTGGETPVYNPKSDFDYESLALALYQEYTELDLFHDGLARFSVEEFTAAGLTAEDRF
                     LIEFMADQEVGHATMVTNILGAEAPRMCTYNYPYTTVHEFVDFCQKLTRFGESGVYGF
                     LPHLNSREAAILLLQSITTEARQQMIFRQFEGLFPMPVWFEVGVPQSWAWTLLAPYIS
                     SCPENQTKLAWQNFPALYIENQPNPVRINGSSAFNETVGGGVNSLNSTAVPSDASCVN
                     STTVGFSCYPAITHNRTLPLSWPGREVFLHWDEPGRPVGPNNSYITSTSAGDPKYVVW
                     VTQLNVTYSPLEITGDNCGLTIQPDVQTYAGDPAVNGTMFIAITDSDPYLSPFNLSMI
                     NPHVVAGPALYQSG"
     exon            973337..973415
                     /number=1
     exon            974010..974299
                     /number=2
     exon            974354..975379
                     /number=3
     CDS             join(975829..976647,977177..977212)
                     /codon_start=1
                     /locus_tag="AO090120000375"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000134"
                     /protein_id="BAE62961.1"
                     /transl_table=1
                     /translation="MEAPRNRKQRRAAAAASKSDTDSTFDPSSIPMAHPPRNTTKNPK
                     EKTLVELIAEREKELLGLGQDRSSTGTGGSTPGMETRFVSIDPTSGEISNLDASKLPN
                     EQQGTKGSIMRSASDENSGSEEDEGAPIPPFIDTVLLSVPLTTLHMTLAYLAAHQYAE
                     YIVLDKLIRESVFVAFPILTFAIHLAHGHIVSLGNAQSSEHVSLIPFSRDKLSIAFLR
                     KLLFPPSLRTMVFLPLAIYLGAKLMAMTNEEPYYAVMKRAPSIGTLWVWSILEIPEFF
                     LRKSQHSM"
     exon            975829..976647
                     /number=1
     exon            977177..977212
                     /number=2
     CDS             complement(join(980616..981006,981099..982225,
                     982451..982702))
                     /codon_start=1
                     /locus_tag="AO090120000376"
                     /note="acyl-CoA synthetase"
                     /old_locus_tag="AO070314000133"
                     /protein_id="BAE62962.1"
                     /transl_table=1
                     /translation="MGLWESSLAPPQFGDNRSYTDLLTFAFGGPRPYNEHRPLFIDAE
                     HPSCSLNALQFRLLVRTLIAGLKAHQVQKGDCVLVHMGNSILYPALFYSIIGAGGVFM
                     GSNARSQPQELDHILELGNPKLIITTRDALPTVLSVSADRGMLPSQVCLVDEAATSHV
                     AQLLLSGPLAYAAAISPYLPHGGDNYYLNFAHLLGYGETGWLFFQDEAIAKSTPAAMF
                     STSGTGGLPKAAILSHHAIVSHHLSIYYDVPYEASRLMSLPMFHLFGALWTHIFPIRY
                     GQPLYILPRFDIAQYVAAVYQYQITEAYMVPAMIHAFNRCAFPVADYLQSLRYVGVAG
                     APIDGASMQQFQELLHVDANASQLWGMTEVGVVFQNRYGQPGNSGSIGRLVPGYEIRL
                     VGQDGNLVLDDNKPGELFVRGNGLLTGYKGRDDAKDAQGWFRTGDVAYVNNGLYYIVG
                     RTKELIKVRGWQVAPAELEAVLLKHPGIQDAAVTGVTSKDGSTEVPRAFVVRTRQPAG
                     MQLTSEEVYMYCRRQLASYKALDGGVIFVEEIPRTASGKIQRFKLTQMNTYREIVSSL
                     LARFKGTSGLQTVGLLHQGRITV"
     exon            complement(980616..981006)
                     /number=1
     exon            complement(981099..982225)
                     /number=2
     exon            complement(982451..982702)
                     /number=3
     CDS             984734..986209
                     /codon_start=1
                     /locus_tag="AO090120000377"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000132"
                     /protein_id="BAE62963.1"
                     /transl_table=1
                     /translation="MSLSEKSVISVPPPAKCASGSTSPRSTLVDVETAMPNCISEKAD
                     RTLTQSPDSFDLEAQAPKKKPFSSSRFTLLNIYRRLFTLVFCANVAVFIYIMTADRKL
                     LALVNATAANLLACGLARQPLVVNAIFLIVCSIPRSAPLRLRRIAAKVYHYGGVHSGC
                     GVASFIWYAGFVGLMSKEYWSPSTGRSTISVAPVVVAYIILVLLLAIIVVAYPGFRFK
                     KHDYFELTHRFSGWLVVALFVVLLMLFVNDFSRAAHQSFGRFLIELPAFWFLMVTVAA
                     IVHPWLLLRKVSVRPEYLSNHAVRLHFNHTTTTFGKGIQLARHPLHDWHGFATFPDPE
                     GKTFSSLVSKAGDWTTACINDQPTHLWKRGVLIYGFAYAMRVFKRVVVVTTGSGIGPC
                     LSFLGDDNRPDLRVVWQTRTPLKTYGQGILDLVSKMDTNPYIINTRESGRIDMVPIIR
                     QLYKEFDAEAVCVISNPFVTKKVVYELESRGIPAFGPIFDS"
     exon            984734..986209
                     /number=1
     CDS             complement(987716..989323)
                     /codon_start=1
                     /locus_tag="AO090120000378"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000131"
                     /protein_id="BAE62964.1"
                     /transl_table=1
                     /translation="MPGRLLSSLVRPHVHHHTSFSSHSTSSSSTSVNEIHTHTVAHKK
                     PSANVLERARSPERRLSFAVDHLIHPHRDHSKEKRRSHGRSSGSKERPGDHGVSATAK
                     LDVVVESPPLVCYGSPANSTGALFSGRLKITVSEAVDSITLDKFDMRLMTRMTTKKPV
                     SRECPNCASRTEELNHWNFLTEPLHLKPGDHEFPFSYLFPGHLPASCNGSLGKIEYYL
                     SAHAQNTTGEEYDFQMPLHIRRAILPGNDKSSIRIFPPTNLTGRIVLPSVVHPIGTFP
                     VQMTLSGVVDKGEETQTRWRLRKMMWRIEEHQKIVSTACGKHAHKIGGEGKGVLHQET
                     RIIGHNEEKEGWKTDFDTAGGEISMQFEASINPTCNPVCDLEASGGLEAKHNLVIELI
                     VAEEFCPNRNTRLITPTGAARVLRMQFHLHVTERSGLGISWDEEMPPMYEDVPASPPG
                     YTNPDASSVMEDYHGSPLPLPEYEDLERMDSLRLDSDSTHSSARSILSTRGRSRFTTD
                     DLTAEPMTQQNRNRAPSADSQVSRASE"
     exon            complement(987716..989323)
                     /number=1
     CDS             complement(994645..995790)
                     /codon_start=1
                     /locus_tag="AO090120000379"
                     /note="voltage-gated shaker-like K+ channel, subunit
                     beta/KCNAB"
                     /old_locus_tag="AO070314000130"
                     /protein_id="BAE62965.1"
                     /transl_table=1
                     /translation="MSSQPLLARYRQLAPSASVRVSPLCLGAMTFGTASKERYGECSK
                     DAAFEILDYFVSQGGNFIDTANAYREEQSEIWLGEWLASRQNRDQMVIATKYTTGWQG
                     HHKDKIQANYGGNGTKSMRISLEASLRKLQTTYIDLFYVHWWDYTVSIPELMHSLNDL
                     VVSGKVLYLGISDTPAWVVAKANQYARDHGLRQFTVYQGMWNAAMRDFERDIIPMCRD
                     EGMGLCPYGVLNQGRFQTEEGFKEREKRNDGRNFIPLSEHDKKVSRVLEDVANAKGVE
                     LLQVALAYVLQKTPYVFPIVGARKVEHIKGVVPAVGITLTTEEIEKIESAYTFDPGFP
                     HTFLSGTLFGDGAPQGAYGPGDVWLTKPLGTFDWVGYPEAIVPTERK"
     exon            complement(994645..995790)
                     /number=1
     CDS             join(998266..998503,998557..999236)
                     /codon_start=1
                     /locus_tag="AO090120000381"
                     /note="N-acetylglucosaminyl phosphatidylinositol
                     de-N-acetylase"
                     /old_locus_tag="AO070314000128"
                     /protein_id="BAE62966.1"
                     /transl_table=1
                     /translation="MSPSSFISLGFAITAVFIFWTLSATSSSPFARNFPRLYNKRICL
                     LIAHPDDEAMFFAPTVLALTKPELGNHLKILCLSSGDADGLGHIRKKELKKSAVHLGL
                     RSESDVLIIDDPTRFPDSMSATWSESDVSSLLASAFAPEIGDAQSGSRKRGATRDKPP
                     VATIDVLLTFDRHGISNHPNHRSLYHGAVHFLRTLMKDKPGYTCPVSLYTLTTTNILR
                     KYIGVLDAPLSMARGAVDSLFSGLKGSSRSSKEDAPARLLFVSSVGEWMTAQSAMVKA
                     HQSQMVWFRYGWITLGRYMAVNDLKREKV"
     exon            998266..998503
                     /number=1
     exon            998557..999236
                     /number=2
     CDS             complement(999933..1002167)
                     /codon_start=1
                     /locus_tag="AO090120000382"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000127"
                     /protein_id="BAE62967.1"
                     /transl_table=1
                     /translation="MRGLVLASERFSSLLVVPSCGRNRSTQFALCAGPTRVIVPARDS
                     TQWRSFTNNIPRDASWNVNNDPPNDRRSSRARVASSRLSTTSILEGGGSHYDHVPHTA
                     DVVLSTDEDLSALKATFYEIIQDGQPDQVMDALLDPRNEELVGSMPQTVFVEVFHLLS
                     PAYFVVPYREIHRPIHPSAAKLKRFESLDSIFDDFATKLATVVSIRRSAGQALGLAEY
                     THLLDCARSIGDALMADYIWHSMTEDEVVPDVTCYNYYMEAKVWDKAYTGRERYHTRM
                     TPYAYRHRRFFHPNVGWQGYRTAEKSVRKEVLQIFNRMTEQGYHGDEVTFINVMLASS
                     RVGHVQGMKNVLKVAWNVDIDALATLDPSELPPATSYDRSSPLYPSSRLLFAIAHAFG
                     TNNDISGALRAIEFISNSYDIPVPETVWLELLERSFVLSRNRFGPDAKRNSLGKVPPE
                     FVKGVFETMTSSNFNVRPTIDVHRILAKTAWDQARLSEFQQHMCAAYDLLREARQKRR
                     TARDIIEAYLGGASRRGSRIDTTLLQSRGFAEAVHTYDVLRLRTAQQTITMERFARLL
                     VTHKRWTGRDNPVWERCLLPQMLEEWQDFLPQSFQYRVRDGQVNLLGATHWGQHRLTL
                     HNRVAVRRPTAENGVVLDEEAVEMDDDFVWAQYLRSNPDLDLNAAPLKRLFSGVVERT
                     RRPRPSTLDRGYVSEPQKLDSEADELSDLPEEEYAGTQWTAQRQKGREAPGVIPGTFD
                     MIFS"
     exon            complement(999933..1002167)
                     /number=1
     CDS             join(1003779..1003832,1003885..1005397,1005450..1005739)
                     /codon_start=1
                     /locus_tag="AO090120000384"
                     /note="GTP-binding protein GP-1"
                     /old_locus_tag="AO070314000125"
                     /protein_id="BAE62968.1"
                     /transl_table=1
                     /translation="MAPAGPKLTPEERRRGEIALSDFAEYAEKQQSHRSVAPSDSGYS
                     TASVSRVHEDHAELEILDQLGLSDTPKPTRLKDLLLNTGDQQEDSLQILGSIIQTRID
                     EGHGEAIFDVGIEDGGESMGFDLTQWETALQRVQEAAGTLPAHCRILVTYNVGGPEES
                     QVRNDRMKGSCGKLLIRQPAETVEEMAELRIVVVGNVDAGKSTMLGVLVKGNLDDGRG
                     KARVNLFRHKHEIESGRTSSVGMEIMGFDSRGEIVTSAQGRKLSWEEIGKRSAKVISF
                     SDLAGHERYLRTTVFGMLSSSPNYCLLMVAANNGLIGMSKEHLGIALALNVPVMIIVT
                     KIDICPPQILQETLSQLNKILKSPGARKIPIFVKDMDQTINTATQFVSQRICPIFQVS
                     NVTGENLELVRTFLNILPHRGHYNADAPFELLINDTFSVPHVGTVVSGVAKSGVIHAG
                     DTVLVGPDSLGQFTTTTIKSIERKRISVNACFAGQSGSFALKRVRRKEVRKGMVVLKK
                     LDQPPKVYREFVAEVLILSHATTIKPRYQAMLHVGAVSQTCSVIDIDRPFIRTGDRAL
                     VAFRFVQRPEFLAPGDRVLFREGKTKGLGIVKSVGYDPNNPLNPEAKEANTN"
     exon            1003779..1003832
                     /number=1
     exon            1003885..1005397
                     /number=2
     exon            1005450..1005739
                     /number=3
     CDS             join(1006504..1006663,1006739..1008088,1008163..1008305)
                     /codon_start=1
                     /locus_tag="AO090120000385"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000124"
                     /protein_id="BAE62969.1"
                     /transl_table=1
                     /translation="MEPFDKAWHTAADSLRNDYRSSEQQWTQHGEEPISGIQGRGTAT
                     DPYDAGNRSEQPGAPQTKKNTALVPEALSSITPGDRSSNLKSSTNKTASGPAAMQPEL
                     NPIGETAAKYGSQPHRVPEQRNLGSNLDHHSQTSGLSHGHHDRTSGLNKGSLTTGAEA
                     AAAGVAGAGSDYKRSAGGLGEATSAQSSALPDDSHTPGLRHTGTLGGATSAQTSALGG
                     DTTHPTGLRHPSTQKSGLEKGVEASGLGHTTSTGQTSPMKSALEKDAQATGLRQPAST
                     THKPVFEKDTTHTPSSGIEGSRNLGSTTSYGGSETQIPDRSSQPIGTHTSTSGLERSQ
                     NPYGGSETQVPNRSSQPIGTHTSTTGIEGSGNLGSTTSHGSQSQIPDRSSQSIGTGTE
                     ARHPRSSIAEEATSTEARHPSSGIADSTPQESKSTTEQRTPSTTAAEGQSSTQKESTS
                     KPSKKDDAPENVGFPPKTDHVSKEALRGPSVAEPREHWKQDEKVAKAEDNDKPAAAAG
                     EPGASNKADSSEKKHTKDSSHSGGTLSHIKEKVEKVIHPHKS"
     exon            1006504..1006663
                     /number=1
     exon            1006739..1008088
                     /number=2
     exon            1008163..1008305
                     /number=3
     CDS             complement(1008576..1012316)
                     /codon_start=1
                     /locus_tag="AO090120000386"
                     /note="helicase-like transcription factor HLTF/DNA
                     helicase RAD5, DEAD-box superfamily"
                     /old_locus_tag="AO070314000123"
                     /protein_id="BAE62970.1"
                     /transl_table=1
                     /translation="MESGDINDRPLKRRRFFVDEEEDTKPSPIDSTAASLDASTPRST
                     HDDEPPVIQSHGVQLGDAAISVNGEGNGYIRDDDQQTTSYTSPQEREGEISGDTIGQG
                     PTSTIQNGALPGIQEERVTTENVPAQEDTDGFDTEVFISIIGERLSSDTIRKIRSAAG
                     GDLERAINVYFDGSWKSPSGSARNQTTLISQPTLSTRSTPVNQTSMFGNGPARKGSGA
                     PADIAPRNTSQPSIRYVGAFGVGAWATRSGVGFIKHGDRVNIERARSQPVSKRGRGGR
                     VFTNNRGDVLTRFTNQAGQEIGRLPQETAAWVSTLLDQKVCKLEGVCVFAPDRVRVND
                     TIYLQLWCYLRIEAFQSGMLDSSIDDNRSTNIFEEKESTEEKRLRLRQVALVKLFDEI
                     GLQPTSANDMTLKHKKEGLLRAVEIAEQYDKNKKENKSNNDSSEDEESPELEEGQLDT
                     LYKKAQTFDFSMPEADPPPTFSLSLRKYQKQALHWMLAKEKDNKSARGPSMNPLWEEY
                     AWPAKDVEDNNLPTIEGLDHFYVNPYSGELSLDFPAQEQHCLGGILADEMGLGKTIEM
                     LSLVHSHRNVPPGQAADGPSSVSGLARLPSSSSGVVPAPYTTLVVAPTSLLSQWESES
                     LKASEPGSMKVLMYYGNEKYVNLRELCAAGNPTAPNVIVTSYGVILSEYRQMLSSATF
                     SAAAPGGLFSVEFFRVILDEAHLIKNRLSKTARACYELKATHRWVLTGTPIVNRLEDL
                     FSLVRFLKVEPWNNFSFWKTFITVPFESKDYVRALNVVQTVLEPLVLRRTKTMKTPEG
                     EPLVPLPRRTITIEEVELPEQEREIYDYIYTRAKRTFNDNIEAGTLLKSFTTIFAQIL
                     RLRQTCCHPILTRNKTIVADEEDAAAAANDGNGFKDDMDLQELIDRFTTTTESADSNQ
                     GQESSNKFTTYALKQIQNESSGECPICSEEPMIDPAVTTCWHSACKKCLEDYIRHQQD
                     KGDSPRCFSCRAPISSRDIFEVIRHQSPTTTPTENDLYSSTPPSSTQPAPRISLRRIN
                     PLSPSAHTSAKIHSLINHLHRVPSNTKSVVFSQFTSFLDLIAPQLDKAGITYVRLDGT
                     MAQKARAEVLAQFNKTETFDQEEIEDAEREDDINSPFTRKPLPTRNGHASASPSPRVL
                     LISLRAGGVGLNLTAASNVFMMDPWWSFAIEAQAIDRVHRMGQLRDVAVTRFVVKDSI
                     EARMLRVQERKMNIAGSLGLRVGGDGNEDKKERIEDIKMLFE"
     exon            complement(1008576..1012316)
                     /number=1
     CDS             join(1012724..1012917,1012975..1013965)
                     /codon_start=1
                     /locus_tag="AO090120000387"
                     /note="phytoene/squalene synthetase"
                     /old_locus_tag="AO070314000122"
                     /protein_id="BAE62971.1"
                     /transl_table=1
                     /translation="MSPLKEMLQPTRGASRQINRLSLGCRQIQTSQRRHFSHSRPTAS
                     PATAAVNEIQAAQKYCSDLLIKYDRPSYTLHTFIPRHAQQFYLALRALNVSLSMIPET
                     TSSHTIGLMRLQFWRESIAKILAGTPPKEPIAILLSSAIADLHERTNGRARISKGWLT
                     RLISARERGLTNDPYPDIAALESYAENTYSTLMYLTLSALPMASVTADHVASHVGKAA
                     GIVAVLRGLPLVAFPAARAAGQQGGQQAGGAARQGAVMLPLDVMAQAGVKEEEVFRLG
                     AEAPGLRDAVFTVATRASDHLITVQQMLSNLRAGQDVGHDFEHEGEEGHEYEVLGEQR
                     QESPLDEVNRAFGVFMPAVGTRLWLDRLQSVDFDIFRPELLRSDWKLPWKAYMAYKRK
                     SL"
     exon            1012724..1012917
                     /number=1
     exon            1012975..1013965
                     /number=2
     CDS             complement(1014446..1016197)
                     /codon_start=1
                     /locus_tag="AO090120000388"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000121"
                     /protein_id="BAE62972.1"
                     /transl_table=1
                     /translation="MSRVSLERTETTELPSGSHDIEAHPQTSPTNAEPAGLESFPTVT
                     KGPSNDTVRNRARRSNTARSYHPDNVTHDPNWHPGTEPGIDPTKPLPPYNADWATAVP
                     SDLFTRCEIIVVDFSQHEMRQYELDNDTLEQFLAREREPWVQCRWINVNGLSWDVIRA
                     LGNQKGIHRLAIEDLINTTNRTKVDWYSDHAYIVLTLQKLVRIYEETSSDSDEESEHG
                     QWENDRRGSTTSSKSVSLKRATTLSLITEALKDLFRLKSRKRDPSNEPNLGANIRPSM
                     KKAESQTMFDNASNAGRTARSMQRYRGGPNEDRIEFMERHAVLAAKGLSVALEQVSIF
                     LHADNTVTSFFETSADDIESPIVKRLTSPETILRQSCDASMLVQAILDAIIDLAIPVT
                     TAYQDAIGDLELDVLTDPDIDQSKDLYILTSEISILRNSMQPIVTIINALRDHRSEPI
                     NTPGIGVLKGYFGPSNSSDPAPYIGTATPNLKSVGGSSVSISTMCHTYLGDALDHCIT
                     IVEGYDQMRRAADNMIDLIFNTIGMHCLIFSSHLAWLTVLFTTRCISEREYEATDTRV
                     LLLSPSHFLVGSYSPCI"
     exon            complement(1014446..1016197)
                     /number=1
     CDS             join(1017336..1017498,1018983..1021843,1023020..1023049)
                     /codon_start=1
                     /locus_tag="AO090120000390"
                     /note="mitochondrial DNA polymerase gamma, catalytic
                     subunit"
                     /old_locus_tag="AO070314000119"
                     /protein_id="BAE62973.1"
                     /transl_table=1
                     /translation="MATSRFAGLATNGDKISMWPRLSSVKRPSEYEKGLLITEAIHHA
                     QQPRVEYAFNIPATARFNEIGVQQLSDHVFSQVFPVKSEPPNPELVALSKEHLSRHDL
                     LGKSQDATEPVAFDMPPLQGQTLDEHFFKLGMDASEPYITYAKDYIKVNSPSIPRKWI
                     KRSGWTKYHSDGSWEAVDAPNESMLTFDTEVMWKEHSFAVMACAVSPTAWYAWLSPWL
                     LGESDNHIQLIPLGDISQPRIVVGHNIGYDRARVLEEYDMKQTRNFFLDTMSLHVAVN
                     GMCSQQRPTWMRHKKNRDLRDKIANENNSVELAALLESKMLSDEEEELWVGRSSVNSL
                     RDVAKFHCDVTIDKAQRDDFGELSREGILEKLDELLDYCAADVAITHRVYKKVFPNFL
                     EVCPHPVSFGALRHLSSVILPVNQTWKDYLTNAEATYHQRLDDVQRKLVELCDEALKV
                     KDQPDVYMDDPWLRQLDWSGQEIKMAKGKKKGDPPRPAARQKKPGMPKWYKDLFATNT
                     SDINLTVRSRTAPILLKLSWDGYPLTWSDKYGWTFKVPRDQVKKFENQPVVLCDMTEE
                     KIAELRDDRRHVYFKLPHKDGPQARCVNPLAKGYMQYFERGTLSSQYALAKEALEMNA
                     SCSYWISARDRIMGQMVVYKDEVQKSASNNAESRTGFILPQVIPMGTITRRAVENTWL
                     TASNAKENRVGSELKAMIKAPPGYVFVGADVDSQELWIASLIGDAQFQIHGGNAIGFM
                     TLEGSKAAGTDMHSRTAKILGISRNDAKVFNYGRIYGAGVKFAASLLRQFNPSMSEKQ
                     TQEVATKLYQETKGARTTRRILSDSPFWRGGTESFVFNKLEEFADQERPRTPTLGAGI
                     TEALMRRFINRGSFMTSRINWAIQSSGVDYLHLLIIAMDYLIRRFNIAARLAITVHDE
                     IRYLVKDEDKYRAALALQVANVWTRAMFSQQVGINDLPQSCAYFSAVDIDHVLRKEVD
                     MDCVTPSHPHKIPHGESLDIVQLLEKNEAACLDPSIDTGLRKGVR"
     exon            1017336..1017498
                     /number=1
     exon            1018983..1021843
                     /number=2
     exon            1023020..1023049
                     /number=3
     CDS             complement(1023257..1023904)
                     /codon_start=1
                     /locus_tag="AO090120000391"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000118"
                     /protein_id="BAE62974.1"
                     /transl_table=1
                     /translation="MMVFDHQRAKRKNGNVKPPRKSKYNSRYDGLAVGEVTIDFDHFV
                     TAYEYGLDLFPGASKLPCLSHIATEELEPIRRDVKNMILTREPSRHAFDWKAITDKII
                     SQYSSALQDIAGGKFSTMHRLRLSMEELLAPFIDYGDYYNITSTVERCQEDFIPISAP
                     SNTLASKAVRHVTGQICSTLTSTLLDFDLQLEDVVNNIVGLIMYLEWTALAHRRN"
     exon            complement(1023257..1023904)
                     /number=1
     CDS             complement(join(1024524..1025839,1025890..1026091))
                     /codon_start=1
                     /locus_tag="AO090120000392"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000117"
                     /protein_id="BAE62975.1"
                     /transl_table=1
                     /translation="MSTTPTPNRGIAVFSGGSAANNLVEVFEEVRDTKNCPLSYIIPI
                     SDNGGSSSELIRIFGGPGIGDVRSRLVRLIPESPPNSERGAIKTLFNHRLSADAATAH
                     AEWLSIVDGTSNIWHAITPAKKELIRSFFNLLNLEILKRARPPSSTFDFTSASVGNLF
                     LTGARLFSGSFESAIYLLGSICGVPSDTVRVIPAINSNFSHHISASLANGSVIVGQNS
                     ISHPSEATALQPRPRRPSLLLADGADDFTDTDTSDTLSYEDDHPPGSLPTLRNKNIKF
                     SKAENEDLPSRITRIWYINPYGQEIRPPANPRVLEAIRDSQAIIYSIGSLYTSLIPSL
                     ILRGVGQAIVTSPARHKILILNGSLDRETGPPSEPFTAVNFVEAITRAGEESRGRMTL
                     SSSNSGAHRSIPSLGLPYSSYVTHILHLEGPGTPQVDRDRLAEMGIETLRLYGRKIAT
                     TGAGGVEMPIGMKYDATALVQALEVVLGKKGDAMLRGGEKNGLSRRNTLDPGRKR"
     exon            complement(1024524..1025839)
                     /number=1
     exon            complement(1025890..1026091)
                     /number=2
     tRNA            1026594..1026667
                     /locus_tag="AO090120t00008"
                     /note="tRNAscan-SE"
                     /product="tRNA-Ile"
     CDS             complement(join(1027017..1027036,1027100..1028057,
                     1028121..1029645,1029713..1034171,1034233..1034573,
                     1034628..1036023,1036130..1036208))
                     /codon_start=1
                     /locus_tag="AO090120000393"
                     /note="protein kinase ATM/Tel1, involved in telomere
                     length regulation and DNA repair"
                     /old_locus_tag="AO070314000116"
                     /protein_id="BAE62976.1"
                     /transl_table=1
                     /translation="MAEITLDRTLVLLSSEKQRERSEGLAVSLFVLIVVFVIDPCISS
                     RSSLNDKACHKIFESLFRFISSEKSLYNRGNSKGPSASRLSTCASVLRLAVDALLHNL
                     RAKSVRAVVDHITETLQDTGGSLFELLGVDYTKCLTALLNYPPHVEHLGASEWEKLMG
                     FCLKIMNTQDYEDDRSHTGSDSRSTLDDFLGTGGTPTPSRSMPTLTAREKPKRDKGAI
                     SEAVVCIQLLTASVNAPVQEPAAKILHGLVGYVKSSHITGSGHQSAFNSINSVIMRVL
                     SDQSELVQSILLDLIPVICHLWATKLVGLKDELLVTIMLCIVLLTAATRQEPSELLSR
                     YTEDLLGALYKEYIKRPEKDILQVDELVFHQKTSAAVDKILIWPRLESGKSEHNWTVI
                     WAIANLVDLSEEITARSSSPRTSTETLNKRQRLTSMVDEIHRDCASSSGARRVCALQL
                     IPLIPRHHASVDSKSSLLLRLLPNILDENGILASWTMITIASLAGSPNADSPSLRAIW
                     QQAWELTCRASTSQATSRASCILMNSILEYNLLEYSIVAEATSSMLTSVNLNGPSTMS
                     DASLTLWATTTRMTARVNPGSLPNASKQICAWLREVWVIGTVTDRTQLAQLAAFARPL
                     DLLNLLLACTNRHYIPPKPQFRGATSLIAKGWHFLHRSKQLLNYLFQLGGILDFDMWD
                     TDDTIHLETFPRQDPNDNMVLDLLQVKSEMFLQAFQSLYEDKSHHVTVEIVQIVTSFC
                     ILVALYTECLPHLSASKFHNLQQNCERLWEIICTFLASHELEFIQGCLVVLSPFLNPE
                     QFSYNPESTISKALLRLVIPLVSLLEAYRRSQRDNLALHNDEPMDLDDTLFNSKDRLA
                     EVTSIVKSNREALPLFQEFSSFQRCITIQLSVLQKTNAFLRNHDQHSSRALVEYLIDL
                     DEVDILAASNSLPYVYRAISGMDRTSLLDILEDLAEKCLQTYELERCEASHLLCIHMM
                     HSFVKAWVSSEADSLSGSASDIYTWFRDVLLAKDMASPSVLVVFSELLVDVINTNASY
                     SSGESNTSPRTSLLKILEKGSIPVKFDVGNLIPRLFGHYSLNDHDAIFNDVLRHLPKE
                     SDWVEGIALRLFILGQLASRWHTLLRRSIYHMFETPAHVPHSLQYAEKCICDVANKLG
                     LKDAKELFRLFSSQILYTWTEQESITAMPFSIFSYASIKDMLGDVQDELVGQIIMRAR
                     EDEEIEMSKYMGKPFVDLLATSFYKAEAYSIARDISTPPGQGSQPKGVETRLKKILGT
                     EQFMELIDQQFPQTIAAFFGSLDQYEQVERALSKRAKFHDALDGLRCILGKSASKIVL
                     PANQQPSFRARYLIDELEFLCKRSGYELETIWTPTLASYVCRTLLESIHPALGSFHAC
                     SVIRKIRVLLCVAGSVMLRDYPFEMTLHAMLPFLVDIYCSEDALGIFWYLLEAGQPYL
                     AETPGLMAGVAVSTLLSLKKFLASPPVDTAQQGQSKIVTANIERFLQWFGEYINTYES
                     SLDAETQESFRRVVKSSQATSTVESHSDDSNERDVILEILDDRSSERSLLSKTVSDHV
                     IALLCADSEEPLGNYHKLNESDRDATANIVAIYQTLQSFNTGSGYRLWAAKVIGRAFA
                     TTGKVCDALLREQDLSLFKSQLSDLRLEVHCYSKASILQELCNMLQNNSHLEVGLVER
                     TLQLIISNLARYPDFEQCAGVVPLYLMKAFTWDPYQCPPIPTLAPETERDDAKVNWQT
                     SNSLSQWARGIALFLSKSAAEDPVIGSLSHIIYVIPELAVRILPYMLHDVLLAELKGE
                     ANIRQKVSQIFKQALCDVHDTTISHARLAIDCILYLRNQPKPNEATIVERDEWLEIDF
                     AEASLAASRCRLPKTALIFLEIHASRVIFGSRRSSLAKYEAPPDMLHDIFKDIDDPDF
                     FYGIQQSPSLDSVMERLQHESSGFKNLLFQSAQYDSEIQMSADQNAYGVLKALNSTNL
                     QGIANSIFSASGGGFVDTSSSFDSMLQAATNLRQWDIPVSPLNPSPPATVFRAFQSLN
                     TSGSLAEASKSINECLLTTLESLTSASRSAMSLRTAMRVLGVITEVSDVLDARSTEEI
                     DHEWQKIAARDSWLKTTSVHEIGEILNSHEALFSSINRKSYLRSSTNISDHDAQLLEV
                     KAIRQSLHITRTQGIQQASLKSAVYLSKLAHQCSALGINIEGAAKFDLANVLWDQGEM
                     TASIRMLHQLKDQNDLHKQAVPISRAELLVTLVSSLHIDSLRTKPCSFRTNSTSCKGH
                     HVAEARLEKPETIIQDYLLTAVKELKGRSGGEEAGRVYHGFATFCDQQLQNPDGLEDF
                     TRVEQLRNRKEKEVRALEDMMKAAEGREREALKFHRGRTKQWFDLDDREYQRLRRSRE
                     AFLQQCLENYLLCLRESETYNNDVLRFCALWLDKSDSDIANAAVSKHLGQVPSRKFAP
                     LMNQLTSRLLDVPDEFQKMLFSLITRICVEHPFHGMYQIFASSKSKGGKDETALSRNR
                     AAGRLVEGLKNDKRIGPTWVAVHNTNINYVRFAIDRPDEKLKSGARVPLRKLQTGGRL
                     EQDAATQKLPPPTMNIEIRVDCDYRDVPKLVKYHPEFTIASGVSAPKIVSAFASNGLR
                     YKQLFKGGNDDLRQDAIMEQVFEQVSNLLKDHQATRQRNLGIRTYKVLPLTSNAGIIE
                     FVPHTIPLHDYLMPAHQKYYPKDMKPNVCRKHISDVQTRSFEQRVRTYRQVTEHFHPV
                     MKYFFMEKFNNPDDWFSKRLSYTRSTAAISILGHVLGLGDRHGHNILLDERTGEVVHI
                     DLGVAFEQGRVLPVPEVVPFRLTRDLVDGMGVTKTEGVFRRCCEFTLETLRRESYSIM
                     TILDVLRYDPLYSWTVSPLRMKKMQDASEAGGGPPMLPGAADQRPSNEPSEADRALTV
                     VAKKLGKTLSVTATVNELIQQATDEKNLAVLYCGWAAYA"
     exon            complement(1027017..1027036)
                     /number=1
     exon            complement(1027100..1028057)
                     /number=2
     exon            complement(1028121..1029645)
                     /number=3
     exon            complement(1029713..1034171)
                     /number=4
     exon            complement(1034233..1034573)
                     /number=5
     exon            complement(1034628..1036023)
                     /number=6
     exon            complement(1036130..1036208)
                     /number=7
     CDS             join(1040967..1041015,1042849..1043129,1043186..1044266,
                     1044335..1044757,1044829..1045189,1045277..1045337)
                     /codon_start=1
                     /locus_tag="AO090120000394"
                     /note="cullins"
                     /old_locus_tag="AO070314000115"
                     /protein_id="BAE62977.1"
                     /transl_table=1
                     /translation="MAGTTLIEAICDDAYADSYFEKIWGQLDAALTAIFDGGKPEISL
                     EELYKGAENVCRQGRASALARQLQERCRGHVSGKLRDTLVVKAAGGNNIDTLRAVVDS
                     WTTWQSKLVTVRWIFYYLDQSFLLHSKEYPVIREMGLIQFRQHIFNDTVLQPQVLQGA
                     CDLVEADRDEGRSISADSSLLRNAIEFFHGLDVYTTGFEPLLVSESKKFFASWAQHEA
                     SGYLATFAENSHRLIEQEVDRCTLFSLNRSTKQKLSELLDQELVAEQENVLLNQNDIL
                     GLLRAGNKTALEKLYTLLQRRDLGAKLKTAFSSYIVEEGTSIVFDDDKEAEMVVRLLD
                     FKQQLDETWNNSFHRHEELGHALREAFETFMNKGRKSGASGGTDNPKTGEMIAKYVDR
                     LLKGGWKLPPGRKAEDVPLADEDAEINRQLDQVLDLFRFVHGKAVFEAFYKNDLARRL
                     LMGRSASDDAEKSMLARLKTECGSSFTHNLESMFKDMDVARDEMAAYNSIQRERKHRL
                     PVDLNVSVLSAAAWPSYPDVQVRIPPEIATAVSDFEKFYYSKYNGRKLNWKHQLAHCQ
                     LRARFPKGDKELVVSSFQAIVLLLFNDISEKGTLSYLQIQEATKLSDQELKRTLQSLA
                     CAKYRVLAKKPKGREVNTTDEFSYNEGFSDVKMRIKINQIQLKETKEENKTTHERVAA
                     DRHYETQAAIVRIMKSRKTITHPELVAEVIKATRSRGVLEPADIKKNIEKLIEKDYME
                     REEGNRYQYVA"
     exon            1040967..1041015
                     /number=1
     exon            1042849..1043129
                     /number=2
     exon            1043186..1044266
                     /number=3
     exon            1044335..1044757
                     /number=4
     exon            1044829..1045189
                     /number=5
     exon            1045277..1045337
                     /number=6
     CDS             join(1048374..1048386,1048548..1049055,1049115..1049740,
                     1049808..1050448)
                     /codon_start=1
                     /locus_tag="AO090120000396"
                     /note="dihydroxyacetone kinase/glycerone kinase"
                     /old_locus_tag="AO070314000113"
                     /protein_id="BAE62978.1"
                     /transl_table=1
                     /translation="MSAQTKHFFSDPNHLVVTALHSLTLTNPSLAFDPENKIIFRRPD
                     SLKKKKVAIVSGGGSGHEPAFAGFVGQGFLDASVAGTIFASPSAVQIRKAALDCVDNE
                     QGVLIIPMNYTGDVLNFGMAAEKARAAGIKTEFFAINDDAGVGKKKGGKVGRRGIGGG
                     ILVLKIVSALAETGASLEEIYRVAQQANSLLATVGSSLEHVHIPGRPASEDTIPVGEV
                     EVGMGIHNEPGSHRMKFTLPELVKTMLFQILDHNDPDRAFITREPGDEFVLLINNLGG
                     VSSLELSGITDEVYRQLERDYSIKPVRVIQGTFLTSLNGLGFSASLLKLADNGLGAGK
                     SFLELLDAPAEAVGWSAPIPASTWDRRTDAPVELKKTKLAEQQPSNLKLDPATIRKVL
                     GAGLRRIIDAEPTVTRYDTIVGDGDCGVGLKRGAEAVLALLEDNFSSLDEDVVKTVNR
                     IVTIVENTMDGTSGAIYAIFLNALVHGLREQDKGKSTPATAEVWGEALKYSLGALGKY
                     TPAKPGDRTMIDALVPFCTTLRDTKDVHAAAKAAQEGTEATKSMKASLGRSVYVGGED
                     EWVGKVPDPGAYGLSEFFTGLVEAIPKQA"
     exon            1048374..1048386
                     /number=1
     exon            1048548..1049055
                     /number=2
     exon            1049115..1049740
                     /number=3
     exon            1049808..1050448
                     /number=4
     CDS             complement(join(1051177..1051219,1051293..1051541,
                     1051637..1051669,1051791..1051813))
                     /codon_start=1
                     /locus_tag="AO090120000397"
                     /note="small nuclear ribonucleoprotein (snRNP) Sm core
                     protein"
                     /old_locus_tag="AO070314000112"
                     /protein_id="BAE62979.1"
                     /transl_table=1
                     /translation="MSTDPKIQDLLNKPKSELTEYEVSLVEEHELTAGPLSLLQTATR
                     THTQVLIACRSNRRLLARVKAFDRHCNMVLENVKEMWTEKPKGGKGKGVNKDRFISKM
                     FLRGDSVILVLLS"
     exon            complement(1051177..1051219)
                     /number=1
     exon            complement(1051293..1051541)
                     /number=2
     exon            complement(1051637..1051669)
                     /number=3
     exon            complement(1051791..1051813)
                     /number=4
     CDS             join(1052536..1052575,1052640..1052793,1052852..1054896,
                     1054953..1056277)
                     /codon_start=1
                     /locus_tag="AO090120000398"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000111"
                     /protein_id="BAE62980.1"
                     /transl_table=1
                     /translation="MESQDGISVRPMRLKVLYTFDDASKTNCLARWPHLLDIQTAALD
                     EKTQIGVIELKTCIQAIVSASPELVAKLGQDYTVYAYDYSEYETPLVGQGMLSWVLAS
                     ASTTPNAPAHQSETMVTGRVCKNVLGLFSKGAQETLEVKLRLVPVPTVMQSEYLESMR
                     KYRELSTVIPHEFDAQTWTNFLRQNPGLMTPSITQQPERTESPMDHSAIERFHQLLSE
                     GSTPREFPPVSANGYRSVSPSQSALAAGSRVSTPGGQRSLYQQDQVSQPTQQQSQQPR
                     LDRAQSDIIRPSSSASMRDSDFAIQSRYASRRESIQSGYGSCEESGESQPRKRAKLYR
                     AECPGKSDFNIERQPSSLRVAASTAASVRIHRPTPINPAIAAAQNSHEEPVRPPTPIS
                     NTNDLPRRARTMPSLLRESSVQSNNYESPYNASDDQTPIECNTHSPEESRYQGLFEPS
                     FSMPSSPPVLDCSFAARSSPVLPPMVTDPDSGFMSGGMEELLDEDIGTPLEDYTRPVT
                     NDAGSEKRRDHPAVQASSPVGARPNQETRNENTVVGDESQGQPAKESAPAPPRAPASA
                     AGSRPSSRASFRQAPKPLAPAPMSQSEIEQLISAIPASDPVMPSQSQGQNSAWAAGPM
                     SDFTAAETPAPQRVAEDGKVRSGAGARRLRQVQARLDKCIRDGQVPPYCENCGAIETP
                     TWRRAWSKEIIGNEQEADEMKKDSGMLFWQSLERNDQDKVTKFKIYKKSLADIDNDFA
                     QVLLCNPCGLWLHKFKSMRPENKWNKSSNGKRKRPPRNRRGGGPLSTNGAATRSQSRA
                     ELTKVDGSSPVASDASSPAAEDGITPRDTNNNENENEDDSQEPPSKRRRATSLEPRKS
                     SDTAGSRWQEDNAIEALRRAIQSSPARNFESRNSATAGENSLTPKSVRRVLFPNSQAE
                     GGPLKALGESVLNSPRRSPRVASHESAKQPQDKENGTSDLDCLFESPSFELDLPTSPT
                     PRRRNPRTGVLGEKSLSLPGHSPSSSKVRKDINTTPTKLTAQRLQRIQNSPGSSPRQG
                     KTPKQSRLHMPELPSLPDDAFSADAFGGMDKVIVDIFSDAPATNADSLFGFDPTKCPS
                     SSNWPDWLPSDYVSPNGSEEEQNNGDDDSGNLINALLSNSDLHKENHFDIFNLDSNIL
                     DSGFFSSDALDTDVMALNVKAKSAEGSSHKEQAQNNTPNAS"
     exon            1052536..1052575
                     /number=1
     exon            1052640..1052793
                     /number=2
     exon            1052852..1054896
                     /number=3
     exon            1054953..1056277
                     /number=4
     CDS             complement(join(1056981..1057091,1057165..1057407))
                     /codon_start=1
                     /locus_tag="AO090120000399"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000110"
                     /protein_id="BAE62981.1"
                     /transl_table=1
                     /translation="MSLQTPRVLPAHLHAFHPSNANPHVTNTVRILGTVTALRGDTAT
                     ITCGDNGDVTLILKPDSHLQMGKLVEVVGKVTDVEGQGLGVRVLGSFDWGNPSDCGML
                     FPSFLDRELWLMVVL"
     exon            complement(1056981..1057091)
                     /number=1
     exon            complement(1057165..1057407)
                     /number=2
     CDS             join(1058380..1058799,1058862..1059176)
                     /codon_start=1
                     /locus_tag="AO090120000400"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000109"
                     /protein_id="BAE62982.1"
                     /transl_table=1
                     /translation="MGPKDKHYISRGWRERKSPHSLTHSPSHTSRSLNNMAQTIPLPL
                     SGIEHGKRILASVVETRARDGPESTWVSVPIDNEDLSRGFKDISFQQLNNAANHAARW
                     LGEHLPGTSEPFQCFAYAGPKDFRYPILAVAAAKIQKVMVLPSPLVTAEAQLRILENK
                     RCTVYLRPSSMASQVDAILREAPRIQAVEVPEIDEFMREDEAVPYSYGKTWEEGKDDP
                     WLVFHTSGTTGPYMHHIQIFLHWNAC"
     exon            1058380..1058799
                     /number=1
     exon            1058862..1059176
                     /number=2
     CDS             1059413..1060288
                     /codon_start=1
                     /locus_tag="AO090120000401"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000108"
                     /protein_id="BAE62983.1"
                     /transl_table=1
                     /translation="MPTFLHMITVVGPPVPPSAEIIKKTLQYGQVEGALLPPALIDVL
                     CQTSPGLDALRQLKFVHYAGAPLSKKTGDQLASHVRIVPCIGSTEAGGYFTKIHDHRD
                     AWDYISFQDYAGAVFEKRLDDLYELVFTRRPGDSPQQIFKLYPDIDRFETKDLWTEHP
                     VHKGLWKIIGRTDDYVYLSHADGLHASLLEPEIEAHPRVRSALIGGYGRPAPVLIVEL
                     FSTEKGETQEELISSLQPYIEKVNARVHDCVRLSTERVIVAAEKKPFIRTIKGSVARM
                     QTLALYEDEIAALFS"
     exon            1059413..1060288
                     /number=1
     CDS             1067782..1069266
                     /codon_start=1
                     /locus_tag="AO090120000402"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000106"
                     /protein_id="BAE62984.1"
                     /transl_table=1
                     /translation="MPPPLPSHHRGMTANPLKPSRYRPGKPIAEEPSSSEEEEEEDEE
                     EQIKEQERRRLEQQRRQRAQAPKATSFPGGNITKGVKNVQIEEDEDEEGFVTEEEEEE
                     SKPPPRVAGDNGGAAAAAPVQAAGEPVSKEESEEEEEEEEESSEEESSSEEETPRRVL
                     LRPTFIKKDKRNNAANQTQNGQGASPNTAAADSAAEAEARRVQRQEKADMLVREQLEK
                     EAIARSAANKQWDDDELEAVEENGIDDKDGIDPEAEYAAWKLRELKRVKREREAIEAA
                     EKEREEVERRRNLTAEEREREDREFIAKQQEEKEATRGQGGFMQRYFHKGAFFRDDLE
                     REGLDRRELMGARFVDDVSRETLPEYMQIRDMTKLGKKGRTRYKDLKTEDTGRFGDGF
                     DNRRRRDAPVGVRDERFLPDRPDDRPKGPTGANAGPVRERRRSRSRSYSPRRDRRPDR
                     RERRESPDRDRSRDRYRPDSRNRRKRSPSPYDDREKRRRLGSVS"
     exon            1067782..1069266
                     /number=1
     CDS             complement(join(1069759..1070248,1070309..1070583))
                     /codon_start=1
                     /locus_tag="AO090120000403"
                     /note="transport protein particle (TRAPP) complex subunit"
                     /old_locus_tag="AO070314000105"
                     /protein_id="BAE62985.1"
                     /transl_table=1
                     /translation="MAHPARHSAMVSVSNSAANHSNASDKQQPPQQIQHIANTGLRVP
                     SNRKTIYDRHLNRSRNAESSRASFAFLFAEMVIYAQRRVTGIQDLEKRLNEQGYPLGL
                     RLLDLLYYRTITSSTSSSISSSSTSAAPPNRPLRILPLLHLIHGPLWRLLFNRPADAL
                     EHSVSPDTPNEYMITDNDPLVNTYISVPKEMSMLNCAAFVAGIIEGVCDGCGFEAKVT
                     AHNQPTEMWPGRTIFLVRFGESVMEREKVLERAGIK"
     exon            complement(1069759..1070248)
                     /number=1
     exon            complement(1070309..1070583)
                     /number=2
     CDS             complement(join(1071945..1072104,1072163..1072439,
                     1072497..1073292))
                     /codon_start=1
                     /locus_tag="AO090120000404"
                     /note="predicted sugar kinase"
                     /old_locus_tag="AO070314000104"
                     /protein_id="BAE62986.1"
                     /transl_table=1
                     /translation="MGFDDTAIDTDGVTVTDMDDWTPKQSETIVESRQLTKKQLSDMA
                     WNVRKLSKKLDSIKLKLSVKNVFVVTKAGDDSVIAFTRKLTQWLLSKDRDTEYNVYVE
                     RRLEAAADFGASQLLEDEPSAAGRLKFWDNKFVYENAYLFDFVITLGGDGTVLYTSWL
                     FQQVVPPVLSFSLGSLGFLTKFDFNDYQKTLGSAFKDGVAVSLRLRFECTIMRSNGRE
                     DGSLTHAKKRDLVEELIGEEVEGTLTHKPEKVVQILNDVVLDRGPNPTMSSIELFGDD
                     EHFTTLLADGVCIATPTGSTAYNLAAGGSLCHPDNPVILVTAICAHTLSFRPIILPDT
                     IVLRMGVPYDARTSSWASFDGRERVELHPGDYVTVSASRYPFANVLPQDRRNNDWVHS
                     ISKTLNWNSRQKQKALKG"
     exon            complement(1071945..1072104)
                     /number=1
     exon            complement(1072163..1072439)
                     /number=2
     exon            complement(1072497..1073292)
                     /number=3
     CDS             complement(join(1073893..1073927,1074011..1074471,
                     1074538..1074993,1075080..1075219,1075282..1075401))
                     /codon_start=1
                     /locus_tag="AO090120000405"
                     /note="nuclear protein involved in cell morphogenesis and
                     cell surface growth"
                     /old_locus_tag="AO070314000103"
                     /protein_id="BAE62987.1"
                     /transl_table=1
                     /translation="MSKVIFTPWKEQSELQSVRNQFYPPPTYDGPDMRSRACATVAAW
                     KLRGNLPHPVEATALLTDAILHDDAKKNSIFSIRATYSAAFCRFVTGLVDSKLHGQRK
                     TMFQRAIDLGLPASFVELRHEATHRELPSLTVLRNAAQRSLEWLWDYYWAKIDLDAGF
                     APDGVEDDIEPVKAAARACLAQVTGETGASEPPRKKRRVQVLSGVATQLVSVCKSSGK
                     GAAAVSEVLVEDEVLVSGERKLGTSLDDEFSRWDYFLQVIVEGYPAFLTGLVEAMVDV
                     LAFARSATKEDAHCEGVYMWLDHILCSSQWESKRRLLSFAYALSACEQNSNHWTDMLK
                     ERIQEVDNDLSSSPGGQGELSGKDKNAPQSLHTGTSHDLDSLKNMGWEVVDTWDSRPL
                     VCLFGVNYHHL"
     exon            complement(1073893..1073927)
                     /number=1
     exon            complement(1074011..1074471)
                     /number=2
     exon            complement(1074538..1074993)
                     /number=3
     exon            complement(1075080..1075219)
                     /number=4
     exon            complement(1075282..1075401)
                     /number=5
     CDS             complement(1075820..1076998)
                     /codon_start=1
                     /locus_tag="AO090120000406"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000102"
                     /protein_id="BAE62988.1"
                     /transl_table=1
                     /translation="MANYIQPQAGSYWLQADQPCVPSSNFRDMMYAFPRPRHTGRVMK
                     PRSAGNSPSSAGRWRAAASHGSPIYQPVQAQPYQAQVNPALLASALRRRRATATRPIS
                     WHPASLETAAYTSPPYFQTTAAENLGVMAPSTQPMGPATTTLADAGMLPSYDSQEFSA
                     PTEVFSFSAMPDPASMQQSSFLDMSGSQIDPVTWDNSAPNMTTMAQPMSDNWPFDMMS
                     MNNSIPSADVEASGYASAPSSGYLTGPSTPDFLPIQHPDSTSKSLHESTSDEPAGDEL
                     VGMGLYNHPDPFLDTSFHEVSGKGLKLEETFTPSSDDEADDSKDAESEDDNQETTEQA
                     SASSSAPVQKQPANPPTNMMHKSFFFDDDDIEQQTMSAPQQLFNLGSQPCMNYGYGWI
                     "
     exon            complement(1075820..1076998)
                     /number=1
     CDS             join(1089627..1089651,1089713..1089800,1089855..1089926,
                     1089974..1090007,1090066..1090279,1090336..1090427,
                     1090481..1090615,1090672..1090698,1090753..1090836)
                     /codon_start=1
                     /locus_tag="AO090120000408"
                     /note="glyoxylase"
                     /old_locus_tag="AO070314000100"
                     /protein_id="BAE62989.1"
                     /transl_table=1
                     /translation="MHIQSIPMWTGKGNNYAYLVTDEPTKKSVIIDPANPPEVAPVLK
                     SQIEDGKIDLTAIVNTHHHWDHAGGNDELLKIFGNKLPVIGGKNCQSVTQTPAHGETF
                     KIGERISVKALHTPCHTQDSICYFMQDGEERVVFTGDTLFIGGCGRFFEGTAPEMHKA
                     LNETLASLPDDTKVFPGHEYTKGNVKFCLAVSQSEPIKKLEAFAEQNQQTQGKFTIGD
                     EKLHNVFMRVNDPEIQKKTGKTDPVEVMAALREMKNAM"
     exon            1089627..1089651
                     /number=1
     exon            1089713..1089800
                     /number=2
     exon            1089855..1089926
                     /number=3
     exon            1089974..1090007
                     /number=4
     exon            1090066..1090279
                     /number=5
     exon            1090336..1090427
                     /number=6
     exon            1090481..1090615
                     /number=7
     exon            1090672..1090698
                     /number=8
     exon            1090753..1090836
                     /number=9
     CDS             join(1091171..1091363,1091483..1091947,1092419..1092477)
                     /codon_start=1
                     /locus_tag="AO090120000409"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000099"
                     /protein_id="BAE62990.1"
                     /transl_table=1
                     /translation="MTTQNDPPGDPKTLKSQILETGAAAVQDFTPVKQICAHLNAFHV
                     YVDDPTRCVEANHYCSHITEDLRQCLLYSSPDRNAKLLGVEYMITPRLFATLPPEEKK
                     LWHTHEYEVKSGMLVMPAPSGMPSTVWETAETAEMRDILPLYGKTYHFWQVDRGDPVP
                     LGAPMLMGSFTTDEDVKRVHEGGLEGLCKDRDGRFGVDVKHKREVRKGIERPEGWVVD
                     SGDWQHEPTTIDSKWTIKGR"
     exon            1091171..1091363
                     /number=1
     exon            1091483..1091947
                     /number=2
     exon            1092419..1092477
                     /number=3
     CDS             join(1092777..1093136,1093211..1093387)
                     /codon_start=1
                     /locus_tag="AO090120000410"
                     /note="mitochondrial inner membrane protease, subunit
                     IMP1"
                     /old_locus_tag="AO070314000098"
                     /protein_id="BAE62991.1"
                     /transl_table=1
                     /translation="MSRILRETLRRATPGGVFRLTLDGVGLFCACTLIWEHLITVQLS
                     EGPSMYPTFNPRGDYLLISRVHKHGRGIEVGDVVRFYHPTFLGVNGAKRVIGMPGDFV
                     CRDLPFSTEVGKSQEMIQVPEGHVYVGGDNLPWSRDSRNYGPIPMGLINGKIIARVWP
                     LSKAQWVQNTMQPAQLDD"
     exon            1092777..1093136
                     /number=1
     exon            1093211..1093387
                     /number=2
     CDS             complement(join(1093527..1094251,1094323..1094860))
                     /codon_start=1
                     /locus_tag="AO090120000411"
                     /note="phosphatidylethanolamine binding protein"
                     /old_locus_tag="AO070314000097"
                     /protein_id="BAE62992.1"
                     /transl_table=1
                     /translation="MAHCERAAKPLLQCLQKSYPRALPTLQVQSTRAFQTTAFAREEA
                     QAEPKSQPFHKAPDPALVSSPRLERRLIRQGVSPIGSRRRRAALQSSPNVPFEQLPYQ
                     CFQEARKVLLADREEKLKEIVSMREKIARLQAVPTEEAGGEQVKKSRLVAMELHLERL
                     KILADINDPLVKKKFEDGQGDMSKPIYRYLADRKWREYRRKILVQRITQMKVIPDVLP
                     HCDPVVDTKLYFGRSPVQPGEFVNSRVSTSAPKLDVQLFDRGEKLVTIAVVDSDVPNV
                     EKDGFDYRMHYLAVNVPISAVSTKVDLSKLSSDSQVVLPWLPPVAQKGSPYHRLSVFI
                     MEQKDSKPLDFAAVKAKETTRDNKLLRTLQARYHLKAIGAHLFRTEWDSTMAEVMKEN
                     GYAEVDMELRRKRVEPLPYKRRNPSTFR"
     exon            complement(1093527..1094251)
                     /number=1
     exon            complement(1094323..1094860)
                     /number=2
     CDS             1095282..1096034
                     /codon_start=1
                     /locus_tag="AO090120000412"
                     /note="mitochondrial/chloroplast ribosomal protein L4"
                     /old_locus_tag="AO070314000096"
                     /protein_id="BAE62993.1"
                     /transl_table=1
                     /translation="MATESQATTEHLTREAPNSVWTTEPARATTYSFPSMEPLRFVEY
                     PRNHLLMPLRKDILHRAVIYEGDMTRQGSANTKWRDDVHGSGRKLHAQKGTGKARVGD
                     KKSPIRKGGGVAHGPHPRDFSTSLPQKIYDQAWRIALSYRYRRGQLIIIDNDISIPED
                     ATPYLIKEIFKVNNWGREFGRSTLITDQPNEGLFATVREVGEHAKILDRKDVDVKDLL
                     ETGRLIIEKQALDRILANHSRDLAAKPAKALY"
     exon            1095282..1096034
                     /number=1
     CDS             join(1096528..1096647,1096709..1096870,1096927..1098129)
                     /codon_start=1
                     /locus_tag="AO090120000413"
                     /note="enoyl-CoA hydratase"
                     /old_locus_tag="AO070314000095"
                     /protein_id="BAE62994.1"
                     /transl_table=1
                     /translation="MLLRHNISRLSTPSSWISRVSPATMPLRAKVTNPAFKAATMSTS
                     TNLPKELPGDEPDDVLFNSLYGVRLVELNRPKKLNSLNGSMARKILPRLKEWEKSQLA
                     NVVMVAGAGSKALCAGGDVAALALQNEQGPEGQQKSTDFFGLEYQLDHTIATYSKPFI
                     SVMDGITMGGGVGLSVHAPFRIATERTVFAMPETTIGFFPDVGGSFFLPRLDGEIGTY
                     LALTSERLTGVQALYAGIATHYFHSSVLSNLTNRLAELVFQDQATPQERMDLVNNTMA
                     EFSTGLPSLAEEPMLIAGGLRSAIDRCFKYNTVEEIFQALEKETEQKEWAQKTLETLS
                     IRSPTSLRVTLRQMRLGKKWSISETFQREHHIASKFMKHPDFVEGVKARLMSKPPRQA
                     SWQPATLEEVSQADVDAFFEIPEEESRLPLLSETTYSEYPHAHYGLPTENDIAKFVRD
                     NTENKQQTVSDFVQKWGNKEGVREKVAEVLARRTVQTPEGLRWE"
     exon            1096528..1096647
                     /number=1
     exon            1096709..1096870
                     /number=2
     exon            1096927..1098129
                     /number=3
     CDS             join(1098714..1099029,1099154..1099257,1099310..1099349,
                     1099470..1099555,1099610..1100149,1100199..1100357,
                     1100465..1100479)
                     /codon_start=1
                     /locus_tag="AO090120000414"
                     /note="iron transporter"
                     /old_locus_tag="AO070314000094"
                     /protein_id="BAE62995.1"
                     /transl_table=1
                     /translation="MSRLDSIDEAEPFLPPSSLSESIETPIRASKPVLVRLYISHSLS
                     TWNSRMFEFGAVLFLASIFPGTLLYASVYALVRSLSAVLLSSWLGSMVDRSNRLKAIR
                     QSIRPSYISPLLFAVVTLLACFEKLAYTANTVAVERDWAIVVSDALQIPRQDSFSTRV
                     AIWTTLGINASCVLVEYFAIAQVYKSVPELVRNQETDDNQNEGEETTSDGQNFQRSIA
                     HSTVQYARSALAPWREYVSSPLFLSSFALSLLYLTVLSFGTTMVTYLLHTGFNSLQVS
                     GMRIGAVIAELSGTWAAPFIMNRIGPIRSGLWFLNWQFTCLAAAVAAFAFLDNSSQLV
                     AVSLIVGVALSRVGLWGFDLSVQFLVQEGVDEHARARFSSTEMALQNIFELFSFATTI
                     VFPLPEQFKYPVFISYGAIAMAAGHMI"
     exon            1098714..1099029
                     /number=1
     exon            1099154..1099257
                     /number=2
     exon            1099310..1099349
                     /number=3
     exon            1099470..1099555
                     /number=4
     exon            1099610..1100149
                     /number=5
     exon            1100199..1100357
                     /number=6
     exon            1100465..1100479
                     /number=7
     CDS             1102194..1102787
                     /codon_start=1
                     /locus_tag="AO090120000415"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000093"
                     /protein_id="BAE62996.1"
                     /transl_table=1
                     /translation="MHHRRRGTVSDEFEVLQVAHQIGADLEGLWNKRPRVLDVYDKPE
                     ELYNTLQPAVADEVCRTFRQYIANFLAIFIYLHRVAFVIYPRTDRVHRAVDQIIQLAT
                     VESGSENHRLPISFTWPLFVAGLEGSLEQRGWIIQEMQRMADLPSDHSPVAQRHPNAK
                     KILQLLEEMTKRQDASRTWADSRLVRRELFVDPFVLI"
     exon            1102194..1102787
                     /number=1
     CDS             complement(join(1102866..1104534,1104598..1104755))
                     /codon_start=1
                     /locus_tag="AO090120000416"
                     /note="arylsulfatase A and related enzymes"
                     /old_locus_tag="AO070314000092"
                     /protein_id="BAE62997.1"
                     /transl_table=1
                     /translation="MAPKRPNFLVVVADDLGFSDIGCFGGEIRTPNLDRIAKQGVRFT
                     DFHAAAACSPTRAMIMTGTDHHIAGLGNLIEWTNISGQNGPKGSAMSTAPQRGMPGYE
                     GYLNERVVALPEVLRDAGYHTLMSGKWHLGLTPERSPFNRGFDRSLAHLPACSNHYAY
                     EPQLQGTDETPTFLEASYIALHMEDDKYVKKLPEGWYSSDGYGDKMLQYLREWHDRSD
                     ERPFFAYLPFTAPHWPLQAPREYIDHYRGVYDDGPEALRQKRLQRLKELGMIRSDVEA
                     HPVVADEVKPWSEFTPEEKKLSCTAMEVFAGMVECIDTNVGKVVDYLASIDELDNTFV
                     CFMSDNGAEGAAYEAYPMVQSGVMPHLQKYYDNSLENLGNGNSFIWYGPRWAQAATAP
                     SRLYKAFTTEGGVRVPFLARFPSSVSVGDHVRNGSITDQFATVMDLAPSILQMAGATH
                     PAPSYKGREVVSMRGRSFYPWATGDAPRIHEQEFIQGWETCGRAALRFGDWKIVYIPK
                     PKGPERWQLYNLAEDPGEIHDLAEQHPDRLKQLLKLWDQYVIETGVIPLNPDLGEFLE
                     ATEAQMPENAWMEYDYWKKGARDEPEKFMRNPPRFQRVVKQF"
     exon            complement(1102866..1104534)
                     /number=1
     exon            complement(1104598..1104755)
                     /number=2
     CDS             join(1104963..1104987,1105300..1105377,1105426..1106888)
                     /codon_start=1
                     /locus_tag="AO090120000417"
                     /note="permeases of the major facilitator superfamily"
                     /old_locus_tag="AO070314000091"
                     /protein_id="BAE62998.1"
                     /transl_table=1
                     /translation="MAGSKAVSRVFRIYWLTAIVCCGGILFGYDSGVIGGVLTFDSFL
                     RDFHCTPDVQTRVSAIAVGIQQAGALAGCLAIWPVTNRHGRRRAMMYCSAIFCLGVIF
                     EVINSHSLPVFYLGRVICGLGIGGSATVIPIYLSEMSPTDMRARLGSCYQFTFTVGIL
                     VSYWVDYGIQFRAPTAAQWQIPLALQLVPGALMGLGMLSLDESVRWLLSQGDSPRAWT
                     SLTWIRASSGPSIAAEFVQIKEGIEADRHATADFHVRELLERPNARRFLLGISLFLAQ
                     QSTGATAMAYFGPQFFSLLVGGSGTNQSLTLLLTGVFGALKVISCLAFIIWVAERFGR
                     RPLLILGALAMSLCMASTAFVVRSDPSTTPTQTTSNSIKSTGILTISLIYLDIIAYNF
                     SWGPLPWPCTAELFNTRIREPGVAAGVAAQWLGNFVWSASTPYILAGMGWATFLLFGV
                     LDLAIAGFVWGCLPETGGKSLEEIEVLFEQIVPDEEGEACLGKSDDRCSISSSSSRHR
                     DREGGERYGSIEE"
     exon            1104963..1104987
                     /number=1
     exon            1105300..1105377
                     /number=2
     exon            1105426..1106888
                     /number=3
     CDS             complement(1109416..1110372)
                     /codon_start=1
                     /locus_tag="AO090120000418"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000090"
                     /protein_id="BAE62999.1"
                     /transl_table=1
                     /translation="MSVDQTLYSRTPTAMADPTCAGPAAFTAAGAFSQPDLMAFSLRE
                     EEPIWGFDTIAPSMASWQGKMEQQTFCNPNMERGLKNTHVRNGQPTPPPFDDKKLQTP
                     MGEMYPVAQYAFNSSPPEYAPPKHRSSLSEQSQTDGYGVSTRRRKASAIDQCEQQQER
                     EKREKFLERNRLAASKCRQKKKEHTKLLETRFREVSNKKGELESEIEHLRSEVLNLKN
                     EMLRHAQCGDEAIKIHLAQMVRLITSKDTPNRDLVSPMRSPEQMAASTPHGLSFGFDG
                     PMQLPSEMGSPLDQRRDSEQSIMTESSYTFSTDDSFEELINV"
     exon            complement(1109416..1110372)
                     /number=1
     CDS             complement(join(1117152..1117337,1117396..1117505,
                     1117564..1117920,1117992..1118141,1118221..1118395,
                     1118446..1118529))
                     /codon_start=1
                     /locus_tag="AO090120000420"
                     /note="5'-AMP-activated protein kinase, gamma subunit"
                     /old_locus_tag="AO070314000088"
                     /protein_id="BAE63000.1"
                     /transl_table=1
                     /translation="MLLSPTTSCDFLLFIRLYSSLRECLANICAIRNFLKVRNSYDVL
                     PLSFRLIIFDTSLSVKESLNILIQNGMYLPYSVNSAVPVSRNGIVSAPLWDSKTSTFA
                     GLLTTSDYINVIQYYFQNPAALGEIDQFRLDSLREVEKALGVAPPETISIDPERPLYE
                     ACRRMLDSRARRIPLVTNDSQTDRAHVLSVVTQYRILKFVAVNVSDTQKLRRPLGEIL
                     LGSYENVATASMDTPVIDVIHILVERSISSVPIVNSEGVVYNVFESVDVITLIKGGVY
                     DDLSLTVGEALKKRSPDFPGIYTCSLNDGLDTIFDTIRKSRVHRLVVVDENFRLKGVL
                     TLSDILQYILLEGENDESS"
     exon            complement(1117152..1117337)
                     /number=1
     exon            complement(1117396..1117505)
                     /number=2
     exon            complement(1117564..1117920)
                     /number=3
     exon            complement(1117992..1118141)
                     /number=4
     exon            complement(1118221..1118395)
                     /number=5
     exon            complement(1118446..1118529)
                     /number=6
     CDS             complement(join(1120083..1120411,1120474..1121278))
                     /codon_start=1
                     /locus_tag="AO090120000421"
                     /note="phosphatidylinositol transfer protein PDR16 and
                     related proteins"
                     /old_locus_tag="AO070314000087"
                     /protein_id="BAE63001.1"
                     /transl_table=1
                     /translation="MSAASEPTVPAASAHSGEAVDSQTSPPSAAAENSSNTVDQAQPA
                     TNGRDIESELPSSAADGLIQKPFPRPLDSAKPTPPAELTSDQQEKYNSVLKAVSAWTT
                     VPTTSAKNAPTEPLTDNERMFLTRECLLRYLRATKWNVSEAIARLERTLTWRREYGVE
                     KLTADFISVENETGKQVILGYDIHARPCLYLLPSNQNTEKSDRQIQHLVFMLERVIDL
                     MGPDQETLALIVNYNETKSGQNASVGQAKQTLNFLQNHYPERMGRALVINMPFMIMGF
                     FKLITPFIDPLTRQKLKFNEDLRQHVPAAQLMKSMGGDVEFRYDHATYWPTLNQLADQ
                     RKAAYRERWIQGGKRIGEYENYLKTGTSPSLAQTEASNGAPAE"
     exon            complement(1120083..1120411)
                     /number=1
     exon            complement(1120474..1121278)
                     /number=2
     CDS             join(1121696..1122006,1122064..1122234,1122291..1123590,
                     1123646..1123819)
                     /codon_start=1
                     /locus_tag="AO090120000422"
                     /note="DNA polymerase alpha-primase complex,
                     polymerase-associated subunit B"
                     /old_locus_tag="AO070314000086"
                     /protein_id="BAE63002.1"
                     /transl_table=1
                     /translation="MEDIVGELNELFAASSPDGLPKDVLAELQSLLRVHSIAPQELFY
                     KWESFCLKMGSEETKLNLETVRLFKRDVQESLERETRSKPGRQLPTATPRAAAATDVF
                     GILDGLTPNASHGRTPNSAKRKADFASPSASKVGKVDSPIGSKAPRKPINGAATGDGA
                     QSVPFSGRQNPGQTLETLNAHLSMPETPMAPFSEARIRPTANTDLKKFGYKPMAMRLS
                     EASEILDDRIDEFMTIFQKEYETEDLPFGSAATQSTSEIVAVGRIASDSMEGKLNPAS
                     LVLETSRRTGAGVRVPLKVDTLPSVNFFPGQIVALRGINASGNYFSVKEVLSTPLLPP
                     AASSVPTMEGINERLEEAGSSPLNIMISSGPYTADDNLDFEPLNEICQKAAESYADGL
                     VLMGPFLDIEHPLVASGDFDLPETNGYDPDTATLTTVFRHCITTPLQRLVAAVPSITI
                     VMVPSVRDAVSKHVSWPQEQLPKKELGLPKQVRMVSNPVTLSLNETVIGLCSHDVLYE
                     LRREEALHGKPKEGNLLTRLSKYLVEQRHFNPVFPPSSRDALPKPGIENGLATGATLD
                     VSYMKLGEWWNVRPDVLIVPSMLPPFVKVVDSVLVINPGTLSKRRAPGTYAQMAIHPR
                     EITEEEREQKHISHKLYERTRVDVIRI"
     exon            1121696..1122006
                     /number=1
     exon            1122064..1122234
                     /number=2
     exon            1122291..1123590
                     /number=3
     exon            1123646..1123819
                     /number=4
     CDS             complement(join(1123917..1123952,1124065..1124442))
                     /codon_start=1
                     /locus_tag="AO090120000423"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000085"
                     /protein_id="BAE63003.1"
                     /transl_table=1
                     /translation="MHHPRLADYFEDFTRPHTSATPSTTTSSHLYNNHTVTYGSSSPT
                     LVPSFLPIEDIYVAPQYQPPNPEDEDDVVPDQHAAFGISRAMERRREAVWRDLGLEAL
                     VNSGSGKSAVRVKEVGRRMGGKRVACMGCLIPLCF"
     exon            complement(1123917..1123952)
                     /number=1
     exon            complement(1124065..1124442)
                     /number=2
     CDS             complement(join(1125003..1126004,1126063..1126704))
                     /codon_start=1
                     /locus_tag="AO090120000424"
                     /note="translation initiation factor 2B, delta subunit
                     (eIF-2Bdelta/GCD2)"
                     /old_locus_tag="AO070314000084"
                     /protein_id="BAE63004.1"
                     /transl_table=1
                     /translation="MANPVDPAQTSPPSTSPSPAPATQQSTDMSSQQPPSQPPQPSNG
                     ASKPAKPPKQPKSKDAPPAAGGAPGEEKLSPAELKKKAKAEKAARRAKERAEREASGG
                     AGAGPGPNAAPPKKGSTGGGAGGKEAPGQPYKSQRHRRGSATQASATEQKKKQEDKNV
                     AVFGHLYGQPRRTTIAGAGKEVHPAVLALGLQMRDYVVCGSSARCVATLLAFKRVIEA
                     YTTPLGTSLSRHLTTHLSHQITYLSTCRPLSISQGNAIRALKLAISSIDPSVPEASAK
                     ATLSDFIDNFIREKITVADQVIATSAAEKIQDGDVIVTFAGSSIVKQTLLTAYKQGKK
                     FRVSIIDSRPLFEGKNLARTLANAGLEVQYSLVNGISHAIKDATKVFLGAHAMTSNGR
                     LYSRVGTALVAMSAKERAGGVEVPVIVCCETVKFTDRVALDSIVVNEIADADELVPSQ
                     PLKQVTGLPDPADEADTKKGDSKKGGNKAAANAPPAESTPLPEGASPLTNWKETPNLQ
                     LLNIMYDVTPAEYVDMVVTEMGSLPPSAVPIVHRMSTNL"
     exon            complement(1125003..1126004)
                     /number=1
     exon            complement(1126063..1126704)
                     /number=2
     CDS             complement(join(1127289..1128949,1129016..1129301))
                     /codon_start=1
                     /locus_tag="AO090120000425"
                     /note="kinesin-like protein"
                     /old_locus_tag="AO070314000083"
                     /protein_id="BAE63005.1"
                     /transl_table=1
                     /translation="MSLDPRVYHHVGHGYGPGSQSSVSSSDTSALTSITSPSIRSTTA
                     SAAALRSNASSPSLRAREGGAMHGTYLDGASSPTPGGNVRVVVRVRKFLPREIERNAE
                     CLISMDPRTQTTKLRAPRLDPEDEGKPKSQARGKVLEDKSFVFDNSFWSHDIDDDHYA
                     HQEDVYNCLGEEFLDHNFEGYHTCIFAYGQTGSGKSYTMMGTPDQPGLIPRTCEDLFQ
                     RIESVQSPDISFNVRVSYFEVYNEHVRDLLVPRTDPPHYLRIRESPSEGPYVKDLTEA
                     TVKNFAELMKFMRKGDVSRTVASTKMNDTSSRSHAVFTITLKQIHHDLSTDETTERTA
                     RIRLVDLAGSERAKSTEATGQRLREGSNINKSLTTLGRVIAALADPKQGRSGKRKGKD
                     VVPYRDSILTWLLKDSLGGNSKTAMIACISPSDYEETLSTLRYADQAKRIRTRARVNQ
                     DHLSAAERDKQIAEMAETIRTLQLSVSLATANRRESEIQNEKLEEYQQKVEKLQRLME
                     ETKMVSECKIKQLQTENEALRNHLKLALDSLRNPIPPVTVEKRRGSLSPVTEYNKENR
                     PGSPISDVETEPDLIWEDEDTIRIKGRELEAHDMQTDMEDLLMDINLFKRKLASDHER
                     FRATQKQGGQKRRRALGDVWTNNR"
     exon            complement(1127289..1128949)
                     /number=1
     exon            complement(1129016..1129301)
                     /number=2
     CDS             complement(join(1130176..1130643,1130810..1130854))
                     /codon_start=1
                     /locus_tag="AO090120000426"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000082"
                     /protein_id="BAE63006.1"
                     /transl_table=1
                     /translation="MTAVVITKSSTPPSMVITMSMFSKAQETVQKAVSSATGSNKPDL
                     SKWNTEEMLETTVDEHGNPVPDASYTDGDKLSRGILGRDEADAYVAATGTFHHSTKDD
                     TLKPDFSKWNTEEMLETTLDEHGNPVPNASYTDYEKLSRGRLGDDEADAYIAATKNFR
                     KPAKDFVDFD"
     exon            complement(1130176..1130643)
                     /number=1
     exon            complement(1130810..1130854)
                     /number=2
     CDS             join(1132065..1132266,1132327..1132937)
                     /codon_start=1
                     /locus_tag="AO090120000428"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000080"
                     /protein_id="BAE63007.1"
                     /transl_table=1
                     /translation="MSGNSSSGNPPDLEAHQPPAKASFSTWWTQSVDVKYTDLICLLL
                     CFTTGLCDSSAYNAWSCFLAMQTGNTIFLGLGASGQPTSKPWGWLKSLCSIAFFFIGA
                     FTLANVTRRAGARRRGTLFLSFVFQSLLVIIAVALIEGDLIPHTSDDASLTGGPLFLE
                     LIPIALLAFQSAGSITSSRALGYNEIPTVVLTSVYFDVASDPNLAAVPTTNLKRNRRI
                     GSVVMLLVGAIVGGWLSRSSGGMQSALWMAAGFKMVIAFAWLAWKKEAAPSK"
     exon            1132065..1132266
                     /number=1
     exon            1132327..1132937
                     /number=2
     CDS             join(1134596..1135076,1136954..1138287)
                     /codon_start=1
                     /locus_tag="AO090120000429"
                     /note="Arp2/3 complex-interacting protein VIP1/Asp1,
                     involved in regulation of actin cytoskeleton"
                     /old_locus_tag="AO070314000079"
                     /protein_id="BAE63008.1"
                     /transl_table=1
                     /translation="MSALYKLAAVNNGPETSWDDNHMRLLTRLNDEEIEILQLPSPKC
                     SAKRISAELCQMPMKKDQIMGPPWRLGICAMEDKALSKANQEIFRRLQVDGLIEVILF
                     GDKTLLSKRPEEWPICDFLIAFYSDGFPLEKVISYTRLRSPSCYNDLHMQSLLFDRRL
                     FVRIAGSAPIFCFIVGALLVWAFLGIRFGKSAEWAAVISDVQAILCYVFDSFLMRQLL
                     REYSEQQEAMAEMKSRRNSHERMLGKLKNKLGPEGVHRVSQISGNRPLDALDQGTRTQ
                     GWFARMIIFSAWAFGHIITVGMYWVCIFIWLGFGHYCGWTDQWQLYINSATSALMVLV
                     FAFLDCLRECYADYVNNCLDAIFRLDATLEKELRCITDDHLPNEPEVIQPPRENPLQV
                     AVFYYADIIGTLVGIMILIAVIVAWAAVGPVFHFNDNWWLLIGTYAGLIGLFDSFILR
                     NIQGKVKEYTVCQIQSLEKRDMTLFAKTQMAVPPKDNFDTSSVTHRISIAMGNVCSHL
                     LMVVAGFLLTIGCVIGSSAMRWSTTGQLISNIPPSIIETFFMLILITGQNDADASARV
                     DMTNIYHRRQRLLWFVKDAREYLAVRPESADLAEKGDN"
     exon            1134596..1135076
                     /number=1
     exon            1136954..1138287
                     /number=2
     CDS             complement(join(1143196..1143554,1143613..1144237))
                     /codon_start=1
                     /locus_tag="AO090120000430"
                     /note="protocatechuate 3,4-dioxygenase beta subunit"
                     /old_locus_tag="AO070314000078"
                     /protein_id="BAE63009.1"
                     /transl_table=1
                     /translation="MHLFSTLLTLALLATAMAHAGPHDILSRSEISRRSAMGLKCREN
                     VSQYHKRRWKRNIDRRWHGHNTTFSVHTEAPYFETIQNDTCVLTPEVTEGPYVYPPSQ
                     TLRRDMTENQPGVPLWLDIGVLDMATCEPLEDVLIDMWHCNATGSYSSFTHLSPNTPF
                     VELLNELGINGSDYKIGITDLHTDNTTFLRGMWPTDKHGMMEMKTIFPGFYVERTIHI
                     HVQVHTDWTLRENGTIVTGNVVSTGQLYFDEALAEKIMSLEPYASHTQINRTTNAEDS
                     IFPYDTAGGFNPVVDIVPMDGKDVTKGMIGYITLGVDTSAIEHGDNYVGVL"
     exon            complement(1143196..1143554)
                     /number=1
     exon            complement(1143613..1144237)
                     /number=2
     CDS             complement(1147733..1148923)
                     /codon_start=1
                     /locus_tag="AO090120000432"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000076"
                     /protein_id="BAE63010.1"
                     /transl_table=1
                     /translation="MYHYSTPPPGWSSHYMTSPPTSPHYAYYATSVANPYGSPRPSSK
                     RHSRKASYAGTPKEAAGWQYSGYGTPFYDAMPEYSTPPRKHENVSAFFGGSSSYHRRR
                     STMGYAPADPWDNASPRPSHSTRKRPIFVDVVDDGFDDAPRFASREEASQPRRFSSTT
                     PRKPKPPTDQYCYSTQVPVHDDDSPKRSRARRQSTSTRTPSKPKPTTSSKPPPKATEE
                     DAAKAGIPAGYSIKNWDPTETPIILLGSVFDANSLGKWIYDWTVFHHGASTPMADVAG
                     ELWLLLIKLAGKIKRADECLDRIKQPEHQEVVEDFLESGERLWARFKKLLKTCEQFMW
                     KAAKREGGKSVSMGRNAGCEFVETIFGRDRELESTEKLMNSVRLWNMRFDANCEDILR
                     RPLA"
     exon            complement(1147733..1148923)
                     /number=1
     tRNA            complement(1152023..1152096)
                     /locus_tag="AO090120t00009"
                     /note="tRNAscan-SE"
                     /product="tRNA-Val"
     CDS             complement(1153633..1156077)
                     /codon_start=1
                     /locus_tag="AO090120000433"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000075"
                     /protein_id="BAE63011.1"
                     /transl_table=1
                     /translation="MEPASKAQTRKATSATDQAPRKRRKRTVVTGAAEDCFTCARQGF
                     SCDRRRPYCSQCLDHGRECSGYKTKLTWGVGVASRGKLRGLSLPVSGSQPAATPSTAP
                     CPAGPQESPSISPSPYKSTPSHTTSSTTPPVPQDQQRPPLASKAHRNIIWTTNASNTQ
                     PWPTGTPLSVHHRPWSKMGTHETAVSKGIPNLDVRPPFQERPDLPTGCHHAISTTDMW
                     SSQPQVLSTIPPWPCSGNAPEAEATEVVEEQDERESTDSPPLRAETCHSPSLSQLLLA
                     RSVGRTPRLRYLISYYAEVIAPMIVAFDGPTNPFRTYFLHLAQESVSLQEAIATLSTC
                     NIRQRHERRMRPTERSLPARLSSLAHRALTDEAFRDEYGGSRPEGFTREEQYHRGMAV
                     KALNMELADPRERLSDSVLATLLVLCLFHMCDTGVAQFKTQFAGVTKLLAIRMRSSPR
                     MSEELKWFIRVFTWFDTMTATTNDRETQLRGACLDIAAVSDGEWGLENLAGCDPSLFK
                     FIAQLGRLNLLSQDHNIKAPGLADVFVPSSAPPPSMTYHYSPSSLMSDIPAVSNTYSL
                     PLPCLPQSSDPTRRPSSPTFWAEWHSLRQKLESWRLPRQDSQHIGAVPASTTNAYISP
                     PSSPSSHAVVTHQNLEDVLHISESFRHSAILYTERLAYPDLPSTHLRIQSLVHRAMHH
                     ISLVKSDVYLLWPLFITGAECVLERHRTFIRERCKDLSKDSGFLNNLSCLELLEKIWA
                     EIPAAADVGDNTDRASRGTYSGPSGDDVSTFGDNSPPYSEMSAFPIQALAARPHGFRW
                     HRVMQAKRAEGEYMVV"
     exon            complement(1153633..1156077)
                     /number=1
     CDS             1157961..1159436
                     /codon_start=1
                     /locus_tag="AO090120000434"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000074"
                     /protein_id="BAE63012.1"
                     /transl_table=1
                     /translation="MSIFRPGRLRTVLSATAALILICTFYLYWTPPPASTIPSTAFEV
                     PLTERQVAFWKVLRSILDAHAPNCPSPTLATSVSATHFNATTVDPRPDLIVFGENELD
                     VLTEAHANYLDDIKTAKKLRPVHSPGTRGIVTTAGGSYLPVFLSSLRMLRRTGSTLPV
                     EVYMKDASEYEKKICDNVLPDMGARCLILSDVVGKNVIQHYQLKVFAVLFSSFEEVVW
                     MDADCFPMDKPEILLNHEPFMSTGLVTWPDFWASSVSPAYYNISQQPMPPMTERQSSE
                     TGIFLVSKKTHYLTLLLAAYYNYYGPSHYFRLLSQGAPGEGDKETFLQAATAVGEPFY
                     AVSERVQALGHQKPDGLSGSAMAQSDPIGDHALTSQGKWRVQDPSVDKPPRVFFIHAN
                     YPKFNPAENVFGYHWETTPTLRPDGTEGRAWTAPEDVLRRFGIDIERAYWEEIKWVSC
                     NPDIEFRTWEGKPGVCEKVESYWNTVFAEPHEDDPKFVDEG"
     exon            1157961..1159436
                     /number=1
     CDS             complement(join(1159829..1159930,1159993..1160114,
                     1160182..1160317))
                     /codon_start=1
                     /locus_tag="AO090120000435"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000073"
                     /protein_id="BAE63013.1"
                     /transl_table=1
                     /translation="MSGQSSVGTNSLYEAGDQRNQPQSVLNEQDRYNEGQKNSHKNLD
                     SKDNRSIANKLAAREKQPDPSHHHNNDVDPEAEVSKKDSTKPAKLHGNEPSKGAKIDQ
                     ELQEEDEQRLREKGIKK"
     exon            complement(1159829..1159930)
                     /number=1
     exon            complement(1159993..1160114)
                     /number=2
     exon            complement(1160182..1160317)
                     /number=3
     CDS             1161058..1161807
                     /codon_start=1
                     /locus_tag="AO090120000436"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000072"
                     /protein_id="BAE63014.1"
                     /transl_table=1
                     /translation="MSSTSTPLTTPPTPQPDPRYAQLFHDLSTRFAQTSLPPEKWYIL
                     AISTIVASPDPERCDQLYLHLINQAPYSTPSARQELIRRLREALFKSIIIVGVCKPIE
                     AILAISKYEREEDKDYTFTRENWQCDQANHDRGVAWLEKLYARNTTGTLDLFRAHQDF
                     GWLSKEITYGLFLSDRGVLDDLDTQMVVLPAIMSQNLKNETHWHIRGTRRLGVCMEDV
                     KVVWECIQRVAGFYGTVLDKVPTVEEVESDV"
     exon            1161058..1161807
                     /number=1
     CDS             join(1162184..1162267,1162330..1162563,1162622..1163176)
                     /codon_start=1
                     /locus_tag="AO090120000437"
                     /note="isoamyl acetate-hydrolyzing esterase and related
                     enzymes"
                     /old_locus_tag="AO070314000071"
                     /protein_id="BAE63015.1"
                     /transl_table=1
                     /translation="MGKRKEIKDNDVEMGGTDPRVDGDESDEDMDIVNVDFEWFDPQP
                     IDFHGLKILLRQLFDSDAQIFDMSALSDMILAQPLLGSTVKVDGNESDPYAFLTVLNL
                     QEHKDKPVIKDLISYLQRKASSNPDLAPLSQLLSQTPVPPIGLILTERLINMPAEVVP
                     PMYTMLMEEIAWAIQDKEPYKFSHYLIVSKNYEEVQSKLDMEDSRPQKKKKKSGDKVE
                     KFYFHPEDEILEKHTRCFGSIEYTHKHDEGHSDSKRAFQELGIRTNGSLMLFDADKLE
                     GAINEMKEFLQPPV"
     exon            1162184..1162267
                     /number=1
     exon            1162330..1162563
                     /number=2
     exon            1162622..1163176
                     /number=3
     CDS             complement(join(1163364..1163441,1163502..1164153,
                     1164297..1164367))
                     /codon_start=1
                     /locus_tag="AO090120000438"
                     /note="chorismate mutase"
                     /old_locus_tag="AO070314000070"
                     /protein_id="BAE63016.1"
                     /transl_table=1
                     /translation="MDTAIDLSDASKALDLANIRFQLIRLEDTITFHLIERVQFPLNK
                     PIYVPGGVKIPGDDIPLMDYLLREQERIQSRVRRYQSPDEYPFFPDVLEEPILAPLEY
                     PKILHDNDVNVNDTIKRRYVEDILPAVCPQFGREDRGETQENYGSAATADVSCLQALS
                     RRIHFGKFVAESKFQKEPERFVKMIKANDRVGIDDAITDAKVERKVLERLALKAKTYG
                     TDPAFPTETGSKINVEAVVAMYKEYVIPLTKVVEVEYLMQRLKGTQWE"
     exon            complement(1163364..1163441)
                     /number=1
     exon            complement(1163502..1164153)
                     /number=2
     exon            complement(1164297..1164367)
                     /number=3
     CDS             join(1165383..1165397,1165489..1166125,1166178..1166369,
                     1166419..1167221,1167277..1167552)
                     /codon_start=1
                     /locus_tag="AO090120000439"
                     /note="WD40 repeat"
                     /old_locus_tag="AO070314000069"
                     /protein_id="BAE63017.1"
                     /transl_table=1
                     /translation="MSHLPSPNDPLIDPSGTQTRHIEAFGRKVTSTAGHLIGPTGDGN
                     PAHYHNAMADIQRELRRPNTQRRVFALTQTTPTDLVRSKLSTSEIQSRALSSLPDDLL
                     ANIPDDSSSYSLFEGFQASQDDIEYRKAHRRRASKSKKLLKDGENRAALPSAPAELKK
                     ERDLLSRRMELMGVRKNMCSSEIHDIDNKIANLHNMRKIVLDRLAGLEMEEAELEHEL
                     TELENKLEDIQEETPETAVVGTPKSSANDESMASEDPAMDASFMSESIYQKIPSPKSL
                     KHKSKRKRSMPILHEHFSPGSLIKEMEAHTDMVTAIDFDYPFGTMITAALDDTVRVWD
                     LNVGRCTGFLEGHNASVRCLQIEDNIVATGSMDASVKLWDLSRARSRPRSSRINKHED
                     EEDAADDASQVSHSTTLEDCHVFSLDSHVGEVTALHFRGDNLISGSADKTLRQWDLVK
                     GRCVQTLDVLWAAAQADTLNGDSTWRPSGRVPDASADFVGALQCFDAALACGTADGMV
                     RLWDLRSGQVHRSLVGHTGPVTCLQFDDVHLVTGSMDRSIRIWDLRMGSIYDAFAYDK
                     PVTSMKFDAKRIVAAAGESVVKVYDKADGNHWDCGAGVGADEQGPLPATVDRVCLKDG
                     FLVEGRQDGIVGAWTC"
     exon            1165383..1165397
                     /number=1
     exon            1165489..1166125
                     /number=2
     exon            1166178..1166369
                     /number=3
     exon            1166419..1167221
                     /number=4
     exon            1167277..1167552
                     /number=5
     CDS             1168735..1170933
                     /codon_start=1
                     /locus_tag="AO090120000440"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000068"
                     /protein_id="BAE63018.1"
                     /transl_table=1
                     /translation="MPPKRASTRRAGAVTRTSERGTPSYIPNMSSPDARNPALPDIPT
                     KQSFAYGSSTTPILPRELSAKPRMNLAEMATNIDEGRRVAQDRDFDRPHMNTRSRRQS
                     ISASLSPVRRSRREPTPDQLQLLDSLREATMSPNPNGQDHAEQSTPTPTPPIPHTLST
                     ASSPATESLTNPKYPVLTTDQLYPSPLLRYGSPARNAISLSSPNFATSIDNESVVSWN
                     VERDIHEDDLQRTRPNGYLDGPHGKNITAPPRRFSGFAFAQEPIEELDEPTTQLSITK
                     SRSPEAVAADIQPKPEPLSEPEMVPSPESTPSPEPEPEPEREPEPEPEREPERQPTPP
                     RAPALAPRTASKPELSSAPTRTIIPSNPIREASFDESTHESTSPLRERVKSNVRSVGN
                     AAVGLQKGLPIKPVSLVVLAVVSILTACFFGDQISSISSSIGSRLPLYGSPFRDLNAT
                     ALQAVHGLSNQVVRLGEEVSSLSKEVDVIKSEVEHIPAPSTIVQPIPAQETPKTNFLS
                     IGMGVLVDPYNTSPTSGRSAGFLQKLHSRFLPSSSQQQPEPPLAALTPWQDVGECWCS
                     KPRSGMSQLALHLGREIVPEEVVIEHIPKGASIRPEVAPRDMELWAQFQIVDESNPDS
                     PPSPNPSRTSGILSEELSLHNHIIDTLRLAYKDEPEGAYSNDELLGPSFYRVGQWTYD
                     LHASNHIQKFELDAIIDVPAIRVNKVAFRVKSNWGGNDTCLYRLKLYGHI"
     exon            1168735..1170933
                     /number=1
     CDS             1176552..1177295
                     /codon_start=1
                     /locus_tag="AO090120000442"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000066"
                     /protein_id="BAE63019.1"
                     /transl_table=1
                     /translation="MSAFKKNTELKEHLEGHIQLKRWPSECVDPSCSHTAADEVDYRR
                     HLRDVHHYQRNICVRPETTCKKRSSSALDESSTSDRKQPMEVKRPCKRQKAGSKPSHG
                     IKGLTFINWGPPTARLRAMSPAQVRKKDQDNQCPSINLHAVSQDGHSARSASLDLPGL
                     IDDTSTCSSYSAVPPAMSAIPIDPQILQSPPGLCANQCKDMGSTVPVILGSMETVTAP
                     MNQQRATFPIRRPWQTLRRWRLTAKRLLT"
     exon            1176552..1177295
                     /number=1
     CDS             complement(join(1180825..1180973,1181475..1181769))
                     /codon_start=1
                     /locus_tag="AO090120000443"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000065"
                     /protein_id="BAE63020.1"
                     /transl_table=1
                     /translation="MDSLETLRSDLEWSLPQLLNDKDPAGLGTEGLGQSPSQLDVHRR
                     LAASNDQPAGRQGEIETWLSDKQSPLDDLHSELSLGYLVTESYGNDLILLKKTLGKYY
                     RRATDALVSTLTDTVQQMLFIFVIGAATHTIHDTGHTSLLFICTL"
     exon            complement(1180825..1180973)
                     /number=1
     exon            complement(1181475..1181769)
                     /number=2
     CDS             complement(join(1183051..1183222,1183290..1183456,
                     1183517..1183627,1183686..1184557,1184651..1184864))
                     /codon_start=1
                     /locus_tag="AO090120000444"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000064"
                     /protein_id="BAE63021.1"
                     /transl_table=1
                     /translation="MVMDQAWTWMALVAIAGLFWITRIFYRLYFHPLAKIPGPKLAAA
                     SHLLEFYYDVILGGKFLFQVEKMHQKYGPIVRINPKEVHIIDPTFYNEIYASGMRKRD
                     KYEGFVRSLAADESTVSTVGSEKHRFRRSILQNFFSKRSVMEFSSAIGERVEKLMRRL
                     EVFEKTQTPVALDVVFSALTSDMITYICYGKDWKFLDHKDFNCDIHQAGVDFANFFHF
                     NRFFPWVFMTLRALSPRMLALLIPGRAATFKFQESLLKHAIEMAANEQSDAPSKETEK
                     SRPNVISNLINPSIPYMERSRRRLEDEVITILVAGTEAPVKVLSMAMYYLGSEPAIGE
                     KLRAELKTILPARTSTATYAELEKLPYLHGVVYESLRISDSVIARFPRIAPTETLRYK
                     DHILPPGTPMSCSSYFISRNHDLFPNPEKFDPERWIHAAEKGENLKQHLTAFTKGSRI
                     CLGINLTIAELFLTIAHMCRRYHILLHNTEPEDVCTTSDLLAGYTRRGVLKVHAKLKA
                     VRE"
     exon            complement(1183051..1183222)
                     /number=1
     exon            complement(1183290..1183456)
                     /number=2
     exon            complement(1183517..1183627)
                     /number=3
     exon            complement(1183686..1184557)
                     /number=4
     exon            complement(1184651..1184864)
                     /number=5
     CDS             complement(join(1186141..1187042,1187144..1187372))
                     /codon_start=1
                     /locus_tag="AO090120000445"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000063"
                     /protein_id="BAE63022.1"
                     /transl_table=1
                     /translation="MSSLILPEFKGSTVDVSIIHAGQITVPAVYILQSPIPGHDLLDI
                     PCYSFLIENKRRKKVLFDLGPRKDWREKLPPTSQIESARAVVKIEQDVADQLSKAKIP
                     LESINTIIWSHHHMDHTGDPSLFPPSTELVVGPGFKLDKTTSLGYPMNADALVNDDAF
                     LGRNLVELDFSGAVNIGGFLAIDFFKDGSLYLLRSNGHSEYLYTVMTGITNTFKIANN
                     HISALARTSENHFILLGGDVAHHPGEYRPTEHLPLPIEIRPSPLDKVTCSASACPSYI
                     FENISPTTAKAKGKKTKVTPFYELNAALNEDLESAEASLDKMTVFDGSANVLIIIAHD
                     ASLLDILPFFPKKITDWNVEGYKEAGAWRFLKDFSGAISRSM"
     exon            complement(1186141..1187042)
                     /number=1
     exon            complement(1187144..1187372)
                     /number=2
     CDS             join(1189436..1189762,1189897..1190388)
                     /codon_start=1
                     /locus_tag="AO090120000447"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000061"
                     /protein_id="BAE63023.1"
                     /transl_table=1
                     /translation="MSYQNMTMLYWGTGTVIVISLALLVRLRDKRHPSTSCQADDNVV
                     IITGGCSGLGREMANIYRKNGAKVAVLDIHLGDSHSILGETVRYYKCDVANEEQVEQV
                     VNRIEVETFSKTINTNLMGPVHTIRTILPQMIASKRNASIVNVSSVVAHVYPGGLSDY
                     TASKAALSALHHCLDAEARYYGYDERIKFFLVEVGQMETPLFKWVKTPYELLTPVLSP
                     KYVAEKVITAVESGCGRLIRLPRYASWACVYDALPTVMQQYARQLGGLDRAMAT"
     exon            1189436..1189762
                     /number=1
     exon            1189897..1190388
                     /number=2
     CDS             complement(1192063..1193673)
                     /codon_start=1
                     /locus_tag="AO090120000448"
                     /note="cytochrome P450 CYP2 subfamily"
                     /old_locus_tag="AO070314000060"
                     /protein_id="BAE63024.1"
                     /transl_table=1
                     /translation="MVSYEWCLDSFNPFGITRNSLCFFFLVALCLCWSSSAWSSKQQR
                     LPPGPPALPVIGNLHQMPRRNRWRALQRWHKLYGPIISLRLGQRIAISLGTHKVAREL
                     LELRGNNYSSRPRFVVAGDYVSEGLHSILLPYGNQWRIHHRIQRELLTNHRTQAYRYL
                     QDIESKQIVYDMLKSSDFVGHFRRYTSSVMFTLAYGKRLESPGRHEIAEASKITENIS
                     LAADQAKNMIVEVYPVLDYIPRCFAPWKRIGTRLHAQTVQFFEQQMLEGLRSPAWNWS
                     KHIIALNETKDLSNKEIVYILGALYEAGSETTATVLQIFVLASVLHPECIGHAQLELD
                     ESVGNDRMPTFEDMPRLPYLNAFIKEVLRWRPIAPLGIPHAPSKIGEFMGYSIPEGAT
                     IFPNNWTLDLDDAVFRDPYAFKPERWLEDPNLPLSTFGFGRRACPGKQMAENSLYIAI
                     ARLIWGYNFHHAYENGLRVELDPWDMKEGVVSPPATFSAVLSVRSSVHQRLIELEWDS
                     AEKDVNGILGQIESLMGSRAAAQKDSSA"
     exon            complement(1192063..1193673)
                     /number=1
     CDS             complement(join(1195543..1195696,1195759..1195925,
                     1195982..1197094,1197154..1197216))
                     /codon_start=1
                     /locus_tag="AO090120000449"
                     /note="cytochrome P450 CYP11/CYP12/CYP24/CYP27
                     subfamilies"
                     /old_locus_tag="AO070314000059"
                     /protein_id="BAE63025.1"
                     /transl_table=1
                     /translation="MFVLPTTFMSVSHGIYQLLFLALLATAWRIYSNRFRHPLSHYPG
                     PFFWTISRLPYAVTYAQGTLHRRVRQLHDVYGDVVRVAPDELSYRTEQAWKDIHGYSR
                     NFPKDMRFYQTSKNKAPSVVIAPDGVHGRQKRSILRAFSERAMKSHEHLLRPFVDSLI
                     QKLQHASTSTEGGAVDLTEWYNYIMFDFMAHELFGQSLGCLENGVNHPWVDMLFGSIK
                     VWAFLSQSKYFPNLSWIIKTAVRLFCRDLLNHRSKKLGCIASKIPEGEGSDSSLPTFN
                     SFLRANKGPHSTLSTEEVLSNHSFMMMAGSETTATLLSGCTFFLLKHPQVYKKLTSEI
                     RNRFSSSTEMTFSSLANMAYLRAVLQEALRMYPPLPLGMPRVVPPGGAIISGQFVPEK
                     TSVAVASWATYQSSSNFNTPQMFLPERWLDTGPGDNDVKGAMQPFSVGPRACPGKNLA
                     FGEASLILARLIWEFDLELSPQCSSWAYQRAYIIWDKGPLLIKLTPRI"
     exon            complement(1195543..1195696)
                     /number=1
     exon            complement(1195759..1195925)
                     /number=2
     exon            complement(1195982..1197094)
                     /number=3
     exon            complement(1197154..1197216)
                     /number=4
     CDS             1197924..1198682
                     /codon_start=1
                     /locus_tag="AO090120000450"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000058"
                     /protein_id="BAE63026.1"
                     /transl_table=1
                     /translation="MVSINAANPRVTTILVDLGGVFMHPQLESKLATRESAISLRRIM
                     STAVWMDYEAGQLSDRECFDQLAKEYHFQASDLAQIIKSFRDTICYDQATASIFKEIK
                     QSGTRIFLVSNISKEDYAALRHRWDDEFWSIFDRVFTSSDLGVRKPSLRFYRQVLRAT
                     RALPHETFFLDDRPENVLAALSVGMRGTFNMSELYRTLNNLVGDPVQRGLGFLRRQRG
                     HFPTTTQHGEPIAENYAPLLILEALKDQYASFLS"
     exon            1197924..1198682
                     /number=1
     CDS             join(1200920..1201861,1202970..1203038)
                     /codon_start=1
                     /locus_tag="AO090120000451"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000057"
                     /protein_id="BAE63027.1"
                     /transl_table=1
                     /translation="MNTNQGGAEIRGNRTKYAQFAHLTSHLLEMIRKGIHGPLSQETH
                     TVIDEDHITGKYVYINTPVWGKSKVFYEFSGEGPQEIMFLHTAGSDSRQYHAVMNDPT
                     MRRKCKMIAFDLPAHGRSFPGENHIPGNYTNTEDAYVGAVREMVKVLKLNKPIICGAS
                     MAGQVCIAVAIRAEEVGAGGTIPLQACDYLAMERHFDDKSPFINQSLFNPNWIYGVMA
                     PSAPLANKKLIWHLYSGQAYGIFHGDLDFYLGGFDARSRLSQIDVKKCPVYFLTGEFD
                     WGTTPDMSHATAVKIKGAEFKRMHGLGHFPATENPSIFEIGLGSYLTSLAVTWHIAPA
                     TS"
     exon            1200920..1201861
                     /number=1
     exon            1202970..1203038
                     /number=2
     CDS             complement(join(1208726..1208845,1208857..1208877,
                     1209068..1209151,1209214..1209483))
                     /codon_start=1
                     /locus_tag="AO090120000454"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000054"
                     /protein_id="BAE63028.1"
                     /transl_table=1
                     /translation="MRVSLTTIFSSLLCTVLVSSQDLDTFDKKCVENYGVPSADPVPG
                     SFSNDDCTDVDGTRGAIQTAVDKLGDMNIYAVTKQVVNGINYVIFVTRNERTYRVPVY
                     QDLTGTYSLQEEEICYLPFDDSTSGAISSTLRPPTNLSYGQETFGLPLQGCVTKEALF
                     WLPW"
     exon            complement(1208726..1208845)
                     /number=1
     exon            complement(1208857..1208877)
                     /number=2
     exon            complement(1209068..1209151)
                     /number=3
     exon            complement(1209214..1209483)
                     /number=4
     CDS             complement(join(1210094..1210184,1210274..1210424,
                     1210544..1210636,1210732..1210949,1211007..1211228,
                     1211293..1211376,1211432..1211522,1211581..1211677,
                     1211732..1211863))
                     /codon_start=1
                     /locus_tag="AO090120000455"
                     /note="arginase family protein"
                     /old_locus_tag="AO070314000053"
                     /protein_id="BAE63029.1"
                     /transl_table=1
                     /translation="MLVTTVSLLALSAVASAHGKHQTPMSGPHQKLWYNTLPGDGGTQ
                     ADSVFSGISTFARLPYFPCLSSEDEKYDIAFIGAPFDTGTSYRPGARFGPSGIRQGSR
                     RLNLYGGYNVPLEANPFVSDLKVIDCGDIPVTSYDNAWAIQQIEEGHNSILMRKPFTD
                     ANEYGLSRAGKTLPRVITLGGDHTITLPLLRSINKAYGPVSVIHFDSHLDSWKPKVFG
                     GSPSQVASVNHGTYFYHAAMEGLLKNDTNIHAGIRTTLSGPSDYENDGYCGFEIVEAR
                     EIDTIGTDGIIKRIRDRVGTENPVYLSIDIDTLDPAYAPATGTPETGGWSTRELRTII
                     RGLDGLNLIGADIVEVAPAYDTNAELSTMAAADVLYEILTMMVKKGPLTVDSDGSVDL
                     "
     exon            complement(1210094..1210184)
                     /number=1
     exon            complement(1210274..1210424)
                     /number=2
     exon            complement(1210544..1210636)
                     /number=3
     exon            complement(1210732..1210949)
                     /number=4
     exon            complement(1211007..1211228)
                     /number=5
     exon            complement(1211293..1211376)
                     /number=6
     exon            complement(1211432..1211522)
                     /number=7
     exon            complement(1211581..1211677)
                     /number=8
     exon            complement(1211732..1211863)
                     /number=9
     CDS             complement(join(1212663..1213564,1213624..1214239))
                     /codon_start=1
                     /locus_tag="AO090120000456"
                     /note="uncharacterized membrane protein, predicted efflux
                     pump"
                     /old_locus_tag="AO070314000052"
                     /protein_id="BAE63030.1"
                     /transl_table=1
                     /translation="MYRQRSPRYGDTPNIEEEPTEYTSLLPKPTDLDSSEDPGCYESH
                     DSDDEGWRQYLTELWILFKGSIPVILAYTLQNSLQTVSVLIVGRSSPENLATTAFSLM
                     FAMITAWMIALGGTTALDTLASSTFTGSSNKHDLGILLQRGFFVLSLFYIPVAILWAC
                     SEPVFLLLGQDPQLSRDSARFLTCLIPGGLGYIYFEVMKKYLQAQGIMRPGTYVLMIT
                     SPFNALLNYLFCYTFGMGLLGAPFATGISYWLSFILLVLYARFIAGSECWGGWSREAF
                     QNLGTFARLAFLGVIHVGTEWWAFEIVALAAGRLGTIALAAQSVIMTADQVLNTIPFG
                     VGVATSARVGNLLGSRNAPGAAKAANTAAWLSILLGGVVLAVLMGTRHDFAKIFNSDE
                     RVVRLTADVLPYVALFQIADGLNGSCGGSLRGMGRQHVGAMVNLVSYYCGALPLGIWL
                     AFHGWGLKGLWVGQCIALYLVGALEWMIVALSNWNKEVDKAFSRMDVHERLEDGL"
     exon            complement(1212663..1213564)
                     /number=1
     exon            complement(1213624..1214239)
                     /number=2
     CDS             join(1217220..1217427,1217501..1217575,1217630..1217978,
                     1218121..1218142)
                     /codon_start=1
                     /locus_tag="AO090120000457"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000051"
                     /protein_id="BAE63031.1"
                     /transl_table=1
                     /translation="MVPAAYATYSPLIQGLLFLGLFIGTLVSEVCCSGRLSDYIVKRL
                     ARKNEGVRVPEMRLWLAYPAILITAIGLIVWGISIDKNYHWMIGQIAFFLFSSGIQIG
                     NTVTSSYIIDSYPLQSTSVVIFYAVFLNLSAFINPVHTPVSHTYLPINHDANKIQFFI
                     ANWQASSGWTWTFTAQALVVLVAGTGVFAVLQRYGAFLRSRAKVPGWVNPEYLIKSL"
     exon            1217220..1217427
                     /number=1
     exon            1217501..1217575
                     /number=2
     exon            1217630..1217978
                     /number=3
     exon            1218121..1218142
                     /number=4
     CDS             complement(join(1219868..1219888,1219951..1221120))
                     /codon_start=1
                     /locus_tag="AO090120000459"
                     /note="ankyrin repeat"
                     /old_locus_tag="AO070314000049"
                     /protein_id="BAE63032.1"
                     /transl_table=1
                     /translation="MALLELPNELLLQIIENLESEKDILSILLTSPRIYAIQQAGPLY
                     KHNIQFSASSALGWYSARGRKSAVEALLEKGADLESRCDVGGTPIVYAAKYGHESAVR
                     LLPEKGSIVNRPTLSWPRWTPLSWAVHNEHKDVVRLLLEKGSDPKFKGTEYDEIQLLG
                     AAQFGDAKFVNLLLERGTDLECNHYLGRTPLSIAACHGQEAIVRMLLEKGADIESKDF
                     FGRTPLIYAAGKGHESVARLLLENGADIESKNEDGCAPLISAVNVGQEGMIRLLLEEG
                     ADIESQTHDGWTPLTVAASHGYENIAKLLLEKGSNIEAKDDDGWTPLICAAEKGHEGV
                     VKLLLEQGSNIESEDHDGWTPLRCAVEKGRKGVVKLLLDKGADLERAGLTTEQVADVD
                     SPDD"
     exon            complement(1219868..1219888)
                     /number=1
     exon            complement(1219951..1221120)
                     /number=2
     CDS             join(1227717..1227873,1227989..1228312,1228368..1228543,
                     1228594..1232592,1232644..1233204)
                     /codon_start=1
                     /locus_tag="AO090120000460"
                     /note="kinesin-like protein"
                     /old_locus_tag="AO070314000048"
                     /protein_id="BAE63033.1"
                     /transl_table=1
                     /translation="MTASPPGSPSGAPQRLSGIMRTPRSNSRLSMSSKQGGGSRASDE
                     DGKTAVKVAVRVRPPLQPDDPNYELIPQRFQRSMVHVTTPTSLAVDVPQGRKLFVFDR
                     VFPETVDQAGIWEYLNDSVTSFLQGYNVSILAYGQSGAGKSYTMGTSGPSEQTSSQGM
                     GIIPRAAQYLFEKLEGPPKHNRNSSTGLRTPARYSISSTSSFSKVNTEKTWQMKATYV
                     EIYNEHLRDLLIPESTPASERSTVTIREDTKGRIIPTGLHQVNINSIDDLLGALNFGS
                     TIRQTDSTAVNAKSSRSHAVFSLNLVQRKSANGITSTKDKRMSMPADMSSGSDVSVTV
                     ESKFHFVDLAGSERLKNTGASGERAKEGISINAGLAALGKVISQLSSRQAGSHVSYRD
                     SKLTRLLQDSLGGNAYTYMIACVTPAEFHLSETLNTVQYAQRARAIQSKPRIQQVHDE
                     GDKHAVIERLKAEVAFLRQQLRNAEDNERRSVGPQDRSERQNEREADLQNQLLDVQES
                     YNALSQRHAKLISELARDSETEEGTDPNDAASYIGKNSIERLKRSHSFAESVEQVVLE
                     YEKTIQSLESSLSNTRSSLSATESTLLERETRCTYVETVNTQLQARIQKLLERESGTE
                     NYLHELESRLDGQSSGEERQAAIISELRKELTRARESEANCEDYITTLEERLAEADQD
                     MELMQREVDRLEHVIERQRSLGKLDNLLYDLDHSQQNGSATRDHDEPEMETPVKRAYH
                     PQRRAASLDVLTEAVETAIPESDEDLGEPAPEVEGDTLISEPPAEASEDLKALENSTD
                     RLQIDRTPSPTQSRVVADKLDTVTQELIDLRMQHESTVSEYEILEAKYEQAMKELADL
                     RQDAADEARHSSPDARHLISPAPTSRPVSFLEDAKAPDSMTGTQQSSSRSLSSELSLV
                     GEPAASHDSSNAKSAPETENYVDAVSESDEAKAQEVEHMRRLLSEHQEGVSIMTQKYA
                     ELQAEHAETLHLIESLKSELQKPRVSPPTTPGYKPVIRRKSSQTLIGNVDRAHRSLAA
                     LRNIAVEEFDSRPGTMQNFEVHLDSAMHELHNRMERIQALEAENQSVKKEMETKSTII
                     SGLTRERSSLQGGGSSVDMGLVSQLRDQVVQQENIINEMKEAHEAREKHLLAEIEELK
                     ALLKTQEEAAKAYDAGAEEQDKKIGLLEGELTQWKTKHQSAVESLQSSEQQLSTTLAE
                     LNSALATLDSMHAERAAAGETSSAEKEAAAKALENERSQQQELVEGLKRDIEQHKSTA
                     AAHVDTIASLEKSHSAAQQQLSELIASKDVSGNEIEARQTRVSELEQEIETHKSHADS
                     YKKDLDSLQESHKAELVELEARAKAAAQAEYELQLAEKDTEHDNALKALRTEITESRD
                     ELVKLLKMVSNLLNSDVTADNLADQIQEILTQKQHFSDKYAELMDTNEDLRKQIELKS
                     NDTDRVDELTKSNTEKEAKVNELAVLVATLEDTLNQRNEQIKKKEALVEEISAEKEKS
                     VRLVEELEEQITNSFDQHHNRLSIIQQERDQALEDAKAKIVTYESDIETYKVRIEQLE
                     LQIKNSSGQDSTSHDRSSSITSNLRKSSSATSLPSPPPAIPLPPLPTIASATNGASGS
                     ISPPSSRHASKELANTQVVEDQEARIRTIEKHLYAEKQLTATLEEALGDLEAQSNKVK
                     SDCEAWKKKAMQLDEELITLRKERNSQRLSLQAVEEERNARREAEAARAQLEERMNAL
                     NKKKKKSTLNCF"
     exon            1227717..1227873
                     /number=1
     exon            1227989..1228312
                     /number=2
     exon            1228368..1228543
                     /number=3
     exon            1228594..1232592
                     /number=4
     exon            1232644..1233204
                     /number=5
     CDS             join(1233940..1234774,1234855..1235462)
                     /codon_start=1
                     /locus_tag="AO090120000461"
                     /note="glycosyltransferase"
                     /old_locus_tag="AO070314000047"
                     /protein_id="BAE63034.1"
                     /transl_table=1
                     /translation="MPGLKRSNVIIIHPDLGIGGAERLIIDVALALQNRGHKVTIYTS
                     HRDKSHCFEEARDGTLDVKVRGNTIFPAHVFRRFHVLMAILRQLHLTISVLGETSRTS
                     DTNEKSKESEVLEDDIFIVDQVPACVPFLKTFARQRQRILFYCHFPDQLLAFRGEAGS
                     LLSFVKTLYRYPFDWFEGWAMSASDKVVANSRFTRGVVKEVFGGEKLGDVSVVYPCVD
                     TEAAALRDPVVVKDGETLWGGKKILLSINRFERKKDMALAIRAYHGLGAEKRRGTRLV
                     IAGGYDNRVQENVQYHRELDELATSLGLQTATSKTVISALSVPDSIDVLFLLSVPSAF
                     RDMLLEHAKLLLYTPINEHFGIVPVEAMRAGIPVLASNTGGPLETIVEGETGWLRNAK
                     KDADWTAVMDKVLYGMDQKEFDRMSIAAKERVEREFSLTAMGDRLEAEISDMLARERR
                     PFAGLQQILVLLALSGVMLSLLAAFALKMI"
     exon            1233940..1234774
                     /number=1
     exon            1234855..1235462
                     /number=2
     CDS             join(1236282..1237607,1237696..1237806)
                     /codon_start=1
                     /locus_tag="AO090120000462"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000046"
                     /protein_id="BAE63035.1"
                     /transl_table=1
                     /translation="MRDQIEGFSDDIAMSDLNELLGVDATTNKRPGLSSRTASLLASL
                     DRSKSGSSGGVSSGRRGRVDVEEEVDEVEEVVPSRKTKAPRRTATKATSADKEAKARE
                     REAMKAQREREKQLEKERKQKAKEEKAREKQLAADLAEVNKLKVDKKESTPEMIIDLA
                     REFEGLSVGNQTVEFMKRLKVEQTFFDSEIPNVVKWRRKVMAKYNDTLGHWEPCALHI
                     REEEHVLVLVTAQEFVDMVIDTSSNTNDLDHHVHRLKSAYANCKPIYLIEGLTAWMRK
                     KNNSRNRAYQAEVRRQYSQSQTQDQPTTTTSRRKKTTTVNKPETAPPVSDDTIEDALL
                     SLQVTHSCLIHHTNAPPESAEWIKNFTEHLSTVPYRRERMEGNDSAFCMDGGQVKPGE
                     NKSDTFIKMLQEVNRVTASMAYGIATQYPSAVDLVRGMRRHGPAMLEDVKKSANRNGA
                     LTDSRIGPAASKRLYKVFMGLDPSATDI"
     exon            1236282..1237607
                     /number=1
     exon            1237696..1237806
                     /number=2
     CDS             complement(join(1238207..1238866,1238920..1239841,
                     1239907..1240175))
                     /codon_start=1
                     /locus_tag="AO090120000463"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000045"
                     /protein_id="BAE63036.1"
                     /transl_table=1
                     /translation="MPPSNGRDSSIDKRDFDTNRPLLAIYDSGGDTECRDLHSRPESR
                     ISARRYSDGEDGLLNDVVEEIVERDRRRLAKEVVRICSFALGIVTCLGAGSITAFSLY
                     GPLFLTRLHYTQLRVNAVSIAAGVSMYLPVSIFGYLCDRYTPSPLALFSGTVFGIGYL
                     LAAIVYKNGPPPDAGGNGYPFWVMVVAFVCVGTATSCMYLAAVTTCAKNFGRGKHKGI
                     MLAIPIAAFGLSGMWQSQVGTYLLYERLEDGSHGDVDVFRYFIFLAALLFSIGVIGTF
                     GLRIVDEDEEKYIDEAVEELERSGLLEESEFFRSRSEVRAAYGTFSQSDNADDEERTL
                     SLTQTEEEREAARLEKEREEEERRKKNWLLNWETKVFLKDHTMWWLALGFFLVTGPGE
                     AYINNLGTVVGALGPESSSSNAPSPAGKPSTHVTTIALTSTIARLLTGSLSDFFAPPA
                     THLFPTNSEAVRPSSPSGSKRVTLSRLTFLLPSAVLLSLGYLLLASPFPVQHPELSHI
                     TTGLIGFGYGSAFSLCPIIISVVWGVENFGTNWGIVAMFPAAGAALWGLIYSRFYQDA
                     TDGGNGSTDGQCHGWKCFGYWALGCALSVWVAIAVWSVAWRSWKRRGVSV"
     exon            complement(1238207..1238866)
                     /number=1
     exon            complement(1238920..1239841)
                     /number=2
     exon            complement(1239907..1240175)
                     /number=3
     CDS             complement(join(1241393..1243352,1243441..1243984,
                     1244618..1245098))
                     /codon_start=1
                     /locus_tag="AO090120000464"
                     /note="inositol polyphosphate multikinase, component of
                     the ARGR transcription regulatory complex"
                     /old_locus_tag="AO070314000044"
                     /protein_id="BAE63037.1"
                     /transl_table=1
                     /translation="MEVDVHRNPSFPPSLLPSSIPARRSPLFSVGPDVDLDRQHETGQ
                     RSPQISGWENLQPLRKTTTDGTGIESPEESPVNRSLISSSLNDASVLQHHSVVPLDHL
                     PAETQQETTSFPKLEQPSPHAAPELGIGRSSSRGRRGRVDHSIEANLTNAEPTSHVRS
                     QPFDPSPTKSSHVLVPKRHSVSDEQEINHVDISLRSKNDSRILHGDLQDRQAPQLEEL
                     IEKPPSATTDRGSEYSTCESEFGSADESGMSTRDEESSLTDEAEMTPTATPTQRQRLP
                     RRGRKHSADAPLGAVELKPYRHQVGGHTTVFRFSRRAVCKQLNNRENEFYERIERRHP
                     EMLMFLPRYIGVLNVTFSKNPKRSKLTSEGNTEISNGEHATGETNGAQQTNSLTTDGS
                     RPSETVDQPRIFSQKQVTGIIPKVILENNRHIIPADLFSRPQRPKTADGITMSRERCA
                     HGVAAMPGEQRLKNGSLDDALTSPKKPKISWGATTVNRKLQEQVLREVFSPPAIHHHR
                     RHARGHITLPRMSSDSVTRRRANLSEDHTASSRRNASVPNEPPRSAAIDITKQIGEGP
                     GLSSSASTALDSTHNRLQQIRIEEPQPRSNSVSRSRRVRRRHSGSGLQRRRSMSPGKK
                     EGELMFFEDDGYGGDGEDEIFSMEADAQMVPSAPQNVKPPNFATLNPDIADAAQAEDG
                     SAADMPPKDSILVQPKEDNRFLLPSNPKEAQTRKDDRVQFFLLLEDLTAGMNKPCVLD
                     LKMGTRQYGIEANEKKKKSQRRKCQSTTSQQLGVRLCGMQSWNVKKQEYTFEDKYFGR
                     DLKSGREFQDALTRFLYDGVSYTSVAKKIPVILEKLSKLENMIRKLKRYRLYASSLLI
                     LYDGEQSSPEKVSQADKSVDNKRIPLQRRTSDEGHNNIDVQLKIVDFANCVTGEDELS
                     PDAPCPPHHPDDIDRGYLRGLRSLRMYFQRILRELTQDEYIERGEGETIALRSQVSGQ
                     EDLSDRYWDEGVMESDPGEVSY"
     exon            complement(1241393..1243352)
                     /number=1
     exon            complement(1243441..1243984)
                     /number=2
     exon            complement(1244618..1245098)
                     /number=3
     CDS             join(1250924..1251288,1251419..1251533)
                     /codon_start=1
                     /locus_tag="AO090120000468"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000040"
                     /protein_id="BAE63038.1"
                     /transl_table=1
                     /translation="MHRQLRLDTSVGGNQRYSFIETPLEMHASGIRNGQQQQEIPPSQ
                     PLTVPNPDTAPAQAAAEQEQPQRLPLLNEKAQYVRQEAVAPGNLGGPNPEEHPAISAP
                     YADAVPQPVQQHDAVVPDYSYPIFLGHRRPQGHPTHHWQTMLRPTISQARYRTLINI"
     exon            1250924..1251288
                     /number=1
     exon            1251419..1251533
                     /number=2
     CDS             join(1252939..1253047,1253165..1255383)
                     /codon_start=1
                     /locus_tag="AO090120000469"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000039"
                     /protein_id="BAE63039.1"
                     /transl_table=1
                     /translation="MGDDVRLAPRQIWAQPTTSSTKTYQPGCTPFVLPSEGYIYLNLS
                     YSIALSENAVFEPVCTSTATASRGPSPMLDTRDPFYASVTPQLYAIGCATVVSYLLVI
                     ILLITPRTFYVGGPGGGANFLGRHGMISGSYSGNSSVVGVGGRPWLQKVAALLVAISL
                     TIATADSFKVAEDQYIHGYSDADALASEVIDGMEIRVIRVISSTFLWLAQVQTLIRLF
                     PRHKEKVMIKWAGFALIVLDTIFSILDKFLVQSNTTRPRLYEDAIPALSYLFELALNL
                     LYAAWVIFYSLSKHRFAFFHPKMRNICLVALLSLCAVLIPVVFFVLDIAKPEVAGWGT
                     YIRWVGSAAASVVVWEWVERIEALERDERKDGILGREIFDGDEMLEVTPSEEVDWPRQ
                     NNRNDRGGGTGTSSGWGGMMGLTQRPLRTRVGHPGGRNRQTRADAQNPAISNDPRHRG
                     AARPTPPPAAVTPVSRADTTSAASTVYNVHYHPVSSPTPPVAMPHMEEENEADDYGDV
                     AVKELETAVEEHRSNSAHERVSAEQTREESPQIINVDDRWRTILNPFRRRRASLPKEV
                     ASAQAEEEQEDPSRDGDELYHGETSEQESSRPVVNRLFALNRKPRPGSGRQGSDTPLP
                     VTVIPARRRGQHTWSPEWFTESSLLEPSPGQRPRPNRTDLPVRVIQPQARTAAPWATP
                     NEGEFGYGDYELRYDPEAAALVGPGESHPYPLSTDNAYYDTNVDPERPSVAERYRPTQ
                     ELDQSAPERLQSPQHPQPTNSPNDSQATNENSRPR"
     exon            1252939..1253047
                     /number=1
     exon            1253165..1255383
                     /number=2
     CDS             join(1256422..1256532,1256604..1258250,1258319..1258420)
                     /codon_start=1
                     /locus_tag="AO090120000470"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000038"
                     /protein_id="BAE63040.1"
                     /transl_table=1
                     /translation="MAAVNRNMFDASVTTDRPRGASLMVLPLNLIASIISHLEDPGDL
                     ARLCRTCRVLNYMTLPQLYKSITLTSYDRIRYRGDQPEGMGSASPFSMGLNAIITRPY
                     ASLVRSLTLRGNWRESELEEHARIGRVTDSSMMLNIVVRAAIDKMKELESFSWELNTK
                     MLETVYLGLAQQPKLTSLTIRFPSSRHPRPTIVIPPMPHLRRLEITDIDPLCYPDDIS
                     TLLWKSKKLQELNLHWSPRMREEQEPSVMVHDYFRKCISAKQPLRVKKIGLRNLYALH
                     TEEFNLAFDQTIVEDVTILTNVKSDDCNFMNTFVDSTWPISPPHIIRIKSIRQDRFNR
                     RHADFLGNFTGLERLYFVNATPNPNDMRSPKHLEYPAPTPPFVDHNHNNPGSAPAYTP
                     DTTPSCSPGLQASIRDAYLNNIIINHAATLRHLLLPSYWPLSSNTIARIVHSSPQLEQ
                     LAFATEFSSMETLGLLLPFLRNLVAVRLLVPTGATSSPQTPRPPKASLGRLSSCPAED
                     VFASALSLADIVEADDDILIEKFSESLADPQVFSQLRFFGFGWKAFELLDYYTIPAVP
                     PLERTVESQSQSPADLVGEEYIDSSPSLSNPAPRASTEDKPDSFVARQTKART"
     exon            1256422..1256532
                     /number=1
     exon            1256604..1258250
                     /number=2
     exon            1258319..1258420
                     /number=3
     CDS             complement(join(1260346..1260651,1260701..1261058,
                     1261106..1261599))
                     /codon_start=1
                     /locus_tag="AO090120000471"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000037"
                     /protein_id="BAE63041.1"
                     /transl_table=1
                     /translation="MLFNNPSTILVGALGCMSLLSQRAYAAHIPYRHRHSQHSPGGVY
                     DSAPPVSACGTGAPTATTTVTVTETIDASSTELNVITPTVVPASYTTVDISSSSSSST
                     FTSVVAVSSTSTSTSTSTSVSESTSVSTSASASSSGNSTSKAKVIIPYYLYPSTGAWT
                     PLEELIVANSDVQFTVIINPDNGPGSNTASDANFLTAVPRLASYSNALVLGYVSTQKG
                     TRDISEVEKDIQTYAAWPSTSGKSSFAVHGIFLDEAVADYNADTVTYYKNLASTIRSS
                     DGLGPDNYIVTNPGAVPDEAYLDIPDSTVIFESAYSEFQSAYSANEFEKVKGLDLGRF
                     ATMVYGIPSDADLSTLITQLRSISSHTYMSNLDTYLAYDSLWSTVVSLLSA"
     exon            complement(1260346..1260651)
                     /number=1
     exon            complement(1260701..1261058)
                     /number=2
     exon            complement(1261106..1261599)
                     /number=3
     CDS             join(1266861..1267210,1267261..1267538,1267598..1267846,
                     1267908..1268245)
                     /codon_start=1
                     /locus_tag="AO090120000474"
                     /note="aspartyl protease"
                     /old_locus_tag="AO070314000034"
                     /protein_id="BAE63042.1"
                     /transl_table=1
                     /translation="MVILSKVAAVAVGLSTVASALPTGPSHSPHARRGFTINQITRQT
                     ARVGPKTASFPAIYSRALAKYGGTVPAHLKSAVASGHGTVVTSPEPNDIEYLTPVNIG
                     GTTLNLDFDTGSADLWVFSEELPKSEQTGHDVYKPSGNASKIAGASWDISYGDGSSAS
                     GDVYQDTVTVGGVTAQGQAVEAASKISDQFVQDKNNDGLLGLAFSSINTVKPKPQTTF
                     FDTVKDQLDAPLFAVTLKYHAPGSYDFGFIDKSKFTGELAYADVDDSQGFWQFTADGY
                     SVGKGDAQKAPITGIADTGTTLVMLDDEIVDAYYKQVQGAKNDASAGGYVFPCETELP
                     EFTVVIGSYNAVIPGKHINYAPLQEGSSTCVGGIQSNSGLGLSILGDVFLKSQYVVFD
                     SQGPRLGFAAQA"
     exon            1266861..1267210
                     /number=1
     exon            1267261..1267538
                     /number=2
     exon            1267598..1267846
                     /number=3
     exon            1267908..1268245
                     /number=4
     CDS             complement(join(1269446..1270192,1270241..1270533,
                     1270583..1270630,1270677..1271677,1271725..1272607,
                     1272693..1272870,1272989..1273006))
                     /codon_start=1
                     /locus_tag="AO090120000476"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000032"
                     /protein_id="BAE63043.1"
                     /transl_table=1
                     /translation="MGEREGGGTAGGLENMMAASNAQPDTGLYTQNSQNQKSPSPQAQ
                     HRRGYQACDPCRKRKVKCDLGSVDNPRPPPCVRCRRESKRCEFSATRRKRKPSEVEET
                     VDGVLRRDKRMMIGDPASNGSPSDGSSSYAQPEPASFESNSAIPQQKWSAERSPTTTT
                     QVPQPTTTTTTATTNHRFTPNTPSSTTHFPDARNTRLVYPLGDRTTSYGLDGGQTMMN
                     RTAVELLSPAISNSHDALHLLSEAAGRTEDLNRQSLENRYAARQSVSSFNSPMSPLTQ
                     AGTPRSAGGSFSRPARSGMQMNNYFPTTGSSSIDHQTSDGRGQSGPSEGLQDPGFADA
                     VKAWSRLRFVRAGWLSVEEAMAYVAYYYKHLAHLSPIVIPDFSHHSTHRTLLTDEPVL
                     AVTILTTASRHMKPKGDGAYTRSFYIHDRLWSYLRGMIERLFWGQEKFGGDSMGISKP
                     RSFDLAPTSAKVNLKGNLRSLGTIEALLVLTDWHPRNLHFPPGDDENTLLDLDAQGQT
                     RPEKDSEMDPDNILNRNPNASAEGRLAFQKWLEPAWRSDRMSWMLLSTAQALAFELGV
                     FDQKNDAKAASEYPVEHTRKRRLRRLILVYNTQSSGRIGIPSMLPLPQYANDIQPTNV
                     ANVKGGDANIDKMHDCWIGITKIMYQSNQLLFASNEQTSELIRSGRYRDQIDRFQPFL
                     REWRQNIDTLDLAPPMRMLLMIEYEYTRLYVNSLALQAVVDRWTTMSNEATQSARPGS
                     GATSANSWFNVLMELYRVNEQYIQEVVDASRRILQTVLEELIPGDHLKHAPVRTYFRI
                     LSGMIFILKTFTLGAREDDVRVSLDLQDRTVEALRTHVVDDVHLSHAIARLLELLTTS
                     IRTRFLRFAPMDRGNDVEHDRASAPTSRPQSPRARENRRDGTSNGWTPGQNTTQNLSY
                     VDSNGHSTGTPMTSVHDPLAGIPAQPINSSNINVSFMPPPPSVYHNYYDPNATPPAGD
                     LDGSNVPSQSMQDSGALPDWFALPLDQFFNSSTLVDQGLGGTGPMVGEFDMLEVLLNE
                     QYDGHTDNLDSTGGGTIPSQFLQSS"
     exon            complement(1269446..1270192)
                     /number=1
     exon            complement(1270241..1270533)
                     /number=2
     exon            complement(1270583..1270630)
                     /number=3
     exon            complement(1270677..1271677)
                     /number=4
     exon            complement(1271725..1272607)
                     /number=5
     exon            complement(1272693..1272870)
                     /number=6
     exon            complement(1272989..1273006)
                     /number=7
     CDS             complement(join(1273606..1275375,1275444..1275524))
                     /codon_start=1
                     /locus_tag="AO090120000477"
                     /note="UV radiation resistance associated protein"
                     /old_locus_tag="AO070314000031"
                     /protein_id="BAE63044.1"
                     /transl_table=1
                     /translation="MSLTITSEGIGHDDAGNRRERSWLFPSNRKLRHLQGISIRNLVI
                     DPPSRTRGKTIDDEDIPNSFQSPSKILAQDASRPLNHSRSFTNLKSVNAAGDKCITRE
                     PPPRRQPQRRNTLPWSDPNPRTRQVKLEDITRSRMADTWFSMHCDKIEEPVYVSEVVK
                     DATNPSFRSFDLNMCGPLVSRSDNLTLKLWAKTAAMEEYMLLVELQLHLQSLQFLGKS
                     LDSFHQPLPSNSILFHFADGVYGNLTDLPPVWVPLPAKPSKASDRNALPTSSYDALMR
                     LANLDECIQDALITREKLEAQISSILERNQKALAVTSEVSRARDRVALTKQAVVSERK
                     QLRLTSKRKEKLIASLRARREAMARGRQTQERARSHLPDAQEKLHSSAKLLEKETEDT
                     KGQIRRISEDLLAIYPIEPIPDKPLAFTIAGIALPNSNFTDIHRDAVAAALGYTAHLV
                     YLLSFYLSVSMPYPINPYLSNSQIQDPVSVSLPQRTYPLYPVNVHYRFEYGVFLLNKN
                     IEFLLNKQGVRVLDIRHTLPNLKYLLYVLTAGTAEIPARKAGGIRGLLPGRLTPSMSR
                     RGSEDSVAYSESNLPRKMMSSLVKSNGDVALDKGKKSIPVLNTTSASQVA"
     exon            complement(1273606..1275375)
                     /number=1
     exon            complement(1275444..1275524)
                     /number=2
     CDS             join(1275925..1276200,1276276..1277037)
                     /codon_start=1
                     /locus_tag="AO090120000478"
                     /note="predicted protein"
                     /old_locus_tag="AO070314000030"
                     /