LOCUS       AP007164             2356219 bp    DNA     linear   PLN 16-DEC-2016
DEFINITION  Aspergillus oryzae RIB40 DNA, SC111.
ACCESSION   AP007164
VERSION     AP007164.1
DBLINK      BioProject:PRJNA20809
            BioSample:SAMD00067075
KEYWORDS    .
SOURCE      Aspergillus oryzae RIB40
  ORGANISM  Aspergillus oryzae RIB40
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Eurotiomycetes; Eurotiomycetidae; Eurotiales; Aspergillaceae;
            Aspergillus.
REFERENCE   1  (bases 1 to 2356219)
  AUTHORS   Sawano,T., Tanaka,T., Machida,M. and Yamada,O.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-JUN-2004) to the DDBJ/EMBL/GenBank databases.
            Contact:Toshihiko Sawano
            National Institute of Technology and Evaluation, Genome Analysis
            Center, Department Of Biotechnology; 2-49-10 Nishihara,
            Shibuya-ku, Tokyo 151-0066, Japan
REFERENCE   2
  AUTHORS   Machida,M., Asai,K., Sano,M., Tanaka,T., Kumagai,T., Terai,G.,
            Kusumoto,K., Arima,T., Akita,O., Kashiwagi,Y., Abe,K., Gomi,K.,
            Horiuchi,H., Kitamoto,K., Kobayashi,T., Takeuchi,M., Denning,D.W.,
            Galagan,J.E., Nierman,W.C., Yu,J., Archer,D.B., Bennett,J.W.,
            Bhatnagar,D., Cleveland,T.E., Fedorova,N.D., Gotoh,O.,
            Horikawa,H., Hosoyama,A., Ichinomiya,M., Igarashi,R., Iwashita,K.,
            Juvvadi,P.R., Kato,M., Kato,Y., Kin,T., Kokubun,A., Maeda,H.,
            Maeyama,N., Maruyama,J., Nagasaki,H., Nakajima,T., Oda,K.,
            Okada,K., Paulsen,I., Sakamoto,K., Sawano,T., Takahashi,M.,
            Takase,K., Terabayashi,Y., Wortman,J., Yamada,O., Yamagata,Y.,
            Anazawa,H., Hata,Y., Koide,Y., Komori,T., Koyama,Y., Minetoki,T.,
            Suharnan,S., Tanaka,A., Isono,K., Kuhara,S., Ogasawara,N. and
            Kikuchi,H.
  TITLE     Genome sequencing and analysis of Aspergillus oryzae
  JOURNAL   Nature 438, 1157-1161 (2005)
COMMENT     URL:http://www.bio.nite.go.jp/dogan/Top
FEATURES             Location/Qualifiers
     source          1..2356219
                     /db_xref="taxon:510516"
                     /mol_type="genomic DNA"
                     /note="SC111"
                     /note="phrap>=30:1-2356219"
                     /organism="Aspergillus oryzae RIB40"
                     /strain="RIB 40"
     CDS             complement(join(933..1719,1802..2109))
                     /codon_start=1
                     /locus_tag="AO090701000001"
                     /note="predicted methyltransferase"
                     /old_locus_tag="AO070222000001"
                     /protein_id="BAE61765.1"
                     /transl_table=1
                     /translation="MPRISNLTILRAYKQNPLLPVLLRECRSHDSAKNELRWLQERAS
                     RSISSKQVTRSSLAPLGWRRLLRSMCHARSKGMPLQYILGDQPFGELDILCEKGVLIP
                     RAETEAFTIQTAKLILNNVQKHGRHEAGQQQRSLRIVDLCTGSGCIGLLLHALLAPHI
                     DQLSILGVDLSPAAIALANKNLAHNIQRGLLLNRAATEVSFQRGNVLPHDSSGLPSAR
                     EVLCNHQGLPSEIEPKCDVLISNPPYISPESFRDGTTSRSVRVFEPKLALVPPLGDSI
                     MGLGHDRQEDLFYYHIILLSFQVRTKLLVLECGDRSQATRVAAIVKTLSSGYQLNALS
                     IKIWSSSGTFIGDETPPEDGPCAVVVTAIQ"
     exon            complement(933..1719)
                     /number=1
     exon            complement(1802..2109)
                     /number=2
     CDS             complement(join(2543..3492,3567..3885,3938..4132))
                     /codon_start=1
                     /locus_tag="AO090701000002"
                     /note="aspartyl protease"
                     /old_locus_tag="AO070222000002"
                     /protein_id="BAE61766.1"
                     /transl_table=1
                     /translation="MQKSWLVLLVACLGLQGTTALTLHRRDLPAVVSLDIKRNNAVDP
                     VARDRMRRKRDKTVEQNLDNEETLYFCNITLGTPKQSLRLVLDTGSSDLWCNAANSTL
                     CSSRDQPCNASGSYDPSSSSSYAYTSSDFNISYADGTGAAGDYVTDTIHIGGATVKDF
                     QFGVGYSSSSAEGVLGIGYTTNEVQVGRLGKSAYANLPQAMVKNGLIQSNAYSLWLND
                     LGADTGSILFGGVNTEKYHGELQTLPIQTVNGVYSEFIIALTGVSLSSASSHHNYSSS
                     DALPAAVLLDSGSSLTYLPNSIVQDIYDDLGVTYESSSGVGYVPCSLAQQNINVTYTF
                     SSPIITVGIDELVLDAGDLRFRNGARACIFGIVPAGDSTAVLGDTFLRSAYVVYDLSN
                     NEISLANTKFNSTKDNILEIGTGDDSVPGATQVSNPVTSVVADGSGARIGGPTGEIFT
                     DIPSATSSGGAAAPAGPTDVPKHLVLGAAAIGYVLAF"
     exon            complement(2543..3492)
                     /number=1
     exon            complement(3567..3885)
                     /number=2
     exon            complement(3938..4132)
                     /number=3
     CDS             complement(join(5425..5873,5931..6049,6102..6217,
                     6316..6396,6470..6790))
                     /codon_start=1
                     /locus_tag="AO090701000003"
                     /note="mitochondrial tryptophanyl-tRNA synthetase"
                     /old_locus_tag="AO070222000003"
                     /protein_id="BAE61767.1"
                     /transl_table=1
                     /translation="MKGHLRRWGSSVTAQPSPISSSQTIFSGIQPTGVPHLGNYLGAL
                     REWVRLQDNATEGTRLFYSIVDLHALTVPQDRCQLKKWRREAFATLLAVGLNPDRSTI
                     FYQSAVPAHTELYWILSTVASMGYLSRMTQWKSKLQLPENTSLDHSAARSKLRLGLFS
                     YPVLQAADILVHRATHVPVGEDQRQHLEFSRYTANSFNHLYGHIFPSPEALISPAKRV
                     MSLKEPTLKMSKSHADSRSRILLTDSPYDIHRKVRAALTDSDASITYDPVRRPGVSNL
                     IEILSHLDGRSCDDLSLEYKSASLRALKEDLAGRISDHLQGIRERYYSLMEDNSGYLD
                     TVTEQGAQAARANADVTMKQIRKAMGL"
     exon            complement(5425..5873)
                     /number=1
     exon            complement(5931..6049)
                     /number=2
     exon            complement(6102..6217)
                     /number=3
     exon            complement(6316..6396)
                     /number=4
     exon            complement(6470..6790)
                     /number=5
     CDS             complement(join(7193..7368,7475..8011,9873..9963))
                     /codon_start=1
                     /locus_tag="AO090701000004"
                     /note="mitochondrial ribosomal protein S10"
                     /old_locus_tag="AO070222000004"
                     /protein_id="BAE61768.1"
                     /transl_table=1
                     /translation="MAAERPASSTSSWFALPSCKIASSSSTPLPSQRNGTNSLHHVPK
                     IGQSSQPLLKDQSLGETCTYPCNRAERLDGINAKSRLPRSVQAVYLRPLRRKAEYGLP
                     VCDLQLRSYSVRNVEFFADFAVRAAYYLKLPVSGPVPLPRIVERWTFPRSNFVHKKSQ
                     ENFERITLRRLIQIKDGSPQVVQTWLAFLRKHALYGVGMKANVWEHESLDVFKNIDNA
                     VPEVEGSLEPHLSHFGQRGGEGTQSPIPDLLGDMRLPKHRSPLSSVREG"
     exon            complement(7193..7368)
                     /number=1
     exon            complement(7475..8011)
                     /number=2
     exon            complement(9873..9963)
                     /number=3
     CDS             join(12767..12848,13078..13106,13164..13805,13905..13907)
                     /codon_start=1
                     /locus_tag="AO090701000005"
                     /note="CCAAT-binding factor, subunit C (HAP5)"
                     /old_locus_tag="AO070222000005"
                     /protein_id="BAE61769.1"
                     /transl_table=1
                     /translation="MEQSTQSASQQQGRQQPVYDTRNGGHYAELYTGTWANVNQGLQG
                     TARDILTTYWQHIINHLESDNHDYKIHQLPLARIKKVMKADPEVKMISAEAPILFAKG
                     CDIFITELTMRAWIHAEDNKRRTLQRSDIAAALSKSDMFDFLIDIVPREEATSHAKRS
                     SQAAGAPSGAPGPTGAAGQLPPSQHGVQHPSHHMAPPDYSLGQHGLQDQEYRQPAMYA
                     GPVQSDPTAAYGQPQSQMFEGMYAAYPHLPPQQ"
     exon            12767..12848
                     /number=1
     exon            13078..13106
                     /number=2
     exon            13164..13805
                     /number=3
     exon            13905..13907
                     /number=4
     CDS             complement(join(14210..14288,14337..14587,14648..15097,
                     15150..15285,15379..15455,15508..15609,15672..15803,
                     15863..16816,16911..16961))
                     /codon_start=1
                     /locus_tag="AO090701000006"
                     /note="exocyst complex, subunit SEC15"
                     /old_locus_tag="AO070222000006"
                     /protein_id="BAE61770.1"
                     /transl_table=1
                     /translation="MPSMVSSRNESAYVLNQLIPSIKEYSVGNRTPQLLQSLSRFASD
                     KEAEIETICNTNHQEFVTSVNQLLRIREGTVSLTAEILDLNQSIQASTEKLAEQKKAL
                     VESRSHRQNIDETSRAIQDCLEVLRLANQIHDLLARKNHYAALRALDELQNVHLKGVT
                     KYKIADMIQRSVPATQKAIAEAVMSDLNTWLYRIREMSQYLGEIALYHTDLRKTRQKE
                     RADMTPYLGHFKLNSAIELVSDEHEEYDLLQNEELQVDFTPLFECLHIHQSLGHMDKF
                     RSEYANTRRRQKELLIPPSITLVDEDGASLHNLLEEMAGFAIVERSTMKRVPDLRSPV
                     DVDELWDSMCQTAVNLILKALPEVDNAESLLKIKNLIALFMQTMNSWGFPVGVFDNFL
                     LTLFKKYAELLKKRFSDDFQEIVSTDDYMPMPIQTLEEFDKVLNVSCFPCVLPFSQMY
                     PLCCIDIRNFLNQFYFFANDDFSHSSVIDESLKDALDELLSSKVCDTLVERLASQYLG
                     QIVQILINLEHFELACHELENLLAAARSHNSTGGPITLKATEKFRNNKKAAEKRIFEV
                     VNSKIDDLIETAEYDWMAPVPPTEPSNYMQTLTRFLSNIMNSTLLGLPTEIKELIYFD
                     ALSHAANMILALPLAADVKKINPNGVMALAKDVEYLYHFVDSLGVPILRENLDELQQT
                     VQLMQADNTDEFYDISTRNKKYGRVDAINGPVLLEKVVRSIQSPVKTDKFTTLSSRFG
                     KKS"
     exon            complement(14210..14288)
                     /number=1
     exon            complement(14337..14587)
                     /number=2
     exon            complement(14648..15097)
                     /number=3
     exon            complement(15150..15285)
                     /number=4
     exon            complement(15379..15455)
                     /number=5
     exon            complement(15508..15609)
                     /number=6
     exon            complement(15672..15803)
                     /number=7
     exon            complement(15863..16816)
                     /number=8
     exon            complement(16911..16961)
                     /number=9
     CDS             join(19077..19162,19249..19630,19692..20126,20211..20249)
                     /codon_start=1
                     /locus_tag="AO090701000007"
                     /note="predicted protein"
                     /old_locus_tag="AO070222000007"
                     /protein_id="BAE61771.1"
                     /transl_table=1
                     /translation="MGPLILNSRLFHRRISDPKATLGPVSMAQAASDPFLVPTSTSRV
                     QLSPTAAAFTPIGMVDTVANSNLSQPLTRALPSVSYLAVDSIAEVNGTSSGLVSPFDQ
                     GSSDYGTIGSAREFRGLSSGAVLEKFDAERRSRALVIENVPTNLTYMALAGFFNRREF
                     GTLKGPVLTELNSMGKVYVSFTDSREAKKAIEKVRLLRPEWRVFPLTAKEYVQHTEPT
                     LLSDVSDYEGQLLVTVYYDSRNPTLNQHTVTRSLETIVTTFGDMKAFTPLPTGQDNIS
                     EFHLEYFNTRDAENAMSTLNGSSVETRYRGQATSSPS"
     exon            19077..19162
                     /number=1
     exon            19249..19630
                     /number=2
     exon            19692..20126
                     /number=3
     exon            20211..20249
                     /number=4
     CDS             join(20344..20541,20602..20637,20691..20757,20892..20911)
                     /codon_start=1
                     /locus_tag="AO090701000008"
                     /note="predicted protein"
                     /old_locus_tag="AO070222000008"
                     /protein_id="BAE61772.1"
                     /transl_table=1
                     /translation="MELSPTGRSTVPPGEHAGLMDWMSRAGEGVLLSPRRDIGRFPEL
                     RVSNQNAVDIERIRLGLDVRTTIMLRNIPNKIDQTMLKAIVDETSHGKYDFMYLRIAS
                     GTPS"
     exon            20344..20541
                     /number=1
     exon            20602..20637
                     /number=2
     exon            20691..20757
                     /number=3
     exon            20892..20911
                     /number=4
     CDS             complement(join(23551..24110,24154..24343,24455..25215,
                     25249..25619,25675..25802,25865..26153,26190..26281,
                     26337..26659,26708..26744,26788..26910,26980..26992,
                     27030..27180,27243..27281,27359..27536))
                     /codon_start=1
                     /locus_tag="AO090701000010"
                     /note="glycosylphosphatidylinositol anchor synthesis
                     protein"
                     /old_locus_tag="AO070222000010"
                     /protein_id="BAE61773.1"
                     /transl_table=1
                     /translation="MAKSVRASVQKRNRAKLRATVFGPVVDARTERLSAKLQELASQP
                     KPSNEEKPDMELNMKDRQEGTKISQTSEDMDIDNGTIKTTQGRSHKGGRIHKRHSNRK
                     NRSSIVFRPHQSKNKKGLKRRLAFGRHAGDPSNSGEIFLPPSRGQLRLESPPSLCSLC
                     CSVVQEAFYRMTDEPPQTEGGIPPFEVDTICLIFSVTLTVYQTRTCQLGYGICQHNLL
                     EIAPACGRSHREIAMKVARSKWTILIANILVPISILVFSSGFFPYKTLLTGFATHEHT
                     IGGQIPPGVFDKVLLLQADFHASDFVYSQHSGFLFTQRLGGGFLIRSGAALPFTAYAS
                     APTVTMPRLKAITTGSVPSFLDVILNIAEADTSSTLMHQDTWLAQLKAKGGKLVMYGD
                     DTWLKLFPGMFHRADGTTSFFVSDFTEVDNNVTRHIPNELLQDDWSAFIMHYLGLDHI
                     GHKAGPNSPYMITKQHEMDSVVSMVYTALEQEKHLKTTLFVLCGDHGMNEAGNHGGSS
                     VGETSPALLFISPKFQRLETRNDSPTEEFSDLQYYHTVEQTDITPTLAGLLGLPIPLN
                     SLGVFIPELLAMWDHGAKSIPLTSSSGPHRIHMLLENAKQLLGAVKGSFPSYSFEFDL
                     MPVICSSQSLIDIERVQCAWFRVLETLNGSGANHDSEASSEIESALLLFLRNAQKLMS
                     SAASDYDLIRLYVGLSISGFAISLTFFPAKRLLVNFAPAGMFLGFSILSYSTMMFASS
                     YVEEEQQFWYWISMGWVVYLHVKYAGHFHGNSIQKSGPANGHWPFEPSLPWFGAAALA
                     VSYRVLRRWNQTGQKFAAQPDITGSFFPSHQHTLWALLSLAASDSPELLGNSFLQPVA
                     MLTDGMHLLYHARMVLCGISLLMIYSLYAGKARETTHKGRGKWPPSTIFHETLTLFLL
                     MQSKVTNIPAFLVFRVQITILASMRLSTVEQTITSLLMQYVTFYAFGGSNAISSVDIS
                     NAYNGIGTYSVFIVGALTFISNWAAPIWWVSASRLLRSSQNREEKEAHVTILTLHMAT
                     ILMSVMAACTTLRTHLFIWTVFSPKYLYTIAWAMINHIVVNVLGEIDWRLFMKR"
     exon            complement(23551..24110)
                     /number=1
     exon            complement(24154..24343)
                     /number=2
     exon            complement(24455..25215)
                     /number=3
     exon            complement(25249..25619)
                     /number=4
     exon            complement(25675..25802)
                     /number=5
     exon            complement(25865..26153)
                     /number=6
     exon            complement(26190..26281)
                     /number=7
     exon            complement(26337..26659)
                     /number=8
     exon            complement(26708..26744)
                     /number=9
     exon            complement(26788..26910)
                     /number=10
     exon            complement(26980..26992)
                     /number=11
     exon            complement(27030..27180)
                     /number=12
     exon            complement(27243..27281)
                     /number=13
     exon            complement(27359..27536)
                     /number=14
     CDS             join(28103..28250,28374..28721,28782..29026,29204..29309,
                     29364..29589,29642..30149)
                     /codon_start=1
                     /locus_tag="AO090701000011"
                     /note="Zn-finger transcription factor"
                     /old_locus_tag="AO070222000011"
                     /protein_id="BAE61774.1"
                     /transl_table=1
                     /translation="MASVGQSSELQSVVALVKTMTNAQLKEILRSEGLAVSGVKASLQ
                     FRIIEFIERLNQGGQIERYDNLKRAVYATTHRSMPQPSTPQSLPSHQYHSSANQPLST
                     QQRPSPLSAPMTSHGLTSGILTMPISMSLHLGANSHFLLGRLNFKESPFYTVFQQLTP
                     VVECKVREQTRDSVELRVVLNQDMASRLQADPNLRVMVYCAADTGLNQYTKSDIAFPH
                     QVELKANLDEVKANLRGLKNKPGTTRPADRFFVLVSLVQRHPVEELVAELKMRKTISK
                     DQVLREMKSRADDTDIVATSSVMSLKCPLSTLRIAVPCRSVICTHNQCFDAYSFLQLQ
                     EQAPTWSCPVCSKATSFESLQIDQYVDDILRSTSTDVEQVVVEPDGRWSNPRVVDASE
                     AGGVTPESDDDDLIEIKELGNTPVKQESLPAASLSLQRTPAQSREPSSTSSVARLSTN
                     KRPATQVIDLTGSDDDNDDGSPVRPPKRPALNLLNRSLPRQEFQSSYNTALANGKAVP
                     RAGQTSSESASQTTGYNA"
     exon            28103..28250
                     /number=1
     exon            28374..28721
                     /number=2
     exon            28782..29026
                     /number=3
     exon            29204..29309
                     /number=4
     exon            29364..29589
                     /number=5
     exon            29642..30149
                     /number=6
     CDS             join(30867..31084,31179..31296,31393..31482,31550..31681)
                     /codon_start=1
                     /locus_tag="AO090701000012"
                     /note="transport protein particle (TRAPP) complex subunit"
                     /old_locus_tag="AO070222000012"
                     /protein_id="BAE61775.1"
                     /transl_table=1
                     /translation="MSFDTPAPDEPQARALSASCLDFLLIELVPMAERLAKELSADDK
                     TPDDDEIRETTFFRLESLGYRVGQGLAERFSRDRPRFSDNLDVIKFLCKDLWTILFKK
                     QVDNLKTNHRGVYVLTDNSFRPFARMSMSVRSEAVSMAQAYLWFPCGVIRGALSNLGI
                     NTTVQAETGELPGATFQIKTVQPKS"
     exon            30867..31084
                     /number=1
     exon            31179..31296
                     /number=2
     exon            31393..31482
                     /number=3
     exon            31550..31681
                     /number=4
     CDS             complement(join(32162..32302,32365..32509,32558..32642,
                     32701..33078,33147..33234,33309..33419,33490..33521,
                     33579..33591))
                     /codon_start=1
                     /locus_tag="AO090701000013"
                     /note="NAD-dependent malate dehydrogenase"
                     /old_locus_tag="AO070222000013"
                     /protein_id="BAE61776.1"
                     /transl_table=1
                     /translation="MVKAAVLGASGGIGQPLSLLLKTCPLVEELALYDVVNTPGVAAD
                     LSHISSIAKISGFLPKDDGLKQALTGANIVVIPAGIPRKPGMTRDDLFKINAGIVRDL
                     VKGIAEFCPKAFVLVISNPVNSTVPIAAEVLKAAGVFDPKRLFGVTTLDVVRAETFTQ
                     EFSGQKDPSAVQIPVVGGHSGETIVPLFSKTTPAIQIPEEKYDALIHRVQFGGDEVVQ
                     AKDGAGSATLSMAYAGYRFAESVIKASKGQTGIVEPTFVYLPGIPGGDEIVKATGVEF
                     FSTLVTLGTNGAEKASNVLEGVTEKEKKLLEACTKGLKGNIEKGIDFVKNPPPK"
     exon            complement(32162..32302)
                     /number=1
     exon            complement(32365..32509)
                     /number=2
     exon            complement(32558..32642)
                     /number=3
     exon            complement(32701..33078)
                     /number=4
     exon            complement(33147..33234)
                     /number=5
     exon            complement(33309..33419)
                     /number=6
     exon            complement(33490..33521)
                     /number=7
     exon            complement(33579..33591)
                     /number=8
     CDS             complement(join(34943..35120,35213..35337,35406..35429,
                     35538..35632,35737..35788))
                     /codon_start=1
                     /locus_tag="AO090701000014"
                     /note="60S ribosomal protein L28"
                     /old_locus_tag="AO070222000014"
                     /protein_id="BAE61777.1"
                     /transl_table=1
                     /translation="MAAQRQNVSSDLVWQLTRNQNAFLVKRNSGGGSQFSRDPLNLQN
                     KHSFKYAGYANTKAIGVQPTENGGVVVLTKKSGNAQQPGKNAVRVTFGPKASTRKIYK
                     GVADKTAKNGYRADLREDAVARVSAIRRSQKPKKDTPPQKPRGAQARKAAEQESA"
     exon            complement(34943..35120)
                     /number=1
     exon            complement(35213..35337)
                     /number=2
     exon            complement(35406..35429)
                     /number=3
     exon            complement(35538..35632)
                     /number=4
     exon            complement(35737..35788)
                     /number=5
     CDS             join(36278..36332,36400..36719)
                     /codon_start=1
                     /locus_tag="AO090701000015"
                     /note="predicted protein"
                     /old_locus_tag="AO070222000015"
                     /protein_id="BAE61778.1"
                     /transl_table=1
                     /translation="MAYYLLYFLAISVVVCGTVLYLTRARWLSLVPVPDYIYDRLPSS
                     FADDLEAGLTSTQFDLSANIADGDTRAGLDNQAKRQIMKIMKRQRINFDEARRIYTEQ
                     RFAKNNIGPDGRPRDPKFVSFS"
     exon            36278..36332
                     /number=1
     exon            36400..36719
                     /number=2
     CDS             complement(37379..37960)
                     /codon_start=1
                     /locus_tag="AO090701000016"
                     /note="predicted protein"
                     /old_locus_tag="AO070222000016"
                     /protein_id="BAE61779.1"
                     /transl_table=1
                     /translation="MNGQYLMNKQVSVQYAYKKDGKGERHGDQAERMLAAQARKHNVR
                     PPTQPLPSPFSGSGTPMVPPAMANGDSSRQISTGPPDLGMGRGVATPNVGFSNVPPPQ
                     HHRSVPPATPLANPPPGLPARPPPSQAGYGGPPQAFLPPAFNNAGQQSSFPPQPAPPP
                     GFAPPGFGPPTGNAAPPPPLPPGFQQPAYSRGR"
     exon            complement(37379..37960)
                     /number=1
     CDS             complement(join(38072..38471,38536..38555))
                     /codon_start=1
                     /locus_tag="AO090701000017"
                     /note="splicing factor 3b, subunit 4"
                     /old_locus_tag="AO070222000017"
                     /protein_id="BAE61780.1"
                     /transl_table=1
                     /translation="MSGARHWEQDKEATVYIGNLDERVTDSLVWELMLQAGRIVNVHL
                     PKDRVTQSHQGYGFVEFISEEDAEYASRIMNGIRLYGKPIRVNKASADKQKSVEIGAE
                     LFVGNLDPMVTEQVLYNTFSRFGNLINLPKVMSTIRP"
     exon            complement(38072..38471)
                     /number=1
     exon            complement(38536..38555)
                     /number=2
     CDS             join(39986..40103,40240..40482,40560..41143)
                     /codon_start=1
                     /locus_tag="AO090701000018"
                     /note="mitochondrial FAD carrier protein"
                     /old_locus_tag="AO070222000018"
                     /protein_id="BAE61781.1"
                     /transl_table=1
                     /translation="MNGQDGLSSSFVESVAGFTAGIVSTLCLHPLDLIKTRLQVDRSS
                     SSRVGGSLHVVRSIYQNEGGVAAFYRGLTPNIIGNSTSWALYFLCYGNIKTATRTWRS
                     SREEDLTSSDYFLASGAAGMLTSILTNPIWVIKTRMLSTSSRTPGAYASFTTGASQIY
                     HSEGIPGFYRGLLPALFGVSHGALQFMAYEKLKLHRIKMSSATVFNDGYAGSAQVRWR
                     RLGNLDLFIISSLSKIFAGFVTYPYQVLRSRLQTYDAHLIYRGVQDAALQIWAREGAA
                     GFYKGLGPNILRVLPSTWVTFLVYENTRAYLPELISRA"
     exon            39986..40103
                     /number=1
     exon            40240..40482
                     /number=2
     exon            40560..41143
                     /number=3
     CDS             complement(join(41546..41884,41951..42163,42200..42253,
                     42325..43089))
                     /codon_start=1
                     /locus_tag="AO090701000019"
                     /note="Zn-finger"
                     /old_locus_tag="AO070222000019"
                     /protein_id="BAE61782.1"
                     /transl_table=1
                     /translation="METAEPVSYEFPGHTIGAVAPRRMMTSNLGHNFPFYATPAASFP
                     LPFHQSSSTAYGFGHALNHHHHNHHQPSYPQFFVASHESINSQPMRLSSEPPPVQSIP
                     DIRPAKNAVNRVSRDPLVKNDPSSNTQQTPMARSSTHGAAAQSKSPSVSEIEFTTEVD
                     ILMKAIQSRNSVQPPNTQSLPPLQQLTHRGCHGYPQTFSLHPSGNTRCNMMAEEVQSR
                     SGKKRKYVCTLPHCGKSFAQKTHLDIHTRAHTGDKPFICKEPSCGQRFSQLGNLKREK
                     TDSNPGAHKQTHQRRHTGEKPFSCDICQKRFAQRGNVRAHKITHQHAKPFTCLLDDCG
                     KQFTQLGNLKSHQNKFHATTLRDLTLKFSQVTIGDPMSPQDRKLWEYFATLYKNSNKG
                     IKGRGKDRRISPTSRSGPGKRHQTLGNNDDKLQRPIYEESSVYTGGSSSDEEDAEAYY
                     IDRQNH"
     exon            complement(41546..41884)
                     /number=1
     exon            complement(41951..42163)
                     /number=2
     exon            complement(42200..42253)
                     /number=3
     exon            complement(42325..43089)
                     /number=4
     CDS             complement(join(50219..50325,50377..50509,50592..51062,
                     51239..51768,51837..52159,52223..52304,52548..52668))
                     /codon_start=1
                     /locus_tag="AO090701000021"
                     /note="WD40 repeat-containing protein"
                     /old_locus_tag="AO070222000021"
                     /protein_id="BAE61783.1"
                     /transl_table=1
                     /translation="MYNTHRGMVPAPNSRLTELLDQLRQEFENQSRSTGEFEHQLTGQ
                     LQEMEMIRQKVYQLEQAQIKMKQDYEAEIRVLRHELESRGVQPVSSHIAGPAQHAGPS
                     QAPPPALGHGPSNLFGGIMANQGGSGPGLAPPPPQDQQPPQHTLQQPAPAAQQGAPQP
                     PQSSFGGYQPGAAVNGYAPPPPPTASPGPGKRPRAPPGPATPQQTHQLAYPDPRVSPQ
                     LARPTPPSQALVRDRPGNMLANWNPDDLPASQKREGADWYAVFNPEVQRVLDVELVHH
                     LVHDSVVCCVRFSRDGKYLATGCNRSAQIFDVTTGQNVATLQDENVDKNGDLYIRSVC
                     FSPDGKFLATGAEDKQIRVWDIAARTIKHIFTGHEQDIYSLDFAGNGRYIASGSGDKT
                     VRLWDILDGKLVYTLSIEDGVTTVAMSPDGHYVAAGSLDKSVRVWDTTTGYLVERLES
                     PDGHKDSVYSVAFAPNGRDLVSGSLDKTIKLWELNVPRGAFPGTGVKGGKCIRTFEGH
                     KDFVLSVCLTPDGHWVMSGSKDRGVQFWDPITGNAQMMLQGHKNSVISVAPSPTNNLF
                     ATGSGDMRARIWRYVLLFNSQP"
     exon            complement(50219..50325)
                     /number=1
     exon            complement(50377..50509)
                     /number=2
     exon            complement(50592..51062)
                     /number=3
     exon            complement(51239..51768)
                     /number=4
     exon            complement(51837..52159)
                     /number=5
     exon            complement(52223..52304)
                     /number=6
     exon            complement(52548..52668)
                     /number=7
     CDS             join(54653..54921,54985..55774)
                     /codon_start=1
                     /locus_tag="AO090701000022"
                     /note="sterol C5 desaturase"
                     /old_locus_tag="AO070222000022"
                     /protein_id="BAE61784.1"
                     /transl_table=1
                     /translation="MDIALEVWDTFIGDRLYAALLPVSLSSSVSFPGFNHAANNTLSF
                     FGASQPFIYEPATHLIYLEPSKYAYMSAWPRNNIYRQFLSFFLIVWIFGLITYFISAT
                     LSYIFIWDKTTVKHPKFLKNQIPMEIAQTMGSMPIMSLLTAPFLVAEVRGYAKLYDGF
                     SDEPFPYYSIIQFPLFIAFTDFCIYWIHRGLHHPLIYKSLHKPHHKWIMPSPFASHAF
                     HPLDGWSQSVPYHVFPFIFPLQKVAYVFLFGFINLWTVLIHDGEYVANSPVINGAACH
                     TMHHLYFNYNYGQFTTLWDRLGGSYRKPNEELFRRETKMDKEEWKKQTEEMESILKDV
                     EGDDDRKYLVEDESKKDL"
     exon            54653..54921
                     /number=1
     exon            54985..55774
                     /number=2
     CDS             complement(join(56874..57757,57827..58008,58175..59067,
                     59121..59388,59450..59556,59624..59715,59847..59907))
                     /codon_start=1
                     /locus_tag="AO090701000023"
                     /note="nuclear cap-binding complex, subunit NCBP1/CBP80"
                     /old_locus_tag="AO070222000023"
                     /protein_id="BAE61785.1"
                     /transl_table=1
                     /translation="MVDYERRHHGPKGGRKRRYREDDDYDRRQRRKYEEPLVAKVRRQ
                     LLTIAESAARRAEDDVVNIAKSVADNYEDEELRQTFVAISVDLALEQPLKIPFIAATV
                     LSANLYRSELVSDVLTKASEYLQHYINNGAWREVKLLLRLLGCLQILYEGDGIFPILE
                     ELFERAVVLQTASSEDLLGLELVKIILFTIPYIMASPITGFEAQANALLEKTDIIAST
                     PHALVELVNPFSPEHDTSSAAQSVISLLQSQLQQEASRNWELACLPRPWKGGRDNEEE
                     QKPLDSGAKHAFPQITVPDPVQNGSRAIFPEVYMSVYSNQEVETVPPTSDIASSLLRD
                     ALVDTINILDFNRIATAKYLIDIDCYFTPHTFVKRATPFDRLRDISGDRPTWKPEDVA
                     VDAVFSQLFQLPSPQHKLVYYHSVLTECCKIAPAAIAPSLGRAIRFLYRSLETIDLDL
                     SHRFLDWFAHHLSNFGFTWKWSEWIDDLELSSVHPKMAFIIGALDKEIRLSFAQRIRG
                     TLPDPYQDLITEGKEKDTPDFKYSLDTTPYANEGTEIMQLIRKKATDDDILPIINAIE
                     EQARAMGVEDPMLPSTDAFVTAICFVGSKSLSHVLSCIERNKERLLAIGPKSTRARRQ
                     IITSVMEYWTDQPGIGINIIDKLLNYTILTPLSVIEWALVDKLEAGTILARTHVFEMI
                     SATVGKVTNRLRQIVAARTQPGLYEPQLSVLDETLNREKADMQALFKVIEDSIMSVAE
                     GHNDELMERGDGSGELPEDEIIRQWGCRWLRAFRRKAGVEESFIAEAMATATPIGTTA
                     PPPQEGTTAIDGPADGDLDVADADGAVDVS"
     exon            complement(56874..57757)
                     /number=1
     exon            complement(57827..58008)
                     /number=2
     exon            complement(58175..59067)
                     /number=3
     exon            complement(59121..59388)
                     /number=4
     exon            complement(59450..59556)
                     /number=5
     exon            complement(59624..59715)
                     /number=6
     exon            complement(59847..59907)
                     /number=7
     gap             61232..61331
                     /estimated_length=unknown
     CDS             complement(join(64132..64265,64319..64523,64579..64772,
                     64826..65174,65250..65333,65401..65573,65657..65702))
                     /codon_start=1
                     /locus_tag="AO090701000024"
                     /note="glycogen synthase kinase-3"
                     /old_locus_tag="AO070270000001"
                     /protein_id="BAE61786.1"
                     /transl_table=1
                     /translation="MSQNRPGVFSSLRMGEVVREKVQDGLTGETKEISYSQCKIVGNG
                     SFGVVFQTKMMPSGEDAAIKRVLQDKRFKNRELQIMRIVRHPNIVELKAFYYSNGERK
                     DEVYLNLVLEYVPETVYRASRYFNKLKTTMPMLEVKLYIYQLFRSLAYIHSQGICHRD
                     IKPQNLLLDPSTGILKLCDFGSAKILVENEPNVSYICSRYYRAPELIFGATNYTTKTD
                     VWSTGCVMAELMLGQPLFPGESGIDQLVEIIKVLGTPTREQIRTMNPNYMEHKFPQIK
                     PHPFNKVFRRAPHEAIDLISALLEYTPTQRLSAIEAMVHPFFDELRDPSTRLPDSRHQ
                     NGPSRELPNLFDFSRHELSIAPAMNSRLIPPHARPALEARGIDIDNFTPLTKDEMMAR
                     LD"
     exon            complement(64132..64265)
                     /number=1
     exon            complement(64319..64523)
                     /number=2
     exon            complement(64579..64772)
                     /number=3
     exon            complement(64826..65174)
                     /number=4
     exon            complement(65250..65333)
                     /number=5
     exon            complement(65401..65573)
                     /number=6
     exon            complement(65657..65702)
                     /number=7
     CDS             complement(join(72647..72754,72822..73469,73553..73864))
                     /codon_start=1
                     /locus_tag="AO090701000026"
                     /note="translocase of outer mitochondrial membrane
                     complex, subunit TOM40"
                     /old_locus_tag="AO070270000003"
                     /protein_id="BAE61787.1"
                     /transl_table=1
                     /translation="MAEYLASPSFLTDNSVAAVIKDAYTSFSERRAALGLPNPGTVDN
                     IAREVQKEVLLSNFMFSGLRADLTKVFGMSPLFRVSHAFSMGSSGNLPPYAFSAMYGS
                     PKVFMQGNFGSDGALAAVGNYRWSPKLVTKTNTQIMAGASQGLMQIDNDYTGDDFSAS
                     IKAFNPSFLDGGLTGIFVGSYLQSVTPSLALGFEAIWQRQAMNTRPETAISYSARYKA
                     NDWIASAQLQAQGVFTASYWKKLSERVEAGVDMNLQFAPNAAAALMGGPSRDGTTAIG
                     AKYDFRASTFRAQVDSAGKVSCLLEKRIAMPISLTFAGEIDQAKQSAKLGLAVSLEIA
                     GEELMEQQEKIEAQGMVPPPF"
     exon            complement(72647..72754)
                     /number=1
     exon            complement(72822..73469)
                     /number=2
     exon            complement(73553..73864)
                     /number=3
     CDS             join(74699..74712,74999..75073,75138..75173,75227..75324,
                     75405..75574,75638..75718,75897..76058,76126..76500,
                     76559..76735,76849..77028)
                     /codon_start=1
                     /locus_tag="AO090701000027"
                     /note="fructose-6-phosphate 2-kinase/fructose-2,
                     6-biphosphatase"
                     /old_locus_tag="AO070270000004"
                     /protein_id="BAE61788.1"
                     /transl_table=1
                     /translation="MDTLLTESGRLFHSGRIVIITVGLPARGKTHISVALARYLRWLG
                     VKTRIFHLGDYRRATIPVGQDIPDDYFFVNASASSVLLRQKIVKRCREDIYQFLNDEN
                     GQIAIYDAVNPLASGRRSLAKEFAKHDIETLFIESWCDDERIIEENVLRVKISSPDCL
                     ILNLEIYINLKQMINAGERLIVNNRSFGYLSHRIVFYLLNLHIKSRHTYFARAGVSIE
                     ADSYKADASLSEQGEDYAKKMTECLLRHRESEKQATIDQGETDYELKPLTVWTSTRRR
                     TIETAKYLYEKGYKVRQRSQLSQLNPGVCEKMSEKKIREEYPDEVAKHELDPYHHRYP
                     RAESYHDLAVRLEPIILELEREQNDLLIIAHESVLRVLYGYIMACNAADIPFLEFPRD
                     EIIEEIIPGSPQDIKIPVPPSGVTTPLVGGLSSPQEGFSTPQSGLRTPREPERISQQH
                     VEDVV"
     exon            74699..74712
                     /number=1
     exon            74999..75073
                     /number=2
     exon            75138..75173
                     /number=3
     exon            75227..75324
                     /number=4
     exon            75405..75574
                     /number=5
     exon            75638..75718
                     /number=6
     exon            75897..76058
                     /number=7
     exon            76126..76500
                     /number=8
     exon            76559..76735
                     /number=9
     exon            76849..77028
                     /number=10
     CDS             complement(join(77144..77261,77313..77477,77548..77627))
                     /codon_start=1
                     /locus_tag="AO090701000028"
                     /note="ubiquitin-like protein"
                     /old_locus_tag="AO070270000005"
                     /protein_id="BAE61789.1"
                     /transl_table=1
                     /translation="MTTDTEINPESARPEAHGSLSVTVEFTGGLEMLFSNERKHSVTL
                     PARLSDGGRPSISFLLEYLVKNVMKDERKELFMLEDNVRPGILVLINDADWELEGEEK
                     YELQPADNIVFVSTLHGG"
     exon            complement(77144..77261)
                     /number=1
     exon            complement(77313..77477)
                     /number=2
     exon            complement(77548..77627)
                     /number=3
     CDS             join(77901..78029,78119..80422)
                     /codon_start=1
                     /locus_tag="AO090701000029"
                     /note="RNA polymerase II elongator complex, subunit ELP2,
                     WD repeat superfamily"
                     /old_locus_tag="AO070270000006"
                     /protein_id="BAE61790.1"
                     /transl_table=1
                     /translation="MVSITSEYISVGGNRHPAAADWDIQSGVLAFGADNNVALWYPKD
                     KSQRGVYSLLVGHTDKVNAVRFYTCPTTGTKLLITASADHTIRIWRAVTGTYLQFTLA
                     QILEGHTSSINTIAVSDGADLVASGAADGSVKIWRIMLQGEGTKSELLTTIVMKPRFF
                     PLALALKPLQADGPMILAVAGTTNIIHAYILEDPLGDTSFRLAAVLSGHEAWVRSLSF
                     TRDKQSKTGDILLASASQDKYIRLWRIQRGEVTLAAPAGEEDPVLGELEPTLSNKAHQ
                     FNAAGSKYSVTFEALLFGNEDWIYTTAWNPSSERQQLLSASADNTLTIWEQDTVSGVW
                     VSAERMGEISVQKGSTTATGSTGGFWIGLWSPDGDQVVSLGRTGSWRAWSYDADADVW
                     VQTLGISGHVRSVNGVRWEPTGGYLLSTSGDQTTRLHAQWLRDGKQSWHEFSRPQIHG
                     YDLNCVDTLGPARFVSGADEKLLRVFNEPKPIAKLLEKLSAFKQSTEGELPDTAQIPV
                     LGLSNQSMGEAPMGEGEGEEANAAHIGQAQANQTILSDTNQPPLEDQLARYTLWPEHE
                     KLYGHGYEISAVAVSYDCTLIATACKASSIDHAVIRLYDTSDWHEIRPSLAAHSLTIT
                     SLSFSSDDRYLLSVGRDRQWAIYCRSEQDRSAFSLMESHPKGHSRMILDAAWAPVPDF
                     HTFATAGRDKLVKIWQISKGSFVCKTTITLKSSVTAISFLPRVQVNSVFLATGEDSGE
                     LSLYKIAIDSLEAACLGNIDKLISPSKAITQLAWRPSAKYDTSQDEFSLKLAVASEDT
                     STRIYAISNMVS"
     exon            77901..78029
                     /number=1
     exon            78119..80422
                     /number=2
     CDS             complement(join(80868..81574,81638..81758))
                     /codon_start=1
                     /locus_tag="AO090701000030"
                     /note="predicted ABC-type transport, ATPase
                     component/CCR4 associated factor"
                     /old_locus_tag="AO070270000007"
                     /protein_id="BAE61791.1"
                     /transl_table=1
                     /translation="MANTPSIQVNNLSYQFQDGSSGLADVSLYLPAGSRTLLIGANGA
                     GKTTLLRLLAGKRLAPDDTITVGGKDPFKEGLEGVTYLGVEWVLNNIVRTDIDVPTLL
                     ASVGGNAYPERRDELVDILDIDLRWRMHAVSDGERRRVQLAMGLLRPWQVLLLDEITV
                     DLDLLSRHNFLSFLKRETETRPCTIVYATHILDNLSQWPTHLVHMNLGNVKQWGPITK
                     FQKEVPETSENSQLGELVLRWLKEDLKARGPRNGRHGQAKTYESFDGRGGYGFEKRN"
     exon            complement(80868..81574)
                     /number=1
     exon            complement(81638..81758)
                     /number=2
     CDS             join(82217..82267,82328..83704)
                     /codon_start=1
                     /locus_tag="AO090701000031"
                     /note="tRNA delta(2)-isopentenylpyrophosphate transferase"
                     /old_locus_tag="AO070270000008"
                     /protein_id="BAE61792.1"
                     /transl_table=1
                     /translation="MEPLIAIVGATGTGKSKLAVDLATRFNGEIINGDAMQMYRGLPI
                     ITNQIPMDERNGIPHHLISCIDLEEEPWRIGLFKSECLRIIKDIHSRGKLPILVGGTH
                     YYTQAVLFKGQLVGEGSDEFQGSGPRSDRETEESSSKWPILDAPTDVVLQKLREVDPV
                     MADRWHPNDSRKIRRSLEIYFQTGRPASEVYAEQKRLKQTTLANGDFTAGEGQLRFST
                     MVFWIHSEKEALIARLEKRVDAMIEQGLMSEAQRMSDYIRERRTQGSSIDPTRGVWVA
                     IGFKELAPYFEALHKSSLSVDELESLKKSCIESIKIATRQYSASQIKWIRNKLWNSLA
                     ETGMTHRLYLLDSTNVGDWRTCITEPSELLTQALLKDESTPDPKSFSELARTILGAKE
                     ARSQKGPGSAAKCFTCHICRKTMVNEEQWHIHLNGHSHKRVLKAMAKRAEREESLQAR
                     KESTRRISCDNESLEEQNSLSDLFQ"
     exon            82217..82267
                     /number=1
     exon            82328..83704
                     /number=2
     CDS             join(86546..86589,86695..86951,87024..87176,87234..87820)
                     /codon_start=1
                     /locus_tag="AO090701000032"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070270000010"
                     /protein_id="BAE61793.1"
                     /transl_table=1
                     /translation="MTSRIDKTIARQREKIASGAYYEAHQQLRVIAARYIKQANYDAA
                     AELLAGGATALLRAGSQQGASASGGDLAIMLVIEVYTKAGWEITGNDDDTEGRARKKR
                     LIELLHEFPSEEPTRKRFIQEMIGWSGRFGPLERGDPELHHAAGSVYAEDHEPYDAEK
                     HLILGTSESAETLAKLEHEWYTNDEPHTAAIYASRAVFPYLLNGNLRSANKAFLIFTS
                     RLSSSNPSIPLQDVSSSSIDARVFPALPLLNFISMLLLTIQRGSADLFKQLTSHYASQ
                     IQEVGIWDDFLAQIGEQYFSIKIPRQGNPLLDMMGSMLFGGGQGGTGGRIPQSRGSSK
                     KVEAPPANPELD"
     exon            86546..86589
                     /number=1
     exon            86695..86951
                     /number=2
     exon            87024..87176
                     /number=3
     exon            87234..87820
                     /number=4
     CDS             complement(join(87915..88012,88079..88147,88211..88583))
                     /codon_start=1
                     /locus_tag="AO090701000033"
                     /note="predicted protein"
                     /old_locus_tag="AO070270000011"
                     /protein_id="BAE61794.1"
                     /transl_table=1
                     /translation="MGTTSVRRNLFHHHLSKRSVSAAPPNASMQSGTHSGLPSLSSHA
                     MSSASSESTQSLGSGMGDGGEIVVKDKNGDYKLDIPLLPPAVGGEDGDEMEGIEAGAT
                     RGSGATGTESTAQTEISGREKEKIEASLVEMMYRSRNRQMSTEPAEILNLIHQSLRNK
                     VASLDEDNWIYEPEPDSLF"
     exon            complement(87915..88012)
                     /number=1
     exon            complement(88079..88147)
                     /number=2
     exon            complement(88211..88583)
                     /number=3
     CDS             join(89275..89363,89427..89647,89702..89801,89862..90284,
                     90340..90565)
                     /codon_start=1
                     /locus_tag="AO090701000034"
                     /note="replication factor C, subunit RFC2"
                     /old_locus_tag="AO070270000012"
                     /protein_id="BAE61795.1"
                     /transl_table=1
                     /translation="MVQAESSSSAARVGLKPVTAGAPSDYELPWVEKYRPVFLDDVVG
                     NTETIERLKIIAKDGNMPHVIISGMPGIGKTTSILCLARQLLGDAYKEAVLELNASDE
                     RGIDVVRNRIKGFAQKKVTLPPGRHKIVILDEADSMTPGAQQALRRTMEIYSSTTRFA
                     FACNQSNKIIEPIQSRCAILRYARLTDGQVVKRLKQVCDAEKVEHTEDGIAALVFSAE
                     GDMRQAINNLQSTWSGFGFVSGDNVFRVVDSPHPIKVQAMIKACWEGKVDAALETLNE
                     LWDLGYSSHDIISTMFRVTKTIPTLSEHSKLEFIREIGFTHMRILDGVQSLLQLSGCI
                     AKLCKINMKPQLFETPRT"
     exon            89275..89363
                     /number=1
     exon            89427..89647
                     /number=2
     exon            89702..89801
                     /number=3
     exon            89862..90284
                     /number=4
     exon            90340..90565
                     /number=5
     CDS             complement(join(91506..92396,92458..92652,92712..92984,
                     93049..93070,93136..93389))
                     /codon_start=1
                     /locus_tag="AO090701000035"
                     /note="amidases"
                     /old_locus_tag="AO070270000013"
                     /protein_id="BAE61796.1"
                     /transl_table=1
                     /translation="MDKPQTWKQTASRKHSLRNERLKPYMVSDLDQRLPQVHDVQERS
                     RIHSDPEIQEITDIDNISVLVDQFRTGKFTVEAVTLAYVRRAVIAQQLTNCITEVVFE
                     DALTQARALDRAFQETGHLKGPLHGVPVTLKDQFNIKGVDTTLGYVGRSFAPATEDAV
                     LVQMLRNMGAIILAKTNLPQSIMWAETDNPLWGLTVNPRDPRLTPGGSTGGEAALLAL
                     HGTLLGFGTDIGGSTRIPQSIMGLYGFKPTSSRLPYLGVPVSTEGQEHVPSSIGPMAR
                     DLASIVYVSRSVADAKPWELDPKCTPLPWNEDTFQEIQIRPIVVGLILDDGVVRIHPP
                     IERALRELSAKLQAKGHEVVIWDASDHFEYIQLMDQYYTVDGGEDIRRDIAVAGEPFI
                     PHVEALVNRSKAISVYEYWQLNKQKVALQKRYLDKWNAIRSPSGRPVDILLAPTTPHP
                     AVPHRRLRWVGYTKIWNLLDYPAVTFPVDEVRVAVDGVLKTYQPRNELDAWNWDLYDV
                     KAMEGHPINVQVIGKKLNEEKVLGAATVIERIWRGL"
     exon            complement(91506..92396)
                     /number=1
     exon            complement(92458..92652)
                     /number=2
     exon            complement(92712..92984)
                     /number=3
     exon            complement(93049..93070)
                     /number=4
     exon            complement(93136..93389)
                     /number=5
     CDS             join(94877..94932,94999..96018,96102..96678,96733..97077)
                     /codon_start=1
                     /locus_tag="AO090701000036"
                     /note="predicted protein"
                     /old_locus_tag="AO070270000014"
                     /protein_id="BAE61797.1"
                     /transl_table=1
                     /translation="MGFECTFFQPQKKRGPTGHRVSQIRQQQTHVLSKNPLTPQSQVN
                     SSAFPTTFPYQAEPPPREEGRHDATPWPISGGDVSVPVDLAQSHATAAVAPGWGVDAS
                     PMASHSHSAISWNERSDVEYWLPDNLDAQMPIFDFPGTNIYLRTSLPSIIQNDADSSS
                     LQAQSLETHNIPAPVPDVDVTKQEPSHTRALWPSSIVEANMIPWIDVYFDRLHPTLPV
                     LNRSSLFIRMLSHEHRKNPQFGSMLLSLCAFSLTQPIEIDERPTSQSRAGQARLMMTE
                     ATRMRSCSDFGENPTIEAVLTSFFLFGCLFGSNQHNAAWLRLREALDLAATLGLNDPN
                     SYRDLPGDEKGQRLRTYLVLSITERHPITFWGKPGFSMRSVHDFIHNATHSLVSGIIV
                     HNEKDAEGMMGLARLMELFDAVDEDVVDCWNRRCSIDSGYCEKLTEAKALAIHQNLSR
                     VSESERYKGYDWFERTKSASGETRNTQPAMGLRETQCADVFITKKWLQNRVWVLCSTH
                     GLLKPSSDHHELCFNYCVSVAKDTLKICQSLRLSSMEAHGIGLVEKLYDIAVSAISVS
                     SNVQLSLGNGFTLIPPVTESIPKSSVSPPSFPGSMHSGATTTLPQSLAEDFLLLLNSL
                     RGGNHPYLERYKAFLSASNIRSNTYSNWSSQVQTTHTPSGA"
     exon            94877..94932
                     /number=1
     exon            94999..96018
                     /number=2
     exon            96102..96678
                     /number=3
     exon            96733..97077
                     /number=4
     CDS             complement(join(97403..98491,98543..98839,98904..99137))
                     /codon_start=1
                     /locus_tag="AO090701000037"
                     /note="permeases of the major facilitator superfamily"
                     /old_locus_tag="AO070270000015"
                     /protein_id="BAE61798.1"
                     /transl_table=1
                     /translation="MTCPTSKSGVDTDIHSTVGSDTSDVQHLDLTTTNSHHLSKERTV
                     NVFLLVACVVFGAASFLFGFDDKIISPVAALHPFVERYQGPNPRTGRYTLTAHNQNIV
                     FSVPLVGSILGGLAASPMNFRFGRKWPVLMAYVISISGGLLQVFAPSLAAFVAGRFIN
                     GIAMGIANGTAPLYLSEVVPASMRGRSVTSINILNVAAGVIGTVVVSETKKRGGRESY
                     LIPLAVQCALPVLLFICTLPLPESPQWLVAKGRLAQARSNLRKLRGLSEEQVDVELEI
                     MKLCEQKEREMKANVKFWEIFSRKYLHRTLTAGSFFSLNQVSGVILSTTYVTVFLTEI
                     GMEDSFTLDAFSLTVIASCCTLAGTIAAPFVIDRAGRRPTALVGMSMLLVIDALAGGL
                     AFSKDKRSGVAIVALSLTFNFFWASSFSSLSTLMPSEMATPKLRHHTMAYTIACAQTT
                     TVITTLVVPRLTAPDAANLGAKAYLIFAGCMCCIVVFTFCFLPETKGRTFAEIDELYD
                     AGVPAWKWRTYESSFQLRTDPNLSKPSPNVA"
     exon            complement(97403..98491)
                     /number=1
     exon            complement(98543..98839)
                     /number=2
     exon            complement(98904..99137)
                     /number=3
     CDS             join(100768..102256,102351..102721)
                     /codon_start=1
                     /locus_tag="AO090701000038"
                     /note="beta-fructosidases (levanase/invertase)"
                     /old_locus_tag="AO070270000016"
                     /protein_id="BAE61799.1"
                     /transl_table=1
                     /translation="MPVLAGCEGAAIPANLVSQTQSYNSNLIENSLSCEQQVTSSRHV
                     LYSRPLFHLTAPRGWLNDPCGLGYDPATGLYHLSFQWNPKGNDWGNISWGHSVSQDLI
                     SWKTSPEPCLTPSAEYDSCGIFTGCFRPSDINGVAGALTYIYTSVRRLPLHYTLPYEV
                     GSESLSIAVSRDNGVTWQRLDSNPILPAPPPDLNVTAWRDPYIGVWTAKQGEHDNDIL
                     PPLSLSGFLSGGIAGRTPTVFVYSVNPDDLREWTYVGPLVNVGLNFRPSRWSGDLGVN
                     WETTNWVVLTDHEGTTKNFIIMGVEGCLVSEREQKRVSRSQLWMAVDPRPEQPKSEPI
                     DALTDYAFSGIFDHGCAYAANSFWDPVTSQYIVYCWITEEDLPDGIRHRQGWSGVISL
                     PRSLKLTTLRNVTKTRHSNLSDVTSIEKEANGEGSFTIRTLGVEPDQRLKKLRGEAQS
                     ITNVALWDRQHCGNYLSLTTSRWELEAEFAVGKLCKLVGIEFQHDLDPRNSTVLAWAP
                     CSETFSIHRPPPYDPGINHNPEIAPHTLFTFADESGMEKEETLRIHAFLDRNVLEVFV
                     NERTVISTRIYTPCVESVSRLRFFAELDPSAPNLKHAPAVLLKADLWDGLEAS"
     exon            100768..102256
                     /number=1
     exon            102351..102721
                     /number=2
     CDS             complement(join(103902..104696,104763..105788))
                     /codon_start=1
                     /locus_tag="AO090701000039"
                     /note="amino acid transporters"
                     /old_locus_tag="AO070270000017"
                     /protein_id="BAE61800.1"
                     /transl_table=1
                     /translation="MVFLNSESRSANSHAPRDSLELASLASSSPELDARSSSSSPSGI
                     SSSRKLSLEDEDPLSNSHVHSNLNSGGPRSARSYSVSSAFDFGRTLFPLSQTAGGYAP
                     LGAPSALDRESGAADGSLERNKTLTYMNGLSLVVGLIIGSGIFSSPSQVNANAGSPGA
                     SLIAWVVAGLLAWTGAASYAELGGAIPLNGGSQVYLAKIFGELAGFLFTWCAVLVLKP
                     GSAAIIAIIFGEYAVRAVVGAEVEQVNPWINKAVAFGGVLMVTLLNCISTRLAARIGD
                     VFMFFKFIALLGVTIIGVVVAITGLSSNGSANEEWKSGWFKDTSVDISAWAVALYAGL
                     WAFDGWDNTNYVTGEFKNPNRDLPRVLHTAMPLVILCYILANISYFLVLPHSTIEASN
                     TIAVQFGDKVFGKAGALVFALIVSASCFGALNATIFTSGRLVYAAGKEGYLPSIFGHL
                     WTRGSSASNRLQRRSWARQSISRLFGEHFRIGYTPINAMALNSALTLVYVIVGEFKTL
                     VTFYGVAGYTFYFLTVLGLIVLRIREPYLERPYQTWISTPIIFCCVSIFLLSRAVIAE
                     PLQTLIVVAFIVAGVPVYYWRIYQRDGQITLPGWKFWQAR"
     exon            complement(103902..104696)
                     /number=1
     exon            complement(104763..105788)
                     /number=2
     CDS             106138..107277
                     /codon_start=1
                     /locus_tag="AO090701000040"
                     /note="predicted protein"
                     /old_locus_tag="AO070270000018"
                     /protein_id="BAE61801.1"
                     /transl_table=1
                     /translation="MKPRTSARTLSLFSSPFPLYRSVGRIRRRHAFSSSSPASSPSEQ
                     CPWLRVAIVTIAAAGVGAYIKSREESKSTTLNPITFTPYYLVSKEPVSSTGSIFTLKA
                     PKPASDNCQVYDEAWKTGVWSVMFKQPQLQIGRDYTPLPPTSVEEDESLRFFIRRDPF
                     GEMSRYLHGLDMGTRIEMRGPQIECEIPVDTQQILFIAGGTGIAPALQAGHTLLRRTD
                     GTHKPRIHILWANRRRDDCVGGTNDNIMTSRSRASWFSGFLKSPPADPSPADPVKSTA
                     PFPSLIVRELEALKSQYPGQITVDYFVDEENTFIGKKAILDVADSATPVEGSQKRKMI
                     LVSGPEGFISYMAGPKLWAQGMELQGPLQGIIKELDLKDWAVWKL"
     exon            106138..107277
                     /number=1
     CDS             107614..109941
                     /codon_start=1
                     /locus_tag="AO090701000041"
                     /note="aconitase/homoaconitase (aconitase superfamily)"
                     /old_locus_tag="AO070270000019"
                     /protein_id="BAE61802.1"
                     /transl_table=1
                     /translation="MQSRLMPSGGPGRRWAFLRVPSTPQRRAFASTRFYFQDIFQSQL
                     EDPSSAAVYSSLQASRAVPQTLTEKIVQKYSVGLAKDKFVKSGDYVTISPHRCMTHDN
                     SWPVALKFMSIGATKLHDPKQIVMTLDHDVQNKSEKNLQKYRQIEDFAKHQGVEFYPA
                     GRGIGHQVMVEEGYAWPGTLVVASDSHSNMYGGVGCLGTPIVRTDGASIWATGKTWWQ
                     IPPVAKVTLTGVLPPGVTGKDVIVALCGLFDKDDVLNHAIEFTGPEETMRSLSVDARL
                     TIANMTTEWGALSGLFPIDNVLKGWLKGKATTAAMGLAEGPFKTLAPQHFTHPLLEQL
                     FANPLTADKGAKYAKELFLDLSTLSPYVSGPNSVKVATPLKDLEAQNIKVNKAYLVSC
                     TNSRASDIAAAARVFKEAAEKNGGKVPKIADGVEFYVAAASIPEQLAAEEAGDWQALL
                     DAGATPLLPGCAQCIGLGTGLLEAGEVGISASNRNFKGRMGSTDAKAYLGSPEVVAAS
                     ALTGKLSGPGWYQAPEGLTEVVRGEGDGIREEDRMLTAEQALEKLIGQIDNLVADGEK
                     QFAPEESEESSGDSLTEVYPGFPERVSGEIVFCDADNINTDGIYPGKYTYQDDVSQET
                     MAQVCMSNYDAQFSSIAKEGDILVTGFNFGCGSSREQAATAILAKKIPLVVSGSFGNI
                     FSRNSINNALMGLEVPRLINRLRESFSGEGSDKSLTRRTGWTLTWDVRRSRIEVQEGE
                     NGPKWTHQVGELPPNVQEIIAKGGLEKWVKNEIGA"
     exon            107614..109941
                     /number=1
     CDS             join(110679..111064,111134..113265,113316..113395)
                     /codon_start=1
                     /locus_tag="AO090701000042"
                     /note="ankyrin"
                     /old_locus_tag="AO070270000020"
                     /protein_id="BAE61803.1"
                     /transl_table=1
                     /translation="MDPGSIFGVISGAVQLVQVITQTAAGLATLREKFSHADLTIRSL
                     IGELVTIKSAITQLDEWARYNTRDTAEENEYDEGLFVALDGCRAVMDVLSDQVAALTR
                     GNDTQFGIGTRVKILWNEDIMRAHQDRLMTGKFGLTHRSRSTSEQVELLRKAENRQII
                     QKVASDTATLRSSSSYAASRADSSSLSYRQSSSGDTIFDFDRRLLSSPPYRRVLHRSW
                     SRTESQSTASNGNESRSTDEGYGSGSVNRPNMPRASSLVLPVLPYDTIRPGHGHSKSV
                     SFRPSNVQPNSTQFQRWQSDSTSSSPISRSSSSKREKIRAAFRQLGRSKSVAQAPIRA
                     LTGGSTAARRINGRDMHTSIDLTTPEGAAAPLIVKTAQSGSRSDVERLIESCHDIEAC
                     HVNTRRNALLVASHCGNEEIVELLLQRNARLNVTDKSGSTALHLAASRGHCEVLKLLL
                     LEGSDTEALNTRGRTALWLAAERGQLEAANILIAGLAKVNTRAENQMTPLHTAAKGGH
                     EAVVEFLVLNGADLEARDGTMMTALHHACEEGHLGVVELLLNHKANIDAVGSDNRTPL
                     ICAAAMGRLQVTQALLKRKASTRQVDDASMTALHWASYNGHTEIVDLLSQKKDILAMT
                     NIAGRSALHLAVLNSKFAVVELLLRKRAPMETQCHSGFAPLHYACITKTDYTGIVKLL
                     LISGANIEVQTKDQQRPIHLAAARGSIALLNLLCDKGASLIARDAIGDRALCAACRYG
                     HTAAVQCLLDRDSPLSLPYDDKLQEDSPLCLAAIGGHLPIVTLLLQRGASVLKRDEQG
                     WQPYHHAAHYGHVDVLRLLLSCSPTGWVMEGAGEGFTTERIGLVERVTTAASGNDPEQ
                     SAQDPSIYG"
     exon            110679..111064
                     /number=1
     exon            111134..113265
                     /number=2
     exon            113316..113395
                     /number=3
     CDS             complement(join(115178..116773,116855..116926))
                     /codon_start=1
                     /locus_tag="AO090701000043"
                     /note="mitochondrial GTPase"
                     /old_locus_tag="AO070270000021"
                     /protein_id="BAE61804.1"
                     /transl_table=1
                     /translation="MGTLPSTPFRLHLAELLLRLCGYQIYQALCPKAALPRPRFAAVR
                     TLFDPTREPSSSSALDAGALVLYFPAPNTVTGEDVLELHLHGGPAIVKSVLTAISRVS
                     QPDSLVRYAEPGEFTRRAFMNNRLDLPQIEALGDTLSADTEQQRRLAVRGASDALSRR
                     YEQWRQQLLYARGELEALIDFAEDQHFDESSDELVLSVAAQVQALRVQVGFHIQNASK
                     GELLRHGIKIALLGAPNAGKSSLLNQIVGKEAAIVSTEEGTTRDIVDVGVDLSGWYCK
                     LGDMAGIRSEPVNGKESVVIGAVEKEGIRRAKARALESDVVIVVLSLERGAFDDIPYQ
                     LSIEQEVVEAVNDCLAADKCIVIAINKCDRLPLDVHNSQFLPEQLLASVSDLFPTVPQ
                     KRIFGISCREAQLESALERKDPGHLQEFLRGLISTFEEIASPSGIEGDANGDYNLSYW
                     EDSLGVTHRQSSNLQRCLQHLDDFLAQTSRKHAPSMLGHEHEQQPIEMEIDIVTAAEH
                     LRFAADALAKITGKGESGDVEDVLGVVFEKYVSLLIRRSIGSLLTVY"
     exon            complement(115178..116773)
                     /number=1
     exon            complement(116855..116926)
                     /number=2
     CDS             complement(join(118077..118877,118953..123593))
                     /codon_start=1
                     /locus_tag="AO090701000044"
                     /note="Rho GTPase effector BNI1 and related formins"
                     /old_locus_tag="AO070270000022"
                     /protein_id="BAE61805.1"
                     /transl_table=1
                     /translation="MPTITSSPDKSRQTSAGKSFFGRKLHKEKPVEDRYDGSGSFENL
                     APPGSSAGSRSSRHSKRSSVQSVDYPHDIDPSGLSMTAGVITSIPFESLPADTKTPIP
                     IEYLSKPEPSRKEQTSSHPSPNHLAKGASDFHQYPAWNPSSVRDNNTYSHPTGPRPPP
                     HASNLTMTGSNTGDKGARYQQWGRPGSSAANTGFSHNSSSTVDSSSNSRISFDQASVH
                     SSLSSNTRGSSYFSSDGSSRTLTTHSADRSTYFPGGNPNRLSTQSNWQPPPAAQPRPP
                     PINTEQYLARPRDDRVVDQLFLELMQKRGWQNLPEQAKRQMLAYPASKKWTLVHQDRL
                     TELQGEQKRRQNARQTHGHDGPAGILERADEEGSPEWYVKKVMDDSITSKQLASLSVS
                     LRTQPISWVKAFVEAQGQIALTNVLLKINRRKASGPVPAPPTGDKDLDHEYNIVKCLK
                     ALMNNKYGADDALAHQQVIIALVSSLLSPRLNTRKLVSEVLTFLCHWAEGHGHQKVLQ
                     AMDHVKNHQGETGRFDAWMRIVEVTIDGRGKMGSLVGASEEYRSGGIGMENLLMEYAV
                     STMLLINMLVDAGENDLQLRCHIRAQFISCGIKRLLTKMEGFQYEVIDKQIERFRENE
                     AIDYEDLLQRESSSMKDSIEGEVKDMSDPLQITDAIATKIQGTRAHDYFLSAMQHLLL
                     IRENSGEDGLRMYQLVDAMLSYVAMDRRLPDLDLRQGLTFTVQSLLDRLHTDAEARRA
                     YDESLEARQIAEAAIAERDEMKAQIELGADGLVKKLQKQIDEQTGIIELQSRQNEMIK
                     AEVADLQRLRAQELQRNELETRELYLMLRDAQDIAASNAKKNNMAETDPSHMRGILDR
                     EKLLERLEMQLERTKTQFKLEGKVWGQHGPSDRLRELREQMDGEPEPNDDFQEHARRN
                     LDSNALGSVYRKRSLVSGGDDTAGEGLEQTTNEDGEIVYEKARLVDIQRPRMNPAQAT
                     GLLGEITAKVPKIGAEEGETKAAVDESPFPEAETPAIRVDEPKGESTDEKVNSTAVAG
                     PPPPPPPPPPPPPGMGVGVPPPPPPPPPPPPPPPGSATGVPPPPPPPPPPPGMGAGIP
                     PPPPPPPPPGAAGKMPPPPPPPPSGASFGAPPPPPPPGASVGGWRANYMASQAVPSKS
                     TVFLPSIRPKKKLKALHWEKVDAPQVTVWASHALTPQAKEEKYTELAKKGVLDEVERL
                     FMAKETKIFGGSAAAKQRKDKKQLISNELSKNLQIAMAKFSQYPADDVVRMVIHCDAD
                     ILDNQVVMDFLQRDELCTIPENISKQMAPYSRDWTGPNAASSEREQDPAELTREDQIY
                     LYTAFELNHYWKARMRALALTRSYEPDYEHISAKLQQVVKVSESLRDSVALMNVLGLI
                     LDIGNFMNDANKQAQGFKLSSLARLGMVKDDKNETTFADLVERIVRNQYPEWEGFVDD
                     INGVVALQKLNVDQLRTDAKKYIDNIKNVQASLDAGNLSDPKKFHPQDRVSQVVQRSM
                     KDARRKAEQMQLYLDEMIKSYDDIMVFYGEDNTDEGARRDFFAKLAAFLLEWKKSKEK
                     NISLEEARRRTEASLARKRNNAALANNAGSGETSQLPASSGAMDSLLEKLRAAAPQAR
                     DQRDRRRRARLKERHQIRVASGQRMPDLPGAEGAEGGGINDGNEVSDNVASIDEPSTT
                     ETGLLSPLSLGSEPGTTSKDSTQISESEDVADRAASMLQGLRDNTDGERSRRRKESAE
                     EERRKRRLRRRNGPTAGSKESAEPMTPSTTDSKGLEESITTSPEDASSQRPVTPVIVV
                     SPTTEQHHRSSSDDEPNADSPGRFSEPSN"
     exon            complement(118077..118877)
                     /number=1
     exon            complement(118953..123593)
                     /number=2
     CDS             join(124381..124407,124472..124891)
                     /codon_start=1
                     /locus_tag="AO090701000045"
                     /note="predicted protein"
                     /old_locus_tag="AO070270000023"
                     /protein_id="BAE61806.1"
                     /transl_table=1
                     /translation="MGSASSFAKTIVIPAAISLALYLLLSFLIIPFFRRYHQRYSQYL
                     PLHTISAHTSTLRDRVADAMMRLFLPAAWRQQARFDDQHDNISIFDEEGEIMVGMDMD
                     PARREALERRRSTVAEPESRLSRELEEGFMDDSDEEEDGRQGPRGH"
     exon            124381..124407
                     /number=1
     exon            124472..124891
                     /number=2
     CDS             complement(join(125835..126181,126244..126788,
                     126855..127030,127101..127115))
                     /codon_start=1
                     /locus_tag="AO090701000046"
                     /note="glyoxylate/hydroxypyruvate reductase
                     (D-isomer-specific 2-hydroxy acid dehydrogenase
                     superfamily)"
                     /old_locus_tag="AO070270000024"
                     /protein_id="BAE61807.1"
                     /transl_table=1
                     /translation="MVLYDGGEHAKQQPGLLGTTENELGLRKWLEEQGHTLVTTSDKE
                     GENSTFDKELVDAEVIITTPFHPGYLTAERLAKAKNLKIAVTAGVGSDHVDLNAANKT
                     NGGITVAEVTGCNVTSVAEHVVMTILTLVRNFVPAHEQITRGEWDVAAVAKNEFDLEG
                     KVVGTVAVGRIGERVLRRLKPFDCKELLYYDYQPLSPEVEKEIGCRRVDTLEEMLAQC
                     DVVTINCPLHEKTRGLFNKDLISKMKKGSWLVNTARGAIVVKEDVAEAVKSGHLRGYG
                     GDVWYPQPAPKDHPLRYVQGPWGGGNAMVPHMSGTSIDAQIRYAQGTKAILESYFSGR
                     HDYKNEDLIVRGGDYVTKAYGQRNKA"
     exon            complement(125835..126181)
                     /number=1
     exon            complement(126244..126788)
                     /number=2
     exon            complement(126855..127030)
                     /number=3
     exon            complement(127101..127115)
                     /number=4
     CDS             complement(join(129374..131680,131734..131874,
                     131940..132458))
                     /codon_start=1
                     /locus_tag="AO090701000047"
                     /note="Leucyl-tRNA synthetase"
                     /old_locus_tag="AO070270000025"
                     /protein_id="BAE61808.1"
                     /transl_table=1
                     /translation="MLSLSRLRLGPTRTFLAQARWKHGCCLPSVPALTRFATTVTPKG
                     NTRKLDLPAIDRKWQEKWHSKKSNLPSIASETKGNTEKPKSYILSMFPYPSGTLHMGH
                     LRVYTISDVLARFYRMRGHEVLHPMGWDAFGLPAENAAIERGIDPAEWTKDNIARMKE
                     QLRSISTSFDWDRELATCAPEFYEHTQRIFLMLYKKGLAYQAEALVNYDPVDKTVLAN
                     EQVDANGFSWRSGAKVEKLNLKQWFFRITDFKEALLNDLDSLAGGWPERVLSMQRNWL
                     GKSYGAKVKFPIAAEGIGCGSTEIDVFTTRPDTLYGVEYLALSLNHPIVLAAAETDSK
                     LRKFLDEAASLPPDSKTGYKLSTVTASHPLHIIDRESPHVARRLPIFAAPYVLSDYGE
                     GAVMGVPGHDSRDLAFFKENVQPESIPVVIEPHRASDAESGASAGHLPAGDMKAYTHE
                     GFLNSRCWKYQGLHSREAGQQIINDLRAVGHGDTVEQWRLRDWLISRQRYWGTPIPII
                     HCGDCGPVPVPDDQLPVKLPKIEGDWLKGKRGNPLESSDEWVNTECPRCQGPAKRDTD
                     TMDTFVDSSWYFLRFLDSANRRQPFSPSSARPVDVYIGGVEHAILHLLYARFIYKFLA
                     KSGLFPEIAHVGDVSRPLEPFKTLLSQGMVHGKTYSEPSTGRFLHPSEMDLSSPDKPV
                     IKGTQITPNVSFEKMSKSKHNGVDPTACALKYGADATRAHVLFSAPVSEVLEWDETKI
                     VGVERWFGRVWKLVQDAQQTLASSSYTFNPDELMLSNHATALPYSPQNLSGNDADAVL
                     FTHRTILSVTSCIENNPYGLNTVISDLTKLTNSLTSSTPSSPQVLYLCISSLLRLLAP
                     IAPALASESWETLNEPIIGRYPKNESIDNAYDVPPIFDCPWPTALLTSEQTDVLSARG
                     GQTVAVQINGKLRFTVTVPRQLSPTTDESSEQDFIINRILETDEGRTWLREKNDWEKR
                     RRVIVVKGGKLVNIVF"
     exon            complement(129374..131680)
                     /number=1
     exon            complement(131734..131874)
                     /number=2
     exon            complement(131940..132458)
                     /number=3
     CDS             complement(join(133740..134447,134500..134868))
                     /codon_start=1
                     /locus_tag="AO090701000049"
                     /note="predicted protein"
                     /old_locus_tag="AO070270000027"
                     /protein_id="BAE61809.1"
                     /transl_table=1
                     /translation="MTLRPVLCRVTNRTPTARFLSATACRASSLRVPLDIPPPFPVTK
                     SCPEPSCSCPTTPPMPYGLPIDYNQPLNGTMVAYAQQILICTGQRDWTSRIEDDGKRH
                     TWGHLVRGLKRLLGRGGRYADMKPFNNILVSNSSFSPSAASTSTPSTASAFLFPSFKY
                     FPSIPTEILDSTDAGTDLSTFVQAYLLPKKLSAMSESLPEVKKAELTRKPELECEFAD
                     VVDLDHSPVILICGHGGRDMRCGIMAPVLENEFRRVLGDKGFTLAGSGDHTIDSPGHA
                     HVGLISHVGGHKYAGNVIVYIPPGMRKKSSSSPHSLAGKGIWYGRIEPRHVQGIVEET
                     ILGGKVVADHFRGGIDRSGDILRL"
     exon            complement(133740..134447)
                     /number=1
     exon            complement(134500..134868)
                     /number=2
     CDS             complement(join(135317..135844,135910..136290,
                     136453..136527))
                     /codon_start=1
                     /locus_tag="AO090701000050"
                     /note="prenyl protein protease"
                     /old_locus_tag="AO070270000028"
                     /protein_id="BAE61810.1"
                     /transl_table=1
                     /translation="MISFISNRSSSDEPVISAQTAAFFSICLTLVYVVPFYVSSTTRP
                     SPTLSRDAPSVIRARIKAVTLSCVGSTLAVSWLIIAKGNVSLLEALRFLGWWPVGFAE
                     VLRSLLLTAILFAGPLFERGIAEGEWRDWIKGNRIPETLRGWIGWRNYVAGPVTEEVM
                     FRSAIIPLHILAKVSPGRIVFTAPLYFGIAHVHHFYEFRLTHPDTSVLAALLRSVFQF
                     GYTTIFGWYATFIYLRTGSLLAVILAHAFCNWCGLPRLWGRVEAGVPLGPPLVKGKND
                     TDRGPVYAYNQLGIGWTIAYYAILVGGATSFYYTLWPLTESSSALVTFTGP"
     exon            complement(135317..135844)
                     /number=1
     exon            complement(135910..136290)
                     /number=2
     exon            complement(136453..136527)
                     /number=3
     CDS             join(138722..140818,140869..140895,141013..141024)
                     /codon_start=1
                     /locus_tag="AO090701000051"
                     /note="predicted protein"
                     /old_locus_tag="AO070270000029"
                     /protein_id="BAE61811.1"
                     /transl_table=1
                     /translation="MRSTGSSTTSSPGRRALHERTSSQTNEVSPPQSLRAVSDKHNGQ
                     EDECDVYTATPYPTKPEHILLPRPGKGQEFIPDSRFHVEEMPNESSATLSTEISHILD
                     SSLIEQSTGDPWDLSSTFDAANTPPQVWEDDPASSKSSLPESGPTEHREVEFKSDDVS
                     YSDEEPNTLPGAAPTIKTVVSDTSSGQPPHPANAASSNSSPNVVPIGPSSSPNFVALD
                     SSSLNFVPIGASSNPDSGSRSNSLSSLNSLGTVIRYIGAAPWTHGSSSEQSSSRSYSF
                     RSNPPYQGPSARSNSTRARERSHSRSITSSSRSDPSSDIQAIVDSGVFLQYPTIHAPS
                     SASSRVDVSHSADSLDNTQHETTADGASEHFKSHLSTVTSRWSAEYDSRSASPADRAE
                     NTPEPSRPTAAHVRQRPTSSSVWLINSTDGDEYLDDVSSLPARPANPAVPSSHSSGSR
                     QSSVRSTKRPGTSSSLAFNVLPTWAKMYYGQPVGSALSLVEGSRPSSARPTTPNSNPL
                     HRLTTAATRPRTRTNETGRSIRWMSKPDPRDPRSHWVKGPEVAERPGHSRHQLRHSWS
                     PHLYPDRRNVRPRGSAWGAPSMDSRREPFLGRRNIQVWSFCLGFVFPLGTCTRTWKSQ
                     LWCLLVFSSAWLIAAFLPLPPKPEMILQEDSEPGREKTLQMRVLDLERKRYENARWWR
                     NLNRWMIPLGLVIITIIITLAVVGTKLFD"
     exon            138722..140818
                     /number=1
     exon            140869..140895
                     /number=2
     exon            141013..141024
                     /number=3
     CDS             complement(join(141904..142382,142436..143554,
                     143740..143761))
                     /codon_start=1
                     /locus_tag="AO090701000052"
                     /note="predicted membrane protein"
                     /old_locus_tag="AO070270000030"
                     /protein_id="BAE61812.1"
                     /transl_table=1
                     /translation="MLPYVDLLKLIASFLLSYPLAALLKRIPDAQPWKKNAFIIAVSL
                     FYLVGLFDLWDGLRTLAYSAAGIYAIAYYIDGSLMPWIGFIFLMGHMSISHIYRQIID
                     DAHVTDITGAQMVLVMKLSSFCWNVHDGRLSQEQLSDPQKYAAIKDFPGILDYLGYVL
                     FFPSLFAGPSFEYVDYRRWIDTTLFDVPPGTDPSKVPPTRKKRKIPRSGTPAAKKALA
                     GLGWILAFLQLGSLYNQELVLDETFMQYSFVQRVWILHMLGFTARLKYYGVWYLTEGA
                     CVLSGMGYNGFDPKSGKVFWNRLENVDPWSLETAQNSHGYLGSWNKNTNHWLRNYVYL
                     RVTPKGKKPGFRASLATFVTSAFWHGFYPGYYLTFVLGSFIQTVAKNFRRHVRPFFLT
                     PDGSRPTAYKKYYDIASYVVTQLTLSFAVMPFIFLSFGDSIKVWHSVYFYGIVGNIVS
                     LAFFVSPARGLLLKKLKARNKPHVPRAVSSENIRQPTLGLPNDAIQEFDDAVQEIRAE
                     IESRQRRGSLAHMPIGDELKAAVEDKIGRGH"
     exon            complement(141904..142382)
                     /number=1
     exon            complement(142436..143554)
                     /number=2
     exon            complement(143740..143761)
                     /number=3
     CDS             join(144215..144334,144398..145423,145485..146123)
                     /codon_start=1
                     /locus_tag="AO090701000053"
                     /note="vacuolar sorting protein VPS45/Stt10 (Sec1 family)"
                     /old_locus_tag="AO070270000031"
                     /protein_id="BAE61813.1"
                     /transl_table=1
                     /translation="MDVVAAVSGYISKMVTAGDPSTSGSSTSAKMKILLLDSETVTIV
                     STAITQSALLNHEVYLIDRLDNAAREKMRHLRCLCFVRPSASSIQLLIDELREPKYGE
                     YYIYLSNIIRKSSLERLAEADSHEVVRAVQEHFADFIVINPDLCSLNLGFPQQRLWSH
                     SPDLWNADALQRATEGVISILLALKKNPLIRYEKNSLLAKKLATEVRYQLTQEEQLFN
                     FRKTDTPPILLVLDRRDDPITPLLTQWTYQAMVHELMGIHNGRVDLRDVPEIRPELRE
                     IVLSQDQDPFFKKNMYQNFGDLGQNIKEYVEQYQVKTKNTMNIESIADMKRFVEDYPE
                     FRKLSGNVSKHVTLVGELSRRVGEDDLLDVSELEQSLACNENHASDLKNLQRIIQLPS
                     VAAENKIRLVALYAIRYEKQPNNALPILLDLLVTAGNVPSYKVNTIPKLLAYHHSLQA
                     PPVAGGFSDLFESTSFFSGARDRFKGLKGVENVYTQHSPRLEATLQNLIKGRLKELQY
                     PFLESGGHIRDKPQDIIIFMVGGATYEEAKMVAQVNASSPGVRVVLAGTSIHNSTSFL
                     EEVDDAVSGWPEPAPSSAAGRLRREITR"
     exon            144215..144334
                     /number=1
     exon            144398..145423
                     /number=2
     exon            145485..146123
                     /number=3
     CDS             join(146517..146657,146744..147712)
                     /codon_start=1
                     /locus_tag="AO090701000054"
                     /note="dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /old_locus_tag="AO070270000032"
                     /protein_id="BAE61814.1"
                     /transl_table=1
                     /translation="MELHNSSPKPLNASSPSATGAREPKLHLPTTTDPPGPQNPPKPL
                     VWLIFGATGHMGRSLVKTALSRDDLVAAVGRTFENSPEYMKKLEEEHDNCLGLLCDVR
                     ARETVKRVIDRTIERFGRIDIIANCAGYGVIGACEDQDEYDIRDQFETNFMGTLNMIQ
                     LSLPHFRERKSGRYLIFSSTSGALGVPGLGPYCASKYAVEGLMESMLYEVDNFNIKTT
                     LVEPGHMRRDDIGDLVSDTAMLASQNENDLASPLPLYGHFFVKPPSEPYNTPTAPAAH
                     AKRMLMWLGDKQPASAVKAAYLVWELGHCSYPPLRLILGTYAVESIRDRLKCIIEEIE
                     DWKYLSFPHGDQHPSPAKDKMPTNARENEAGETAT"
     exon            146517..146657
                     /number=1
     exon            146744..147712
                     /number=2
     CDS             complement(join(148403..151708,151782..152779,
                     152867..153032))
                     /codon_start=1
                     /locus_tag="AO090701000055"
                     /note="targeting complex (TRAPP) subunit"
                     /old_locus_tag="AO070270000033"
                     /protein_id="BAE61815.1"
                     /transl_table=1
                     /translation="MGADPLSPIAPARLRALLLPVGKIKRSRFLSFTARLQAENVVRL
                     GDISPDARPNRNMFSPLAFPTGMILYDLTFSVPPTSHLELFPFEIHREPLVVIAVADG
                     VELNGGNEQKIEESTFKGKNEASPTPAGLDQLRQELELLRERNPKALVHQLLIFDYEE
                     VGKLLNGPDDILWIPRPEASKATTMKTVLCDITSLLLSELDGFARTMQSIPSIESPKA
                     FSWGPHRGPDIRPRPTDRLFHRMTMPAQLPSNPNGTPETPLSSSQGSPTPSDHETPTT
                     FDEITRSIQLSSRSNSIGKPNSLPSSKEHSRDRMSVSSMSATDRTKNRIKGRAGVVIG
                     TLFLQAGRWPDALKELVEAASNARACSDYVWHAKALESILLCLLMFAWAGMDFQIPPI
                     CYPVADKSSKTSYNFESTSGQSTPGNRIISLQNLSNLLPDLSNNILNLYNRAANIVNA
                     PLPQLIFSETVIRLGRLLVAARIRDGALDDIALKHIVMGDPLQPLHRPERPRGLVILR
                     KSEIANFLLRALPLSPGSDLPATDAIPIMIGVVSVFDTLGLPRKKAFILRELLSILVP
                     TLVQARKIGAAEVGIHPAAGLASLSDTAFDINALDVGPGNMEESMRSLLATIGEIYGV
                     QPSSFYEWQKRCSANDNGAESFPEYDSVAAIVERSFRHAVLDGYGDLNLKIDVLKACI
                     NSCEALPDFGGVLRFTVELLQTIKGDLMLAETLHTPPCLPQDEQVRLLNNIKRTVGAA
                     NKLGASGLEAEYWDDFLVRGVQLLALPDFRSPVRRSKSELYVVTADREKSSKDPFLYN
                     PFHKPSNKTAELLMVAGEHAAFQLTLQNPYEFEIEIEKLRLDCEGVPLDAVAEWIVLR
                     PLSLQGITIFGLAHEEGVVNITGCFVKVRHCRERRFPIFKDLWRPEAERKFKRTGLAA
                     KQPSMERPLSWSSTTSRDGKQLPKKGPDTSSCEIKVIGCQPSLVIESLSLSQSAFMVL
                     EGEVGSFRITLRNTSSCPLDFILFTFQDSTTRQIQNALSNRDLLPVEVYELELKLSKP
                     ALRWRREGKNPGDHAIPPGECATFTVDVTGKPGLQDSTVQIDYSCVGQSHGELPDVFY
                     TRQLFVPLTVTVNASIEIARCEILPFSGDFAWWNCREADVEPEYTAKADTDGSACPLS
                     SDLFSPVLSHLGRGTYGSDHCLLLLDLRNAWPSPLTVSLQANEQPVELSEQSIEEAEL
                     VDSRYIVSGELQPGQTSRFVLVLPRVYLDNPHASIPVLNTGVKRQFVVSAHKLSFDAE
                     AASREAFWYREELLKRVSGFWTESPAGRKGMIDLRNLRFSSRMVDAFRLEDVDITFAL
                     SPPSSDIISPNGDSVVQIGRSKYKVQIDEMLSLNVTIRNRSSRPIHPILRLQPSLRHQ
                     PNNIALDLSKRLAWTGMLQQVLPVIHSGESTTATVGVTILCRGEYEFGASVEELRFLR
                     PSPGTESDTHPQAQAQASFHDDDGPIKDTFGVDVAKKRHIWHAKEACVMNAHG"
     exon            complement(148403..151708)
                     /number=1
     exon            complement(151782..152779)
                     /number=2
     exon            complement(152867..153032)
                     /number=3
     CDS             join(153740..153867,153928..158937,158994..159078)
                     /codon_start=1
                     /locus_tag="AO090701000056"
                     /note="predicted protein"
                     /old_locus_tag="AO070270000034"
                     /protein_id="BAE61816.1"
                     /transl_table=1
                     /translation="MTQNIDFNALKARTMGSGNDEEAVTVDTRGLISKVLARYSGKWT
                     VLREMIQNAADANATKVTIKFETLPSTVVPLPSHADNTTLIKHTISHHTLRRLLISNN
                     GSPFSEKDWARLKRIADGNPDETKIGAFGVGFYSVFDDCEEPFVSSGKEAMAFYWKGN
                     ALYTRRLQLNDAPNPETTFVLDYRNDTSPVPSLMELCQFLSSSLTFVSLESIELWLDD
                     WNLLRLTKKAAPSIDLSIPRDIETKTSQGLMKIVNVTREVAQVDATWMRAVEWNPHAN
                     LLREGLRDTAGSLRTFFSRLTGQGGSEKPVKSESNPNINDAEDMTKASTASVFLHINT
                     ASIQCSISQSLSSELERATRKPPPKKSTLAVLTPSYDTTLASGTSGLQSDILSSILPS
                     KAGRVFIGFPTHQTTGLNAHISAPSVIPTVERESIDLNTRYISKWNLEMLRAAGIVCR
                     VAWSAEMASIKSKIQPTKSSKIRKDDIVGVLPEAIHTANQFVFRESTPSSVLGQTIED
                     AFWTCNKNASIEVLSTCGIIQSHQARIAPKDLSFMDSIPVLPDDFVSNAKDFVRKLTD
                     FGLVTDITVSDIQRELEASTLQSSQILEFLTWLSRRAVSGQLDSLSVQSLLNVAVAND
                     EDSSGAVCRLLVFADMTSYLNPQRIPVELPLPSSVMPFKYTKSLGKQELESLGWTELQ
                     MVPWIHWIVSNAGNRGVLSIEQDITQSSSFSAQVLPVISKQWDVLSQPSKQSVINLLQ
                     PHTIMPTKLGMKRPVETYFSSVRLFDDLPVVRGLNSIKEKFLTALGVRKTVDLGVIFE
                     RLLSTTESSNGGSVSQRKWSHVDLIRYLASVRDDIPASDIKRLKDTSICTAEATETTN
                     DPTKDRRKRYKIYELFEPHDPLRALGLPVIEWPGKYQSNSNEGKFLSMLGLRSFPSPF
                     ELIKIMAKAAAARDWTLHGKAMSYYIAEYHNNGYAAFNYEEITVPFLPIEGSDSLSIP
                     SQCFTDEAATLFGFKILRHTLHPHAPKFGVKQHPALTDCLNYLLRQPPSTKRDARVTF
                     KYLAGRVSELKPRDIDRVSSAQIVPVSVKDIPDPESSIRHVAPKLCYLGEGEDYRDIF
                     DFVDFGQEANFFLMAVGSKREPSKIELAYMLVKEPARISSAFQSADKYLKLLRTLAEN
                     ISVLKKDRGLLNEMRCSAFLLASRDISSLAQGNSGKRGLPGSEDDDDEQSIKEWTLTA
                     AKDTVVVDDFQSFNLFKEHILAAPQEETLENFYLALGAVPLKTLVEERAHWGAVASDQ
                     LPAAKLQKLIHERSRLFLHDQPAETIQHDVRWLEKNLRVQVVHSISLTRSLKGRRVSH
                     TQKRSAIITRQSTSWVLWISPGKYDLYEISQALVHLILVRPKLHSTLTLEMLLKTDLL
                     ELKARGYNVERILKQKAHEARMAEDRRQKQLEEERQRLQEREAAWAQERAQAQVQTQA
                     QQAEDKRQHLMPGDFPDSPSPSSKDIGPSSQGEALEQSQDRRPRGLFANLTKRFGLDS
                     GRPASNPLGGDSSQPSAESSNNTPPPPYSAEDPQKSRPEQPVTVSSPHKLQSELLSAI
                     QACRPHGSSNVYSRPETNQVTESKSYCDEKPSHDLEFVATLPCGIHVLFVKTLADRSN
                     FLAKNSAGMNLFASMLIDCASVFSLRADILSVFYDPGGKTIAFNRAGSIFCNYFYFQQ
                     LHEKELLQKPAADRSEALIYWWVILCHELAHNLVGDHSSAHSFYSESFVAQYFPKMAT
                     KLATVNPQTPAPNS"
     exon            153740..153867
                     /number=1
     exon            153928..158937
                     /number=2
     exon            158994..159078
                     /number=3
     CDS             159907..162384
                     /codon_start=1
                     /locus_tag="AO090701000057"
                     /note="para-aminobenzoate (PABA) synthase ABZ1"
                     /old_locus_tag="AO070270000035"
                     /protein_id="BAE61817.1"
                     /transl_table=1
                     /translation="MAPLLGSWTASSAGGPSKAQLHTSTRKNILYVDAYDSFSYNVVA
                     MLEEVLGVKVTVLMIDSEWPEGNKAEFLQYFEAVVLGPGPGDPNVPQDIGIMRDIWDL
                     SDADLLPVFGICLGFQSLCLHHSIAIERLSYPLHGRVYRISTAEKDIFKDLQDVEVTL
                     YHSLYAKLDDSLEAALAEYSGKQIKANADLDLLAWLPIEQDNVSERTIIPMAVRHREK
                     PFWGVQFHPESCKSDRGVCSELLRKWWEMSLDYNKKHGRGGYGFLPEDITRGSSDMTS
                     LPEIAFTMLNWCASTSRSSAFRSLPTSRLNAEFICERLNAPGSPTVLFQSNGRYSIIS
                     VPGPTSWRLEYYAQAEALLVERLQGHCNGHTNSGIKKSLSVYDLWETLRYLMDMKKVE
                     FGDDAVPFWGGFLGYFSYEMGLACLARPKTHSDDNHGYIPLQNAAATTDPADVSLLWT
                     ERSVVVDNETGRITIQSTRNADDKSTGWLDETLQYLTELSRVDVLENENANSDAGYLD
                     TILRQCVIRFPNEQTYKQQLEACKAELEAGESYELCLTCETSITLPSPSTDSERVAFP
                     WKLYKRLREYNPAAFSAYARLGTVKVVSSSPECFLNWDRSFTLEMKPMKGTVRKSASM
                     NMKKAKEILGSTKEMAENLMIADLIRHDLYGICGSGRVRVEKLLEVEDHGRVYQMITH
                     VKGDVDPGRLGFAVRNLPHLHSSNMSAYGLTALQRCLPPGSMTGAPKERSCMHLSLIE
                     ARKRGVYSGVMGFLDLGGGGSFSVLIRTAFSCSDDKDNEQTWRIGAGGAVTILSTADG
                     EWNEMLTKLTTVCGVFAPSDLQGSGKV"
     exon            159907..162384
                     /number=1
     CDS             join(162904..162997,163072..163433,163493..164023)
                     /codon_start=1
                     /locus_tag="AO090701000058"
                     /note="predicted protein"
                     /old_locus_tag="AO070270000036"
                     /protein_id="BAE61818.1"
                     /transl_table=1
                     /translation="MASAQDGSMEEILWRSPAHVQMMGGFLHSNNILFYFAESPFFDA
                     TSNNASLAIQANYNETLRHFVETREAFEGRLKTMQGLEFVVAYDPLQAAAQTETSFAH
                     EPSNIWVIRKQTRRKRAGLEDEVVVLSTYFVVGDCIYMAPSVASVVGNRLLSAVTSLT
                     SLLKTASSLPSFTPSHGHTYLPPAPKPTDSSQPGAQSQQSKENTPMPDADSTKALLVG
                     PQTANAGAILQDTRTFAESFSLLARYGEEFMDENPLVGEPGSFILSKSGDTDRGAASK
                     QPSNVNRPGSIPGKVGTPQVKVDTPGKTPEKGATPSASDDSKIRKKKAKIGN"
     exon            162904..162997
                     /number=1
     exon            163072..163433
                     /number=2
     exon            163493..164023
                     /number=3
     CDS             join(164615..164658,164756..165443)
                     /codon_start=1
                     /locus_tag="AO090701000059"
                     /note="predicted Rossmann fold nucleotide-binding protein"
                     /old_locus_tag="AO070270000037"
                     /protein_id="BAE61819.1"
                     /transl_table=1
                     /translation="MASVQQDKPAVVCVFCGSVSGNNSVHLETARALAHEFHRNNIQL
                     VYGGGTAGLMGELARTLVSLSGPQAVHGIIPRALVKVEPGYDNAQEERNPSTVVSGKE
                     AERVVKEPMGKIGTLKESEYGYTTIVPDMHTRKRMMAEKVREGGPGSGFVALAGGFGT
                     IEEVMEMTTWNQLGIHKLGMVLLNANGYWDGVLAWVKNSVQEGFVSPENGEILVEAKD
                     VREVWPKLVGYKISNGRMQLNWGEE"
     exon            164615..164658
                     /number=1
     exon            164756..165443
                     /number=2
     CDS             complement(join(165759..166388,166476..166587,
                     166954..166982))
                     /codon_start=1
                     /locus_tag="AO090701000060"
                     /note="20S proteasome, regulatory subunit alpha type
                     PSMA1/PRE5"
                     /old_locus_tag="AO070270000038"
                     /protein_id="BAE61820.1"
                     /transl_table=1
                     /translation="MARVPMQSLSSPQGRIFQVEYAQEAVKQGSVVVGLVNKTHAVLV
                     GLKRNAEELSSYQKKIIEIDSHMGIAIAGLASDARVLSNYMKQQSLGSRMTYGRPIPV
                     DRIVTQIADRAQTNTQHYGKRPYGVGLLVAGVDEAGPHLFEFQPSGMIHEMLACAIGA
                     RSQMARTYLERNLDKITNSTRDELITHGLRALKETLSQDKELTVDNTSVGVVGLAGEE
                     GKGKIESFKLYEGQQLVPLLEAVESGETKEEETMEVDS"
     exon            complement(165759..166388)
                     /number=1
     exon            complement(166476..166587)
                     /number=2
     exon            complement(166954..166982)
                     /number=3
     CDS             join(167150..167188,167273..167486,167607..167740)
                     /codon_start=1
                     /locus_tag="AO090701000061"
                     /note="predicted protein"
                     /old_locus_tag="AO070270000039"
                     /protein_id="BAE61821.1"
                     /transl_table=1
                     /translation="MTAGLKTIIALSFVLAIGFLLVILSSALWHNFLPLIVVATYVVA
                     PLPNWICSRCANPDDFMDSSGNAAADFGRFLTGFLVLMGIALPAVLAHSGAIQVPAMI
                     MSILGGLLIYGTIISFSMFFKEQEEF"
     exon            167150..167188
                     /number=1
     exon            167273..167486
                     /number=2
     exon            167607..167740
                     /number=3
     CDS             join(170131..170229,170289..170549,170650..170747,
                     170804..170867)
                     /codon_start=1
                     /locus_tag="AO090701000062"
                     /note="predicted membrane protein"
                     /old_locus_tag="AO070270000040"
                     /protein_id="BAE61822.1"
                     /transl_table=1
                     /translation="MDVSNNRLFRFSKPEWLNNNSVRNAGVYTSGALFSLGFFFLVDA
                     AAFSHSSRNGSNVHVKFVDWIPGICSALGMLVINSIEKSRLHADSWSYSGSGVAWKAR
                     FVLFLGFALLAGGLAGSVTVMVLKYLIKQYPLQTLYFGIANVVANGLVMLSTIVLWIS
                     QNIEDDYTYNLAL"
     exon            170131..170229
                     /number=1
     exon            170289..170549
                     /number=2
     exon            170650..170747
                     /number=3
     exon            170804..170867
                     /number=4
     CDS             complement(171661..172311)
                     /codon_start=1
                     /locus_tag="AO090701000063"
                     /note="armadillo/beta-catenin-like repeat-containing
                     protein"
                     /old_locus_tag="AO070270000041"
                     /protein_id="BAE61823.1"
                     /transl_table=1
                     /translation="MDANMNNLLKWSIQNSTTQQSDAPNASNNTADSSARGLTPEMLS
                     ALFGGPSDADLMKAAMEALHSDEVDLENKLIAFDNFEQLIESIDNANNLEPLGLWTPL
                     VELLQHEEAEMRRMAAWCIGTAVQNNEKAQDKLVVFNAVPKLVTMSTTDSNPATRKKA
                     VFALSSAVRNYQPAMDELVKHLPEGYSQGEKVDAGDMDAVDAIMDRLRAHPVPSSA"
     exon            complement(171661..172311)
                     /number=1
     CDS             join(175379..175921,175987..176217)
                     /codon_start=1
                     /locus_tag="AO090701000065"
                     /note="actin and related proteins"
                     /old_locus_tag="AO070270000043"
                     /protein_id="BAE61824.1"
                     /transl_table=1
                     /translation="MTQIVFETFNAPAFYVSIQAVLSLYASGRTTGIVLDSGDGVTHV
                     VPIYEGFALPHAISRVDMAGRDLTDYLMKILAERGYTFSTTAEREIVRDIKEKLCYVA
                     LDFEQEIQTASQSSSLEKSYELPDGQVITIGNERFRAPEALFQPSVLGLESGGIHVTT
                     FNSIMKCDVDVRKDLYGNIVMSGGTTMYPGISDRMQKEITALAPSSMKVKIIAPPERK
                     YSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF"
     exon            175379..175921
                     /number=1
     exon            175987..176217
                     /number=2
     CDS             complement(join(177190..178835,178893..179420,
                     179477..179756))
                     /codon_start=1
                     /locus_tag="AO090701000066"
                     /note="glycinamide ribonucleotide synthetase
                     (GARS)/Aminoimidazole ribonucleotide synthetase (AIRS)"
                     /old_locus_tag="AO070270000044"
                     /protein_id="BAE61825.1"
                     /transl_table=1
                     /translation="MSQEQLRVLIVGNGGREHALAWKLSQSPRVEIVYVAPGNGGTGS
                     GATSKITNANVKGNNYPGLVAFAQKNGVNLVVPGPEAPLVDGIQGYFQAVGIRCFGPS
                     KAAARMEGSKAFSKDFMKRHNIPTAAYENFREYEPARQYIDSISHNVVIKADGLAGGK
                     GVVIPQTKEEAHQALREMMLDRQFGDAGNEVVIEEYLEGDELSVLTFSDGYTIRSLPP
                     AQDHKRIFDGDQGPNTGGMGCYAPTPISSKEVLEEIDRTIVQPSVDGMRRDGFPFVGI
                     LFTGLMMTKNGPKVLEYNVRGGDPETQTLLPLLSDDTDLAEIMVACTEHWLDGVSINV
                     KPDFSTTVIAVAGGYPGSYAKGKAITLDPVPEDTLIFHAGTTLVGNELQTFGGRVIAS
                     TATASSLEEAVRKSYSGISTIHFEDMFYRKDIAHRAFRQRDAVASQKESLTYASAGVS
                     IDAGNDLVNQIKSSVAQTKRPGTDAVIGGFGGLFSLAAANSAYHPHSPTLIGAIDGVG
                     TKLKIAHTVGVHDTVGIDLVAMNVNDLVVQGAEPLFFLDCYSCGKLDVNTASAFVTGV
                     ANGCVQAGCALIGGETAEMPGLFIDDTYDAVGAAVGAINTTGDNARTILPETSAMQDG
                     DVLLALASSGPHSNGYSLVRKIVERSGLSYNDPAPFSMPFSDEPLSLGRALLTPTRIY
                     VKPLLKALSIPSSNKTTGHFSSAIKGLAHITGGGLVDNVPRMLPSTLTAHINVSTWQL
                     PPVFAWLKKNGNVTATEMARALNCGVGMIIAVEKEAAAAVKDLLQKEGETVYEVGELK
                     AKKEGEEGCILQGLETWDA"
     exon            complement(177190..178835)
                     /number=1
     exon            complement(178893..179420)
                     /number=2
     exon            complement(179477..179756)
                     /number=3
     CDS             join(181401..181514,181566..181731,181783..181846,
                     181904..183560)
                     /codon_start=1
                     /locus_tag="AO090701000067"
                     /note="predicted protein"
                     /old_locus_tag="AO070270000045"
                     /protein_id="BAE61826.1"
                     /transl_table=1
                     /translation="MSAMKTRRALAKEKQKTKASKDHSEQKEQLAAATQEDPTSRIKS
                     SLQSIVSHLDSTKATSVREQESPKNLSFVMSSIYAKESGKVESKDLQLNPLDVETAPV
                     PRLSFGLERVLFNPGVYHLRDPRSRVYNFDPYLGQIMPVTEFDFDALKDYITSSKDHT
                     LRDIAVKEKKKYIGSSSSMTSVLSHFHYLLSAWRGVDIRTLSQGFPDKLRSFTRLLRA
                     PSAMFLRYQDGVYAIDADKEFESANILMNLGKSMEKLLTLPKDDFERYRRSSENKISA
                     EEEQAIPESYHYSTLGDFLMRSQLDAYDPRLPGTGMFDLKTRAVVSIRMDARNFERGL
                     GYEIQNRYGAFESYEREFYDMIRAAFLKYSLQVRIGRMDGIFVAFHNIERIFGFQYVS
                     LPEMDQTLHGQYDTALGDTEFRLSLALWNKILDKVTAKFPERSIRLHFETRDAQTPFM
                     YIFAEPVTDDEIHSIQTRNQAEIDAYQRRVLNLAPSEEEDVPSTDGKEELQPSSSSDK
                     QERSVDEETRSSEVGPDDYEAEYDSSAPLDEAFISEVENEVAEKAPNNGRELLAMTLV
                     TKNFVNGRIVDRPNDLKTYDEWNVEYELSELKGEKAHALYAACQKRREKALTGRGEDE
                     QDVANNVYIRRLREISKKGRDYRRNENRLDKANGIVVLDDSA"
     exon            181401..181514
                     /number=1
     exon            181566..181731
                     /number=2
     exon            181783..181846
                     /number=3
     exon            181904..183560
                     /number=4
     CDS             complement(184832..188764)
                     /codon_start=1
                     /locus_tag="AO090701000068"
                     /note="predicted protein"
                     /old_locus_tag="AO070270000046"
                     /protein_id="BAE61827.1"
                     /transl_table=1
                     /translation="MADSSLGKKERRKSLSVFSPSTTSSLSGLGTHDRSPSDDAQVVK
                     KKRRNSGFFGGRNPSPPGPSHGLWRPGTADTNAAAYTAAMPNGAFEASRPRRKSMQKK
                     RASVFGSLRSFHSFEDDDRSLGRSKGSPSMDDDEASDSRQGIGSVILHHGEIQTTGGM
                     WRKKSQYLVLTDTHLVRLKSQSKAADMFPSIPPSFARSGPSNRQSITSISSLGDPQLS
                     TTSDSAAGIPLNSIVAVYMLDDGKPSSTVEVAYLDERAHKAAFIQMQTPDLQELNLWM
                     VGIRSAAELIRQGNPLPFDQRSIEYVVRMLEYERDYDPETFRIFRVIQMASSKSPART
                     SSEDLTKLSPTGCYLALGSHKLHLIPLHKASNRGSAVSLSDLDNTTTFGLMNLTCLSM
                     EWGDDSLHLTFRIPLCKPFSVFLASVHSLEVAFWIRQQTEFLRPLWVRQPYEFIVPRD
                     LGNESNFPPVDLNEDYGCFDRTLVAYSASYDVDTSNIRYTIDVQCDDAPCFKLLPPAS
                     PSRRKYTALELVAVLRALRYNESFRSISFSGVSLDALQGLRDYHGLDKDMLLSRAGAP
                     VHITGQESLSVLSQEIRALTLKSNWLRRLDFSYTLSRTPKSDNESHDPGCGIPEAIFP
                     ICRRELTSVDWVVLNGIKLGDSDLDYLVDAASQGASQMRALEVGNCGLSVHDLDLLLS
                     TTVAQAHTLEAINISGVQGRLSPDILQQYLGYFKRVKKLDLSRISRTSGPDPLITAET
                     LINWQLEELSLSRTKVNRETVDAIATYLASDRSRGLRVLRLDQCGLTGQDVAILLHSS
                     VVPDCARDLHLHVNENRLDLGCSFLFDALAKSKSPPHLSMRMIDFKKEEQFQDLVEAL
                     RKNRSLKYLDISKASLPYDAGPETCRALQLMFEENETLEDLDISGESAHLDVARFGIG
                     LNLALTGLKKNKSLKVLRIEHQKLGLQGASTLASVLEENDCLREVYCENNDINLQSFT
                     VLVNGLQRNKSLLSLSYMDRDRIQSLDKVRREIESVKRDMGVAQGSTTSTIRRSLNAA
                     KHATVGHKSSKHLHAPGHLRAGVSMPNNLAAAEASPFLYHDIEVVLQSLNRKWDAEVS
                     RLRRYLFRNFNVANGLEVETAALDGDDAASDGRPNTAASLATMLDNLKLDVTVSEKEV
                     QPRPQTNTQPSPKASAPSEASHLDIFRSLDTETNIQIEPKVRPQTAPFSFEYAPQILP
                     SDYASSSGPSSWLAVPVPSMPSVLNKSSSVRSARSSSTVSTSAGTAASARSSYGTTSS
                     TLRGFLKGGASKERRRAEKMKPAAVCVSRDRPPTLKWSPPKLDLGDFR"
     exon            complement(184832..188764)
                     /number=1
     CDS             complement(191347..191763)
                     /codon_start=1
                     /locus_tag="AO090701000069"
                     /note="predicted protein"
                     /old_locus_tag="AO070270000047"
                     /protein_id="BAE61828.1"
                     /transl_table=1
                     /translation="MQITNGLSIAQFGSVSILAHMIMILPHPFKFSPSATPPAPSQPQ
                     AQSSPRPGPSLLSKDYLRSRLFYRPLEGFSEWLSPASRIYRGLTPQYKVFLQIAAMTL
                     GGCIWAERRVNDYIDLIRKTKRAERLEAQRAARYAE"
     exon            complement(191347..191763)
                     /number=1
     CDS             join(192420..192738,192795..193210)
                     /codon_start=1
                     /locus_tag="AO090701000070"
                     /note="imidazoleglycerol-phosphate dehydratase"
                     /old_locus_tag="AO070270000048"
                     /protein_id="BAE61829.1"
                     /transl_table=1
                     /translation="MSLPQRTASLTRITNETKIQISLSLDGGVLPPYEPTDHFPAPED
                     PKEAEAATHGIVPPKDAHHATQFTATQQITVSTGIGFLDHMLHALAKHSGMSLAIRAK
                     GDLYIDDHHTTEDTFLALGAAFTKALGARQSIARFGRGDAPLDEALSWAVIDISSRPW
                     AVINLGFRREKIGDLSTEMITHGLQSFAQEAGVTLHVCCTYGDNDHHRAESAFKALAV
                     AIRTACTRRVAGEVGAGDIVSTKGVL"
     exon            192420..192738
                     /number=1
     exon            192795..193210
                     /number=2
     CDS             complement(193847..194245)
                     /codon_start=1
                     /locus_tag="AO090701000071"
                     /note="predicted protein"
                     /old_locus_tag="AO070270000049"
                     /protein_id="BAE61830.1"
                     /transl_table=1
                     /translation="MKPVFFTNTLYLLLPVLASAAPAPIIGRDIHSRGTSITAQQIIA
                     IAPSSAQSCTNRADKNAPTECADAEKVATNIAKSFDKYQVTSPAEQAAVISLMALESV
                     EFLYNRNKSPGVPGQGSMYLQSVPVEKCEK"
     exon            complement(193847..194245)
                     /number=1
     CDS             join(194419..194777,194810..194867)
                     /codon_start=1
                     /locus_tag="AO090701000072"
                     /note="predicted protein"
                     /old_locus_tag="AO070270000050"
                     /protein_id="BAE61831.1"
                     /transl_table=1
                     /translation="MKMMEEEEEEEEDGENEGSVGTFYTTWTYLRVEGQHTEGFSHWS
                     SSMTGMSIPNLEVESPVRCMGLECRGTSKVGGYWQIKFQAETRVSKLLSLSSGGIDQG
                     AREKQWGSFGVLPEHYQSCKYPSTPTVIPVVSSQVY"
     exon            194419..194777
                     /number=1
     exon            194810..194867
                     /number=2
     CDS             complement(join(195555..196196,196269..196424,
                     196488..196766))
                     /codon_start=1
                     /locus_tag="AO090701000073"
                     /note="predicted protein"
                     /old_locus_tag="AO070270000051"
                     /protein_id="BAE61832.1"
                     /transl_table=1
                     /translation="MRRGVLIFLVVNLLILSFLVRSVFTLLSLLVEDASADAIHRAEL
                     PSPNSSLIEQRPQVIPKIIHQTYKNETIPEVWREAQQSCIDLHPDYEYILWTNEKARE
                     FIAHEYPWFLATFDGYKYPIQRADSIRYFVLAHYGGTYIDLDDGCNRRLDPLLSYPAW
                     VRRTAPTGISNDAMGSVPQHPFFLRVIELLQSYDRSWLLPYITVMYSTGPLFLSVIWK
                     EYMQEAMGESSRVRILMQDEYNRYSWSFFTHHVGNSWHGKDARLIFWMGQHWMFLTVC
                     GFILVGSVGFCLWWVYGRLILLGSKYRYRYTKVPTFISVSGLSPTRRPRRPTPTLLRR
                     VSFKEDEETGPITETSYELYSRRD"
     exon            complement(195555..196196)
                     /number=1
     exon            complement(196269..196424)
                     /number=2
     exon            complement(196488..196766)
                     /number=3
     CDS             complement(join(201710..202258,202329..202517))
                     /codon_start=1
                     /locus_tag="AO090701000076"
                     /note="predicted membrane protein"
                     /old_locus_tag="AO070270000054"
                     /protein_id="BAE61833.1"
                     /transl_table=1
                     /translation="MAAIWGNGGQAGQFPLEQWFYEMPPVTRWWTVATVATSVLVQCH
                     ILTPFQLFYSFRAVYVKSQYWRLLTTFLYFGPLSLDLLFHVFFLQRYSRLLEESSGRS
                     PARFSWLLFYAMASLLLLSPFLSLPFLGTALSSSLVYIWGRRNPDTRLSFLGILVFTA
                     PYLPWVLMAFSLVVHGIVPKDEICGVVVGHIWYFFNDVYPSLHGGHRPLDPPGWWIRL
                     FESRASAGTDTANLNRDFAAAAAPEVR"
     exon            complement(201710..202258)
                     /number=1
     exon            complement(202329..202517)
                     /number=2
     CDS             join(203208..203388,203466..203812)
                     /codon_start=1
                     /locus_tag="AO090701000077"
                     /note="histones H3 and H4"
                     /old_locus_tag="AO070270000055"
                     /protein_id="BAE61834.1"
                     /transl_table=1
                     /translation="MPPKTGGGRKVIAASRAKADGAGKESAAAKGSPSTRGRKSAGGA
                     RAGKRPAGASRKSDVQPGDPTPQGRHRRYRPGTVALKEIRKYQRSYDLLIRKLPFARL
                     VREVALDLLPADVGSELRWQSQAIMALQEAAEAFLVHLFEDTNLCALHAKRVTIMQKD
                     IQLARRIRGAWGGLG"
     exon            203208..203388
                     /number=1
     exon            203466..203812
                     /number=2
     CDS             complement(join(204829..205028,205096..205243,
                     205294..205354,205405..206279))
                     /codon_start=1
                     /locus_tag="AO090701000078"
                     /note="predicted protein"
                     /old_locus_tag="AO070270000056"
                     /protein_id="BAE61835.1"
                     /transl_table=1
                     /translation="MSLEFILTVPAMWPDKAKMTTLHCAEKAGFGGNGTIRLISEPEA
                     AAMHALNVSNPHGLEVGDTVVLCDAGGGTVDLITFSIVEREPNLRLKEEASGDGSLCG
                     STFLNRLFERFLESRLSSVPGWGRDTLDEAMQRFEMVIKRTFCGDVTQDSMIPVPGIA
                     DDSAAHIHRGRLRVSGQEMADLFKPILEEIHHFVDNQVKTSKKRVKALFLVGGFGQSP
                     YLRRYLRDALPQDMEVLAPVDGWTAVVRGALMKSLGEISPLATKALVESRVARKHYGM
                     IYQTKYEKDIHDRKKRYWSDFHRHYRIQVMEWFIQKGDEIKEAEPIKTTWHQHRLLSD
                     GNFDSIHVTLYELDTPVEKKPPLYFDRRIKKHAVLNPNLDAIEKARIPVRLGQDDEEH
                     YEVHFQIHATYFSAHCEYALWYEGKDHGSVRVDYA"
     exon            complement(204829..205028)
                     /number=1
     exon            complement(205096..205243)
                     /number=2
     exon            complement(205294..205354)
                     /number=3
     exon            complement(205405..206279)
                     /number=4
     CDS             join(207230..207268,207333..207930,208152..208195)
                     /codon_start=1
                     /locus_tag="AO090701000079"
                     /note="predicted protein"
                     /old_locus_tag="AO070270000057"
                     /protein_id="BAE61836.1"
                     /transl_table=1
                     /translation="MDENSISTTKGFDGQNHSSADNVPATTSSRDSNQNKCPAQSALK
                     RLERHAAGIYEEVDSVSRSISQQAYRIEQMEQQLENAHQRIQKLEVELQTRIFRSMPD
                     YQVSDASISEDFLVIRDSLCEWMEGFPDIRSFTETLDNAIHRRGIDKNMFTFPRELQL
                     EFDHAQTEILTMISFGIIREHVLESLVFAAPPADQELLERLYNMMSMLEPKKGSRNRS
                     YHKLQLLR"
     exon            207230..207268
                     /number=1
     exon            207333..207930
                     /number=2
     exon            208152..208195
                     /number=3
     CDS             complement(join(209214..210055,210106..210758,
                     210809..210924,211064..211174,211249..212253))
                     /codon_start=1
                     /locus_tag="AO090701000080"
                     /note="predicted protein"
                     /old_locus_tag="AO070270000058"
                     /protein_id="BAE61837.1"
                     /transl_table=1
                     /translation="MSYPPPPPHNGQYPSQYLQQPPIQPQQTIQPQQLLYNNAHPNVS
                     PYQYGKPVVYPQVMIPAYPAYAHTYNQQPQPQPQPQPQPQSQPQPPPPQPQPPPQQQP
                     PQPQYVNPSDLFNTPPLPSISPPQFSQRSSQYGGQPAVSTAAASNLSPAITTSAATQP
                     TYYTAAGPNQGNQVYGKLPQATPSATPSTTPKPTPKPTPKSTPKVTPKTMPKTTAAIA
                     PNPPTVRPLPVTATPPALSPRPVPQVLIPAPPPEIQQKPERPPSKKQAQRQASQMTPQ
                     KLAKPPIDYQVLLLAMADEYLNAAHSNGTMVALLKQELEVEEYYKLVATGLGCLEAVL
                     KNWRLQPRVEALVRLRYARILFEETDNDLEAETALSKGNRMLDLKYSMQHLLARMLHK
                     TNPKASMKAVDGMIQDVEAYRHSAWEFAFRFLRVSLSLSSSAHQDSVAALQHLHKIAN
                     MANRNGDKAVSAMSAVIEALAHLQQGSGFDSIEQAQRALAVARSHQLNDELRHIPQLT
                     TLVQMVDICCSLLEYDINQSSQKLKNLQDLMDERLNDPNWRADGSFSIPLSGKSAGPS
                     SIDTGDILQVQNGTLLLSFNWLPQHDLYALCYFLSSITLSCKNSYDGRKAEKFLQEGI
                     RMIQGSFKSPQDITESMVNANRRVEWRRTLYCNLLLQQVFLACGRTDWDLASKTLKDL
                     RQEAQELGECLPDTVQCLMEYAEGTIAQATGDLKAALDAFQSPLLSLSPSTSKTARND
                     PQRDIALLAALNTVLILRDPTHASHFQLPNILATVESFCKGSPNKYIQAAYYLVCATV
                     QTESTIQTKQFLQQALQSATAISNSQITCMTLTFMSWKYFRGVVGEQAEKSARAGRAM
                     AKKANDRLWVSVTDEMLAETLERQGKNDEAKGVREEGHRVMMGLPSALKRPA"
     exon            complement(209214..210055)
                     /number=1
     exon            complement(210106..210758)
                     /number=2
     exon            complement(210809..210924)
                     /number=3
     exon            complement(211064..211174)
                     /number=4
     exon            complement(211249..212253)
                     /number=5
     CDS             join(215234..215842,215993..216153,216214..216294,
                     216357..216480,216532..216660,216715..216897)
                     /codon_start=1
                     /locus_tag="AO090701000081"
                     /note="alpha/beta hydrolase"
                     /old_locus_tag="AO070270000059"
                     /protein_id="BAE61838.1"
                     /transl_table=1
                     /translation="MGMLSWLRPSGRVSFFHSKDNNLILKKVGKGTKQQITLTDLCRT
                     ATPKTCTLNPFLFNGHLQTAWTTVKFDDVPVYYKRWMFEADNPMFSGHFAVDFVVDPF
                     EAPKDSQLTDQERKYTQPSGLPERTAFFAADEFDALPSDDTKPMLVVLHGLSGGSHEI
                     YLRHVLAPLIADGAWEACVINSRGCAQTKITSGVLYNARATWDYLGEEGEACQLKAAV
                     LCASPWNLEVSSVSLQSSWMGLEVYSKVMGSNMKRLFEHHVDEVSKNPRVDIDAVRST
                     KYLHEFDRALQCASWGYPTEGAYYRDASSVDSLLAIKIPFFAVQAEDDPIATVKALPF
                     QEIGQTPYGVMMTTSWGGHLGWFELGGSRWFVKPVTNFLNLMAKDVDLEAPFLVENPD
                     KAPGHVANNTSNLDVTPKPDFNPMRRKLDFQSALLN"
     exon            215234..215842
                     /number=1
     exon            215993..216153
                     /number=2
     exon            216214..216294
                     /number=3
     exon            216357..216480
                     /number=4
     exon            216532..216660
                     /number=5
     exon            216715..216897
                     /number=6
     CDS             complement(join(217081..217224,217299..217448,
                     217510..217788))
                     /codon_start=1
                     /locus_tag="AO090701000082"
                     /note="predicted protein"
                     /old_locus_tag="AO070270000060"
                     /protein_id="BAE61839.1"
                     /transl_table=1
                     /translation="MAAKPGSTKPSGKDSNKSKPLSSASKVSKKAAKRPPPKEVKSKA
                     RTEASQLKKKKKREYTEEELDLPKLNAITPVGVVKPKGKKKGKVFVDDQEGMATILAM
                     VNAEKEGQIESKLQKARQLEEIREAKRKEAEARQAQKKNKLEETKAAIRQKRKRKGDS
                     NEDTKTDTTATQPNGSSSKSKGKRKSVSFA"
     exon            complement(217081..217224)
                     /number=1
     exon            complement(217299..217448)
                     /number=2
     exon            complement(217510..217788)
                     /number=3
     CDS             complement(join(219558..219691,219766..219835,
                     219898..220026,220100..220225))
                     /codon_start=1
                     /locus_tag="AO090701000084"
                     /note="DNA-directed RNA polymerase, subunit L"
                     /old_locus_tag="AO070270000062"
                     /protein_id="BAE61840.1"
                     /transl_table=1
                     /translation="MPASVHSQDQDQSMMDATAAAPQEQEQQVEQEDVLEEKRIIVLP
                     GATETAASFQFEGEGHTLGNALRYAIMKKCVLLFIVSVVDIVEFCGYTIPHPSETKMN
                     LRIQTYDTTNAVEALEKGLDSLMDLCDVVTDKFTASRDAFNASEADKMNS"
     exon            complement(219558..219691)
                     /number=1
     exon            complement(219766..219835)
                     /number=2
     exon            complement(219898..220026)
                     /number=3
     exon            complement(220100..220225)
                     /number=4
     CDS             join(228659..228861,228925..230146)
                     /codon_start=1
                     /locus_tag="AO090701000086"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000001"
                     /protein_id="BAE61841.1"
                     /transl_table=1
                     /translation="MSTAVAPATAAPLTSSHMNRDPSPKNCPTLAPTAGSQSTSTPPR
                     PSGPSRDGSSSKSSPAGRKQTSPASQNGSAPPKVIVKKEPPSSPAMQSHSRPRPRKLD
                     LSTSLPTSGGLSARPPGGPMTAREGVNMHQVGIACLSPGFQTHDPIMREQLQRSLSVR
                     DQQRSIIESRLQRSAKDDGPDGIKPSESSFGLPKASASKRRPPPGLSIVPPSAAQFAN
                     ERVIQSAPLNQTFTSRHQPQPLTRQVANQSPTLGSTSHLHHIPVTQTNNRLPPLSDVF
                     GSDALGSREQNANRAPFYQNASNSNSSQSNNLPPLPSPRIPGTATQVPKRPREYRSAE
                     EAVQELSGGREDLLPRIVHYGGHQPPTPPSPRAVNGQPKSTAVHPEAAPVPNTQVPPS
                     QPMYPSERTARRRTRSEYEQDNGSPPLGHGPEPHYRQNPALAPGAGASYGPFGAGRDS
                     PETQRRKKEEFLALCARAWDLFHS"
     exon            228659..228861
                     /number=1
     exon            228925..230146
                     /number=2
     CDS             complement(join(231158..232042,232102..232275))
                     /codon_start=1
                     /locus_tag="AO090701000087"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070326000002"
                     /protein_id="BAE61842.1"
                     /transl_table=1
                     /translation="MAISDLLNRRVRALPEEDEEIYSEESAFEEKSDDRRSGESDSDS
                     DDLDDEALEETDDNSEHDGPVGLEDDEDSEDGEDNDNGEDDVQASLSSISFGALAKAQ
                     ASLGPKGKRNAKTAKPTEESPQTTSPLDDIRARIREAREQKRQESGKSKDSAKPARTS
                     KHAPMVQSSKRAVSRKRTVVEPPSVPKSRDPRFDPTVLSHGGRHNAESARKAYSFLDD
                     YRSSELKELKAKFAKTKNAEEKEALKREIRSTSDRLRAMENRRREEEVLAEHKKREKQ
                     LIREGKKSNPYFLKKSDLKKQVMLKKYENMNSKERTKALERRRKKIASKERKEMPMER
                     RLGSEGNDDGGRKRRRMA"
     exon            complement(231158..232042)
                     /number=1
     exon            complement(232102..232275)
                     /number=2
     CDS             233243..234754
                     /codon_start=1
                     /locus_tag="AO090701000088"
                     /note="TFIIF-interacting CTD phosphatase, including
                     NLI-interacting factor (involved in RNA polymerase II
                     regulation)"
                     /old_locus_tag="AO070326000003"
                     /protein_id="BAE61843.1"
                     /transl_table=1
                     /translation="MPIFPGGPSGMAAFNEQTLQFPFFSPNTPNQQSQSQPSDQPAFA
                     PFNTALPNDISNPLNYFSLMPPPPFMMNFGLQNPAMAGPLLSGFPPLPFDPMAFAAAG
                     SAGGNISDVLGQLPVGASATKDVASPPPKPPSPVKSYIEQSSLPPKLVTPPQPLLVIL
                     DLNGTLIYRKHRRFPPVFARRAGLDEFLDNLVRKYKVMIWSSSQPNTVKAVCDRLFPG
                     NKRKALVAEWGRDKFGLTSSQYRAKIQVYKTLETVWSNKAVQASYPSPSQNKRRKATQ
                     TGTQLKTRWDQSNTILIDDSKLKALSEPYNILEIPEFTNQHGLDESAIFPKVMQLLDE
                     LAKHDDVSKVLYRWNFELPENHGILELDLGVNTKEVDQDHNNSTTGDAHSPPSQQDTP
                     TEPTAVAQARKERRKRRKEQRKARKQEQKLETKTETKTRKIPQKVSSTGQADKATATP
                     TIPAATTTGISAGSTKAMVQPILERSPSPATSSAESENFLLDRLEDSLNVRTD"
     exon            233243..234754
                     /number=1
     CDS             complement(join(235662..236662,236916..237117,
                     237247..237276))
                     /codon_start=1
                     /locus_tag="AO090701000089"
                     /note="glutathione S-transferase"
                     /old_locus_tag="AO070326000004"
                     /protein_id="BAE61844.1"
                     /transl_table=1
                     /translation="MAFGKIYGQPNNGRTIAALVAAKANDVELELVQTEANANAEFNK
                     SAEYTRISPLGKVPAFEGANGYTLSEAIAIAVYVTSQNEKTTLLGKTKQDYASILRWL
                     SFVNAEVLPHFGAWYRPLLGLDGYNKKNVEEASKVALKNISVLEKHLTANTFLVGERI
                     TLADIFAASLLTRAFATVLDKKFRSENPAVSRWFQTIVNQPYFKAVVENPVLVDEIIK
                     YTPPKKEEKPKKEAAPAAAAEPKPEGEQKKPKHPLEALGKPDFILDDLKRTYSNEDTR
                     PVALPWFWQNYKAEEYSLWKVDYKYNDELKLTFMANNLIGGFHARLEASRKYLFGAQS
                     VYGTNYNCVIRGVFLVRGQEFKPAFDVAPDWESYDFVKLDPSKEEDRKYVDDMWAWDV
                     PVTVDGKEYPWADGHVFK"
     exon            complement(235662..236662)
                     /number=1
     exon            complement(236916..237117)
                     /number=2
     exon            complement(237247..237276)
                     /number=3
     CDS             join(237593..238436,238496..238587)
                     /codon_start=1
                     /locus_tag="AO090701000090"
                     /note="mitochondrial/chloroplast ribosomal protein S9"
                     /old_locus_tag="AO070326000005"
                     /protein_id="BAE61845.1"
                     /transl_table=1
                     /translation="MALQSPNCIVHAMQSVRRTVQLRSFLHTPKISLRSNVPPILSQQ
                     RKNARGYATEVQAAPEIEFEKFYTQPARIVPASPAYFSGSPKFIDHLLNLETILAKWA
                     SLPTVAPSEAPRMAWFKLAQFRDFVGEPVPTKKYKNLIKILQRLNRIDPKIMPIEVRD
                     TLKTFLRPGNPYGNKPAPATVDEMGRARGRGKRKTSSAVVHLVEGEGDVMVNGKTLVE
                     AFPRLHDRESATWPLRCTSRLDKYNVWATARGGGVTGQAEAITLALARALLVHEPGLK
                     PVLRKAGVITVDARRVERKKPGHVKARKMPTWVKR"
     exon            237593..238436
                     /number=1
     exon            238496..238587
                     /number=2
     CDS             join(245558..245660,245728..245812,245937..246150)
                     /codon_start=1
                     /locus_tag="AO090701000093"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000008"
                     /protein_id="BAE61846.1"
                     /transl_table=1
                     /translation="MDNLGKELIQLCDRVEQFGLVDYQMGIWEEEILGVLGQCLDLYE
                     SLPEVLRAHMSTAIAGARSLTLGDTCMLRSFVGLFDVASSSLSLPLLAESGCMRFLRF
                     TPLFVSPGGNLEFPIAGDPSDRDAPAPPFMP"
     exon            245558..245660
                     /number=1
     exon            245728..245812
                     /number=2
     exon            245937..246150
                     /number=3
     CDS             complement(join(248259..248269,248342..248676,
                     248746..248819,248876..248959))
                     /codon_start=1
                     /locus_tag="AO090701000094"
                     /note="Ca2+/calmodulin-dependent protein phosphatase
                     (calcineurin subunit B), EF-Hand superfamily protein"
                     /old_locus_tag="AO070326000009"
                     /protein_id="BAE61847.1"
                     /transl_table=1
                     /translation="MSLTRQSHRTVDRDEVERLRKRFMKLDKDSSGTIDRDEFLSLPQ
                     VSSNPLATRMIAIFDEDGGGDVDFQEFVSGLSAFSSKGNKEEKLRFAFKVYDIDRDGY
                     ISNGELFIVLKMMVGNNLKDVQLQQIVDKTIMEADKDQDGKISFEEFTDMVENTDVSL
                     SMTLSQI"
     exon            complement(248259..248269)
                     /number=1
     exon            complement(248342..248676)
                     /number=2
     exon            complement(248746..248819)
                     /number=3
     exon            complement(248876..248959)
                     /number=4
     CDS             join(249639..249779,249918..250400,250465..250761,
                     250815..251570)
                     /codon_start=1
                     /locus_tag="AO090701000095"
                     /note="polycomb enhancer protein, EPC"
                     /old_locus_tag="AO070326000010"
                     /protein_id="BAE61848.1"
                     /transl_table=1
                     /translation="MGRTRPKKLTSKASIPVVREHDIDAIEEEVQNALQQIETGVEKA
                     EESEFHLQAAINASAQGKVNEAHIPTPETVLSSLRYDELYPPIFSQPATYIRFSSTVE
                     DCCGCPYNMTEEDDVFLKIMNEKRDAADRCTEDQFEEVMHFFEETAQTKQPFAAVDNP
                     PVLSFTEIQDAMDAAVEESVKRFAKDVYEHWKSRRTETGNRSLMPSLKFETGQETDDT
                     DPYVCFRRREVRQIRKTRGRDAQSADKLRRLRKELEDARQLVALVRQRELARKEMLAI
                     ERQVFLQRSEVKEMKRKLNLKDDDEDLINQKPKKKPTEAPAVQRPVAPQLRMPPKAGT
                     QAAEDLQLLEDVQAEKENEILRDINQNIAKHIKWNEGYVDFTRAPLSPSPERTFQAAF
                     RPAITAQLPTPPSSDSSENMMDTTLDNPSTLSLRDKLAPQTMVMSDDTSRMPSFRRRI
                     GRGGRLFIDRRNLVSRCRVELDPWKADRFKYDQEDSDEELDFERDQFDIHIMQHRAIM
                     MAKARDQAAAAAQAQAQAQRRLQADQTANNPGQTMGSNPGPGAIAPTPET"
     exon            249639..249779
                     /number=1
     exon            249918..250400
                     /number=2
     exon            250465..250761
                     /number=3
     exon            250815..251570
                     /number=4
     CDS             complement(join(252505..252580,252651..252766,
                     252820..253169,253515..253665))
                     /codon_start=1
                     /locus_tag="AO090701000096"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000011"
                     /protein_id="BAE61849.1"
                     /transl_table=1
                     /translation="MSSTIHFHDPANFQSQSDEFISWLSGKPGVKVNPKIRLADLRSR
                     AAGRGVELQELQGSAIVDRIGKEGAEESILEMIAPIVRANPSLFPPVDGLASYDGDAG
                     TQALLNLAHVMGSLIMAYAFDIEKPEDEDDEGDDESGYVTDDEEQLSKGMVPLADLLN
                     ADADQNNARLFQEETGLVMKAIKPISAGAEIFNDYGEIPRADLLRRRQALKMPILRTN
                     LWYILSISPIPV"
     exon            complement(252505..252580)
                     /number=1
     exon            complement(252651..252766)
                     /number=2
     exon            complement(252820..253169)
                     /number=3
     exon            complement(253515..253665)
                     /number=4
     CDS             join(254226..254577,254682..255406)
                     /codon_start=1
                     /locus_tag="AO090701000097"
                     /note="predicted metalloprotease with chaperone activity
                     (RNAse H/HSP70 fold)"
                     /old_locus_tag="AO070326000012"
                     /protein_id="BAE61850.1"
                     /transl_table=1
                     /translation="MIAIGLEGSANKLGVGIMLHPDNGNPPQVLANIRHTYVSPPGEG
                     FLPKDTARHHRAWVVKLVKKALKEAHVSVQDVDCICFTKGPGMGAPLQSVAVAARMLS
                     LLWGKELVGVNHCVGHIEMGRLITGSTNPVVLYVSGGNTQVIAYSSQRYRIFGETLDI
                     AVGNCLDRFARTLHISNDPAPGYNIEQLAKKGKQLVDLPYTVKGMDCSFSGILAAVDG
                     LATTYGLGGEGKDDETDTPIPDADGNGKPTRADLCFSLQETIFSMLVETTERAMAHVG
                     SKEVLIVGGVGCNERLQEMMGIMARDRGGSVHATDERFCIDNGIMIAQAGLLAYSTGF
                     RTPLKDSTCTQRFRTDDVFVKWRD"
     exon            254226..254577
                     /number=1
     exon            254682..255406
                     /number=2
     CDS             complement(join(256170..256217,256275..256887,
                     256995..257719))
                     /codon_start=1
                     /locus_tag="AO090701000098"
                     /note="protein involved in Snf1 protein kinase complex
                     assembly"
                     /old_locus_tag="AO070326000013"
                     /protein_id="BAE61851.1"
                     /transl_table=1
                     /translation="MGNNPSKGPAGDVPSTSGHSTHAGSAGDRKVTRRPSLNAPSGTA
                     KATAADPSASKETATGHPVSQNQASVQQRLQSRNAPDSATRHAPDTKKADPHYKEIPS
                     PDPSNPVQVPTSRTSARHDHYTSVAPSGPPHNAYYSASAHLQRPPRLPLPIGDATATP
                     GSPYMGSPPSERLLDEQAGQGDPKLGDAAVEDEEVLEELEPYTSSGVGRPVPTIIEWT
                     APGDKVYVTGTFVNWEKKFRLHRSSESNPGVMSTRLNLRPGTHHLKFIVDGEMRAADS
                     LPTAVDFTNHLVNYIEISADDTNRSRSGSDKTSQSNVPPGVHPPQVLPTRVGSEQVGS
                     GSAVEDQPDEWEEIPQGDFRRIIPQFLVDLDREDETQESPAYQQAVNVIGDAPTPPSL
                     PLFLGKSILNGTTPMKDDSSVLNYPNHTVLNHLATSSIKNGVLATSATTRYKRKYVTT
                     ILYKPTGDIAG"
     exon            complement(256170..256217)
                     /number=1
     exon            complement(256275..256887)
                     /number=2
     exon            complement(256995..257719)
                     /number=3
     CDS             259707..261200
                     /codon_start=1
                     /locus_tag="AO090701000099"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000014"
                     /protein_id="BAE61852.1"
                     /transl_table=1
                     /translation="MVLPRPFSRVRTLLLAAALAAFLTYSFLRWQRISYAEQAQSAAK
                     EAASSNAQAVVLTRPEGHIGFWRQFQPLLATYQPKCEPPLRLDNAPSIRFEQASPDFR
                     PEVLDMLDDHVDAMKQAHTGFIEDIKAKPPMLHYVPNTRGLVSTAGGEYLPVLVISLR
                     MLRRTGSELPLEVFLANEDEYERYICDVVLPSLNARCVVLAHILDAVPKVMDIQKYQF
                     KLFAMMFSSFEEILFLDADAFPLHQPEILFMNEPFKSKKMVTWPDFWATTISSYYYEI
                     SSQPMPSNTIRQSSESGEVLLSKKTHMQTLLLSVYYNFWGPDYYYPLLSQGASGEGDK
                     ETFVAAARTLGESYYQVSEPICAIGHGTEGGFAGSAMVQFDPVEDYALTQKGEWRVHG
                     SKAPAPRAFFIHANFPKFNPATVFDKQAVNPAFADDGSYTRAWTIPQEVIGKFSTDVE
                     KYFWKEILWTGCELESKFSTWKGRKGICSEVKKYWNAIYVDKKTSKV"
     exon            259707..261200
                     /number=1
     CDS             complement(join(262079..263184,263237..264332))
                     /codon_start=1
                     /locus_tag="AO090701000100"
                     /note="ABC (ATP binding cassette) 1 protein"
                     /old_locus_tag="AO070326000015"
                     /protein_id="BAE61853.1"
                     /transl_table=1
                     /translation="MSGRRLLDAIQVLNVAKSVATKHLAVRQRQLDLFTRTSSLTKGI
                     KEQADGLVLTAQAAAALASRFNEPNPSESTPRAQTQSATESRRAANASADDARRSQRQ
                     AESQIPSTTAAYSGNERSGDLNVSSQQDVFYQPSQKAGSELSGLPSTTLPKAASVTQS
                     GLVNEINADVFHSSVDAEKVTSPAQEQEIPDEVMNQLFRSPKVAKSISRRGDANMNKG
                     ELKTARSSTRTVEEDDIEKLGNSIADDIVSTNSQVRSVIYLRRKDIYANRFEQTDPVV
                     ITDTKQAGSYQMLESRVPSSRLGRLWQYGGLATSMAFGAVGEGLRRVTGSNDADAGSL
                     MFSPGNMERLVAKLSKMRGAALKLGQMLSFQDSKMLPESIGIVLQRVQDRADYMPASQ
                     RDKVLADNLGPNWRDLFSSFDEVPMAAASIGQVHGAVLKKTGQPVAVKVQYPGVADSI
                     DSDLNNLSILLTASRLLPKGLYLDKTIANARTELAWECDYIREAECSKHFKELLKDDP
                     VFLVPEIIPEASGRQVLTMERLNGVAVTKIQNFTQEQRDWIGTQIMRLCLREITEFRY
                     MQTDPNWTNFLYNAETNRLELLDFGASREYPTEFITKYIRTLVAASRNDRETCHRLSI
                     DLGYLTGHESSAMVNTHVSSITTLAEPFMGSSPDVYDFSNQTITDRVRAFIPVMIRER
                     LSPPPEETYSLHRKLSGAFLLCAKLGSRVRCKELFEEAVKKADKSGMEIKP"
     exon            complement(262079..263184)
                     /number=1
     exon            complement(263237..264332)
                     /number=2
     CDS             264623..265588
                     /codon_start=1
                     /locus_tag="AO090701000101"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000016"
                     /protein_id="BAE61854.1"
                     /transl_table=1
                     /translation="MITKSSPQALEKEIYDLEYRLQNAKARLALASGQEPDGDSYVPL
                     PQGMRNELQDIAAANADLSLPDTIQLLSSHALFLLSDSALPLGSFAYSSGLESYLAHN
                     KPLPPKVTPTASFNCFLKLSITSMASTSIPYVLAAYRHPEDLETLDNDMDASTPCVVA
                     QRASIAQGRALIGVWERAFRGTYVSGPFLEGVTASEAAKAIEDFSDALKSCSDTADDL
                     GPKGHFAPLWGIVCLAMGMDARQTAYVFMLNHAKAVLSAAVRASVMGPYQAQAILASK
                     GLQDMIIERIDREWDTPVEDAGQVVPPLDLWVGRHELLYSRIFNS"
     exon            264623..265588
                     /number=1
     CDS             complement(join(266107..266280,266340..267413,
                     267475..268074,268116..268265,268308..268592))
                     /codon_start=1
                     /locus_tag="AO090701000102"
                     /note="E3 ubiquitin ligase involved in syntaxin
                     degradation"
                     /old_locus_tag="AO070326000017"
                     /protein_id="BAE61855.1"
                     /transl_table=1
                     /translation="MPVAEASPVASSEPGFVKMEDRKRAATSDHNDSAPPLKKQATSV
                     NGGSKPHPDADMPWKDDLEVSLGLAGVVGFMSFQGGLRYPSSAEPTTSLTIKDAIWRQ
                     MQEYKREKVSLEAKLKDMSKAATRHNEHLRVIDTWYNQVCGSTLIDEVKLLLGAAEDI
                     KGDRPTFQSSLSFDDVDNFEKHLKSRSNDIRDIISRLVKNTPKSPPEICELQSQLAKK
                     LAEEKATIAELDKALSEKQQLEESLEEASLRYMVAEKKLDRARSLTVAKLEKQYILGP
                     QRPGGDSASGQREEQSVSNGATPSAERGPELDEAHNKLVAISEKQKEQLQKLETENAN
                     LLSQITDLNIKRSKLTDDDYAHTDLFKQMRSQYDDVVKRINHLEATNVQLREEAVKLR
                     SERTAYRNQVDEETQNVIAEKEAQLIRAETDLARIRNARDELLADQQMRKAAQEQEKT
                     AVLKVQELAEARNAQIASLESEVERLRLQVENAKATQADSSDIPVEELRGKYQVLERQ
                     YAMLNTELTSMQTACKKYSTLASQKVTDFSALEEKMARLTAEKSKADQKYFAAMKSKE
                     ARDLEVRTLRMQNSKSSDIVSQLKESEAATRSLLANMEKQVSETKEALNSMMNKHHAT
                     QQQLAENGIVIEGLKGQINELKTLSTSKDATLASTSSACRQAETEIEGLKATLADTKK
                     SLDNWKNKSLGNSSSEYEMLRTLALCTVCRRNFKNTAIKTCGHVFCKDCVEERLTSRS
                     RKCPNCNRSFGNNDYMHITL"
     exon            complement(266107..266280)
                     /number=1
     exon            complement(266340..267413)
                     /number=2
     exon            complement(267475..268074)
                     /number=3
     exon            complement(268116..268265)
                     /number=4
     exon            complement(268308..268592)
                     /number=5
     CDS             join(268972..268999,269075..270765)
                     /codon_start=1
                     /locus_tag="AO090701000103"
                     /note="transcription initiation factor TFIIIB, Bdp1
                     subunit"
                     /old_locus_tag="AO070326000018"
                     /protein_id="BAE61856.1"
                     /transl_table=1
                     /translation="MKSFSSSAINKSGKKFAPKAPVRRAAPAPAAAPRRPSVASQVSA
                     SQTPQPPTQTATPEPASIAEPSPSLETPAPDAETPNEKDVVPTPPATATVTATATPKA
                     AATAISIPRPKRKPSFSAFTLSQPPNATPAEPTPLLSIEVAPDESGEDRAPVEEPQLS
                     ETLVNEEPSLVAETPAEARPSKRQKTNAEPATPALESQRLTGPPQLATPPATQTSTNE
                     ETTESRDTTESQPPAEQNRKTTKSRKRKPSKDVNGGDTTTRTRERKPRAARKKREPTP
                     EGSEAVQIAPGIVKMSELCKDLRTGKISKRETELRQMELAELERKQKAQQDADNTEQT
                     PIKENESAATPALETSNSGDQKAQNGPVMRIVNGEIVLDAASLQVDRHADAARNAGEL
                     EDVVENHLTRKVNQASFGKRSKTESWDEEMTDLFYRGLRMFGTDFMMISKLFPGRSRR
                     QIKLKFNNEERRAPGRIKDTLLGPREAVDITTYSEMTNTIYDDPRIIQQELDEEKKRI
                     EDQHAKEKQAQEELTNNPDGAAGANHSPEQGTAPVKSKRNSRKQAAKNTSGGNEEILG
                     TIDDFP"
     exon            268972..268999
                     /number=1
     exon            269075..270765
                     /number=2
     CDS             complement(271129..271854)
                     /codon_start=1
                     /locus_tag="AO090701000104"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000019"
                     /protein_id="BAE61857.1"
                     /transl_table=1
                     /translation="MRCSNAGYDYDEEDVQWTCTASLPQEFKLGSTDVVCEGYRNADD
                     KWVLKGSCGVEYRLLLTELGERKFGRVREETRPRMPLNNNENGMASLGDILFFGLMGA
                     VFLVILVAIYNDCSDSRGNRRGRTPGRGFGGGGGDGGGGGPYPGPPPPYSSCPDSSSF
                     TSAPTGQGWRPGFWTGALGGAAAGYQYGRRNRHEYPSAGRRATSFGRWNDASDPGEGS
                     PRSRSPQFSTPTTSTGFGSTRRR"
     exon            complement(271129..271854)
                     /number=1
     CDS             join(272535..272590,272748..274176)
                     /codon_start=1
                     /locus_tag="AO090701000106"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000021"
                     /protein_id="BAE61858.1"
                     /transl_table=1
                     /translation="MGDDQSLRSTVAENDISANLSFTQGFLLGQLSVVLLIGAFIKFF
                     IFGEAPPPPSRGLSHRASTHRRSNSIYTINPNEGTSRSLREKPSTSNVLRPVPSSATN
                     TRSILRKTYYSAIPTNPSGKHGRHRIHHSSHQPESLDWFNVLIAQTIAQYRQTAYLLK
                     DDPTSSILSSLTAALNNPEKKPSFIDKIAVTDISLGEEFPIFSNCRIIAVDDPNSDGG
                     RLQALLDVDLSDDNLSIAVETSLLLNYPKPCSAILPVALSISVVRFSGTLCISLVPAS
                     TPPLHTPSPSPSPPTADGAVNAGTHPTNGSREPTQEAPNAQEESPPKTSPKSNVAFSF
                     LPDYRLDLSVRSLIGSRSRLQDVPKVAQLVEARVHSWFEERVVEPRVQVVGLPDLWPR
                     MGRTGVRTGEDSETGSNAASRSAMSADMGNSLRADDIGREPDGLRFRGLGARPPFDSV
                     SRTSSFNVETGGFRSHSMTREGSGGGMSDDFHMPGTLPGGAAAN"
     exon            272535..272590
                     /number=1
     exon            272748..274176
                     /number=2
     CDS             complement(join(274416..274502,274623..274994,
                     275073..275102))
                     /codon_start=1
                     /locus_tag="AO090701000107"
                     /note="uncharacterized conserved protein, contains
                     double-stranded beta-helix domain"
                     /old_locus_tag="AO070326000022"
                     /protein_id="BAE61859.1"
                     /transl_table=1
                     /translation="MKAYWYDNKPGDQREPHDSGRPVSKDYLASLGVFYRYCPDIESV
                     NALAKERGYKNRDEVCVSPQTMGDVYESKVKMFFAEHLHEDEEIRYIRDGEGYFDVRG
                     QDDEWVRIQLSKDDLIILPAGIYHRFTTDEKNMSIPTPTGRHILELSAQVLWLQSKRV
                     AC"
     exon            complement(274416..274502)
                     /number=1
     exon            complement(274623..274994)
                     /number=2
     exon            complement(275073..275102)
                     /number=3
     CDS             join(275434..275540,275621..277580)
                     /codon_start=1
                     /locus_tag="AO090701000108"
                     /note="NAD/FAD-utilizing protein possibly involved in
                     translation"
                     /old_locus_tag="AO070326000023"
                     /protein_id="BAE61860.1"
                     /transl_table=1
                     /translation="MAFRVRSVTLQRWGHGSRSRLLGSVRGLATVSDGSRPYDVVVIG
                     GGHAGSEACAAAARSGARTALITPSLSNIGVCSCNPSFGGIGKGTMIREVDAMDGVAG
                     RIIDKAGIMFRILNRSKGPAVWGPRAQIDRDLYKKYMQEELLATEGLSVLEGKVADIV
                     VSKEGVEDVPGAQGKIVGVRLESGEVIPTSRVVITTGTFLGGEIHIGMTVYPSGRMGE
                     AATFGLSKSLREAGFQLGRLKTGTPPRLDAKTIDFKSLEVQKGDSPPQPFSYLNNTVQ
                     VGDEGQLNCWMTHTNEASHDIIRANLDKSIHIRETVRGPRYCPSLESKIIRFQDKQRH
                     LIWLEPEGFAPNDVIYPNGISMTVPEDAQFAMLRTVRGLENVRMLQPGYGVEYDYIDP
                     RNLWPTLETKLISGLYLAGQINGTTGYEEATGQGIIAGTNAGLSAQGRSPLTLTRSDG
                     FIGIMIDDLITKGVSEPYRMFTTRSEYRISTRSDNADLRLTRMARNAGVVSDKRWRHF
                     TDTEAQINELQTLLANTRMSSNAWSRRGFKARVDTSIRSALDLLCLDEVEIDALIPHI
                     ESPSGKVYTPSSFAPEIRSRVAIERRYAPYVARQETAVRKFLQDESLLLPPDLDYSKV
                     KGISTEEKQALERVRPVSVGMARRIEGVTPAGAIRLLAHVRRTGTHPASENLEETPDD
                     ILQQAP"
     exon            275434..275540
                     /number=1
     exon            275621..277580
                     /number=2
     CDS             join(280737..280761,280847..281922,282004..282450)
                     /codon_start=1
                     /locus_tag="AO090701000109"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000024"
                     /protein_id="BAE61861.1"
                     /transl_table=1
                     /translation="MTPQNEATLIGLHDFTMGIWDDGEDPEPFPMRNPNLAMVTIDRP
                     AAPAPPGTPSPPASRRPSAPEHPSTEPSTDPNLAHPRLMVNRACIYERQLPGDAYITA
                     HVQRLQHGFYSSPAVSDQDLDHVDFLGINFVFHSPNTLTHRFKAATIRASIHSMRENS
                     KPSTASQKPHAYRSRNPRFLKHAPHLLYGAVSPETLQWNYSLSGSLGVAELPLLASIS
                     PSGGINGRYRRYEMMRIQGSVRSLKSSRGRKFDVEAGEIVWSLEENNLQRSGLPREFT
                     FAMLIQKPRADSRIQLVLDIEPVLQCSYFNYPTWWLDLPAYKPIPRRSVDFRVEVGQR
                     FEPLTPNKGFNFATLESSFDDYVHMPGRKVTTGIPLEGGIAQDDNEIRREVTRDFAMV
                     EPVRGIPRAPYIGSTPIGTTGKVPGNRNGVSNMLPILDPGSLSVRILLDNSHGHSSQL
                     ASHISALRSNSNIAKERDKTQGQAPPQSPATIRDKRSSTQSKKVQITQSVSDNQIMKR
                     SRGTKYN"
     exon            280737..280761
                     /number=1
     exon            280847..281922
                     /number=2
     exon            282004..282450
                     /number=3
     CDS             complement(284535..285971)
                     /codon_start=1
                     /locus_tag="AO090701000110"
                     /note="gluconate transport-inducing protein"
                     /old_locus_tag="AO070326000025"
                     /protein_id="BAE61862.1"
                     /transl_table=1
                     /translation="MVNGTTTVLEPTFTGYVATTQDALILFEACLTGVLHHVPRRPHD
                     RERGHLVRSGSVFIYEENSSGIKRWTDGVTWSPSRILGNFLVYRELEKPFPPGEKKRA
                     MKKANRRPVPPSRPGEPYPRHDSNGSQGYSPSSTGTFGERSHQSDVERALVGSLVDSY
                     GFKDSGLVKKTMSVTVSGVTHHLVSYYSVEDVMRGILNPPSMVESLRFIRPRAELTQK
                     QSFRAPIDDLETGGMENLNDPSHALYGYRPPQLVAPSGYGMPNPHPEFYMHANPYAAT
                     HPPQSAPMTAYSMAGSIPAQPAPNPYLPAPSAPTQIPQKPDDYPQFRAPAQYGTSFDA
                     LNHNPLSSSISSAMGAAMPSSLSDRNRSHSDHSPSAYRNSSISSRSVATDATSPMDPA
                     TPATYSRGNSFSLAGQLDGASHHSVEQRGMAAFDPSIPRRESNPIPTPYYTGGDRHPY
                     YVGATAPAAHANYPVSTWTTAAPAQPQV"
     exon            complement(284535..285971)
                     /number=1
     CDS             join(298553..298756,299197..299288,299796..299823)
                     /codon_start=1
                     /locus_tag="AO090701000113"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000028"
                     /protein_id="BAE61863.1"
                     /transl_table=1
                     /translation="MLGITLMLHSTSASMPDGRVTHMAILKKSNGSCVRVCACLCWDQ
                     HFPSALGMPGPTCTCSTDLGNSVSKPGSETQEGTFSPLASGTICGVFAVHHVFIVSLT
                     GWEEP"
     exon            298553..298756
                     /number=1
     exon            299197..299288
                     /number=2
     exon            299796..299823
                     /number=3
     CDS             join(302547..302606,302666..303655)
                     /codon_start=1
                     /locus_tag="AO090701000114"
                     /note="predicted hydrolases or acyltransferases
                     (alpha/beta hydrolase superfamily)"
                     /old_locus_tag="AO070326000029"
                     /protein_id="BAE61864.1"
                     /transl_table=1
                     /translation="MQLKLPNALAKGQPGILHQYAERLVAFEFTRGNQRKPHSLIFIG
                     GLSDGLWTVDYMTDLVAALQHSEWSVFSLVLSSSYNGWGVGRLGKDIDEIAQCVQYVR
                     DYKKQLFGAGKVVIMGHSTGSQDVMHYLSCPNPRPRHPVLDREIDPLTRTPVDGAIMQ
                     APVSDRESILSVLNDGTERDSPEVMQELYRKAVAHAKENTYEDDDTVETVVPLSVTAR
                     IGYPSSTAVSSRRFLSLASPDSPRKPDEDDLFSSDLSDEQLQQTFGVVGSRGLLKSKF
                     MVLYSGRDQSVPPWVNKETLLKRWSTAAGPSWHPKSMIIPNASHALSDPDQAEPRRIL
                     AERVIAYLDEVAQEV"
     exon            302547..302606
                     /number=1
     exon            302666..303655
                     /number=2
     CDS             join(308020..311703,311758..312141,312198..312740)
                     /codon_start=1
                     /locus_tag="AO090701000115"
                     /note="pleiotropic drug resistance proteins (PDR1-15),
                     ABC superfamily"
                     /old_locus_tag="AO070326000030"
                     /protein_id="BAE61865.1"
                     /transl_table=1
                     /translation="MADDHRQPEASSNTAANPYNHPVASEHTLGSLNTTSTSETDASA
                     DADARWGERNQGDPVSRRGAMEEFEEMRREVTKLSLHRTRSAKDARRRSRAEGRDEEK
                     ALEDEQASSTDEYRGGFDLNEFLMGGHLERRTTAGEPAKKVGVAFKNVTVKGVETGAS
                     FVRTLPDAVVGTFGPDLYKIICRFVPALHFGKRPPVRDLLHDFSGAVREGEMMLVLGR
                     PGAGCSTFLKTIANDREAFAGVEGEVSYGGLSAEEQHKHFRGEVNYNQEDDQHFPNLT
                     VWQTLKFSLINKTKKHDKASIPIIIDALLKMFGITHTKNTLVGNEYVRGVSGGERKRV
                     SIAETLATKSSVVCWDNSTRGLDASTALDYAKSLRIMTDVSKRTTLVTLYQAGESIYE
                     LMDKVLVIDAGRMLYQGPANEAKQYFVDLGFYCPEQSTTADFLTSLCDPNARQFQPGR
                     EASTPKTAEELEAIFKQSEAYKQIWNEVCAYEKLLQDTNQEDTRRFQKTVAQSKSKTV
                     SKKSPYTVSIVRQVAACVQREFWLLWGDKTSLYTKYFIIVSNGLIVSSLFYGESLDTS
                     GAFSRGGALFFSILFLGWLQLTELMPAVSGRGIVARHKDYAFYRPSAVAIARVVVDFP
                     AIFCMVVPFTIIVYFMTGLDVEASKFFIYFLFVYTTTFCITSLYRMFAALSPTIDDAV
                     RFAGIALNVLILFVGYVIPKQGLIDGSIWFGWLFYVNPLSYSYEAVLTNEFSNRVMSC
                     APSQLVPQGPGVDPRYQGCALTGSELGKADFAGSRYLQESFQFTRHHLWRNFGVVIAF
                     TVLYLLVTVIAAEVLSFVGGGGGALVFKKSKRSTKLKAQNGKGNDEEQVQNTGDNAAL
                     SRGEAKSSSSGEAMQRLSASDRVFTWSNVEYTVPYGNGTRKLLNGVNGYAKPGLMIAL
                     MGASGAGKTTLLNTLAQRQKMGVVTGDMLVDGHPLGTEFQRGTGFCEQMDLHDNTATI
                     REALEFSAILRQDRNTPRQEKLDYVDQIIDLLELEDIQDAIIGSLNVEQKKRVTIGVE
                     LAAKPSLLLFLDEPTSGLDSQAAFSIVRFLKKLSQAGQAILCTIHQPSSMLIQQFDMV
                     LALNPGGNTFYFGPIGPEGRDVIKYFADRGVVCPPSKNVAEFILETAAKATKKDGRAI
                     DWNEEWRNSEQNRRILDEIQQIREERSKIPIADKGVEYEFAAPTWTQTVLLTERLFRQ
                     YWRDPSYYYGKLFVSVIIGIFNGFTFWMLDNSISSMQNRMFSIFLIILIPPIVLNSIV
                     PKFYINRALWEAREYPSRIYGWFAFCTANVVCEIPMAIVSALIYWLLWYYPVGFPTDS
                     SSAGYVFLMSMLFFLFQASWGQWICAFAPSFTVISNVLPFFFVMVNLFNGIVRPYKDY
                     PVFWKYWMYYVNPVTWWLRGVISSVFPSVDIECASKEATHFDPPPGSTCQQYAGNFVS
                     NIAGVGYLVNPDATEDCQYCPFANGTEYMHTLNVHDGDKWRCFGIFLAFVIINWALVY
                     FFIYTVRVRGWSFGMGYLFGGVGVMIEGVKKVFSKKSEKEQN"
     exon            308020..311703
                     /number=1
     exon            311758..312141
                     /number=2
     exon            312198..312740
                     /number=3
     CDS             complement(join(314322..314568,314637..314737,
                     314801..315102,315149..315209,315260..315371,
                     315395..315450,315650..315748,315973..316836))
                     /codon_start=1
                     /locus_tag="AO090701000116"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000031"
                     /protein_id="BAE61866.1"
                     /transl_table=1
                     /translation="MNPDDLDDPDLRAAIAASLRESSNHEENSQNGRQHEVVDLTADS
                     DDDVIPIFPKSNSVIGSETDGDETDSGEEDGDDEDEDLKRAIELSMQSAIADEDGSSR
                     HHLSSIGNNDSKASNTPISSRAETPASIQAPTQAAGLLGLDRRQMEKERLERLNKRKA
                     EEPVSDGQRDAKQARTGTPSRSPGPAISVVDSSSGSNSSRTTPAGNDQIQIPSPTPSV
                     QFPNGVVKKTWAFGCRRQGDDIKIEEVFQKSDLQLAVLSSFMWEMEWLFSKLNTAKTR
                     FYLVMQAKDESTLMLLFHSGYVRIVVPTANLTPYDWGEIGGLMENNRAYCICPHYVTS
                     STLTSCGGSHMGDSWRRTGYCGLGRAVNSLGLRTSKPLNIDFVTSSVGSLTDEFLRSI
                     YLACQGITLCPGDDGSTEYVLRTAKSFPVRSRSNPTQLINKSTAEEWKDRFRVYFPSE
                     TTVNDTKGGPQSAGTICFQSRWYTGPKFPRHVLRDCVSQRLGLLMHNKILYVRPDDPA
                     TLPDNSQCRAWAYVGSANLSESAWGRLVQERATKEPKLNCRNWECGVLMPVISKEDAV
                     SEQNKSPNDESGTMLDAFKGIVPVPMRLPAPQYGPNRKPWFNSESGM"
     exon            complement(314322..314568)
                     /number=1
     exon            complement(314637..314737)
                     /number=2
     exon            complement(314801..315102)
                     /number=3
     exon            complement(315149..315209)
                     /number=4
     exon            complement(315260..315371)
                     /number=5
     exon            complement(315395..315450)
                     /number=6
     exon            complement(315650..315748)
                     /number=7
     exon            complement(315973..316836)
                     /number=8
     CDS             join(319698..319901,319966..323412)
                     /codon_start=1
                     /locus_tag="AO090701000118"
                     /note="DEAH-box RNA helicase"
                     /old_locus_tag="AO070326000033"
                     /protein_id="BAE61867.1"
                     /transl_table=1
                     /translation="MPKFVPRQRKQKHRQKEAADAAVDSNAAEVLPVSKEQKEAKRQK
                     LREELRAQHTKISAKKQKRLDKYIENKLKKEENVELLKKLEKTTLDTSNFESSRELGK
                     RKRLDENGIIEASRYTHDSASHVELSGDETDDSLPPSGTSFAIPKAQGPIEKPAEQVV
                     VGSGLKRPLELGADGFPVLKKRKRAPKLKTKATKIQDLPWEGFDSDEDENESDNGSTP
                     DYRKLKDKEVEALDRMNEDDDESSEDAFEDDQSEDENEGEEAEEEEEEESDDDDEGDE
                     DEEEEEEDDSTSNQPRQSAFKAWARQQINETVGFKPTTGPVVSEEQPFGPKLKEKPVR
                     NTVYEEEPLPAELQVTKGNPFRKAFHVQVDRSEDIQNARLGLPVVGEEQKIMEAIYNN
                     SSVVIWGATGSGKTTQLPQFLFEAGFGNQDSPNPGMIAVTQPRRVAAVSMAKRVGDEL
                     GQFSDQVSYQIRFESTVSKKTAIKFMTDGILIREIAEDFSLSKYSIIVIDEAHERSVN
                     TDILIGMVSRIVDLRKAMSEEDPAVKPLKLVVMSATLRISDFTQNPNLFRQGPPPLVQ
                     AEGRQYPVTVHFSRRTRQDYVEEAYRKVSRGHRKLPPGGMLVFLTGQNEIRQLSKRLK
                     QAFKPTQRGGETEVKVQISANDAPLEAEDLDIGDADLSKVGNEDDDSDLEITGLDNDD
                     DDDDGFDLGEEAMGSSTRVHVLPLYSQLPTKEQLRVFEPPPEGSRLIILATNVAETSL
                     TIPGIRYVFDCGRAKEKQYDLDTGVQKFQVNWISKASANQRAGRAGRTGPGHCYRLYS
                     SAVYENEFAQYTEPEILRTPIEGVVLQMKSMGLHNVINFPFPTPPSRQGLAKAEKLLK
                     NLGALTSDGKVTQIGNRLSTYPLSPRFGKMLYIGHQHGCMPYVIALVSALAVGDLFVP
                     ENQIDPNPKGDNREKDAVYTNSDRLEDTVREQRHKDYARAHRLWSQHDDTSDALKFLS
                     AICAYGYASDGESFCEKMFLRGKGFKEATQLRSQLTDIVRANNPGVVGAYQPRLSQPT
                     EKQIKALKQIVTAGFIDNVAIRADLSPVPPEMHRTPKRAIDVPYLTLFKSREGPATEL
                     DEKAVYVHPSSILASLSPKEMPQYIIYSHLQQASPSLVSTEVPKVRMFPLVCPSGLQL
                     SAIAHGTPLIEYGKPIGKTEPIDGIPPRRACWVIPSLVSEAGRGGWPLPAKKVVQKKD
                     PKEGWIIEKFGA"
     exon            319698..319901
                     /number=1
     exon            319966..323412
                     /number=2
     CDS             complement(323642..324067)
                     /codon_start=1
                     /locus_tag="AO090701000119"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000034"
                     /protein_id="BAE61868.1"
                     /transl_table=1
                     /translation="MEERDRLEEENERIEEELAERKKKGDKEDGEEQEGKILSDEEIE
                     ERCEALRERLVKEMEEEEERKGKEGERRGGRSARDLPPRDRRQFKAYQVHELAEAKIE
                     ESERLRKALGIKEDKETGEISSGRRDWEEKKRERERDRP"
     exon            complement(323642..324067)
                     /number=1
     CDS             complement(join(325258..325673,325727..326282,
                     326341..326619,326674..327590,327651..327965,
                     328030..328129))
                     /codon_start=1
                     /locus_tag="AO090701000120"
                     /note="translational repressor Pumilio/PUF3 and related
                     RNA-binding proteins (Puf superfamily)"
                     /old_locus_tag="AO070326000035"
                     /protein_id="BAE61869.1"
                     /transl_table=1
                     /translation="MGGERNRGSHGGMGQPFGGGKASWKNTIWGDNLDQHAGDKAFEG
                     KAGSSSLLSSSESDGWNGRPNMPWSTVNTSSNVLSRATNNSMTTSPIQTRAGDRGTGS
                     LAEAGDSSYLTLPRSAAIGGTAGSTNHKAYLNTGSEESRRHANSSAFGGSPVGSGFPM
                     KPGFSTPLESTRPDEMPSMSALPQGLPETVAPTLGRNSYTHASHNSASFAPQRPVHSS
                     YPSFHSESQGFEGRYAGGPADINSGLSKLHFNEGSYAAHPSSTRPGYLSHPSFDGSFQ
                     RLKYQGDEPAYQGASYASEGASDVQLGYQAPRNRVGDNPISPTEYARVDSPLYAALDS
                     GSVHVPHYNSASARLSDAQAAALERRLREQELAQQAINPLQRLPFTPYDLARYQGSGM
                     NALSGFYPVAQLGAAALASRGHRDHDPSQTVRSPVLEEFRANSKGNKRYELKDIYNHV
                     VEFSGDQHGSRFIQQKLETANSDEKEQVFREIQGDSLQLMTDVFGNYVVQKLFEHGNQ
                     TQKKILANQMKGHILALSTQMYGCRVVQKALEHILTDQQASMVKELEHHVLRCVRDQN
                     GNHVIQKAIERVPSEHVQFVINAFIGQVEKLATHPYGCRVIQRMLEHCKEEDREAILA
                     ELHVCTAKLIPDQFGNYVIQHVIENGEDKDRTRMVTIVMSNLLTYSKHKFASNVVEKS
                     IEFGQESQRHQIISMLTSTDDNGENPLLGLIRDQFGNYVIQKVLCQLKGAERDALVEE
                     IKPLLSQLKKYSYGKQIAAIEKLVADSNSPTNGTLPHTTSTTPPNSHKSSPQPSKRAV
                     NGLDGCRAPVVGAAPPTPPPIDPQSNGDGSSDTKTVTKSTPLTAAESAGTTPTTSVEI
                     NGAN"
     exon            complement(325258..325673)
                     /number=1
     exon            complement(325727..326282)
                     /number=2
     exon            complement(326341..326619)
                     /number=3
     exon            complement(326674..327590)
                     /number=4
     exon            complement(327651..327965)
                     /number=5
     exon            complement(328030..328129)
                     /number=6
     CDS             join(335557..335955,336135..336263)
                     /codon_start=1
                     /locus_tag="AO090701000121"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000036"
                     /protein_id="BAE61870.1"
                     /transl_table=1
                     /translation="MMHLFKRLVARDDEKSNDDRLTPAMIDLLIALLVLVLVGIALVG
                     ALLVLRRKRQNRKRSELPVHNGQCTTHHRSLTISAPPYAKTESVLVYDEKKRLMENSS
                     SPPPSPVPEIRITFPEEEDESGKRKSGRMVVRPSILSVIPLSNLLLFDDLKRHDDIPA
                     KIFFRFLHIATCVSL"
     exon            335557..335955
                     /number=1
     exon            336135..336263
                     /number=2
     CDS             join(337520..337767,337846..340837)
                     /codon_start=1
                     /locus_tag="AO090701000122"
                     /note="glycosylphosphatidylinositol anchor synthesis
                     protein"
                     /old_locus_tag="AO070326000037"
                     /protein_id="BAE61871.1"
                     /transl_table=1
                     /translation="MASGISLGSRFDRPDPNGLQTTASPSRLSERNDTQKAPVPKALT
                     GRHSRPGKGSNGQESVDDGLEREFKLRHLGSLGVLGWILFLHIVGIFFFTKGFLLTRM
                     VLENKSSCDVLPFGDVSSHPAVGKKTEACWHQRSFEKAIVIIVDALRYDFTVPFASTA
                     EGETSQLFHDNIPVLYETAVNTPENAFLLPFIADPPTTTLQRLKGLTTGTLPTFIDAG
                     SNFAGTAIDEDNLVAQLRAAGKTLVHLGDDTWHSLFPDYFDPELTRPFDSFNVWDLHT
                     VDNGVNDHLFPLLHPENATKWDVIFGHYLGVDHAGHRYGPNHPAMGAKLRQMDQVIRD
                     LITNVDENTLLVVMGDHGMDSKGDHGGESNDEVDAALWMYSKRKLFGRTSPDTAVPPK
                     TARERSIPQIDLVPTLSLLLGLPIPFNNLGSPIEEAFAGPGGQDWKNLVAVNRLTSAQ
                     IKRYQHEYAITRGVDDGQEFRSLSFWETAEDAWQRSSKRGKSNTEAMRSVYQSYREYQ
                     RHTLDICRALWAKFDVPSMLQGVGILVAGLVLLVFYARGIRSDRTELTKPLLSIVGVG
                     SGLGAVVGGGLTFSGVADMPITESSALWAAVGSILGASRVIFVKPGHLSLPVPNSLWG
                     WLAVMFTVTQSVGFASNSYTIWEDEILLFFLSTFGVVAGVSSMRQKSTADRVLGVYHS
                     ILFVILGRVASFSRLCREEQMPFCRSTYYASATSSTSAPWQLAIPFLVTLILPAVVKS
                     FYAGSKSYEGVATLWVGYGFRLGLFLTSIFWMLEGADDGEWFSLSKETLKSIRVFLAQ
                     LVLGLAFAAGTTAFIYSKPCVSISVTQGTADSESKNKSTSSPSQPGRTTVTILGFGNI
                     YGTRFFLLVVNFCLAIALMQKPMGLGTIGLLLWQILSLLEILDTNALVLGNSAIGPIV
                     LALLGSFYYFKTGHQAVLSSIQWETAFIPLSSIKYPWSPILVTLNTFGPQILTAVAVP
                     LTVLWKRPLQLHDQSRSTPSKPNNPATKILSDVVQAACTYILYFATINLATTIWAGHL
                     RRHLMLYRIFCPRFMMGAAVLGIVDIVLILFSVAGVRWSMMSVGEIFGW"
     exon            337520..337767
                     /number=1
     exon            337846..340837
                     /number=2
     CDS             complement(join(341897..344526,344725..346621))
                     /codon_start=1
                     /locus_tag="AO090701000123"
                     /note="tuberin - Rap/ran-GTPase-activating protein"
                     /old_locus_tag="AO070326000038"
                     /protein_id="BAE61872.1"
                     /transl_table=1
                     /translation="MSSDDASSPSNYKHATSSFADVFRSLGVARSKSLSPILGRENSD
                     TLSQASDGHRNSWIALGLESMHRGSVVSSSSDASGAPDFETSIRNLAQKQNLAHAIDE
                     AEHVAKSLHWFTSEQTLALWEAGSYLIHHATSPEARRSGSLLMEAIAARQDLSPTARR
                     AVFELISCPSEADVVPARVISLISLSDHGRKLEFASSSSIIPIISSCVVPLYDLISTA
                     RLKARKAKIAKANGLAYDDAILDDLLQFAVDLITLQRKPPNSEEVRSLLDQLFIICKK
                     TSVAADIKNSLAVFEAIILYSDVPDESFVPLLEVLCNIYASVKSLSGPTSRTVRNLAR
                     SRRQDEMVNSLYGFLLGSSEEQGRNLNILRGTVHVFTDLIRAYGQDGMPRLQFEQLMD
                     SLLVVLKKDDGRLEADVLDLCLNALEGEFSHVALERDWSIFINIIVSCSLRAVDESGD
                     CSASSSSSQLSYPRASVLDDTRASILANIIQIASALETVWERMNRQQRLEATRFLMNV
                     CQHVEPPQAELILNTMRGERLCFPENPDWVRHCQRLIRCFVRSRTKPSEIRILALDTV
                     NEAFTNYENLSQFRAHGLLNSMLENFSDEDDILFLESLVSFVVDTSILVDDETSFVLL
                     VDTLGSPMTQASERPVDSRLTVLKVLFRLRCDSSGSIAVLSVSENDFLMNVSARNADS
                     GPKPHTTVDDHTGEYSADNDNQRTSISGKLSTKDNASISSKSSGRNTGIPLRASKLTP
                     PAWTHTSSQVLPEQPPDESSPFVYAYTTSDTSHHLESDPAQKVALKANMWLETVISLL
                     HRDTNWEIYSYVLTHLAPQLRNKDFFSNAVPQVKLLRSILCDQVKNDSFREPPASTGV
                     KKTDVAGYIFDTLCVLIGYHEFFAKSEEDELVRSFMMGIIGSWGGTSRGCIHALSVCC
                     HEIPLSVTKSLNGILDKMSKVITLANLAVHILEFLALLARLPDVYVNLREEEIRTVFG
                     ICIRFLQTSREQRFKASESTNRNPQMSAKLGSGVRETAALPAEMSDPSLQDGMSRYIY
                     TLTHHVMVFWFLSLKLQDRAKHVNWITSRLIFRDEHGKEMVEEQSQVFLDLMQRVAFT
                     DLGETIPYATFPPSPADGPVSKKSWVVGMSIVTVEIAGVSGLTQITKRQASGTTYAMY
                     QQRTAPVLPHQVPPTPDAHLHGDGMRTAVLPSHVMLQLTTTAFPTPTAMQPVPLPEDD
                     ITRRALSTFDRNDIVDGHKIGVIYIDDRQMTEADILSNTSGSPDYEYFLSRLGTKVPL
                     RGAQFNTQGLHPDIDGESTYAWRDRVTEIVYHVVTMMPTNFDNDPSCINKKRHIGNDF
                     VNIIFNRSNIPFNFDTIPSQFNFVNIVISPVCRIANGVEPANMDPEGYEKLFYHVQVM
                     SKPGFPEISPAAAPKIISGKNLAAFVRFLALNASVFSLVWNSQGGEHISSWRNRLREI
                     KRLRERALGSQTQTSDAAEGAYPGQRRNTKANIFSEELPSRSTPAQSDFATDWNASAD
                     ANILQNLDFSRWGR"
     exon            complement(341897..344526)
                     /number=1
     exon            complement(344725..346621)
                     /number=2
     CDS             join(347387..347456,347520..347830,347886..348056,
                     348146..349470,349524..349606,349664..349967,
                     350024..350203,350262..350706)
                     /codon_start=1
                     /locus_tag="AO090701000124"
                     /note="nuclear export receptor CSE1/CAS (importin beta
                     superfamily)"
                     /old_locus_tag="AO070326000039"
                     /protein_id="BAE61873.1"
                     /transl_table=1
                     /translation="MADNLGAVAQLLEASLDPRQNKQAELALRQEEQKPGYSLQLLQI
                     TASGSYPYNTRLASALCFKNFIKRNYTDEDGNYKLQLDEVTTIKQELISLMISVPAGI
                     QSQLGEAVSVIADSDFWERWDTLVDDLVSRLQPKNPAVNNGVLQVAHSIFKRWRPLFR
                     SDDLYREINHVLDKFGNPFLALFEGLDSYLEENKTNKDNLVQGFTQFNLMIKLLYDLS
                     CHDLPPMFEEQISGIATLLLKYLTYDNQLLHTDDDTEAGQLEFARAGIFEVLTLWVQK
                     YIDEFKPHVEQFVGSSWSFLATIGQETKYDILVSRALQFLTSIAGMPEQAAFFQDENT
                     LSQVIEKVILPNVSLRESDEELFEDEPIEFIRRDLEGSDSETRRRAATDFLRKLAEKF
                     ESSVTKVVLHYTEGHLAQYTSDPASNWKAKDTATYLFSAIAAKGVATTSHGVTATNSL
                     VSITDYLQKHLAADLVAGDGVNPILKVDAIKYLYTFRSIITKEQWQEVLPLVVNHLGS
                     SNYVVYSYAAIAVERALYLTDNQGQPIIAPNTITPLAKDLLEHIFALIQKDPAPEKVQ
                     ENEFLMKCAMRVLIVIKEGVVPHTDSVLQNLINITEVISRNPSNPRFYYFHFEALGAF
                     IRFAAPANPDKLEQALYPPFAGVLQGDVQEFMPYIFQLFAALLEANPSGSLPNYYQNL
                     VAPILMPVMWESKGNIPALVRLLSSIIARGSQYVLENQQLSNVLGIFQKLLSTKANES
                     YGFDLLESVVANFPPNALEQYFISIMQVILTRLQNSKTENLTGRFVRFYHFISAHDEK
                     GYSADFFIQVTDKVQPDLFTPIYLNIILPDTQKLARPLDRKTAVLSFTKTLANSDAFA
                     NRYKKGWGFTCEALLKLLELPPLPASKDDIIVEHDVEDMAFGVGFTALNTVRPQTKDP
                     WPETGADLKAWVGQYLKEADKKYNGRVSGFAQERLSNDAKTVLGSYIA"
     exon            347387..347456
                     /number=1
     exon            347520..347830
                     /number=2
     exon            347886..348056
                     /number=3
     exon            348146..349470
                     /number=4
     exon            349524..349606
                     /number=5
     exon            349664..349967
                     /number=6
     exon            350024..350203
                     /number=7
     exon            350262..350706
                     /number=8
     CDS             join(353056..353173,353238..353482)
                     /codon_start=1
                     /locus_tag="AO090701000126"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000041"
                     /protein_id="BAE61874.1"
                     /transl_table=1
                     /translation="MTFFLWIPASFARWIRLKIYQYEVTFAVYMLTPTEKFIFNSLLL
                     TLISMIITAIYVYLPDHIRSIYGHLYYYWAGERPFISSALPAISSVFREAGTQTLEVM
                     YETAKNNAAAATDTIREL"
     exon            353056..353173
                     /number=1
     exon            353238..353482
                     /number=2
     CDS             complement(join(354406..354663,354725..354775))
                     /codon_start=1
                     /locus_tag="AO090701000127"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000042"
                     /protein_id="BAE61875.1"
                     /transl_table=1
                     /translation="MSNILQRLRGGNLEVFKFGMYVLFPIGWMYYFGTNLDDRFSVPG
                     FWPTTEQSHKIPLEKEEIDKELARMRMVDAIRREKRQREAQAQAEAQMQVESQAQNAE
                     "
     exon            complement(354406..354663)
                     /number=1
     exon            complement(354725..354775)
                     /number=2
     CDS             join(355392..355582,355641..356277)
                     /codon_start=1
                     /locus_tag="AO090701000128"
                     /note="enoyl-CoA hydratase/isomerase"
                     /old_locus_tag="AO070326000043"
                     /protein_id="BAE61876.1"
                     /transl_table=1
                     /translation="MATEDLVKLTYQDRIAIITFNRPEKLNALNQDLYYLLGERLREI
                     DKREDIFITILTGKGRFFSAGADVTSTRPSGDLSSNVRRELTRSFVVNNIDITNTVAH
                     HSKILVAALNGPAVGLSAALVAMADFIYATPHTFLLTPFSSLGLVAEGGSSRALVERL
                     GISKANEALIMSKKITCEELVATGFVNKVISAPSGRKDDSDGFLEKVLEEVEDRLGTH
                     LSQSSLLGIKELIRRPEREILDRQNYLEVFAGLQRFLKGIPQEEFRRLASGEKKHKL"
     exon            355392..355582
                     /number=1
     exon            355641..356277
                     /number=2
     CDS             complement(join(356565..357678,357729..357856))
                     /codon_start=1
                     /locus_tag="AO090701000129"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070326000044"
                     /protein_id="BAE61877.1"
                     /transl_table=1
                     /translation="MPHSDTEVPASAEASTDLPQRLPFPPVTHSHILHCSYHDWQPRY
                     RALTPKSRLIPLTVPFISYLRADGIVLPPENATPTDDDNLDTYSDDEADEQPDPSTEW
                     EEIHTQIKTTISELGGIITPKLNWSAPKDATWMAATNDMQCRTPNDIYLLLKSSDFIS
                     HDLELPFDDCVPDMPDSTTTPDVPYHLVLRKYVNFNPSLEFRCFVRDRVLLCICQRDQ
                     NHFDFLFPLRETLRSRIQAFFDEKLKDTFPDPSFVFDVYIPPPHQRVWLIDINPWAVR
                     TDPLLFSWLEILNMKDPIGIQEEDGAEEQFVRLSLNGNTVTGVVGAAEGSESSDTEDE
                     SADDVDEDSPFFPEFRLVKRDDPEAYAFTTPQYSAHKLPKEVVDASISGPGGMSEFLG
                     KWQDILAKQAQESDTDSDGGQ"
     exon            complement(356565..357678)
                     /number=1
     exon            complement(357729..357856)
                     /number=2
     CDS             join(358296..358438,358498..358667,358724..360765)
                     /codon_start=1
                     /locus_tag="AO090701000130"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000045"
                     /protein_id="BAE61878.1"
                     /transl_table=1
                     /translation="MALDGPDPQSLNSWQDAFQYPIPTVRRVEQELRRDIASNKEKLR
                     ALVGTRYRELVGTAETIVSMNREMQEVDATLADIGRRCNPRLMEKKVTHFSQIKGDVH
                     DKGATKRAVGAQLALLHRCETAISRLLRRRDSLLLGAKLVVVSRLLHKALSQQKTVPP
                     FLESLRNQIASLRQTLLRRVNKCLASASSTADDIIEVLASYCLATSSSSEDAIRHFHR
                     VREEVIESQLGLDDPSGGNILKALGLYVSTLQISKILLSRRLSDVLGKLKAHPILTDP
                     EIYNLDDLNLDVLGRWVPPDVSNFTPWIKLSELSKSGVEKTLKNWSKQAFEKFVQGCQ
                     KNLKSWLNFAELLSLREKVIEFWLRSWASTITHSSLQVLEGVRGIFNNRLVEILSDQA
                     GSLAEFGQDVTSKISIWDNTDHVASQSLWDHELIVSDYSKGADAFKSAIADRLLGRDE
                     EVSNMLRGYQSWLTSVDKSKQSIDELRQIRWNDIIEEGEDEDFDLDITATLNEDDPRL
                     LQDALQSAVRKAFDALQSSFGDAFQAFGDSNHSGKAAFILRLIRLVRRGLPNELIADK
                     FTFSKDIVPQLQEMLANEVVTQASPLKLLAKPGSRVPGRSLWEGDPELPVQPSPSTFK
                     LLRRLVGSMDRCGPGLWDVTTVQVLKRTLQGGLSSIITSGIEILSSCDNYESKENTES
                     DGGPSEQEGQNGDDDERVKGEDVSESRNVRDLKLQLYYDTAYLKNALAVKDSGQDLLM
                     DVLEKLRSDLGSADNAARTMEHNAAEYWKRTQLLFGLLAIGGEQ"
     exon            358296..358438
                     /number=1
     exon            358498..358667
                     /number=2
     exon            358724..360765
                     /number=3
     CDS             join(361110..362229,362281..362453)
                     /codon_start=1
                     /locus_tag="AO090701000131"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000046"
                     /protein_id="BAE61879.1"
                     /transl_table=1
                     /translation="MATPRLPFLYPNLMRAVRSCEPATHRSVRIPSKNGHAPFHTTRR
                     RAQETYHRRYGPAAEANLPPPSRPKDELSQTQVPQPAPKDTNTPLNTAPPEKSPPQDT
                     KSNIPEASSQAKDQETSESSDKKQTDEPTPHEESISESHDVEPFSASPTENVGEERHE
                     ERHEPPNRPDPLDGVLHMPSPSSYLMPSGAATPDGKPHLAPPPYIHHFDTYSLVRDLS
                     KGGFTEDQSVTIMKAVRNILHNNLDMARQNLTSKSDVENESYLFKAACSELQSSLQTA
                     RNSEMQRQRASRTQLQHEADILSQRTNQELAGLKDDIKAMFNDHKMTTREQQRSIDTS
                     VQELNYKITVSLNSDGKSEIEGLRWILTRRAAFAIAASAFMIISFLKFYSSRKAQDAA
                     EKKKKASSKKAIEKQAAKEPIIGSAVPVPEVHLTESLG"
     exon            361110..362229
                     /number=1
     exon            362281..362453
                     /number=2
     CDS             complement(join(362916..364469,364531..364832,
                     364886..365117,365169..366443,366494..366850,
                     366904..369345))
                     /codon_start=1
                     /locus_tag="AO090701000132"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070326000047"
                     /protein_id="BAE61880.1"
                     /transl_table=1
                     /translation="MSSSETAARTSSDNAPPRAELDITKLHALPSEQQDLYLLTFTSD
                     LVQYISGLEKPQISAQQKFLKKELFKILTLSSPTITRVVRNNLGRCFGAIFSKGDRGT
                     LFETVTDLLGLLNAGKHEELRTKFAAAHCLGEVFAVAGESVFAQAGIVISSLLKLLKN
                     SSNHTGLRGSIFAVLRKVVVGVGIPVDEAAARDIWKQARNAATGDKSTFVQVHACRCL
                     EQLVNTTPFFDNANDFDHVKTVTWKVIDSPAAPVRHAAAACLARALAKLHATDAKVTP
                     MPKSKKAKRQSKKPAPRPGEDEEEAEVSESSLSKKPESRLFFLLPDLLRQLSTQYLRG
                     TTSNRSRAGIAVCYKHVLRILGNKFVEERYGEIANHLLFDLLNHPTVTYNRFRLLMTR
                     KFVKSILEDTVGRESLSENSQLNASKWLINEVLKDYPQVIQERREPSKYTLTSALSAL
                     SSLISSLGSAFVSLAEPCREALLQVLPHPSYTVQIHAAHCLRNFVLACPHQMLSCVTI
                     CLNSLNREVGQLSTPRQAPRRCVGYANGLSAMLSTSRLQPLYGSVEVYSRVFTQATDL
                     LKTSSNSELRAASTQIQVAWILIGGLMPLGPSFVKIHLSQLMLLWKNALPKHLGKDNF
                     AQRGNLEMSFLAHVRECALGSLLAFLEFNSKLITADGARRIATMLQNTVGFLDDLPRQ
                     KSVTDISQRLHPSLQLHDIATMVRRRVLQCFSKLIHVHPLSHGDVISQTSLLSLAISS
                     FAEPESAQSGPLESSIAASTAQFESLWDLNDNFAFGLTGLAREYVRVTLSGKHENDNG
                     PAWSAVESADQAIDDALTFPICQGSEHDSALLYASRHGGCLLADPHSTGVVNAAIELF
                     SVAIPLHAPKVQESSVEQIATFLSSSSLQRNPGRRAAMVVNIAVALLEALKVALKDSN
                     PMSGKLNPTTDKILQELLQKFVTDADPVVRTIGVEALGRLCESSGNTFTTSQINWLVD
                     TIVDNREPNARAGCAAALGCIHSQVGGMAAGLHLKTIVGVLMSLCNDPHPVVHFWALG
                     GLERVANSAGLTFSPFVSSSLGMLAQVYYADTHNEECATLATSNIEMSYLTPIVISRC
                     VDSLINVLGPDLQDIAKTRNLILTLLRQFQLEDNPALVTESSKCLDHLSLYAPNYVDY
                     SGYVKRLQTELAADNPLMRDVAIGGLSNLMKRDSLSVLKAAPALEEEIWLAFDDTPDN
                     ANLKSMIQDWLQQTALEETELWVQRFHNTLTKTRGKVEEPPPTPAAKSAVNDIPDDEV
                     AGFASAIAGAGQSDNVNEAAPGQELLKWQTRNFVLSCLSELLATVEQEILPDQTIPAE
                     LALQQRVGDIVRMAFSASTANVIELRVWGLKILDQVLRMFGKTPDPDFTEASLLEQYQ
                     AQIGSALTPAFAADSSPELASGAINVSATFIATGIVTNVDRMGRILKLLVLGLENFSK
                     NPDTTEIGDLKGLNSNARVMVKMALYSAWARLQIASIEQDYLNEVVQSHLAKLTPLWL
                     SSLQEYARLRFEPDISGSLGTGPLSNDLDEVYAALNRETLLKFYQDTWLSLVDAIAGL
                     VEKDIDFVFDALDGKMKPDEEPVEKSQDEEDVTNEETKGKGNDINYRDEPVAFFFVLF
                     GLAFEALVDQSTTASQRLEILQALKRILRPIISGNAIYQEAIFSETMDSLDRLALTEG
                     TPIQNVIVEIARNLSLDHPSAKGSEGRSDHLSDDIEQLFELTKSIILVLAGLLPNLRE
                     SVPLARFNVGSDDALSLIRLALSSLVNVASIFPSIIRNDLNACILHIFTTILATGLCQ
                     SEVVPQALPIFKHFIQSISHPDDVGPDNSGNFHVVARQLRGCLTRFLTTLTIAQRRES
                     ESSLPCAKNTLLAITILLTTGGHVLPPNDPTIVRILNEFLDCLQDVGLANVAAGCLRS
                     ILLASTGSLTDEVIARYLFPRLIAFVVGCPMENGDVPNDPENSRTVIARTLVSYVSIA
                     SDIPTALSIVMSTLIARGKREGQAVYQETAAHLLELAKTDQSVFRSLVATMAPEQKAL
                     LEDILRSVNIDSGANKSTRDSVQAQQNEPSIALRFDF"
     exon            complement(362916..364469)
                     /number=1
     exon            complement(364531..364832)
                     /number=2
     exon            complement(364886..365117)
                     /number=3
     exon            complement(365169..366443)
                     /number=4
     exon            complement(366494..366850)
                     /number=5
     exon            complement(366904..369345)
                     /number=6
     CDS             join(369642..369849,369908..370533)
                     /codon_start=1
                     /locus_tag="AO090701000133"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070326000048"
                     /protein_id="BAE61881.1"
                     /transl_table=1
                     /translation="MTAILNRDLLRKCARPQSVCYCCRGFASSSPSFAGHNRWSQIKH
                     DKAKNDKAKSKERQIIGKEISSATQMWGADTKFNPRLTLALSNAKRAGIPKTVIEAAI
                     ARGQGISVTGEALEQVTIEAILPHSVAAVIECQTDQKARILQDLRYAIKDAGGTVTPT
                     TYLFEKKGRIIFEKKDGLNPDDYLDQAIEAGAMDITADEEGRLIVFTEPTETKSVGEA
                     LTKSSQLTIEELEIIWDPNRDTLVELTEDEHVREIEDILSTLREESSVRDIYLNTTQQ
                     L"
     exon            369642..369849
                     /number=1
     exon            369908..370533
                     /number=2
     CDS             complement(370706..371281)
                     /codon_start=1
                     /locus_tag="AO090701000134"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000049"
                     /protein_id="BAE61882.1"
                     /transl_table=1
                     /translation="MGSVLASYKSAFEASLTSQVLQTPGSAESLYPTQLVGQFNGYIM
                     DICNLIWRNRGLNGEDPNALGCLIPAPTIAALTQYVRDATDSARERKREAAFTYNLSS
                     IFSLSHNVALCNMSAACFADIEEESDLSENQPRLKRPVTQKALSALEKEGGIKVAWQE
                     YRVRMLDWLEATGSIGIGSLMRSTMKALRKE"
     exon            complement(370706..371281)
                     /number=1
     CDS             complement(371706..372434)
                     /codon_start=1
                     /locus_tag="AO090701000135"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000050"
                     /protein_id="BAE61883.1"
                     /transl_table=1
                     /translation="MELVVTSGGDERELVTLLKVFKNYCPDIIVGDLGVSGRKGLFFK
                     HPDPEWSSHVRLLQDTNMERLQATQPANFQVVHRGISKRSKMEVLVPDVQTSRVSYGR
                     TSLEELRGVDHFVDKLDKIELPNQIISMIGDGIAQKYLFLVQPTSASHRLDDWWGSFF
                     NENLEDAEDRDEKLESLSYIMSLAVGYVQYTKVRNCTWIIIVSTLKNILGDSSPGCHF
                     LEIVSSIMERERFERANILPSRIP"
     exon            complement(371706..372434)
                     /number=1
     CDS             complement(join(372518..372523,372591..372883,
                     372956..373085))
                     /codon_start=1
                     /locus_tag="AO090701000136"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000051"
                     /protein_id="BAE61884.1"
                     /transl_table=1
                     /translation="MSSDTDTGLLASNSWKWTSLLMAIPGAESRPTGLLDAIKRLEAV
                     AFVPSKQRDTDAGELAKTIATHAYEGGLSQIALERLVKITTTRSQLDQGTITTLIKNL
                     YPVESVPSSLVTQIVGCLGPNKNKPSPATQSLLLRWLIMT"
     exon            complement(372518..372523)
                     /number=1
     exon            complement(372591..372883)
                     /number=2
     exon            complement(372956..373085)
                     /number=3
     CDS             complement(join(373776..374108,374161..374646,
                     374707..375771,375837..375878))
                     /codon_start=1
                     /locus_tag="AO090701000137"
                     /note="transmembrane protein"
                     /old_locus_tag="AO070326000052"
                     /protein_id="BAE61885.1"
                     /transl_table=1
                     /translation="MPEQRQRRDEPESSSGFKGALQGLAFFLLTQFIFSQFFGGRQQN
                     DAGSSGKPGGIPTFADRPARSEITEYSAIPDIINPIWPSDSALDMNIYVSPSVVLPTV
                     KSGSASQLVLNEKNFTLGNYSDTREIDTTIKIPKEVQQNGTLFAHFMLGLSGHQLDPS
                     AKDYSTDSAVYFFRPLNQYLPKKKAKKLKNLLAGSEEAEEEEEDNTPDVSIASYYHPN
                     FTVSLIPDSGTQRFRQIHPAVRSHLQLEASGARDISGKNGWYYPIVYLNTFWQLRSHM
                     MELNSTVETVPLRITLNNLQNWKFSMMSSVDDSAKQTARQAAFGASTPGGGDGTEFEM
                     VKEILLDTNIWLLGTTGIVTILHMVFETLAFKNDIAHWRKKKDVVGTSVRTILANVFM
                     QAVVFLYLMDNSDNTSWMILASQGFGILLEAWKITKTVDVRLRQPSRNSFFSFLPYVV
                     VFEDKHKLTETEQKTKEYDEIAFRYLYIVAVPLLAAYAVYSLVYNTHKSWYSYIIETL
                     VGSVYAYGFLMMVPSLYINYRLKSVAHMPGKALMYKFLNTFIDDLFAFTVKMPWLHRL
                     ATLRDDVIFFVWLYQSWKYRVDYTRVNEFGQGGDSDAEEEPPAVEAKDVKKTVETPAS
                     SQASGKETSKSSTRKRK"
     exon            complement(373776..374108)
                     /number=1
     exon            complement(374161..374646)
                     /number=2
     exon            complement(374707..375771)
                     /number=3
     exon            complement(375837..375878)
                     /number=4
     CDS             join(376995..377075,377132..377683)
                     /codon_start=1
                     /locus_tag="AO090701000138"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000053"
                     /protein_id="BAE61886.1"
                     /transl_table=1
                     /translation="MKTAAHIGTPGLGMYCAAGWALEGFCDSLAYEIAPFNLKLTIFQ
                     CSIEIGILTNLVTSVPPIVPAYSPSSNQAPLFRGMLNRLVPRLPNTHTETNGAQETGQ
                     IASVENGPFSRPEVTSMYPPLSPAHMEILVAETVYAITAIGGHENPPSRHIVGQEGVA
                     SVKEKLKTVSEELEDFIQSSYAVDYAAGGDQKRASKDENIFGMGTGNGGV"
     exon            376995..377075
                     /number=1
     exon            377132..377683
                     /number=2
     CDS             join(378215..378248,379802..379836,379909..380018,
                     380078..380483,380542..380604)
                     /codon_start=1
                     /locus_tag="AO090701000139"
                     /note="synaptobrevin/VAMP-like protein SEC22"
                     /old_locus_tag="AO070326000054"
                     /protein_id="BAE61887.1"
                     /transl_table=1
                     /translation="MTEGFMFATVGGLMLAASVDDEQAEVELSEIKTQAKMIFRRLSR
                     NSAPQASIESGQYNLHYLIQDDICFLCICDRSYPRKLAFTYLADLATEFTTTYSSAQY
                     QSPTLRPYAFVEFDTFIQRTKKLYQDSRASQNLDRLNDELRDVTKVMTKNIEDLLYRG
                     DSLERMGELSGRLREDSKKYRRAAVRINWELVIKQYGPIAGVGLLFLFLIWLRFF"
     exon            378215..378248
                     /number=1
     exon            379802..379836
                     /number=2
     exon            379909..380018
                     /number=3
     exon            380078..380483
                     /number=4
     exon            380542..380604
                     /number=5
     CDS             complement(381020..381544)
                     /codon_start=1
                     /locus_tag="AO090701000140"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000055"
                     /protein_id="BAE61888.1"
                     /transl_table=1
                     /translation="MLTYLATTIIRLHSFSHILAQKAARDRSLAAPVFGLEEEQDGVL
                     LGRLDKPVGKDSVEGIVLEMEHRRKSGRGVLEWYILPPASRYSPQHLKEVVTLLDDHP
                     LYRPPEEPEAGTGEEEPESTFELRLTDRQRREREGVVLPYFDAQQGDGPGEGGRILYD
                     MGEEDDFDEEEDEI"
     exon            complement(381020..381544)
                     /number=1
     CDS             join(384916..384951,386539..386776,386867..387346,
                     387411..387568,387670..388103,388153..389059,
                     389115..389363)
                     /codon_start=1
                     /locus_tag="AO090701000141"
                     /note="glucosidase I"
                     /old_locus_tag="AO070326000056"
                     /protein_id="BAE61889.1"
                     /transl_table=1
                     /translation="MAAPNERRHIVITMHLSKLFTLSTSLFYVVAASIDNDVSVLAKE
                     AARANNQSLLWGPYKPNLYFGVRPRIPNSLSAGLMWAKVDDYATAQSNFRHTCEQNEG
                     MAGYGWDEYDIRKGGRQTIHDAGNSLDLTIDFIKVHGGQHGGSWAARVKGVPRDDALP
                     DQPTTVVFYSALEGLGNLGLHTKSDDSRGFEGDVKLAGYTSDLGEFTIDVTEGPRTNE
                     YPEHEHPSYEDKPLDRTLVSSLTIPPEHAWQTKMILFSQMKEGVSETIEKYGAENPPP
                     PSQVFTIKNTPGDGNVQLVQKVFKGAFECLSFEFLPWKLMLTIYVTADLLTQEITSAS
                     AAFAERFDKILPPQSPFNSDKYSEFSKSMLSNLIGGIGYFHGTDIVDRSAAPEYDEEN
                     EGFWEETAEARARAQPVLEGPKDLFTCVPSRPFFPRGFLWDEGFHLIPVVEWDTDLAL
                     EIVKSWLSLMDEDGWIAREQILGAEARSKVPPEFTVQYPHYANPPTLFIILEAFLDKL
                     DANKNISVQQSPEDIAERLRSAYVQQPELGEAYIRSIYPLLKKHYSWYRNTQRGDIKS
                     YDREAFSTKEAYRWRGRSVQHILTSGLDDYPRAQPPHPGELHVDLISWMGMMTRSLRR
                     IAERLGETEDAEEFKYYETAIERNVDDLHWDEQAQTYCDATIDEYEESVHVCHKGYIS
                     IFPFLTGMVSSDSPRLKAILDLISDPEELWSDFGIRSLSKKDEFYGTAENYWRSPVWI
                     NINYLVFKNLYDIATTPGPHQEQAREMYSKLRKNVVENVFKEWKKTGFAWEQYNPETG
                     KGQRTQHFTGWTSMVVKMMSMPDLPATESKGHDEL"
     exon            384916..384951
                     /number=1
     exon            386539..386776
                     /number=2
     exon            386867..387346
                     /number=3
     exon            387411..387568
                     /number=4
     exon            387670..388103
                     /number=5
     exon            388153..389059
                     /number=6
     exon            389115..389363
                     /number=7
     CDS             join(390795..390893,391137..391958)
                     /codon_start=1
                     /locus_tag="AO090701000142"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000057"
                     /protein_id="BAE61890.1"
                     /transl_table=1
                     /translation="MEFNIDDGPLGRKTRAREGLHLRPLNVEKGAKRAALSQRRNLLF
                     VAYTHQIYVWEPAGSFQTLGSKPEMIITPVMKDPYSSGYISPHMPHAINNIIVDDLGR
                     DEVLLLVTDSGNVCGYRVEAIFSALKRAAERKEHRPFDGSQVDPFFAEYVEASAWGLA
                     IHKFSRLIAVTANTGLVTVFAFALVNSASGKGNDIGQGLGGEEDLTDYGQTWLEIKSD
                     EEFKQLRHLMPAEQRKRNMRLTYTGHFTNIPSVSFLNCDLDPNGTWMVSTDIENQVFV
                     WKTWEGPGPFNVYHFGDASFKHFPETFNHE"
     exon            390795..390893
                     /number=1
     exon            391137..391958
                     /number=2
     CDS             complement(join(392833..393306,394107..395846))
                     /codon_start=1
                     /locus_tag="AO090701000143"
                     /note="predicted E3 ubiquitin ligase"
                     /old_locus_tag="AO070326000058"
                     /protein_id="BAE61891.1"
                     /transl_table=1
                     /translation="MNDTELLDDERSVELSSIAAIYPEIKIDPSFPFKASLDIPVNPS
                     PPLRICFEQYSDTELPTILTPPTSLDASEVGLGFATKTVDGGATASSDEDIHVLSHLP
                     PLCLEIELPGGYPSEQSPIIKLSTDPAWLPSSIISRLLDDGKRLWEECGRDLVVYTYI
                     DHLQQLAEPAFGIDDIPDGEVRLPRELKISLLDFNNKAEREAFEQETFECGVCLEPKK
                     GVNCHRLLLCSHVFCVPCLQDFYNTCITEGDVENIKCLAPDCGKEGKSVRSQEGQPNR
                     RKKHDRTLSPSELLQIPLEQETVQRYVFLKRKKKLEADKSTIYCPRQWCQGAARSKRH
                     PKPIDPMSDDLDPSDDEDIGLVFDPNGDEAQLPPMADRVAVCEDCNYAFCCVCKKGWH
                     GELVRCFPRREAELSAEEKATEEYLRLYTSACPTCDAPCQKRMGCNHMICFKCDTHFC
                     YLCSSWLSEDNPYRHFNDGNSSCYNKLWDLEGGDGIDPDGAEALHQIPNELLDFDDSS
                     DDEDQPAWDFDDGDNHFRRQGHPPPPAPAPPRVNQRAGGPGRREGGRNLNGLDAAGRA
                     AAAERQAQARAMAEWNFTPSPLALCGMLGTSGGISNPCIGLTLMPRRGIRGRSPYFSW
                     LSKGTIQSTLNDRPLVSDSVRVITAARPFCEAATTIPCSGIYLTMLKRSHASRSDPTM
                     WVNCCRRGVPQNTVARGASGLGMRRISVWEKWRIGKFACVGAGVDEKSISDSLCP"
     exon            complement(392833..393306)
                     /number=1
     exon            complement(394107..395846)
                     /number=2
     CDS             join(397247..397294,398943..400847,400897..401003,
                     401058..401224,401279..401408,401462..402302)
                     /codon_start=1
                     /locus_tag="AO090701000144"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070326000059"
                     /protein_id="BAE61892.1"
                     /transl_table=1
                     /translation="MTDTPLASLSLTHVHYADEVDQTGTDISPVSDDQLMEEVAEGLR
                     QERVSGSTPSAPGEVPMEAGKPYRRPELRRDAAAPPLPLQPPPPAPVQQSSERPTDSL
                     SLAQLRQFVQEMPRIEQPAYAFVYADSQPFAEEIEEWFQYSEFDRAMLLGMKSSFEKK
                     WASFLEAQNAESSQISWIDTTDDQRRAFMAQMVNGIREREVSVRLEALEVVCYTVTGV
                     WGTTAGRDVDDYPEDPSPMETAEVPKSKSLQISWIENNANLVLESSGLAPLFECLCRI
                     FERNRTSYSSEPASAGAESANPASLAAMEREANLILTAFYMIVEVGRKQEAQDPRHTP
                     LRNALIGLKPNLLVFLVEVIARLRWDDSANIPLTRIILLFWKSLLLFFGGSDELKRAK
                     EELEPKFKEREDDTSRRTPFLTASPLDYHIFRQEITSKYPAYNPPPPVVPLELENNSI
                     LPPLPQHPSRGASSNGLFSGVGPSVAGGNGSILHQSVHIATPAPSPPPSPIGPGGKAG
                     KKQNYQTNQNFPFMYPPLDVSSNDIGGKGTTELQDVLVGKRWEGSDVPASIIEAGKLF
                     STHVKMTRAMRQLWEERERFMKYDRGWYLDDSGAPSDENIPDELLEDFQDLDLKQGKK
                     NTPRWSPSKETDDEDIQRRLDAVESFYTQALVHLQSITIVFLKIILTNVSAMVNQTQG
                     SQGMSDGYGVNGSGPGPASITEDLHSEAAIEELDNVRLREITGKAISGSLLLLVKWFK
                     RSHILKFEYMTQLLLDSNYLPLILKMFAHQDIDQAVAQKFDRKELGFFHFCLLQSDQP
                     PEPSHSDEESSGDEAVPPPIARHRSQVDPGNSSVRVQSPEDAFEEFLNEPDLPRPEVD
                     ELGYPTAPPPKEPIKVFSFRNFFSAINYLHIMQKITRDKAHRCLLLVQYKSSTILRKG
                     LKIPDPHLRFYTLKLFKSQVPYCGRKWRQSNMRVITAIYLYCRPELRDDWLAGSDIDA
                     EVEEALPLEQALRGLTHWWHLRRYKDVMGGEEGASLMEEERDFFVRELEAMGWGFAGE
                     EMLNGTSEEAEMAAAGGQLPEGTEWDGGPLQMEGW"
     exon            397247..397294
                     /number=1
     exon            398943..400847
                     /number=2
     exon            400897..401003
                     /number=3
     exon            401058..401224
                     /number=4
     exon            401279..401408
                     /number=5
     exon            401462..402302
                     /number=6
     CDS             join(402640..402701,402855..403770)
                     /codon_start=1
                     /locus_tag="AO090701000145"
                     /note="RNA-binding nuclear protein (MAK16) containing a
                     distinct C4 Zn-finger"
                     /old_locus_tag="AO070326000060"
                     /protein_id="BAE61893.1"
                     /transl_table=1
                     /translation="MSSDEIVWQVINQQFCSYKLKTTKGQNFCRNEYNVSGLCNRQSC
                     PLANSRYATVRSDPETGVMYLYMKTVERAHMPSKWWERIRLSSNYAKALEQLDERLIY
                     WPKFLVHKCKQRLTRLTQVAIRMKKLAKEEERLGEKIVPKMAPKIRRREETRERKAES
                     AAKVERAIERELIERLRSGAYGEAPLNVEEGIWKKVLRGLERAGEGERDEDLDDGELE
                     EEEEGVGEVEYVSDLDEEEDLEDIEDWLGAESGDSSDDYDDEDDEDDDSDDESDDEDA
                     SEHSEDEKKKPAPGFKRKRPAPQAKPRKKGPRIEIEYETEGAGKENLFA"
     exon            402640..402701
                     /number=1
     exon            402855..403770
                     /number=2
     CDS             404377..405096
                     /codon_start=1
                     /locus_tag="AO090701000146"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000061"
                     /protein_id="BAE61894.1"
                     /transl_table=1
                     /translation="MSSYFSSLTSSSAISNLGTRLTSLRRAITLGDEADDPDHEDCSH
                     ISNVLRAYYTEKGRPFPGWLPPDPKAPTPAPARTIATTQIQPGAHGSAPATSMYGRGS
                     GGGLGDLWGDSGSAQPPTSQTASLRRGRAAGSMGAPLAATSSAPPGSVATPPSHSPTP
                     PSLHPGGARPLPSQRGGSYQSLSGSQPLERAASAQERLRARLHGGRSPSPGQNPNSRP
                     ISPYYGGSDPSVRKPVGGRMR"
     exon            404377..405096
                     /number=1
     CDS             join(406708..407155,407212..408305)
                     /codon_start=1
                     /locus_tag="AO090701000147"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070326000062"
                     /protein_id="BAE61895.1"
                     /transl_table=1
                     /translation="MDMELQQLENQLRELKKSRFELALPNPAYFTYILVAFASLGGLL
                     SGLDQSLISGANLYMPDDLHLSDSRASLVNAGMPLGAVGGALILSPANEYLGRRMAII
                     VSCILYTIGAALEAGAVNFGMMFAGRFILGMGVGLEGGTVPVYVAECVTVPSRIRGNL
                     VSLYQLNIALGEVLGYAVAAIFLDVKGNWRYILGSSLVFSTILLVGMLFLPESPRFLM
                     HKNKPVEAYGVWKKIRGFEDIDAKSEFLGMRQSVESENEEQQHTKKYAWMDFFTNPRA
                     RRAMVYANIMIVLGQLTGVNAVMYYMGTLMENIGFDKRNSVFMSLVGGGSLLIGTIPA
                     VMYMEKFGRRYWANTMLPCFFIGLVLVGVGYQINPERNPVAAQGVYLTGIILYMGFFG
                     SYACLTWVIPSEVFPTYLRSYGMTTADANLFLCSFIVTYNFTAMMKSMTRIGLTLGFY
                     GGIAAIGWVYQVIFMPETKNKSLEEIDELFSKPTSYIVKENMKSTAQIIRDLSHFRFK
                     KVFSP"
     exon            406708..407155
                     /number=1
     exon            407212..408305
                     /number=2
     CDS             complement(join(409304..411273,411327..413160))
                     /codon_start=1
                     /locus_tag="AO090701000148"
                     /note="P-type ATPase"
                     /old_locus_tag="AO070326000063"
                     /protein_id="BAE61896.1"
                     /transl_table=1
                     /translation="MPSSSDYLNPKARASIADDSGSDDDLDLEELDPTSATIHSPRST
                     DESTRPRDHGPGIALRNLRLGVRDRVWGRNQSGTYRGSEDMDRLLEDRDDDGLRRSHA
                     SSHNYTDDNAPLLEEGRHESGRSFPDNERVLHRNRRFRFPGANIASLFFGSSASTESE
                     TVIAKPPRDVFVGQVQRSKYPPNIVSNAKYTPWSFLPRTLYNEFSFFFNIYFLLVALS
                     QIIPVLRIGYMSSYIAPLAFVVSISLGKEALDDIGRRRRDAEANAEEFSVLAFDKPLE
                     RQTLSARGDVNSEIANAIQVTKKSRDLKVGDVLKIRKNQRLPADVVILKSVSNDTAHQ
                     DTVTELSSDLIQADQSLGPPTAESSSRTAAETTNTSSTSDTFIRTDQLDGETDWKLRL
                     PSVLSQNLPLLDLSRLKVTASAPDKSVNDFVGTIELGPPVGFYDPHVDKTDGDNSGNE
                     GVQSKSAPLTIDNTAWANTVLASNTITYAVIIYTGSQTRAALSTSPSRSKVGLLEYEI
                     NNLTKILCVLTLALSIILVALEGFQPTNDKEWYVAIMIYLILFSTIIPMSLRVNLDMA
                     KSVYGRFIERDKDIPGTVVRTSTIPEDLGRIEYLLSDKTGTLTQNEMELKKIHVGTVS
                     YANDAMEEVASYVRQSFSGSSLTTPSTPFGTQTGLGAAPRTRREIGSRVRDVILALAL
                     CHNVTPTTDDEDGVKVTNYQASSPDEIAIVRYTEEVGLKLAYRDRQTIVLESTHTRSV
                     VVRARILEIFPFTSDSKRMGIIVQFETDGGILESPKQGPEIWFYQKGADTVMTSIVAA
                     NDWLDEETANMAREGLRTLVVGRKRLSLQQYQEFDVKYKQASLALQGRDIGMAKVISE
                     YLERDLELLGVTGVEDRLQRDVKPSLELLRNAGIKIWMLTGDKVETARCVAISAKLVA
                     RGQYIHTVAKVKDKSTAQEALDFLRNKTDCCLLIDGESLALMLGQFRSAFISVAVLLP
                     AVVACRCSPTQKAEVADLIRQHTKKRVCCIGDGGNDVSMIQSADVGIGIVGKEGRQAS
                     LAADFSITQFHHLTKLLVWHGRNSYKRSAKLAQFIMHRGLIISACQTMYSIASHFDPK
                     GLFINWLMVGYATVYTNAPVFSLVFDRDVDEHLANLYPELYKELKSGRSLSYRSFFTW
                     VLISVYQGAIIQGLSQILLDTIAGPRLISVSFTALVINELLMVAIAITTWHPVMIFCL
                     LGTALLYAASVPFLGEYFDLQYVITVDWVWRVVAVVAVAIIPVWAGKLIQRSWHPPSY
                     RKVRG"
     exon            complement(409304..411273)
                     /number=1
     exon            complement(411327..413160)
                     /number=2
     CDS             join(414267..419223,419282..419856)
                     /codon_start=1
                     /locus_tag="AO090701000149"
                     /note="regucalcin gene promoter region-related protein
                     (RGPR)"
                     /old_locus_tag="AO070326000064"
                     /protein_id="BAE61897.1"
                     /transl_table=1
                     /translation="MAHNEVSAAWHPALRSEDGVPSNAPVSDDLTQVSKDSMTESAAE
                     LKPSEAVIQENDLHSSSTSPDTDASVNVQSTAVPAVLDSDTPVYAEQVLNQENAQKNT
                     AENSAQEDAPDHGQELSQTISDEPHVIETSEESAPTLGAAFGSDANGSHDTAAPDYMM
                     DEPSPAEHDTTERREDNDAASWFNEQVDSGDRQTTNEFVNDDNQDFWGSPTNGDAGDD
                     FFNQLKTQTKPIYIPPETESRYEEGVPLLDNTVESPVQPSMKEESQIDKIFEDDGDDE
                     GGAFFNEVQGSVPNEGVPSPPITRKSTTQVIGSLDASPDSPVSPASSTAQEFNNILAA
                     AASENQVKEDLSDDDLAAKWQAELSDDQPEKSTEDDLAARWQAALDDDDDLLLEDEIG
                     KGPNNGQESLPQNPNGSVHETTQATLSSPFGTPQSSARPQAQPTSYTPHQPSTSDLLQ
                     GIPGIAPQSSAAPMQDYFAPPAQPRPTTKRAESFAERSKEGYKSPYDLPDDLTRPRKP
                     VVTHKPVVAQPGSMPPPPRSSSIPVPPTNAPGVPTPPPAPSTVPAVTTPKNFYEELPL
                     PPPRPRSRPASSGRYTPTANIVTSPPSHSQPPPPPPANPYASLSPPPQDSGSVGSQTQ
                     LQQPERLDPYANLLGPGAPGAPAAPSAASRYSPKPPTLQPGTKPPSAPRYSPAPPQSA
                     APAPPRTRYASQPSSVSSQGAVLPFQPRTSSPLAHHEKVSYQPPEGLAIRSAPESASS
                     YAPNGMQPRPNQQDVSNSITAPVGAAGSAAVTAVPENVSAAIQPTSPPRNPYAPPAYI
                     NEFSKRVAPMASPPPAVVPPTGDAQFVPPRRSQTQSPSQQASAPGLSVPSDSLQRPAS
                     VHAPASPTKSANPYAPSQISIHNRVPSQPLEFIPPNDGQELDPLERWKGAPIVKFGFG
                     GSITSCFPKHVPRYAAGQAAPKIKSTPGEVKIFSANDWVPITEGIVQHPGPLKNKSKK
                     KDLVAWLSSKIAAFENEGISEAAQLHPESSKRHDEKILLWKIVRALVEHDGVLEGSAE
                     VEKSLRYIIFPHLQNSEPESTSGVNLPAFNALPPLNAPSQSDATDSQSLESIRNSLLV
                     GNREKAVWDAVDNRLWGHAMVIASTLDRSVWKQVVQEFVRREVKSTTGNSESLAALYE
                     IFAGNVDESVDELVPPSARAGFQMVSKVGGQGPSKNALEGLDSWRDTLGLVLSNRSPE
                     DHKALLALGRLLLSYGRTEAAHICFMFSRAAVFGGADDPQTSIVLLGADHQHLPLNVL
                     QDDDAILLTEAYEYAVSVLAGSPTSTLPHLLAFKLIHACSLAEHGRKSEALQYVDAIT
                     AALNATTKPSGYHNQHLLFGVDELSARLRQTTSDSGSSWISRPSMEKVSGSMWAKFNS
                     FVAGEDSDAASTGSGKAGDGDIGPFAKFSGTPTVSRSPSVSDFGPYSLPAAQSVPGSG
                     PSRYQPGNQYVPNSSPEQYRGRSSLDSQRSSSFGFPFGQRRGSQEPSTPVESSMYQGG
                     PLYGSPSAAGYQSTPPQASYMPLAPVVEDSAPQPYPVEPAPMQGSPVNISPYQPPANE
                     SFGEPLDQSSATVPASSMAGYVPPGAGGGYEPPSVEISAAPALDTTEEPTHQDVLKKK
                     KSFMDDDDDDDLAARAAAIQKAEKARKDREADEAFRKAAEADAKRPPAAKKSWFGGWF
                     GGAKKENDNNNNSGGPIRAKLGEENSFYYDKELKKWVNKKDPNSASVSRGTPPPPKAS
                     APSRSASGSTAPPAASMGLGLDSRPPSSAGAPPSLSSSPAPPSLAAPPPMLGTARSAS
                     TSAAMPTPPIGSSLPPPPRPATSLSNASSIDDLLGAPQARKGTSAKGRKKGRYVDVMA
                     K"
     exon            414267..419223
                     /number=1
     exon            419282..419856
                     /number=2
     CDS             424540..428505
                     /codon_start=1
                     /locus_tag="AO090701000151"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000066"
                     /protein_id="BAE61898.1"
                     /transl_table=1
                     /translation="MATSRSNPIPPPISLPAANFASHAVPPTPSPSRPTIPSYQSLDP
                     LLANLSPESTLEALTSTDAVPKNEPAYDILCKSISQVSEAERALGIRAAVAAQNLSLW
                     YKEVQTWEWPKCTDAQLGQGFISPSTTISNTSEPEYLGSLPAGVVAEHEKRIEEIRDG
                     MESLGVDELKEHVLNAHIPSRSRPSSSNSNLSGPPSFSYVQLSDFTAVITATILRALP
                     LLSRLNSLLSTWDVRLLVLRQVPGLLWSLRLAQSELNSALDLLKPSTPPSEQDALYSR
                     TNYHAKRAALEVTVLSAGRRMDRMLDALEGREDSLPENWIDELEAIESGFGNWVMDAE
                     KQTVENEWRRMMANKLKSKDHPQVPNQPAPVSDENGAPEDLTTQPPEPFPQAARPPLM
                     ETIAEEPGSPTEDQISFETMLDQSVATSQRIEQAPTRGSGTSSSLDGTETANDSSEAS
                     RTIQEADTVIEPIVTPERSTTNTAVLDALPLGEKETANAHPVHAQQISSESVCTVAAK
                     DMPFSDLNREEVTLPEDILPRKTEPVCELQKAAEDPFVAQDKVLGSAEQRSQARDYPG
                     NSASPEADSSPASPSSQAETGSVIIQRPKGVVDSPTLEETVESHGSETSTVPTAPESI
                     IEVFGQLRSASAEEATTPPSVTVEPAPTDVAASIAVNRDSSLSSRTSSPSSPVSSRPP
                     PSLTNDKDTAAPSPRQPLDSPIKLSKTRPGRLDPEETLISRGRRASGASVDSSDYPSL
                     VSSPDIRGLHTVSSNGTPKLIETPPLFQTDYQRPGPMPTNSDHTLREDRLLRLDSEKS
                     PPTSLKHNRALSLPLQRFINERLDMDYEGESNTDLTIPTIDKKVTDSVVRSSSHNDRL
                     RPLSHSSKQRHPAPSTGIRRPVGRRSDLSREDHTSSGPDSVTQRQPKVWERNKNTSVR
                     NTAHKAPVSQPPVLSTATRARKQLTAHPSLESIGAYKSTPRRSGETLTGTANEKTGSR
                     PSTPGSQIRRPRDHLDEKISSILTTLPTRIHFEDREADASSVISSLPLNARERFRSIS
                     PQGSASRSGTPTPSLTLTPAGSRRRYSHAPEESSVKLYHLHQGGKTVPTKLFVRSVGE
                     NGERVMVRVGGGWADLAEYLREYAIHHGRRHVSDTPRVEVQGLSSRETTPTYTPPGSR
                     LTRSGNGRCTPSRPHSVISNRPSSSLAVRKTRRASNVSDMTDLRAASTIETLNLSSSP
                     MSTVSSRRRLSTSSNTSFGAASTMSDARYGSIPLGLAGPKPRSRYAPMSAESEAWVED
                     VLGQARRSSSLRPFTFGLSPPEQDHAAGKVPTLPKSRSISDIGKVGSSKRVVLRGLGS
                     R"
     exon            424540..428505
                     /number=1
     CDS             complement(join(429349..429704,429759..430077,
                     430133..430395,430457..431837,431912..432067))
                     /codon_start=1
                     /locus_tag="AO090701000153"
                     /note="Ypt/Rab-specific GTPase-activating protein GYP7
                     and related proteins"
                     /old_locus_tag="AO070326000068"
                     /protein_id="BAE61899.1"
                     /transl_table=1
                     /translation="MARKEVQYTPPPSPPSPTASYYDVSDDEEDDYNTISHATTGRGV
                     KLLFSKSKVYVHPTPSSKDNIPGFIALIQQKPAHGASNAIASADSSRKAELSSYLLAW
                     VPESSLGDAYNTYVKVDLAGDSSPPRQRYLVPPLPTTTTHKDPIGLYAFAVPLSEIYS
                     LLVRPPSIGWWFGSLVINTRAGDSFPALFFHDSECESTILQKRKRTQESFDPFGEDGS
                     LFWGGDEVLRWLRKYVEVQRSAADNSVYLINPSEEDRISFGRPLTADGTVTRAQDQAT
                     GPSAQGSSGQRDAGMDPFMKAIKETRWKVLEQLSKITTFTKRTANEIAENPRIPPQVR
                     RLMKTPEIQTLQDEFDSARLYLARWAMSISEQSERERNQRIWTARDVLEMENSSVGDF
                     EILELETGTMSIHERRKTVTLKEWEGFFDPATGRLQVTVEEVKERIFHGGLDPNDGVR
                     KLAWLFLLGVYPWDSSHDERQALMNSKRDEYIRLKGAWWETMVEGHSTEEQHEYWKEQ
                     RNRIEKDVHRTDRTIPLFAGEDIPHPDPDSPFADTGTNVHLEQMKDMLLTYNEYNPDL
                     GYVQGMSDLLAPIYAVMQDDAVAFWAFVGFMDRMERNFLRDQSGMRAQLLTLDHLVQL
                     MDPQLYLHLQSADSTNFFFFFRMLLVWYKREFEWVDVLRLWETLWTDYLSSSFHLFIA
                     LAILEKHRDVIMDHLKHFDEVLKYINELSNTMELIPILTRAESLFRRFDRAVQAIDKK
                     NNFPVPSAHQRKPIQSPSDADKGKSPQRPPSTGFSSGTSSGPSAPPGDNSEPQVISPE
                     LRELFSKDIPWKRQPSERREHIQNSS"
     exon            complement(429349..429704)
                     /number=1
     exon            complement(429759..430077)
                     /number=2
     exon            complement(430133..430395)
                     /number=3
     exon            complement(430457..431837)
                     /number=4
     exon            complement(431912..432067)
                     /number=5
     CDS             join(433869..433885,434580..435105)
                     /codon_start=1
                     /locus_tag="AO090701000154"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000069"
                     /protein_id="BAE61900.1"
                     /transl_table=1
                     /translation="MREYIRVDGYQECLHCQYTHPSFSVYYPPTFYTVHNHQNFSQHI
                     ADPNKPDDGLFLYFFPNCTLNVYGGGMSSFRVCPTEDPNITRMEFDYYHMESGEKFEE
                     YFKFVRQVAMEDYELCEKAQDNLGRGVYSEGILNPEKENGVSCEYDRFRSLHDPTTNG
                     AQSTRTEYLSWCASNMPQIS"
     exon            433869..433885
                     /number=1
     exon            434580..435105
                     /number=2
     CDS             complement(438749..439180)
                     /codon_start=1
                     /locus_tag="AO090701000156"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000071"
                     /protein_id="BAE61901.1"
                     /transl_table=1
                     /translation="MSDWLPRFEILVFGAKKNVAFSLKLVDFIHFGELPTMQQLSLFI
                     MIIINPARPLYTITSFLPQFSSRNWVPPTHLLSGHPSHFPKVDTTSPTSIPIASDLTA
                     KRPSAVAQLPRHQAQVNSPDDTEYTTNQESLICWDDSKIQD"
     exon            complement(438749..439180)
                     /number=1
     CDS             join(442508..442726,442802..442957,443006..443687,
                     443746..444587)
                     /codon_start=1
                     /locus_tag="AO090701000157"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000072"
                     /protein_id="BAE61902.1"
                     /transl_table=1
                     /translation="MAGLPSFLNPNQILEPLSQSIERELRMQLPRLQVKETKTACSPI
                     LEIEPSTEKEAIQRPEEVEASQREKSPDQVDIAELPEMVYELDSGSPKSRRKPTISDY
                     LPTPTLQMPGNLPDKVVVTFLRQFYRVFKDHELELIKGAVFTMSPPAWELREMSPPWS
                     TEWQILVDPDTPVPEYTPSLYLQRYAQDIYTLAQLKLLILTRCETFLRQDTIRGLTGK
                     DDACAKEVDDALWRIWTFCRIFGSGKSREGDIVGQVDWLNGGAMAMSDLKHGATASVT
                     EPFGIHDILFEPPTGFGHGNKGGLSNDQLYYMTEMWTCLGVLLQPIHGRCKEAREAGI
                     FAGHQVTEHDHARAAAVLEEWTYYVLTLGPSAVLNMASIGPGGCAATLKRAQSIGLTK
                     WECSESGVSRSSFLKEAVSKAYRSRCDSLCQWSPRTSEGGSPSASDTSSPSSANSRAA
                     QLQLENERRRQAAYADQLRNQRKRPANEGPHSFSDERPISKYSFIMSRLEGVPYEQRP
                     PMPAPPTMASYAAYCGPPTSQYPVKSQPPFATYQQPQVRDPVDQAIDMMVRELGFQEQ
                     DAKWALKVTDSGEGINVNAAVSLLIREHQNYQRNNNVVPMRTYRSNSLLSSVIASPES
                     MNSVWRWA"
     exon            442508..442726
                     /number=1
     exon            442802..442957
                     /number=2
     exon            443006..443687
                     /number=3
     exon            443746..444587
                     /number=4
     CDS             complement(join(445056..446749,446803..447115,
                     447174..447410))
                     /codon_start=1
                     /locus_tag="AO090701000158"
                     /note="catalase"
                     /old_locus_tag="AO070326000073"
                     /protein_id="BAE61903.1"
                     /transl_table=1
                     /translation="MANIVAGGLHKVQEAVQGAASKDKKLVDLAPDTHNVQSSKEPLT
                     TDHGVRISDTDHWLKEVNDNHTGPMMLEDQIAREKIHRFDHERIPERVVHARGTAAFG
                     NFKLHESAEDVSYAGILTDTSRNTPVFLRFSTVQGSKGSADTVRDVRGFAVKFYTDEG
                     NWDLVGNNIPVFFIQDAIKFPDFVHAVKPEPHNEVPQAQTAHNNFWDFVYLHPEATHM
                     FMWAMSDRAIPRSYRMMQGFGVNTFSLINKEGKRHFVKFHFIPHLGVHSLVWDEALKL
                     AGQDPDFHRKDLMEAIDNGAYPKWDFAIQVIPEEKQDDFEFDIFDATKIWPEELVPLR
                     VIGELELNRNVDEFFPQTEQVAFCTSHIVPGIDFSDDPLLQGRNFSYFDTQISRLGIN
                     WEEIPINRPVCPVLNHNRDGAKRHRIAQGTVNYWPNRFEAGPPAPVEQGGFASYPAKL
                     NGIKKRGLSPKFREHHNQAQLFYNSLSEHEKVHVKKAFGFELDHCDDPIVYERLAGHR
                     LAEIDLTLAQEVAELVGAPIPDKALRPNHGKRSKHLSQTEFPGKQPTIASRRIAIIIG
                     DGYDPVAFNGLKGAITAVGALPFVIGTKRSPIYADGEDKSSSKGVIADHQYDGQRSTM
                     FDATFIPGGPHVESLKANGQIRYWIIETFGHLKALGATGEAAAFIKEALGSALDVKVA
                     TSDNPQPVEWYGVVTAGKIHKPESFKEGIQIVKDAKDFISTFFYQISQHRNYKRELDG
                     LASTVAF"
     exon            complement(445056..446749)
                     /number=1
     exon            complement(446803..447115)
                     /number=2
     exon            complement(447174..447410)
                     /number=3
     CDS             complement(join(448390..448627,448984..449026,
                     449092..449251))
                     /codon_start=1
                     /locus_tag="AO090701000159"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000074"
                     /protein_id="BAE61904.1"
                     /transl_table=1
                     /translation="MAIITRRGEREAGERKRKEKASKQACTKCKHSRFTVVRVVKLQG
                     PGEASFSINSMVNGYAASFSPVSRISVWRGVSVFILSSAPFPSGINDNLSHCNRNNGI
                     GVSPVIIWQGMGSLTFLADDLHAYPPTKVTDHKWPPFQLMGFNN"
     exon            complement(448390..448627)
                     /number=1
     exon            complement(448984..449026)
                     /number=2
     exon            complement(449092..449251)
                     /number=3
     CDS             join(450819..450921,450969..452477,452531..453216)
                     /codon_start=1
                     /locus_tag="AO090701000161"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000076"
                     /protein_id="BAE61905.1"
                     /transl_table=1
                     /translation="MHGSDGELLDDSQNETTPRRQSFLEKIFGRKSSSGISRARSTSG
                     RRKKLIKKANSIRFSFVNKYSRSESRAATLESVRTSIEVEKAAEIRQQANQTPLQDAE
                     YVALLRETQNIYIHVQYVSGGIVVHDASGRQRILQMDEAARLFSQLRDELAATTVWSQ
                     ALTTRLRAEASLRQANCRAAVVEYHDALKILETAPALDVDKLSRATILHSMGQAYRNL
                     DMPAQSEACCLEALGLYKRALGRDNPKNFSVLHDLGALYERDGYATEAAALYERSFAG
                     RLKMLGHNAPETLSSMQDLASLKVLLGDLEAALLLLEKVVPALETVFGLQHATTLNAM
                     NHLSILYQKLRLGEESRAISHRTIPHCRTFFGINSPITRDAVVRYFQDSNNFDFPTDI
                     QDILDHYQRSRDPDSLKVIHQLGRSYMDNGLNHDAAELFEALVEDFLTIKGPEASETF
                     DALSALCVSREHLDSIDKAILAYKQLIHMANRTPADHPSRKRIGYADRRISDLNRRRD
                     ILADERKAWSLHEPAQCENCRTNTKVLCNTCKIFRFCNEICQKQALQTHFPYCIPSVS
                     LRESKSLAVKARCPTSARDQAISKIRRVDKTKSVNVTASYTFYLDPRNFTTFRMKLNS
                     DTNTVILFSLDCDIQYATIDNPLLDHNQGDSTSRSTSPSSTSSTADLKGVRWLSPDRQ
                     EAIVYVPSEMPQPQARYVLVTPGREMLKSIIERRVGVRGGGGEKERFQALELPDDELI
                     EFAQGLLLTGFLGEVFMHVVEWVWK"
     exon            450819..450921
                     /number=1
     exon            450969..452477
                     /number=2
     exon            452531..453216
                     /number=3
     CDS             complement(join(453787..454074,454138..455559))
                     /codon_start=1
                     /locus_tag="AO090701000162"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000077"
                     /protein_id="BAE61906.1"
                     /transl_table=1
                     /translation="MRTSERDALNRRRSSTLHYQTFETPPPKSRGRPNSGESRSSAAD
                     HPHDEPSHNESEGHSPLPKKQMAILAMISLCEQTAFNSISPYLPEMASKFPEVEENLV
                     GVYVGTLATAFAIAQFTTNYFWGWLSDRIGRRPVILLGTILTAVCFVAFGFCKTLAQA
                     IVVQALMGAVNGNQGLVSTCLGEITDRSNQSKAFAYLPVLYGIGGITGPLVGGLLVFH
                     HNPWDSSKPNPYPYLAPNLMAAAVLVLDFVLSIFFLEESLEDPESLPKLQQRVRDFFS
                     WLWQFTSLAKRARYLQPPHPIPYRPFRQDSGDTADHDSDLDSASEASSYRDNHRASLT
                     SSELLNRDTLLLLLTYLVFSLCNVAYNALFPIFSQAAPPTGRGLTPSEIGLAQGFSGF
                     VTIIFQICIFGKLRDKMGNRWSYRAGLFGFVVSFILMPFIGYKGNDSGGLSGKTALLA
                     AELCFVLLVKTIATVGGLTSALLLITNSAPDHAVLGALNGLAQTLSAAGRAVGPFVSG
                     GLFSLSSRIKPKGEALAFGVFAGISFVGFLLSFGIQGRSLEADDWESDSEHYKSDDEE
                     PDS"
     exon            complement(453787..454074)
                     /number=1
     exon            complement(454138..455559)
                     /number=2
     tRNA            456509..456580
                     /locus_tag="AO090701t00001"
                     /note="tRNAscan-SE"
                     /product="tRNA-Arg"
     CDS             complement(join(456984..458302,458470..458755,
                     458812..459030))
                     /codon_start=1
                     /locus_tag="AO090701000163"
                     /note="signal recognition particle receptor, alpha
                     subunit"
                     /old_locus_tag="AO070326000078"
                     /protein_id="BAE61907.1"
                     /transl_table=1
                     /translation="MLEAFEILTTSGVVLWSKSYAPVGAHIINSLINDVFIEEKVQIQ
                     AANAAYPVYKKEKYTLKWKKVKEFNLIFVAVYQSLLHLGWIDKLLDNISTLFIDIYKD
                     QLRSTRVRVVEYPFDKYFEQQVKELEDNSAPINSEGVVTGAENKKDPLVSSEHGGPPP
                     PSVPGLIQGPGGRVSRRARKAANAGANVSSGDESIRKGKTPKGGKKMRKWDADGYADE
                     DDGTVLDYSAPADGDEAAAPAVEAVAQDSWGHRTGKGQFVLKDLGDEVHSILENADSE
                     KAKNRATGIVGSGFNAIGGLFRNIVGGKVLTESDLEKPLKAMEDHLLKKNVAREAAVR
                     LCDGVQRELVGKKTGNFQSVDAALRQAMESSLRKILTPTSSLDLLREIDTVTSPTSKQ
                     QSPRPYVISIVGVNGVGKSTNLGKICYFLLQNNYRVLIAACDTFRSGAVEQLRVHARN
                     LKELSARENVGQVELYEKGYGKDAANVAKDAVEYGAANKFDVVLIDTAGRRHNDQRLM
                     SSLEKFGKFAKPDKIFMVGEALVGTDSVMQARNFNQAFGTGRNLDGFIISKCDTVGDM
                     VGTLVSMVHATGIPIVFLGVGQHYGDLRGLSVPWAVNLLMK"
     exon            complement(456984..458302)
                     /number=1
     exon            complement(458470..458755)
                     /number=2
     exon            complement(458812..459030)
                     /number=3
     CDS             join(459308..459598,459658..460221,460279..460479)
                     /codon_start=1
                     /locus_tag="AO090701000164"
                     /note="predicted membrane protein"
                     /old_locus_tag="AO070326000079"
                     /protein_id="BAE61908.1"
                     /transl_table=1
                     /translation="MYRQSFAPPPAQSPPLHHPVPQHVSTVPMMRSPPPPTSQQSQTS
                     GYGNNPYQPAPAQGGSGTYAPGFGGFINDPTAQMGFQVGKTAMMAGQEYMEQNLNRYV
                     SIPALKHYFNVSNSYVLNKLALVLFPWRHKPWSRQQSRVTAASTGPNGQISHQQYSTM
                     FLPPRDDLNSPDMYIPVMALVTYILLSAMLAGFRGNFHPELLGSITTTAIAVIVFEIL
                     CLKLATYILSINNESQLLDLVAYSGYKFVGIIITLVTSEVLTPGRGTGGWVGWVVFIY
                     TFLANAFFLLRSLKYVLLPDSATDARTGSMHTVARSQRNRRTQFLFIYSYVIQFIFMW
                     VLSREGPTASNVAGSAS"
     exon            459308..459598
                     /number=1
     exon            459658..460221
                     /number=2
     exon            460279..460479
                     /number=3
     CDS             complement(460957..462177)
                     /codon_start=1
                     /locus_tag="AO090701000165"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000080"
                     /protein_id="BAE61909.1"
                     /transl_table=1
                     /translation="MSPAKAKLVAEALLSSIGLELVSCRVLQTLWAGYGHICEITARA
                     SGNQTTRTSNVKKDANGNFHLILKLISPPKSDGDEGHLRKLLSYEVEQYFYQEITPSL
                     DQDVAVASCLASTGHLQQGQSQELQGLTATIMEDLRQKFPVAGEKRALLNQQQVYAAI
                     EWLAKFHANTWKLLPDDLDRYLLPPLKEMQRRRADPSSGGDKLWLNGGYTYLATRQKE
                     LASLIEDTDSEWSAALCEPPQGSALSIADQVANFLTPCGRPYESYIHGDVKSENLFTT
                     GSGDEVAFFDFQYVGLGLGVCDLAKLFTCSVPLGMLTSDYDVPEELPMDDGERALLEC
                     YREALLARRPSGMKEFDYPMNILVHHWETALVDWCRFQASWGFWGNTEWLEARVRSIL
                     RDPAWQEWLRNESG"
     exon            complement(460957..462177)
                     /number=1
     CDS             join(464918..465145,465256..465314,465367..465688)
                     /codon_start=1
                     /locus_tag="AO090701000167"
                     /note="transcription factor containing NAC and TS-N
                     domains"
                     /old_locus_tag="AO070326000082"
                     /protein_id="BAE61910.1"
                     /transl_table=1
                     /translation="MADPRVEEIVEEETPKQTVEDAGSDSESEAGEANIPAGAAVTIH
                     SRNEKKARKAIGKLGLKHVPGITRVTLRRPKNILFVINQPDVYRSPSSNTWIIFGEAK
                     IEDLNSQAQASAAQQLAAAEAAAGEHAGHDHEHDLGTKVPEAETKKEEEEDDGEPVDE
                     SGLEAKDIELVMAQANVSRKKAVKALRENDNDIVNSIMALSI"
     exon            464918..465145
                     /number=1
     exon            465256..465314
                     /number=2
     exon            465367..465688
                     /number=3
     CDS             join(466161..466169,466247..466642,466726..466812,
                     466875..466904)
                     /codon_start=1
                     /locus_tag="AO090701000168"
                     /note="mitochondrial F1F0-ATP synthase, subunit d/ATP7"
                     /old_locus_tag="AO070326000083"
                     /protein_id="BAE61911.1"
                     /transl_table=1
                     /translation="MAARSAALKIDWVKVTSSLGLRGQTAASLQAFKKRNDDARRKVQ
                     LLSEQPQTIDFAHYRKVLKNQAIVDEIENQFKTFKPATYDVSRQLKAIEAFEAQAVQS
                     AEETKGKVEAELRSLEKTLENIETARPFDELTVDEVASAQPEIDEKTASMVSKGRWMP
                     AGYKERFGDMSVV"
     exon            466161..466169
                     /number=1
     exon            466247..466642
                     /number=2
     exon            466726..466812
                     /number=3
     exon            466875..466904
                     /number=4
     CDS             join(468246..468920,468997..469002)
                     /codon_start=1
                     /locus_tag="AO090701000169"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000084"
                     /protein_id="BAE61912.1"
                     /transl_table=1
                     /translation="MRKCQREYVEHAIRRKCRNLELAPEDHYTLANINSRFSNLESCD
                     KGWGGCRSKGDLILKARDRDTNIDYKVAVWFHFGAFQVRKPNKLVTDLDLFRLPCCLP
                     ELPARMPNKLLGPPWTDTKLEFLQLLSLDAYIDADDTFTRSRRILRQVIRDRDFATFQ
                     RLVNMHIRCQCYKYPVRWSVLPNHFQVALKYADEYDDPFIKLLVEQRWEDIPANLLHL
                     KDQLMSKN"
     exon            468246..468920
                     /number=1
     exon            468997..469002
                     /number=2
     CDS             470258..471661
                     /codon_start=1
                     /locus_tag="AO090701000171"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000086"
                     /protein_id="BAE61913.1"
                     /transl_table=1
                     /translation="MLTPIRVRGRRTKRPAPTEDAGPQLKRSKGRGGRPLMSLAERYN
                     FSQSQATRRAQRLIAKPPKQPLKKLSRLETLPVELIEKIFLLSLNVNLPRASASLAAT
                     VSSERIYRALILFAFWNDVPSSTGPFDAVSATAIAKILRPLEYIPLDLNERAALQSAI
                     LRCKWCTVQRLLSRFPDLMGLSIQRYWFSAGIAMTEDQEEKLRRFLAREEEENETRSF
                     EGTDKDNNHYTLSVSPLVSVTVTCHETETAQTHRILGITEFPERFLKGGNGFTSETIA
                     YLETLRLASGFNTSELMETHVALSRDALQKGIHAALVEHNAEALTSLLKIDEYHFRCR
                     NTNVAVTNSVPYTIPAEHFRTAVRVARNEPALFQLLVRASAESVPADDSDITQWAMDL
                     DDSFGQWLLDLMLQLPQRIEAANANPAEGAVFYLGRANGQVELARRYLNEVLGIEELG
                     SWMEETSHDFESQWRSL"
     exon            470258..471661
                     /number=1
     CDS             complement(join(471803..473270,473342..473523,
                     473598..473858))
                     /codon_start=1
                     /locus_tag="AO090701000172"
                     /note="betaine aldehyde dehydrogenase"
                     /old_locus_tag="AO070326000087"
                     /protein_id="BAE61914.1"
                     /transl_table=1
                     /translation="MEALAPYIPPALLPLAQTLHDQVPLVGVALVSLGAIYLGYIYIL
                     GIKEAAVPFNVPIPPEVRANWKGKAWEDVQGEEKKVLEGQLRGSWNNKVILSYCPADG
                     RILGNGIKPATTEDVDRAIQAAKMAQIEWARTSFAERRKVLRTLLKYVLEHQEELVTA
                     CCLDSGKTKVDASFGEILVTAEKLKWTIDHGEKALTPQSRPTNFLMMYKKNMVTYEPL
                     GVVSACVSWNYPLHNFIGPIISGIFAGNGVVVKPSEQTAWSSAFFLEVVRGALSACGH
                     SRDLVQSVVCLPEVADFLTSHPDISQLTFIGSRPVAHKVCESAAKALTPVTVELGGKD
                     PAVILDDARTVSEISSIASILMRGVFQSAGQNCIGVERVIALPGVYDKLLNDVSSRIK
                     SFRLGSVLLESKPEDPQQKPGAPDMGALISPASFDRLETLINDAVRQGASLICGGKRV
                     NHPKYPHGHYFAPTLLADVTPSMRIAQTELFAPVFLLMRADSVPHAIAIANSTEYALG
                     ASVFGYNHVDIAACVSNIKAGMVSVNDFGSYYAVQLPFGGVKGSGYGRFAGEEGLRGV
                     SNIKALCVDRFPKLMATRIPPRVDYPICKGDGSRQNGTGAWEMCKGVVETGYQLTLAG
                     RVTGILRLLKNM"
     exon            complement(471803..473270)
                     /number=1
     exon            complement(473342..473523)
                     /number=2
     exon            complement(473598..473858)
                     /number=3
     CDS             complement(join(476067..476589,476646..477333,
                     477393..477930))
                     /codon_start=1
                     /locus_tag="AO090701000173"
                     /note="glutamine phosphoribosylpyrophosphate
                     amidotransferase"
                     /old_locus_tag="AO070326000089"
                     /protein_id="BAE61915.1"
                     /transl_table=1
                     /translation="MCGIIALIQANPSSSAAVDLHEALYLLQHRGQDAAGIATCAAGG
                     RIYQLKSNGMAAKVFHDGSRVADLPGFMGIGHLRYPTAGSSANAEAQPFYVNSPYGIC
                     LAHNGNLINAPELKRYLDFEAHRHINTDSDSELMLNVFADELSETKKARVNKDDVFAS
                     LSRMYERCQGGWACTAMLAGFGLVGFRDSYGIRPLVLGSRPSAEGEGTDYMMASESVA
                     LHQLGFTNIRDIQPGEAVIIEKGGEPVFRQVAPKKAYAPDIFEYVYFARPDSVIDGIS
                     VYRSRQRMGDRLASRILDVLGPEVVKDIDVVIPIPETSTTSAAAVARYLDIPYCQGFV
                     KNRYVFRTFIMPEQKTRQKGVRRKLNAMQAEFKDRNVLLVDDSIVRGTTSREIVTMAR
                     EAGAKKVYFASCAPEITHAHIYGIDLASPNELVAHNRDPEQIAKHIGADSVIFQTLSD
                     LKGACAEIAQENGLAEPQNFEVGVFCGDYVTPVSDGYFDHLEKIRGEGRKIKALDRAK
                     EAVTHGFASEKDFQIAANGVKLDASGNIIPASTPGESEVPQVSICSTRKPEESEEHPK
                     VKDRMDISIHNMGDHP"
     exon            complement(476067..476589)
                     /number=1
     exon            complement(476646..477333)
                     /number=2
     exon            complement(477393..477930)
                     /number=3
     CDS             join(479220..480658,480715..480851,480936..481120)
                     /codon_start=1
                     /locus_tag="AO090701000174"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000090"
                     /protein_id="BAE61916.1"
                     /transl_table=1
                     /translation="MSSIQAREPSILEIADPRPTTLEVYDSDTDSSVTLDHDSDGPDY
                     ADDVVVISDNRPRDPTPFLLSTNAAANLRELVDLTLPTFQAFDEDDYCTDEEFELLLQ
                     SWQLHTPSPRVTTPVDETRATTVLPVEEVCIDGILYKPGQSLELYDGSYLRICTVLKD
                     SMDAVSFSGRRLLKTRNHAGTYVPKERNELVWIANATEIIPFQMAKKFVSMNFTNICA
                     IRGDPQKLVNPNHLWCRLKETLEDGEVSIEYVSFVEADEGHKIEPAILRQLWRGKSRA
                     FGEEDRPRESSPVIVLDNPDPVIDLTCSESVDEQKRRRQYTFGDGFCGAGGVSCGARR
                     AGLYNKWAFDNSEHATSTYRLNFEHAYCELSDIFSFLTSNDEFLRVDVSHSSPPCQTW
                     SSAHTIEGANDDANSACVFSSADLIRRAKPRVHTMEETNGLLDRHRDTLHRVINDFIE
                     IGYSVRWGILRLLEYGVPQTRKRLLVIASGPGETLPPFPRPTHGPGLGEYPTISQAIQ
                     NIPLGAPDHDVQAALSRGRRNFTNRELACLQTFPRNFRFGRRQVRKQIGNAVPPLLAE
                     AMYREIIRTLKKTDEDEASR"
     exon            479220..480658
                     /number=1
     exon            480715..480851
                     /number=2
     exon            480936..481120
                     /number=3
     CDS             join(481696..481980,482093..482870,482925..483109,
                     483168..483599)
                     /codon_start=1
                     /locus_tag="AO090701000175"
                     /note="uncharacterized protein involved in propionate
                     catabolism"
                     /old_locus_tag="AO070326000091"
                     /protein_id="BAE61917.1"
                     /transl_table=1
                     /translation="MSASCLALRRLTHRSPRTFQSRISSVSRISSAASSFSSLNALRA
                     VNSTAPRVSRFSTMAPLQSGSQDGALQKPYDPEIQDMANYIHNYEVNSDLAYDTARLV
                     FLDTLGCGLEALKFKECTKLLGPVVEGTVVPNGTRVPGTPYQLDPVNGAFNIGAMIRW
                     LDYNDCWLAAEWGHPSDNLGGILAVADWISRTNRAGGNIAGGKIVKVKEVLEAMIKAH
                     EIQGVLALENSYNKVGLDHVVLVKVATTAVVAKMLGLSEKQTADAISQAFVDGQSLRT
                     YRHSPNTMSRKSWAAGDACQRAVNLVLKVQKGEGGLHTVLSAPVWGFYDVLFKGNKFK
                     FQRPYGSYVMENVLFKVSYPAEFHSQTAIEAAEIINKKLAALGKSAKDIKEVTNRTHE
                     ACIRIIDKQFKAMDNFADRDHCVQYMVATMLAFNRLTATDYADGSEAATSPLVEDLRK
                     RIRCVEDTQFTTDYHDPAKRTIPNALTVTLNDGTVLEEVVVEAPLGHRLRREEAKPEI
                     LAKYKRHLQAHFEQARIDELLEVGLNKSALEGYDVDKYVDLYVKDKMVASA"
     exon            481696..481980
                     /number=1
     exon            482093..482870
                     /number=2
     exon            482925..483109
                     /number=3
     exon            483168..483599
                     /number=4
     CDS             join(484378..484511,484580..484779,484837..484913)
                     /codon_start=1
                     /locus_tag="AO090701000176"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000092"
                     /protein_id="BAE61918.1"
                     /transl_table=1
                     /translation="MITGLAHINLLVPEGSLPEANEFYVQTLGLTARPVPQAQVETTA
                     WFDIAGGPQQVHIAFGVNESLESSRHPCFKIGSLEDLQKLQQRIWDHHVRGGRAAPRE
                     ADKPGEAISGEMTEEYPTRFFARDFAGNRLEFSL"
     exon            484378..484511
                     /number=1
     exon            484580..484779
                     /number=2
     exon            484837..484913
                     /number=3
     CDS             complement(join(485129..486244,486325..486828))
                     /codon_start=1
                     /locus_tag="AO090701000177"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070326000093"
                     /protein_id="BAE61919.1"
                     /transl_table=1
                     /translation="MVTDMKKDIQPHVLSEGFSTSEHHETVAIKPDIELQEIPAYGPD
                     GVRGLISSGYVLGAAFLASLGGFSFGYDQGVISIINVMEQFHAVFPQAETAFGKGLMT
                     GMLLLGAFVGCLFMPYLADRISRKWALTVVVVIFDIGAIIQTCAQSYATLVAGRAIGG
                     IGVGTLAMISPPNLRGTLLVLESISIVSGVVISYWITFGTRLIESEVSFRLPFGLQMV
                     CATILGVGIHFFPYSPRWLALVNRQQDCLASVSKLRGLPDTDERVQAEFQGIITEVKF
                     QELIQEKRHPGTHGIKRQLLAWRDLFGRKGWRRTVVGCGVAFFQQFIGINAFIYYAPT
                     LFQSIGQSDEMSLILSGVFNVLQLVTVLVCFLIIDKIGRRPLAIFGGFATGVAYIIIA
                     ILSGLYGKDWSAHTAAGWACVAMAFLFILIFGLTYSPLGWALPSEVFPNATRSKGVAL
                     STSTNWLSNFIVGVATPPMMENLGYRTYIFFAVWCVMAGIWALIFVPETSGKTLEEID
                     DVFGDTSGHEEQEVMRTAALATMRPPVQTTV"
     exon            complement(485129..486244)
                     /number=1
     exon            complement(486325..486828)
                     /number=2
     CDS             489270..489743
                     /codon_start=1
                     /locus_tag="AO090701000178"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000094"
                     /protein_id="BAE61920.1"
                     /transl_table=1
                     /translation="MAAAVILRQYEEIEEEEEIDSSTGARDQQPVNFLAIIQAIIETT
                     ASIPTHHSFANAVFWIAIRQEIYYALAMQRFPRITPDQDKRQGASAANKLILFAGDVT
                     RWWLGDRSPLDWGELQQALLERVHAADHLECSCVKGRIALNHEGTYARVRSNPRQ"
     exon            489270..489743
                     /number=1
     CDS             complement(490402..491025)
                     /codon_start=1
                     /locus_tag="AO090701000180"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000096"
                     /protein_id="BAE61921.1"
                     /transl_table=1
                     /translation="MLEYDNIIHTAPSLRNFLWYTQLLVPLPGYVFLVGELRQRTTGE
                     LCERAWKAICVNYNDRGLIRKLRSPMHVAFGRMLLKAWNAHEEAELQLGRNVQPPQLV
                     TMLRERVALQTSTSQSKPDLAGNGSTDSVKTTNGGPIAGTRMWVDDNPGLDRMGRPFA
                     IMSNEDSMFPSLHSASQMFDEVSPDQNDVDWSYLMQPGVLGELCGKH"
     exon            complement(490402..491025)
                     /number=1
     CDS             complement(join(491711..492268,492357..492387,
                     492457..492593))
                     /codon_start=1
                     /locus_tag="AO090701000181"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000097"
                     /protein_id="BAE61922.1"
                     /transl_table=1
                     /translation="MSQHGISFDSVLEGEYDVANLEHDTNGAGTAAEGSAQNSNPQAQ
                     GKHSKWFPYYQEYCTTDDMLRDTSDDENERLTIHHSFDTMFGDTDGFPFNVCGSPAQI
                     TDLHPPAIKMFQLWQVYINNVNPLLKISHVPTLQAQVVEAAADPAKIFKPLEALMFGI
                     YLVAVLSLTDEEVEATFNEGKAVLLSRYHQGTQQALINAGFMRSNELMVLQAYFLYLV
                     CRPLRFSYSLGCTLYSSMWQRID"
     exon            complement(491711..492268)
                     /number=1
     exon            complement(492357..492387)
                     /number=2
     exon            complement(492457..492593)
                     /number=3
     CDS             join(492773..492793,492879..493347,493377..493560,
                     493624..494027,494084..494756,494834..494948,
                     495112..495774)
                     /codon_start=1
                     /locus_tag="AO090701000182"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070326000098"
                     /protein_id="BAE61923.1"
                     /transl_table=1
                     /translation="MRLPIASTTSKVYQAKGIIGSNEQPIISSARDNEAEVDKGKEMG
                     SDKVSDVEKQSIVPSQAVQKRGEESESRYQPRTLKFWLIISCNLLSLFVVTLDRTIVS
                     TAIPRITDEFDSLGDIGWYGSAFLLTGATSQLLYGRIYRAYEMKRVFLLSIVIFEIGS
                     AICAGRAIAGFASAGVFSGCMLIIIPMIPLHKRPMFQGMFGGVFGASSVMGPLVGGAF
                     TSSVTWRWCFYINLPIGAVTIILLFLIWDPPKSNYEPASIGTHLKRVDPLGMFFFVPA
                     IVSLLLALQWGGSTYSWSNSRVIALFVLFGVLILLFAAVQILRPETATIPARVITQRS
                     MFCAALYTLFISSSMILMVYFLPIWFQTVKLVSPIQSGIYTLPLMLSMVPATFIAGFM
                     TQKTGYYVPAMYICPCVLSVGLGLMSTFNLDTDLSHWIGYQFLSGFGLGFGMQVSGLV
                     VQRVLPFADVPIGIALVFFLQQLGGSVFATIGQSILTNYLMPQLSDIPGLDAREILNN
                     GATNLASVVPSEYMVQVQQAYNGACTKSFLAAMGLSLAGLLASLGMEWKSIKKGKKPE
                     VAVKDMVQRKHQELDGNADASTPPSRLDNKEESLTVNLIFPLSVFIHVLLPSPKATQY
                     PWKPTTPEGEIWQSLPPAISSSAAANLTPEEITSLNLDPSSPNATKLVLLEQALTKKL
                     QCLENAAKPTPLYEKDHPTWQSLKSALFHINRSTGDLEKQESLLLEQVNHPGPKGKDL
                     AALQNLAGLYEEKGEYKKAEKLARETIPALREHPILGSNSPQVLGSLRILIKDLAGQG
                     KIGEAEEVIREAEESIENLAEGQFAEHQQEERDALEKVVAGLKK"
     exon            492773..492793
                     /number=1
     exon            492879..493347
                     /number=2
     exon            493377..493560
                     /number=3
     exon            493624..494027
                     /number=4
     exon            494084..494756
                     /number=5
     exon            494834..494948
                     /number=6
     exon            495112..495774
                     /number=7
     CDS             497556..499166
                     /codon_start=1
                     /locus_tag="AO090701000183"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000099"
                     /protein_id="BAE61924.1"
                     /transl_table=1
                     /translation="MVPGSSSALKASRGVTSKVLSSTTQGALSGETLSKSGAHHPVRD
                     PRPSVPPRGSEKDGKVARAKETSPKQPEAPIKPQPNQTVSTTQTCMESKLNTAPKLAS
                     QGISSDSLTGHSQPQQPAQADADSLTTFPPFAVGAKDKVKRFLESQGLGEPGDTPHQS
                     PIDHLKSRPPTPWPGAGADPEALQSVDDARPPVPSHRLPRVPTAEDKPQNGPLLESSV
                     SKKPEELGLKNLRISQPDIPSHPLPPIPTSRFNFLPSEDDFSVIDDPGLLTPITEVPS
                     ELSRANSPVDPLMAGCKPRPIIKQPNPPVKKPPVQKPIEMPTPHHATPAAREVPKSQL
                     PPSSTVLSSTPDRPETPQVTVGLPKPKQKTPLSSASPQARPDLVTAKKLERKPSKLNI
                     TTTSSTIENNSRRQSETISEKQIDEPSVDPPQQRLSSPFNPSKIKQQAWDLETIASED
                     SWFQENEDNDSDGSASGESGPRRTPPGQVRARLTVETVECTFQPPAQTPDLDQAQYDT
                     TGQARNEFFPPWAVGSQALSEGARDLRT"
     exon            497556..499166
                     /number=1
     CDS             join(501802..501833,502035..504084)
                     /codon_start=1
                     /locus_tag="AO090701000184"
                     /note="signal transduction histidine kinase"
                     /old_locus_tag="AO070326000100"
                     /protein_id="BAE61925.1"
                     /transl_table=1
                     /translation="MGGSRLFVCKKQTQPLVQSRKVSADTPNGIQIAICDVPNGYVQE
                     VPPKEYPVTEWRDDTANTSCKFDKDLAELPRSLDLYEPFRSGTEVEQIPGRQIDAEAI
                     DASKGDPITEAHYFPKPPNVASSHGFEKHISVRTFDEIIKLKNSIRHMTSIVEKRLEH
                     CISARETVEEAYHSKSELLATMSHEIRTPIHGIIGMAQLGLEAGCLPAVAHDAFNLVH
                     SLGKSLLANINNVLDLSRIEASRMVIESIPFNLGSTVLSTLKPLAVEASKKMTDLTYE
                     VGSHVPQHAIGDPNRLCQILFNLVGNAVKFTNNGRIELSVKTAQQQACAKNQCVLEFS
                     VADTGVGIPPNKLELIFDRFQQADDSVMKQFGGTGLGLAISRKLVSLMGGDIWVRSTV
                     GKGSIFSFTCPLKLESPCATTTEQKKSHRDLVIFYITANGQKSDPICKIITGLGIQVR
                     VFNQHDIQIQELRDQNHLPDALIVESLEMACALRAHGHFGSTPLVLFDPTPSDSLKIS
                     IRSAFDLGIVSYITSPCSSESVLSSLLSALQDRPRHLEPSQIMPLSVLIAEDNDICRL
                     VAAKALEKCTNDITVVTNGLQALQAYQNRQFDVIIMDIQMPVMDGLEAVSEIRNYERT
                     HNTKRASIIAITADTIDDDRPGAELDEYVSKPLNPNQLRDVVLTCHSEGAKSPTIGDN
                     MDRGSACEISR"
     exon            501802..501833
                     /number=1
     exon            502035..504084
                     /number=2
     CDS             complement(join(504757..505030,505088..505457,
                     505571..505910))
                     /codon_start=1
                     /locus_tag="AO090701000185"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000101"
                     /protein_id="BAE61926.1"
                     /transl_table=1
                     /translation="MALPLLVNAGLLALPIAGSIGTLLGIDAHRQATGQRPLFTSEIG
                     NDGSISRNGVTNTRYCDLFNPISPKSEGQLYTCKFEGCRQYIGHMLTWGHSEPQPVGR
                     DRQNRRRIMYEPPEFSVTWKFDQETKDQTVHAFPNVQVDNILPASLADIHHLNLDMHW
                     TYGIGNKTVNKTDDAELKDVNTNVALDMFFDDDIKTAKNVSLAKYEMMIWFAGYGEAK
                     PFGYEDGIVKTKDLNGTTFQLYTGQNDLKQEVLTWYAANTTEKFDGDILPLITDLYTL
                     DKGVKLSNTDYLGVLSLGTEAFSSHSNVTFWMPRLSIDIQGPTARTTTAKA"
     exon            complement(504757..505030)
                     /number=1
     exon            complement(505088..505457)
                     /number=2
     exon            complement(505571..505910)
                     /number=3
     CDS             join(506572..506757,506831..507502,507562..508815)
                     /codon_start=1
                     /locus_tag="AO090701000186"
                     /note="glycosyltransferases, probably involved in cell
                     wall biogenesis"
                     /old_locus_tag="AO070326000102"
                     /protein_id="BAE61927.1"
                     /transl_table=1
                     /translation="MVDQHEGQQDQEKIAALNIYETEHNTNSFECQEEYAKGMIPIRP
                     KHLSFESSDTAKDSSPSLCKEAQVDESPSSPTGSSNIAVLHNRDDVDISTGWRRWVFT
                     LAPLFTIINTAVYFFYLGLRIYCIVMAQRSVDIYYGGAWIFVAVEMAVAIPSMIHNLW
                     TVMAWKKRSRPKLRLTGDKVPTVDVFVTCCGEDDVVILDTVRGACDQDYPQDKFRVIV
                     LDDAKSASLAAAVKELATMYPNIFYMAREKIPGKPHHFKAGNLNYGLEQVQYLPGGAN
                     ELMAALDADMIPEREWLRAVLPHLLVDAKVALACPPQLFYNTPASDPLGQSLDFFVHI
                     IEPIKDALGVAWCTGSGYIVRREALADIGNFPLGTLTEDVATSTLMLGKGWKTVYIHE
                     PLQFGSVPEDYGGHLKQRTRWAIGTVDTAAKLNFCLWGKNIQHLTFAQRFSGFIYAIL
                     NLFTLLLTASLFTIPIILLWGKPLVAYANDDQLHWLIWACFASTIINRLCEATLFSPA
                     GYHTGQRNSRFQLWMAPYIAVCMVRSFILPKWLGGQTQAFKPTGSLASALNERDPKLT
                     KNMFVRLRVMLLNYMVFFHLAFVYVTLIAVIVSSYRCFAIENGARDVIVCLITHAFWP
                     PFAFFFICSSMWTPIAYAINPPIMPDREDLLVRDQKTGVAHPTEESKRIAFGGQAVWF
                     EFEYSAATIATVLVFAYSFFF"
     exon            506572..506757
                     /number=1
     exon            506831..507502
                     /number=2
     exon            507562..508815
                     /number=3
     CDS             complement(join(509207..510206,510268..510620,
                     510682..510930))
                     /codon_start=1
                     /locus_tag="AO090701000187"
                     /note="phosphatidylglycerolphosphate synthase"
                     /old_locus_tag="AO070326000103"
                     /protein_id="BAE61928.1"
                     /transl_table=1
                     /translation="MFGRVGGQTFRCVVRRPIGRRRLCERKFSAYTTSTSPSANASST
                     ASPLGSITSELDRIAPCFEVPASRITILDSPASFYSTLKSKIRKARKRVYLSTLYIGK
                     SEHELIETVNQALHDNPDLKVSILTDALRGTRETPNPSCASLLASLVAEHGSDRVEIR
                     MFHTPNLTGLRKKWIPKRINEGWGLQHMKLYGIDDEIILSGANLSNDYFTNRVDRYHV
                     FKSKELADYYGRIHHAVCSLSFQILPDPHNTAGYLMDWPTSNGTVSPLEDPENFTSYA
                     STVLGPLIQPTQTKPALEQKSSDGTYVYPVAQFTPLLKPDASTEFPAVTTILRMLSTS
                     SAFSGARWLFTAGYFNIHPVLSSLLIASTSTSHTESTTRGTVLTASPWANGFYGSPGI
                     SGMLPAAYTHLSARFLDRVAEAQRTNSIQLKEWRRGTVGEPGGWTYHAKGLWITLPRE
                     EHPSLTFVGSSNYTKRSYSLDLEAGALVVTGDQDLKRKLGAESEWLQKESQAISRDDL
                     RRTERRVSWNVRLAMWIVEKVGGAL"
     exon            complement(509207..510206)
                     /number=1
     exon            complement(510268..510620)
                     /number=2
     exon            complement(510682..510930)
                     /number=3
     CDS             complement(join(512281..514725,514777..515768,
                     515810..515953,516068..516077))
                     /codon_start=1
                     /locus_tag="AO090701000188"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000104"
                     /protein_id="BAE61929.1"
                     /transl_table=1
                     /translation="MAVNSDKGRRYIAALDNARCQNKWDEIPELIRKVTKHAPQKTCN
                     SLSYSIGCLLEVASAEYQIAVHSPQRPSSAQSSSASSSSALPELIPHLLSTVERADGP
                     PQDIFQAQVCLGWVHWTLNEPGLAVARLPDDFDETVHKLTSTGEELSPWTKVCIAKAC
                     YLKGTYLKFWAFFHFLTGLGAGQHKVSGSADALDILQSLTSWLSSHNELSSDSSQFLH
                     WSEQLASESALVASMEALKTIPVADEALVKTALRLLRLWSAHPHVKQGALPHVDGFDV
                     CTPKYLTWKSYYDLLSATLQHDLAYVPPASGPERQQLAAEIRRVESMYESSLLRETKF
                     PTAYAGSTQIEDWVEQVITNWEILCGPQWTDEDLGEGGQNAVGRNVLDILYRAATKTY
                     HSHLILRRLFHVHSSLADFDLALKALDSYIEIVVGAKERAEKSAQYGELENDGTLLRT
                     LSEGVTMLCCFGSAKEAEKARELTTLMKKFINKHVQEIEGDDEEQVKLLISSDTSSTR
                     SQAVSPTDIAAAYRGVGIGLAAWANWTPVNEERDNIRSEAIDNLEKSTAPELEDETNY
                     SSLYTLALLLAEDRDLDSAIDCVKTALTAKTNPGTVQGYFTRERDLVPLWHLLALLLS
                     AKHDFDIAERSCEAAFEQFPAAVTSLAHHERRPQKQQQAIQDQANGAGLQRTLIEELR
                     GREKERIIETRMTQLAFVELLEGPEAAVNHSEQLLGLFATLFGNLALEADDKKNSQTD
                     NLRPPSSSAHTVKSLRGSIFGRHKGPRAPDRRAQSGSDFKTDENNPSLVPNESDQAPT
                     IQVTHEDKHVGHENPQDSRKLRKRSSTLKKGDNAPDPNHKSHINGHGSVTNGVGSVEQ
                     PNGGEDQSPDMVAAAMSANKEQSGKQPLRPVAHNMSHTQQPPPIGHAKQPPEQDVRLP
                     TSYGFDSPTKAVTKFPLAQAQKHALCILVKIWLLVAGLYRRAALFDDAFEACEEAAKH
                     VSRVEALCATQDSSARSFRERGWGVPKSADELWADLLAEQAFLSNAQSHPHKAMDKFE
                     QALMRDPDHPKATIGLANLLLDIWDQKMPLLPPEPEIELDMSMLTLASPEKQNSAARK
                     ADNKATNGQSSAETPDSQHNQVPHAIQNVEPKLLNRIAARDRAYGLLSALTKRGSSWD
                     NSEAWYTLSRAYEAEGNTKKLKEVLWWCVELEDRRPIRHWSNLGSGVYVL"
     exon            complement(512281..514725)
                     /number=1
     exon            complement(514777..515768)
                     /number=2
     exon            complement(515810..515953)
                     /number=3
     exon            complement(516068..516077)
                     /number=4
     CDS             join(516512..516847,516916..518973)
                     /codon_start=1
                     /locus_tag="AO090701000189"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000105"
                     /protein_id="BAE61930.1"
                     /transl_table=1
                     /translation="MASMSMSLHAVNHRLTNIPVKQLPPIASCLATSLSNCGELLSAP
                     QNQKSKSESDNAVQVHKLMTRLASLLQDRSPEGRWTAVVLVKAVVEAGQWEILRGCEP
                     LVRGLIAILAKPDPNSTKKMSIITLTRIFHLTYQYPTLVREITTPSLPSFVTSALNLI
                     SVKPSSEPTRKLKPHSPFLETVLNALGELIARHPTIFRPFSAQIHSILQAIIGSTSPT
                     FPQTALDSAERLFISLHHCAPKNTSGEEWKNACQMTIASIHGAADYVFRAVVEQWESV
                     DPALRQASRPQDYSREVGDGGLDTLGLAGWQGLDSGVNRLVVLLQMLSTCLTTATASM
                     VAIPIGPILDLTSRLTAVVVPSDGRDIQANPQISRTEREHLFAELPRIHVGCMELLQN
                     LVKTLETGAIPVTQTILEQTLWVYRAENFSREIRISAYHLVQTLLTRMGPSLTKQSLA
                     SLADLIRASCHDLLPPTHDQSTSARASSDAKDKAKSNHATANADSFLNPRLKQSRQSD
                     IPSFSSLTKAASELLAGVLTHAPTEYLSPSLRAEIDRTIILTSDKHTMLASVLNPVPA
                     AKGRGVSASIMPFLARSFPAEIEVEALIRPRMPVLMNAPGIGGYTDIEEEEEEEVPAR
                     VSGTASESTGFLQPSSTPILHHDMMDTDVSHKAAPTLTKRSLAEDNKPQPPALGSTGK
                     VDSSFQSKRPRVEGDVTAVASQPSLDRASPATFTGTAAVSVPSSSATVTSVPPPRVAS
                     VNTSSTTTVGGPLSGSAVAQTNPADAGEDDSDDDLPALNIDPDTEDENEDEDETMEG"
     exon            516512..516847
                     /number=1
     exon            516916..518973
                     /number=2
     CDS             522633..524447
                     /codon_start=1
                     /locus_tag="AO090701000190"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070326000106"
                     /protein_id="BAE61931.1"
                     /transl_table=1
                     /translation="MADTGEPVKPTRIPHWRLIVDQGILTQEVIDHPYAGSGTEDDPY
                     LVTWLPNDPRNPMTFPDSRKWFYTVTVAWATLAVSLVSSAYTGGVDQIMEQFNCGTEV
                     ATLGVSLFVVGFAIGPLLWAPMSELYGRQYLFIGSYCGLTVFNAACTGSKNIWSLIIF
                     RFFAGSFGSSPLTNAGGVIADMFPASQRGIAMSVFAAAPFLGPVLGPIIGGFLGMKEG
                     WKWVMGFLAIFSGALWIAGAVCVPETYAPVLLQRRAAKLSKVTGKVYQSKIEVDQGKK
                     TPKEAFKIALSRPWILLFREPIVLLLSIYMAIIYGTLYMMFAAFPIVYQGQRGWNQGV
                     SGLAFLGIMVGMLLAVAYTLWDNKRYINTQARHNGFAPPEARLPPCLIASIVIPIGLF
                     WFAWTNYPSIHFMASIAAGAPFGFGMVLVFLSLMNYLIDAYTIFAASVLAANSVLRSI
                     FGAVFPLFTTYMYNDLGVHWASSIPAFLALACVPFPFLFYKYGPAIRTRCKYAAQSDA
                     FMKKLMEQTRDVPDETDTEKKSENNATEGLKEVDDTVSEPTPASSQLDDLPSASKYDR
                     RKSIASQASRRSEGVNSQTVYDANPYDIDRVNTRESFK"
     exon            522633..524447
                     /number=1
     CDS             join(524841..525122,525477..526699,526754..527729)
                     /codon_start=1
                     /locus_tag="AO090701000191"
                     /note="helicase-like transcription factor HLTF/DNA
                     helicase RAD5, DEAD-box superfamily"
                     /old_locus_tag="AO070326000107"
                     /protein_id="BAE61932.1"
                     /transl_table=1
                     /translation="MGVRRGKRQVDQIDLTQSDDENPQSTPKTPRVTRGQRLGEDTLF
                     APLSQSSQLAADDEEDDAQAADVIPGSQAADDPAAGSSMLYGNVNTKIVGDRLPLSEF
                     KQREREERKQQKEREKARKEAEKRARALAKGKGQQWEAANNSMFSNLYAGDGSIEGGE
                     SLEELIGQSSTFNPRDIGQVAENFGLSEADLAKMPMADRPAALSTELLPYQRQGLAWM
                     IEKENPTLPAAGSEDVVQLWKRKDNRFTNIATNFSTSIAPPLASGGILADDMGLGKTI
                     QIISLILANSAPKTPGYSKTTLIVAPVGVMSNWKNQIQDHTHSESAPQVHVYHGTGKK
                     EAANLDQYDVVVTSYGALALEYNPNAKVPPKKGIFSVHWRRVVLDEGHTIRNPRSKGA
                     LAACNLRADSRWTLTGTPIVNSLKDLYSQVRFLKLSGGLEDMTVFTSVLIRPLMSEDP
                     NARLLLQALMSTICLRRRKDMEFVNLRLPPLTSRVLRIKFHTHEQEKYDMFQSEARGM
                     LLDFKSKDKSSTTYSHLLEVILRLRQVCNHWALCKDRIEKLAQLLEDNKVVPLTPENI
                     KALQDMLRIQIESQETCPICLDTLEQPVITACAHTFCKGCIEQVIERQHKCPMCRAEI
                     TDTSTLVEPAVEMGESTETVVADPDTPSSKIEALIKILTAQGQAPGTKTVVFSQWTSF
                     LNLLEPHLNRYGVGFARVDGKMSSLARDNSTYRFSHDPNCKVLLASLSVCSVGLNLVA
                     ANQAILADSWWAPAIEDQAVDRVYRLGQTRETTVWRLVMEDSIEDRVLAIQETKRKLM
                     LAAFRETAKKKKVDDRATRVADLEKLLT"
     exon            524841..525122
                     /number=1
     exon            525477..526699
                     /number=2
     exon            526754..527729
                     /number=3
     CDS             complement(join(528785..528818,528992..531601,
                     531875..532050))
                     /codon_start=1
                     /locus_tag="AO090701000192"
                     /note="transcription regulator XNP/ATRX, DEAD-box
                     superfamily"
                     /old_locus_tag="AO070326000108"
                     /protein_id="BAE61933.1"
                     /transl_table=1
                     /translation="MSDDSMEDFIDKSDIEDQPIHAENNSSTRTPPMSESDDNIISPS
                     RIRRHSRARKLPFREKRPSLPDIHDVDKLVSVPWDLLEERQDRRRLLAKLIATLSIEE
                     RNKLAQAVPRYSSSDLQQLTGTGLKLLLKNQEIIPELEEAESRVVMRVTSFYISWINC
                     VHLPSEGIQRNLVLYAQSKISSFVTYFNELCARLDDYPKKKGSKMHRLNEKGALSDPT
                     DTPHKKRKREVKESQNAKKSQQSAQLRVALQEKQRKILERKIGSTNTDPTRQAVSFGN
                     PAIYLDPQIGLRVKPHQLNGIQFMWRELIEDENKQGCLLAHTMGLGKTMQVISLLATI
                     SAAASSDDPKIRQQVPAAFYRSQSLILCPSSLIENWYEEFLMWAPVQSGIGPLRKITT
                     SATMPERLQEVCDWNEEGGVLIMSYDIFRTWILNRETNKRGKPLNDNDYGKVRDCLLE
                     GPNIIVADEAHKMKNPATGISQAAMQFRSKSRIALTGSPLANNLIDYYAMINWIAEGY
                     LGEFVEFKAKFVEPITEGLYVDSTYTERRRSLVKLQVLKEILAPKINRADISVLAGSL
                     PTKVEFVITVPLTDLQKQAYDSYVETILQGKGAFGSAQLWSWLAILSLCCNHPSCFRD
                     KLLSRANDAQKINKRLDEMEMIPGDEPIAQAGLPDSEKLVSEQEQIFAKVPDIKALEM
                     SHRARIMNSIIDESIRAGDKILVFSHSIPTLDYIEHVLRSSNRKYSRLDGRTPVVTRQ
                     DATKRFNLGSEKQVYLISTRAGGLGLNIPVANRVIIFDFKFSPVWEEQAVGRAYRLGQ
                     QKPVFVYRFIAGGTFEEVMYNKAVFKTQLAFRVVDKKNPVRWAQKSLGEYLFPAKPVP
                     QQDIAEYLGKDPQVLDKIIMGDTGEEKSIRNIALTETFQKEDNDKLTEEERQGVQQQL
                     SDERLKRTDPEAYRHTGHEHLPRAF"
     exon            complement(528785..528818)
                     /number=1
     exon            complement(528992..531601)
                     /number=2
     exon            complement(531875..532050)
                     /number=3
     CDS             join(534236..534534,534640..535888)
                     /codon_start=1
                     /locus_tag="AO090701000193"
                     /note="glutathione synthetase"
                     /old_locus_tag="AO070326000109"
                     /protein_id="BAE61934.1"
                     /transl_table=1
                     /translation="MGDIYTNYPPPLNPAQKEYLVTTIKDWATQNGLLVRPAPSFVPK
                     EIDPSGVLATNAPVTLFPSPFPKSCFNEATALQTVYNRLYAAITCNEEWIGKIMEDLI
                     DVDDFISHLWKVHLAVKEEGYVQTLSLGLYRSDYMVHAPSSSTTPSLKQVEFNTISSS
                     FGGLSSLVTSLHTELLDSPPGKPIAYPSHPLFESNAPPENTAVETLSAGLAAAHNAYG
                     PSKSTPALPTCIIFLVQENERNTFDQLALFRQLTKVHKIPVFRLLSSEILDHTSIPSS
                     NPSRPLVYSPPHSPETQFEVTTAYLRCFYAPSDFKSERDWEARTHVERSAAIKCPTVL
                     NQLAGCKIVQQVLAETTGPDNLTSFLPDTDPAVVARLRETFAPQYDLSSGGRGRDLAL
                     NVETAMNHVLKPQREGGGNNIYKEAIPDFLRSIPESEWKRWILMELIRPPAEARNIAL
                     RTDGEVLSGEVIGELGVYGTILWDQANGKISHNEQGGWLMRTKSKDVNEGGVATGFSS
                     LDSILLY"
     exon            534236..534534
                     /number=1
     exon            534640..535888
                     /number=2
     CDS             complement(536273..537031)
                     /codon_start=1
                     /locus_tag="AO090701000194"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000110"
                     /protein_id="BAE61935.1"
                     /transl_table=1
                     /translation="MTLLTKSTDTTPPTDRFHTCPHPYHTPYSEINLPPILFRMDAPI
                     GQDLPDLSPLRENGQVARDHEDKEIWDFPFLPRYITSSPPGWLLEYWMRTDPRLTYRD
                     IRVRMAGPLHLRPHENALNMRRERDARRPLRLSCWTYRRGTPGRLNKIDVERVERWSI
                     DQIRYNTTMDVVYADGGPVRLEDRALAAHTPATYPLDYFLNQGRTEIPSERIRVAQSV
                     FFRLSERAKQLGLGSWRQLPDNEWPDTFRYNISR"
     exon            complement(536273..537031)
                     /number=1
     CDS             complement(538470..540062)
                     /codon_start=1
                     /locus_tag="AO090701000195"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000111"
                     /protein_id="BAE61936.1"
                     /transl_table=1
                     /translation="MIDPEEDLELSQQSNASVYPESSMTAESSESAKVNAKKGKGKKD
                     KGESLPSPAKQRDSTNGDIGKPVPRQDSPQAIDPRNFTTSRPDQDNWSWADLPDILYQ
                     FEPADKKDRKSDPPRMNYPIHGQYLRDLPILPDNIASTVEEFRVEAWMRLDRRIRLRD
                     ITDRMHPLFRIQDNALQQRSVRFRQQFSLIAWDSGNKRSQQLKQDILRKMQEIGLSPA
                     LNTTRGITPGLIDPALGEDGGRIPLPNQYNKGKRVSRGRKPSKTPLKEEVATEDPRHE
                     YTVQEEQPTGFSVPIKKSASVGKVDTSKKEGPALVVASPVESVSIDFTVDDLTVESVA
                     ELFNYVPSYISFDENNDSLEGSLPVITGLIPDSELPETVSMVDIDLTVSIKDSIPRHN
                     TEKALKPIATGKIQRRRPSPLKLARGGFCGNACHLGKCATPVYTNLTLVSGPAGAGVF
                     HEGLLPPSQGLYPDVLTPYSASDLPFGVRHRVFDNLFEQCLSGDRYLFDIPAMAPDDM
                     EMMDIGDINDIIIDDYDDYFQK"
     exon            complement(538470..540062)
                     /number=1
     CDS             complement(541986..542672)
                     /codon_start=1
                     /locus_tag="AO090701000196"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000112"
                     /protein_id="BAE61937.1"
                     /transl_table=1
                     /translation="MTASHTDQDNWSLENLPDILYILKPEHGKSRQVVRITAQKVFGK
                     HINAFSVLPDQISSKVEGWRLEAWMRLDRRITGQDIIDRVNPRYRFRLTSIDIELRRK
                     AFREKFHVACWGAQKTINNISRLAMANGIDPASNSTRGLTPGLIDPSKGEAGGRILLP
                     PRAAYDDISDSVSHPNHSNSDIFERTRLIKQSSHPGQIPAVILDESHRSNKTKSAEIL
                     YQLHWDTKHL"
     exon            complement(541986..542672)
                     /number=1
     CDS             join(543905..544141,544227..544385)
                     /codon_start=1
                     /locus_tag="AO090701000197"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000113"
                     /protein_id="BAE61938.1"
                     /transl_table=1
                     /translation="MSNPSSQLFRLIQNTATKHRHPKQISNKYSLQISCNVKPNASAN
                     REGIIAVGPEKVDVCVAAVPRDGEANAAVSRVFAQILKVPKSTVVVIRGLKSRDKTLC
                     VSDLEIGSEGEEKFIQQVRQKLEEAVIKK"
     exon            543905..544141
                     /number=1
     exon            544227..544385
                     /number=2
     CDS             join(544620..544756,544826..545180)
                     /codon_start=1
                     /locus_tag="AO090701000198"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000114"
                     /protein_id="BAE61939.1"
                     /transl_table=1
                     /translation="MSSTNPETTSSKRKAPDDRVASKAAATQAIHFTARNPPWTYLKL
                     QLIHQPGTSTAVQSQPLDPLTARTHINSALSQFLGLSGTAISIDILKILPEAPQPKPT
                     DKFIWLRVPRQDAPAVVAAVSSWIGGGTGGGSVGSVAWRVCAKGNYLGALTQGSGEDL
                     FAP"
     exon            544620..544756
                     /number=1
     exon            544826..545180
                     /number=2
     CDS             complement(join(545922..546271,546338..546511,
                     546573..547108,547304..547419))
                     /codon_start=1
                     /locus_tag="AO090701000199"
                     /note="predicted membrane protein"
                     /old_locus_tag="AO070326000115"
                     /protein_id="BAE61940.1"
                     /transl_table=1
                     /translation="MAHLPPNAWQCAAQDDPASVFCCGVGHSDHTTLEIRTPSWADGR
                     KYWSLLIQTSRNLARTIWVNTKEREGELGKEDLLQKLYVGIRCKRPQLYTIFSDNTRT
                     AMNLILAFAVALKHKLRFEPDIAYDDLAGLVGYLDTFAKDAHDRQRLQPQRKSLWKST
                     GEYLGVSFAESNPRKLVKRSKKPLGHLPLEILNHLSAYIDRCIANDTLSISLHQAQAI
                     NGLATLNEVVTGTERVLDTPLPTAYSIAIAQIAWIYVMSLPFQLYNTLTWVTIPGSII
                     AAYIILGLATIGSEIENPFGQDVNDLPLDTYCRQIALELDIITATPAPRVDDFTVRDD
                     NLVLYPLSMDGYNDWKDRSVEEIRAALRTKVIANSPSSALGSDESTVVGSMSSKQTV"
     exon            complement(545922..546271)
                     /number=1
     exon            complement(546338..546511)
                     /number=2
     exon            complement(546573..547108)
                     /number=3
     exon            complement(547304..547419)
                     /number=4
     CDS             550968..551729
                     /codon_start=1
                     /locus_tag="AO090701000201"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000117"
                     /protein_id="BAE61941.1"
                     /transl_table=1
                     /translation="MQEIDNAAGAVAGVAMFVLGLPTIGWFVRKSYEVIYILIFIVLW
                     GELGLTSTVFYMVHVLMFILIMIMVGMHRPKISTHSLVIVIFTSCMWFSDRLLRLAKI
                     CWFSVGNHATVTALLGDTVHVRLTRNVSCRPGSHVFLWLPSIRLFETHPFTMVSSSPP
                     EFVIRAYDGFTRDPYYLAHKKQGQLLRCSMDGEYGQVPNFVEFDKVVFVAGGSGASFT
                     FAIALGSLDTLAARNTSKQIEFLWAIRSLGRCIYI"
     exon            550968..551729
                     /number=1
     CDS             join(551962..552189,553688..553893,553971..553996,
                     554054..554084,554151..554655)
                     /codon_start=1
                     /locus_tag="AO090701000202"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000118"
                     /protein_id="BAE61942.1"
                     /transl_table=1
                     /translation="MGLSKTTAPGAIHHDAVYMKKGRPDIRLLISDCISGCGSEERVG
                     IGGCGPIGMIDTLRQVVRERQISGPSVTLHTENGRRYHAYREGEYALVCSVTLIPGVW
                     LDGLIHVYSLILDGEIHLAPIKNPQRVLDIGTGTGIWAVDFADQYQSSEVIGNDLSPI
                     QPRWVPPNCQFEIDDFESEWSYAHPFDYIYGRELAGSIHDFPRLCKQAFAHLHPGGFF
                     EIQSFTVDIFSDDGSIEKAPYIKQVVFIDVVCKVVKAPSSPWAKDPKQKEIGRFFQAH
                     QVHIVLAHTNVLLSKVLGWSKTDIDILNMHVLRESKNLEVHQYGKLYLIYGRKPL"
     exon            551962..552189
                     /number=1
     exon            553688..553893
                     /number=2
     exon            553971..553996
                     /number=3
     exon            554054..554084
                     /number=4
     exon            554151..554655
                     /number=5
     CDS             join(558064..558264,558317..558621,558681..559044)
                     /codon_start=1
                     /locus_tag="AO090701000204"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000120"
                     /protein_id="BAE61943.1"
                     /transl_table=1
                     /translation="MKLPPADVLATWPTPNYIDPTTRGDSVLVVTIVFSAIAFVITCL
                     RLYTRIKITCSPGIDDILIVVALAFTIAMCVVICLATERHGCNRHIWDVPLEWLPTAS
                     KFNLLFQILFSLSSSITKLALLWFCKRLLGAGSKGLYTTYNIVLIGAMVLVALLCIIF
                     LFVCIFQCSPIHAYWDFQPTYPHHCLNDGAVVFAASVVNIFTDFISTVIPMPLIWNLK
                     LPARQRIAVMSIFSLGIVVNVAGTVRTVYVYKSMIASYDMTWFGWPVFLAASIEINLG
                     LVCLAKFLSANVF"
     exon            558064..558264
                     /number=1
     exon            558317..558621
                     /number=2
     exon            558681..559044
                     /number=3
     CDS             561813..562679
                     /codon_start=1
                     /locus_tag="AO090701000205"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000121"
                     /protein_id="BAE61944.1"
                     /transl_table=1
                     /translation="MAQASTPTEDIPLEYFPEPTEEDEHPWYSAFRLALDKPLLRIWD
                     SHSTVKPTSKNRLYSRDQIKRLDTFEARAISLSIHAHNSRAPTPFISFTTSAGAARRL
                     AQKMPQKRGSQMLTVINPRVRRAKGRYLLSTVDEMCYYGVRKPYRTFYRDYQDEFLCL
                     WVVGEEEIVGHWKWDKLVEEKGWYQATILPAFRKHDKRFTAHLSPISLSVSVEVCSDT
                     SSSAEMISRGQTKGWEEGNSLDSEISPDQHQDLSSEGYSGSLEDYSDPGDSYYENEAN
                     SIGFLLNASEED"
     exon            561813..562679
                     /number=1
     CDS             join(563967..564217,564280..564315,564381..565543,
                     565601..565647)
                     /codon_start=1
                     /locus_tag="AO090701000206"
                     /note="4-aminobutyrate aminotransferase"
                     /old_locus_tag="AO070326000122"
                     /protein_id="BAE61945.1"
                     /transl_table=1
                     /translation="MASIARSSFRLRSVTRVPTARTISTTPHLRAAAKPFFADEPAGP
                     KLATAIPGPKNKAATAELDKVFDVRSLNMLTDYSKSIGNYIADLDGNVLLDVYAQIAS
                     IPVGYNNPHLTKVAQSPEMTTSLINRPALGNFPSADWADILNTGILKVAPKGLNQVFT
                     AMAGSDANETAYKAAFMYYRQLQRGGPEKEFTEEELQTTMNNQSPGSPQLSIMSFKSA
                     FHGRLFGSLSTTRSKPIHKLDIPAFDWPQAPFPSLKYPLEEHAQENAQEEQRCLQETE
                     RLIKEWHNPVAAVVVEPIQSEGGDNHASPAFFRGLREITKRNNVLFIVDEVQTGVGAT
                     GKFWAHDHWNLETPPDMVTFSKKAQTAGYYYGNPALRPNKPYRQFNTWMGDPARALIF
                     RGIIEEIERLNLVEHTAKTGEYLYSGLQRLAEKYPEHLQNLRGKGQGTFIAWDTPKRD
                     EFLGKAKGVGVNIGGSGVSAVRLRPMLIFQQHHADILLESIEKIIKQL"
     exon            563967..564217
                     /number=1
     exon            564280..564315
                     /number=2
     exon            564381..565543
                     /number=3
     exon            565601..565647
                     /number=4
     CDS             join(567174..567326,567434..567514,567658..568093,
                     568172..568902,569004..569039)
                     /codon_start=1
                     /locus_tag="AO090701000208"
                     /note="serine-threonine phosphatase 2A, catalytic subunit"
                     /old_locus_tag="AO070326000124"
                     /protein_id="BAE61946.1"
                     /transl_table=1
                     /translation="MASSDLEAATALKVQGNKAFGQHEWPTAVDFYTQAIAKYDREPS
                     FFSNRAQAHIKLEAYGFAIADATKALELDPAYTKAYWRRALANTAILNYKDALRDFKV
                     VAKREPNNRDAKVKLADCEKLVRRMEFEKAIEVGDPPSAFEDLDIDAIAVDDSYDGVR
                     LEKEMTQEFIDDMIERFKNGKKIHRKYAFQIVKAVKDIVYAEPTMVEIGVDQGTKLTV
                     CGDTHGQFFDLLEIFRLNGYPSEKHAYLFNGDFVDRGSWSTEIALLLYAYKWLRPNGI
                     FLNRGNHETDDMNKVYGFEGECKAKYNERMFKVFSESFSALPLATLIGNKYLVLHGGL
                     FSDDNTSLDDIRKLDRHNQRQPGQQGLMMEMLWTDPQTEPGRGPSKRGVGLQFGPDVT
                     KRFCEKNGLEAIIRSHEVRMEGYEVEHDGRCITVFSAPKYCDTTENKGAFINVGPELK
                     LDFQVFEAVPHPDIKPMAYAQNSIMSMM"
     exon            567174..567326
                     /number=1
     exon            567434..567514
                     /number=2
     exon            567658..568093
                     /number=3
     exon            568172..568902
                     /number=4
     exon            569004..569039
                     /number=5
     CDS             join(569596..569617,569698..569768,569834..569964,
                     570033..570145,570207..571063,571122..571352)
                     /codon_start=1
                     /locus_tag="AO090701000209"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070326000125"
                     /protein_id="BAE61947.1"
                     /transl_table=1
                     /translation="MEFDPKTPQYLTSDKSSFALTSALERWPVIITGAIDDLHRTVGD
                     VSDEEKRKEGKGIIEKLAALKYELQHNRQLTPLPDDGQPGIEEYNKELEQRGNPKWHD
                     VAWLYSECYLYRRISAYFALSTHWKGYDVFARQKMSTFKSSRPAVLELAARYKEIAQE
                     AEKGQADGKTPEQVEQAERILFSEMCEICLWGNATDLSLLTSLTYEDIQKLQGSQARK
                     AAEKNILVNDLDAAFEVLNKARKEKKTGERRVDIVLDNSGFELFVDLILAGYLLSAGL
                     ATTVVLHPKLIPWFVSDVTPPDFRDLISALADPQSFYTAADESGKEHSPLSDKELSEV
                     NFLFEQWSRLHADGKLVIRPHAFWTSPGSYWRMPNTAKDLFEDLQQSELVLFKGDLNY
                     RKLTSDATWDPTTPFTTAIGPMGPKSGVRVLAFRTCKADVVVGLPAGEDERLRQLPNG
                     GGSEARKWAWSGKWAVVSFSDGKA"
     exon            569596..569617
                     /number=1
     exon            569698..569768
                     /number=2
     exon            569834..569964
                     /number=3
     exon            570033..570145
                     /number=4
     exon            570207..571063
                     /number=5
     exon            571122..571352
                     /number=6
     CDS             complement(join(571904..574026,574166..574205))
                     /codon_start=1
                     /locus_tag="AO090701000210"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000126"
                     /protein_id="BAE61948.1"
                     /transl_table=1
                     /translation="MLEWITGQNEQFADNSKVLEPPETPAPVFAIRAFKSALFGTPGA
                     DDEDQMEREPNPKNLTANQSSRASLSLKPTIGNTSDAPIATKADVDMAVNAMASPTKS
                     ILVTPGTASNRRKTVSFGDGVVDNERKRGESPNKSSRTPLTSQWSINSSDGKAKPRSK
                     LTQALMDSRDKSPKESDASQTPQSTEARPVAQSASSTEDDTGDDTINLNEPRSQSGKY
                     WKAEFDSYRTKTTQEIRKLIQYRSAAKAYARKKDEEALRLAEKLKEEEVKVSEMERHV
                     TQLASTMVGENSKADKEQLVQELTKQTALALQYKHRVGLLRKLLEQHGVVNNDVEHIA
                     GSSETTNDTPGDTAEELHKAQQALGEANTKLEEMKREQSEFAKLKDLAQSSEQKASNL
                     EKENATLKQTLARVKQEMTKYEGRRKEKEAKLKQREAKLELRVQEYRERLKSTSQQHR
                     EQEEGLRESFNDERRRMQDQIDLLKLKLTTFERLPELRSRTRHSDKGYAGVQVYDFVH
                     DSPQKEQSDETQDIDEPPSPSPRAKDRRSHTTRTVLGELDIKRASKALGLETEDHSEQ
                     LAYLDDTPYKPKENHLLEGDGIPPSSPPDYPPLEPPTRRTSRQKYNSESYRSYVPTHS
                     TITSLAHHLATREDSKQIRTERLRARRSPSKYSLDAITGLPQTYHLPDRTKRRQSLAS
                     VQRDSIPVDRMLAAQARLKRKQDSRKTRQEGKENMIRA"
     exon            complement(571904..574026)
                     /number=1
     exon            complement(574166..574205)
                     /number=2
     CDS             join(574699..574917,574983..577046,577106..579308,
                     579359..579663)
                     /codon_start=1
                     /locus_tag="AO090701000211"
                     /note="eIF-2alpha kinase GCN2"
                     /old_locus_tag="AO070326000127"
                     /protein_id="BAE61949.1"
                     /transl_table=1
                     /translation="MPHKQKKTSSNAHKNGSPRAEKKRQFPPDAPSLALPVVAPTNYE
                     EIHRNEIEALRSIYGDDFEEVEHKRSAWQQSSDVVFKLHLRASSNPEVRLDLLVELPT
                     TYPKTYPNLFLENLDDLRQGARSRIDDIIRTKPKSLVGSEMIYEIAVSIQDVLEDVAE
                     AKAQNKDLPSLEEERMEQEAAANQRAELERQEELQKQEAATAEEERALQQLLEDKIRE
                     RTKARLLRRKSRTSGIDTGSDIDAGENIPGAISFDPPLVMADSDEGPLVFRAVYGKTL
                     LKSAQGKNTYAVRPVVTENRCHAPLLILKEYSIDETQLSPLAFREKMRSSEDKLEALK
                     RLRHPNLLDFVGFKIYRPLEPASPQDNAWRVYLLLEHANKGSLSEFLDIVGSVPVETL
                     RSWTIQLLEALEFYHRSGFVHGDIHCGRIMILRNQTGGTIVKLQASIENALPDSADSR
                     QSLEASKSPLWLPPESTQGNTSPTMKTDVWDLGIVFLQMGFGKDVLQRYTSANALMGT
                     LGLSAPLQDLLNEFFRTDPKKRPTAFQLQPSEFFRVDAPLVSHSSTSNSISLPRRPRF
                     DSFGGLPAFSRYYQDFDEAGRLGKGGFGMVVKARNKLDGRLYAVKKITQRSAAALKDT
                     LSEIMLLSRLNHPYVVRYYTAWIEEDYDFVDEEAVSSTEGDPFASQGSEGSQDSQGYG
                     YSTGGLDFISSSGYPKIEFGSDSEEENDGTLSSRDNGQTPETYGTGSETGKELSRVRS
                     GSQGRPVSTTLYIQMEYCEKHTLRDLIKNGLYDDVDRTWRLFRQILDGLSHIHGHGII
                     HRDLKPDNIFIDVANNPRIGDFGLATSGQFTTAVRSSTAADFEGDFTRSLGTTYYVAP
                     EMKSGFTGNYNDKVDMYSLGVIFFEMCYPLGTGMERDQTLRAIREKEHTLPPIFRYSE
                     KALQGKIIESLLSHNPSERPSASELLHSGQIPLQVEEETFRRAIMHLLSDPSSPDYKK
                     ILSAIFSQSPKKFEDIAWDMDSRGTPAANELLVQGLVKERLTSIFRRHGSVETTRQML
                     FPRSQHYNNGAVRLLDSTGNVLQLPFDLTLPNARAIPRQDPSLEKTFAFGTVYRETSH
                     GGEPRTHKEVDFDIVSHNTLDLALKEAEVIKVLDEIIEEFPPLRSASMCFLVNHSDLL
                     QLVLEFCRITPSQIPLVKEVISKLNVGKWTMQKIRSELRSPAIGVASTSLDELARFDF
                     RDSPKQMQKRLRDIMEGTEFAERLTPIFVRINWLMGYLKSFDVKRKVYVNPLGSLNDK
                     FFRGSILFQCVFDNKRRDVFAAGGRYDSLVQEFRPKVLASRPQTHAVGFNLSWDRLSS
                     AMLEYIKGSSKSHLKHHEVEPAAFWKTRRCDVLVASFDSKILRKKGIEVVQDLWANDI
                     SAELAVDASSLEELLTKYKDHNHSWIVIVKQDSQERGFKVRCLVPKEEFDLRSSELIP
                     WLRNEIRARNQREGAVDFRQSRLPSQPDPGIDGERSSDVRILVPQHRSKKTNRRNIVE
                     NALFRSREVIEDALNGPIAAIDTRDDLLEAIRDTRLSDPESWRTVIQSAPLTERKYLS
                     QVHELLVDLAHENHVNDGADNFSNAFIYNYRTGSCVYYDLGRGK"
     exon            574699..574917
                     /number=1
     exon            574983..577046
                     /number=2
     exon            577106..579308
                     /number=3
     exon            579359..579663
                     /number=4
     CDS             complement(join(579919..580409,580473..580944,
                     581039..581308))
                     /codon_start=1
                     /locus_tag="AO090701000212"
                     /note="RRM domain"
                     /old_locus_tag="AO070326000128"
                     /protein_id="BAE61950.1"
                     /transl_table=1
                     /translation="MAHTTVADPPQSVEPTNSLEETNTPDEHVASEENALAVTQPAES
                     AVAEGAPKKKKIIRKKRRPARIQVDPATVKSEPPPQTGTVFNIWYNKWSGGDREDSYL
                     SKQHAPSRCNISKDSGYTRADKVTGSYFCLFFARGVCHLGPECQYLHRLPTIHDLFSP
                     NVDCFGRDKFSDYRDDMGGVGSFMRQNRTLYVGRIHVTDDIEEVVARHFAEWGEIERI
                     RVLTSRGVAFVTYTTLAQAEFAKEAMAHQSLDNNEILNVRWATVDPNPLAQKREARRL
                     EEQAAEAVRRALPADFVAELEGRDPEARKRKKIEGSFGLQGYEPPDEVWYSRTKQLED
                     AGNGDQGQLEAPNQPLMLENASSASAPPQESESSGIFSSSTVAALRGLAGGNVTTQAA
                     PQASGGPLVGYGSDDESD"
     exon            complement(579919..580409)
                     /number=1
     exon            complement(580473..580944)
                     /number=2
     exon            complement(581039..581308)
                     /number=3
     CDS             join(581885..581913,581986..582014,582163..582187,
                     582250..582568,582657..582766,582821..582966,
                     583024..583081,583145..583309,583365..583572)
                     /codon_start=1
                     /locus_tag="AO090701000213"
                     /note="GTP-binding protein DRG2 (ODN superfamily)"
                     /old_locus_tag="AO070326000129"
                     /protein_id="BAE61951.1"
                     /transl_table=1
                     /translation="MVNITEKIKEIEDEMRRTQKYHLGLLKGKLARLRAQLLEPTGGA
                     GGGGAGFDVSKSGDARVALVGFPSVGKSTFLSKITKTKSEAAAYSFTTLTAIPGVLEY
                     GGAEIQILDLPGIIEGAAEGKGRGRQVISAAKTSDLILMVLDATKRAEQRALLEAELD
                     AVGIRLNKEPPNIYLKQKKAGGVKITFQTPPKYLDEKLIFNVLRDYKMLNCEVLIRDE
                     YATIDDFIDVIMKDHRKYIRCLYVYNKIDSISLDFLNQLAREPHTAVMSCELDLGVQE
                     VVERIWKELRLIRIYTKRKGEEPDFSEALIVRSNSTIEDVCDNVHRTLKESFKYALVW
                     GASARHIPQRVGLAHIVADEDVVSIVAK"
     exon            581885..581913
                     /number=1
     exon            581986..582014
                     /number=2
     exon            582163..582187
                     /number=3
     exon            582250..582568
                     /number=4
     exon            582657..582766
                     /number=5
     exon            582821..582966
                     /number=6
     exon            583024..583081
                     /number=7
     exon            583145..583309
                     /number=8
     exon            583365..583572
                     /number=9
     CDS             complement(583869..585221)
                     /codon_start=1
                     /locus_tag="AO090701000214"
                     /note="multifunctional pyrimidine synthesis protein CAD
                     (includes carbamoyl-phophate synthetase, aspartate
                     transcarbamylase, and glutamine amidotransferase)"
                     /old_locus_tag="AO070326000130"
                     /protein_id="BAE61952.1"
                     /transl_table=1
                     /translation="MFAARLFKAMPARASAFPSVNASIQSRFMATVRNGRVAHERATF
                     TIRDGPIFHGKSFGARSNISGEAVFTTSLVGYPESLTDPSYRGQILVFTQPLIGNYGV
                     PSAEKDQHGLLKYFESPHLQAAGVVVADVAEQYSHWTAVQSLGEWCAREGVPAISGVD
                     TRAIVTYLREQGSSLARITVGEEYDADQDEAFVDPEQIHLVRQVSTKAPFHVSAADPQ
                     CHVAVIDCGVKENILRSLVSRGASITVFPYDYPIHKVAHHFDGVFISNGPGDPTHCQE
                     TAYHLRRLMETSQVPIFGICLGHQLLALAIGARTIKLKYGNRAHNIPALDMSTGRCHI
                     TSQNHGYAVDASTLPSDWKPYFVNLNDSSNEGMIHKTRPIFSTQFHPEAKGGPLDSSY
                     LFDIYLDSVRKYKASQSAFHPTRDSLPSPLLVDLLAKERVGVQPTIGMQNVAAAAAAA
                     "
     exon            complement(583869..585221)
                     /number=1
     CDS             join(586549..587104,587170..587343,587462..587490,
                     587619..587639)
                     /codon_start=1
                     /locus_tag="AO090701000215"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000131"
                     /protein_id="BAE61953.1"
                     /transl_table=1
                     /translation="MIIFKPFLQALVATVLLTLSLGRASLRSPSYQQLIPQSPNHWEE
                     PGCDGSGIVDPDGHCNGDGIIDNPQNPRDKEREGFRFDNPSTNCKYVTQMHIWDSFKD
                     LEKDMNKLFTLIHKNVSFTVVGHHPIAGHYNDLLHFYVNALRRVSVLFMDHADKFQIH
                     PQAIHGGCDSAWSVSEINFKGVMNSGDDFDIVNVWVTRWYQDQMVEIRTYIDAPRIMD
                     ALHKNELWWNGTTFRDNVHYMPGPAAHFCLVALQLGAKRPC"
     exon            586549..587104
                     /number=1
     exon            587170..587343
                     /number=2
     exon            587462..587490
                     /number=3
     exon            587619..587639
                     /number=4
     CDS             590257..591981
                     /codon_start=1
                     /locus_tag="AO090701000217"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000133"
                     /protein_id="BAE61954.1"
                     /transl_table=1
                     /translation="MSETVRKRSRIACVSCQSRKRKCTGDQPCSTCCQFGIDCHYDLL
                     SRKKKDARSFRPQQSIPPIASTTSRNEPIPKSHREGTTGDSPDMPVNSLEANSGAAFV
                     RRLGLKIDPANAPRLDLFAWNVGARHPTPSSMPPSSMPRAVSVVDIISLEEMKLLAAT
                     FFEKVDPCYGFIDRDHLFRQLGRRWLPPSSETALPYGPYDAVLCGVAAFGYLFSRRQA
                     PQTELQLAEAARLILDQHMLSETPSSVDIVTGWVLRVAYLRTTAAPDAAWMASCSLMH
                     LIEATGLHLEPSSDTVLGQSAEPCDPEIRRRLFAMARHLNVWISFELGRSRVVLYGAT
                     SLPPTPRSTGEIFNLLPVSESLDPNKAQGSLDLESALENVLDVVHPLASHTLAQCNLM
                     LCIYRRLRGLDSVISGALLDRVLELAKKGLKASRDMIALISPWHQTANVPFQIVCTLL
                     AIDSRASLALLGDAMQTLREVALAYDTDVMREAYSTAYLLILLHQRRKEDDTRTLRGV
                     LRANSAASAPPAEITEPAIESTHSLADYPGFSWLSDLVIDMPGLQNFDLESFMATDNS
                     WPLPEPGM"
     exon            590257..591981
                     /number=1
     CDS             complement(join(592143..593408,593454..593517,
                     593581..593732,593815..593964))
                     /codon_start=1
                     /locus_tag="AO090701000218"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000134"
                     /protein_id="BAE61955.1"
                     /transl_table=1
                     /translation="MRRRITFVQRPETPFSLDQAVLTPDALALHGIDGAREERATFSV
                     DELPEELSDVLKQCHQLHVRWASERRYDAVAPFSSRVSPGLHVFYTPVDGSSEENKLK
                     SLCALLKRAFDYGLKCKSPETLEESFITPPILSTRFASTAAFQYHSLLPTLDNLVAYI
                     ENKICSSSDEQCLRYAASIRSADSVDINYDSISHSLTVLGYWSQSPKNGWTDEIRRHA
                     AGTDQVEVGLLGTEAATEPEDIKMGGLLAVVGKDDQLSMLSSGLPSEFGVAYGYGTDD
                     SWAEPTLFSFPSRHQPLPEDATYSISFTSPTGLHPTMTISMPPSSLNSPPAPPDATCA
                     LHTYLTLPSTIFGDKYQLSTTDPLFLDSHNLVALHAVAGETDLEAPDWFVSRWGSNWL
                     LELATPSESDQVPEEWNVTIPLHLRYLRPSESGYRSASVPWPVVFWACTAEDGTKMGV
                     NPFDRVNLGWEGLFGTRTMFYQLHPSSDRLVEELEVPVLQLDDKGFFQSKAIELGTMI
                     VIGLGSLWVLWKLGAIAWSSGTRPQRKSTKQKKSE"
     exon            complement(592143..593408)
                     /number=1
     exon            complement(593454..593517)
                     /number=2
     exon            complement(593581..593732)
                     /number=3
     exon            complement(593815..593964)
                     /number=4
     CDS             complement(join(595422..595718,595784..596451,
                     596542..596689))
                     /codon_start=1
                     /locus_tag="AO090701000219"
                     /note="molecular chaperone (DnaJ superfamily)"
                     /old_locus_tag="AO070326000135"
                     /protein_id="BAE61956.1"
                     /transl_table=1
                     /translation="MVAETKLYDSLGIKPEASQDEIKKAYRKCALKYHPDKNKDNPTA
                     SEKFKEVSQAYEVLSDPEKRKIYDQFGLDYLMRGGPAPPPPGSGAGGAGGSPFDGGMP
                     GGFSFGGMPGGGGARTFRFSTGPGGGSGFQFSSADDIFRNFAKGGGGGMDHDDLFDIL
                     GGMGGGGGGAGRSFRSSRGPSAFQQSQRAPTPEPTVVEKELPLTLEELMRGTTKQVTV
                     KSKTFDTSGKRTVQDVTLEANIKPGLRTGSKIKYRGVGDQEEGGRQDVHLIVTEKEHP
                     NFKRQGDNLITTVEISLKEALTGWDRIVRTIDGKSIRVAKPGPTQPGYEERFPGQGMT
                     ISKKPSERGDLIVHVNVRFPASLTASQKDILKDVLP"
     exon            complement(595422..595718)
                     /number=1
     exon            complement(595784..596451)
                     /number=2
     exon            complement(596542..596689)
                     /number=3
     CDS             complement(join(597548..599245,599305..599442))
                     /codon_start=1
                     /locus_tag="AO090701000220"
                     /note="carboxypeptidase C (cathepsin A)"
                     /old_locus_tag="AO070326000136"
                     /protein_id="BAE61957.1"
                     /transl_table=1
                     /translation="MPLLKSVINAAGLVGAVAGQYFPPTPEGLKVINSKHQEGVKISY
                     KEPGICETTPGVKSYSGYVHLPPGTLNDVSLDQNYPINTFFWFFESRNDPRNAPLSIW
                     MNGGPGSSSMIGLMQENGPCRVNNDSNTTEINPWSWNNYVNMLYIDQPNQVGFSYDVP
                     TNGTHDLLTGNWDVSGYPDGVPEQNNTFYVGTFPSQNKSTAANTTENAARALWSFAQT
                     WFSEFPEYKPHDDRVSIWTESYGGRYGPSFTAFFQEQNEKIANGSIDIDDAHYIHLDT
                     LGIINGCVDLLVQSPSYPQIAYNNTYGIEAINKTVYDMAMEAWSKPGGCKDQIIECRR
                     LAAEGDPEMYGNNETVNKVCAKANNYCSNQVEGPYSLYSGRGYYDISHFDPDPFPPPY
                     YFGFLNQHWVQGALGVPVNFTESVDSVYNGFSATGDYPRSDVRGYLEDIAYVLDSGIK
                     VALVYGDRDYACPWNGGEEVSLKVEYSDAAKFRSAGYAPLKTNASYVGGLVRQYGNFS
                     FTRVFEAGHEVPAYQPETAYEIFHRALFNRDIATGKVSIAKNNTYSTHGPSSTWNVTN
                     TVPDSPAPTCYILELGSTCTKEQTASVVNGTAVIKNYIVVDADSS"
     exon            complement(597548..599245)
                     /number=1
     exon            complement(599305..599442)
                     /number=2
     CDS             complement(600485..601804)
                     /codon_start=1
                     /locus_tag="AO090701000221"
                     /note="geranylgeranyl pyrophosphate synthase/Polyprenyl
                     synthetase"
                     /old_locus_tag="AO070326000137"
                     /protein_id="BAE61958.1"
                     /transl_table=1
                     /translation="MSEDDARAKTKELILENEKEFVKRREALYQAHPDLAPKLRKWME
                     VLEAALGGIHYWCTNAPRYAVPETAEEESEEESDEESSSDEDESEDDEEEENDEEEVR
                     ANGTIDHVGGGDEPEGEPVWTPLVNGEEHPAVHLDATPLLAPTNYIGSISTNEVQLEL
                     VSALNAWLQVPNRPLTFVKQVVNDLHDSSEILANIQDQSSLQRQKTAAHLVFGPAQSI
                     NSAAYMFVRVAKTVNGLNCPGMLDGLLEELETHFIGQSWELNWRFSLQCPTEQEYLEM
                     VDKKSGSIFRMLVRLMQSASMEGSTLDFELLTQLFGRWYQIRNEYLGLLTGNNQRGFG
                     EDLDHGKISYAVVRCCNVDPTAKSIILGIFRQKAEGASLSAESKIQILELLHKSGALQ
                     ATYDLVRQLGRDIMKTVSELEIAAEETNPGLKALVKTLGDIPAPTQE"
     exon            complement(600485..601804)
                     /number=1
     CDS             complement(join(602061..602308,602360..602768))
                     /codon_start=1
                     /locus_tag="AO090701000222"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000138"
                     /protein_id="BAE61959.1"
                     /transl_table=1
                     /translation="MFRQYSNFISHKRRRSKSTSRVLSVAQSEAASDAPTVNEPIEIW
                     THSQPIDAATQQQNGCFTTLTARIHKYDHVAQRGSDRFLEDLTATLDSEEAKSKSSYL
                     TSPVGNYASFLYPECMPERLELVAYLTELGNVHDDHTDSKNTPAADKPEELVESPRAE
                     ARKKLLEKVTGELTDKDGLEIIDCYRSNWLVTPDVPTADNCANLDDYVARRRLNAGIE
                     "
     exon            complement(602061..602308)
                     /number=1
     exon            complement(602360..602768)
                     /number=2
     CDS             complement(join(605580..605625,605807..605879,
                     606340..606560,606679..606728))
                     /codon_start=1
                     /locus_tag="AO090701000223"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000139"
                     /protein_id="BAE61960.1"
                     /transl_table=1
                     /translation="MVTKDLGCRHMIQTYEGLLIRTDTRIQLIEQIINYTFTNPATIH
                     EALRTPGSMAILTPHRLDGHKDLAQLGDAALRLVLAKDGYQAHATRARGPLARSSSSD
                     IPFMLADDYSMDLLMLGYCRVVFCGWL"
     exon            complement(605580..605625)
                     /number=1
     exon            complement(605807..605879)
                     /number=2
     exon            complement(606340..606560)
                     /number=3
     exon            complement(606679..606728)
                     /number=4
     CDS             complement(607352..609364)
                     /codon_start=1
                     /locus_tag="AO090701000224"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070326000140"
                     /protein_id="BAE61961.1"
                     /transl_table=1
                     /translation="MAPSFWEKTKGTSKKGFDKAWHTLDKLGDPVNRLSNRVGAEAFW
                     PMTLDRESDKAARILRSFCKDGFYADEESQKQSTDGAKSGKIDRPKGKQRVLKKIPTE
                     VIKRAKGLAIFTTMRTGLWLSGSGGSGVLLARIPETGEWSPPSGIMLHTAGIGFLAGV
                     DIYDCVVVINTYEALEAFKKVRCTLGGEVSASAGPVGMGGVLDSEVHKRQAPIWTYMK
                     SRGLYAGVQVDGTIIIERTDENERFYGERISVTDILAGKAKRPPTSIKTLIQTVKAAQ
                     GDKDVDESLVPAAGAPTPGDVEVVPASGSSSPPSKFGIPAADDPDPFGVKALEAEGLF
                     IREAGTKTRPHVDSFEFRPSPNSPIYSTFRHSVDSSPRNSWRTSVQSYASIDRGTQTD
                     EPPLTARTSISRASSRSNRDFTERAEKSPWDLEERGWDTIIPEHPTDHSHHATHDGDD
                     DLVDDDVEIHEVSNATVTKCDGFPSSPIEDLTSTSPKRQSPTFTRARLVTIPKRAPPA
                     LPPRNPYRGYGSMSTPVSPTAGPPSPSKRSVVSSLGLTELNSFAELPLDVKNDASSVS
                     SAEASHLQHNGNIDKDEFHSISTVGTSDSASDGGFSAKDTSVTGTSPSKTEDTYHTFD
                     DITDNTLSKLQHRHPSDVAKPTATELEHSTTITEHDYKPAMHSSLA"
     exon            complement(607352..609364)
                     /number=1
     CDS             complement(join(613749..613831,613903..614551,
                     614715..614768))
                     /codon_start=1
                     /locus_tag="AO090701000225"
                     /note="electron transfer flavoprotein, beta subunit"
                     /old_locus_tag="AO070326000141"
                     /protein_id="BAE61962.1"
                     /transl_table=1
                     /translation="MASGLRILVPVKRVIDYAIKPRINKAQTGVETSGVKHSLNPFDE
                     LSIEEAVRLRERKGPLKVENILALSAGGAKCADTLRTAMAMGADRAFHVDVPDSNDGG
                     LEPLTVAKMLKEVVNKENINLVLLGKQAIDGDQGQTGQMLAGLLGWPQATQASKVDIK
                     DEQGTVEVTHEVDGGVETLRAKLPLIITTDLRLNEPRYATLPNIMKAKKKPLEKKTLA
                     DFGIEDKKRLKTLKVTEPPARQGGGKVEDVDGLIGKLKELGAL"
     exon            complement(613749..613831)
                     /number=1
     exon            complement(613903..614551)
                     /number=2
     exon            complement(614715..614768)
                     /number=3
     CDS             complement(join(615221..616718,616775..616873,
                     616937..617112,617182..617340))
                     /codon_start=1
                     /locus_tag="AO090701000226"
                     /note="NADP-dependent flavoprotein reductase"
                     /old_locus_tag="AO070326000142"
                     /protein_id="BAE61963.1"
                     /transl_table=1
                     /translation="MSEDQGSGPRKRSALILYGSETGNAQEVAEELGSLAERLHFMTQ
                     VSEMNHVKPEKLSSYTIVVFAISTTGQGDLPANARTFWRSLLLKRLPATFLEGVSFTS
                     FGLGDSSYPKFNWAARKLCKRLVQLGANETYLSGEADQQHPEGLEGTFIPWITDFRKH
                     LLDTYPLPEGQHPIPDDVQLPPKWVLQLQDQTSKSNTDPAVPRTENQSTEDSKSRLEH
                     DLRPIPDTLTATLIQNKRVTPAKHWQDVRHVSLTVPDSVTYVPGDMISVMPKNFTEDV
                     QALIQMMGWEEQADQLVSLVPANSQHSAEDLPLPPIPNLESYPKLTLRAIIMDYLDIR
                     AIPRRRFFSEISHYTNDEMQKERLLEFTNPEFLDELWDYTSRPRRSILEVLHEFDTVK
                     IPWQHATSVFPVLRGRQFSIASGGELKRTPEGGAKFELLIAIVKYKTIIKRIREGVCT
                     KYISALQPGSTLKVHLQRGGLNSSLGQLSGPTVLVGPGTGVAPLRSMIWEKAAFVKAY
                     KEENGGAEPTIGPTILLFGGRNRNADFFFDEEWQQLSKLVKLEVFAAFSRDQKQKVYV
                     QDVIRDNFGLFFRLLHEMGGSVYVCGSSGRMPQAVREALIEAFQNGGETDAERFSREE
                     AEEYLLGMEKSGRYKQETW"
     exon            complement(615221..616718)
                     /number=1
     exon            complement(616775..616873)
                     /number=2
     exon            complement(616937..617112)
                     /number=3
     exon            complement(617182..617340)
                     /number=4
     CDS             complement(join(618150..618276,618337..618384,
                     618435..618508,618576..618650))
                     /codon_start=1
                     /locus_tag="AO090701000227"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000143"
                     /protein_id="BAE61964.1"
                     /transl_table=1
                     /translation="MQITKSLIATTVALYTSVVLGESVHIAYTSNGDFYQEKIEAEKL
                     TKLEHPGVLTDIQNTANCVLWRHHPNHPPDYQAKRGSNLVIPPQQLDYIYCYEPSGAW
                     VNYVW"
     exon            complement(618150..618276)
                     /number=1
     exon            complement(618337..618384)
                     /number=2
     exon            complement(618435..618508)
                     /number=3
     exon            complement(618576..618650)
                     /number=4
     CDS             complement(join(620139..620521,620606..620675))
                     /codon_start=1
                     /locus_tag="AO090701000228"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000144"
                     /protein_id="BAE61965.1"
                     /transl_table=1
                     /translation="MPSYSGKYQKKKRAIPKLSGRPYIMKFFPRDDLWEVIQPNFKAG
                     AAVDGFVAQMVRPPLKRGFEDDDEEDEDIGKRRKTGDEDDEGGENDDLLEPDDEQAEE
                     EIMDDDFEDDDDEMGGDYNAEQYFDGGDDEYGDDGFGDGGGGGDEDTY"
     exon            complement(620139..620521)
                     /number=1
     exon            complement(620606..620675)
                     /number=2
     CDS             complement(621441..623396)
                     /codon_start=1
                     /locus_tag="AO090701000229"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000145"
                     /protein_id="BAE61966.1"
                     /transl_table=1
                     /translation="MAIPSTYNEVKLHLQQVQRDPSVRLDIPIIDKLKLQLTESTDSS
                     VPATLLPLVSQLLPVLQEDPTPITTLAIKATAYTSFADLRSVDPPIDFIAGFKAPSPP
                     INSLALALLSKAGQTPSDAAIVGGDSELVASLVELWLSTSSTAVAQAAFDAIWALLEV
                     DLTSPLENGEGSNEGQEATGGQGLVWRRVFTDRDVYGRLFSLCSLTENGPGSLTKRDK
                     TVAQGRLMGFLAKAGNLRWDIISSSQISDIETRYNSSSLLHFAACEMVDKTDVLMHMT
                     LLNFFHDLLEIQAPGLIARSFVQAASTFSSPALDFLISQNIHSSLLSYYLDESKLDPV
                     DLNYLCGPIMAYVAQYAELYPNHFLQNPKHLLDRILSRISASVTISSAQWAHGPVPSG
                     QLNVLSCIPRVLLVEATKQGLNPVLALPTSPPNKEALDVLSRILHGPSKLYLPDTMEL
                     NTSGQTATDWHKEAAAARILYFMYLNQHSTFWTDVVAAADILAMKDVSLAAISFMRSI
                     ITANWEKLSVEVTSSVPGTSRYQLPSEQGLGSLSPASQGVLPSSGAWAALTPPALTVL
                     LPYLFKAPRSYAEFVAGGAGDSQNAVWKVATAKYEVLVALHNHLKETGGDMAGFEDIM
                     RTLQQRVSEGPWGPVTHGGSQVETVGL"
     exon            complement(621441..623396)
                     /number=1
     CDS             join(623640..623910,623966..624457,624517..624950)
                     /codon_start=1
                     /locus_tag="AO090701000230"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000146"
                     /protein_id="BAE61967.1"
                     /transl_table=1
                     /translation="MTERLSSLVSQKSSDSGLHIQLHPLILLTISDHITRHAARSQQG
                     PILGALLGQQNGREITLEHAFECIVKEGPNGEPQLPNEWFNERVKQCVTVKDVHKVPA
                     LDIVGWWSTAPPSGPDVTHLPIHRQILQDYNESAVFLAFHPSQVKGASANGGKLPLTV
                     YESVYEGENAAESEKTMQVDGEEQSLSIRFRELPYFVETGEAEMIGIDTVARTARNAA
                     VEGPSALSSAKEVLKKKTDNKEQSADTAVLSPEDEELIASLNTRLNAIRTLESRISLI
                     KSYVASISPESEGGNQKNTTPSTATLSHPILRNINSLLSHLSLLSPQEQSAFSAEVLA
                     QSNDVHLVALLGQLSSSINSMRELGKRTAILTNVRRSNTSRKTQMSLQNRFEEELFSR
                     DGTTHG"
     exon            623640..623910
                     /number=1
     exon            623966..624457
                     /number=2
     exon            624517..624950
                     /number=3
     CDS             complement(join(625431..625465,625495..625975))
                     /codon_start=1
                     /locus_tag="AO090701000231"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000147"
                     /protein_id="BAE61968.1"
                     /transl_table=1
                     /translation="MLDPSYRTHNEAIDLDGAGGTNATAYQGAGAMMNSGRTGRYTPD
                     EEGQVLLSNAQPDPTARPEGDVGLNPPPYDDVDHGHYYPSHNRLSNPALLDPETHSPR
                     PYSPYDNPFSNPYIVPSDSESDHHHTSTTAHHNAPYPPDALQEQPPMPMPESYHPPSH
                     ANNKLLSAVQH"
     exon            complement(625431..625465)
                     /number=1
     exon            complement(625495..625975)
                     /number=2
     CDS             complement(628249..630129)
                     /codon_start=1
                     /locus_tag="AO090701000232"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000148"
                     /protein_id="BAE61969.1"
                     /transl_table=1
                     /translation="MTDYSTWKVTELKAELKRRGIAQTGLRVKQQIIDRLVEEDAKGD
                     ESPVANEGPATTQDAIEELQPAEGKQPTPPPVDAAAESHDPNPAEQAQEQHHDQEVPG
                     TDAGETQAEKMTTDVTQDDDAPTEKNQQQPSKSEPAEPAEAQPETGTPTQPIEQAPGD
                     TEEKEPTPAREASTGQTDSAEKVAPAAAPPSELATGLSTPLPPEELIEDSRKRKRRSQ
                     SPVPTPDALANKKAKLPAEAPRVLLPEDRGAMDIDGDTKADEVVSVSQETPEEHVHAD
                     LPDEQASVPRDDPRSPSSPDNSRSKKSTAPKHDVRFKRLFAAGETEQTRPASPPADTV
                     TEDAEVEPALHVATAALYVGGLMRPLQPAALKSHLISVASPPGASPDPDVVVNFYLDS
                     IKTHCFVNFTNVTAASRARAALHNTVWPNERNRKTLFVDFIPEHKLQLWIDTEENSRG
                     RSGPPARWEVKYDRTDDGVEAVLEEIGPKNAGSRQAHGPAPGDFSRPPPLGPRADMEK
                     KDRRPSGPSKVEPSSRPGQGFKPLDELFMSTTTKPKLYYLPVPRDVADRRLDRFDDLL
                     RKGSYPRPGGDETRRISFEDGDLFVDNGPEFAGRNRRRGGRGRGRGGFGDSWRGDRRG
                     RH"
     exon            complement(628249..630129)
                     /number=1
     CDS             630963..631802
                     /codon_start=1
                     /locus_tag="AO090701000233"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000149"
                     /protein_id="BAE61970.1"
                     /transl_table=1
                     /translation="MAIKAAQNNQAIYFRNLHTPGHPILLTNVYDPATASLIANHPST
                     KAIATASYAIAASQGIPDDALTLPQNLAAVRSIAATLKPNNPSGNKVSDEVATKLPLT
                     VDIQDGYADVAETIREIINLGAVGCNLEDLDGTTGQLRPLAEAVARIELAVRTAAELG
                     VPDFVVNARTDVLGANPGGKPGSIQDAIERGRAFLRAGACTVFVWGGAGGRGVSREEI
                     KELVGAFQGKLNVKLVLRDGFLTVPEVKELGVARISLGPELYRAAMSGFMEKADAVLA
                     SYS"
     exon            630963..631802
                     /number=1
     CDS             join(632160..632427,632530..632585)
                     /codon_start=1
                     /locus_tag="AO090701000234"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000150"
                     /protein_id="BAE61971.1"
                     /transl_table=1
                     /translation="MGTHQPLPSFLPVDNPTQPFWRTEPHPLDELRSTEALPGQSDIV
                     IIGAGYSGVSIAYHLLKHLDGHNKPHPAITILEARQICSGATGRNGDMEWMLQPRWPT
                     LNSVM"
     exon            632160..632427
                     /number=1
     exon            632530..632585
                     /number=2
     CDS             join(634188..634224,634286..634676,634737..635793)
                     /codon_start=1
                     /locus_tag="AO090701000235"
                     /note="homoserine acetyltransferase"
                     /old_locus_tag="AO070326000151"
                     /protein_id="BAE61972.1"
                     /transl_table=1
                     /translation="MATESNSAPAQPQRLDSQPENPFSNLITDQLFVSIPSFTLESGV
                     TLYNVPVAYTTRGQLSETGDNALVICHALSGSADVADWWGPLLGGPGQAFDTSRFFVI
                     CLNSLGSPYGSASAVTYKDGNPEKGLYGPEFPLTTVRDDVRIHKIVLDYLGVRQIAAV
                     VGGSMGGMLTLEYAYFGKDYVRAIVPIATSPRHSAWCISWGEAQRQSIYSDPKYEDGY
                     YSFDDPPATGLGAARMSALLTYRSRNSFESRFGRNVPDPTKQQNIKGTEKLPTPPNEH
                     WAIHNDGHKGGRSTPSGRNSPTSPTPQQTEVQYMDPQFSGTKTFSKTIDSALKSGQKR
                     PPTYFSAQSYLRYQGEKFVKRFDANCYIAITRKLDTHDVSRQRASPTSSDPVREALAQ
                     IQQPALVLGIESDGLFTFEEQKEIAAGIPDSRLKRIESPEGHDAFLLQFEQVNRYILE
                     FFREVLPDIMSKAPADGAVEVDGVNKLTKSSTFGEAEVEDITAW"
     exon            634188..634224
                     /number=1
     exon            634286..634676
                     /number=2
     exon            634737..635793
                     /number=3
     tRNA            complement(636452..636522)
                     /locus_tag="AO090701t00002"
                     /note="tRNAscan-SE"
                     /product="tRNA-Gly"
     CDS             join(639050..639124,639485..640465)
                     /codon_start=1
                     /locus_tag="AO090701000236"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000152"
                     /protein_id="BAE61973.1"
                     /transl_table=1
                     /translation="MESIRRRKGTTMNRRGSISQLLHIQVGAEVAALKDKFDSGVGLT
                     QQPSRQTMRLLKSSHSDARPDSSERAPGSLLGQVRGTTSGSDASNAEDPNSQSLVKES
                     RQGSKQSMMGNPIGDAQTKDQDTMSFLAGTCNSGPSSDEALDDMEVFLNPDVGLDSNG
                     IPSFTSPSTFLSSTSPSFGVSSGLPQSRQPELIAQSRFLGDSPGTKAGLDPSQSGNGE
                     SEPGVIIDGNGFAHILTVAEEAQRNLNLQQAVMAKMKANAVESNSNALPQTPKQVLLR
                     QEPQSEHQPIPSRLQNSWSHKSKATTLNWKSRTETPASSNNKPTFFQKIAGLFKTRRA
                     PGQGNHVLVEQPFGLAH"
     exon            639050..639124
                     /number=1
     exon            639485..640465
                     /number=2
     CDS             642429..642863
                     /codon_start=1
                     /locus_tag="AO090701000238"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000154"
                     /protein_id="BAE61974.1"
                     /transl_table=1
                     /translation="MQPSANMIHPEGPVVISIPESAKIHIVGKTNADFRQRVTVEEIG
                     KDKYIFEGSGEGKPMTLAGGNESVDLEPIKGTGFRTWKIDFQNSSSGAEDSFRMSKVL
                     RPVYNTVYDENYKVRKMEWEIASEDNIDDDYNDAIITVSADI"
     exon            642429..642863
                     /number=1
     CDS             643429..644544
                     /codon_start=1
                     /locus_tag="AO090701000239"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000155"
                     /protein_id="BAE61975.1"
                     /transl_table=1
                     /translation="MRRKVRRSVTHLTVFGCILFLILYLNCSPSLSPLKKNPQTYPWT
                     RVTYQTNSEVLPPARGICPGLKESSKPALVISRVEADGDPSWLDVLDKKYHLCVYTVD
                     APENPKSQYLQVPLNRGHEAMTYLTFIIDNYDQIPTRGAVFAHGSRFAWHNDHQTYDN
                     ADLLAALNIPAALEPWGYHNLRCDWSLSTCPSNVPPQGGLENAFTAAFQPWSARAVSD
                     VALPKALDALFGTGAGSQAKLGRTHTVRSQCCAQFVVARDNIRRHSREEYVALRQWLL
                     DAGTHRNAASLDDRTSGRVLSYIWHILFINQNPVAGVSEGVDLEALNHQACPSAKDCY
                     CRLYGRCDLDRCVSGSCFGQYRLPKNLRLPDDWADTH"
     exon            643429..644544
                     /number=1
     CDS             complement(join(644956..644963,644977..645289))
                     /codon_start=1
                     /locus_tag="AO090701000240"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000156"
                     /protein_id="BAE61976.1"
                     /transl_table=1
                     /translation="MVIFLAMAGSIYQNLALQKVTQAMPTLSAADITNLVAGTSSHTY
                     KALSGEERDLVTPQITDAMRDVWLFFLVAGVVSFVLTLGLGVSYLLLSVFGIRKGIYG
                     LTED"
     exon            complement(644956..644963)
                     /number=1
     exon            complement(644977..645289)
                     /number=2
     CDS             complement(join(645831..645893,645947..646327,
                     646391..646432,646497..646862,646943..647005,
                     647055..647174))
                     /codon_start=1
                     /locus_tag="AO090701000241"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070326000157"
                     /protein_id="BAE61977.1"
                     /transl_table=1
                     /translation="MSFIDTDPEKQGSNDNVASTGSSENVIPKEASLRPIHGWKWAIA
                     YASMISTTFLFALDNTIVADIQPVILDLFGEVSLLPWIGVGFALGTMCVLPWGKVYGV
                     FNVKYVYLFNITLFEIGSAVCGAAPNMTALVVGRVIAGVGGSGMYSGTLSFVAMLTSL
                     KERPIYMAGSTVIWGIGSVLGPVVGGAFADSSATWRWAFYINLPIGAVFAPSYLLLVP
                     SVDPQPSKSWAEKCRMIDWIMTTMFLAGSASLVMAITFGGTLYAWSSGNEIALWVVAG
                     VLLVVCIVLAKYHPGVYKDNRLYPAHFFKRPILVNLQLQMFLVSGIVLAMTYYIPLFF
                     QFIRVRDLSS"
     exon            complement(645831..645893)
                     /number=1
     exon            complement(645947..646327)
                     /number=2
     exon            complement(646391..646432)
                     /number=3
     exon            complement(646497..646862)
                     /number=4
     exon            complement(646943..647005)
                     /number=5
     exon            complement(647055..647174)
                     /number=6
     CDS             join(649352..649375,649465..650205,650271..650519)
                     /codon_start=1
                     /locus_tag="AO090701000242"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000158"
                     /protein_id="BAE61978.1"
                     /transl_table=1
                     /translation="MRANTSNSHFVRAWMTLGRAVTLAQILNLHRIDSGDTARQQRTG
                     SQQDATETGLACDTLDPASLEETRRSFWSLYIFESYGSVRIGRPCTLEEDNLCIFLPS
                     PGELSETFLPSPMPFISDSTKLTGVGYLTSYAAVTIMVKLARLCFEHVSILSRSASDS
                     GFWDRHYRLVKTINDYTAIFQRYLTAKAVREDPLAFSLHLNLCATHINLHEAAIRKVE
                     EQDLPKLVAAESRKCSTAAAFKILGAIRMNWPVQRSERDHFTLQATFIGWPISMSLIA
                     LSRSLANGDTTPIGIVDSLRLLCAALDHVEEADGYWHQASRAAVAALAKWDEQQHESR
                     PGE"
     exon            649352..649375
                     /number=1
     exon            649465..650205
                     /number=2
     exon            650271..650519
                     /number=3
     CDS             complement(join(651039..651961,652052..652094,
                     652190..652227,652292..652341,652396..652712,
                     652767..653645))
                     /codon_start=1
                     /locus_tag="AO090701000243"
                     /note="UDP-N-acetylglucosamine enolpyruvyl transferase"
                     /old_locus_tag="AO070326000159"
                     /protein_id="BAE61979.1"
                     /transl_table=1
                     /translation="MPSAIAIDGGRDVTGNVRVSGSKNAGLPLMAATLLAPGPSTLHG
                     LPPVSDIKNMGSILQYLGADVSQVSDNFTIDTTDVTSRFVPAQLTDSLRASILFLGPL
                     LARFGHACLSFPGGCSIGNRPVEEHINGLRKLGACITVTDTYIEAHASQLQGATIDMQ
                     TPSVTGTMNLIMAACLARGVTHIHNAAREPEVGDLINFLVLMGVDIHGAGTDQLVIHG
                     CHSTPLSPCQYGVMEDRIEVGTFLILGAICGNPLTVYPCHPEQHVMLIKNLKAVGARV
                     DISDDSVTVWKAKQPLAFMVLLCLAQGTSHVTESVFERRFGQCFGLRAMGAGIRVCER
                     TAIISGVEKLSGALVSGSDLRATASLILAAVVGRGRSVVGGIKYLDRGYYHLERKLAK
                     IGVAVERDSATSLAFLFIGDSVIESIGPIIKAKKESDPGLRRLCALPRGNVYTYNAIV
                     AQCPPVPGLRPHDMHSISNDRFSFLLLCQPTFISYIAYCKLPKDKQCVWPNRARFTDD
                     DMEALARKLADYPICESVVFGELWRTRTKAQLISLEEGILDHWFFGRTVMAGDAIHKG
                     TTNSALGGCTAIEDGVAITNQLHQLLNRHPNKKPSTVEISATMQEYQDSRLDRVKTIV
                     KVGGDLTRLQAFDGWYFYIMQRWLTPWIGLDTLAINIAKLASAGTNLSFVDFPEQKGL
                     LGWPDTIAVEARKNEQRKLPKRWWYWTGDLQQIWPLLVGFFLCFSSTLLWFLPRDPHH
                     VWSGIEAAH"
     exon            complement(651039..651961)
                     /number=1
     exon            complement(652052..652094)
                     /number=2
     exon            complement(652190..652227)
                     /number=3
     exon            complement(652292..652341)
                     /number=4
     exon            complement(652396..652712)
                     /number=5
     exon            complement(652767..653645)
                     /number=6
     CDS             complement(join(655993..658442,658494..658563))
                     /codon_start=1
                     /locus_tag="AO090701000244"
                     /note="beta-glucosidase-related glycosidases"
                     /old_locus_tag="AO070326000160"
                     /protein_id="BAE61980.1"
                     /transl_table=1
                     /translation="MPRLDVEKTIEELSLGEKVALTAGIDFWHTASVPRLNIPTLRMS
                     DGPNGVRGTRFFNGVPAACFPCATALGATWDTELLHEIGQLMGEESIAKGSHIILGPT
                     INTQRSPLGGRGFESFAEDGVLSGLLAGYISKGIQEKGVAATLKHFVCNDQEHQRMAV
                     DSIVTQRALREIYLLPFQLAMRICRTACVMTAYNKVNGTHVSQNKEIITDILRKEWGW
                     DGLVMSDWFGTYSTSDAINAGLDLEMPGKTRWRGTALAHAVSSNEVAEFVMDERVRNV
                     LNLVNFVDGLNIPENAPEKALNRPQDQALLRRAAAESVVLMKNEEDILPLKKEKSILV
                     IGPNSKVAAYCGGGSASLDAYYTVTPFEGVSAQSKGEVKFSQGVYSHKDLPLLGPLLK
                     TADGKTGFSFKVYNEHPSESNRELIEQLHLVSSSGFLMDYVNPKIKSLTYYVDMEGLF
                     TPEEDGVYDFGVTVVGTGQLFIDGELVVDNTKNQRQGSAFFGSATVEEKGSKELKAGQ
                     TYKVLFQFGTAPTSDLDTRGVVVFGPGGFRFGASRRVGQEELISNAVKLASEAEQVVV
                     FAGLTSEWETEGYDRDHMDLPPGSDEMISRVLDVNPNAVVVIQSGTPVTMPWANKTKA
                     LLHAWFGGNECGNGIADVLYGDVNPSGKLPITFPVRLQDNPSYVNFRSERGRVLYGED
                     VYVGYRYYEKVDLAPLFPFGHGLSYTTFTRSDLTLTTTPEKPQYEESGEPITATVTVT
                     NTGKVAGAEIVQLWVAPPATEVNRPVRELKGFTKVFLQPGEQKKVEIVVEKKLATSWF
                     DEMREKWASEKGEYEVLVTGTGEGVLKSSFKVEKTRYWLGL"
     exon            complement(655993..658442)
                     /number=1
     exon            complement(658494..658563)
                     /number=2
     CDS             complement(join(659933..660192,660245..660392))
                     /codon_start=1
                     /locus_tag="AO090701000245"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000161"
                     /protein_id="BAE61981.1"
                     /transl_table=1
                     /translation="MTGKVPDVVLMTTSGSMRIVGEMKTRWVVALDLEAATLPHEEPH
                     LRHILGADRGYMKMSDRKYGFISTYEGTIFLKQDFKMGSWTLFHGHAIRHSTKEQEVL
                     DFGDKFSLRECFWFLIGCDLEDDIAGNSLLLRE"
     exon            complement(659933..660192)
                     /number=1
     exon            complement(660245..660392)
                     /number=2
     CDS             complement(join(661294..661947,662006..662101,
                     662237..662326))
                     /codon_start=1
                     /locus_tag="AO090701000246"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000162"
                     /protein_id="BAE61982.1"
                     /transl_table=1
                     /translation="MSAPCSGMFQVRWRWYNKDVDRILSHVYIMVFAPLLSLSLATSV
                     AGHGYMYIPSSRTRLGHEAGIDSCPECAILEPVSSWPDLDAAPVGRSGPCGYNARDSI
                     DYNQPTTNWGSDAVQSYSPGEEIEVQWCVDHNGDHGGMFTYRICQDQSIVDKFLDPSY
                     LPTNDEKQAAEDCFDAGLLPCTDVSGQECGYSADCTEGEACWRNDWFTCNGFEASDRP
                     KCQGVDNAELNSCYTSIAGGYTVTKKVKLPEYTSNHTLISFKWNSFQTGQIYLSCADI
                     AIQ"
     exon            complement(661294..661947)
                     /number=1
     exon            complement(662006..662101)
                     /number=2
     exon            complement(662237..662326)
                     /number=3
     CDS             665130..666041
                     /codon_start=1
                     /locus_tag="AO090701000247"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000163"
                     /protein_id="BAE61983.1"
                     /transl_table=1
                     /translation="MLGSSLSTTKLPFFRDLNQLPCPLPTTEDIEAGTILPTKSERIS
                     GDHGHVAVVGDHFVVKYGQFILENEGHALLLLEKYPSIPVPRLYAMYRKDDILYLVMQ
                     LLPGADLSKLWGELSCNEKASICDQLKEAFAQIRTIPSPGYFGSVTGGPVQHRFFGWV
                     DSDPRIMGPFETLEDFHLDMALVSQRQEKRKDRHPWGAEWFARHLPQALKDHLTTFTH
                     CDLVKQNIMVQELPQTDRHTDRKFKVTGIIDWELPGWYPRYWEYAAFFADFLWEGERG
                     KMFETFIDPWPLEAALLGLFKHDLEGY"
     exon            665130..666041
                     /number=1
     CDS             complement(join(666371..666580,666630..668891))
                     /codon_start=1
                     /locus_tag="AO090701000248"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000164"
                     /protein_id="BAE61984.1"
                     /transl_table=1
                     /translation="MSFSPPDSYLQISQILRDPNNDCNTIPINELQFALPLCLTPPDS
                     ELDQSVSSVVNVGEKQQLPEWIQTEPGWLDSVEASYQNQEACAGNVTHSYSHYQIDDR
                     ASSASAVNIQQELYPVPTPQKQSTGRRIRRQNHSCDPCCLAKRGCDLPRGVAICGDKP
                     TVACTMCSLRSMECTVAWLASRKPSRQIQRRAETSPRSPVGYKAPTSQWNPVEDVSQM
                     EGLTLIPRAEWDQAKQLEARERCLQHLYLYIDVFDMQITACLSEGCMPPCYSLGIEAL
                     VPLSNSADVSPYVERVRSSINNSWYMDLTAWNSTSATPNLYLAVSLLDALFQYPGGQK
                     SPSSSNTRDKAIDETYKWVAIATATQFTVDENNRTGTAKSHSRARDIAFATWQKAREM
                     LFRNIGATGSFRLALSLLLFGGILPPTGLEQREICAEDTTYAHREGARRLRALCSNAR
                     IYLQENRGHGGHPLSSLNTVGAATGRRKSHTVQAFSSEARQYIQEVVGAIEWFFWMSH
                     SVTIAISRERTDPTNLDLQYGSIKELALRGPAQPGNLDELKTRRHEREIEDSILARAR
                     PEKHNVTTLWSQNVSCDVVDRAVTNAGSLAVLLWRSVALLTLASQDMLMGMGDEESFQ
                     RQYTATTELIDSWREAFGPITSTTIIGLQASRADIQRRALFCATDGDLAILLFDELIR
                     ELEVGLKESLPAGDSFYTTLRSTSTYRQEERLESAMNISYLASLSIKVPSPGFQGDHG
                     LKANVQDIAAHPVRQPALVVKAYTLAAKTLADEIQRVMAKMETGSVYTLTNGLNNCLQ
                     GLLALEKTLVMFPNRDDDSAKAPLE"
     exon            complement(666371..666580)
                     /number=1
     exon            complement(666630..668891)
                     /number=2
     CDS             join(669781..670376,670535..670700)
                     /codon_start=1
                     /locus_tag="AO090701000249"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000165"
                     /protein_id="BAE61985.1"
                     /transl_table=1
                     /translation="MSDRPSSKRHAFFEPNLEISPQDIEYFASLPFASPYLNSPFYEP
                     VPFITRYDTKATSNKFFSKVINTAETIPHLLALVRVPDSKSNQTTDQRDNAHPDFVVF
                     VSLGPDLCGFQDTVHGGVLAALLDEALGLCAESTELVSKGHTRLYTAGLEISYRSPVP
                     VPSVVMIKTWVTKRQGRKWFLEAQVLDQEGAVKVEAKTFLCPLCVFSGSISLLFFYID
                     RLATNVQSDPKQLRCTYFNNGHWELQRNQIGRPDS"
     exon            669781..670376
                     /number=1
     exon            670535..670700
                     /number=2
     CDS             complement(670799..672160)
                     /codon_start=1
                     /locus_tag="AO090701000250"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000166"
                     /protein_id="BAE61986.1"
                     /transl_table=1
                     /translation="MHTNSTGSKPVVFIGAADAICGEAIRLFVQASDVPVILADSDED
                     ALRAVVAKLPGKNITIRKVDLFNPDELRSTITEAALVIQGAQPYHRTSAPVLTACIDA
                     KVPYLDYSDDVNSTQASLDLHEQAEREGVPCYINCGSSPGMTNLIAIDIAKELDTVES
                     LDICWLVSEEGGQLGREVLEHLMHITGGPCLTWADGKAAVHENWVETAFAPIITGSSD
                     LFYESVHPEPVTLPRRLKDITRIRTMGALSPAPFNGFARGLGAAVHSGTLSMDAAVDF
                     LEGMQRKPSSSWSETIGAMAVQFRGGDITLNQLYQLATHGIASLKPWNLALWGMIDQV
                     RKGQCTSGEALGFLINSARGKQSPHRSGILVRGVGTRNGYPAITIRRTPVVREDSFMG
                     ESMATSIGASCAAFALMVLDLGAQKRPGVQCPEDWAKLETFIKSMERLGCPRDQVLES
                     VEG"
     exon            complement(670799..672160)
                     /number=1
     CDS             join(672737..673327,673383..674136,674323..674354)
                     /codon_start=1
                     /locus_tag="AO090701000251"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000167"
                     /protein_id="BAE61987.1"
                     /transl_table=1
                     /translation="MAENQIPHELLAKLAGQIIQDPGIPVAAPTVSAWQEPAHPIATI
                     QSDKLPQRTDFAIIGSGITGTSVAKTLLENELARDKTITMFEARSLTTGATSRNGGFL
                     LSHAPPFFKSYAEALGIDAARDIALFCDRTLESIVDMAKAENLDKASQIRDVTTIASF
                     EHQEGFAEVTESIRMYEEAIPEAKGKYTIIDKDTAEKEYHLRKSSGALVVQSRVFWPY
                     RLVTNLLQRLLQLYPEQFAIETQTPVISITIDEADTEYPYILTTPRGTVRAAKVFHCT
                     SGFTGHLLPKLRGAIFPCRLSMTTQKPGPQWGNRPNSWLFHTKQSYDPNTTLVEQGLY
                     WMQQNAETGDLFVGGDLQRLDDFLSSDDSVISADSARNLTDLLPKRLFKEGWTNPITN
                     TTMTSATALHRIWSGILSMTADQVPIVGSVPTSISGRNVEGGEWIAAGFNGYGMSQFW
                     WTWICHEY"
     exon            672737..673327
                     /number=1
     exon            673383..674136
                     /number=2
     exon            674323..674354
                     /number=3
     CDS             complement(join(674775..676075,676138..676306))
                     /codon_start=1
                     /locus_tag="AO090701000252"
                     /note="predicted flavoprotein involved in K+ transport"
                     /old_locus_tag="AO070326000168"
                     /protein_id="BAE61988.1"
                     /transl_table=1
                     /translation="MSERNDSLDYDVIIIGAGISGINFAYRLQESHPDLTYCILEERH
                     EIGGTWSLFQYPGIRSDSDLFTFGFAWRPWTQKHSIAHGSLIREYLQESAEQEGIDQK
                     IKFRHRVEKMDWSTGKKAWTVHVSTDGEATVTLRTRFIMMATGYYDYHEPLETEIPGI
                     NRCQGTVIHPQFWPSNLDYTNKDIVIIGSGATAITLLPSLAEKASSVTMLQRSPSYVL
                     SVPREDTTEKVIRWICPQKLAASLIRFKWIIVPLVLVNFCRWFPNLAKRLCLDITRKE
                     LPREVPLDPHFTPRYNPWEQRMCMCPDGDFFECLRNGSGSVVTGVIESITEKSIRLQS
                     GAELNTDIIVTATGLKMNIAGGIQITVDGDWFSIPDHFMWKCTMVDRLPNVVFALGYV
                     DASWTLGADATAQLTCRILTQMREEGLSIVSPRCGDEERNGMQELPFLNLNATYVRRG
                     GSAFPKVGDRPQWEPRSYYWKDLVRAWWGDIRTGLEWSE"
     exon            complement(674775..676075)
                     /number=1
     exon            complement(676138..676306)
                     /number=2
     CDS             complement(join(677380..679780,679848..684754))
                     /codon_start=1
                     /locus_tag="AO090701000253"
                     /note="KEKE-like motif-containing transcription regulator
                     (Rlr1)/suppressor of sin4"
                     /old_locus_tag="AO070326000169"
                     /protein_id="BAE61989.1"
                     /transl_table=1
                     /translation="MAPGGGGKRKRGERTWSSDSVNDGQRPSPHRPSNLNMAQHNLPR
                     DHSYTRGRGRRQNNRGGRNNFGRRPSNDNKNQAGGRKDTAMSPPNTTPAKEAPDQNQT
                     NGAPLAMNQSQPPPSPSPAPSQSQPHPPPTPQPQMLHVPPIQPAAPPPPFDYEYVSDS
                     VVEAWSSTGKQKLVEDGVHAKNEQDIAKLAAIYQEVIRAAFYGRLSPTDAGAVVRDII
                     GEDVAAEDIDMDSEGQTTTLFDTRSLFLDTLSIVTDSDTTNPALKPLVFSTGINAALM
                     RLQLDTPLLQSLGLVRDTFARMGIRKQTNLLYRQSNYNLLREESEGYSKLLTELFTTS
                     NNEPPSSEVVEDTFERVKAMIGAFDMDVGRVLDVTLDVFAAVLVKQYRFFVKLLRASS
                     WWPKEDAFRGSDGDNRDSGLPNWALPGSAGWVTTDEERAELVHTNQHRDREFWKRVKE
                     IGIRAFFEIGRKPVSEEELKRMLPESNNLSEEEAGTRKWIEETGTLPPKGNRVAAQLL
                     GFKLRFYSSRARSKSDILPDNLIYLAALLIKVGFISLRDLYPHLWRPDDSMDLLKEEK
                     MKEKAERERAARPGGGVNALMMAGALSDDTLPTPTPRIRESETRSATPGKDQEAEKST
                     PVKTEEDELPEPSDQKVMLLKSLLAIGALPESLFILSKFPWLMDGYPELPEFIHRILH
                     HCLSKVYASLRPLPSAEELREQKQILSSDQSGIPKGQIRLTQAPPRRVLRWAQLDKED
                     TNDGTDYRFYWDDWADNVPLCQNIDDVFALCSSFLNLSGHKIGQDASLLTKIARIGKD
                     SLSKDDSPENRARWKDLCKRLLVPAISLTKANPGVVNEVFDLVSFFPRETRYNMYAEW
                     YFGQTSRLPDVKSAFDQARAETKDVLKRLSKTNIRPMARALAKIAYANPGIVINVAIS
                     QIESYENLIEVVVECARYFTNLGYDILTWALINSLGQKGRSRVQEGGLLTSRWLNALS
                     TFAGRTFKRYSVMDPTPVLQYVVEQLRHNNSTDLIVLEQMISSMAGIITDTNFNDNQI
                     QAMAGGEVLQAQTILQLLDRRHESKTTSRRLMKALTVSKLAGQLLIAIAQERWTCIFQ
                     ESEGSDELKLLGNVFDEIHRVLAQYLDLLRSNMSVEEFDSFVPDLSSLISEFGVQPEI
                     AFWIRRPSVAKKISESDRATTEEEAGVAKSGEVEQQSPPKDEADKMETDEGEATAQDS
                     GQTAESAMDVDKDQSEKPPDTDAVNKTTEQAIATASVTAESPLNPVMQDLQDQVKSAL
                     PSETWGVVGLHFYVTFWQLSLYDVHVPQKAYEDEIDRQKKKVIAIGNDRSDISMAGSQ
                     RKEREKKQITQLQDRILEENKAHLKSYGQTRTKLQKEKDRWFAGMRGKHDALNVALLE
                     QCFMPRLLLSPIDAFYCFKLLKFLHTSGTPNFRTVGLLDQLFREQRLTALIFQCTSRE
                     ADNLGRFLNEVIRDLGRWHADKAVYEKEAFGTKRDLPGFAMLVDPEGKPTTFLEYEDF
                     RRLLYKWHRLLAAALKTCLNGGEYMHIRNAISVLKGVVQNFPAVNWIGRDMLTSVNNL
                     SQNDERDDVKIPAASLIGDLNRREKKWMLPQAFMITSQPAAGKGNPSKSEAADKNANG
                     KTLPSRPQSSTPGLNASAAEFKPTTEPSKIEPTKTEVEDGEIEDAKMTDAASKNTIDT
                     DKLSQKSSEQADTTASTPAEPIASQTQQASSAESTTNEKPATPAVEPRTTGQPAPASP
                     APTASQAPPKGPEPGRQANIPRRPDPERAPPSNQNVRSQTHTPNRPYREDGRLPPRPD
                     LLDDRRDRHSDYPRGGRYGGEHDYNRSFEQPVGDGRGYGRLDREYPLRPSMDESFRGP
                     PYREGRLLREPEWPDRPGRLRPSDAREAPPVARSGPPTHPDRAEMIHDHPDREGYRRG
                     EALRQEKDDRRPLPSRTLSPPRVELPNRPERFPDERRSGNFGQAHSRHEDLPTGPRSE
                     RVGRPPMDGHDSRDSDLSHGRLRQPEPSAEIPSGPRMRNAPGRGGRGGPGPSNGPNAP
                     NERQPPTGPGRQGMRSGPDQSASAVPSSPGPERLDTTGIHPDRLKNLQPQPTEGSFGG
                     PMRSSHPSSPASVVPPSGPRSALGPPQGPSSLNRGPPQGPGYGGERGRGDKRFAGLNN
                     MLQQSGGPAERAGPGPGPTIRGRGANRQPAGMNASQAPDEGGRLGPPQNRPDLMAGRP
                     STSFPEDDGQPRNRPSGPRGEPVEESGPESRRSGRYSGHDRDRERERDRDRDRDRDRD
                     RDRERERRTGEEEGTRSSSRREEQRDRTRDYERERSRRSDAGAGNTREERYESREASR
                     RGAGSRDENRRRRDREDASDAQSQEHEGRLRPPSSLGGHPPPPPPPPPLPGSAEEDRR
                     WAGGREPRDRDRDRNRDRQRDRDYNRDGGSGGGGSHRKRGRPGGDDSGHGDGGGRGGM
                     RMGGESKRPRRGA"
     exon            complement(677380..679780)
                     /number=1
     exon            complement(679848..684754)
                     /number=2
     CDS             complement(join(685600..686399,686476..686629,
                     686743..686769))
                     /codon_start=1
                     /locus_tag="AO090701000254"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000170"
                     /protein_id="BAE61990.1"
                     /transl_table=1
                     /translation="MAPPKVFLWAHPDWQYSLLVRSKDKAAQVTSKYPNVRIVLGDLD
                     SSNIIEEEVKNADIVLHCADCDHVASAEAIAKGAAHHTPENPVWVIHTSGTGILTVED
                     FRTNTWGFYRSKEHNDWEGVDELLNLPDDSFHRNVDKIIIEASQRNPESVKTAIVCPP
                     TIYGPGRGPGNQKSVQAYWLAAAVLKRKKGFLVGEGKNIWHQVHVQDLSDVYGALADA
                     AAAGGGKATWNDKGYYLAENGQFVWGDIQREVARVAYEKKLIPSPDVESLPDAQVSEL
                     NEFGLYAWGSSSRGHALRARKLFGWSPSKPSLKELIPEIVDLEAKNLGLL"
     exon            complement(685600..686399)
                     /number=1
     exon            complement(686476..686629)
                     /number=2
     exon            complement(686743..686769)
                     /number=3
     CDS             join(691651..691795,691852..692066)
                     /codon_start=1
                     /locus_tag="AO090701000255"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000171"
                     /protein_id="BAE61991.1"
                     /transl_table=1
                     /translation="MSSFAESSRDVRIENRGPETWLVCEAQAEDGSWQPAEINLDDVI
                     GNDDGWFSRDTTGFTQSADDITFEFRGSEPWLEAELPTRDGGSRGRQGINLGLHITNN
                     DGNLEWYVSIEIYHWGH"
     exon            691651..691795
                     /number=1
     exon            691852..692066
                     /number=2
     CDS             complement(join(693697..693996,694058..694081,
                     694131..694167,694285..694312,694366..694411))
                     /codon_start=1
                     /locus_tag="AO090701000257"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000173"
                     /protein_id="BAE61992.1"
                     /transl_table=1
                     /translation="MALCLCQQSKISGAQELIRLLFDIDLLHLLIDLNIRSRKIPKGN
                     MKRTKKYASQVNGKEIIPGTSQLLETCGRSSAASGTEGTLELWDKTQRICKLYWDCPW
                     GSKVNKFKVQEKYKTYRVEVGPWNSYGGALGNVDVEISRKRA"
     exon            complement(693697..693996)
                     /number=1
     exon            complement(694058..694081)
                     /number=2
     exon            complement(694131..694167)
                     /number=3
     exon            complement(694285..694312)
                     /number=4
     exon            complement(694366..694411)
                     /number=5
     CDS             join(696581..696606,696678..697827)
                     /codon_start=1
                     /locus_tag="AO090701000259"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000175"
                     /protein_id="BAE61993.1"
                     /transl_table=1
                     /translation="MPTPIFTAFIDFATGFPTQLDNFGVNLDHRGQSVENGVNGVVSH
                     QSEEPYSTRDSVLKHEDDSAVESLTESMEDWASDRSLSQLTATDTGSDSSQLYLGPHD
                     PFEPKEQLDGYNAGRKPVFAIAHRVLTIQGMKDAVAHGANALEIDMRGWSSWGRKGWY
                     CDHDGTITSPGDKAEDMFRAIQDQRRNGKTINFVWLDLKKPDEYKAGENAIERLRDLA
                     RKYLQPWGVRVLYGFYRSHVDGRAFGVIRDNHNYLEAVSINDKAANVHKSFQHYGAKI
                     QNTKRVADYGYFNLGFQFGNCSELDYYTCTELRHAGRMRDEGKFGKVFGWTLAVDQAD
                     LANALLGTARVDGLIYGFKVTAYRDHEDTRAAVKDIQTWVQKHSVTHYLAGQNDSPW"
     exon            696581..696606
                     /number=1
     exon            696678..697827
                     /number=2
     CDS             complement(join(698719..699048,699101..699484))
                     /codon_start=1
                     /locus_tag="AO090701000260"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000176"
                     /protein_id="BAE61994.1"
                     /transl_table=1
                     /translation="MYREEKLTNAQMKLTAIATLAYGISTASAYALYGGYERMFYYYG
                     YMIDADVNGQPKKVAPSCKQTGKCTFNEFIKYINDLSKPVSVTSDELPEVHTTAQKLD
                     TLQLTGAYKVGKIWPKASTIPALFDQISRYIKEVRDRVKRKESIEFARASIESVCFLR
                     KFARSEALRPYLEGKKVTPVIKKEVFNGKYYDLVDEAATIKKFSQAKKMIQDFDKADP
                     SHNDNIKASCDAAARLHGG"
     exon            complement(698719..699048)
                     /number=1
     exon            complement(699101..699484)
                     /number=2
     CDS             700354..701826
                     /codon_start=1
                     /locus_tag="AO090701000262"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000178"
                     /protein_id="BAE61995.1"
                     /transl_table=1
                     /translation="MASQIERRLSHIEYSDKICIEAIRGERLPEALGLPVVQHSVIRG
                     IRYHDGFAEELMGSLPAFTRALCARSIMSNRVPQINQPEDIPYCIWHPDVATEATYRE
                     VARRYPQMKYQVGRACAVAGYFNLYMELNLLPEVHIADEARENGHSDIYEDIMASPVK
                     YEVMNDYFRTINADQPKVAHLNGNTAVRPYLEVKRKFRQTDEPFDVKGTASKGHYFDI
                     TEDNGVDEFDTKSLPSDGAAVTQYLYSPLPRDLPLINKDVLILTAAYYGDIDRYARLC
                     RPMTVPTEIHCIVRGIYHNTMFAKWWSLQPDISDYRIQRAIYARFIMDNDISRITPET
                     PCNELPYLIWYPAIAHGRVYQELVRRKPSMKAAVARACIVADYRDVYDKLDVDPDVDL
                     LAEAKVSPNPYYLQDLRNKTERRGGVPDEWPKWNPCYTRDRLFEHTTTRLLGDVSNSI
                     ADTESGVPYNGVYAGMSHVALHVCASEGQDMHDVDLSDMY"
     exon            700354..701826
                     /number=1
     CDS             complement(join(704141..705003,705058..705511,
                     705575..706027))
                     /codon_start=1
                     /locus_tag="AO090701000263"
                     /note="membrane coat complex Retromer, subunit VPS5/SNX1,
                     Sorting nexins, and related PX domain-containing proteins"
                     /old_locus_tag="AO070326000179"
                     /protein_id="BAE61996.1"
                     /transl_table=1
                     /translation="MDYSAISHDPEHPAGTSPWASPRPNQTTFPTSSTNDIPSDPLAP
                     PHPPYDADRESQPESSLPTGQEQTESPDISERLQSAQLGDPDYHNEPSQYAAQQQQYG
                     EQPRSQVPARYQTGARQHARPAPLYKIQAKITSLERTGKKDPILRFDVHTNLPKFRTT
                     QYRDVRRTHAEFTKLAEHLMSANPEAMVPAVPPPLTPAGAGTEEDEIRVKASMQKWLN
                     TVLGNEVLMQDDEVVLFVESDFGYSPVVRMKQPATGMRRKVLKQFAPPPDDTPELQNA
                     RPVVKMFYLGSMDASHKVDRVVKGRRGLGLAESDFGVKLGQMHVQETHPGLANAYRKL
                     GKVIQTVGDYHAVQATAEATTIGEPLNYHSSDAFIVKETLTNRHILLRDLIQAQQVTR
                     SKRAAADRLKVSSSVRPDKVDEAINALDEAQSHEDYLTKRTHRVTSNLLQEKRRWFDR
                     TTSDLLASLREYTLRQIDAERRTLATLESVRPDIRAIDSSGGLSRLGRESHPTVRRPN
                     LGSSQGPKGDAWSGIPRRSDGLGRSMSGSLISPTSEADEEVNGQGKGRLRSPSGVGPV
                     VEEDDEDRLDARNAASRLATSTF"
     exon            complement(704141..705003)
                     /number=1
     exon            complement(705058..705511)
                     /number=2
     exon            complement(705575..706027)
                     /number=3
     CDS             join(706067..706116,706737..709218)
                     /codon_start=1
                     /locus_tag="AO090701000264"
                     /note="mitochondrial elongation factor"
                     /old_locus_tag="AO070326000180"
                     /protein_id="BAE61997.1"
                     /transl_table=1
                     /translation="MAPTHHVCSAGTEILAIGFTRRIGDVDEGSTVTDFLPAERARGI
                     TIQSAAITFHWPPQTAGDGNTTPQEPQTPRSASSHTVNLIDTPGHADFTFEVMRSLRI
                     LDGAVCILDGVAGVEAQTEQVWHQASTYRIPRIVYVNKLDRDGAAFGRTVREVASRLG
                     GWPAVCQIPWFEGGNGRFTGIADAINLQGLRWEEGDGKSVKMFNLEQLASEEPQLAQE
                     LKRARVALVELLSEHDEAMVEKFFDCEEDHLAVPPNDILESLRRCLLEEQGRKIIPIF
                     AGASFRNIGVQPLLDAVTNLLPSPPETPDPEVSIGGVKGGLRRLLSGDLLVEQGEKAA
                     SAKGKHKKKSAIQAESRNAIEKLQGCALAFKVVNDPKRGVLVYVRVYSGSLDRNSILY
                     NTNLNVSERAPRLLKMYANDAVEVDSIPEGHIGVVAGLKHTRTGDTLVTYSGNKATPP
                     EPLNTLQLRPITVPPPVFFASVEPHSLSEEKRLQESLAMLLREDPSLHVTVDEDSGQT
                     LLSGMGELHLEIARDRLLNDLKAKASMGRIEIGYRECPLGASGPITRIFDKEIAGRKG
                     KAGCTATVEPFDPEETTTEPDPSTLSIQTTDGNQIVIQAPGLEVEVNKKGIEESPLLP
                     PGLDVHALRTALQNGCLAALARGPQFTFPMHGTRVTLTFNPAEHLFGNESTPSALSAA
                     ARLATSSALRDLPSGAGTSLMEPVMNVIISVDEASLGAVVHDISSSRGGHIISLDEET
                     PLQTTDITSNPTDDLLPPIDPNKVYAPPDPFQSSTVGIDLPSSANRPRTITAKVPLKE
                     MVGYLKHLRSLSAGRGTFVMSVDRFEKMSAPRQKAVLAELRGDFF"
     exon            706067..706116
                     /number=1
     exon            706737..709218
                     /number=2
     CDS             complement(join(709678..710022,710091..710801,
                     710914..710982,711062..711103))
                     /codon_start=1
                     /locus_tag="AO090701000265"
                     /note="ADP-ribosylation factor GTPase activator"
                     /old_locus_tag="AO070326000181"
                     /protein_id="BAE61998.1"
                     /transl_table=1
                     /translation="MSKMWEVDPETKAKLLQISKTNGNDKCCDCGAPSPQWASPKFGI
                     FICLNCAGTHRGLGVHISFVRSITMDAFKIAEIQRMELGGNEPWKSFFDDHIVTQSEG
                     RTFEDSTIKERYEGEVGEEWKERLSAKVEGREYVPGQKPPQPKRNPTVEAASSRSSTP
                     LGRASPASHDGFGGMDGGRKERNEAYFAKLGSENATRSDSVPPSQGGKFTGFGGGVPV
                     SSGPSRNTSGGNIPGFDDFQKDPMAALTKGFGWFTSTVGKGAKTVNDSYIQPTAKSIA
                     ESDFAAQARQHAAQFGQTVQVGARGAAGQFQRFVEGPDENSAGRRRAEPERKDFWDDF
                     SSLAQEDNHRRNASRSSAIGTAAMKPSPTSNTSAATGNASSTAAKEKDDWDNDW"
     exon            complement(709678..710022)
                     /number=1
     exon            complement(710091..710801)
                     /number=2
     exon            complement(710914..710982)
                     /number=3
     exon            complement(711062..711103)
                     /number=4
     CDS             complement(join(711721..711738,712525..712767,
                     712827..713156))
                     /codon_start=1
                     /locus_tag="AO090701000266"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000182"
                     /protein_id="BAE61999.1"
                     /transl_table=1
                     /translation="MLTDICYSESVSIPVNPRTNRPVGYAFVDLATAHEATSAIGELS
                     GKEILQRKVSVQLAHKPEPAEAKAEGAVSGGEGASGNEGRRRTGGRGRGRGRGRGRGG
                     RLGRGGRAQNQHQNGQAAAPAEPTNVPGQAAPLTETTNQTEAAATSESGKQAAKPRAR
                     PQKQRGPPEDGIPSKTKVMVANLPYDLSEDKQPFSL"
     exon            complement(711721..711738)
                     /number=1
     exon            complement(712525..712767)
                     /number=2
     exon            complement(712827..713156)
                     /number=3
     CDS             complement(join(713244..713343,713409..713623))
                     /codon_start=1
                     /locus_tag="AO090701000267"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000183"
                     /protein_id="BAE62000.1"
                     /transl_table=1
                     /translation="MSTAVENHADNQAATTPAATEATTNGTAPAAPAQSTDAAAASAD
                     EGRRLYIGNLAYATTEGELKEFFKNYKVFLGLPVLQAKEIINPSRFRSLRLLQERSQF
                     LL"
     exon            complement(713244..713343)
                     /number=1
     exon            complement(713409..713623)
                     /number=2
     CDS             complement(714976..715905)
                     /codon_start=1
                     /locus_tag="AO090701000268"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000184"
                     /protein_id="BAE62001.1"
                     /transl_table=1
                     /translation="MAEKRRASSDMYSDMPSKKAKVLNETQEWILDEDEIPATPSSPP
                     SPSETNDSPADTDALSESSSTGPATPSPYTVEFFADMANTIANLFPCEAFAKAHDCTI
                     SDVSQAISAMVVAPLSDPSFTWHSDNEMSIAEYGQGMIRIWNEHYERKLRNADTTKST
                     IDLTTPTGSTSSSGVETPSEDGSELSASFDKELLGETSPEDEDEPPDSEAPGLPKKSC
                     LSTQSQKVAGQPAKRVRWAPPLSPVVREEVYKDNYGNYVPVPTPEEVKEKERKKMREE
                     MRASKGLLERPQTTYDAFDLEILSGFDDLSYVV"
     exon            complement(714976..715905)
                     /number=1
     CDS             join(717446..717560,717610..718011,718027..718140,
                     718205..718944)
                     /codon_start=1
                     /locus_tag="AO090701000269"
                     /note="predicted protein"
                     /old_locus_tag="AO070326000185"
                     /protein_id="BAE62002.1"
                     /transl_table=1
                     /translation="MNRFSRNRVSASGAAPSSGADTTDNEYHPHVVDVLDVIDPEVSA
                     LSTLTNVQNSLFVPNLGPLINRNQTYALSPPRESSESTGEETTETEEGEETFEKSPEG
                     RPSLERPLTSLSAVLGKQDPQFAVLPEGSNLEGWTARDIEELNDHVRHMLHSRRSKFK
                     RAMKGFGKYVSKPAALDRLLTVGPVALGFLITLYATLITLFGLAWVLFLIGWINVGGR
                     QLYIINVIDNVLVALFAIMGDGLAPFRAIDTYHMCFIAHYTFQTWKVRRKRQLPDLKD
                     KNDLPTRREIDVDVEFGDTPKDEEYEFTVLNRLQQQKLVHHQTKLSKSHTFYKPHETL
                     THHAFPLRMLIAIVVLLDCHSLLQIALGACTWGISYHHRPFALTTVILCCSITCNITG
                     GVLIMVGDRRTRKKDVVERLFREQLTKEAMKKVCKKKQKRQQKIEEEDEPRLSVSTRP
                     QPYDGT"
     exon            717446..717560
                     /number=1
     exon            717610..718011
                     /number=2
     exon            718027..718140
                     /number=3
     exon            718205..718944
                     /number=4
     CDS             complement(join(719967..720685,720738..723415,
                     723490..723875))
                     /codon_start=1
                     /locus_tag="AO090701000270"
                     /note="uncharacterized conserved protein, contains GRAM
                     domain"
                     /old_locus_tag="AO070326000186"
                     /protein_id="BAE62003.1"
                     /transl_table=1
                     /translation="MQSIGKLNRSKTSIDDALGSSGRSNGRSSSIDSTSDRPKSQAGE
                     GTDSAKAGPSGFSKLLAARKKRKKKENQKATEELPTQFELEGEKDAQDRPDEPSEDRP
                     PSAANNDGLNPQNDEVNLLTDDSEPERTPSLTAQKSHAGFYTTSSPLKKTTSTDANDT
                     DSAQADVESAVSGPSATAHSESNADTELSRPTSQPSSTLGVPEDRGGKKRSVSPGRRW
                     KGAFGSSQDKKDSNRDRSSSTQSEGKKGGGLFGNSRRSSTSSKKAPTIVAESPPPLPP
                     LIRTDVKEEKPAQPSDHAAPSTPPRRTIPAPHTTVTPPTPRTEAAANLFSSPDVTESP
                     DSLKGKDPLPPGVVVSPSGNMISHRRVRSASSVSHKPSKLSNSISALGPTIEEAKATS
                     KTNLGTQQTGFFSSVFSAAQNAASTLSSSLNTQSKTRSPSQQVSTESENISTKDGESS
                     QNETQESSKTERKKPLAIETLGTGDLDFSHLDIAVPPGGSVSTPDGVVITKPDIPSDK
                     RKNTAVHQRDEEAARLEDRHAARAVTMAYEKPSEVSVVPPSDESLELQSTSSLPRDAT
                     GDHTSPSGSVLDGEISVRPSRSGSVRSRLTRRRHRGSSAATASTAAAAGASAMALGIP
                     GGNSSVPRLTGFAVASKKRNRDFHQLFRSVPEDDYLIEDYSCALQREIILAGRIYVSE
                     GHICFSSNILGWVTTLVISFDEIVAIEKESTAMVFPNAIAIQTLHARHTFRSLLSRES
                     TYDLMVNIWKINHPTLKSSVNGTRVEQGTGDKTEKAGEESEGGSEDEDEIYDEDEDGD
                     NADSFFEPGDASVNGSDKSLPLKGLSRQASGNLPVNGTAPATSNTNGDPRGGKSANEN
                     VDGDFPGPTTHGPTTYTDPAGQYDKVIKDEIIPAPLGKVYSYVFGPASTNFMPKFLVD
                     NQKSGELQFDIESGGLTNESRTRQYSYIKPLNGSIGPKQTKCISTETLDFLDLEKAVL
                     VTLSTQTPDVPSGNVFCTKTKYLFTWAANNQTRFLMTCTIEWSGKSWLKGPIEKGAID
                     GQGTFGSDLISALRAAVAPRARAASKVGGKGKGRRKRGDVANEEAAAAAAKAASDATK
                     QQAQTWGPLEPIRGVLEPIAGILKPLWNGNLAVLVIGILLFLIFFRTPSQPSMLSHDI
                     GCPGYSLPQRLAAYEEMWRREESELWSWLEDRVGMDGMVFPTVNRPGESRAHERARKI
                     QSGRDFINKLDEDKMSVREMDHAIRTTREKLDTLEKILTNRKMQATAGEDTMHSEL"
     exon            complement(719967..720685)
                     /number=1
     exon            complement(720738..723415)
                     /number=2
     exon            complement(723490..723875)
                     /number=3
     tRNA            726139..726227
                     /locus_tag="AO090701t00003"
                     /note="tRNAscan-SE"
                     /product="tRNA-Asp"
     CDS             join(730807..730823,730913..731207)
                     /codon_start=1
                     /locus_tag="AO090701000271"
                     /note="predicted protein"
                     /old_locus_tag="AO070294000001"
                     /protein_id="BAE62004.1"
                     /transl_table=1
                     /translation="MKIKAQMAPWTGDTSCADYLPITQEIFRELSVLEKLTEGGCSST
                     PRFIDFLAFEQDDDDPVPDGYFVVFLLEKLPGVNLERIFSEFSLEKRNRVRIAFAKAF
                     R"
     exon            730807..730823
                     /number=1
     exon            730913..731207
                     /number=2
     CDS             join(732452..732475,732546..732671,732729..734288)
                     /codon_start=1
                     /locus_tag="AO090701000273"
                     /note="predicted protein"
                     /old_locus_tag="AO070294000003"
                     /protein_id="BAE62005.1"
                     /transl_table=1
                     /translation="METAPLTLAHTHARNAVLETRKSNPVAASEEHDLAAGEFAAAAQ
                     KSSDREALRTLQLLEQHHKKLAQILRFQHENPPAAAPGTQQVTVESGGGKTDTQQHPP
                     KLLGHARLPARETSSIASNLASARGIPSQPRRGSPVSPTVSSQQAGAKMTEGPAKIRT
                     SEARLRERQAYATKERSNRTPSKQSWNPPAASPTDITSQQFVPPDAESSHPKDRQATS
                     EEPFQRFYSTFEGLISKLSAPLAFAGLPLGSDVSEKADSARKTSADTKVDRQPAVSDR
                     QSQPGDTDISRIFSRAALRAVRDSTGGGTGSTAESFYVVPTTGGTVSYAGILSRAEKE
                     ARRSSFEEGDEDFVDARETPPSPEMRQSMTGSKGRGSRGKDKLTSIQSPKTLEELQME
                     NQALKHLTDTLSKRLHMWEVNAQSSSMALQQSLRAMHHQNVPSPEHFPQSTPAVASPI
                     APLPTPASADQEQRIRELEELIQQSEKELDKVGRENDKLRNVVGRYRDRWEKLKEGAK
                     TRREGRSTADRNSYAEPSTPVRTGSTSTQKASETTQVQAEGAAENDTNSSNEPEVKND
                     SSS"
     exon            732452..732475
                     /number=1
     exon            732546..732671
                     /number=2
     exon            732729..734288
                     /number=3
     CDS             complement(join(734671..735448,735512..735750,
                     735840..736137,736187..736402,736462..736530,
                     736593..736771,736825..736932,737004..737080,
                     737140..737247,737306..737398,737455..737629))
                     /codon_start=1
                     /locus_tag="AO090701000274"
                     /note="beta-glucosidase-related glycosidases"
                     /old_locus_tag="AO070294000004"
                     /protein_id="BAE62006.1"
                     /transl_table=1
                     /translation="MVSGVFTKGVLLLGLLSGLALGQDEKPRYKDPSVPVEERVTDLL
                     GRMTLEEKMSQLIQGDITNWMNETTGEFNLTGLEWSTKMRGGMFYVGYPVPWDYIADN
                     VKKAQDYILQNTTLGIPAIVQTESLHGFLIGNATIYNSPIGFACSFNPELIEKMARLI
                     GQEASALGVNHVMGPVVDLARELRFGRVEETYGEDPFLAGEIGYHYTKGIQSHNISAN
                     VKHFVGFSQPEQGLNTAPVHGGERYLRTTWLPSFKRAIMDAGAWSIMSAYHSYDGIPA
                     VADYHTLTEILREEWGYKYWVTSDAGASDRVCTAFKLCRADPIDKEAVTLAILPAGND
                     VEMGGGSYNFETIIDLVNAGKLDIEIVNTAVSRVLRAKFEMGLFENPYNAAPASEWNK
                     LIHTQEAVDLARELDRESIVLLENHDNALPLKKSGSIAVIGPMAHGFMNYGDYVVYES
                     QYRGVTPLDGIKAAVGDKATINYAQGCERWSNDQSGFAEAVEAAKKSDVAVVVVGTWS
                     RDQKELWAGLNATTGEHVDVNSLSLVGAQAPLIKAIIDTGVPTVVVLSSGKPITEPWL
                     SNNTAALVQQFYPSEQGGNALADVLFGDYNPSGKLSVSFPHSVGDLPIYYDYLNSARE
                     IGDAGYIYSNGTLEFGHQYALGNPKAWYPFGYGKSYSSFEYGAVKLDKTNVTEADTVT
                     VSVDVKNTDATREGTEVVQVYVVDEVASVVVPNRLLKGFKKVVIPAGQTKTVEIPLKV
                     QDLGLWNVRMKYVVEPGAFGVLVGSSSEDIRGNATFYVQ"
     exon            complement(734671..735448)
                     /number=1
     exon            complement(735512..735750)
                     /number=2
     exon            complement(735840..736137)
                     /number=3
     exon            complement(736187..736402)
                     /number=4
     exon            complement(736462..736530)
                     /number=5
     exon            complement(736593..736771)
                     /number=6
     exon            complement(736825..736932)
                     /number=7
     exon            complement(737004..737080)
                     /number=8
     exon            complement(737140..737247)
                     /number=9
     exon            complement(737306..737398)
                     /number=10
     exon            complement(737455..737629)
                     /number=11
     CDS             complement(738572..740134)
                     /codon_start=1
                     /locus_tag="AO090701000275"
                     /note="cytochrome P450 CYP2 subfamily"
                     /old_locus_tag="AO070294000005"
                     /protein_id="BAE62007.1"
                     /transl_table=1
                     /translation="MPGIYVLAAAGALALGVGYVVILPIIHYFYDPKGFRKYPNFAPL
                     AGITDLPYCYLSSCGYRSKDLYEAHKNAPILRIGPNNLSFGRIGAVKDIYGHNTPCIK
                     DIKYAMTWGSHTHLFDVIDKADHAAKRKRMSSAFAIKNSERWEHKVANVTGRLVKALD
                     AHCTLPLLPGQTEPQAADVTLDYNKWINLFTIEAINLIALSSTLGLLEKGSDEVTAQR
                     KDGTTYPARYRKSQDSTAHAQSLFVWDYKYFHWLSRLSKLVPKYRQMWKDGEPWGDVI
                     YHQAVTRLQRYQSGEKLDDFFSSLMEDKAGHPNNLEWGEIVAEVGAIINAGADTTAIA
                     LTQVLDILIRHPKYLQRLREEVDSTLDADEVVAPYDKVKNLPFLRACLDEALRLIPPT
                     SAGLPRRTPPEGAQILNEWIPGDTSVSMTSYSAHRDPEIFPVPEEYNPDRWMDLDNRK
                     RMEPYFVPFSTGARGCLGRNITYLEQTVVLATLVHRYDFAVPANWKLGRFEAFNLIMG
                     EMPMKIWRREKA"
     exon            complement(738572..740134)
                     /number=1
     CDS             join(740905..740973,741043..741552,741628..741697,
                     741739..741957,742033..742073,742087..742333,
                     742382..742536)
                     /codon_start=1
                     /locus_tag="AO090701000276"
                     /note="predicted protein"
                     /old_locus_tag="AO070294000006"
                     /protein_id="BAE62008.1"
                     /transl_table=1
                     /translation="MSQYRNGGFISLLTRNGLACLGKKGRLHYVHVNPDGRQESDGDA
                     DDDDDVEESLPDATGSNNSPSPSSMIWRKGQKPHSLPASTSTNTSHNHQGERLGQSHR
                     DSRHYSISSFNAVADSNETSPQSASYYAQTSAYECLSQPTDQPSNAFPAERDHYRLGP
                     LKGVPETFSDASYTSDLQEACLIRYFVEKLAHWLTAHSSTPQTETDTSRSQSPAEQSG
                     HMRQALKCRNNINGTVIFDGIPLPRLSEDSAIRYHNICISYLIEISKDPNEDYNEDVL
                     TAATILRFYEQIDAPSIGTDTEAYLKAYTPKTTTPSTPPKQSTAQRTTPTSTPRPQSP
                     SATPPASSPSGKKSGAHSCTNDPSGSPSPQRTTTTPSPQPATSSGPTASWSDTRRKHP
                     GSKNGRVSRPSKHTGITINLFRINRFTMYHRNRRRGLISRLSGL"
     exon            740905..740973
                     /number=1
     exon            741043..741552
                     /number=2
     exon            741628..741697
                     /number=3
     exon            741739..741957
                     /number=4
     exon            742033..742073
                     /number=5
     exon            742087..742333
                     /number=6
     exon            742382..742536
                     /number=7
     CDS             complement(join(743387..744834,744902..745904))
                     /codon_start=1
                     /locus_tag="AO090701000277"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070294000007"
                     /protein_id="BAE62009.1"
                     /transl_table=1
                     /translation="MAHLHEVPLAAGLLTTFVPSAVPTPTLSSLYVSPSSQPFPTLAS
                     DPGYDDGGGGGGGMHEWSSLIGIVTALIGNILISLALNIQRYAHIRIEREWEHQKLQK
                     EAEWKRANPGRGSTDTYGSVADHEYNDYETRGRNKSRRFARYRDESPEVRFVHHDQPH
                     IDLGPEDDDEMDTNAHQDQMDESFMSDRTVRPGDLRRKSYLRSPYWWVGIVLMCVGEI
                     GNFMAYGFAPASIVSPLGVVALISNCVIAPILLKEKFRGRDFWGVVVAVTGAVVVVLS
                     ASSSEEKIGPHDIWVMITRWEFETYVGISTVLIIGLLWASGKYGSRTVLIDVGLVALF
                     GGYTALSTKGVSSLLSFTLWHVITFPITYLLVFVLVFSAVLQIRYINRALQRFDSTQV
                     IPTQFVLFTLSVIIGSAVLYRDFENYTLDRAGKFVGGCLLTFLGVYFITSGRVRNDDE
                     SSYSNDEEEAIGLLAGERYRDSVDMSPPARHVRVQKPSRIPLETQAENMQSPSGSLLS
                     HGIEGIDEGQRTPRGVSSAAPSSPVGSLTADSLTGQSLQPSPPMHPNSLLTNPWADAH
                     ESAIVTPKSEPQIPQIDRPVTPEQSRPTTSGSPVLLRFPPAPGIEDNNLKVPAASGTE
                     TASPGIRSSTVPQTPPARRLRNSISSRFSPGPLLPTISAGFSAVVAESLRRGETSPVK
                     DRKSVRRHRGKQLSTTIVDGFLRSRDGENANIDEGLGPRGVLPTARFNSTGDIATAPV
                     TAGQSTTTLDTEDAPQNLQPDGSTSVSRIRSLSDSWSGGLAWLGGTLRKVNGHGNGHE
                     QIAESQTNEEETGANTQA"
     exon            complement(743387..744834)
                     /number=1
     exon            complement(744902..745904)
                     /number=2
     CDS             complement(746831..748612)
                     /codon_start=1
                     /locus_tag="AO090701000278"
                     /note="uncharacterized conserved protein, contains WD40
                     repeat"
                     /old_locus_tag="AO070294000008"
                     /protein_id="BAE62010.1"
                     /transl_table=1
                     /translation="MDGFDEEAFKKFFPGSFGKQERKTDVNTQIDRTKRTHVSAKTTA
                     DDDKAGLISDEQANVQTGAEDRKDKSESDSDNESDDSDSDDEDEDEFPVSHELVLKTH
                     ERAVTTLTVDPSGSRLITGSTDCTIKLHDFASMTPSTVRAFKSVDPTAKKQSALQEAH
                     AVHYAAFNPLSPGYVMVVSATPQPRILDRDGETITEFMKGDMYLRDLHNTKGHISEVT
                     SGAWCPTDENLCVTAGSDSTVRIWDANIGRSQKEVIMHKSRAAGSAGRSKMTAVAWGS
                     PKQGGPNVLIAAALDGSLMMWSGNGPFTRPSGEIRDAHTRDTWTSGLDISSDGRLVVT
                     KGGDDTIKLWDTRKFKQPISTVAHPSSSSRYPTSNIVFSPTSANVLTGSETGHLHILN
                     PATLKPELVTPVTPGSPLITVQWHEKLNQILTGSANAETHVLYNPDMSSKGAALVMSK
                     APKRRHIDDDPNLTMDLSQGISGDNVVVGSNGVPHYSSATWSSRHPTIGLTASGRPRD
                     PRRPHLPATTPFAKSQPDEKHIRENIPLSSMRDEDPREALLKYAEKAEKDPVFTKAWK
                     ETQPKTIYREISDDEGEQEPDKKRARR"
     exon            complement(746831..748612)
                     /number=1
     CDS             complement(join(748874..749127,749181..750246,
                     750308..750373,750452..750454))
                     /codon_start=1
                     /locus_tag="AO090701000279"
                     /note="26S proteasome regulatory complex, ATPase RPT2"
                     /old_locus_tag="AO070294000009"
                     /protein_id="BAE62011.1"
                     /transl_table=1
                     /translation="MGNQQSNIGGGPGGDGRDDKDKKDKPRYEPPPPPTTRLGRKKRK
                     AAGPSTASKLPDIFPTSRCKLRYLRMQRVHDHLLLEEEYVENMERLRKTKAQAAHDSV
                     SRSEFDIMDRNADERGRVDDMRGTPMGVGNLEELIDDDHAIVSSATGPEYYVSIMSFV
                     DKDLLEPGASILLHHKSVSVVGVLTEESDPLVSVMKLDKAPTESYADIGGLETQIQEV
                     RESVELPLLHPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRIVGSEL
                     IQKYLGDGPRLVRQIFQVAAEHAPSIVFIDEIDAIGTKRYDSTSGGEREIQRTMLELL
                     NQLDGFDDRGDVKVIMATNKIETLDPALIRPGRIDRKILFENPDQNTKKKIFTLHTSK
                     MSLGDDVDLDEFINQKDDLSGADIRAICTEAGLMALRERRMRVQMEDFRSARERIMKT
                     KQDGGPVEGLYL"
     exon            complement(748874..749127)
                     /number=1
     exon            complement(749181..750246)
                     /number=2
     exon            complement(750308..750373)
                     /number=3
     exon            complement(750452..750454)
                     /number=4
     CDS             join(751261..751521,751581..751885,751946..752120)
                     /codon_start=1
                     /locus_tag="AO090701000280"
                     /note="ubiquitin-protein ligase"
                     /old_locus_tag="AO070294000010"
                     /protein_id="BAE62012.1"
                     /transl_table=1
                     /translation="MASNRSRRIAKEIADIHADTQSGITAEPVGSDEDLTHLRGTFPG
                     PPGTPYEGGTYVVDIKIPTDYPFRPPVMKFHTKVWHPNISSQTGAICLDTLSSAWSPV
                     LTIKSALLSLQSLLSTPEPKDPQDAEVATMLLRKPKEFERVAQTWATLYAGAPSKNAG
                     EGSGGATNESLRQQELKSREEQEKEDLAKYDGYNKDLIDRFCSMGFDVDRVVAAFKYY
                     GIDRMNGEDYELEEAYMGDVTARLLGEP"
     exon            751261..751521
                     /number=1
     exon            751581..751885
                     /number=2
     exon            751946..752120
                     /number=3
     CDS             join(752723..753067,753158..754081)
                     /codon_start=1
                     /locus_tag="AO090701000281"
                     /note="Cdk activating kinase (CAK)/RNA polymerase II
                     transcription initiation/nucleotide excision repair
                     factor TFIIH/TFIIK, cyclin H subunit"
                     /old_locus_tag="AO070294000011"
                     /protein_id="BAE62013.1"
                     /transl_table=1
                     /translation="MIEDDFYRSSSQFRLWSYTEASLQSLRATTNANASERVRSALRK
                     SREAQQSATSSAAGTPAANQNGSDADSKAGGEETEIECLTPEEEHQLVRYFCEQIIEL
                     GEMYKPPLPTIVRATAIQYLRRFYLTNSPMTYHPKSIMLCALFLATKTDNYYLSLRQF
                     AEVIPGGTTPEDIIQPEFLVMQSLRFTFDVRHPFRGLEGGIMELQAISQGMGQPAPHF
                     PTQTPDDLKRKLHSLPASPTTSSSSITNRLARAHHNTREILKSAAQMTDAYFLYTPSQ
                     IWLAAFMIADKPLAEFYLETKLGGPQQQQQGSPLYELRTKLLRTLTDCSHLLQAYKPL
                     ASDPDQKKNLRRIRKKLTHCQNPDKAGVAGQKRIPAAAAAVAAAGDPATSESEMERLA
                     KKRKLDGGQPNDIFGGELVTQRTKEAQQPQ"
     exon            752723..753067
                     /number=1
     exon            753158..754081
                     /number=2
     CDS             complement(join(754610..755878,755932..756516))
                     /codon_start=1
                     /locus_tag="AO090701000282"
                     /note="predicted transporter (ABC superfamily)"
                     /old_locus_tag="AO070294000012"
                     /protein_id="BAE62014.1"
                     /transl_table=1
                     /translation="MVSASKAARLAKRADGDSKKKLGKGKKSGTESPQVDSDVPADDQ
                     PATTTEKMKEVEKLTAQMDKHGLSDRVTTGVLSSMESSRDVKVTSASLVFHGKVLITD
                     STLELNFGRRYGLLGENGCGKSTLLKAIAHREYPIPEHIDIYLLNEGAPPTELGALEW
                     VVTEAQNQLDRMEKQAEDILEEQGPDSPILEDLYDRMDKMDPSTFHTRASLILTGLGF
                     NKVTINKKTKDMSGGWRMRVALAKALFVKPSLLLLDDPTAHLDLEACVWLEEYLKKWE
                     RTLVLVSHSMDFLNGVCTNMIDMRMKQLLYYGGNYDSYHKTRSEQETNQMKAYNKQQE
                     EIAHIKKFIASAGTYANLVRQAKSRQKILDKMEADGFIQPVIPDRIFSFRFAEVEKLP
                     PPVLSFDDVSFSYSGSWEDTLYEHLDFGVDMDSRTALVGPNGVGKSTLLRIMTGKLQP
                     IGGRVSRHTHLKLGMYSQHSAEQLDLTKSSLDFVRDKFPEKSQDYQYWRQQLGRYGLS
                     GESQTALMGTLSEGQKSRIVFALLAIESPNMILLDEPTNGLDIPTIDSLADAINAYSG
                     GVVVVSHDFRLLDKIAKDIMVCENKTVTRWDGTIGQYKDHLRKKMIDAGAV"
     exon            complement(754610..755878)
                     /number=1
     exon            complement(755932..756516)
                     /number=2
     CDS             complement(join(757516..758106,758169..758441))
                     /codon_start=1
                     /locus_tag="AO090701000283"
                     /note="predicted protein"
                     /old_locus_tag="AO070294000013"
                     /protein_id="BAE62015.1"
                     /transl_table=1
                     /translation="MLRNVDFSRWHVDIDRYLNPLVPRPPWRWLPRPISHFLGYRGDK
                     PPKNLGNLVLAFWSLIGVFCGVLVVAEVSLHVPSFQHHHAPIIVASFGAAAVLEFGAI
                     ESPFAQPRNAVLSQVMASAIGIGIGRLFALNPHANALPQVGGALACAITTAVMVLTKT
                     VHPPAGATALLSVTEGYEIGWFLILIMFLGCIMMQSVALVINNIQRRFPVYWWTPDPL
                     PRPKVVVEDTESAREGKQESLASSASDDDTQAPVPARIVIQEGRVSIPDNVWLTAEEK
                     EWLEKISQRIR"
     exon            complement(757516..758106)
                     /number=1
     exon            complement(758169..758441)
                     /number=2
     CDS             complement(join(759698..759909,759974..760061,
                     760128..760531,760615..760710,760776..761058))
                     /codon_start=1
                     /locus_tag="AO090701000284"
                     /note="predicted dehydrogenases and related proteins"
                     /old_locus_tag="AO070294000014"
                     /protein_id="BAE62016.1"
                     /transl_table=1
                     /translation="MASKTFNVGVVGYGFSAKTFHIPFVSDVPQLKLYAVVQRTPKPD
                     DDAEKDHPGIKSYRTAEDMVKDDGVDVVIVTTAPDSHYQLTKLALEHGKHVVCEKPFT
                     PTTQEADELVALAEKQNKLLAVYQNRRWDADYVTASKLVKSGVLGRVAEFETHFDRHR
                     PEEPAPDVSKWKNKVVPGGSAIYDLGSHLLDQAVHLFGLPNRVTGFIGSQRAVNTSGY
                     EDSFTVLFHYNNGPLVTAKAAVVSPEEEQLRFWVRGEKGSFKKFHLDVQEEQLKSGIK
                     PGDSVYGREPSERYGTLTTIQNGKPVKEVAPTVEPPTWSEYYRKLARALAGEGDLPAS
                     GAEARDVIRLIELAQESSRQGKTLDV"
     exon            complement(759698..759909)
                     /number=1
     exon            complement(759974..760061)
                     /number=2
     exon            complement(760128..760531)
                     /number=3
     exon            complement(760615..760710)
                     /number=4
     exon            complement(760776..761058)
                     /number=5
     CDS             complement(join(761370..761414,761573..762217,
                     762280..762309))
                     /codon_start=1
                     /locus_tag="AO090701000285"
                     /note="O-methyltransferase"
                     /old_locus_tag="AO070294000015"
                     /protein_id="BAE62017.1"
                     /transl_table=1
                     /translation="MSQNQPTTRQRNDEAELDLLDFIYAQPNRDEIQGNPQKVLDLID
                     EFAKSRHLIHVGPEKGKVVADLIAERKPQTMIELGGYVGYSAILFGDAVRRAGGKKYY
                     SLELNPEYAAISTLLLDLAGLRDFVQILVGRSDQSLNKLCASGEVPQVEIMFIDHYKP
                     AYTTDLKLCEQLGMIVPDVSVLVADNVLYPGNPPYLEYVRSTVEQKRKAAEKGPIQMY
                     NTEGIPADALEITRCVGVEKA"
     exon            complement(761370..761414)
                     /number=1
     exon            complement(761573..762217)
                     /number=2
     exon            complement(762280..762309)
                     /number=3
     CDS             764399..765904
                     /codon_start=1
                     /locus_tag="AO090701000286"
                     /note="predicted protein"
                     /old_locus_tag="AO070294000016"
                     /protein_id="BAE62018.1"
                     /transl_table=1
                     /translation="MSIPTVRRAFGSIPKQRTLQSIRGLLQIQTLGLLLRIAISFILL
                     PLDNAILFATCLVGHFSVFLSHSNPVHRRQAARRDVHFYPKTIFITGIDTPYGLALAR
                     CLYYHGHRVVGADITDLPFASGEGMSKTLATYYRIPRSHYVSRLLDIIQREKADIWIP
                     CSSRASVLEDAMAKQAIESRTACKCIHLDTELVNQFSDTESFTQYLVEKELPVVENYQ
                     VQSRDSIHKILHRSPSKVYHMRRPDLAVSDNKVVTLPKRTLSMTYTEVSEIQISKDRP
                     WVLQQQARLGEFFAELLLVSGQVKAIKIRPADNQPWGHSRLDEGLALAIHRLMDRFAF
                     KGGHRMTGHLCLRLMVDEEFDANNVRYVTHIAGCTQGTTAVRHLLEEPSPSLIDGYLA
                     VLSSQPDDTSVDLDRKRMQARASISAVSRSKFTFYKTLKQCDVRRVLPSLYPVAQQLD
                     HLVSQGSDLLLFWKDPRFTVLDPLPWWWNAHIYQPLKGLEVVLSRRDVKRL"
     exon            764399..765904
                     /number=1
     CDS             complement(join(768783..771906,771929..772440))
                     /codon_start=1
                     /locus_tag="AO090701000288"
                     /note="predicted protein"
                     /old_locus_tag="AO070294000018"
                     /protein_id="BAE62019.1"
                     /transl_table=1
                     /translation="MTRSIIRQLVPEELPGSLVSLWEEHGRHNREPDQDKLSTVLHDV
                     INNYTGDRLFLIFDALDECPDNEVHERDLLFQVLKGLIDEHGEKIHLLATSRYEENIR
                     CHLEESLEIDLEDRMNNDVEAFVRDALDHGKLSRWKKEKGVNDQILAKLLDTKEPRYC
                     HALCCSQQNILRFRWADLQIKRLEKCKKRDQITESLETIPKTLEETYQRILHDIPEDE
                     KEDARSILTWLSFSLEPLRLETVAAVVGFPHPEDVVGTCTTYLVTVSPSNGTIKLAHF
                     SVKEFLVVSESVHWYQLTKNGGHMDIANRALDDLLDKTEVLTEEAVHGLPLLKYAAAH
                     WSRHFSELTDSDAKFWDLEKKIHRLFEERIVYLNWRRVARDNFSMSSWDRGLFSFEPP
                     IYLACGMGMQNVVERLLSQGANACTELGLSTVGVAALNGHLTLVKLLLGNIGVSAKIA
                     SEIASYIDLNNVPHEEVEDLLDLLLSTKVLYDKTANGCVLLNEDFVSAIAENERSGRR
                     LMCLLLDRQDKLEVPVTESVLDAALCNRDGGETMRVLLDRRRKGIQITEGLMESVAAD
                     SRYTPDISELILQRWGATVPLNQKIVKEFVRRAPAKVMELLLQIRGHEIQITEELVDA
                     AAANGDHEVFRLLWERVSGIEITSKTWQRIIIWGSKGLERMEIALAKCPQRYFLENEI
                     ILKVARCLYGLPLMRMLLDKREAGLVVFDVSEATMIAAASNSNCPQQMMELVINNADS
                     EIPVNEKILSSAIGNVRASESALEYLLELEQNLPITEEVLVSAAAATAVPFYQRKRVL
                     KFIFNKFPDAPMTDRVFKAAGHMSGVLLSLWLKRGRHIQDCQLIGRLLGQGIVSLQEL
                     TKLFDEGLVEMDDNLVDAVGTQNALIMALEGYGAMEKLLDLRRNDITVTEEVVLRALD
                     EVCVDGQAFKMLTDRLGSVVPVTEKILEKAFLKDQSILLDLLLKEERNWNLQKVWDAI
                     WRNHGYFLRDIVGGANALLKYGEFDVSQTLVEFLPRHEEDGFSNKDLDELVNLCAGRD
                     ISAPAMEMISVISFKWGDARTIRVFIDRLSSAVPMTEKVWDALWLNDGFSFQQKAIIS
                     NILLEYGEFDISQILLEFLPLREEKGVFSDEEIDELVNLCVGQDISAPATEMLIEILF
                     EYGNANSIMKFVKRKPTVQLTDGLIQRADRNERAYKKVLMPFLYSKRAADQNINNAEA
                     KTEAEED"
     exon            complement(768783..771906)
                     /number=1
     exon            complement(771929..772440)
                     /number=2
     CDS             complement(join(773419..773492,773545..774124))
                     /codon_start=1
                     /locus_tag="AO090701000289"
                     /note="predicted protein"
                     /old_locus_tag="AO070294000019"
                     /protein_id="BAE62020.1"
                     /transl_table=1
                     /translation="MRHQLKKNSKTRNPDQQDDVKCLEEAKHDGVDADVSPISKQHTK
                     GTSLKEDREFGDPETGPKALHELKNDHKQDEAETPEYPVSKKTPADEKVVERSEKPGN
                     VDLWQRAFDELNEDLKGQLREDEAISPENAIKEVIDRTKESFKAYQNGGLKFKKYDGK
                     EVNVRDVAKKILNSAIHCSDIIKGIAAFDPSNHASSAWGIVTLGLTVRRVILIYYNI"
     exon            complement(773419..773492)
                     /number=1
     exon            complement(773545..774124)
                     /number=2
     CDS             join(775763..775918,775983..776284,776344..776806)
                     /codon_start=1
                     /locus_tag="AO090701000290"
                     /note="predicted protein"
                     /old_locus_tag="AO070294000020"
                     /protein_id="BAE62021.1"
                     /transl_table=1
                     /translation="MKLARPSINPGRTKNIIHGVQGFIIFLAWACTIAVFTKGDGIDG
                     RSAWYWALCWFSIPGLIYLVAVPMWPRARRFGNVYAFATVDCLYALLWFTAWVCVASY
                     VAQGKSEGKDSNQEDKDKDSDKKTGCDNWKYGSASKCKISTATCIMGVVIFLLFIVTA
                     FMSFRNVMHFRRTGTLPDAVSDPTFAAQSQAAFSSNPAHDFEEEDDFRSGRAGGMGSS
                     VRSDRDEDYALLHQSEVDEFGNPSGRTAMHGAYDPTASNAGGSVLHDYNTVNTATSYG
                     GAHGQHYAPNSEYAPPSEWGMGSSVSGYGR"
     exon            775763..775918
                     /number=1
     exon            775983..776284
                     /number=2
     exon            776344..776806
                     /number=3
     CDS             777519..778163
                     /codon_start=1
                     /locus_tag="AO090701000291"
                     /note="predicted protein"
                     /old_locus_tag="AO070294000021"
                     /protein_id="BAE62022.1"
                     /transl_table=1
                     /translation="MADSIDIYNQYPLVLDPTSKAINLSSQTTTPASASTVTTELTEL
                     NALHRGLISLDPPNIPPPPLPINPKRSAQITKLRDSANTAYRKNNHAEAVRLYTYAIE
                     MGIARPGWEPMSLAREELAGLFANRAQAYMAQQAWPEGLVDAKCSVESKPVGNVKAWW
                     RAGKCLAEMGRWDEAQVAIDKGLEFEPRNGEGAKELLSLMEEVKEGMKRANSSA"
     exon            777519..778163
                     /number=1
     tRNA            complement(778500..778571)
                     /locus_tag="AO090701t00004"
                     /note="tRNAscan-SE"
                     /product="tRNA-Glu"
     CDS             complement(join(779330..779648,779702..779993,
                     780053..780213,780262..780422))
                     /codon_start=1
                     /locus_tag="AO090701000292"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070294000022"
                     /protein_id="BAE62023.1"
                     /transl_table=1
                     /translation="MVVWDDHTYGYSSSYHRQSLTVTVISGELMNTAAYAFAPAVLVT
                     PLGALSVLISALMGAYFLNEDIQVLGKLGAAICLLGSILLVLHAPGDRDIQTIEEILH
                     LAIQPGFLIYCTLVTVFASYMIYKVAPRLGRTNPLVYLSICSTVGSISVMSVKAFGIA
                     IKLTFAGDNQFTHASTYVFSLVLVVTTLTQMNYLNKAMGEFPASLVNAMYYVGFTTCT
                     LTASIIFYQGLNTSDWTSITSMMCGFLLNFIGISLLTLSKTGQEARPESVRALSMRSF
                     DMSRGRYDHVRTSSVDLPSALERRSSGLDAAERQ"
     exon            complement(779330..779648)
                     /number=1
     exon            complement(779702..779993)
                     /number=2
     exon            complement(780053..780213)
                     /number=3
     exon            complement(780262..780422)
                     /number=4
     CDS             complement(join(783422..783744,783844..783865,
                     783983..784191,784285..784398,784490..784967,
                     785149..785269,785643..785821,786434..786712))
                     /codon_start=1
                     /locus_tag="AO090701000293"
                     /note="predicted protein"
                     /old_locus_tag="AO070294000023"
                     /protein_id="BAE62024.1"
                     /transl_table=1
                     /translation="MNATFQIKYTSDFDTDKNETYYACADIRYVAASKFTTQVPCFNV
                     TADEFTAVTSTTATAGATATAGSSSSSPKDSGTKESSSGLSGGAIAGIVGIPAGRSEF
                     TFLPTRNSRSRRRNHEKNSASSSDLNGIGVQAEGSLEIIRDILYEFISSVFIGTDSFF
                     CPLVLCTIRDPCLLPHYPFFPAFLLPPYQPHHCTRCDGTQPGCKTCEVYGVECRYEKA
                     PPMSQILAMAKRLQETEQTITELRIALHEAREANAAQHTLSIERQIPNTPSADTSFDS
                     ASYIEASSSTQVAPESETAPEQILLSDLSLDENGKVCNTPTQKAPCMSIDPVAIWIAL
                     LLWSYIRRPRTTTGRINKRNAAIQTDIPRQMISKLLQIHWTWIAPMFNWVYRPAFMLV
                     VMCAHAAHFDDHQISELLISRARLLLGTEILNPSSIPTAQGLLQLSARELAWGSISQA
                     WLYSGMAFRMAISLFLGLDDSAENDLWAPYYGDQLSPDKAPPGEYPPMKSHLVSSFQN
                     VCKLAIILNDIILQLYSRRGNIYMDEALNRIQARLDHWREQSPVHLRCDPDNLPEICP
                     PPHIIAQK"
     exon            complement(783422..783744)
                     /number=1
     exon            complement(783844..783865)
                     /number=2
     exon            complement(783983..784191)
                     /number=3
     exon            complement(784285..784398)
                     /number=4
     exon            complement(784490..784967)
                     /number=5
     exon            complement(785149..785269)
                     /number=6
     exon            complement(785643..785821)
                     /number=7
     exon            complement(786434..786712)
                     /number=8
     CDS             complement(join(786854..786981,787020..787221))
                     /codon_start=1
                     /locus_tag="AO090701000294"
                     /note="predicted protein"
                     /old_locus_tag="AO070294000024"
                     /protein_id="BAE62025.1"
                     /transl_table=1
                     /translation="MIMKSSFMPLVALSSAISAWAHGEEEAKEMGPVAFMWPPDRVWG
                     AAYDNTAPCGSSSGATNRTDFPMADERVCSKSTANSHSSSKMNRGTFRSRSLTKAVCQ
                     TSHISGI"
     exon            complement(786854..786981)
                     /number=1
     exon            complement(787020..787221)
                     /number=2
     CDS             join(788130..788262,788325..788710,788786..788806,
                     788871..788980,789056..789080)
                     /codon_start=1
                     /locus_tag="AO090701000295"
                     /note="predicted protein"
                     /old_locus_tag="AO070294000025"
                     /protein_id="BAE62026.1"
                     /transl_table=1
                     /translation="MHLPTLVTLACMAVSASAFHYPDFVPLHRRQEPGTPEYDCHANC
                     GGVIVAARKDGYCDTDTFKTELSDCLNCALKYDIWKYYGASVSKAATGCGVDATPVEA
                     SSTTTTAAASASATETGSPITSSASSTSTDTAATTGVTSAASSAVPSSSGAASSTPAA
                     STVASSATPSQNSTGGASPTLDVSPWRFCKGILTLSCDAARGSGQAKSQIVLYCKHLS
                     LITSNM"
     exon            788130..788262
                     /number=1
     exon            788325..788710
                     /number=2
     exon            788786..788806
                     /number=3
     exon            788871..788980
                     /number=4
     exon            789056..789080
                     /number=5
     CDS             791304..792713
                     /codon_start=1
                     /locus_tag="AO090701000296"
                     /note="monocarboxylate transporter"
                     /old_locus_tag="AO070294000026"
                     /protein_id="BAE62027.1"
                     /transl_table=1
                     /translation="MEKDIQPPHDQNQPSEGPVQPQAQQQNVQSNPPDGGYGWVCTAA
                     AATINAHSWGFNSAYGVFLAHYLKHNTFPGSSPLEYAFVGSLSITLLLLVSPIATISV
                     REWGIKLIMFCGVILETASLICASFATEIWHLFLTQGVLFGMGVGFLFIPTAAVVPQW
                     FTTKRSLASGISLSGAGLGGLIYSLATGAMIRNLGLQWAFRILGIIGFIVNTTCTLLI
                     KDRNSTTTGHHKQTSMNLTLLRKGEYQLLLGFASFTMLGYFVLMYSLANYANEIGLNA
                     SQASIITAIFNLGQAVGRPCIGYFSDRVGRINMASSMTFLSGVLALVVWTNAKSYGVL
                     GFFAVAEGLIAGNFWATIAPLMAEVVGLKEVPAGLNILWLSIVLPCTFSEPIALEIFT
                     GTGSYQGTQLFTGFVYLAAAGCLVALRGWKIMVESRGAGVIGDGSGRRTDGVDVLVGG
                     MDRLGFVEFCQLCFRWAVV"
     exon            791304..792713
                     /number=1
     CDS             complement(join(793773..793859,793981..794056,
                     794168..794206,794322..794545))
                     /codon_start=1
                     /locus_tag="AO090701000298"
                     /note="predicted protein"
                     /old_locus_tag="AO070294000028"
                     /protein_id="BAE62028.1"
                     /transl_table=1
                     /translation="MKLFISSILSIGCLAKIANASLGALNNPGLFPFVFNGVAVFNYP
                     NWTTQQPRDSIKEGENFFCYATETGYLSFGCYSHCRPDSPDFVCDANLALPELGTLST
                     FYRDEEQGASAISVRRRRRSKLHGGVGVSFRWMGDVIAN"
     exon            complement(793773..793859)
                     /number=1
     exon            complement(793981..794056)
                     /number=2
     exon            complement(794168..794206)
                     /number=3
     exon            complement(794322..794545)
                     /number=4
     CDS             complement(join(795535..795855,795930..796067,
                     796138..796417,796481..796524,796592..796963))
                     /codon_start=1
                     /locus_tag="AO090701000299"
                     /note="S-adenosylmethionine synthetase"
                     /old_locus_tag="AO070294000029"
                     /protein_id="BAE62029.1"
                     /transl_table=1
                     /translation="MKSQSKFLFTSESVGEGHPDKICDQVADAILDECLKQNPLSKVA
                     IEVAVRPGLVIVFGVVHFIPQLDIDAIVRFVLKDIGYTSPDQELDYRTCQVMDCVELH
                     PSLFNGISSGLEAPDDEPAGDQGMAFGYATDETPQLLPLTLHLAHRISRELKAAHTNR
                     ILPWLRPDTKAQVTVEYVEDEGRMVPTRVHNVVITAQHTPGVPLEKLRQGILDKVVRK
                     SIPAKYLDDRTAYHIQPTGDVGVSPSGKFAGVTGRKIVVDTYGGWGAHGGGAFSGKDF
                     RQVDRSAAYMARWIAKSLVHHGLAHRCLIQLSYSIGIAEPLSIFIDTFKTSKFTSDQL
                     KEIIRKNFDLRPAAIAKDLNLIDPIYYQTAKNGHFTNEKFPWEQPLDLVL"
     exon            complement(795535..795855)
                     /number=1
     exon            complement(795930..796067)
                     /number=2
     exon            complement(796138..796417)
                     /number=3
     exon            complement(796481..796524)
                     /number=4
     exon            complement(796592..796963)
                     /number=5
     CDS             join(797880..797990,798049..798613,798650..800148)
                     /codon_start=1
                     /locus_tag="AO090701000300"
                     /note="carboxylesterase type B"
                     /old_locus_tag="AO070294000030"
                     /protein_id="BAE62030.1"
                     /transl_table=1
                     /translation="MHLTYLCVLIQCLLLSPVGSARNPKSPAFAVLVDNSLEPAVVQS
                     SPSYLLLREAHTQESAAAACNTLGESLASVKDVPFFEPLLSMHLRALDGEISYPMWLA
                     GNGETCTAYSLPNNHTFSVECTRRIRALCTNTAEYQTGLDPPSTSRHIFVKTSQGLIK
                     GFRDRLTARFQGIPYAKPPIGERRLKNPERLHSFPGRKKGSAYDATEFKALCPVRFPI
                     ESPTSTRNMTPNATPDLPNPNYPISEDCLYLNIYTPILPENESPDLLPVVVWIHGGSN
                     YFGGSSLPFYFGMNLATRRPLVVVSINYRLGALGFLSDLSKASDIGSNQAMRDQLMAL
                     DWVREHIKSFGGDPERVTIFGESSGGSAVMSLIQTNPEKGLFSQAIVQSGGTWSGWQR
                     PHVQADLTRMFLDLAGCNDLDCVKNNRTMGEILEYQGLLFSKAQEVFPRGEVNFIEPF
                     RPFIDHDLITEDWTAALEAGRYRKVPTLVTYTRDEFGLILKTNETLKDKPIDYSTAVE
                     FLATFLLGEERTRQVLDTPELGFNRSLIHMSDVTDPFIQLTTDLGYRCSSEIYAGFLD
                     RHNRDVWEVSWDIGLPQFIGGMICGNGTKRACHAAELPILFGSANYANISSSALASVN
                     YYQQARNTIDLYSNFVHDGEVWINATYYLRRNGNAVRNVLHWDDTPASTRGGVRWEIC
                     QKMDEMNLYDRLYYPYLPLGDRANTRDGYISLQYPMVAGPFD"
     exon            797880..797990
                     /number=1
     exon            798049..798613
                     /number=2
     exon            798650..800148
                     /number=3
     CDS             join(800697..800808,800878..801462,801580..802053,
                     802116..802289,803304..803356)
                     /codon_start=1
                     /locus_tag="AO090701000301"
                     /note="vesicular amine transporter"
                     /old_locus_tag="AO070294000031"
                     /protein_id="BAE62031.1"
                     /transl_table=1
                     /translation="MSSSPLLDNERRNTQWMGQLRSSNKFTLATMSMALFTDELLFSF
                     MVPLLPYIFEQRLKVPASRVQAYTSIFLTEGALVAIITSPLIGHVADRAKSKKALLLG
                     LLVLTLASVCGLAVTKSCTFYLPSVTYILTGQVIVAGIFIGRFFQCFTSNGLWIVGVA
                     TMVESVGSEHMGKIAGLTSTLTAAGTCAGPVLAGFLFGLGGYWPSWLGPAVFLVVDIL
                     MRVLLIDRPKAPQEMTENSRLLDAQPISVEEEQGWRFYTRLFRQPRFTTGIICYSVYA
                     LYIASFQTTIPLHSWETFKWGVFPVGLLLAAVQGPGMVLAPLIGYWKDRWGSRIPTAI
                     AFFSMAPFLVLSGAAGDERFSWFTGGNKGKIIYSCSLAMTGCLMSLLSGVGAMEATEA
                     VDKLEESHPGIFGKYGGYSRAVAITSMSWTMGLLLGPILAGFMAERFAYFELQCVLVL
                     GISHRLVGNIQQLKQ"
     exon            800697..800808
                     /number=1
     exon            800878..801462
                     /number=2
     exon            801580..802053
                     /number=3
     exon            802116..802289
                     /number=4
     exon            803304..803356
                     /number=5
     CDS             join(803577..804776,804838..805198,805254..805306,
                     805364..805547,805597..806475,806529..806668,
                     806731..806903,806961..807074,807139..808386,
                     808524..808578)
                     /codon_start=1
                     /locus_tag="AO090701000302"
                     /note="predicted protein"
                     /old_locus_tag="AO070294000032"
                     /protein_id="BAE62032.1"
                     /transl_table=1
                     /translation="MARDQEIVSLSSFGKDLLASGFFTSLDAPNFADNNVKGPPRRNL
                     EIAPEETFPPQPASPATWMGLSTLSAVTSAYADSPESPEQLIVGGAEVQNVSLVMVDE
                     HGTYNDLKVMPVPVSGAKSSGGSLLVAPVGESKQIAAQPMLLLPAKADSDLSFSDDSK
                     ALPMAELEKAMKESKGKVGVAAVDSYVLSGEIENFFGVKGVTGKLYCFRSDEEEGSKD
                     EEEKPIDEKVKLQDMESPLGIFFPEIENKTIKTLPLKNLEFTFSNTKKETLLPDGLRL
                     QGDLDLTDGLQWVSDGLKNVFGSDKATELPSKIRVSALLAKERDWTKKPKIEGIVLQA
                     FLHEMKLPAWDFLEFQTVGIELSARKEAAKKDIEDNPEKEQKEDTDKTKEEEEDGKSK
                     EIVAKKDKPSNAPTTKDHATEERRKKEEEGSKEEKRWKVGFGLFGKVNITKVPKSPVP
                     LEARYWIRMGDWKEEKKEEEEEDEVEGDDEDKELEKPDGGEGKETAEAGGENENDDAE
                     EDKPTERGKQYEVLIAVGEWKDFCAISNLDMKEAQLHAFFKPGEFRKSCTLSVTGSLE
                     FAQGCLDKKDGDEEEEEEKPKNATLTIEGVLSRQDYHFDAKVGDLKLDSILKMYAQIT
                     GAEPSKEAKEHDLVFEELHLNISRKLKSKEKAIEDKKDVKEKKEEEKEKEKEKEKEEE
                     KEEEKEEEKEEEKEEEGEEPSTCLELSGKVSFNDCKSVHGLIKIDTISGLTIQGGVED
                     YMIKDADVTIKEASIDIFIGAKPKQSKDTSRKTKPKLEADTKDGKEAGEGKVEVFNRE
                     SKFAIKGRVDFSGITVTVAFMTERKETNAKSKKSSEREWVLFGIYEGTLHLGKICDIM
                     EGPMADLELKNVALIAASGESKTIEALNTLKYPVRKGISLCATIPPLPELNNFAKQNV
                     DGLVLAATIQKQKLELDIQLPRAFDVTITDSVKLCEIGIGIEISKTPSLMVMGTLNIV
                     MDVDQDPLLLEGMVKAGLLSSSASIATKSPWVNPLNISKHVTIADFRVEIEITYATVM
                     ELGPSKLGLAGDIEVGDLTAGAAMQISHHPGEQVISANISEVDLVKIIRVAGQVAEIQ
                     VLQDIRGGEDTFVFTDANMYFSTGGTIAGREYPQGISAGGKLTAFGKTAQFDLTIGKA
                     GLDFQAYIDNFSLGPLVVSSASGDPRAKMVVLMTKDKQVIQVDGMVRCFGIGFATLVD
                     IQIGTETPSFDARIAVAFTDAFIISLQATVKDFKELKDIATKDLYFQAQIQGDLFDMI
                     CESIKSLLRTLEKLGTEGIESLQNLIGAQIAEKQAEMDQEKEKLDEARQKVDTRRQVR
                     QRDMKNEKDKRDKAKAEIERLRDNVTRAKQNKAQAENELKEKVEKLKLERESLIQRKR
                     KEYNDMLEKAKQDQANNQRELERLRQEQRDRYGTDFLRKVNIAKGAYYEKERILKQAW
                     ENVARLRREFNDANICRNSGQPNLLMRLQKLY"
     exon            803577..804776
                     /number=1
     exon            804838..805198
                     /number=2
     exon            805254..805306
                     /number=3
     exon            805364..805547
                     /number=4
     exon            805597..806475
                     /number=5
     exon            806529..806668
                     /number=6
     exon            806731..806903
                     /number=7
     exon            806961..807074
                     /number=8
     exon            807139..808386
                     /number=9
     exon            808524..808578
                     /number=10
     CDS             join(808797..809244,809364..809380)
                     /codon_start=1
                     /locus_tag="AO090701000303"
                     /note="predicted protein"
                     /old_locus_tag="AO070294000033"
                     /protein_id="BAE62033.1"
                     /transl_table=1
                     /translation="MQNENNKYQKAIREAQHILDQNAPDLEDQIAQADENIKSLEEDA
                     MLADLERKYNYQLEVHNKVHNTIQQMQAGLETLKENWQKGMHALEDVVNEIQKKINAI
                     FHIERIVVGIHTHALIDDKPLVFKFYGTVANRHFEIEAQWAPGNDLSRDRRD"
     exon            808797..809244
                     /number=1
     exon            809364..809380
                     /number=2
     CDS             join(811823..812062,812209..812274)
                     /codon_start=1
                     /locus_tag="AO090701000304"
                     /note="predicted protein"
                     /old_locus_tag="AO070294000034"
                     /protein_id="BAE62034.1"
                     /transl_table=1
                     /translation="MPYIMEIYTDGGCRRNGRSDAIGAAAVVFKNRFGKCTGWTRSLP
                     RYPPPTNQRAEITAIIFALEKALDKFERLDTNPYLEIERGRRRGVYLDSEGGESEGG"
     exon            811823..812062
                     /number=1
     exon            812209..812274
                     /number=2
     CDS             join(813391..813635,813679..814312)
                     /codon_start=1
                     /locus_tag="AO090701000305"
                     /note="predicted protein"
                     /old_locus_tag="AO070294000035"
                     /protein_id="BAE62035.1"
                     /transl_table=1
                     /translation="MALQLSRSPVYSLIILSILWIEGIAAGNFTFPTESESRFIVGDQ
                     VNITWDVLTPRISLYEECGTQQWIIARKRSYTERNCAPYVWSANRDVYKESGCYFELE
                     SLTSEGEPDGQDNATSVVFGVSKRYHDDPSPTSYHFASTSATSLTGTSTPATTSSSES
                     AGAVTVTGVSAANPSTEGSSGGLSSAAKIGIGLGIPLGFLLLAVGVGSFLFFRRRRRL
                     RESEPDVAEPVWHSQSTTPLPGGFVDGSNTAKNVRGSHTDTIISELSSENYRSRDERQ
                     THEVNELMGVERSELD"
     exon            813391..813635
                     /number=1
     exon            813679..814312
                     /number=2
     CDS             815224..816363
                     /codon_start=1
                     /locus_tag="AO090701000306"
                     /note="predicted protein"
                     /old_locus_tag="AO070294000036"
                     /protein_id="BAE62036.1"
                     /transl_table=1
                     /translation="MRYSYHFHQPPQAWEMDVSMLEDHPFFAHHHPPPYEDHFEMKHG
                     KCFKGKMHKGEKGMRGMGDDEFPEMPRCGFGGRGGRGGRHHGPYGHHHHHHPYAFGFA
                     GHHGRGKFHPHPHGHRHGHDSDNEHEFEHGFHPWTKHGRSGPGHHGRPGFHHPHHKHG
                     GPGPHFHSRGDFHRQGHGGPRHERGLGKKHGKGKGFHHFDNMHHMHHMRPFRRGHHHS
                     RDAASFTPLVDVFLTATQTIVHASLAGAQKTNLSVGYDASRSLLRIAGVVHRPDVDEE
                     MYRTFLVAERGYLLGVFKREVPLSHGVVVEGIQARLEDGVLKVILPRIEGEEVQHGNE
                     VEVEMVNAEKELSTPDESDTEGEEEEEHEDEGEEAEKEFVKVDIQ"
     exon            815224..816363
                     /number=1
     CDS             complement(join(817210..817556,817615..818865,
                     818930..819383))
                     /codon_start=1
                     /locus_tag="AO090701000307"
                     /note="copper amine oxidase"
                     /old_locus_tag="AO070294000037"
                     /protein_id="BAE62037.1"
                     /transl_table=1
                     /translation="MVLDRLQQLTLQVSASSPPPHPFDPLSTVEIDTAVALVREAHGK
                     VNFNAVTLWEPRKAEMMAWLADPQKAPRPMRAADVVAIAPGGKIYDGVVDLDQKKVIE
                     WKHTPGVQPLITMEDLQEVEHIVRQDPKVIEQCAIIGIPKEDMHKVYCDPWTIGYDER
                     FGTDVRLQQALMYYRPHVDDSQYTYPLDFCPIFNAETKQIIHIDVPPVRRPLSKAPPN
                     NYHPAAIEKEGGFRTDLKPIHITQPEGVSFTVNGRHIEWQNWNIHVGFNYREGIVLNN
                     ITFNDKGNVRPIFYRLSLGEMVVPYGNPEHPHQRKHAFDLGEYGGGYMTNSLSLGCDC
                     KGAIHYMDAAFVNRAGASTIVKNAICIHEEDAGILFKHTDFRDESIIVTRGRKLIISH
                     IFTAANYEYCVYWIFHQDGTVQLDIKLTGILNTYAMNPGEDTKGWGTEVYPGVNAHNH
                     QHLFCLRVDANIDGPNNTVFQVDAVRGEGEVGSAENKYGNAFYAKKTKFTTPLEAMSD
                     YDGFTGRTWEIANTNKLNAYSKKPVCYKLVSREVPPLLPKEGSLVWKRAGFARHAVHV
                     TKYSDDQIHPAGRHVPQTSGEPSQGLPAWIEEAGPNSSIENTDVVLWHTFGLTHFPAP
                     EDYPIMPAEPMTLLLRPRHFFTRNPVLDVPPSYARTPSQIAAGASSCSCKKNDGSSVL
                     V"
     exon            complement(817210..817556)
                     /number=1
     exon            complement(817615..818865)
                     /number=2
     exon            complement(818930..819383)
                     /number=3
     CDS             complement(join(820514..821488,821594..822082))
                     /codon_start=1
                     /locus_tag="AO090701000308"
                     /note="mRNA deadenylase subunit"
                     /old_locus_tag="AO070294000038"
                     /protein_id="BAE62038.1"
                     /transl_table=1
                     /translation="MPPPVGRYGPTGLSGPYTHLQQAHLQQQQQPQHHPAHAQSANTA
                     LPPPSLGGHPGFAAGNPNTNINPFTLSGTGIANGMSVAGFGGAADAGGTGLASHAAQM
                     GFARGAQMQQQQLHQTHDGRLALEAKAGAVKTRIRDVWKHNLAQEMAVLRQLVEKYPY
                     ISMDTEFPGIVARPIGAFTNKADYHYQTLRCNVDLLKMIQLGITLFSAEGEVPPPNAT
                     DANGQPLGNSLVPAPCTWQFNFRFSLEDDMYAQESTAMLAKAGIDFSMHDKNGIDPFE
                     FGALLISSGLVLLDDVHWVSFHSGYDFGYLMKIMLCKPLPENEEEFHKLLNIFFPSLY
                     DIKYLMKHAGRNQAVNDTPLTPAAAQILTNLGQKSGLQDIADELGVKRVGIAHQAGSD
                     SLVTGEIYWKMRQLVFNGSIDESKYSGQIWGLNGQMPALLYQMPHQTPNLNGATIYSA
                     AGTPSTPNAGTPQHQGLGTLTPGAVGGVLGQFQVGKA"
     exon            complement(820514..821488)
                     /number=1
     exon            complement(821594..822082)
                     /number=2
     CDS             complement(823236..824789)
                     /codon_start=1
                     /locus_tag="AO090701000310"
                     /note="angio-associated migratory cell protein (contains
                     WD40 repeats)"
                     /old_locus_tag="AO070294000040"
                     /protein_id="BAE62039.1"
                     /transl_table=1
                     /translation="MSSSQDPHHEAEDAYVEADEAEEIFQRDEDHPMDSDGEDGDEPM
                     TYEQEEITLENDSSAHFDLHSDSLFCIAQHPIHNSIVLTGSGDDTAYIFDSTPNTERP
                     LLPQSYESNPQPKKERESLQPIAKIEGHKDTVNAVAFTGPKGEYAVTAGLDGQLRVWR
                     DTTPQLTGQAWEFVAEAQEVEEINWIAVCPCEKGDEENSNVIAIGANDGSAWVFRIDH
                     NDTAQPITIMQTFFQHTGSCTAGAWTPDGKLLATVSEDGSFYVYDVFGAAAAAGISYS
                     AGTSAVVGLTPEDQRFAVDGGLYSVAIAPDGAFAAVGGAEGHIRIVGLPRLASGGAAA
                     SKAKGKGAASQSTGAAAGTILASLQAQSDGIETLSFSSPPLSLLAAGSVDGSIALFDT
                     AHRFALRRHIKEAHEGAVVKVEFLQGRSAPASLPPRGPIASAASGQGQPWLLTSVGMD
                     GIVRRWDARGGTAAAAQGLLKEWKGHLGLTENSEGEQAGGVMAFTQSLDGKRVVTAGD
                     DGISFVFEE"
     exon            complement(823236..824789)
                     /number=1
     CDS             complement(join(825486..825815,825878..826200,
                     826260..826422,826475..826747,826803..827183,
                     827240..827515))
                     /codon_start=1
                     /locus_tag="AO090701000311"
                     /note="acyl-CoA synthetase"
                     /old_locus_tag="AO070294000041"
                     /protein_id="BAE62040.1"
                     /transl_table=1
                     /translation="MVFTPQKGAGELPAIPDNIPISEFMLNDQYGRNPLQKSRDPFTC
                     GITGKSYSGAQVAERVDYLARALAKEFNWAPNQGTEWDKTLAVFSVNTIDTLPLSWAT
                     HQLGGIVSPANAAYSAPELKHQLVDSQAKALFTCAPLLSTALEAASLAGFPKDRIYLL
                     EVPAELTGGASIPAQYKTVSQLIEAGRSLPKLERLNWGPGDGARRTAFLCYSSGTSGL
                     PKGVMISHKNVIANVLQISAFEKTHRDALAAPGGPQHTEVVLGLLPQSHIYALVVMCH
                     TGPYRGDQVIVLPKFELKSYLASIQHFKIGSLFLVPPIIITMLRNHEVCKKYDLSSVK
                     SLFTGAAPLGMETAEDFQKMYPGVTVRQGYGLTETCTVVASTHPNDIFLGSSGTLIPG
                     VEARIVSPEGQEITSYDTPGELVVRSPSVVLGYLNNEKANKETFENGWMRTGDEAVFR
                     LSPKGTEHVFIVDRIKELIKVKGLQVAPAELEAHLLTHPAVADCAVIAIPDEAAGEVP
                     KAIVVKSASADKDDEKTIQSIKKYVEEYKARHKWLKGGIRFVEAVPKSPSGKILRRLL
                     RDQEKEERRRAGAKL"
     exon            complement(825486..825815)
                     /number=1
     exon            complement(825878..826200)
                     /number=2
     exon            complement(826260..826422)
                     /number=3
     exon            complement(826475..826747)
                     /number=4
     exon            complement(826803..827183)
                     /number=5
     exon            complement(827240..827515)
                     /number=6
     CDS             join(828666..828752,828802..828950,829014..829141,
                     829195..829930,830058..830070)
                     /codon_start=1
                     /locus_tag="AO090701000312"
                     /note="predicted protein"
                     /old_locus_tag="AO070294000042"
                     /protein_id="BAE62041.1"
                     /transl_table=1
                     /translation="MPAKRKRATAGAEVSLPSAVNGEPPAWANFRSELGDTLPWFRAV
                     QGGIYHKDGLAWGVLVDRDSGERSYIDEEVVITRIGGSCSKNANGDLVRVKDQAKKDL
                     LVKCLMNSMEQKVPVGVIIGEHNTVLGKMVPHPYNVMDYFRITNIWFECIGKRIAAKV
                     RYEKLDLQSKSWWADKGSLPPPPLQERDFASRPNSVECNACNNRSFQVFHQGWMCLQP
                     SCTRFFKIGALAAPANLTYHQKFLSYRMAPDPVIKPHHSLIPDLLSTFDEDDASVATS
                     RVAWKGIVCPQCRKCISRKFWRGWKCSDDSTSISTQPQHSCTFEKMTRMPVVSLRSVI
                     DTLEIAPQKRAFMPDDKFMTPEVDDNSLAPYRRDFL"
     exon            828666..828752
                     /number=1
     exon            828802..828950
                     /number=2
     exon            829014..829141
                     /number=3
     exon            829195..829930
                     /number=4
     exon            830058..830070
                     /number=5
     CDS             complement(join(830498..830526,831957..832745,
                     832825..833083))
                     /codon_start=1
                     /locus_tag="AO090701000313"
                     /note="predicted protein"
                     /old_locus_tag="AO070294000043"
                     /protein_id="BAE62042.1"
                     /transl_table=1
                     /translation="MSFIQLVHFFGLLTLAAGKPILIPRQASGAPQDGARNLIDVQLQ
                     SIGNSTIKAFITNIADENLRVVKRGGLLDNELPTKKVVVSGSGANPTFTGAEVDYVNT
                     HLNDDAFLELAPKQTIESIFDIADSHDLSPGQKYSAIADGMLEYTKLDNPKKFFVVPY
                     TSNAIDFDAPEDSANRLATRATLEACSGEYNKLMQDNLAQAAKMAEAAAADARDGSSG
                     LFQKFFKSQDEADKKEVAERLEAIAKEATSKGTLTYYCQPSAQDSCGGNIAAITYPTQ
                     NRVVNCQAYYETQQVVNECGYLDQAAISLHEFSHATSVYAPGTDDVVYGLDGVLQLST
                     AQAKNNADSFAYYANSVSNSCIYP"
     exon            complement(830498..830526)
                     /number=1
     exon            complement(831957..832745)
                     /number=2
     exon            complement(832825..833083)
                     /number=3
     CDS             join(836405..836437,836459..836510,836570..838407,
                     838464..838580)
                     /codon_start=1
                     /locus_tag="AO090701000314"
                     /note="predicted protein"
                     /old_locus_tag="AO070294000044"
                     /protein_id="BAE62043.1"
                     /transl_table=1
                     /translation="MQPSIAWGISGTHVRLPQSSPDSKDQPCVQWTNLDSEHDGFDIA
                     TIDRNIYITNSFASDRDQNGLTLIPPSAIEFANTFRQDLEEITGESWNLHPVEVWPEG
                     QTGIFLDRLDCSQDGLTYENGDPTEEGYKLQVQPGRVSILGSGARGMWWGTRTLLQRL
                     LIAHNSPIPSGQVVDAPSYSTRGFLLDAGRKWYSPSYLKDLCTYASFFKLSEFQYHTS
                     DNYPLSRGHNETWQDVYAQFSLRPESPELQGIVQRENETLSRADFEDLQQHCAQRGVT
                     VIPEIEAPGHSLFITKWKPELALESKDLLNLTHPDTIPLVKSIWTEFLPWFQTKEVHI
                     GADEYDATLADDYIDFVNDMAEFMDEQAGKTIRIWGTYEPSDTRNISKDVIIQHWQYG
                     QSDPVELAEQGYEVINSEDWWAYMSLKNDHMPIFPAPYPDFFNNSRVLNFADREGWQW
                     TPALFNPVNVTEQPDPKPVKGAILAAWNDNGPDATTELESYYAIRNGIPVVAARAWAG
                     NRGPIINVSTLSDSMDLLTSKAVAQNLDRQISHKSEDANELLSWTNPSENINRDKIHL
                     GYGSKGMNYELTLNVSGPFTLWSNDSTLALSPDGNLTFVSDGWEYPLRSIEETDGFDE
                     SYPGRIWTNETSSTHEPSGLGQRGIRRKIRSAGIWWQKPAIILEPDGVRGTTGVD"
     exon            836405..836437
                     /number=1
     exon            836459..836510
                     /number=2
     exon            836570..838407
                     /number=3
     exon            838464..838580
                     /number=4
     CDS             join(838931..839128,839177..839809,839882..840112)
                     /codon_start=1
                     /locus_tag="AO090701000315"
                     /note="predicted protein"
                     /old_locus_tag="AO070294000045"
                     /protein_id="BAE62044.1"
                     /transl_table=1
                     /translation="MYTFPLLLGILAATKDLALAKPTQKWGLREFNNLVTFGDSYTDD
                     TRASYFYAHNGSAPPVGWKQPESNSSASGGYVWGHYVAAATNATRHNYAVSGGACSNK
                     ITPRTMSGLNMSFPSVLEYEIPAFLADTQYVDSQGNKFLDIPADETVYAIWIGTNDLG
                     NYAFLTDSQVQGKVIPDYIECVYESLDRVYESGGRYFVLMNLAPLQLTPQYALLENGG
                     AKTVSWWPDKPSNQTLISYRMWEQVVNVNEVFRYRTPFEVLVADRYPGAGVAVMDMYG
                     LLSDIYYNPDDWFGDVGANVTGFVKHCNAEGEDCVRLQDEENFMWFDELHPSQTTDKF
                     IAEEFVKVVNGESQWATYW"
     exon            838931..839128
                     /number=1
     exon            839177..839809
                     /number=2
     exon            839882..840112
                     /number=3
     CDS             complement(join(844337..844959,845012..845159,
                     845206..845445))
                     /codon_start=1
                     /locus_tag="AO090701000316"
                     /note="PEP phosphonomutase and related enzymes"
                     /old_locus_tag="AO070294000046"
                     /protein_id="BAE62045.1"
                     /transl_table=1
                     /translation="MKVGDSSSSNLAITITVEKDGFYEVNGTRQEPTVSLYMTAGASK
                     LRRMLRETDDLIVCPGVYDGISARIAMGLGFKAMYMTGAGTTASRLGMADLGLAQLYD
                     MRTNAEMIANLDPFGPPLIADMDTGYGGPLMVSKSVQQYIQAGVAGFHIEDQIQNKRC
                     GHLAGKKVVDLEEYLTRIRAAKLTKDRLRSDIVLIARTDALQQHGYDECIRRLKAARD
                     LGADVGLLEGFTSKEMARQAVQDLAPWPLLLNMVENGAGPIITTKEAQEMGFRIMIFS
                     FACFAPAYLGIKAALERLKNEGVVGIPDGLGPKKLFEVCGLMDSMKIDTEAGGSGFTN
                     GV"
     exon            complement(844337..844959)
                     /number=1
     exon            complement(845012..845159)
                     /number=2
     exon            complement(845206..845445)
                     /number=3
     CDS             join(846939..847065,847197..847798)
                     /codon_start=1
                     /locus_tag="AO090701000317"
                     /note="predicted protein"
                     /old_locus_tag="AO070294000047"
                     /protein_id="BAE62046.1"
                     /transl_table=1
                     /translation="MYDSQRKERLTFFKAEVQPKHADVLLFACCLCSGLVDSTLYNGN
                     TIFVGLGASNQNPRPYGWARSLTSIGCFIIGSFIFARLNRLFGAKKRGTLILSFCLQV
                     IMLILTACLVQSGVISGLPLHNVNTAEPDWTQEVPIVLLSIQSAGQIVASRALGYNEI
                     PTVVITSLLCDLMSDPKLFLLRNEKRDRRVIAFVLTLVGAIAGGWITKGTGDIYAALW
                     IAAGIKLGIASAWMFWKEELDLST"
     exon            846939..847065
                     /number=1
     exon            847197..847798
                     /number=2
     CDS             join(849711..849756,849888..850338,850417..851122,
                     851181..851440,851775..851799)
                     /codon_start=1
                     /locus_tag="AO090701000318"
                     /note="aldehyde dehydrogenase"
                     /old_locus_tag="AO070294000048"
                     /protein_id="BAE62047.1"
                     /transl_table=1
                     /translation="MASITVTGAAGRQIQVPTGLFIHNEFVPSTTSQTLTVENPSTGE
                     SLGTISAASPEDVNKAVESATIGFNVWKNTSGPARAKLLLKLADLIERDADDFASLEA
                     VDAGVLYTDSKGMNIPQAVGNLRYYAGWADKIDGKTLAMEGGVAFTYREPLGVCGAIV
                     PWNAPLMITIWKLAPALAAGNSLIIKPSELSPLYAQKLALLIQEAGFPAGVVNIISGD
                     GASAGRALAEHMTVRKISFTGSSATGRQILKTAASTNLKRVNLELGGKGPSIVFDDCD
                     LDNAVLWTRIGITANNGQICAAGSRIYVQKTIYEKFLEAYKKMAEGSPSVIGNPLDPA
                     TTKGPIVSAAQHNKILSYIEQGKQCGARLLFGGEKVGDKGYFVENTAFADVSENATIM
                     KEEIFGPVASIAPFETEAEVIAKANDTLHGLSAAVFTNDISRAHRVTAALESGQVTVN
                     AWAMLSPNAPFGGVKESGFGRDMGEEALEGWTSVKSVNWTLDFLG"
     exon            849711..849756
                     /number=1
     exon            849888..850338
                     /number=2
     exon            850417..851122
                     /number=3
     exon            851181..851440
                     /number=4
     exon            851775..851799
                     /number=5
     CDS             complement(join(851801..851919,851974..853129,
                     854072..854320))
                     /codon_start=1
                     /locus_tag="AO090701000319"
                     /note="FAD/FMN-containing dehydrogenases"
                     /old_locus_tag="AO070294000049"
                     /protein_id="BAE62048.1"
                     /transl_table=1
                     /translation="MDRLKFIRYPQAAPGSQGVGPHKDSTGLFTFLSQDDTGGLQVLN
                     KNGEWIDAPPIEGSLVVNIQQGFEAITGGICTATTHRVIGVVVMPTETEDVRTALLWA
                     QEHNVDLAVKGGGHSVAGTSSSEGGLVIDLSRMNKVTADTEKKTLTVQGGAVWKDVDE
                     AGAEYGLAAVGGTVNHTGVGGLTLGGGYGWLSGQYGLTIDNLLAATVVLADGQVVTAS
                     ATENPDLFWGLRGAGYNFGVVVDFTFQAYEQKTPVYAGIIAFTPDKLESVVEQMNVLF
                     ENPDPRSGAMIIFAQPPGAPTIMVNVLVFYNGTNEEGSKRYAGFLALEPVVNMIEVIP
                     YSLLNSLQNPMATYGDRKSFKGLFYRTPMDAQFLRSMLDELNAKAQDHPDMIPAMLLE
                     CYDMRKTCSVPLDATAFANRSLTQNGLLNLRWTDSSKDAEYRAWAREIQAKFKAQFES
                     QLNGEETADVPQYINYAEPGDAVVNNIYGSNLERLKDVKAKYDPKNVFHKMHPVSRA"
     exon            complement(851801..851919)
                     /number=1
     exon            complement(851974..853129)
                     /number=2
     exon            complement(854072..854320)
                     /number=3
     CDS             join(856532..856633,856696..856922,856979..857064,
                     857120..857205,857271..857735)
                     /codon_start=1
                     /locus_tag="AO090701000321"
                     /note="pectate lyase"
                     /old_locus_tag="AO070294000051"
                     /protein_id="BAE62049.1"
                     /transl_table=1
                     /translation="MANFKLFLALAACLSGQALAAPTKTIGKRAAITDVAHGYASQNG
                     GTTGGAGGTTTTVSSYAQFTEAVSSDDAKIVIVDGTITETADQVKVGSNTSIIGKDAN
                     AILEGFGLLVKEKENVIIRNLGVKKVLADNGDAIGVQYSNNVWIDHCDVSSDRDHDKD
                     YYDGLIDLTHAADYVTVSNTFVHDHWKAMLFGHSDSNGDEDTGHLRITVNNNYLNNLN
                     SRGPSFRFGTGHLYNNYYLDVSDGINTRQGAQLLVEGNVWSGGKKPLYSTDDGYAVAR
                     DNDFGDGENTAPEGTLTSVPYEYDLLAASAVKDAVVGTAGQTLTF"
     exon            856532..856633
                     /number=1
     exon            856696..856922
                     /number=2
     exon            856979..857064
                     /number=3
     exon            857120..857205
                     /number=4
     exon            857271..857735
                     /number=5
     CDS             complement(join(858605..858821,858894..858956,
                     859020..859185,859249..859478,859524..859564,
                     859601..859892,859951..859961))
                     /codon_start=1
                     /locus_tag="AO090701000322"
                     /note="predicted protein"
                     /old_locus_tag="AO070294000052"
                     /protein_id="BAE62050.1"
                     /transl_table=1
                     /translation="MDLKLNAPSPLSLLPGTSSSSALASPASPVPSPSPKNSLPSSPT
                     FRSPSSNAMTSSPPPAAPSTSPPSPSATSTASASSTSSTKWAPKAAQTSKPSSSSPAT
                     KKGTDSVDTRAAGGQRTSTSYSGRSSSAAKKTKTKPPCTSKTAPPQPVTWSWAATACT
                     RRPAPTGYLRSIRPSIPASPSCRPSSTPRVSTTVIENTTRSSWRLSCSSMRPICPPVR
                     SKTDRTGSHNIGSRMPCTRRCRLASGSPESGRMHVGIRIGLCCSVMLHTLCPRATNPP
                     PTPSTTQSSSPASSPNTVTNPSPSPSKPTKTSVATPSTQPSRPPVACGRRTGTWDSSR
                     AGSKN"
     exon            complement(858605..858821)
                     /number=1
     exon            complement(858894..858956)
                     /number=2
     exon            complement(859020..859185)
                     /number=3
     exon            complement(859249..859478)
                     /number=4
     exon            complement(859524..859564)
                     /number=5
     exon            complement(859601..859892)
                     /number=6
     exon            complement(859951..859961)
                     /number=7
     CDS             complement(join(863621..864382,864436..864750,
                     864822..865144,865217..865455,865518..865795))
                     /codon_start=1
                     /locus_tag="AO090701000324"
                     /note="carboxylesterase type B"
                     /old_locus_tag="AO070294000054"
                     /protein_id="BAE62051.1"
                     /transl_table=1
                     /translation="MRGAWEYISTRGTLHSAINSPCFPPTFAYIQRFLSVIQSSSPDQ
                     SSMMRYLLTVSLALVATVGGNPSEPIVDLGYSSYRGYYNTTTGLNIWKGIRYAAPPIN
                     ELRWQPPVAPPRNSSHILPAVDQPPVCPQSGAAGTPTVYGFNSGPGDEDCLYLNVYAP
                     PRASDLPVFVWIHGGGYGLFGAVYDPSPLMNTNGNGFITVEIQYRLGAFGFLSSAEVR
                     ERGTNNAGLLDQRFALQWVQQHITKFGGNPRRVTIGGESAGAGASMLHALAYGGEESN
                     LFQNIIAASPYSVPIYPYDDPVPTGYYEEFVEKAGCGPSSIAKVRYNSSFDCLVAAPS
                     ETLQNASGLVSESGLFGTFAFLPVIDNDLIRERPSAQLLSGKVSGQRILVGNNANDGV
                     PLSNPNVVTRTAFDSYLSATFPNFTETDLAWLNLVHDTADSQPTDDSPRFDTLGTSGP
                     TAKNESEVATGLQQTVFNIFAESTFDCPAQWLAEAFGGPLRQAWKYQYSVTPAYHGAD
                     MNAYFPAGASWPSKGFNHAFQKIWGSFIINDSPIIPLQDATANQSHAIVPETPHGTLD
                     WPQFHPSAPWHMDLNTTGGTVSPVVVTPNYTYYIRQGDDIVNHFRLANAYTWEGGRGL
                     RCLFWRAVADRIPL"
     exon            complement(863621..864382)
                     /number=1
     exon            complement(864436..864750)
                     /number=2
     exon            complement(864822..865144)
                     /number=3
     exon            complement(865217..865455)
                     /number=4
     exon            complement(865518..865795)
                     /number=5
     CDS             complement(join(866371..866999,867061..867659,
                     867716..867837,867921..868169))
                     /codon_start=1
                     /locus_tag="AO090701000325"
                     /note="predicted protein"
                     /old_locus_tag="AO070294000055"
                     /protein_id="BAE62052.1"
                     /transl_table=1
                     /translation="MLLPASFSRHISSLRSLNRKWQRLVARRNRNNDGLSSRMLDVFL
                     RTWDLGFTSFGGPPVHFRILHERFVQGKGEKEKWVDEQTYQELFAICQGLPGPASTKM
                     IFCLTLLHAGFIPALLVFFIWSLPGAIGMYALSLGVQKIGDTLPLPVYALLSGLNSST
                     VGIIALAAVQLAEKAIRDRLTRILVIFGACAGLCHNSLWYFPLLMVLGGLASIIWDGW
                     MSQQIRKIKLAWRRRHTVHPTTETELATMESAPMEEGGRNPGSNQIDNTPESQRNPVR
                     SRNVGPRSESVRPSSADTPFHQDAEERPLPTHRIRIRVGILITVCFFASFIGLLVGRS
                     VSEQPPLALDLFTNMYLAGTIIFGGGPVVIPLLRSYVVAPGWVSSRDFLLGLAIIQAF
                     PGPNFNFAVYLGALALQNSQFPTIFGAFLGGLGIFFPGIALAVAVQSFWRTLRQRKWV
                     VDFLRGVNATAVGLVFTAVYRLWEIGYLTPEATNGQSLAKEPWWVVIAVLTYAESAWF
                     NVPSAAAIIVGAVLGLCWYGVVGY"
     exon            complement(866371..866999)
                     /number=1
     exon            complement(867061..867659)
                     /number=2
     exon            complement(867716..867837)
                     /number=3
     exon            complement(867921..868169)
                     /number=4
     CDS             complement(join(868951..869013,869079..869134,
                     869200..869394,869451..869610))
                     /codon_start=1
                     /locus_tag="AO090701000326"
                     /note="predicted protein"
                     /old_locus_tag="AO070294000056"
                     /protein_id="BAE62053.1"
                     /transl_table=1
                     /translation="MNIATTCNSWSIEHHRLEEERRWVTDLHCKAKKDNGEWISTQLR
                     LDDILGNDDGNFKYSLRYPERNISSSMSNPRLEVTGDGRPILHGRLTTRDAYGHDRSL
                     DLSKILWNKDGRLSLNEDVVRAEDDRRREEARQKMLEKARRNPKLMERLRRQGKL"
     exon            complement(868951..869013)
                     /number=1
     exon            complement(869079..869134)
                     /number=2
     exon            complement(869200..869394)
                     /number=3
     exon            complement(869451..869610)
                     /number=4
     CDS             complement(join(872928..873654,873701..873852))
                     /codon_start=1
                     /locus_tag="AO090701000327"
                     /note="predicted hydrolase of the alpha/beta superfamily"
                     /old_locus_tag="AO070294000057"
                     /protein_id="BAE62054.1"
                     /transl_table=1
                     /translation="MGDKVAAITLPNSEQFYLDGEQGESYLIQVSWPLHWQGHDPPVG
                     NEQLPIIYIVDGNALFLTATEAAWRRAASSHFAGGGIVVAIGYPLTRKLYDARRRSLD
                     LTPPTQAQIPGYGGADLCLDFIDKAVRPAIKERFPKLSFSREALYGHSYGGLFALHAL
                     FTRPQSFDCYIASSPSIWWNSRCILHEAKSFLDKAKEADEQTPSLMVFFGSHEQSPPQ
                     WNNEPLDHYEARKQIASDLRMGDNARDLVEMVRRSERLHTVVVNEYEGEEHTSVMACS
                     MSRGLTAFFEDWPLPN"
     exon            complement(872928..873654)
                     /number=1
     exon            complement(873701..873852)
                     /number=2
     CDS             join(875817..876735,876796..879788)
                     /codon_start=1
                     /locus_tag="AO090701000328"
                     /note="multidrug/pheromone exporter, ABC superfamily"
                     /old_locus_tag="AO070294000058"
                     /protein_id="BAE62055.1"
                     /transl_table=1
                     /translation="MRRATSFGRLLVYGNPSSSDLALLLVGFITSIASGIPFPIMSIV
                     FGQLVDGLNSSTCNVTPSNADSYQAGINDKILLIVYIGIAYFALIYIYVLCWNLSGER
                     LAQRLREKYFSAILRQDAAFFDNLPAGEVSSRITGEIAVIQQGSSEKVGIVINSIAFF
                     ITAYIVAFIKDPKLAGMLVSLTPAYLIMSIGGGYFVQKFFGRALEGMAKASSVALEAF
                     SNTMVVQAFSANARLEEKFVEVLHPALSAGVWKSIAAATQAGLLYFIAFSANGLAFWQ
                     GSRQIADAVESGGDGITVGNTFTVILILVDASLILSQAAPFLQSFDAAAVAFGKLEAD
                     IDHPTTIDGTTEDTGRVLPEVTGNVELRNVSFKFPSRPDKPVLQDLSLSCPAGQQTAI
                     VGLSGSGKSTVAGLITRFYNVDEGAVLLDGHDVKDLNVRSVRSHISLVQQEPCLLDRS
                     ILENIALGLINSPRHDHLHSILMGSVLADVAAAVRDGKDLVLASLEHGDGAREIVELV
                     LHAALLADANGFIERLKEGFGTQVGSKGNLISGGQKQRISLARALVKDPRILILDEAT
                     ASLDSATEARIQEALDNVAIGRTVITIAHRLSTIRNADNIIVMRQGKLVEQGTHQQLL
                     EANGAYAELVRLQNLNVHGGQDDEETEVSSARSGSLVPIVSEKTGALETSVTDAIDEE
                     KTKPAKTAEPESAIEEKRSFGSTVGSMGSLFRPYTFVLILAIAGAVIIGGTYCGSSVI
                     FGNVVGKLSGCEEPDSIRHAGELFGLMFFVLAIVEFLANFLSWSLFGWVAEQVIYKVR
                     ILSLRSILEQDLAWHESANRNPSLLLSFITKDSSALGGLTGSVVCTILSVLVSLVATI
                     TMTHIIAWKIALVCLSVIPLLLGAGYMRVTTLASFEERHLEAFANSVGITVEAVNSIK
                     TIMSLSLEHEVLGTYRRSLSAPMRQITRQSAWANLWLAVGYGLSNFLYALAYWWGSKR
                     IIAGEYTQTQFFIVQLALLVSSQLWGQMFALAPDVSRAFQATRRLLNLLDLGSTKKLS
                     APLQLLGDVEATAPPREKRSSSESRDGISVVFKQVRFSYPARPDTRVLHGLDLSVQPG
                     QFAALVGPSGAGKSTIISLVERLYGPDSGTIEVDGHNIAYSDGSFRDDIAYVPQQSVL
                     FEGTIRFNLTLGARPGQTVSQSELEEACKLANIHDTIMQLPDGYDAYCGPNGDRLSGG
                     QKQRLAIARALIRKPKLLLLDESTSALDAESERLLQDGLEKATKHMTVIAIAHRLYTI
                     RKADVIFLIEDGRCVDRGTHAQLIERSESYRVNALNQAVDG"
     exon            875817..876735
                     /number=1
     exon            876796..879788
                     /number=2
     CDS             complement(join(880450..881381,881444..881786,
                     881851..882121,882188..882459))
                     /codon_start=1
                     /locus_tag="AO090701000329"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070294000059"
                     /protein_id="BAE62056.1"
                     /transl_table=1
                     /translation="MAIGDRFQNLVGRQTPNDTHEAPTVEDIETPVTINAAPYDKEAG
                     TGSPENKTASSDDNISLPHEDAQRGVKDIEAVTLAWSKATLATFLILIWIYTLANGFR
                     SSILASLTPYATSDFQSHSLLTVIEIVASAMTSAVYIPMAKMLDVWGRAEGFLLMLGF
                     ATLGLILMAASNNLPTFCAAQVFQSVGLGGMTYSVNVLSADVTNLRNRGLAFAFVSSP
                     WMITAFAGSKAAEEFLVHVNWRWGFGSFAIIIPAVAMPLYVVLKVNLRKAKQKGLVNH
                     ERSGRTLVQNIIHYLIQFDLPGVILFAAGLTVFLLPFTLARSAPEGWKTDYIIAMIVV
                     GFVVLLLFAAYQVYLAPVPFLKHTYLLNRTVLGACLLDFVYQMSYYCWNSYFTSFLQV
                     VNNLTVAEAGYVNSTFQVVSGVLLFIVGYLIRKTGYFRWLLLIGVPLYIFAQGLMIHF
                     RQPNGYIGYIVMCEIFISVGGSVFTLCMQLAVLAAVDHQHVAAAMAILFVSGGIGGAV
                     GNAISGAIWTNTFESSLARYLPESALPSLASIYASLPVQLSYAVNSPERIAIQKAYGY
                     SQTRMLAAGTGLMALAFVAVFMIRNLNLKNTTQTKGVVF"
     exon            complement(880450..881381)
                     /number=1
     exon            complement(881444..881786)
                     /number=2
     exon            complement(881851..882121)
                     /number=3
     exon            complement(882188..882459)
                     /number=4
     CDS             complement(883700..884281)
                     /codon_start=1
                     /locus_tag="AO090701000330"
                     /note="predicted protein"
                     /old_locus_tag="AO070294000060"
                     /protein_id="BAE62057.1"
                     /transl_table=1
                     /translation="MTQAILRTERLELVPLGPEHSEFTKMLDKDPQVMKYIGFGKPLD
                     DEQAKEVHKWLLHAATLVPGFGCWVGFAGGEFVGWWVLAPCPSEGTPAQFRSDRSEFG
                     YRLLPKFWRQGYAKEGSRELLRHAFQDLGLSEVFGETMAVNVASRAVMAACGLKHAYT
                     FHNKYDTPPPGIEEGEVRYQITKDEWVSLVPVQ"
     exon            complement(883700..884281)
                     /number=1
     CDS             complement(891779..892792)
                     /codon_start=1
                     /locus_tag="AO090701000333"
                     /note="predicted protein"
                     /old_locus_tag="AO070294000063"
                     /protein_id="BAE62058.1"
                     /transl_table=1
                     /translation="MEAISLNSSDMSRFSDFTILTTTYKTVHGHEITTDILYPKALTP
                     RFEKTQDTVTCPILLRYHGGGLIAGYSLFAPFFNPWYLELSKEYSAVIVSPNYRLLPE
                     ATIFEILEDVEDHWNWMHKSLPQFLSKHTYGTIQPDLDRILTAGDSAGGYLSIQMGLS
                     HPEQIRAVNAVYPLVDIKSPYFTNQMEKVVFSTPVLPQDTLARHIRKFREREEATNQK
                     VVVSAPTDAERTQLMFSVCQHGLFGQFFPGDAVELYPLERLDAGARFPRGGVLVLHGR
                     DDSVVPVEGSYMLKNKIDELDSSLRFRLVVRDGEHGFDHSAKLHDAWLWEAAQDVIHS
                     WLV"
     exon            complement(891779..892792)
                     /number=1
     CDS             complement(893472..895028)
                     /codon_start=1
                     /locus_tag="AO090701000334"
                     /note="ATPase related to the helicase subunit of the
                     Holliday junction resolvase"
                     /old_locus_tag="AO070294000064"
                     /protein_id="BAE62059.1"
                     /transl_table=1
                     /translation="MVECPICQKTVLLSEINRHLDSGCEAFCENVSSSSLLSSGPNPG
                     CDRPLEVTSNSAVDDEERPDRIHHTIPIARPLVTESTKRVFDQQQSCEEEKRDTRTEH
                     TRKRLKPDNAPLAERVRPGSFDDIVGQNHLIGPNGTIRQFVHEDKIPNMIFWGSSGTG
                     KTTIARIIGDVSRRRFYEIGSTITTVTEYKNIIEKAFKDPDKGLRPSIVFCDEIHRIT
                     KPQQDILLDAIKTGRIVLIGATTENPSLTIRHGLVYKCAVYTLTKPKDADVRKMLHRV
                     VEEQGLHSHLLDDELLEYLSNFADGDCRLSLNLLEIACDLSKRDGMTGERLRNSLTMH
                     LNYDRSGDQHYDTISAFHKSIRGSDADAALYYLARMLKSGENPLFIARRLVVATSEDI
                     GLADNVLQTYATSVYSVLEKLDIQDAQASLAQLVIMMCLSKKSTRSYRGLNNAFACLK
                     EPGAANAPIPYQLLPISPKTKTMVEEFTTPHVFSKGKETNFLPECLKGRKFLEDTDFL
                     FKRDPDLTYR"
     exon            complement(893472..895028)
                     /number=1
     CDS             join(895578..896478,896540..897027)
                     /codon_start=1
                     /locus_tag="AO090701000335"
                     /note="FAD/FMN-containing dehydrogenases"
                     /old_locus_tag="AO070294000065"
                     /protein_id="BAE62060.1"
                     /transl_table=1
                     /translation="MDQHQAPVIQELSRLIPSLPVYTVSNPQFEHYRMTYNRALTHQP
                     LAIVRPQTEEEVSQVVQACSNQRIPLAIRSGGHDFFGRSLVAGGIVIDMRAMDSIIIS
                     PDRTSARVGGGVIAGTLQQYLAAHQLFTPTGQSKTVGYVSWACGGGYGFYVGTYGFGV
                     DQILGARVVLASGAIIDTDDDQELLWALRGAGAGNFGVIVELRVKVYPAPKLYAGYLA
                     FPLHEAATVLEEFETVVAHGLPDEFSGDGIVAHPDMLQGVVSEPCFTFFWCWTAVDGD
                     LEPARIFLRRMMGLGTVLANTVEETTAAAYGVGDSASATFFCSRNIRGLNPEIGAIFS
                     GHPPIQPLSAVIIHNNHGKGVRKEIPNGFSACFPNRFPHVILGLHGGTHSNAEVGSDT
                     ITEASSWAKQLRREIEERELALDGGFPSFFPPEQIDVEQFFGVQATDRLRRLKGRLDA
                     DNVFSGGMVKCL"
     exon            895578..896478
                     /number=1
     exon            896540..897027
                     /number=2
     CDS             complement(join(898865..899485,899568..899968,
                     900026..900236,900288..900536))
                     /codon_start=1
                     /locus_tag="AO090701000336"
                     /note="predicted protein"
                     /old_locus_tag="AO070294000066"
                     /protein_id="BAE62061.1"
                     /transl_table=1
                     /translation="MVMRSLKFWASSLLCATLLRECHAQQSDANIGSELGGKLSSGAS
                     IYFPGSDLFNNATARWSQWGKPNISVVVEVANKWDVAETVKYATKHDVPFIAINGGHG
                     NIETLENVHQGIEIWMHKLNTVDISDDTATFGGGILSHQVIESLWAAGKQTVTGVCDC
                     TGFLGPALGGGHGYLQGRHGLIADNFVSLEVVTADGKIRTVTRDGPESDLFWAMQGAG
                     HNFGIVTSVTQKIYDVPNNGVWSFVKHTYTQDKLELLFQYLNILGWNGQRVDVMYWAT
                     ISRDAEIDPVNEGVETLDATVSRSLLNFAPEKTVTHSGPYVDISKWTEFNIGSRACDK
                     GDEGPQIVRFPLNLKTYNLEALRRAFNAFAEETVAHPDFEHSTIMLEGYSNQGVQAVD
                     PASTAYAHREDTILVSSVIIFEKETDRPAAEAFGDRIRDILHEGSGEPEKHVYVNYAS
                     GDEPLESMYGYEPWRQSKLSALKRKYDPENRFGFYAPIPAADW"
     exon            complement(898865..899485)
                     /number=1
     exon            complement(899568..899968)
                     /number=2
     exon            complement(900026..900236)
                     /number=3
     exon            complement(900288..900536)
                     /number=4
     CDS             complement(join(901512..903432,903502..903779))
                     /codon_start=1
                     /locus_tag="AO090701000337"
                     /note="ankyrin"
                     /old_locus_tag="AO070294000067"
                     /protein_id="BAE62062.1"
                     /transl_table=1
                     /translation="MSFFGTIHGCQYFLNNLASHLDCCLIPRKQRSFAPNISQIPNLI
                     LPVTVRLKKNATMRSDYSAQDLDAILELAATVQKQYTDVPDQYKAILHDAKRLSDQLC
                     ETEDEDTGDSAEDQEKQRLDDIHKRCRDLLHELDAYLGQLDTTRTPSPQDEGGSVDLK
                     TTTGETVLLAAKQGFREIVRFLLEQGVPIDPKDRAGRTPLHHAVAKDHKEVVKVILEA
                     GGDIETTDLADHIPPMFAAPHGNDKENRSCHTPLITAIEADNEEMVKLLLEAGADPDH
                     YTDYYTPLTSAARNHNMGIFTLLIDKVSNLDHQDEGGDTPLIHAAKWHNGLAELLVER
                     GARLDVENRYGETAMSIASQRANKHLLTLLLERIPGQEYINAKGQGLLHFAAESDLGG
                     GDEAMVRFLLAREGLTRDQKVADAQSGLHGAAWRGYTTILKILLEIDGVDVDGKDANG
                     YTALWLAVRMGREDAIELLLDTYGANPEIHNGHMEWTAIHAAIIHNEPSTARMLLARG
                     VNPNSRDRHGRTPLSGAVNIEWDICHDGIGSTMVPLLLETNGVDVNSQDNLGRTPLFW
                     ALLSAIYLVHSPEKVEMYEAGVQLLLEQGARVDIRDESGRTPIFYAAMVKRAALVQMF
                     LAKGAEPDCIDADGRTPLSYAVEPFNVVWLVEYKGESEDEWDPAWSGDQLSKVVKALL
                     AQGADPNRRDVKGLTPLSRAEKRLEEGNEVLILLRKASARGSGLWFKSRF"
     exon            complement(901512..903432)
                     /number=1
     exon            complement(903502..903779)
                     /number=2
     tRNA            complement(904025..904128)
                     /locus_tag="AO090701t00005"
                     /note="tRNAscan-SE"
                     /product="tRNA-Cys"
     CDS             complement(join(905093..905187,905245..905418,
                     905484..905981,906044..906328,906410..906655,
                     906723..906819))
                     /codon_start=1
                     /locus_tag="AO090701000338"
                     /note="vesicular amine transporter"
                     /old_locus_tag="AO070294000068"
                     /protein_id="BAE62063.1"
                     /transl_table=1
                     /translation="MQFTTSRGSVWGHKWRSSSLFIVSAMAMALFTDVFLSTFIVPIL
                     PYILESRLGLDVSLTQRMSFALLALSAVTSLICSPFIGHYADQMSSKKIMLLGSLATA
                     LFSTIILAMATSTFTLFFGRFIQAVASAFIWTVGYATIADNVKQDNLGKTYGVISLVV
                     AVGTSGGPMAAGILFEIGGYWLAWSSAFAIIVVDIVLRVLMIERPRTQPGTPRGDDQD
                     PENDPLLPDNISIVEEKTGWHFYTYLFRHRQFVCGAMSYFVFAVLISSFDTTIPLHVR
                     DVFDWGSMMSGLLFAALQGPGIIMSPLCGWLKDRYGTRYPTAAGFAILTPIMWVLGMP
                     GDDRFPGVNGGNTGQIVYAVCVTAVGTFSCLLNGAGSIEATVTVDEIEARHPGIFGPN
                     GGYSRALSLASMSWTSGAFIGPILSGYLTEKVGYYEMNCVIAVLCALSTVNALWNLKS
                     KTPADGQGQPDDRK"
     exon            complement(905093..905187)
                     /number=1
     exon            complement(905245..905418)
                     /number=2
     exon            complement(905484..905981)
                     /number=3
     exon            complement(906044..906328)
                     /number=4
     exon            complement(906410..906655)
                     /number=5
     exon            complement(906723..906819)
                     /number=6
     CDS             join(908928..909287,909320..909337)
                     /codon_start=1
                     /locus_tag="AO090701000339"
                     /note="predicted protein"
                     /old_locus_tag="AO070294000069"
                     /protein_id="BAE62064.1"
                     /transl_table=1
                     /translation="MPTDQGEIKYIAVLGATGNQGGGVVRALLAKTEPSFHVRAITRD
                     VSSPAAQRLQAKYKDSGRLEFVAADVYNKQSLIEAFQNVYGVFAVTNNRIAGKKIEKE
                     QDMDHELVAGRNIIDAAKSQHNE"
     exon            908928..909287
                     /number=1
     exon            909320..909337
                     /number=2
     CDS             join(909410..909539,909587..909634,909696..909788,
                     909844..910189,910245..910342,910424..910494)
                     /codon_start=1
                     /locus_tag="AO090701000340"
                     /note="predicted protein"
                     /old_locus_tag="AO070294000070"
                     /protein_id="BAE62065.1"
                     /transl_table=1
                     /translation="MSSLPNITNASKGRFTKVFHFDNKHKIEQRARDELLAVTALHPG
                     LFYTNMQWSQYCQRQDDGTVRFCAPIDGNKLADWVDPSYDIGVYAAEIFSLGPEKTAA
                     KTYPVVGPKLSFADFARVFREITSQEATFDPITLDQWGATVAATVGKGYEEDIKQMME
                     WIAVAPDDKICYGTRDQTEDTSYEDLGVKASTLADWMRRTAWQGPQTGPNGGRWFGLS
                     LPDRKSTKEKGVAKPDPTRIYLMGDPCTSPSIRSSPNGFVRTR"
     exon            909410..909539
                     /number=1
     exon            909587..909634
                     /number=2
     exon            909696..909788
                     /number=3
     exon            909844..910189
                     /number=4
     exon            910245..910342
                     /number=5
     exon            910424..910494
                     /number=6
     CDS             join(910549..910589,910697..910811,910850..911022,
                     911099..911141)
                     /codon_start=1
                     /locus_tag="AO090701000341"
                     /note="predicted protein"
                     /old_locus_tag="AO070294000071"
                     /protein_id="BAE62066.1"
                     /transl_table=1
                     /translation="MDRLLSVPERTRSSLFLASRRACLQASVLATAGFVKGGDEVDGK
                     LTNLPSTAITVQGIKKIAHVSFNPGSKVPDSRLHVFPWRPGPDAGKDIGTSGSYDTLV
                     FIVFLEKLPPIQSVKSAAITT"
     exon            910549..910589
                     /number=1
     exon            910697..910811
                     /number=2
     exon            910850..911022
                     /number=3
     exon            911099..911141
                     /number=4
     CDS             complement(join(911538..911890,911960..912575))
                     /codon_start=1
                     /locus_tag="AO090701000342"
                     /note="protocatechuate 3,4-dioxygenase beta subunit"
                     /old_locus_tag="AO070294000072"
                     /protein_id="BAE62067.1"
                     /transl_table=1
                     /translation="MRYFFPFAVAIMAFSASAHLGPHDARSNAEMAHKAELSSRCAQH
                     VAQFNDKRWKRSLGHPGNTTVKIHTQAPYYDVLQNDTCVLSPEVTAGPYYWPRSQILR
                     QDMTEGQVGVPLWLDIGVMNMATCSPLEGVMVDLWHCNATGSYSSFTELSPNTKFPAL
                     LAEQGKNASDFVVGSTDIHTDSETWLRGMWPTDDHGMMQMKTIFPGFYVERTIHIHVQ
                     VHTDWTTGENGTLVFENTVSTGQLYFDEKLEEKIMAMEPYSSHTQINRTRNDVDMEFS
                     KGTANGYNPVVSVVPVDENDLTKGLIGYITIGVDTSAIEDEHWSAS"
     exon            complement(911538..911890)
                     /number=1
     exon            complement(911960..912575)
                     /number=2
     CDS             complement(join(924597..924993,925470..925540))
                     /codon_start=1
                     /locus_tag="AO090701000343"
                     /note="predicted protein"
                     /old_locus_tag="AO070294000073"
                     /protein_id="BAE62068.1"
                     /transl_table=1
                     /translation="MAGRVLDRTQLVHLIEKPTSSCIALAAMAPIHERIREDLLIKER
                     SLWTALTSADPGPEIEKLSNSEANFLFPKTPILTLDGEPSLQQTLKPPFHHFDSFELK
                     DVRVIIIDLMAGTVTYNINASKGKEQYRATGSTTWSQASDGEWRVVAHTETLL"
     exon            complement(924597..924993)
                     /number=1
     exon            complement(925470..925540)
                     /number=2
     CDS             join(927111..927248,927304..928371)
                     /codon_start=1
                     /locus_tag="AO090701000344"
                     /note="purine nucleoside permease"
                     /old_locus_tag="AO070294000074"
                     /protein_id="BAE62069.1"
                     /transl_table=1
                     /translation="MQLLNTITTGLLLSSSCLAAASPATWQRSVSQAPKKAAPKVFIV
                     SMFEPEAAAWWGIPEFDLLAHNITIPGASPIFPDVHCTADYSVCQLITGEGEINAAIT
                     VSSIALHPFFDLTHTYFLVAGIAGVNPKVATIGSATFARYAIQVALQYEIDLRELPDN
                     FTTSYFPQGAYAPDQYPTSIYGTEVFEVNADLRDLAASFAKKANLSDSESAKEYRSKY
                     TAEGYEAATKAPAVVKCDVATTDVYYSGKLLSEAFDNTTEVWTNGTGKYCASAQEDNA
                     TLQALLRTSARNLTDFSRIIIMRTASNFDQPHSDESALQHLRYVDAGGFEPSIKNLYN
                     AGIEVVTGILNGWNTTFKAGVKPSNYVGDIFGTLGGTPDFGPGRQQALADAGAITKRG
                     LLRRGLMLA"
     exon            927111..927248
                     /number=1
     exon            927304..928371
                     /number=2
     CDS             complement(join(937399..937987,938037..938147,
                     938202..938638,938687..938878))
                     /codon_start=1
                     /locus_tag="AO090701000345"
                     /note="lysophospholipase L1 and related esterases"
                     /old_locus_tag="AO070294000075"
                     /protein_id="BAE62070.1"
                     /transl_table=1
                     /translation="MLLRVFVRIFSLLLLARIAWSYPLSSSIGQRNNVLFRNSDTHWV
                     SIWTAMPQLTEPANLPPPPYNSSTYIFQNTTIRQTIRVTQPGHEIRLRLSNAFGLEDL
                     SVTKVAVSLPVDQKLGTSAIQSNTTKDVLFSGSADIVIPNGGLVVSDPIAFPVKAQDT
                     LTIDIYLEQGQGGGAITSHPGSRTTSWMSLGDWVGKRNLTDSSVESVDHWYFISAIEA
                     HLPSTSRSCAIIGDSITDGRGSDTNKNNRWPDLLLTRMQQTPTTNSIALLNQAAGGNR
                     ILADGLGPNVISRIDRDALAQSGVRYAIIFEGVNDIGVADADPEVQKKIGDRLIVAYQ
                     QIVTRLHAASIPVFGATITPFGAPANASDVQPYSNPVREDTRQRINEWIRTSGVFDAV
                     LDFDQVLRDPEAPAQLADEYDSGDYLHPNVAGYQALADYFPMDLFEEYRS"
     exon            complement(937399..937987)
                     /number=1
     exon            complement(938037..938147)
                     /number=2
     exon            complement(938202..938638)
                     /number=3
     exon            complement(938687..938878)
                     /number=4
     CDS             join(939513..939869,939924..940475)
                     /codon_start=1
                     /locus_tag="AO090701000346"
                     /note="dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /old_locus_tag="AO070294000076"
                     /protein_id="BAE62071.1"
                     /transl_table=1
                     /translation="MSIFQAQKTALITGAASGIGFATAKLCRSRGMHLALLDIDAANL
                     HKAKDELAATDPSLKTESYEIDVGDKNRWSEVANSIKSAFSGVDLVFLNAARPQRAQS
                     QYEGKLKPWADVESWKKTFDTNVFGPLNGIEAILSLLLSTNTPKSVVITGSKQGITNP
                     PGGGAPAYNASKAAIKNLTEHLAHDLRSDPATAHISAHLFVPGWTWTGLMGNVGPTQE
                     ENVKKMAGAWFPSQAAEVLVDGVEKGSFYIICPDGETDWPLDQARMQWASDDVVEGRP
                     ALSRWEASWKERAEAGIRADAEQRRK"
     exon            939513..939869
                     /number=1
     exon            939924..940475
                     /number=2
     CDS             join(941199..941421,941468..941530,941576..942834)
                     /codon_start=1
                     /locus_tag="AO090701000347"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070294000077"
                     /protein_id="BAE62072.1"
                     /transl_table=1
                     /translation="MASKSVSPSDLERHDTFKSAGRNASLDDNDTNKLGAYASAPGVV
                     EDVVRVVDHKAERALCRRFDLRLLPILAVMYLFNALDKGNLGNAETDGMSDDLNFKPN
                     QYNLLLSIFFVPYVIFAPPFAMLGKRFSPARVLPILMFSFGSFTLLSSATKNFGGMFA
                     LRWFLGMSEAAFFPLVIYYLTTFYRRGELARRLAIFYAASNIANAFSGLIAFGVFQIK
                     HSSIPNWRYLFIIEGGVTVLFSIFAFWYLPRSAAEAKFLSDEEKALALHRIQVDSSAV
                     VNEEFRFREALGIFKHPSTYVWLCIEICLGVPIQGVALFLPQIVQRLGYSTVKTNLYT
                     VAPNVTGAVMLLILAFCSDAVRLRSPFIVLGFLLTFAGFMIYASIDDVQAQIRVAYFA
                     TFMMTWGTSAPSVLLSTWYNNNIAHEGRRVLLTSIGVPLANLMGLVSSNVFRSQDKPK
                     YIPALITVGAFGATGAALAGCLGIYMWLDNKRRDRRDGVTVRAQDVPTERLRDGPASP
                     EFRWFL"
     exon            941199..941421
                     /number=1
     exon            941468..941530
                     /number=2
     exon            941576..942834
                     /number=3
     CDS             948563..948985
                     /codon_start=1
                     /locus_tag="AO090701000349"
                     /note="predicted protein"
                     /old_locus_tag="AO070294000080"
                     /protein_id="BAE62073.1"
                     /transl_table=1
                     /translation="MPTLHTALAPLLPSKQNSFLSVRVDGVFNQVAFRVMPAPLREKQ
                     PLFDLSRRQQLQSAHNVRGLLFGFWSPGCSNGFNVAGFHLHFISDDRTAGGHVTGFEA
                     WDVKLSAGVLKDYVVELPQDEDFLEVPIRSYEEDQNLS"
     exon            948563..948985
                     /number=1
     CDS             join(949507..949648,949707..950153,950239..950708)
                     /codon_start=1
                     /locus_tag="AO090701000350"
                     /note="NADPH:quinone reductase and related Zn-dependent
                     oxidoreductases"
                     /old_locus_tag="AO070294000081"
                     /protein_id="BAE62074.1"
                     /transl_table=1
                     /translation="MASIKQWTTPLKGVESLKLTEAPKPAPGKGEVLVEIHAVSLNYR
                     DIEVTNGEYTHHKSVGQEDRIVPCSDMCGVITQVGDGVSAWKVGDRVLSTFLPDHQTG
                     QVTEKELLRGMGLPLDGVLAEYRVFPEHALVKAPSYMSDEQAATLPIAVVTAWMSING
                     MRPMGQNGGHGEYILLQGTGGVAIAGLQIGKASGAKVIITSSSDSKLAQAKELGADYT
                     INYRTHPNWEEEVMRLTNNHGADIILEVGGAQTLKKSFDSIAFGGLINCIGYVSGKMD
                     APDDRTNVNLLALRRNVTLKGIINGPKDRFEEAVKFYEKHQIQPVVNKVFSFEEANEA
                     FRFLESGNHFGKVVVRVK"
     exon            949507..949648
                     /number=1
     exon            949707..950153
                     /number=2
     exon            950239..950708
                     /number=3
     CDS             join(951742..951921,952003..952404,952458..952757,
                     952815..952913)
                     /codon_start=1
                     /locus_tag="AO090701000351"
                     /note="serine/threonine specific protein phosphatase PP1,
                     catalytic subunit"
                     /old_locus_tag="AO070294000082"
                     /protein_id="BAE62075.1"
                     /transl_table=1
                     /translation="MSEKEEVDLDSIINRLLEVRGSRPGKHVRLQDSEIQYLCHKARE
                     VFISQPILLELEAPIQICGDVHGQYYDLLRLFEYGGYPPDANYLFLGDYVDRGKQSVE
                     CICLLLAYKIKYPENFFILRGNHECASINRIYGFYDECKRRYNVKLWKTFIDCFNCLP
                     IAAIVEDKIFCMHGGLSPDLNSMEQIRRIMRPTDIPDCGLLCDLLWADPEKEITGWGE
                     NDRGVSFTFGPDVVHRFVQKHDIDLICRAHQCVEDGYEFFAKRKLVTLFSAPNYCGEF
                     DNAGAMMSVDESLLCSFQILKPAEKKKANITRGFKSDRSNPSSSQQKKQS"
     exon            951742..951921
                     /number=1
     exon            952003..952404
                     /number=2
     exon            952458..952757
                     /number=3
     exon            952815..952913
                     /number=4
     CDS             complement(953573..953977)
                     /codon_start=1
                     /locus_tag="AO090701000352"
                     /note="predicted protein"
                     /old_locus_tag="AO070294000083"
                     /protein_id="BAE62076.1"
                     /transl_table=1
                     /translation="MKRIPGEPLSKAWSKLSTHEKEGIAKQTAEYLLQLRNLQSDKTQ
                     SLTGGPVYLDFLFRNKDSHLSHGPITTHDELWAHMERGLNEAISEAVRIRLRQRMPPA
                     APYTFTHGDLTNVNIMVENGCLTGIIDWETSG"
     exon            complement(953573..953977)
                     /number=1
     CDS             955340..955933
                     /codon_start=1
                     /locus_tag="AO090701000353"
                     /note="predicted protein"
                     /old_locus_tag="AO070294000084"
                     /protein_id="BAE62077.1"
                     /transl_table=1
                     /translation="MSSSSHNPHNTPTLPNFTRYITTHDANGTAIIHSETESTFREYD
                     NGSLRFNVPFTTSQFPAELSGDADIAAHESLIASGNLGLVSFSGTVCRVVDFAPLKSG
                     GKGLMHRTQSLDYGIVLEGSIEMWLDSGEMKLLKKGDIAVQRGTMHEWRNASETEWTR
                     MVFVLQGTKPLVVGDKVLKEELGTQTEIKPSVSATNL"
     exon            955340..955933
                     /number=1
     CDS             complement(956417..957604)
                     /codon_start=1
                     /locus_tag="AO090701000354"
                     /note="predicted protein"
                     /old_locus_tag="AO070294000085"
                     /protein_id="BAE62078.1"
                     /transl_table=1
                     /translation="MTPLPGSNRAMLVALWLMFALLIEFSDGHARPIRRHGGLRNPSR
                     PIKAFLLCGIGCPSCPAGSKAAPKVSTPKNGIKSGSLPKRVLARPEDEDFGGDVDAFL
                     VSQYMRADWVPSSQQSLSSGLFRELGNVKFNLAVQDLHGCTSVVVVSEKGVWMSHMWE
                     NPAFGTEGPSGELWPSAENTFIADVLNAMEHGNQEMPGLTQFTGNGGAFIAAYKPFAY
                     IFYPTGTQNLNYDRAYKARIDRISEKLQRLIPLKAPPLLYQYDRTRGSMMDARGKVLF
                     QYEPNERVMQTNDGPLQQALNRLWLANRPTYVHQRYWPAWPRQMVAGNANQKRDTASS
                     TPSSTPNSTLDDPETTLTRQIIPTLSNISLDDSLESSPAALDETLIASPTSEAEPECH
                     IDI"
     exon            complement(956417..957604)
                     /number=1
     CDS             join(960301..960432,960523..961375,961437..961654,
                     961715..961884,961974..962289,962602..962847)
                     /codon_start=1
                     /locus_tag="AO090701000355"
                     /note="sulfatases"
                     /old_locus_tag="AO070294000086"
                     /protein_id="BAE62079.1"
                     /transl_table=1
                     /translation="MKVMFGTWLLWGLATAAKQPNILFILTDDQGKLIGGLDHMPKLQ
                     ENLIQKGATYPKHYCSVALCCPSRANLWTGRMPHNTNITDVGLPYGGYPKVVSAGWND
                     NYLPIWMQEAGYDTYYVGKLWNSHTEENYNNPYAKGFNGSDFLLDPWTYRYYNAKMTR
                     NGETPVSYAGQYSTDVIKNKSLGFLDEALANPDRPWMLTIAPNAPHSNGSQDAVTGAT
                     WFGEPEYAPRHAQLFKEYKIPRDESFNKIIDGAVGWVADLPTLTEEEINYIDEFQRCR
                     LRALQAVDEMIGELFEKLDKAGVLNNTYIFFSTDNGYHIGQHAMQPGKNCGYETDINI
                     PLFIRGPGIPQNQTIDVVTSHTDLAPTFLSIAGTTRDGLDGKKIPTTIDAGNADNKSE
                     HVAIEYWGIAVPEGIYGYKSDNDSQPGNSYRNNTYKGLRLVSDDYSLYYSVWCTNDKE
                     FYNLKVPNAHQSYTIANRHLGQIIPRLDALMMVLKSCNGDSCREPWRQLHPKGYVNNL
                     ADALDSGFDEFYANQPKVSFSECSLGYHIYAEGPQEFNIYGSGSTAKRSEGEYVSKSH
                     RCKTWERYTKLGCRLLMQETSVPITPIPRTSDAAIHTNMITHFKNDTTFGQSAQTCST
                     DIIRTEIVNSGMHPLPLLEI"
     exon            960301..960432
                     /number=1
     exon            960523..961375
                     /number=2
     exon            961437..961654
                     /number=3
     exon            961715..961884
                     /number=4
     exon            961974..962289
                     /number=5
     exon            962602..962847
                     /number=6
     CDS             complement(963639..965285)
                     /codon_start=1
                     /locus_tag="AO090701000356"
                     /note="predicted protein"
                     /old_locus_tag="AO070294000087"
                     /protein_id="BAE62080.1"
                     /transl_table=1
                     /translation="MGRPSYGSLAQQYKFLDDAPPVPSTFPSKLLRDSNATTFSEANM
                     PHGETQHDQDQHKRHGSGNLNPSTERTSDQDAQGDRLGGLRASSHANSDRLSSNRGSA
                     ELFFRSPTPSSNGTPSELLDLPQERSTSPADMQGIEYKAYKSPGLPHLPPPDQELGDV
                     DEPSGAQRRNSDAVSEAAISITNFARELGLDTMDSAAESSTASSDSSPSDTRSGSSFS
                     SIGSAISMSKRHPSDQGQLGTLVEDLQKGNGENTTMSMAGSDTLEPPRMPQHLFSPDS
                     PTDPAISMGSVSLLHDKPMQKPTKQDQPEPPATTSPTTDRPARAAPRPKGPCRGCGEM
                     IIGKSVSSADGRLTGRYHRACFVCYDCKTPFQTADFYVLDDLPYCAQHYHQRNNSLCH
                     TCHTGIEGQYLETIERRGHGPADRFKFHPDCLTCRTCQVALKGEYFEWNGQVYCERDA
                     RRAAALPPPPRYQRPGPGLYPPGPLPPHARQPSRGYPRPPPPGYAGRPRSPRPPGPPG
                     PPGTPTTRLPPPSALDGPYGMTSNSGGRFPERRTTRLMMI"
     exon            complement(963639..965285)
                     /number=1
     CDS             join(969423..970120,970169..971066)
                     /codon_start=1
                     /locus_tag="AO090701000359"
                     /note="myo-inositol-1-phosphate synthase"
                     /old_locus_tag="AO070294000090"
                     /protein_id="BAE62081.1"
                     /transl_table=1
                     /translation="MAPHANSDVAANGAVNGSAQSSLFTVNSPNVEYTDNEIKSKYAY
                     HTTDITRTADNKLVATPKATTYHFKVDRKVGKVGMMMVGWGGNNGSTVTAGIIANRRG
                     LQWETREGMRAANYYGSVVMSSTVKLGTDPKTGEEINIPFQDMLPMVHPNDLAIGGWD
                     ISSMNIADAMDRAQVLEPSLKQLVRKEMAEMKPLPSIYYPDFIAANQEDRADNVLEGT
                     KACWAHVEKIQQDIRDFKAQHGLDKVIVMWTANTERYADIVPGVNDTADNLLNSIKTG
                     HEEVAPSTVFAVACILENTPFINGSPQNTFVPGALELAEKHKAFIGGDDFKSGQTKMK
                     SALVDFLINAGIKLTSIASYNHLGNNDGKNLSSQKQFRSKEISKSNVVDDMVAANHIL
                     YEKDEHPDHTVVIKYMPAVGDNKRALDEYYAEIFMGGHQTISLFNICEDSLLASPLII
                     DLVVLAEMMTRVSWKAEEAADYKGFHSVLSVLSYMLKAPLTPPGTPVVNALNKQRNAL
                     TNIFRACVGLQPESDMTLEHKLF"
     exon            969423..970120
                     /number=1
     exon            970169..971066
                     /number=2
     CDS             complement(971204..972259)
                     /codon_start=1
                     /locus_tag="AO090701000360"
                     /note="1-aminocyclopropane-1-carboxylate deaminase"
                     /old_locus_tag="AO070294000091"
                     /protein_id="BAE62082.1"
                     /transl_table=1
                     /translation="MPDTIPLPPPFSTIPRTPLTLGPSPIHPLPRITADLNQTATIYA
                     KRDDLNSGLAYGGNKTRKLEYLAADALAQNATTLVSIGGVQSNHTRQVAAVAARLGLK
                     ARLVQEHWVDWEDPGYDVVGNIQLSRLMGADVRMEDAGFGIEHKETLKKLREECEGNG
                     ERPYYIPAGASDHPLGGLGFARWAFEVREQEREMGVVFDDVVVCAVTGSTMAGMVAGF
                     KLIEKLYPGEKKKRVIGIDGSAKPVETKAQVLRIARNTAVQIGLKEEDITEKDMILNE
                     DYHAGTYGIPDKATWEAIEYAARMEAFITDPVYEGKSFAGMVDLIKKGEITGNVLYAH
                     LGGQLALNAYSRLGETK"
     exon            complement(971204..972259)
                     /number=1
     CDS             973281..974399
                     /codon_start=1
                     /locus_tag="AO090701000361"
                     /note="predicted protein"
                     /old_locus_tag="AO070294000092"
                     /protein_id="BAE62083.1"
                     /transl_table=1
                     /translation="MTKVLLTGATGYIGGTVLDHLIKSSATSVKDLNFDLLVRSNDAA
                     EKLIKKYGDRVKPILWAGFTDLAFITDTAANYDIIINAGTGFLPEGTKAFIHGLARRI
                     GPDKPVPWFIHISGCTNLSDRPLTATAYPDREWDDANGNAVYEFLKSEDARDPYPQRT
                     TEVGVLTLAEETGVQAVSLNAPGIFGTGRGLFNTQGLVHLLAMSYILKHGYGYKLNDT
                     ANFDWVHVEDLADVFVLLVRAILEREDRGVGYIPSSKNGIIFPAVGRVSLIQIMEEGL
                     DAAFGAGVLPREDTLKEKEIRLVGLQEVADEVMGGLLDMAERGVAGHKKMKGTVARRL
                     LGWNPSRLEEHWRQAYVDAIEVLQSRKGSDTLETCLGK"
     exon            973281..974399
                     /number=1
     CDS             join(974997..975063,975118..975702,977500..977666)
                     /codon_start=1
                     /locus_tag="AO090701000362"
                     /note="predicted protein"
                     /old_locus_tag="AO070294000093"
                     /protein_id="BAE62084.1"
                     /transl_table=1
                     /translation="MASLDIPHETLVKLKDKIILITGGSSGIGRATVELCLQLGAKAV
                     IGDLSPPPSDLSSTENLKFVKADTSSWDSLRNLFNEAVKTFGRIDHVFANAGIAPRTN
                     FLDESLDENGELAPPDLKVLKVNLIGAIYTTRLAVHHFRKFAEQHNGIATGSVVFTAS
                     ASSFQTFGAPDYATAKHGVLGLMRSLVGQLPGNVRVNGIAPSWTTTGLVSADFLASLE
                     RVKRPRSTPYHRSGLLESPQFCNIGAPLRSAAPHALLGLRMLVHSCLKGIIPKV"
     exon            974997..975063
                     /number=1
     exon            975118..975702
                     /number=2
     exon            977500..977666
                     /number=3
     CDS             978423..979208
                     /codon_start=1
                     /locus_tag="AO090701000363"
                     /note="predicted protein"
                     /old_locus_tag="AO070294000094"
                     /protein_id="BAE62085.1"
                     /transl_table=1
                     /translation="MSTSGNQRVATKVDRKRITDRKAQRNHRERVKAYISRLETTVEE
                     LTKASQEGSECSLLQKLQEKQLEIERLKGAIRQANTALRTALDTTSASITRSPIAEIV
                     PRDTPVTENNSPSVAEHETTQRLNNRRMQMEYTLELEDISLNMNRASQFQKNNKRKDF
                     AAPYSNLACGDGQMNYFQVLNESLIHVLSGGPLTTSAADDDDLTIRAILHGWDTIKEE
                     KPLDRAWNFLRALDQGLFHRTGPVERLAILRLMRSMLMVGRNK"
     exon            978423..979208
                     /number=1
     CDS             join(980256..980512,980572..980804,980868..981064,
                     981122..982228)
                     /codon_start=1
                     /locus_tag="AO090701000364"
                     /note="thiamine pyrophosphate-requiring enzymes
                     [acetolactate synthase, pyruvate dehydrogenase
                     (cytochrome), glyoxylate carboligase, phosphonopyruvate
                     decarboxylase]"
                     /old_locus_tag="AO070294000095"
                     /protein_id="BAE62086.1"
                     /transl_table=1
                     /translation="MAGFALNDHNGELNGGDLLAQTLKHLGVEVAFGLHGGHLDAFLQ
                     GCEASQIRLIDTRHETVAVQAAESYAKFSKKIGVCFITANSGFSNGIPGLATALADRS
                     PILCITSSPPTRDAENNSLQGIIDQVVVSRPLTKFAYRMTNPEDTPRIVKYAMGVALS
                     GAPGPVLLDFPVDVLFTPVHKPLISWGSVSSPFPYGPGPHTAAIEGTVELLNAAKRPV
                     IILGTGGNSKEAAESLMKLSETCHMPIFDTTKCKISFFPSQFALNGGASSALALLPHV
                     GIQRPDLILLLGARTGMFLGGRSGAIIPDKDCKLVQVDVDGAEIGRTLPVDLGAICDV
                     TQFAAGLNRHFETASFQGSVDTKWVDDVLGLKSLPSPYEQQAEVQPSGRLHPYHALKH
                     LLTFVPKESIIILDGGEAPLWAGEMISTCSPSAIVKSSGGLGFLGNGFGYALGAAVAC
                     PDQTVINLHGDGSAGFHFMDLDTYKRHNLNIMTIVVNNYCWGMSSNGQDLIYGTKTPT
                     RPVSHLSPVTDYSLVAKALGNASAKIQSIDDMSPAFVKLLDQSGPTCIELVVDDKPIH
                     PITVSMVGQTDEPGMVVVPYYDNVPRAYYKS"
     exon            980256..980512
                     /number=1
     exon            980572..980804
                     /number=2
     exon            980868..981064
                     /number=3
     exon            981122..982228
                     /number=4
     CDS             join(982778..982916,982986..983683,983737..983842,
                     983891..984045)
                     /codon_start=1
                     /locus_tag="AO090701000365"
                     /note="threonine dehydrogenase and related Zn-dependent
                     dehydrogenases"
                     /old_locus_tag="AO070294000096"
                     /protein_id="BAE62087.1"
                     /transl_table=1
                     /translation="MKAARFYAAGDIRIEEVETPKGSDEKALVQVEWCGICGSDINEY
                     VQGPMSIPHTRTGPHPLTGDILPVTLGHELSGRIIQAPSTSSLSPGQAVIVDPRYYCS
                     SCTACTSSVTNCCQSLGFLGLSGGGGGFSEKVAVPPAMLHQIPDNIDMATATLIEPLA
                     VAWHAVRCSGVKGFKGLPILVIGGGPVGVATVFVLRAWGADQIYVSETARRRREFLQD
                     LVQATFDPIEVNVGSECRSLSNGSGIGLVFDCAGSQKGLEAACDSLRFHGLYVNLAVP
                     KSAISLPAMYFMRKELTYKSFLAYDDADFKATVAAFTEGRFAGVERMITRRIALEELV
                     EKGFKTLLQNPDEHIKIVATAGELPSRDSTL"
     exon            982778..982916
                     /number=1
     exon            982986..983683
                     /number=2
     exon            983737..983842
                     /number=3
     exon            983891..984045
                     /number=4
     CDS             complement(join(986371..986417,986529..986940))
                     /codon_start=1
                     /locus_tag="AO090701000366"
                     /note="predicted protein"
                     /old_locus_tag="AO070294000097"
                     /protein_id="BAE62088.1"
                     /transl_table=1
                     /translation="MVSACTNKPNASEGEIVTLRQPIFQVPASEAVPDESESSSGLST
                     GAKAGIGVGVGVGGLLIVGALGWFFCLRKRSKKVDAHQYERPWQQENPDAPVLSPDPR
                     SGPPSEMPAEAVVKGPTELEGEGNAKANVGSGGNEGYELHRRCIGLRDHV"
     exon            complement(986371..986417)
                     /number=1
     exon            complement(986529..986940)
                     /number=2
     CDS             complement(join(989357..990084,990181..990259))
                     /codon_start=1
                     /locus_tag="AO090701000367"
                     /note="predicted protein"
                     /old_locus_tag="AO070294000098"
                     /protein_id="BAE62089.1"
                     /transl_table=1
                     /translation="MKNCLLCESTGTTYLNNHSGDLWDFLFIQKYTLQTCLYDGASET
                     SISGCEDNCLPLRSIFKDLWYKTNHTEELYYYCSDVFTQYASDCATCLRSKSGSVILG
                     NFMDNMDSACETKPNASAGETITLRRPLFDLSTATSNTTSTSTSSATATGTGDNGGRG
                     AASSSILSTGAKAGIGVGAGVGGLMILGAAAWLLLARRRRGAAQGGAHQYEPPMEQGP
                     ASELSYGAGAPVEQVTVKQFGELAAVERTEVELDGGNGGVRRGDNAVELP"
     exon            complement(989357..990084)
                     /number=1
     exon            complement(990181..990259)
                     /number=2
     CDS             join(993970..994384,994436..995810,995851..995869)
                     /codon_start=1
                     /locus_tag="AO090701000370"
                     /note="predicted protein"
                     /old_locus_tag="AO070268000001"
                     /protein_id="BAE62090.1"
                     /transl_table=1
                     /translation="MNLCDVCQTIDIRDLLQSFHNSEAFSVDVLKSPDPYLSSTPHFQ
                     PHHTSITALQNASKAGCELCEMIWAHCRIRSCDHSPYGGDKCLCEKYRGPLRFVIYQG
                     VYNSYAQLVVVAMSDKDRRGHPDGTWIAELDICIAKGAEIPEGDTHLLERLARNETPS
                     DLRSEVCLSLAAGWLDKCSREHTECDADNDKPALLPTRVIDVGNSMTPPHLHVSGDGE
                     TGKWVALSYCGGADSSITLNSSSFENLRSGQPLSDFPLTLRDAVLVTRALGVRYLWID
                     CLCIFQDDTNDMAAEASRRSRVYSNAVVTIAATTAETVNDGFLDKREPHFNCSFPWRR
                     HDHLDSVKNDCRTYPVFFRGDRSPLNKERPRDSPWATRGWTLQEELLSKRILYYTKQE
                     MIWQCHAGTATEPAEEPEPYSTPFSRLKKLSASSGYPEKSTKSAAATYKLWYELLEEY
                     VRRHLTSENDRLPAIGAIAESIQTQLNEQYCAGLWRGDLLFGLLWSLHCSSGGSGPPG
                     RVIRRALLRLFDFQPKHPTLPAREIPAGVSKNRGPSWSWVGADTFVGLTWPQQIDTFD
                     YLAKVVHVEVRGKIQDDFGRVEGAALTLDAPPRGAL"
     exon            993970..994384
                     /number=1
     exon            994436..995810
                     /number=2
     exon            995851..995869
                     /number=3
     CDS             complement(998447..999316)
                     /codon_start=1
                     /locus_tag="AO090701000371"
                     /note="predicted protein"
                     /old_locus_tag="AO070268000002"
                     /protein_id="BAE62091.1"
                     /transl_table=1
                     /translation="MGIFTCSRKSRAIPSKPMGDWKSQSPPDYNEVVASDYASNQSSS
                     PDGFLATSELQVEAMGYNTNQALSGSKLLENISVYSVEFGVRTQEKYTSIRLKRNSNS
                     CALVRSSDPRQNALISTIYRWGPGRHPRMRILARDSSVSVEQAIDDDKVCGELVDVQS
                     RSMVSRAQVFDTSLGKYEWRYGSREERKACNADSLLILERMDRMVLGNGTRTKSGARV
                     AQLIRNDQFRTPGSVKYSGGNGGRLVMDLRMWKDEKHADTDSVEAFFVASCILMLKRE
                     ADRFIDNNIVAVT"
     exon            complement(998447..999316)
                     /number=1
     CDS             join(999527..999539,999569..1000218,1000225..1000345,
                     1000415..1000512)
                     /codon_start=1
                     /locus_tag="AO090701000372"
                     /note="predicted protein"
                     /old_locus_tag="AO070268000003"
                     /protein_id="BAE62092.1"
                     /transl_table=1
                     /translation="MRHFRIIWRPEVNGSAAVKQCCARIRPTDDQQECPRSLVDRLDV
                     FLAQELNTPVLDELYPRLWLVARKSGTSIDALHEQKLKGREVVPVENPQLHLVWHRDK
                     FYIKPLPECLLNHDFWTGHLSSHGTNKRSVALGFVRSYAHLIKHRSDFALVHVHHLIP
                     ETVTWNAWCQFIQHFRHCEDTQVAKRYHYGQLCLSRLNWAVRLFQPPCAKTIWFYDVP
                     YWSTYLQRISAPLIFGFASISLVLSSMQVILSISTDEMTLGAVGLVWTLLLVIPIAVL
                     FWQVSWGFKNRKQVTSI"
     exon            999527..999539
                     /number=1
     exon            999569..1000218
                     /number=2
     exon            1000225..1000345
                     /number=3
     exon            1000415..1000512
                     /number=4
     CDS             complement(join(1001479..1001696,1001753..1002390,
                     1002440..1002575,1002626..1002740,1002880..1002900))
                     /codon_start=1
                     /locus_tag="AO090701000373"
                     /note="alcohol dehydrogenase, class III"
                     /old_locus_tag="AO070268000004"
                     /protein_id="BAE62093.1"
                     /transl_table=1
                     /translation="MADTVGKAAVAWAAGEPLSIEDIEVAPPKAHEVRIQVHHTGVCH
                     TDAYTLSGKDPEGAFPVVLGHEGAGIVESVGEGVTSVKPGDYVIALYTPECRECKFCK
                     SGKTNLCGKIRATQGKGVMPDGTSRFKARGKDLLHFMGTSTFSQYTVVADISVVAVTP
                     KIPTDRSCLLGCGITTGYGAAVVTAKVEEGSNVAIFGAGCVGLSVIQGAVKNKAGKII
                     AVDVNDGKEAWARKFGATHFVNPTKLNGKTIQEELIEMTDGGCDYTFDCTGNVGVMRA
                     ALEACHKGWGESIVIGVAAAGQEISTRPFQLVTGRVWKGCAFGGIKGRTQLPGLVDDY
                     LNNELKVDEFITHRETLDNINAAFEQMHHGDCIRCVVDCRQ"
     exon            complement(1001479..1001696)
                     /number=1
     exon            complement(1001753..1002390)
                     /number=2
     exon            complement(1002440..1002575)
                     /number=3
     exon            complement(1002626..1002740)
                     /number=4
     exon            complement(1002880..1002900)
                     /number=5
     CDS             join(1006713..1007025,1007089..1007241,1007294..1009575)
                     /codon_start=1
                     /locus_tag="AO090701000375"
                     /note="Rho GTPase-activating protein"
                     /old_locus_tag="AO070268000006"
                     /protein_id="BAE62094.1"
                     /transl_table=1
                     /translation="MVTGKSQGAEAFQSLPPTTTQPRFIAASPPSKRDLTSWWRQFKR
                     NTRKEEPKGTCVCVGRDIVWGEPAGRSCDGRGCLTLASFIPEGRIWSWPSTISFVKIP
                     VIQKPQGIFGVPLNISIKYANVAISLTNDNGESFIYGYVPIVVAKCGVFLKEKATDVE
                     GIFRLNGSAKRIKDLQEIFDSPERYGKGLDWTGYTVHDAANVLRRYLNQLPEPIVPLE
                     FYERFREPLRIYQKQVQGGGPTNEGDKFDHAKAVAAYQQLIRELPPLNKQLLLYILDL
                     LAVFASKSDQNRMTSANLSAIFQPGLLSHPQHDMSPEEYKLSQDVLIFLIENQDHFLF
                     GMNGTAADEATVKEVEGGMLRPTSHSTVRRSVSSASGGAESFRKFGSLRRNVSVSSKN
                     SRNSNSNNASPATPTSMSGAGVHRSNTLPSKMSPAIAQARYGRVAEAPGGNTPGQTST
                     QRSQSPSRTPPGPEQKPQSQKPQPAKPQPPTQGSETATTGLVYVHTSTHGPIPISNAT
                     ATHSPIAEKPSQDTLAVPSSPPRAAVTPTKERKLSSLFSKSPPSGSEKEPRQPNRLKK
                     KRIPGSASASAQSSSQSLQAATSDSGIGIPPPRPSDPTDAGGDTPKPLNAPNPEDDSQ
                     QDGKPEKPAGPNEAGHPSDTTLRPYGSRTPSMNSRSSFTDLSDADPIDDASRAERKEH
                     RRSWRFPRSAKRSNEQIGLGLGSPPLLASNPGADRSTSSFGSWHHSSKSSPSDLQQFA
                     SEHSFQPLSLDAEVNNNGKDSSEPEKRSLFGKFKAKVAQVRDGVMDTERDRTRSPPVH
                     SDAEKSVSSQTLSPAPKESSHVRPAPPAPIDVTRELQEINSTPVSPLPGSGMPPAIPE
                     EPRTPDSPAAPVELEAKKENGVAETHPPETRPAETGSAATLPTFESHKGDIETSQFLG
                     N"
     exon            1006713..1007025
                     /number=1
     exon            1007089..1007241
                     /number=2
     exon            1007294..1009575
                     /number=3
     CDS             join(1010172..1011019,1011131..1011284)
                     /codon_start=1
                     /locus_tag="AO090701000376"
                     /note="predicted protein"
                     /old_locus_tag="AO070268000007"
                     /protein_id="BAE62095.1"
                     /transl_table=1
                     /translation="MSSTPPSPSLAQGPAAPKSAPPIHILPNNISKTYALIHPVLLLA
                     LLALRFNALVADPVAELLSKLPFLALLQVAFVMTCLPPAGSAKDDDKSTSANSSSSSS
                     NAGSTSGVILKPGKIGLRRKNTPKSESACLSAKLIVRLLIKYPPPSSSIPTHPYMSIN
                     KTPVTQKAHPTNSQNQKKKNTNKKKKQPAILSLTLTTLLATPVLTILLILFGAPLTTH
                     HPETLLCGAHMAVLTSTALIYVHGVDGSVWKEVWGARRPADAVWGAALGTCVGAWFGA
                     VPIPLDWDRPWQAFPITILVGAYIGYSVGFGLGRTVLFGKRLKIEEEGDVVEAKKVD"
     exon            1010172..1011019
                     /number=1
     exon            1011131..1011284
                     /number=2
     CDS             complement(1011815..1013488)
                     /codon_start=1
                     /locus_tag="AO090701000377"
                     /note="predicted protein"
                     /old_locus_tag="AO070268000008"
                     /protein_id="BAE62096.1"
                     /transl_table=1
                     /translation="MSRPSLSIGSDSLRSCLAPRDQSSDSGSDICYDTALPPITSKQL
                     ILNSRSCRGSDPSIVVGSFRGNQKAAAALGFAPDMSSMTRGPNAHRRTGSTLKTVMRK
                     IFTRKARGQADGCEEVSPDFRLNNSQESRPEKDTTNYAALSNSLKSKYSNPARDELKD
                     PKAFEDTLLKLEMRPPRTRRATLPSLIFSEDDESRDALDALIHSDPADSRSKSPRLGD
                     HDERRRELLRSKRRSRSATALRGLAKNHRMSPIQWRRRSIESYVTSTACGATSETDLV
                     SIRPPTRGTAVSAPQTAVEPSVDGVDPLDDPVDEERIPPNVGTLVSAMQHDESISLEQ
                     RLTTLEVKLIDLEFAIARMQTERSEPSPTASAGRKQSQNSTEHKRKKSTAQSPPSGSE
                     ATSSVGSAGDRPLSTATIRPSAQHLHRSKTLQSPSLSSLSDHHAGISVEQYSALVMLL
                     RREQNARRSLEHEVSGLRSDIQQLQQLARNSMGLKTMYPIRSADSQEFIRPDSNTMGY
                     SQTTSVHTEQKLGSPYESDSDYDRSDTPKEDTFRPRWPPNRRVEIGNMI"
     exon            complement(1011815..1013488)
                     /number=1
     CDS             complement(join(1018276..1018360,1018456..1018516,
                     1018568..1020584))
                     /codon_start=1
                     /locus_tag="AO090701000378"
                     /note="DNA helicase"
                     /old_locus_tag="AO070268000009"
                     /protein_id="BAE62097.1"
                     /transl_table=1
                     /translation="MAPTPIPVPLFAQTQQQLLLQEHEAEVSSSTLASTAASVSPSTR
                     RTLQATGYALTGIVLSQCRTGLGGRVVGEFGADAAVSTKNTDGHGKDGEPQLGAHGIR
                     VGDVVRVNEIGSSTKKMGKDKASKDGKPAGTGPPKGPEGVVTRVGERSVWVAFGQQGG
                     GGRSKEDDEAIEELWGKKLWLIKLANDVTYRRMRQTMEKMGKIIESDYTHFMRVAFGH
                     TTPLPPDYGAVGDVEFNDPSLNDSQKEAIRFALASRDIALIHGPPGTGKTHTLIELIL
                     QMVQRKLRVLVCGPSNISVDNIVERLAPKKVPVVRIGHPARLLPSVLEHSLEVLTHTS
                     DAASIVRDVRKEIDQKVASIRKTRFGREKRAIYQDLKELRREFRERESKCVDNLVRES
                     SVVLATLHGAGGHQLKNQKFDVVIIDEASQALEAQCWISLLSASKVVLAGDHLQLPPT
                     VKSTDQKSKDVKAGKVDTVNDGDNGVLGKMSLETTMFDRLLSLHGESIKRMLTTQYRM
                     HETIMRFPSDELYESKLMAGDAVKARLLKDLPYDVEETDDTKEPLVFWDTQGGDFPEK
                     TEDKEVGQKEALLGESKSNEMEAMVVAKHVDNLVQSGLKPEDIAVITPYNGQLAILSQ
                     MLREKYPGIELGSVDGFQGREKEAVVVSLVRSNSENEVGFLGEKRRLNVAMTRPKRHL
                     CVCGDSETISKGSGFLKRWMAFLEENADLRYPDAGGLL"
     exon            complement(1018276..1018360)
                     /number=1
     exon            complement(1018456..1018516)
                     /number=2
     exon            complement(1018568..1020584)
                     /number=3
     CDS             complement(1021429..1023054)
                     /codon_start=1
                     /locus_tag="AO090701000379"
                     /note="predicted protein"
                     /old_locus_tag="AO070268000010"
                     /protein_id="BAE62098.1"
                     /transl_table=1
                     /translation="MDTLDPDEQAFWQLYNELNPPSSSMENLSREESPSTDACSLCGP
                     STMEVDMGPSFQPGISFLSLPENAKIKILEYAGLLRPCLIDISSECVRRNPNIQPLCN
                     RSSMRETQGSWTAFVDRGCTHPRLPTALFQTSRAVRDEIGSMFFGLNRFSAMLYRKAD
                     FCQFRDATLWGMEHLKYLHIDLGPCDRRFLKLYGGVHRTIMKIWVAFCDLAAVRMPSL
                     TYFSLKCRVKDLEVAHKLMCAMDHFPSLAQCAIHLNQYQENDIRAVVKRSCWRLTNNL
                     GDRPPFGFLRLPKEVQLLILEQLLINRPDPYIMASECPKGLVTLQDRRRQRPTIYPLT
                     CCGTCSPLRAMCFCYARQTAFSTTCSCFTSPTPYFLVSRGFYEDARRVFFSKNNFAFT
                     DEDPELIMRLLHYIPTSSFMQIRHLTFKFPLTFRSPARTAHRVEDAALLSWSVLRRFI
                     REHFDIPRLSLTIIDLGTKNYGNGATQSRNKYLRKLLKAFADLRGLRDFRVYLADERS
                     YERDAERAVLGFACHGRSKPSHMPFIGQKHLNT"
     exon            complement(1021429..1023054)
                     /number=1
     CDS             complement(1023454..1024263)
                     /codon_start=1
                     /locus_tag="AO090701000380"
                     /note="endonuclease III"
                     /old_locus_tag="AO070268000011"
                     /protein_id="BAE62099.1"
                     /transl_table=1
                     /translation="MREANPTAPVDTMGCAELYWRASSPRDRRFQTLVALMLSSQTKD
                     TVTAVAMQRLHTELGDGEAPLIETSMIKEEPDEDTFKLEKPLRDSTLNLENILAVSPE
                     RLNELIGKVGFHNNKTKYIKAAAIILRDQYQSDIPSTAEELMKLPGVGLKMAYLCMSA
                     AWGKHEGIGVDVHVHRITNLWGWNKTKTPEDTRKALESWLPKDKWHEINKLLVGLGQT
                     VCLPVGRKCGDCDLAGTKLCKSEIRGLVSSRKVDAKEESVEGGVEVKIEGE"
     exon            complement(1023454..1024263)
                     /number=1
     CDS             join(1025098..1025254,1025340..1025686)
                     /codon_start=1
                     /locus_tag="AO090701000381"
                     /note="ubiquitin-protein ligase"
                     /old_locus_tag="AO070268000012"
                     /protein_id="BAE62100.1"
                     /transl_table=1
                     /translation="MASSSTVKRLLSELKNYTNNPNEHLLHLGLVDNDDLFQWEAVLK
                     GVKGTPYEGGLWSLSITIPPNYPNAPPTIRFNTRISHPNISFTTGEICLTLLTTEHWT
                     PAYTLSQTLTEIHQLLTNPEPDSPLNVDVAVLLRDGDIPAWESIVRYWTEEERWQGPE
                     SASFSRA"
     exon            1025098..1025254
                     /number=1
     exon            1025340..1025686
                     /number=2
     CDS             complement(1026202..1027266)
                     /codon_start=1
                     /locus_tag="AO090701000382"
                     /note="predicted protein"
                     /old_locus_tag="AO070268000013"
                     /protein_id="BAE62101.1"
                     /transl_table=1
                     /translation="MNRLLKLAFLSLVASSAIATTAPEQVESETNTVADQSDSLHKAL
                     HLFEKFSHGVFRSDEDAADALTAEDRELAAHLNLKRDNSSSAVEPSATAVVPSSPTQA
                     SSPSSNTEAPSSTTEAPSSHTTEAPSTSSPSTTEASSASSSDSSTSQAEPTTSAQPTT
                     ATPTQKTTVEPTTSEQPTTTEKPTTSEKTTEKPTTSEQPTTTDKPTTSDKTTSEKTTE
                     KPTTTDQPTPTTTDKPTTSEKTTSDKTTEKPNTSADSTKGPTTMQTTTTAPEPTTTEQ
                     TTKHTTPYTSTYKSTTTLPNGEQSTITSITVVHPTETDVATPTSAAPGLQTDNAAPTT
                     GLTRELFVMVGGAAVVAMAL"
     exon            complement(1026202..1027266)
                     /number=1
     CDS             complement(join(1031319..1031374,1031503..1032085))
                     /codon_start=1
                     /locus_tag="AO090701000385"
                     /note="predicted protein"
                     /old_locus_tag="AO070268000016"
                     /protein_id="BAE62102.1"
                     /transl_table=1
                     /translation="MHYIQYGIGCLLSLLLTGAKGHEDKLFTRGPAFSAYPYPTFFIE
                     CPEIGASGSRMDIAHVYDGSGYFPELRWPITTPDTQEYVLVCEDPDELLAAPVIHGIY
                     YGIPPVFIGLHRSDFIEVDSRNDPYRLRGGFKYGANSGGGVYLAPQPARGQGPHRYFF
                     ELIALNHTIDQSKLSPMATFDEIARQIEGKIIGWAPISVPSDYLETIARPSG"
     exon            complement(1031319..1031374)
                     /number=1
     exon            complement(1031503..1032085)
                     /number=2
     CDS             complement(join(1032567..1032876,1032929..1033243,
                     1033294..1033520))
                     /codon_start=1
                     /locus_tag="AO090701000387"
                     /note="predicted protein"
                     /old_locus_tag="AO070268000018"
                     /protein_id="BAE62103.1"
                     /transl_table=1
                     /translation="MTENTFFDNWAGRSVDFATAGTPSKWILTELLSEKNSQVHGDDF
                     FKNGCIGGAYGTFLCHNVTDSTQRGVMKVLMQVPWEGSQYAPAEHRSSQASGSYELDW
                     NITSQLNALITLTSNNCLSTPRILDLKYGWQETADPVPGGYIIFILMSYLPGVQLTKA
                     FWGLEDSVREQIRQAFKLTWLDCVGSGITPAHPNIEHVFWDAAANKAYVVFPVNNENE
                     VWACLMRNAVYFIYSYIISFRESEPAKREDVWQDVNWSLWGMAKPQESYNSQPDESKW
                     MDSLTLR"
     exon            complement(1032567..1032876)
                     /number=1
     exon            complement(1032929..1033243)
                     /number=2
     exon            complement(1033294..1033520)
                     /number=3
     CDS             1034304..1035047
                     /codon_start=1
                     /locus_tag="AO090701000388"
                     /note="C-4 sterol methyl oxidase"
                     /old_locus_tag="AO070268000019"
                     /protein_id="BAE62104.1"
                     /transl_table=1
                     /translation="MPKLETHWATIVTSYSPSTIEFTGTLLIQLLTFWLPSLIYLTLP
                     TLFPTWSNNHKIQPAPKQPTKKEIHHCFKIVLRNQLLTTTLHLLQLNLLNKGTSSYTL
                     TPTFPSLPILARDFLLSLLAREALFYYAHRFLHRPYFYVRIHKQHHKFTAPIALAAQF
                     AHPIEQIFANALPISLPPQLLGSHVLTFWAFLGYELFVTATVHSGFDFFGGKARMHDL
                     HHEKFNLNYGSLGLLDWVHGTDRLEKRRD"
     exon            1034304..1035047
                     /number=1
     tRNA            complement(1035537..1035608)
                     /locus_tag="AO090701t00006"
                     /note="tRNAscan-SE"
                     /product="tRNA-Glu"
     CDS             join(1037885..1038481,1038542..1039309)
                     /codon_start=1
                     /locus_tag="AO090701000389"
                     /note="predicted protein"
                     /old_locus_tag="AO070268000020"
                     /protein_id="BAE62105.1"
                     /transl_table=1
                     /translation="MKGSAIATALTLGASTALAAPSIKARDDVTAVTVKGNAFFKGDE
                     RFYMRGVDYQPGGSSNLADPIADAEGCKRDIEKFKDLGLNTIRVYSVDNSKNHDECMN
                     ALADAGIYLVLDVNTPKYSLNRASPKISYNENYLQYIFATVDAFAGYKNTLAFFSGNE
                     VINDGPSSKAAPYVKAVTRDLRQYIRSRNYREIPVGYSAADIDTNRLQMAQFMNCGTD
                     DERSDFFAFNDYSWCDPSSFKTSGWDEKVKNFTGYGLPLFLSEYGCNTNKRQFQEVSS
                     LYSTDMTSVYSGGLVYEYSQEPSKYGLVEIDDGKVKTLADFDALKSAFEKTKNPSGDG
                     GYNKTGGANPCPAKDSPNWDVDSDALPAIPEGAKKFMKDGAGKGEGFAGKGSMSGGGS
                     TSTGTAEPGSGSATGSAGSSSGSSSSSSSAGVMNIPNMSLAPLVVGMVTVMSTFVGAG
                     LILV"
     exon            1037885..1038481
                     /number=1
     exon            1038542..1039309
                     /number=2
     CDS             join(1044081..1044654,1047255..1047718,1047777..1048280,
                     1048347..1048479,1048545..1048620,1048938..1048971)
                     /codon_start=1
                     /locus_tag="AO090701000391"
                     /note="WD40 repeat-containing protein"
                     /old_locus_tag="AO070268000022"
                     /protein_id="BAE62106.1"
                     /transl_table=1
                     /translation="MYDVLGGFFKGLGWKSVNQHEQPNEKHQAYGYPSWSVANGIRAG
                     PVRSYLPLAQELDNFSLRLQTKVRRLVRRGGRITGVEVETESGAIEIINIRAGGKVVL
                     AAGSMSTPRVLFNSGIGPAKQIENVKSGSTGITVPAQEEWINLPVGENLKDHPMFTIS
                     VHTKSNFTAFNTSSVLSGPAAAVQQLYSKGSAKRKFCSASKMLTPPSISRSSPVTSPG
                     PYLSYPSGLGVNLDEVMRNWDELPPERKKAGDRWSAVINPDIDKNWEIDLLHSVTHDS
                     IVNCVQFSNDGKYIAVGCADGAVQIVEVSTGTQVARLQDEGYSHDCLCVRVRFLPDNY
                     LLLTAHSDGNIRVWNYMGSLLRRIPCGSETGFFTLDLSATGHLIAFSERNKTVKAWDL
                     DAASGIRQLGTLHTADDVYIVAVSPDSGYIAAGCDDGMIYIWRADSLDPGTASASGTK
                     IEKVLEFQAHDENVMALSFTPDCRSIISGGMDGTAKLWNIDSLKAFVNEDITPNDCTL
                     IYKAHQDMVLSVSPDPTGNWLLSGSKDMTVYLWDISTGVAEMRLGAHGNSVLGIAWSP
                     TDNIVATGGGDRVLQLWRYYPSIRLALR"
     exon            1044081..1044654
                     /number=1
     exon            1047255..1047718
                     /number=2
     exon            1047777..1048280
                     /number=3
     exon            1048347..1048479
                     /number=4
     exon            1048545..1048620
                     /number=5
     exon            1048938..1048971
                     /number=6
     CDS             complement(join(1049197..1049471,1049559..1050117,
                     1050173..1050355))
                     /codon_start=1
                     /locus_tag="AO090701000392"
                     /note="predicted protein"
                     /old_locus_tag="AO070268000023"
                     /protein_id="BAE62107.1"
                     /transl_table=1
                     /translation="MASSPDLDTPMPPDHRTTSGLLAEYYILTVIALALVLLRAWVCL
                     RLTRNWGWDDTCIVIAWIALLAGLITIQLEANLGLGRHAIYLPDPEHTVLQILKVNTI
                     YQIFNVICALVTKYSISFYILRIRNSRAVRWILAWLMLFMTLTTIGAVVILAVSCIPL
                     EKQWNKDVPGTCLPPKTVYSVAYVQSAFTIVIDLCLTSAPVIILWDVKIKRGRKTLIC
                     GLMSLGLVATVSNALRNCYQGGLTAPDMPYAITNVAIVSILEVGTGVIAACIPACVPA
                     FRCRQKAEPVANSYRDKKISVIRGGRWDEGSGNWSLGNAMSDSIALCGVKSPGRVVTK
                     VTAC"
     exon            complement(1049197..1049471)
                     /number=1
     exon            complement(1049559..1050117)
                     /number=2
     exon            complement(1050173..1050355)
                     /number=3
     CDS             complement(join(1056241..1056635,1056699..1057857,
                     1057909..1057989,1058035..1058562,1058663..1058689,
                     1058745..1058789))
                     /codon_start=1
                     /locus_tag="AO090701000396"
                     /note="Cdc42-interacting protein CIP4"
                     /old_locus_tag="AO070268000027"
                     /protein_id="BAE62108.1"
                     /transl_table=1
                     /translation="MATPDVAPQFGAELKDAFKPVNNWVSHGVQWLDEIQQFYRERSA
                     IEKEYAAKLTALCRKYQDRKAKKISTLSVGDTPTMTPGSLESASLTTWTTHLTTVEAH
                     AGERDQFATNLLVQVAEPLKLAATQYEEIRKSHVEFHAKLEKERDAAYGDLKKAKGKY
                     DGVCQEVEGKRKKMENSFDHSKPKAQAAYQQQILEMNNVKNSYLISINVTNKLKERFY
                     HEYVPELLDSLQNLNEMRVSKLNSLWSLAAQLEKSSLSKSMEHMAHLLNEIPRNVPHL
                     DSLMFLRHNVSQSQEPPNMTFEPSPVWHDDEALVTDETAKVFLRNLLSKSKTQVRELR
                     VEADQKRRDVETSKRIRENIQQGKDNRSEVEVVRSIFYLQGALHEVERKKLTAEVETS
                     TIMSVVGDLSLGAKNHNFKSQTFKIPTNCDLCGERIWGLSAKGFDCRDCGYTCHSKCQ
                     MKVPAECPGEQNKEEKKKLKAERQEQANATPHLDLEPTTTGSSAAPSLTRKDTMNSLS
                     SGYAVSANRSLSNAASQPALANPTESAAPSPVPEAAATPAPVQETKPKRNRVLAPPPA
                     QYVKAPPVAETTKPSEPRGKMVYPFQAGGADEITVQDGDDVTILEPDDGSGWMRVRAG
                     SAEGLVPASYVEPAPAASVAPATSPGMAERPGSTYSTSSASLAGSAVGKKVGPAVAPR
                     RGAKKLQYVEALYDYEARSDMEWSMVEGDRFVLVNRDGGDGWADVERGGVTKSVPANY
                     IQEV"
     exon            complement(1056241..1056635)
                     /number=1
     exon            complement(1056699..1057857)
                     /number=2
     exon            complement(1057909..1057989)
                     /number=3
     exon            complement(1058035..1058562)
                     /number=4
     exon            complement(1058663..1058689)
                     /number=5
     exon            complement(1058745..1058789)
                     /number=6
     CDS             join(1059567..1059654,1059728..1059893,1059958..1060455,
                     1060516..1060753,1060800..1061000,1061063..1061335)
                     /codon_start=1
                     /locus_tag="AO090701000397"
                     /note="ATP-dependent RNA helicase"
                     /old_locus_tag="AO070268000028"
                     /protein_id="BAE62109.1"
                     /transl_table=1
                     /translation="MSAEQPAETASAGNPLADRITTADGSKPEGTTETTDNEQADGAA
                     AQLGGSELNEPDYTVEVKLSDLQADPNNPLYSVKSFEDLGLDPRILQGLSAMNFRKPS
                     KIQERALPLLLNNPPKNLVGQSQSGTGKTAAFVLNALSRLDLSTEQAQKTPQALILAP
                     TRELARQIVGVIQCMGQFLDGLNVSTAVPADTNSRHSKIESSVVVGTPGTVMDMIRKR
                     VMVANKLKVLVLDEADNMLDQQGLGDQCIRVKALLPKDIQVVLFSATFPTHVHQYASK
                     FAPQANELTLQHEELTVEGIKQLYLDCSDEEDKYKTLVQLYGLLTVASSIIFVKTRAS
                     AAEIEKRMVAEGHTVASLTGGIEGSQRDAVIDQFRAGQAKVLITTNVLARGIDVSTVS
                     MVINYDIPELHQPGAPERQADFQTYLHRIGRTGRFGRVGVSISFVSNREEWNMLNQIQ
                     QYFNCTIQRVDTKDWDEVEDIIKKTIKNTRAQAQFGR"
     exon            1059567..1059654
                     /number=1
     exon            1059728..1059893
                     /number=2
     exon            1059958..1060455
                     /number=3
     exon            1060516..1060753
                     /number=4
     exon            1060800..1061000
                     /number=5
     exon            1061063..1061335
                     /number=6
     CDS             join(1062552..1062644,1062705..1063661,1063720..1064010)
                     /codon_start=1
                     /locus_tag="AO090701000398"
                     /note="bifunctional GTP cyclohydrolase II/3,
                     4-dihydroxy-2butanone-4-phosphate synthase"
                     /old_locus_tag="AO070268000029"
                     /protein_id="BAE62110.1"
                     /transl_table=1
                     /translation="MTTDSPETTRADGTTVQAAPSPESHYSTHIVLTTYPGQSGIDPV
                     PLNWGAKDAKSRGPVVVSRSGPLLKRRNAMGAHGGSYSIYNALAIAAGDLPPDFRPDF
                     KNSEPTFNFPWQPAWADKDKIVSMDPYGHDIVNQFRDELNAGWDIRPTMAVTRANMKL
                     AEIGEAVRDGQLDVDGSIVVDSSGEVRVTKVAVEPVWYLPGVADRFGVSEPILRRTLF
                     EHTGGSYPELITRPDLKVFLPPIGGLTVYIFGPPERVSDENVKLALRIHDECNGSDVF
                     QSDICTCRPYLAFGIREAIREAQNGGSGVVIYFRKEGRALGEVIKYLVYNARKRGGDT
                     ADKYFTRTENIAGVRDMRFQALMPDILHWLGIKKIDRMLSMSNMKHDAIVQSGIKILE
                     RVPIPEDMIPDDSRVEIDAKINAGYFTTGRQYTMEELAEVKGRGWEKWEDITVS"
     exon            1062552..1062644
                     /number=1
     exon            1062705..1063661
                     /number=2
     exon            1063720..1064010
                     /number=3
     CDS             1064715..1065698
                     /codon_start=1
                     /locus_tag="AO090701000399"
                     /note="dihydrodipicolinate synthase/N-acetylneuraminate
                     lyase"
                     /old_locus_tag="AO070268000030"
                     /protein_id="BAE62111.1"
                     /transl_table=1
                     /translation="MGSHVTPQPHVPKAGVWCPAITFFDHSTDTIDFDAQKKYYSYLS
                     KTGLAGLVILGTNSEAFLLTREERAQCIAAAREAVGPDFPLMAGVGAHSTKQVLELAH
                     DAAGAGANYLLVLPPAYFGKATTPAVVKKFFADVARQSPLPVVVYNFPGVCNGVDLDS
                     ETITAIVRESAASRGDGKSNVVGVKLTCASVGKITRLAATLKPEEFAVYGGQCDFLIG
                     GLSVGSAGCIGAFANVFPKTSAKIYELYKAGKVAEALDLQQKAALAESPCKSGIASTK
                     YAAAIYSAPLAGIEGAEEKAKPRTPYEEPGEGAKKTVRELMDSVAKLEVCI"
     exon            1064715..1065698
                     /number=1
     CDS             join(1066861..1067032,1067085..1068490)
                     /codon_start=1
                     /locus_tag="AO090701000400"
                     /note="beta-fructofuranosidase (invertase)"
                     /old_locus_tag="AO070268000031"
                     /protein_id="BAE62112.1"
                     /transl_table=1
                     /translation="MYIKPFILPALAAVAQAASYSGDLRPQTHFSPPSNFMNDPNGLF
                     YDSKRGVYHLYYQYNPTATVAGNQHWGHATSPDLYHWTNQPIALAGDKPEEYIFSGSA
                     VVDSNNTSGFFPDQDDGVIAIYTVDTPTLETQHIAYSRDGGYTFTKYENNPVIDIGSK
                     QFRDPQVVWHPETQQWVMTIAYAQDLVIGFYTSPNLKDWTHASNFTQEGLPGDQFECP
                     NLVKLSVDRAVSEETSKFVLFISVNPGAPLGGSGTFYVVGDFNGTHFTSEVVQETLFD
                     FSKDNYAAQWYSGIPENEPPVSIGWASNWDYTEEVPTGPLEGWRSAMTLPRAHTLTKV
                     NGVWTVTHSPFEGLSALKGRQLVSKSVHSGDVKANFSGVPSNAVYFDVTLKGIDVAKP
                     TGRVNFNFTSSVSGEFLDGGVSLDDSSFWISRAGTHLFTIEDNGNYTSSSTTTISSFG
                     NGTFSFSGVIDRSVFEVFLGQDGIQSGTMTFFPSSPLDTLAVSAEDLGDRASVSVKAW
                     GLQSGWNSTTASKRFRA"
     exon            1066861..1067032
                     /number=1
     exon            1067085..1068490
                     /number=2
     CDS             1069728..1072730
                     /codon_start=1
                     /locus_tag="AO090701000401"
                     /note="predicted DNA-binding protein"
                     /old_locus_tag="AO070268000032"
                     /protein_id="BAE62113.1"
                     /transl_table=1
                     /translation="MAMPGMGSDFQLFSPAQSSDRRESQTDSMVFPQSSPEDSGQDWT
                     QWMRWDDHSFPETTNEITQSPFDFPFTSPGTSIGKQSLGAVQKSEFSPDISLDCVTNL
                     PFDSFLGQDGGGGLPPHRSSNAGTDMQSAQSTTSGSPMSLAGAKRKSGSDDDGSTVSG
                     LAPPGKKMPSKKRAHNVIEKRYRANLNEKIAELRDSVPSLRASRHLVDEDDGEGVTPA
                     NKLNKASILSKATEYIRHLEIRNKRLEDENTALKNRLRQLDKAVDQNVTSAASVSSPS
                     NYTESGASSSPSVFSNAEDVPSDPSPTSLHPPEGMIKVPDAFKRMRAAAPRDESWSQS
                     YIQYPSSGNASPQPGSRKRSHYPNKYMLGALAGLMVFEGMSSEKKTESTAKGLLAIPV
                     NFFNNLQLPPAGYWVTWARSFWYSWHARAISHFLILATLVVGSAFIVFVYLFNSGGPG
                     LQYSSSKSASATLSSSNFRRQAWLTSIQRVGVPRHTFFHEWYVVTSRCFEYVLRCLLG
                     WKLYSWATGITEEDEKGRVKTWDIAIDAQLAGGDAEVSKSRLVLTIFAAGTLPRSPMR
                     MMLKALHVRILLWRVGDPGSWTFNVSNDIARSLARYQWDLARKMNSSLPEDHPDVLPS
                     HLSALLELDSEEVMIDSVIQRAANLTWNRPTQEGTDGDEALLDVVEEDPAIQSSLDAL
                     AAWWSSHLLQRALLRYFEASAGGQDRRKSRDAFKSKLRTALNVAPQPSAAHTRALVMK
                     AVFFEQDRVANINMVLAALPKDKGNTKKAQASNFLDSSLPVSVRDEINIAVRCAMIAA
                     IFTARTTGDTSLPASFTMQKAVSWFNQLPLDPVELTLLGFAATYHLLHVLASDTDYMN
                     SSDSSVPSSPVSRHRSLSDNESDRPAPSHNPKCSPLIPNLSRVASELSYWAKNAYNPA
                     FYGFTSHLVGVVDAECKTLCHSAGVDLIDYSRIQEERSKAIRNKDEKKKKKPRKKSNE
                     DSRQTRWAISNSKPAQCPSPESSREVEA"
     exon            1069728..1072730
                     /number=1
     CDS             join(1074684..1075302,1075359..1075420,1075482..1075667,
                     1075792..1076188,1076240..1076401,1076452..1076843)
                     /codon_start=1
                     /locus_tag="AO090701000402"
                     /note="ferric reductase, NADH/NADPH oxidase and related
                     proteins"
                     /old_locus_tag="AO070268000033"
                     /protein_id="BAE62114.1"
                     /transl_table=1
                     /translation="MGVDQIGPGKQHTRYDHPPMNPALATPLYVLGGFFVVSFLSRSI
                     IRLRHHRRLREILREDKQERFARNGALSAFFNKHVFYAPLWSLRHSREFRLLGRIHMG
                     IIPLRLEAVLLLAYFVLNIIFFFVLANWWSGYEETMYQIKYAAGHLCVMNLPALVLTA
                     ARNNPLIPMLGLQFDTFNLMHRWIGRLIIGEAVVHMACVVASEAKEMSMSKVTHLLWN
                     TPFFIEGFVALIAFMVILFQSTSPIRHAFYEFFLHLHILLAITSFVGLWYHLRGLALQ
                     RVLLVTLILWGLDRIGRLGSIIWRNFGKQRTMATVELLPGDVARVDVALARSWTFKPG
                     QYMYLYMPSLGLWTSHPFSVAWTDDRTNLTEKRGSNDSLSILLGGPKREVMSFLIKRR
                     DGFTNKLLEKVNKSMEGKFTASALVEGPFGGLHSLSSYGTVLLIAGGIGVTHPMSYLH
                     EIMSGFSQKSTAVRKVSLIWVIRSIDHLEWIQPWMTSLLNHPALQVPNEQKSHTYFQF
                     PELSLSIQIYLTVSESTDEYSLDESPWTNSAPPSVPISMVFGKPSFDQILESEKTQQV
                     GAMAVSVCGPGGMGDDVRKCVRDNQGTQTIDLYEASFCW"
     exon            1074684..1075302
                     /number=1
     exon            1075359..1075420
                     /number=2
     exon            1075482..1075667
                     /number=3
     exon            1075792..1076188
                     /number=4
     exon            1076240..1076401
                     /number=5
     exon            1076452..1076843
                     /number=6
     CDS             join(1077379..1077694,1077909..1078642)
                     /codon_start=1
                     /locus_tag="AO090701000403"
                     /note="glyoxylate/hydroxypyruvate reductase
                     (D-isomer-specific 2-hydroxy acid dehydrogenase
                     superfamily)"
                     /old_locus_tag="AO070268000034"
                     /protein_id="BAE62115.1"
                     /transl_table=1
                     /translation="MAPQFRILHIGDNIKYNHDVYARFSSEFEIIQPSAEEREREEFM
                     RALKERRWGDFHAIFRPFWNTGGEMGRWDRELIPLLPKSVKIMASAGAGYDWADVDVF
                     AEHGIIYCNGAAASSESVADMTIFLILSVFRNLVWSHQAAHSANPQAFADAHKNSPLT
                     ARNPRNHVLGIIGLGQIGYMIAQKAHAAFGMKIAYHDLFRKSPEQESRVGATYYKDLE
                     SLLADADCVVVATPFAGKTLLTLERFRQFKKGARFINIARGSLVDEEALVQVLDEGHL
                     VAAGLDVHANEPYVHPRLVKHPRVMAMSHNAGGTVDTHIGFERLAMENIEGFLLKGKA
                     LTPVNAHLLKSKSSL"
     exon            1077379..1077694
                     /number=1
     exon            1077909..1078642
                     /number=2
     CDS             complement(join(1078963..1080133,1080179..1080767,
                     1080855..1080870,1080904..1081218))
                     /codon_start=1
                     /locus_tag="AO090701000404"
                     /note="ankyrin repeat"
                     /old_locus_tag="AO070268000035"
                     /protein_id="BAE62116.1"
                     /transl_table=1
                     /translation="MRLLKTTKSEVGHFEIELFTDEQLHNLPYAILSHTWGPDEVTLQ
                     NINDPLVKSWTGYMKIEQCCAIAYSSGYDYVWIDTCCIDKTSSTELSEAINSMFLWYQ
                     EAKTTFEDSDKMSLRRRVSQCTRIPESILAGERNLDTFSTAQRMSWAAERQTTRVEDL
                     AYCLMGLFGVNMPLIYGEREAAFIRLQEEILKISEDHSLFAWKSSDTRNGLLATSPAA
                     FIDSHDIVPCETFDTFGSPLIISGGGIHVDVCFVGLERIGLGLAVLQCKKLDGMSTSV
                     AIFVQDTSLTFELERFKRVYCDDFRLVDLGSGRITRVKSPRGDEEYNNLEPPHIYPNP
                     IQTQTIEWGSPRVEVYLWLLLTQSNLGAALNAVSNGRTPLSWAAENGLENYVRILLRK
                     GATIEVDSGLVEAPLSLASRNGHTATVRLLLDKGAGVDAKDHKGWTPLVHAILADKVS
                     IVKMLLDYGADINASDKNARTPLMHAIKTQDTTTIKMILNENPDIEAKDDKGQTPLMH
                     AIWTRHIAIINVILSKNPDIEARNREGQSPLIQAIMTQDTATIKVILRKNPNIEARDN
                     KHRTPLMHALNIANRTIIRMLLKKNADIEARNEQGLTPLMLAIIETLNGHISCPTRKN
                     IVEVLILHGADINAKNLHGETPLSIATKEGHGDIVELLLRNGAIRETTRQTPMAWLAR
                     MSQQGILKLFGSES"
     exon            complement(1078963..1080133)
                     /number=1
     exon            complement(1080179..1080767)
                     /number=2
     exon            complement(1080855..1080870)
                     /number=3
     exon            complement(1080904..1081218)
                     /number=4
     CDS             complement(join(1082036..1082772,1082839..1082899))
                     /codon_start=1
                     /locus_tag="AO090701000405"
                     /note="predicted protein"
                     /old_locus_tag="AO070268000036"
                     /protein_id="BAE62117.1"
                     /transl_table=1
                     /translation="MRILCLHGRGTSAQIFKSQTTSFRSRLNDLPITFDFIDAPYPTT
                     PASGIDLFYEPPYYTFWPDDSPTSHQNARTWLLNHIAKNGPYDAVLGFSQGCSLAALT
                     LLLHAHESPLTPPPFKAAIFICGGAPLPLLEELGYTITPEMRSRDTESRKKLSIQADS
                     AAILAKGAERWGGGGDAGEVVDEESVRREIERCGIGKVKIGVPTVHVYGRKDPRFVAG
                     VQLSGVCEGSVRQCFDHGGGHDIPRSSAVSERLAELVRWVLEEGGVA"
     exon            complement(1082036..1082772)
                     /number=1
     exon            complement(1082839..1082899)
                     /number=2
     CDS             complement(join(1083569..1084372,1084463..1086389,
                     1086485..1086579,1086665..1086791,1086848..1087119))
                     /codon_start=1
                     /locus_tag="AO090701000406"
                     /note="Ca2+ transporting ATPase"
                     /old_locus_tag="AO070268000037"
                     /protein_id="BAE62118.1"
                     /transl_table=1
                     /translation="MGIETSPPDVEESTEPPICPYPKESKSHLNNHPSDVKSDLETEH
                     GTPEHSPTSFESASNTSTRQQDFRSSLQYAHTIDPEHLAVILDVDVRHGLSSADSATR
                     LQRDGPNRVREMEGLSVWKILLRQVSNSLTLVLLITMAISFGIDDYIEGGVITAVILL
                     NIVVGFVQDYRAEKTIMSLQRLSAPVCKVLRDGRVSSAKAESLVVGDIVQLAVGDIVP
                     ADMRLLDGMNISVDEALLTGESLPVTKTPHITLTSRDIPLGDRTNMAYSGCSTTQGRA
                     TGVVTATGMMTEVGKIAQLLQDKRDQGSANPFVRAFQNVKSTTKNILGLVGTPLQVKL
                     SKFALLLFGLAVLLALIVFAVNKFDVQGEVLIYGICVAVAVVPESLIAVLTITVAVGT
                     KAMAKGNVIVRKLQCLEAVGGVTNICSDKTGTLTQGKMIARTAWIPLAGTLTVSQTTD
                     PIDPTSGSVQIDEVDWKPDAVQGNIALTTFLNAISLCNLSTVQKEQQSMPSEKDPEHG
                     AQVRWTAVGEPTEIALHVLAMRFGLGKPNILQDSNLQLHTEYPFDSSIKRMTVIYRSL
                     ETSMNEVYTKGAPEAVIPRLNSSEIEKSSIQDTADRMAGEGLRVLCVAYKKVPINNES
                     EVSSRTTAESNLSFGGLVGLYDPPRVETAAAVRRCQMAGIAVHMLTGDHIRTATAIAS
                     EVGILDPVMGAKSSRLVMAAEDFDRLSDIDIDAIEQLPLVIARCSPTTKVRMVEAMHR
                     RNAFCVMTGDGVNDSPALKRADVGIAMGKNGSDVAKEAADMVLTDDNFSSIVKAVEEG
                     RRLFDNIQKVVLLLIALAFKDAEGNSIFPLSPLEILWANLVTSSFLAIGLGLEEAQPD
                     IMYRPPHDLKVGVFTWELITDKMIYGTCMGSLCLVAFVCVIYGKGNGTSSMGHDCNEA
                     WNESCRIVFRARATTYATLTFLLLVTAWEVKHFSRSLFNLDPGRYPGKLSVFHSIWRN
                     RFLFWAVVAGFVIAFPVIYLPAVNRIVFKHQAIDWEWGVVFGCVVVYLTMVEIWKAMK
                     RAFGIGSGKNATLTLEDAETRAGLVSPVLTLTANASVDASVEMK"
     exon            complement(1083569..1084372)
                     /number=1
     exon            complement(1084463..1086389)
                     /number=2
     exon            complement(1086485..1086579)
                     /number=3
     exon            complement(1086665..1086791)
                     /number=4
     exon            complement(1086848..1087119)
                     /number=5
     CDS             complement(1089137..1089850)
                     /codon_start=1
                     /locus_tag="AO090701000407"
                     /note="predicted protein"
                     /old_locus_tag="AO070268000038"
                     /protein_id="BAE62119.1"
                     /transl_table=1
                     /translation="MDSYPNPYSLEIVNSFNPLLEKHFGSVFFNLNGVGNYHRANYFY
                     TNLPWWVNGRDNDHMKAELARRHRAFTRSGASWRRMLVSQPAPPALGYGWQEYGDWTT
                     IYKALITENPQPAALSLDPVFPGEPVSPQPLPISQTGLRFGLLYGPLQYHAGHHQYPS
                     LYFRLVWGRRYAPLLRDAMEHACRQLLEETSAIVQFFHRNNDLEHEPADVEAWDSAFR
                     SEDFQLPHEQLEVVYRNPW"
     exon            complement(1089137..1089850)
                     /number=1
     CDS             complement(join(1090807..1091210,1091263..1091637,
                     1091720..1091905,1091955..1091991))
                     /codon_start=1
                     /locus_tag="AO090701000408"
                     /note="isopenicillin N synthase and related dioxygenases"
                     /old_locus_tag="AO070268000039"
                     /protein_id="BAE62120.1"
                     /transl_table=1
                     /translation="MDIREPPVIDFAPFYGPEGAAKERLINELRQACKQFGFFQLINH
                     TIPASLQESVLQQSKEFFELPISTKEKYKKGLNGDNRGYEGFRAQNFEKRGKGDLKEG
                     FYLGKDLPLDDPQVVTRKFDKGPNKYPLEVSEPAKFRAVMDEYHEAMTSLAMGILRML
                     ALTLELEESAFDAFCEHPIAILRLLHYPPQDPDSSDIERGIGAHTDFGGITILLQDTT
                     GGLQVWNNVSSEWVDVTPVPGAYVVNLGNMMMRWTNDRYLSNLHRVINKSGKERFSVP
                     FFLSGNPDYIVECLPTCIGAGPKYPPITVGQWMAGRYADTYGTSNEEAISDMREVPS"
     exon            complement(1090807..1091210)
                     /number=1
     exon            complement(1091263..1091637)
                     /number=2
     exon            complement(1091720..1091905)
                     /number=3
     exon            complement(1091955..1091991)
                     /number=4
     CDS             complement(join(1092977..1093133,1093213..1093290,
                     1093719..1093946,1093952..1093974))
                     /codon_start=1
                     /locus_tag="AO090701000409"
                     /note="predicted protein"
                     /old_locus_tag="AO070268000040"
                     /protein_id="BAE62121.1"
                     /transl_table=1
                     /translation="MITSSIYNAMTENTFFNDWTNRKIDFGRGPSSMWTLDRLYGEKN
                     SQVDDERYYEYQCIGSAYGTFLCQNVMDSTSRGVMKIFMQDCVNSGIVRGLHETEHVL
                     WDAATYKSYITSFRMSGPAGESDEWRDDELIVWSMAQTQNNRIWFEDPNKHPDMSTWT
                     L"
     exon            complement(1092977..1093133)
                     /number=1
     exon            complement(1093213..1093290)
                     /number=2
     exon            complement(1093719..1093946)
                     /number=3
     exon            complement(1093952..1093974)
                     /number=4
     CDS             complement(join(1095140..1095793,1095864..1096095,
                     1096168..1096335,1096405..1096747,1096804..1096948))
                     /codon_start=1
                     /locus_tag="AO090701000410"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070268000041"
                     /protein_id="BAE62122.1"
                     /transl_table=1
                     /translation="MKDQDIVGEALAAVLPQHDKPWFRVPHLLKLNLILLVPLLSSAV
                     AGYDGSLMNGLQSIPEWKRYFGNPTGSILGVVNAAQSIGSVVSLPVVGWLSDRLGRRL
                     TLLLGSLTIVASSAIQAASVKYGMFVFSRVLVGVGSMLVVQPAPMLITELAYPTHRGK
                     YTSAFWTMDYLGAILASWTCYGTQRNMTDDWTWRIPSIIQAGFPIVQILFWWCVPESP
                     RWLIANDRREEAEQLLARFHTDGDVNHPLVQFEMSEIIHTLSMEARASQVPWSTLVKT
                     PGNRKRTFIAICVGAFAQWNGVAVVSYYLTLVLDTVGITDSDTQTLINGLLQVFNFIA
                     AGSAALLVDRLGRRTLFLWSAAGMLVSFVIWTACSAVFDTSQAAPLGNTVIAFVFIFY
                     FHYDIAYTPLLLGYPTEIFPYSIRSKGVTTTLLSVYSSLVILAFVNPIALENIGWHYY
                     IFFCCFDLLVLAVTFFMFPETKGHSLEEIAQIFDGPSAGTGGLEVGKKDYDETITREH
                     AEYAG"
     exon            complement(1095140..1095793)
                     /number=1
     exon            complement(1095864..1096095)
                     /number=2
     exon            complement(1096168..1096335)
                     /number=3
     exon            complement(1096405..1096747)
                     /number=4
     exon            complement(1096804..1096948)
                     /number=5
     CDS             join(1099482..1099539,1099659..1099817,1099879..1100008,
                     1100063..1100621,1100688..1100927)
                     /codon_start=1
                     /locus_tag="AO090701000411"
                     /note="sorbitol dehydrogenase"
                     /old_locus_tag="AO080549000389"
                     /protein_id="BAE62123.1"
                     /transl_table=1
                     /translation="MRWFTIERLFFIWKLLKYQYSNPSFVLKAVKDVAFEDRPVPALQ
                     DPWDVRVQIAQTGICGSDVHYWQRGRIGDFVLTSPIVLGHESSGTVMDVGSAVKNLKV
                     GDRVAIEPGIPCRHCEYCHSGSYNLCPNDRFAATPPHDGTLSKYYITQSDFCYPIPDH
                     MNMEEGAMVEPVAVACQITKVGNVRANQKIVVFGCGPIGLLCQAVSKAYGAKKVIGVD
                     ISKSRAEFAKTFGADDVFVPPPPPADVSPEEWSEKLAKIIKEQFDLGEGPDVVLEATG
                     AQPCIQTGIHLTKKGGTYVQAGMGRENVMFPITTACIRDLTIRGSIRYSTGCYSTAVD
                     LIASGKVDVKRLITNRYTFEEAEQAFELVRQGKESVIKVIIEGYQGR"
     exon            1099482..1099539
                     /number=1
     exon            1099659..1099817
                     /number=2
     exon            1099879..1100008
                     /number=3
     exon            1100063..1100621
                     /number=4
     exon            1100688..1100927
                     /number=5
     CDS             1101522..1102268
                     /codon_start=1
                     /locus_tag="AO090701000412"
                     /note="predicted panthothenate kinase/uridine
                     kinase-related protein"
                     /old_locus_tag="AO070268000043"
                     /protein_id="BAE62124.1"
                     /transl_table=1
                     /translation="MDAVYAQVVESIYSRAIIHDKPRFLVAIAGAPGSGKTTLANALT
                     ERLNAMPASIRRHTVCVPMDGFHLSRAELDQLPNRKEAYVRRGAPWTFDVSGFIMFVQ
                     RLRKWAEKDTSPFHNQTTPPPSPSSSEILHAPSFDHEKKDPVTDGISITPDTSIIILE
                     GNYLLLDELQWRDVASMVDYRVFVEADLQVARERVAKRHVLAGIEPTLDDGFRRVDQN
                     DFLNAQTISERRLPADLVINGTPEHQSKDN"
     exon            1101522..1102268
                     /number=1
     CDS             join(1102521..1102895,1103042..1103050)
                     /codon_start=1
                     /locus_tag="AO090701000413"
                     /note="predicted protein"
                     /old_locus_tag="AO070268000044"
                     /protein_id="BAE62125.1"
                     /transl_table=1
                     /translation="MIDFAKIYLVHAAGEIHHMIFIVGKSTATLEIPRWPDWKVHRLN
                     KEINDLEVSYEDLGRDNILWNEELGSNADNEMPLLLSLGTGNIWPGQTSTATKRVAVT
                     PGNGCRRRQNHNSVGITKCIALMLL"
     exon            1102521..1102895
                     /number=1
     exon            1103042..1103050
                     /number=2
     CDS             join(1104227..1104558,1104615..1105620)
                     /codon_start=1
                     /locus_tag="AO090701000414"
                     /note="predicted protein"
                     /old_locus_tag="AO070268000045"
                     /protein_id="BAE62126.1"
                     /transl_table=1
                     /translation="MNAQDSSQSEQCFVPETEESRRHRERRARRDWRRRLRLHVISRL
                     TDDNLRDLLTRPAEERDEDRNILDMETVRQYVPLEFEGRPVPDIDAPEELTWATEEAV
                     KKRLCGIESIYAYTWSQPYNRTTRLVALWYGEEEPQLPEFLQDVPYFELRLGRDPRNI
                     RPQVSCKILCVEPQSISAVMQPTRSFSSLGFLGLLEEDTHNGGRVRHVGVTVGHILDD
                     SIEDIVELETDDQMYSVQLHPAPNFERRGRRRPAFRNHLPRFRSCFDSICLLEADTLS
                     AELMDLLHISNAIDCNALFSVPEGIPLVDSLWDPALLDSEHVLKSLTQMLPLEVHKHG
                     AATGQTTGQLVDIEDLENNDSHLKQTLGDDTLAKQLVIEWLSPEKSFARDGDSGSLVY
                     AKKNGKIVPLGIHHGSDEGLRLSYAYLLWSWCEELDRKLGLRLTFCPPGRCPN"
     exon            1104227..1104558
                     /number=1
     exon            1104615..1105620
                     /number=2
     CDS             join(1106569..1106592,1106723..1106819,1106887..1106945,
                     1107018..1107392,1107471..1107668,1107732..1107815)
                     /codon_start=1
                     /locus_tag="AO090701000415"
                     /note="reductases with broad range of substrate
                     specificities"
                     /old_locus_tag="AO070268000046"
                     /protein_id="BAE62127.1"
                     /transl_table=1
                     /translation="MSRLRGYKESTKIGNMVLAQPDNKHVMQAFSLKGKVAIVTGGTR
                     GIGLEITNALAEAGADVAIIYNSSSTAEATAASIAKTHNVRVAAYQANVGDQKEIEAA
                     VQKIVRDFGKLDIMVANSGIATAVAAEDYTTEQWQQIMNVNLDGAFYTAQAASRVFKE
                     QGSGNIVFTASVSAALVNVPQKQAAYNASKAGVVQLAKCLSVEWVDFCRVNCISPGFV
                     ATEILDHHPPELREKWLSMIPASRMAGTYELKGAYVFCASDASSYMTGANLVIDGGYT
                     LP"
     exon            1106569..1106592
                     /number=1
     exon            1106723..1106819
                     /number=2
     exon            1106887..1106945
                     /number=3
     exon            1107018..1107392
                     /number=4
     exon            1107471..1107668
                     /number=5
     exon            1107732..1107815
                     /number=6
     CDS             complement(join(1107968..1108007,1108042..1108835,
                     1108889..1109574,1109642..1110236,1110357..1110380))
                     /codon_start=1
                     /locus_tag="AO090701000416"
                     /note="predicted protein"
                     /old_locus_tag="AO070268000047"
                     /protein_id="BAE62128.1"
                     /transl_table=1
                     /translation="MRVGNADDCDRLLPSCSLCDKFSRRCIYETLSKTPLTRQYLTEV
                     EEELTRTKALLSELLPGTSRDISNGERFIYPEQGTTGDRGLTSEIPNREGSSEQPERT
                     YVPHSNIGSETIPAPEVPSRPSLGVFSASLSNSGQLYDYSDRNQTGISHRANRRSQDA
                     VMSMETPPSAGNVNFEWDERTEDQGGDGFVDGMAILPSRSNDGGYLGTASGAALLRMT
                     NSQSGGERLDMPEPGRPFETASSHPSPSIPFALSSLSQLEPFVDAYFSLYHCSYPIIH
                     EATFRAQFMEVIPRPTSNTWQVLLYVVAALGAFTAAVTPTDVDLALFKAAKARLTIDV
                     LETGSLILVQALTLSSNYLQKRNKPNSGYNYLGLARRTAMGIGLHKEFPTSKASPLAM
                     EMRRRVWYCLYIFDVGAIITFSRPLEFPEQGIETRLPLNIHESGITASTQTAPSPVTE
                     TTVYTHLRAQAMFHLKTNLIYTKITSTSFPSAAELIELDGRLIGDWLASLPYFFNEGA
                     IQAPKFALCHSILRWRYRNLRILMYRPFLVGKWMLNSDQGPDGLREKDDTHVELAIQR
                     CFDAARESVELISSFWAQHQKTTMACWYGVYFLFQAILIPVICLRNNPSDPAAHGWRE
                     QIFQAVNTLESMVPLNANAERFLRVIQSLCGCYLYPRSNGWEGPIQESPETQIANLYP
                     LMWPTLEMAQLDGVDSALLTLCPFFSDNNL"
     exon            complement(1107968..1108007)
                     /number=1
     exon            complement(1108042..1108835)
                     /number=2
     exon            complement(1108889..1109574)
                     /number=3
     exon            complement(1109642..1110236)
                     /number=4
     exon            complement(1110357..1110380)
                     /number=5
     CDS             complement(join(1111497..1111884,1111943..1112214,
                     1112271..1112515,1112568..1112719,1112780..1112971,
                     1113193..1113425))
                     /codon_start=1
                     /locus_tag="AO090701000417"
                     /note="cytochrome P450 CYP2 subfamily"
                     /old_locus_tag="AO070268000048"
                     /protein_id="BAE62129.1"
                     /transl_table=1
                     /translation="MASLHLASIAIGVLTAYLLTKLLTFKKPPAPLPPGPPPKPIIGN
                     LKDLPQNGERDWEHWLKHKELYGRFTQTVILSYTSGCGGILGLIPYSDRSRAIRKAMN
                     KEIGSKVAVSRFNALQEAETRRFLLRVLEAPEELRNHIRTEAGAVVLKLAYGYTVEPH
                     KQDPLVDLADVSMYYFSLVCRYGAWVVDVFPSLRFLPSWFPGTEFKRIGQRSKEAFDN
                     FGGKPYNFVKHQMSQGTHHPSYLSSILESEEIEPGSEKEYVTKWSAASIYAGGADTTV
                     STMASFFLAMALYPEAQRKAQEEIDRVVGNSRLPTFADRDNLPYINATVKEVLRWHPV
                     VPNNLPHLSTHDDMCQGYFIPKGSIVISNIWGFAHDPDVFHDPMTFKPERYLGDNPEP
                     DSHRISFGFGRRICPGRVMADAAIYLNIAQSLAAFNIGKKVVDGKEVEPRVEFQAALI
                     SHPEPYDVSIKPRSSVHEELIRAVEEEYPWEKSHADELVNIKV"
     exon            complement(1111497..1111884)
                     /number=1
     exon            complement(1111943..1112214)
                     /number=2
     exon            complement(1112271..1112515)
                     /number=3
     exon            complement(1112568..1112719)
                     /number=4
     exon            complement(1112780..1112971)
                     /number=5
     exon            complement(1113193..1113425)
                     /number=6
     CDS             join(1117277..1118110,1118299..1118322)
                     /codon_start=1
                     /locus_tag="AO090701000419"
                     /note="predicted protein"
                     /old_locus_tag="AO070268000050"
                     /protein_id="BAE62130.1"
                     /transl_table=1
                     /translation="MDNFFVHTAQSRPDLWKSLEDPTHPLNAAWPLFLDQDIYLQHYC
                     CPLSKIEAFACFQYAIVQIDDYDQEHIIACGRSLPFYWPELAKVGGKIGLAQHPKVLH
                     TLPDEGYDAILSRAFEQYYAREGIFQDTDRPTSFNDPPAARTEPPNALSAISITVSPE
                     YRSRSLAEALILAMKQAAIERNCDAMVVPQRPTRKSEFPTTDMIDYILWPATTVATHS
                     PGTTVRKPDSNLPFDPWLRKHARLGPKVIKVARRSMRVEGSVEEWQQWTGVNIPQTAR
                     QGTQMKIGT"
     exon            1117277..1118110
                     /number=1
     exon            1118299..1118322
                     /number=2
     CDS             join(1120380..1120715,1122540..1123776,1123825..1124336)
                     /codon_start=1
                     /locus_tag="AO090701000420"
                     /note="predicted sugar kinase"
                     /old_locus_tag="AO070268000051"
                     /protein_id="BAE62131.1"
                     /transl_table=1
                     /translation="MVGPTASLTPLSRADGSASYQCPSTGSNILGSVNAPIELPGRRD
                     ALKPEDATVEVFVKPGTAPGGVGERYVEGIIKNMLGKLILGREKGYARRGVVITLAIV
                     GGESVARGDSTPNDVHASDSHPGSCSNSASQKADLRDDAAVLSLPSSPFLPLRSAASL
                     KAHNRNALSTDSIPRQTIMKALASRPSISNPNNSNVPLAASLGLLSNSASTSPPDEKE
                     RRSSNPSSQKLSAALSNLQLGPYLDRLPPTARLAMQSPCFFHQRFDDAVNIQKVLEEI
                     TDDEWLSHSRLVQTATGVREVSKQLQRRPIKRAVRNVMIVTKARDNSLVHLTRELAEW
                     LLSTPRYGSDLGVNVYVDAKLRNSKRFDAPGLLQMEPRFEKMLHYWTPDLCWESPEKF
                     DLVLTLGGDGTVLFTSWLFQRIVPPILCFSLGSLGFLTNFEFENYKQHLNAVMGDVGM
                     RVNLRMRFTCTVFRKDRRKEAEAGAVEEGEQFEVLNELVIDRGPSPYVSNLELYADND
                     FLTVVQADGCILSTPTGSTAYSLSAGGSLIHPSIPGILLTPICPHTLSFRPMVLSDSM
                     LLRIAVPAGSRSTAYCSFDGKGRVELRQGDYVTVEASQYPFPTVVSGSGEWFQSVQRA
                     LRWNTRGAVQKSFYRGSEAGLEGLDEGEDEEWDIDTDAGAAGTDSGIGPSEDGDAGSI
                     SPMKRQMSMLSM"
     exon            1120380..1120715
                     /number=1
     exon            1122540..1123776
                     /number=2
     exon            1123825..1124336
                     /number=3
     CDS             complement(join(1124782..1124892,1124965..1125309,
                     1125445..1125555,1125622..1125723,1125796..1125806,
                     1125892..1125925))
                     /codon_start=1
                     /locus_tag="AO090701000421"
                     /note="GAF domain-containing protein"
                     /old_locus_tag="AO070268000052"
                     /protein_id="BAE62132.1"
                     /transl_table=1
                     /translation="MHNTYPKHNLYTLQYQFFCIIATFFNLITIPPIHYSPTSLQKPY
                     QITTMPHADSSYFGENASKSDIYTQVLEQAQGLVYGQRNWVCSNFSNVASLLWHAYAA
                     LPSPSSSVNWAGFYIRQDKFPNAQTTEKQNQNQKQVLWLGPFQGRPACQEIRFGKGVC
                     GTAAEKRETVLVGDVLSFPGHIACDASSRSEIVVPILVGGETVAIIDIDCTEPDGFDE
                     VDRKYLEDLAKLLAEACDW"
     exon            complement(1124782..1124892)
                     /number=1
     exon            complement(1124965..1125309)
                     /number=2
     exon            complement(1125445..1125555)
                     /number=3
     exon            complement(1125622..1125723)
                     /number=4
     exon            complement(1125796..1125806)
                     /number=5
     exon            complement(1125892..1125925)
                     /number=6
     CDS             complement(join(1126271..1126479,1126530..1126755,
                     1126809..1126851,1126954..1127005,1127058..1127211,
                     1127270..1127464,1127536..1127793))
                     /codon_start=1
                     /locus_tag="AO090701000422"
                     /note="arginase family protein"
                     /old_locus_tag="AO070268000053"
                     /protein_id="BAE62133.1"
                     /transl_table=1
                     /translation="MIAYGLLTLIVSTAAVAREIVFPPIAAIQGSGQVPLGEDDTVDI
                     VTGSHFSGLTTFGHLPYVNCLVDDQAHSTPYDIAILGAPFDTGVTARPGARFGPVGIR
                     LGSRRLQGWNIYTGVNVFESWAKLVDCGDAPLTRLDNTVALKQLDLAHKVISSRPTNS
                     TDRGRTPRILTLGGDHTTTLSALRSTYDKWGPVSVIHFDSHLDTWDPKVLGKVMFKPP
                     ISGVNHGTFLHIAHEEGLIRNTSLHVGIRAPVIRPKGDIRNDIRCGFEIIKARDLDRV
                     GINGIVDQIKARVGDSKVYISVDIDVLDPAYAPATGTAEPGGFTTRELLSILDALHGL
                     PVIGADVVEVAPIYDTTAETTTLAAAEVAHSLLYLMVETPVNDN"
     exon            complement(1126271..1126479)
                     /number=1
     exon            complement(1126530..1126755)
                     /number=2
     exon            complement(1126809..1126851)
                     /number=3
     exon            complement(1126954..1127005)
                     /number=4
     exon            complement(1127058..1127211)
                     /number=5
     exon            complement(1127270..1127464)
                     /number=6
     exon            complement(1127536..1127793)
                     /number=7
     CDS             join(1128644..1128734,1128784..1128844,1128903..1129135,
                     1129195..1130037,1130101..1130423,1131526..1131708)
                     /codon_start=1
                     /locus_tag="AO090701000423"
                     /note="amino acid transporters"
                     /old_locus_tag="AO070268000054"
                     /protein_id="BAE62134.1"
                     /transl_table=1
                     /translation="MTMAKEDDNQQVFSESTGEDARLENLGYEQELKRTFGLLGMIGF
                     SFSVVTSWTALSGVFIVGVTSGGPPVMVFSFIGVSLLTLAVAIPMAEMCSMYPVAGGQ
                     YSWVAALAPPSIARGLSYISGWFMLIGILAMGATNNSIGANFVLGMANLVFPDYTIER
                     WHTVLVAYLVAFMATAINIWGPHLLHRISRFILIWNIGSFLITTIVLLATNDHKQPAS
                     FVFSEFQNFSGWGSSMAAIVGILQACFGMCCYDAPSHMTEEMKSASKEAPKAIILSVV
                     LGAVTGFAFLLTLCFCIGDINTTANTSTGVPVIQILYDSTGSKVGTCFLASMIAIIVI
                     VAGNNLLAEGSRSVYAFARDHGLPFSHIFSRVDSKSHVPVNAVLLTLVVQLALDAIDF
                     GTTTGFETVIAISTEGFYLSYAIALFSRLLGFITGHKTHMKGPFALPQSMSIGLNILG
                     LLFLLFAAITFNFPTDYPVTHESMNYTSAAIGVIGLVSTVTWITTGRKQFTGPQAMSV
                     LNGHERHERGEIGEHHCFCEDCLANEGDDEEEVPSEEELCGLFDLVKWTVCYAEFHGK
                     SVRALHLRRCV"
     exon            1128644..1128734
                     /number=1
     exon            1128784..1128844
                     /number=2
     exon            1128903..1129135
                     /number=3
     exon            1129195..1130037
                     /number=4
     exon            1130101..1130423
                     /number=5
     exon            1131526..1131708
                     /number=6
     CDS             complement(join(1133148..1133685,1133739..1134100))
                     /codon_start=1
                     /locus_tag="AO090701000424"
                     /note="predicted protein"
                     /old_locus_tag="AO070268000055"
                     /protein_id="BAE62135.1"
                     /transl_table=1
                     /translation="MASAAVQLPPSHEPSPLTQKTSAPTSSEKPRHVQTKLYFLKELE
                     DGSHLTPNYVTRPETYERPSVELAVTVHDVSGHELDYTLDKNGFQYYYHESREKDFLD
                     DEKIAREYYPETEQLLKDATGASRVFIFDHTIRRAPKDVRAQSTPQRGPVQRVHIDQS
                     YEAAKNRVSYHLPEEAPELLKGRYQIINVWRPIKPILKDPLTVGDAHTLPDSDLVGIK
                     LIYPNREGETYAVKPNPDVKWYYRYGQTPDLVTLIKCFDSKTDGRARRVPHSAFVNPE
                     TVNEEPRESIEVRALVFHPDDQE"
     exon            complement(1133148..1133685)
                     /number=1
     exon            complement(1133739..1134100)
                     /number=2
     CDS             complement(join(1134546..1134687,1134736..1135136,
                     1135192..1135920,1135998..1136348))
                     /codon_start=1
                     /locus_tag="AO090701000425"
                     /note="amino acid transporters"
                     /old_locus_tag="AO070268000056"
                     /protein_id="BAE62136.1"
                     /transl_table=1
                     /translation="MSNTEIEPLLDSAAPGYDTVHDPSYDSPPDALHSGFQNKLPEAP
                     SHRKALNWSSAYILVISRVIGSGVFATPGSIVKSTGSIGLTLLLWLVGTILAACGMAV
                     SMEFGCMLPRSGGDKVYLEYAYRRPKFLASTLIAVQAVLLGFTASNSIIFAKYILFAF
                     NIEPTEYQHKALAVGLLTLITIVHGCFLKTGIWIQNILGWVKIFLIMAMSLTGIWVIL
                     LRPYDESMSESDRVVTNNPFAWDTLWEGSNWSWSLISTSIFKIFYSYAGLNNVNNVLN
                     EVKDPIKTVKTVCPAGLLTAGALYFLANISYFLVVPLDEIKNSGELVAGLLFERLFGA
                     HVGRVLFPLAIAISAAGNVMVVTFALARVNQEIARQGFLPWSHLLSSSRPFNSPLGGL
                     LVHYIPSILVISLPPQGDVYNFILDVEGYPGQIFALAITVGLLIVRRREPFLHRPFKA
                     WTWAIWLRIVVCIALLAAPFFPPPDRKGDVHFFYATYAIVGAGVILFGIVYWYIWTVL
                     LPRWGNYQLEEEKGVLEDGTGITKLVRSYRIT"
     exon            complement(1134546..1134687)
                     /number=1
     exon            complement(1134736..1135136)
                     /number=2
     exon            complement(1135192..1135920)
                     /number=3
     exon            complement(1135998..1136348)
                     /number=4
     CDS             join(1137591..1137880,1137992..1138434,1138488..1139026)
                     /codon_start=1
                     /locus_tag="AO090701000426"
                     /note="predicted protein"
                     /old_locus_tag="AO070268000057"
                     /protein_id="BAE62137.1"
                     /transl_table=1
                     /translation="MTAVSTYAPLVTLSEKQQTISYQEIYPEQRSEPTFANPNVQEEI
                     RPQLGRATQRALLLKAAREQYTLVTDHAIPSISNKDEILVKVLQSVFQGWTCRAFNFG
                     IPSLPWVNGRDLAGVVVKADRSSRVQEGDIVLVPSTDYRDIRKAAFQEYAIATHFNAA
                     RIPPTQSIHASASLGVAYVASALALGVSLGLDFSHASACPGPDLTEVVRQLDTDTIPA
                     DIRDECYSGLSKIEKVKPGDWIAIWGASTTTGYITLQLAKLAGLKVICVADIARHGAR
                     LVDLGADALVDRHDTQRAVDIIKGLTKGKLRYAIDIVGKDTATLLQQTLDDAVREDGS
                     HAHLLGLTGLPKDRGSNVIYHTVPIKLFHTSPQVGERMVSWLEDLLHSGALQLPEIIR
                     TDGGLGNVNASLELLRQGTASGKRIVVDLAG"
     exon            1137591..1137880
                     /number=1
     exon            1137992..1138434
                     /number=2
     exon            1138488..1139026
                     /number=3
     CDS             1139854..1141305
                     /codon_start=1
                     /locus_tag="AO090701000427"
                     /note="coenzyme F420-dependent N5,N10-methylene
                     tetrahydromethanopterin reductase and related
                     flavin-dependent oxidoreductases"
                     /old_locus_tag="AO070268000058"
                     /protein_id="BAE62138.1"
                     /transl_table=1
                     /translation="MGSIDKPKKQLILNAFAMQSPSHLNPGLHRYPKDQGGAYKSLQH
                     WVTLAQKLEAAKFHAIFFADVLGGYDVYKGPANLDPTIPAGAQFPINDPLYSVPAMAA
                     ATESIGFGVTASTTYDAPYALARRFSTVDHLTNGRVGWNIVTSYLDSAARNFGLNTQV
                     EHDERYRIADEYLDVTYKLWEGSWRDDAVNVKDGVAGYADPKAVRQINHEGKYFNVPG
                     PHLCEPSPQRTPFLLQAGTSTAGKAFAAKHAEAIFLHGQKPELVRPSVDNVRQQAQAQ
                     GRDPASIKVVAGILAIVAETDEAAHAKFAELAQYGDPEGALALFGGWSGYDLSKYEDN
                     QDFRFVEQPAIRSMVNHWASTVPGTEGKKWDKKTISEYLIMGGNGAKVIGSAKTVADE
                     LERWVEVGDVDGFNLSYASIPETFDDIIKYLIPELQKRGIFHTDYAVKGGTFRENMYG
                     EKGQARLPQSHPGAKYVWHAGEETPKYALEKNT"
     exon            1139854..1141305
                     /number=1
     CDS             complement(join(1143438..1144742,1144797..1145057,
                     1145114..1145428))
                     /codon_start=1
                     /locus_tag="AO090701000428"
                     /note="predicted flavoprotein involved in K+ transport"
                     /old_locus_tag="AO070268000059"
                     /protein_id="BAE62139.1"
                     /transl_table=1
                     /translation="MAAVEVSVVSDRNIPLLNGHAQSHTPVAVSTDIKGPVASTVIEK
                     TEEVAPQGRPAFELEDHPIDEVRNIKVGVIGAGIGGITAGILLPAKLPGLDLRIFDKN
                     ADVGGTWYENTYPGVRCDVPAHVYQSGFAPNTQWTEEFAQGHEIRDYWQGLARKYQVY
                     KYIRLQHKVEEAIWVPETGKWRVTVRDIGIGRVYVEHLDVLINAIGHFNDWQLPNYPG
                     IDQYTGTIFHSSHWDHDADLKGKRIALIGNGASGLQVLPSIQPVAQHVDHYARNRTWV
                     ADSFGTTGVRRLEPNLFSREQLESFKDPDTYIKYRKSVEEGYFSRFGAIFKDSPENQA
                     QRDTWTQLMLQRITEKPELADKILPEFPPNCRRATPGPGYLEALTKDNVSYIQTPIER
                     FTATGIVTADGVERPVDVVICATGANVDHAPPFSIIANGIDLKKAWKHDGLWGFPYNY
                     LGIATPGFPNLLWIGGPHATGHSGSVPNSMENLVTYIAKVLRKIRSQGIKSMAPSKQA
                     TDDFVEYSDTFYPRTVWTGNDDSTPGQKNCRSWYNGGRPGGRIHGLFPGSAATLNYIR
                     REPRWEDWEYAYTNPSGNRFAYFGNGWTRREKYLDADLVPHVKRPDTIDLTTYMEGWW
                     DV"
     exon            complement(1143438..1144742)
                     /number=1
     exon            complement(1144797..1145057)
                     /number=2
     exon            complement(1145114..1145428)
                     /number=3
     CDS             complement(join(1146029..1146543,1146594..1146995,
                     1147045..1147261))
                     /codon_start=1
                     /locus_tag="AO090701000429"
                     /note="predicted dehydrogenases and related proteins"
                     /old_locus_tag="AO070268000060"
                     /protein_id="BAE62140.1"
                     /transl_table=1
                     /translation="MSPIRVGLIGLPSASGENYEGTSWSVNAHLPFLTKSPNFEIVAL
                     LNSSVESAQTAIQKYGLPNETKAYGDPQDLANDPDVDLVVCSVRVDRHFLTVRPSLIA
                     GKAVYVEWPLDRNLEVAQEMATLATKHNARTIVGIQGAFSPIIRKMRSVIESGEIGRV
                     LASTITGSFGNNVDAESKNVRYFLDRDIGGNPITIHVGHSLEYIAAVLGEFKTLRSFS
                     SISRPTIDIKDYSVGDTGKVVEAGARNTVPDQILAYGTVEPSDAAVTVKFHAGKEFPG
                     QPRLDWRIQGEKGWLRLASPLVSLNVGGPGIKLEIARNETNTVEEILPEADEWDELPV
                     PAQNIARLYEAYRKNEWHPTFDWALKRHEALDRIWKEFDAESH"
     exon            complement(1146029..1146543)
                     /number=1
     exon            complement(1146594..1146995)
                     /number=2
     exon            complement(1147045..1147261)
                     /number=3
     CDS             complement(1147717..1148637)
                     /codon_start=1
                     /locus_tag="AO090701000430"
                     /note="nucleoside-diphosphate-sugar epimerases"
                     /old_locus_tag="AO070268000061"
                     /protein_id="BAE62141.1"
                     /transl_table=1
                     /translation="MSKRIIVTGGSGKAGQYVIHHLLAQGYSILNLDLNPLPPPLNEK
                     VHTLKVDLTDNGQVHGALLSHFRLTEPFREPHQQVPDAVIHLAGYARNMIVPDTETYR
                     VNVLSFYNVIEAACRIGVKKIVLASSITVYGVTYAEGDVDYPSFPVDEDVDANPMDVY
                     ALSKVCGERTARSFARRFGNDIYVMRLGAVVGPDEFQEKFDGYVERPEEYKVHGWAYT
                     DARDIGLMFERCLVTDGLGFEIFNAVNDDITNFAESTMAFLEKMCPNIPITRQMEARE
                     APVTNRKLKRVLGFKQTCHWQDLYITAGNR"
     exon            complement(1147717..1148637)
                     /number=1
     CDS             1149497..1150336
                     /codon_start=1
                     /locus_tag="AO090701000431"
                     /note="predicted protein"
                     /old_locus_tag="AO070268000062"
                     /protein_id="BAE62142.1"
                     /transl_table=1
                     /translation="MSTSTPTLTVYDILMREPVSENACSPNPTKTRQTLNFKSVPYKT
                     TWIDMPDIAKTRKSLGIPAGRKFADGSEFYTLPVLVDTATNSKIGDSFDIAVYMHETY
                     PSVGGDLFPQGVELDFRTSNTAMLVPLSELSEVARRERYIRYAEFNTHVDAAFTAHTI
                     LNVMGLPFNPETAEASKAEFCRRAGMPSFEAFNVTGEARRGIMDSFEKTLGDLARLFV
                     RNQTGPFILGDKPCYADFIVGGWLRMFSVCLPREEWEEVRGWHGGVFGELFDGLRGFY
                     EIK"
     exon            1149497..1150336
                     /number=1
     CDS             complement(join(1151899..1151962,1152193..1152515))
                     /codon_start=1
                     /locus_tag="AO090701000432"
                     /note="predicted protein"
                     /old_locus_tag="AO070268000063"
                     /protein_id="BAE62143.1"
                     /transl_table=1
                     /translation="MTPGCRSEKIFVAFWTFLLSGLCHVIADWQAGEPCHPHDDLLFF
                     VANFMASALELLVVRRLERVKGYRADHDKDIWSVLLKTTNRVVGYVWVLGFFFWITPK
                     WQYPKLKCSASDTNSVVFDLAAPQGE"
     exon            complement(1151899..1151962)
                     /number=1
     exon            complement(1152193..1152515)
                     /number=2
     CDS             complement(1152735..1153148)
                     /codon_start=1
                     /locus_tag="AO090701000433"
                     /note="predicted protein"
                     /old_locus_tag="AO070268000064"
                     /protein_id="BAE62144.1"
                     /transl_table=1
                     /translation="MNVLWALFACVWIQHAAAVRYFDQLRVPQTASPWLAIYKIWNDP
                     QRRMSTGLPPRYKRSISSPSRISFTFHRLAKIILCWALQLFIIGPLVPLYFNFTAQDF
                     APSRKVFLRRLLPLHNNHHLITLREIQIRLFLSIY"
     exon            complement(1152735..1153148)
                     /number=1
     CDS             join(1156410..1156454,1156727..1158193)
                     /codon_start=1
                     /locus_tag="AO090701000434"
                     /note="protein phosphatase 2C/pyruvate dehydrogenase
                     (lipoamide) phosphatase"
                     /old_locus_tag="AO070300000001"
                     /protein_id="BAE62145.1"
                     /transl_table=1
                     /translation="MAARPWITLLRLVNLSTMLSVRVRGTRLASRVTRTSLSQTQVRN
                     FHSRKDTAPAINKTWRSFAIAGAVSAPGFWLLTSTRDDDVPRLEAPPTGHLVAEPGPS
                     KEEVTRIISQDAYSFPVRSVTGVNRYDGTQLASNSLCEDRFTHGIFPSPLNDGTQWMA
                     WAVFDGHAGWQTAELLKDQLLLFVRHSLSKVKSASTGEKSMPDEVLQHAIVKAFLDLD
                     DSIVKTALQTAQSSEPLQDKLKKLAPAYAGSCALLSMYDSVTGSLHVACTGDSRAVLG
                     QQKPDGTWEAIPLSVDQTGSNEDEVARINQEHPGEENIAKDGRILGMMVSRAFGDSRW
                     KWSLDLQQDLKQRFGGPSPLTPKYDVRTPPYLTAEPVVTTTKIDPGKPSFVILATDGM
                     WDTLSNQQAVDLVGKWLDAQIHGHPISQPKTEYKRVDFGDLGNGVDWEFEEGRTTIQD
                     DNAAVHLVRNSLGGNHHELIAGRLALGSPFSRHIRDDVTVQVAFFNCPHLLPK"
     exon            1156410..1156454
                     /number=1
     exon            1156727..1158193
                     /number=2
     CDS             complement(join(1158577..1159421,1159478..1159850))
                     /codon_start=1
                     /locus_tag="AO090701000435"
                     /note="pyoverdine/dityrosine biosynthesis protein"
                     /old_locus_tag="AO070300000002"
                     /protein_id="BAE62146.1"
                     /transl_table=1
                     /translation="MNVTATTSRVVAEAPVDLTVERIVNLFDKELRYRVKNDQWETQG
                     REYFASKVQFFVQHNSTLQLCLPAFPCKSSNPEKVMGVLPDRGEEIALRRLHAFAHKI
                     EQIYPPGARILIISDGHVFSDCIGVDDETVDKYGEHLKVLNRAVSIAMGEDAEQVQFQ
                     SLVDLFDLTSPSPLTSPNLVGMLSLPKLQHYLSTNLDDIAEFCRRILVAGCQPSGESL
                     RTQIESGDESTLALYRGFSRFMLQDLDRHPLTQSLSRSQRKKLATKVSFEMILRNQAY
                     SNLIELMFPDCLRLSIHAHNNSGPKFGIRLFDTATVRAIRQLDSVGSDDNNGDDESAA
                     IASHLLHIPTPWHNCIVEVAGDPKLYIVKYGVIKNGSFNDKYSSELVKGNLAKGEGAF
                     VSLKRPLNSVRTA"
     exon            complement(1158577..1159421)
                     /number=1
     exon            complement(1159478..1159850)
                     /number=2
     CDS             join(1160825..1161472,1161531..1162415,1162505..1162558)
                     /codon_start=1
                     /locus_tag="AO090701000436"
                     /note="cytochrome P450 CYP4/CYP19/CYP26 subfamilies"
                     /old_locus_tag="AO070300000003"
                     /protein_id="BAE62147.1"
                     /transl_table=1
                     /translation="MVMHGLCIIIGKALAVGILFLSICIFSRIVPPRYPRNIPAVPFW
                     VTLLSLVRDIDQEDIYRRHIQKPLQTHGAIKIFFAGQWNLLIQRSSYLNEIFRNEDVY
                     QKSGNQKKIPHSVLAEFLGRFPVSPSVALLLTLGPKGDNVISSRGTTWRLYRDIITPG
                     LQGHFDAGLIAANAEELCSSLLAFQNTVGNCGVPVQDLLQQFTIANVSQVLLQANHKP
                     TKGDESSLHQLQLAVKREIFKPIFMNFPVLDRLGKLIPCRVRARNVVEQFSAALQYGV
                     RHGQGTPNASNLGARLMAARDGGVLTGKQFRDNLNVLFVAGQENPQLLLISMLYLLAK
                     HPVSVSCPLKSMELMSQDVQSRLRREIDACSTLDPSNVAFSELPYVTCVIYESLRLLP
                     PISQLINRRTSQDVILGNQIYIPKGTYVGYNCYSTNRDPAVWGPTADEFRPERWGQSN
                     TEISQCYRQRRARAEFVSFHGGSRACLGEKFALLEARVALFVLVSRLSWSLDPEWPDR
                     KTPAGPLYPRALRLIFTERK"
     exon            1160825..1161472
                     /number=1
     exon            1161531..1162415
                     /number=2
     exon            1162505..1162558
                     /number=3
     CDS             join(1164179..1164331,1165511..1165876,1165934..1166128,
                     1166185..1166320,1166372..1166935,1167009..1167295)
                     /codon_start=1
                     /locus_tag="AO090701000437"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070300000004"
                     /protein_id="BAE62148.1"
                     /transl_table=1
                     /translation="MPPTLLATNARTLTVKPFFHVRFVSGSAAGDAECKPPTERMKIG
                     IYDASITNTNCFVCVRRTGWFFDILAMTSPTTSPPNQPCSVAKEEEPSKLVTAPAKSP
                     ASAVIQPPPYTAFSRPKRVFILAVVTVAGFLGPLAGNIYLPALPVLEHEFQVSAAAIN
                     ATVSVFMAVFGFGPLFWSSYADWKGRRPLYLISLIVYIIANVLMAVLPTNFGALVFLR
                     IVQAFGSSAVVSMGAGTVADITQPKRRARAMSYFMLGPQCGPILGPILGGAIVGQASW
                     RWIFAFLAILAVVLWPIMLLFQPETLRARVGNGKPYSNKGWILWPPTPFSCLAPESER
                     GPPPPKPTLKGYWRLFTYPPIGIVSVNTAILYSSYFGIAVQLPTALENVYHWNSTEVG
                     AGYVAVGIAMVVGSIAGGRWSDWRRARMVNALGEDKVTPEARLRDQIGGILLCAAGFA
                     MFGWFVDRAIHPAAVLFSTFLVGFGMSWIFVTTNAFLTECIRQQAAQAFALGNMLRSP
                     AAAVTAAIIHPLTVRMGWGWCFTGLSILNFVLVGSAMVILRVKSPDWRRRRSAHMAGN
                     "
     exon            1164179..1164331
                     /number=1
     exon            1165511..1165876
                     /number=2
     exon            1165934..1166128
                     /number=3
     exon            1166185..1166320
                     /number=4
     exon            1166372..1166935
                     /number=5
     exon            1167009..1167295
                     /number=6
     CDS             join(1167835..1168020,1168092..1168208,1168313..1168659,
                     1168708..1169261,1169340..1169707)
                     /codon_start=1
                     /locus_tag="AO090701000438"
                     /note="permeases of the major facilitator superfamily"
                     /old_locus_tag="AO070300000005"
                     /protein_id="BAE62149.1"
                     /transl_table=1
                     /translation="MEKIAGSTVLSDVGESNSELGTEDERRKALLQSFTPEEDKQIRR
                     KIDRRFLFLIGMMYIIKTIDYTNAASVKVLQVGEDRNILNELRMTSDEYNWVQSIYFI
                     SYIVFEVPSNLLLKRLTPRLWQSRIMLTWGIVLACHAAAKNKETLWAMRFLLGMCEAG
                     MFPGIAAQLCGWYRSDEMGKPIMWMFGFQNTSGIVGSLIAYGISYMNGLCGMSAWRWV
                     YLLEGLFTILFSGVIYLVLPDWPKSPRTRKWLSEREQDYVEARLSENAPKTADSDFSK
                     EEVIASLKDPRTYAFMLSQVLVNFSGYALTWELPTITTSLGFAGLPRNQLLNIPPSAA
                     AVLAIIFSGWFLKQAYITRPAYTMFCIMGPMLVFFILLTVLESRVGIYISCVLGNMFY
                     SVYFIPFWAWRTSSLKGTTGAAFTLAFQSCVGQVGGVIGPQLFQSKFAYNGYKTPFGI
                     CAGVIGAACLANLWTWWLTRNVEWDVRRIRRLRIKEERQGRIYADDDVKVYQERQFYS
                     GVAKKGSETNAVEAV"
     exon            1167835..1168020
                     /number=1
     exon            1168092..1168208
                     /number=2
     exon            1168313..1168659
                     /number=3
     exon            1168708..1169261
                     /number=4
     exon            1169340..1169707
                     /number=5
     CDS             join(1170261..1170530,1170584..1170685,1170868..1170951,
                     1171007..1171094,1171204..1171237,1171291..1171358,
                     1171418..1171646,1171694..1172149,1172274..1172292)
                     /codon_start=1
                     /locus_tag="AO090701000439"
                     /note="permeases of the major facilitator superfamily"
                     /old_locus_tag="AO070300000006"
                     /protein_id="BAE62150.1"
                     /transl_table=1
                     /translation="MGDTKDNVISEQSSVHDDRKDNTLHYASRGQALSDESTGAGDIA
                     GFDAEWMRARTSLTADEEKKLLRRVDWHIMPLCAIMFLLKNIDSENVANAKIMNKGTD
                     RNILTQLGMTTDQYNLVTVLYYISWGIALACHAAVKNKEGLYAVRFLLGLFEAGLFPG
                     VILQLCYWYRPDEMSLRLLYFFSGSHGLSGWQWLFLTEGVITVAFGISLIFIFPDFPP
                     QAKWLTDKEKAFIQARLPGNAPRAEEINFNFREILDSLRDRRLWLFTLIWAFFTVGTH
                     GLRFYQPTVIANLGFTDIATSQLLNIPTSVLTVICIGVFGIWADSSRLPRPLYPLSFL
                     AVILACYGVLYSFPSNGAVYAVTVIANALGSAWYPLMWPWRVQTTSRATGSAFSIKAW
                     RGQEYNCLSVVQQLSGEAIARSQCISRSIRPASNIVPGDAHLHIFAISSVWPEVRKD"
     exon            1170261..1170530
                     /number=1
     exon            1170584..1170685
                     /number=2
     exon            1170868..1170951
                     /number=3
     exon            1171007..1171094
                     /number=4
     exon            1171204..1171237
                     /number=5
     exon            1171291..1171358
                     /number=6
     exon            1171418..1171646
                     /number=7
     exon            1171694..1172149
                     /number=8
     exon            1172274..1172292
                     /number=9
     CDS             1172480..1173193
                     /codon_start=1
                     /locus_tag="AO090701000440"
                     /note="predicted hydrolase (HAD superfamily)"
                     /old_locus_tag="AO070300000007"
                     /protein_id="BAE62151.1"
                     /transl_table=1
                     /translation="MSQLQDYRLLTFDVYGTLVDWEGGILAALQTSLHRNDTQLSREH
                     ILHVFHELERDQQARTPEMQYSDLLSTIHPTLLQQLGLPTPTAEESKAFGESVGHWPA
                     FADTVDALKQLSKHYKLVVLSNVDRESFAKTNAGSLQGFPFDLVITAQDIGSYKPDIN
                     NFKHMLSAVKERFGVEPSQVLQTAQSQFHDHHPARKVGIKSVWIVRPGAIMGNLDETV
                     YDWKFDTLGDMADAVEAGN"
     exon            1172480..1173193
                     /number=1
     CDS             1173589..1174338
                     /codon_start=1
                     /locus_tag="AO090701000441"
                     /note="predicted protein"
                     /old_locus_tag="AO070300000008"
                     /protein_id="BAE62152.1"
                     /transl_table=1
                     /translation="MSPPPRKKSLRLRLYQWLWRLRNISSPLRLRGSLVRLRRFHESP
                     LLALIRLLIPFPQWKFPVPDPVAPIDILGNVELEENKLEYLDDLRSIPLWRLRDTPMR
                     SLYRMYEAMLSGLYEALGPETEYFWYQRNWSLQGIRDPQDADPVRYAILACLVEELVV
                     AFNWRLSLGLRRDRNHIMRETGKDSLPPYAPLSGPIWTSSVPAISPKDLDRFPPEYVS
                     DDRKLVLEADGLNKVFARRNIVTNVGWLYTI"
     exon            1173589..1174338
                     /number=1
     CDS             complement(1174514..1175224)
                     /codon_start=1
                     /locus_tag="AO090701000442"
                     /note="predicted protein"
                     /old_locus_tag="AO070300000009"
                     /protein_id="BAE62153.1"
                     /transl_table=1
                     /translation="MQKRKQYLGAEDFYNGKRSAPFLNTMKVSVPNPMLGLRLLDSKL
                     AAIPIIVAFAPIKVIAAGGFFAVAHLKNRQTTKDLDYLLEPDWANDDDIKQSLREAIV
                     QVADELGYPQNWANDDVALFVTKQARQLLMDLALKQNIVLWSGNQITVLSAPVEWALE
                     RKLRRIYAADRGRKAELDLSDALAMLNLLKNDKGGRLDMEYYRTLNINGFDVVPDRVT
                     MQRVSAAYKAKYNDEVFF"
     exon            complement(1174514..1175224)
                     /number=1
     CDS             1177225..1180206
                     /codon_start=1
                     /locus_tag="AO090701000444"
                     /note="predicted membrane protein"
                     /old_locus_tag="AO070300000011"
                     /protein_id="BAE62154.1"
                     /transl_table=1
                     /translation="MPDPKSSDAADHPSGSQQGRRFKLPGWLDHFNVRDLKVLFRCWA
                     AAWVASLLIFIGPALHKIGIATFFGALVLYIVPPAGILFVYLLAALSLLFGMCLAWAW
                     GLLTMKAALAARPDAQTKAMVQALQQQAVAIGNQTGTSPAAEAKVLVYDGFMLDARVT
                     VVFYVMICVFIYFMSRVRVANPKFALAQIFGIIIADLFLLFGPSLPSFTASLPEVLIK
                     PGAIGIGLGFACCLVFLPQSTSFVALTQMEQLVRLGEIPLKCTRQRFAGESLDLQQLT
                     ATKAKIIGAFKAMQPSLAFLPLDFSRGRWSSDDIKTLQEPLRQAILSSVSLMDYHITL
                     LRSDQKLQGIQPLSQQGSDKSYMQEKRVREVGQYQLQESADLLQALNSPEHGVSRART
                     REALRKSTTELLELCSETSELLVQCLHAVNSGRWFRRAASRNHLDELVMKADTVLQTL
                     QSTRSSCATETTEALLDSHADLFDENGHLKAPEHLGPHALRGIILGMVMEERILGTAE
                     TLERLLAQVHRLMQARTQERIWIPSGLRYAFSWLVNPRQKAPADDLTAAPATDPDDAE
                     EQAKEAHRRLNISRGYGRPIRQSLLVRALTGFYHWFTNPGGMYALRMVVVTIAVAIPA
                     SIPHSAGFYYREKGIWALITAQTTLLVYMGDFTVSLVGRTIGTVVGGVLGMVAWYIGS
                     GNGPGNAYGLAAITAVMTAILMWWRLFLPPIFTMAAIMGGATFVLVVGFSYDDTHTWQ
                     YGLPGHGYEAFWKRLVTVLLGFVAAFIVQIFPRPPSATRHICKTLSNTIRTLSDHYAL
                     LLSHWGRPETNSPIGAVAEKIAVEVAETLLSIQGSIGLLKFEMTFGPFHREALANMHV
                     LCQDMNQALGRLLILSTSLPEHLQERFAQNVSLLNDHHIGDIMAVLSVIEQALKSGLP
                     LPERLPTPLVKRCFEQWYAQHRAAELSTTLVRDENYRRYCVAISSYLKFLSAIDDMVL
                     VLKGTLGESHLIERWQGEVPV"
     exon            1177225..1180206
                     /number=1
     CDS             complement(join(1180523..1181047,1181111..1183747))
                     /codon_start=1
                     /locus_tag="AO090701000445"
                     /note="predicted protein"
                     /old_locus_tag="AO070300000012"
                     /protein_id="BAE62155.1"
                     /transl_table=1
                     /translation="MTSQTLPGSPFTKGAKATPQHGKAFKSSSDVIGGEQRQQVMPGK
                     RRASGSSGSPIPQEGNDMNAQLGGIAASPAQSASGSVPIGKTAMNEPRRDAQGNVEQF
                     KPSGGQAREELHKTASSAPGDLPTSLSALEGLQVSDGGHILDQNGQTVGQVVEGDPED
                     LVGMTIGSDGEILDEDGDLVGRVDLLSKPGDAVEEKAADAGEAPSLGAARVNISFKIG
                     EDGRVMNDDEQPVAKVVDGDPRQLVGKTPNEQGQIYDEKGELLGRVEPLSTEEATGAI
                     DEKLEGTKEQAGDTAHMADDTAAEGEAAIDEKLEGTKEQAGDTAHMADETAAEGEAAI
                     DKAGATATEELPDVSTLEGLTCNKFGNIVNADGVPVGELIEGDPRILCRGGFQLDDQG
                     QFWNNRGKVIGKARPVPVEESPPGPFADLDDLFVVEDGWVQDANGRRVGKIVDGDPKK
                     LIGRAVDDDGDVVDKRGNLLGHAEPWEEPDEPEPEKPDLSMLEGYRSNKYGNIMGSSG
                     VPIARVVEGDLKAVAGRPVDREGNIWGDTGEVIGRVEIIPENERETRGPFSGFRDLQV
                     NQDGFIDDADSVIVGRVKDGDLSNLRGLTVDEQGNIIDEYGDVKGHAERYDPPEEQVE
                     EEDLSSLEGKTVNKLGNIVDTHGTVFGRVASGYIKHLAGKKVDARGQIWSDSGKVIGQ
                     AELIPDNEQERPEGPFFGLEGLVLTKDGMVIDPEQKIVGRLVEGDPQRLAGRAVDEDG
                     ELLDKAGNVIGRAEPWTPEEKQRDVNPMAGHKVNREGEVRDGDGNLIGKLTDGNLQQL
                     IGKEIDDNGYVVDNDGNKIGECTLLENLPEEEEPEQEPELSPEELEKQEKEKQDRDLA
                     KRMCAILQQTLDSVQPICKQIMQNIEKANQTPKDELDEEELVKTVKPLIEEAASMLQE
                     CKGALRALDPTGEVAATAKARDAAHEATPEQYSLANLLKELTQTVVETIDQGRRLIAD
                     MPHAKKQLNPLWALLSEPLFQIIAAVGLLLTGVLGLVSNLLDGLGLGGLVRGLLGSLG
                     IDKVLEGFGLGTLTDALGLGGSK"
     exon            complement(1180523..1181047)
                     /number=1
     exon            complement(1181111..1183747)
                     /number=2
     CDS             join(1186789..1187429,1187500..1187506)
                     /codon_start=1
                     /locus_tag="AO090701000446"
                     /note="predicted protein"
                     /old_locus_tag="AO070300000013"
                     /protein_id="BAE62156.1"
                     /transl_table=1
                     /translation="MAESPKTSHIEDTKPDSTTQQSPGRRRPPKLRKQQVSAEESNKQ
                     QSTSPGTAKSPSPDKPQTPPPNQVREKESMEANQEDTESVDAPSSGPEMQPEPQAAAP
                     PPETRVEERPAQNIPRRRRRRQGQQEMVPLGNVGDVGNTVNEAGELVQAAGSKAVNTV
                     TDTAGKVVGGALSGGQSEEKKGKDEQLRLRLDLNLDIEVQLKAKIHGDLTLQLLK"
     exon            1186789..1187429
                     /number=1
     exon            1187500..1187506
                     /number=2
     CDS             complement(join(1188138..1188619,1188758..1189061))
                     /codon_start=1
                     /locus_tag="AO090701000447"
                     /note="dienelactone hydrolase and related enzymes"
                     /old_locus_tag="AO070300000014"
                     /protein_id="BAE62157.1"
                     /transl_table=1
                     /translation="MRVLVHLADQTVQVLSASHGTDHKRHIVKRRVGAGLGTGDRLDF
                     GYRAYSYPGMSPGFAESDLNNYDPVATEIAWTRTLSVLQSGFQKHLDLEKTWEGIEQV
                     TYIPTLKGASGIQALHQFYKTSFLQGRPPSMRLRLLSRTIGADRVVDELYVAFKHTQE
                     MPWILPGLQPTDRQVEIVLVSIVTLRGGKLYSEHIYWDQASVLVQVGLIDRNLVPEQA
                     KGITALPIIGREAAKKILLHDQEESTEPETASMVAQVDGLDIH"
     exon            complement(1188138..1188619)
                     /number=1
     exon            complement(1188758..1189061)
                     /number=2
     CDS             join(1191157..1191244,1191310..1191411,1191492..1191616)
                     /codon_start=1
                     /locus_tag="AO090701000448"
                     /note="predicted protein"
                     /old_locus_tag="AO070300000015"
                     /protein_id="BAE62158.1"
                     /transl_table=1
                     /translation="MYSKKNKAVLPYISPDQVSKRNGVDNSEIWLVIDDIVYDCTSFL
                     SGHPGGEAVLRRFAGFDCSWQYHAIHGERRKVFANKSLEKLRVGWTEGVSNPYSKPEW
                     VE"
     exon            1191157..1191244
                     /number=1
     exon            1191310..1191411
                     /number=2
     exon            1191492..1191616
                     /number=3
     CDS             complement(join(1191722..1191843,1191934..1193488))
                     /codon_start=1
                     /locus_tag="AO090701000449"
                     /note="predicted protein"
                     /old_locus_tag="AO070300000016"
                     /protein_id="BAE62159.1"
                     /transl_table=1
                     /translation="MDANPPQEQPPQTRRRRTRLACEACKIRKRKCDGQTPCESCSRY
                     DYRCCYEPPPRKRRLTTVAAGQTFSPPVTLPSPGPVPVPPSTALEPSSRRPTEEKSME
                     ANAGVIFPQLLGLKLSPDHAPSMQHGSGWNLGVRRSPHRSEKSITWILSQAAWQKLFG
                     VYVEKIHPVYGFLDLEVVAGQAGRRWEDPCASNEYDAVLCGVGALGSLFSSRSKASEQ
                     ERHLIDCAKDILETTSTLVVSPGVHDVEGWLLRTMYLRCHSTPHAAWIASCTTMHIVE
                     AAGLHRESTRGSLVYPEINPGGQSENVECRRRLFWIAKLLNTWISFEYGRSQVVIRGA
                     QCPAPAPKPGDPTSDLISLFQLSEKLDPDQTVQVLELEESLVRLEEFEFESDAAILSQ
                     SVLAFTIYRRLQLLNSTTNMTSVVDRVIRLGCRGLAASSRSIDASCPWWHVSNVPFQF
                     TCILLAMDTRKSLVHVKDSLATLKKAADHFATQKARKAYKNIDFLVRLSQKRKEQDAA
                     LLNESVGSSQDTLLNPMDPSSLNYSYDWDIFVRDALDFSTTFPRLAEQEY"
     exon            complement(1191722..1191843)
                     /number=1
     exon            complement(1191934..1193488)
                     /number=2
     CDS             complement(join(1194721..1194788,1194821..1195108,
                     1195164..1195401,1195459..1195535,1195582..1195776,
                     1195837..1197574))
                     /codon_start=1
                     /locus_tag="AO090701000450"
                     /note="2-keto-4-pentenoate
                     hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase
                     (catechol pathway)"
                     /old_locus_tag="AO070300000017"
                     /protein_id="BAE62160.1"
                     /transl_table=1
                     /translation="MAPGILVNGFHDSTTPSSTLPTRRRPYPHEGLRFDPKLKPKSYR
                     MTGTSPDSKILFLDVNILDSTGNDPYRGDVLIHGERIVSVGLVPDVEALRHDPKVRVV
                     QGRGRTFMSGLGDAHTHWTWNNIALELLGDIGVEEHTLITARSALCYLDSGYTMCYGA
                     ASAKDRLDCVVRDAINRGTLPGPRLLANGREIAKREGELAAGITAFAEGPLEMREVIR
                     HHAKIGVDQIKLSMSGEAITETVSAEECFFTDEETAACVDEAHRNGIRVCSHARARDS
                     VIQCARHGVDVIYHASYTDEEGMQILEKVKDRVVVAPALNWLYATVYEAEPFGYSMEK
                     AEQVGYRRELETAIKALKEMHKRGITVLPGGDYGFAWCPHGTYARDLEHFVKLLDFTP
                     MESIVAATAGIAKLFMQEDELGKVLPGYYADCILVDGDPLKDIAVLQDHSKLDVIMIN
                     GRIHKAQPTEFLNTSAVPPSLQEKKSYFNFVAFEDELGRSRIGHLDLGDSTIQPLTMA
                     SGSPLASLSQVIELGDEGVVRAAEAPFPLSSVKLLPPLADRDVLCIGENYRKHIKEYR
                     ESGFAAADNKVTDSPQVPTVFTKRSTSITASGTDIYPHPGFTQTMDYEGELGVIIGKA
                     GFSIKEKDAMDYIWGYTIINDLSARERQRDHRQYFMGKSPDTFCPMGPVAVEAAALSG
                     EIRVQTHVNGEKRQDGTTADLIFSIPKLIETVSSGITIQPGDVIATGTPHGVGVGHHP
                     PKFLKPGDLVEVSVTGLGKLSNRIADPGSKNPTIDRVLQKPSSIPTYNLDRTWGGVGL
                     TKVGPDHYINVRELGSQSPDAETIVFIHGLGANLEYYAPLVQAAGLERTRRYARPSVL
                     NCYLADLRQRP"
     exon            complement(1194721..1194788)
                     /number=1
     exon            complement(1194821..1195108)
                     /number=2
     exon            complement(1195164..1195401)
                     /number=3
     exon            complement(1195459..1195535)
                     /number=4
     exon            complement(1195582..1195776)
                     /number=5
     exon            complement(1195837..1197574)
                     /number=6
     tRNA            complement(1198447..1198527)
                     /locus_tag="AO090701t00007"
                     /note="tRNAscan-SE"
                     /product="tRNA-Ser"
     tRNA            complement(1198943..1199014)
                     /locus_tag="AO090701t00008"
                     /note="tRNAscan-SE"
                     /product="tRNA-Glu"
     CDS             complement(join(1199829..1200763,1200819..1200933))
                     /codon_start=1
                     /locus_tag="AO090701000451"
                     /note="predicted protein"
                     /old_locus_tag="AO070300000018"
                     /protein_id="BAE62161.1"
                     /transl_table=1
                     /translation="MSEHTLDWVRDKAIGWSHTPPRNKIDTHHHCVPSFYAKAVEEQG
                     GDPSGWPTPHWSSLASKLLMKRVGVKTAVLSVTAPGACIMPSRSERSQLARKLNEYSA
                     ELRDKDPESFAFFVSLPNILDTEDALAEIAYGLDTLHADGVTLFTRYGSTNTYLGHAD
                     VEPIWAELNRRGCVVFIHPTHPVDTNPVNSRLPQPSIDYPHETTRTAMDMITNKTRLK
                     YPRCKVILSHAGGALPYIISRVTTPMSKAPDFAVSHRMGITHDQAMESFRSFHFDLAL
                     SASPQVLDMLLKMVPHDHILYGSDFPYAPITAYPAFLEALESYEMDPELRDMINFGNA
                     MKLFPRLSTPRGGSL"
     exon            complement(1199829..1200763)
                     /number=1
     exon            complement(1200819..1200933)
                     /number=2
     CDS             join(1201326..1201574,1201624..1202814,1202863..1203015)
                     /codon_start=1
                     /locus_tag="AO090701000452"
                     /note="cytochrome P450 CYP2 subfamily"
                     /old_locus_tag="AO070300000019"
                     /protein_id="BAE62162.1"
                     /transl_table=1
                     /translation="MGASIHAHISAAANESPITAAFVSIAACLGLIFLIIQEIFKPVG
                     KRRSPQGKKWKLPPGPQGVPIFGSLLYLQKVREDEEHRIHKDLAKYGEMTTLHLGSKT
                     WILLNSKRVVSEIIAKRGSLTNGRSPMPIASGIVSRDGRSLLLPPAQWMEKRRVMHSL
                     LSGTAMKQYGSWQELESTQMLAEYLFQPERWYRHHYRYANSVVHRIALGERLVKSGKE
                     LAELQDVVTHFVGSIGTSLVDWFPELDKLPRMLQPWRKHWEKLGDWNEEVYKSWWIPA
                     REKVENGTAPPSWVRDVLLHPDTKFTGNDQEAMYVALQLLEAGSDTTREALNIFAMAA
                     LCFPDKFQKAREEVDSQCSTTKNFRLPGIDDLGNMPYICAMIKELLRWRPIFSFTPDH
                     VLTSDMEFEGYNFPAGVGFVINEIPVCNECEDPEDFKPERWLDGHETDAAHGLWQFGG
                     GRRICVGYRLAFQGLFINVARLVFCYNYEAAGPYDSKRLNHHKTVEPFPVKVTPRSEQ
                     HTSLILEEGARLGVLEDAKRLI"
     exon            1201326..1201574
                     /number=1
     exon            1201624..1202814
                     /number=2
     exon            1202863..1203015
                     /number=3
     CDS             complement(1203183..1203650)
                     /codon_start=1
                     /locus_tag="AO090701000453"
                     /note="predicted protein"
                     /old_locus_tag="AO070300000020"
                     /protein_id="BAE62163.1"
                     /transl_table=1
                     /translation="MKNLVDLHGTVKGCFLVSPLTSFDFTTAAYQKRFNADILSRKVV
                     HKWGDYLVENSPWLEEISAGSGWGMALDVPESWWRNFKAVDRILLTGGYEEVFSDHIQ
                     QLGNMLKRQSQGTVTLHMGNETHDTPLMDFISGRRPSETTNTITSFVISCFKG"
     exon            complement(1203183..1203650)
                     /number=1
     CDS             join(1204939..1205138,1205203..1206309,1206390..1206761,
                     1206816..1207033,1207150..1207478)
                     /codon_start=1
                     /locus_tag="AO090701000454"
                     /note="predicted protein"
                     /old_locus_tag="AO070300000021"
                     /protein_id="BAE62164.1"
                     /transl_table=1
                     /translation="MPLKAVDEGKRRSRTRSKIALACNSCREKKIRCDGTKPICGPCV
                     RRSYRNDQCVYNPENSRSTSRDEYLHALHQRIKDLEDICSRAGVVVHNPSTPQSGLPL
                     DSTGHGETPPQGASLSSAPRHSEHESMGQNPTPVTSNTRLAPACILPGTQGEHDNSHT
                     RSAEEDATDIYESPLFDEGEGHIAGMGQIILSGAGSEEQRGSTRLQYYGTSSTASLMR
                     FAWQRMPSRPAGTSAETRYSRLQDTSDNYGIDDFLLPPRAFADQLVKHFFDKVFNLYP
                     FFHRPSFEAAYRNLWRAEDEPIIAAPTVLQVGLGSSAESGPKSIVFQCALNLIFALGC
                     QFADIAPEEAEAVANSFFLRAKKFIGLDFLDINTLGVVQTLLITALFLQSSPYPSRCW
                     HSVGNACRVAVVLGLHRSDILATLSPLESEIRRRTWHGCVMMDIPSMTSHLAPVPRPD
                     GLKTYERQEGGEEPSLMAFYNESIKLYDILDIILADIYQAWSGRLRRDQLQTSNMNLG
                     SLDIVLRVEKELAFFEANLPPFLKWISGPPEGLSCPESNTAISQQRNVLRARYIHLHL
                     LLYRPIFTQLYSNRNSSCGLEMQRPLYSSMFSKCATACVTTAIDLTHLVQETYQTKAT
                     DAWWYNGFYQSTLGKTRDAWKEAISILESMTTFCRSATNTLQFLQAAYHQAVPNGQQQ
                     VVVEGDASQIHQTSNSCDLPNSGPTQISTFDWEEFAESMVPGLDDLGFLTEFNFHGAL
                     E"
     exon            1204939..1205138
                     /number=1
     exon            1205203..1206309
                     /number=2
     exon            1206390..1206761
                     /number=3
     exon            1206816..1207033
                     /number=4
     exon            1207150..1207478
                     /number=5
     CDS             join(1207991..1208621,1208673..1209007,1209080..1209420,
                     1209480..1209627,1209683..1209787,1211524..1211751,
                     1211900..1211920)
                     /codon_start=1
                     /locus_tag="AO090701000455"
                     /note="predicted flavoprotein involved in K+ transport"
                     /old_locus_tag="AO070300000022"
                     /protein_id="BAE62165.1"
                     /transl_table=1
                     /translation="MASKSTDVPTYSQIACVGAGLSAVALGATLQRWYGLEDIQFFER
                     HPTSGGTWYINSYPGDRGSALSHFSIQTNILVGCGCDVPSALYSFSFAPNPNWTKLMP
                     SNKEIKEYIDDVVDTYNLLPKMSFETEVVRTVWREDANRWLLYLRELKTGREYTHEWQ
                     ILFAATGQLVEPRPCEIPGASDFRGSIFHSARWDHSVDLNGKNVVVIGNGCTAAQIVP
                     ALANSGQVKSLTQIVRTKHWIFPAPNFTYPKVLQWIFRYVPLAMRLHRLHIFLVAEND
                     FRLFPMTKGAARLREKRRKQVEKYMREASPRKYHDLLIPDFDVGCKRRIFDPGYLESL
                     HQDNVLLTDAKTERITEEGIETDKGFIPADVIVLATGFQTNKFIPYMDVVGRNGETVS
                     KHWGRYGGPAAYNCSALNGFPNFFILLGPNAATGHTSAMMAAENSINYALRILKPVLD
                     GDASSVEVTAKAEHDYAYWVQDALSKRVWNAGCVSWYLNDQKWNSMSYPWTQGHYWWR
                     SLFPTWSDWTIKCLGQELRAQNALKVRTSLAVLSFTKTPLFRGETNQSHFFMPLLHVD
                     TVVDAIVDTLDSGLSRTIFLPGIFSLLAGLTGRLVA"
     exon            1207991..1208621
                     /number=1
     exon            1208673..1209007
                     /number=2
     exon            1209080..1209420
                     /number=3
     exon            1209480..1209627
                     /number=4
     exon            1209683..1209787
                     /number=5
     exon            1211524..1211751
                     /number=6
     exon            1211900..1211920
                     /number=7
     CDS             complement(join(1212306..1212502,1212529..1212814,
                     1212878..1213429,1213474..1213732,1213794..1213981))
                     /codon_start=1
                     /locus_tag="AO090701000456"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070300000023"
                     /protein_id="BAE62166.1"
                     /transl_table=1
                     /translation="MNEEDPQFPSRLSKDIQTWHEESISPQYLTHEERIIEKRLVCRM
                     DLHILPLVILVYLMNYMDRNNYVSARLQGLETDLSLRGDQYEIGLSVMYISYILAQVS
                     SNLLLNYFGRPSLYLGFFVLSWGLVATLTSQCTNFGVIVACRFMLGLWYKKDELNLRM
                     AIFYSGSLISGAFGNQIAAGILNGLSGKRGLAAWQWLYVIEGSITMFFGIIVLFFLPE
                     FPQTCRLLTEGEKSVANRQMALDAADADVGEASAMSQLKGLKLAVTDIKTWILAFTYM
                     AITGAADFQSFFPTLTATIGYSHIISLLLVAPPYIFMTFWSYVHGALPDRLESDSGRI
                     RFFMYPIPLTIAGFIIFVAVDGFGPKYFSFFLVIFVFAMNSTLFTWIATSIPRPPAKR
                     APAIAIINGLGNSASIWTPSTYSSSEAPYYRTAFGIRQALWLRFLLVRENKLLARFKN
                     GNAVLPEPELDKLRQLAIVEGVDIDTARQLRRGFRYAIYKFSW"
     exon            complement(1212306..1212502)
                     /number=1
     exon            complement(1212529..1212814)
                     /number=2
     exon            complement(1212878..1213429)
                     /number=3
     exon            complement(1213474..1213732)
                     /number=4
     exon            complement(1213794..1213981)
                     /number=5
     CDS             join(1214430..1214745,1214800..1214877,1214943..1215505)
                     /codon_start=1
                     /locus_tag="AO090701000457"
                     /note="predicted protein"
                     /old_locus_tag="AO070300000024"
                     /protein_id="BAE62167.1"
                     /transl_table=1
                     /translation="MTPAFEDLPLAPEGPPGNAWGRFGDQDELGTLNLITPDTIVRAA
                     KEIQTGVRISLDWPLSKPSHPSFGRKGFQQEIVHRSPNCINDDILTFNTQGSSQWDGF
                     RHYAHQKSRRFYNNVTQEQIESSDIIGLHTVVEAGGITGRGVLLDYAQWATTKNLEIQ
                     PLSSTPITVESLEAMVKDFQIEIHPGDILLIRSGFTAAYNELNEQERINLAQRPSPDF
                     IGVEATENMLRWLWKYQFGAVAGDAPSFERAPIRGPHADPRYNLHEWVLAGWGCPIGE
                     LFDLERLSQHCRATGRYTFFLSSVPLKVPGGVASPPNAIAVF"
     exon            1214430..1214745
                     /number=1
     exon            1214800..1214877
                     /number=2
     exon            1214943..1215505
                     /number=3
     CDS             complement(join(1215566..1215578,1215648..1216144))
                     /codon_start=1
                     /locus_tag="AO090701000458"
                     /note="predicted protein"
                     /old_locus_tag="AO070300000025"
                     /protein_id="BAE62168.1"
                     /transl_table=1
                     /translation="MARKYDQTVLFHWLLTISFVLLVKDTRAIAQRAFRSSRTRLSTS
                     GANDRTITIPSNVNASVTAEHQNTPSGSLYPQVEPREEWEDAQGVMDNIEEAPAPDLV
                     SLFSLIISQRTLNEASEQGELADIVNGDDLDFIMNIGFDASPFNHVDPLQFFVADKLT
                     KPGPQAGFI"
     exon            complement(1215566..1215578)
                     /number=1
     exon            complement(1215648..1216144)
                     /number=2
     CDS             complement(join(1216356..1216614,1216667..1216899))
                     /codon_start=1
                     /locus_tag="AO090701000459"
                     /note="predicted protein"
                     /old_locus_tag="AO070300000026"
                     /protein_id="BAE62169.1"
                     /transl_table=1
                     /translation="MRLILVSIYRLAQITTQVLRKLYGSKKHDKVARDESTSQIEAQL
                     SKWLDERPRFLNPEEQLGQNESEVFYDVPWIFKRQQRTIRAAFYFTSMQLYRGHLLDE
                     FLQANFHDRLSLTPAPPVQKCIHAALQMALFAADIKEDVTYNSVFWVYHLHLSWLLIL
                     FLD"
     exon            complement(1216356..1216614)
                     /number=1
     exon            complement(1216667..1216899)
                     /number=2
     CDS             complement(join(1217376..1217466,1217502..1217558,
                     1217615..1217853))
                     /codon_start=1
                     /locus_tag="AO090701000460"
                     /note="predicted protein"
                     /old_locus_tag="AO070300000027"
                     /protein_id="BAE62170.1"
                     /transl_table=1
                     /translation="MSRPAEEVLSEHPLKTSLIPLDRGLAEEYIDCFHSHSCATYRYI
                     PRSQSNEFLGKLYSEDESFLQDDASMAVIFLILAVGCIWYPSLHSRDIFEYKTKAANS
                     HKARGSTRPHNQGWRRQHPCSLPRFW"
     exon            complement(1217376..1217466)
                     /number=1
     exon            complement(1217502..1217558)
                     /number=2
     exon            complement(1217615..1217853)
                     /number=3
     CDS             join(1218969..1219254,1219318..1219922)
                     /codon_start=1
                     /locus_tag="AO090701000461"
                     /note="ribulose-5-phosphate 4-epimerase and related
                     epimerases and aldolases"
                     /old_locus_tag="AO070300000028"
                     /protein_id="BAE62171.1"
                     /transl_table=1
                     /translation="MAPSVVGNDPIQQKTPCATPDSKRATPPQLQVLGKTKDGRDLKI
                     RSYPKFDTLEEERLYRKQHLAAAFRVFADRGFDEGVAGHISVRDPILTDHFWINPLSA
                     HFSLIKVSDLILVDEDGLVVEGDEPINAPAFAIHSEIHKARPDVHAACHAHSVAGKAF
                     AAFGRELDMITQDALRFYKSHGVYRDFRGVVLDREEGQRIAKALGQGKAAILQNHGLL
                     TVGQSVDEAAFWYMSLDKTCHAQLLADAASAAGYKKIIIDDDEAAYAALQVGGPEKGW
                     LAFQPYYDEQLAKTNGNFLL"
     exon            1218969..1219254
                     /number=1
     exon            1219318..1219922
                     /number=2
     CDS             join(1220703..1220791,1220866..1221375,1221436..1221700)
                     /codon_start=1
                     /locus_tag="AO090701000462"
                     /note="fructose/tagatose bisphosphate aldolase"
                     /old_locus_tag="AO070300000029"
                     /protein_id="BAE62172.1"
                     /