LOCUS       AP007163              338231 bp    DNA     linear   PLN 16-DEC-2016
DEFINITION  Aspergillus oryzae RIB40 DNA, SC166.
ACCESSION   AP007163
VERSION     AP007163.1
DBLINK      BioProject:PRJNA20809
            BioSample:SAMD00067075
KEYWORDS    .
SOURCE      Aspergillus oryzae RIB40
  ORGANISM  Aspergillus oryzae RIB40
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Eurotiomycetes; Eurotiomycetidae; Eurotiales; Aspergillaceae;
            Aspergillus.
REFERENCE   1  (bases 1 to 338231)
  AUTHORS   Sawano,T., Tanaka,T., Machida,M. and Yamada,O.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-JUN-2004) to the DDBJ/EMBL/GenBank databases.
            Contact:Toshihiko Sawano
            National Institute of Technology and Evaluation, Genome Analysis
            Center, Department Of Biotechnology; 2-49-10 Nishihara,
            Shibuya-ku, Tokyo 151-0066, Japan
REFERENCE   2
  AUTHORS   Machida,M., Asai,K., Sano,M., Tanaka,T., Kumagai,T., Terai,G.,
            Kusumoto,K., Arima,T., Akita,O., Kashiwagi,Y., Abe,K., Gomi,K.,
            Horiuchi,H., Kitamoto,K., Kobayashi,T., Takeuchi,M., Denning,D.W.,
            Galagan,J.E., Nierman,W.C., Yu,J., Archer,D.B., Bennett,J.W.,
            Bhatnagar,D., Cleveland,T.E., Fedorova,N.D., Gotoh,O.,
            Horikawa,H., Hosoyama,A., Ichinomiya,M., Igarashi,R., Iwashita,K.,
            Juvvadi,P.R., Kato,M., Kato,Y., Kin,T., Kokubun,A., Maeda,H.,
            Maeyama,N., Maruyama,J., Nagasaki,H., Nakajima,T., Oda,K.,
            Okada,K., Paulsen,I., Sakamoto,K., Sawano,T., Takahashi,M.,
            Takase,K., Terabayashi,Y., Wortman,J., Yamada,O., Yamagata,Y.,
            Anazawa,H., Hata,Y., Koide,Y., Komori,T., Koyama,Y., Minetoki,T.,
            Suharnan,S., Tanaka,A., Isono,K., Kuhara,S., Ogasawara,N. and
            Kikuchi,H.
  TITLE     Genome sequencing and analysis of Aspergillus oryzae
  JOURNAL   Nature 438, 1157-1161 (2005)
COMMENT     URL:http://www.bio.nite.go.jp/dogan/Top
FEATURES             Location/Qualifiers
     source          1..338231
                     /db_xref="taxon:510516"
                     /mol_type="genomic DNA"
                     /note="SC166"
                     /note="phrap>=30:1-338231"
                     /organism="Aspergillus oryzae RIB40"
                     /strain="RIB 40"
     CDS             join(1505..1782,1847..2066,2267..2442,2497..2819,
                     2877..3778)
                     /codon_start=1
                     /locus_tag="AO090166000001"
                     /note="predicted protein"
                     /old_locus_tag="AO070211000001"
                     /protein_id="BAE61662.1"
                     /transl_table=1
                     /translation="MIPIGKQRLCTMYPQEYTASLSDQLTMSSISDTSTESEYLPEDE
                     EEDEKEIVKTNTNNWLQLENELNENELHRRQYQQKTINIKNRVWSLWCQFCTATNRDT
                     LTLIKEEPPNIKTLCTFFDFILTTRCEYVKSSSTLQTYWNYWVLLRREKVGLSIPAIT
                     KDKMVGLSLILLLAGMSGHRPDALLSLKNANVQVALLPTGRERPHMVLEFKPHKTKRY
                     RGMKKKNPTLGIPEVRSEPCLLLCPQSFLLSLLIRKSAFSHLRITSAAQLYALQVPPE
                     AGSLELRPANPECFLFDITPRTLNTWLKRLGELTGFNLSITSYCLRRGAGEAVNSSCE
                     ISEAQQNLLLQHAANSSVYQERYAPDYFPKDFSAVWRGSQPQNKVIRMASGQSRSIDL
                     RRPVDLNEAQAAEADAQPKVQRCKARWEQSRLKVQMAYGAMYKGKGKPLYQKAMKRRN
                     AYHTARQAARREMKAVIRARFNEEQPTDDIIRQVHGLPMKSRKAYKTELVPLEQQRAF
                     SLLFRFAPETERDETEYRAAVIDAVSKVGPSRKRRLQEIHSEGPTPGWVTAALQGKPQ
                     VQLARRQCLLCMIYGVRGEPFTRDSSFERHIRRIHNKQIQCPDPACQDMLIGHIDIAN
                     HMRYIHGA"
     exon            1505..1782
                     /number=1
     exon            1847..2066
                     /number=2
     exon            2267..2442
                     /number=3
     exon            2497..2819
                     /number=4
     exon            2877..3778
                     /number=5
     CDS             complement(4344..4985)
                     /codon_start=1
                     /locus_tag="AO090166000002"
                     /note="predicted protein"
                     /old_locus_tag="AO070211000002"
                     /protein_id="BAE61663.1"
                     /transl_table=1
                     /translation="MASDKLHQPLLSITQLQRARPQAVSTASSFTDNWSRPDRPTSVE
                     FQIVQHGGHSSAVELLPCRLQWSKQELHTEKDRLMRAVYEASYLRAENAYYRKVRRAS
                     ILLQAEIETVLLAYTAVQELRTCLHRLDTLTANNKRQSVLLRQSVLGTIWSRNASLLR
                     TAIDDYRVMIDRIDTSFIKLQKSQQEFTAALRRIDQEYADFFAIQLGEEAVKF"
     exon            complement(4344..4985)
                     /number=1
     CDS             complement(6607..7893)
                     /codon_start=1
                     /locus_tag="AO090166000003"
                     /note="predicted protein"
                     /old_locus_tag="AO070211000003"
                     /protein_id="BAE61664.1"
                     /transl_table=1
                     /translation="MSGKPSAGLETKKVWLGKYYIHLALRHVVQLRTAYQKEFRQSEG
                     IHTCSKGHLRNARPSETAKLSIIIESPPLIYHGDPTNSMGALFSGSLRFTIGEHTIPI
                     KIIKLKLTLAIHLTTVKPVVKGCSRCATRIEELSNWNFITRPMHLTLGHHEFPFSYLF
                     PGQLPAFCNTPLGGIAYVLSAQAEDIVGTSYSSNMPLHIKRALPPGNEISLLYTFPRT
                     NLTSHVIVPSVVHPMGSFPVRVALIGVMDNKKPNRNHLYIQNVKWHIKEHVKIVSHPC
                     SKHASKSQAEGVIHKKTRVIGRNKESNGSKYKLDLGSDEIRLQFEVSIDYTRESVCDV
                     EDSKGLEVKHSLIVELIAAERNTWITPTSGPAIVLRMCSGLRISERSGLGISWDKEVP
                     PIYKDVPPGPPGYTAMRTPVRQLGASRRLTPPECDC"
     exon            complement(6607..7893)
                     /number=1
     CDS             complement(join(11165..11169,11298..11885,13020..13094,
                     13906..13954))
                     /codon_start=1
                     /locus_tag="AO090166000004"
                     /note="predicted protein"
                     /old_locus_tag="AO070211000004"
                     /protein_id="BAE61665.1"
                     /transl_table=1
                     /translation="MEGLTSNLRIRLYFYLRIPSQLEEIPTLPVDIQFCSNTTEPCQT
                     ALYCAAANSHSITVSRLLRENGLLVNCPDIMSGWTPLAVAVLHGHSDVIQCFLSDGRA
                     DINTVDKHTRTPLFHAVQHDRSRIVEILLTDTRTNVTHRDSKGCTPLLDAARRGFYSS
                     MNILLRHPDIEVNVYDSFSLSPLWYAVGFRSVDTAQQLLNRGATAHMMNGSHSSPLQR
                     AISLQHMAMIRLLLEHPGVR"
     exon            complement(11165..11169)
                     /number=1
     exon            complement(11298..11885)
                     /number=2
     exon            complement(13020..13094)
                     /number=3
     exon            complement(13906..13954)
                     /number=4
     CDS             complement(14867..15667)
                     /codon_start=1
                     /locus_tag="AO090166000005"
                     /note="predicted protein"
                     /old_locus_tag="AO070211000005"
                     /protein_id="BAE61666.1"
                     /transl_table=1
                     /translation="MLNTEMRYVESSTIGMGIYTDGLSTHTSDWHPPENHTINDLTSN
                     SSSVLSTMQSDHQFISLTAPEMTTGNVSTSLYSSMNETVGLAAYTTRWRDSEEQDPRT
                     YIQCPFSHDLLSIRGCEWCGQPTSISEGHMPSQSYCCPPSISAANEYGEEPSPHFPIS
                     LALDTSATFGIDTGFDHTIMAEGNQPSQGDQTPAEELALASSMIEPSYPNSTCFDGMD
                     SGGWPVIPLAGSNGRNTASANTPVPTDQSTILGYGEGMMQNWVMGHYR"
     exon            complement(14867..15667)
                     /number=1
     CDS             join(17293..17367,17977..18420)
                     /codon_start=1
                     /locus_tag="AO090166000006"
                     /note="predicted protein"
                     /old_locus_tag="AO070211000006"
                     /protein_id="BAE61667.1"
                     /transl_table=1
                     /translation="MDGHWGIWNESPPLCVAVMRGRLDIMVEILLLSPTIKIESALGT
                     AAKLGHIWIVKLLLWRQPNADLNFRDGSGMTALAQAAFAGHDNIVKYLLQRRHIDVNL
                     HDFNRCTPLWWAAKRGHLDIVVQLVNDSRTVFNSRLHRCPRDEAKYWGHSDIANLLTY
                     VIDKKNPLTLLN"
     exon            17293..17367
                     /number=1
     exon            17977..18420
                     /number=2
     CDS             complement(21561..23078)
                     /codon_start=1
                     /locus_tag="AO090166000008"
                     /note="predicted protein"
                     /old_locus_tag="AO070211000008"
                     /protein_id="BAE61668.1"
                     /transl_table=1
                     /translation="MKGLHASSSNNICMIQTSEYTFSERAISADEQFEVAYRQLWLYA
                     MRHYPQMPRDPKRKERLARPRSATANERVVSGMGHLAHQLGFDSSEIQELIGQAPDRL
                     IARNALLQARDPESFEVDDATVDSIIGHIITCFDMIRPKGVVTVPPTRVSRSVPRKSR
                     SGHPTLKALVQDRALLFLDHIHTAAVPDLVTTAFVRHCVYFAFFGPHPAVSQAANSVY
                     CPTPPLFVPESRPSQIHPDQDSLQHMSNNSPGFGQPIETWNYISPSMDVDHNRSQNHT
                     TAGPVAERRPSRVDTECTREEAEFQESTSHAVQGFHHQMTTDNMTHQQASSTMVMYAT
                     ELGNLPNRYTKGAINAIREPCTQKGGDLYCEPMEELSNDNIAAGAINNTHQLNNNQRA
                     QTHRKNILRNSYTGKINIVFYVYDEHSQWNVTTIVQVNPADPSSTSEFRQTVQRYKQQ
                     GITLCDIKMRSVSISSSLSAAMADGQNVLLLFPPGTRRLCQSPAIPKGLPVPGID"
     exon            complement(21561..23078)
                     /number=1
     CDS             join(26576..26915,27337..27476,27520..27801)
                     /codon_start=1
                     /locus_tag="AO090166000009"
                     /note="predicted protein"
                     /old_locus_tag="AO070211000009"
                     /protein_id="BAE61669.1"
                     /transl_table=1
                     /translation="MGKSAKRKREREKALLEQGRLSELNVDSDGDELMDRESAVQHGD
                     STESESRFYTLEHRAEATRIQQLEDKDYYGILGLENDCTAKDIRKAYLKLGRLTHPDQ
                     NKYGDAQVAFKSRPEDEGLIKVHLLFGFACSYREAGKKGGNNPEDLIRIQKQFDHVKK
                     ASQPTLQKQGRETWRIRRPLNESLVIYRAADFADPRLSWKTQVFLPVCSLSNMATSMA
                     TWLEHTSLCQRRRKKMCVVHRSGIARPIAPNTIGF"
     exon            26576..26915
                     /number=1
     exon            27337..27476
                     /number=2
     exon            27520..27801
                     /number=3
     CDS             join(30908..31200,31457..31600,31697..32047,32150..32180)
                     /codon_start=1
                     /locus_tag="AO090166000010"
                     /note="predicted protein"
                     /old_locus_tag="AO070211000010"
                     /protein_id="BAE61670.1"
                     /transl_table=1
                     /translation="MGDVIPDIWRACILGQLIRYVLNEGHRAYADCIKGELLRQGTTE
                     TARLTAVKYLTACRTTIRLALSIISGKVASCVDPESSNCTGYKNWSWSLGDGIWPLAN
                     VQSIVDSFLRPLWHQAYNQVDLIHIGELHGDVQLLRQILMGAYDVRFDDPNGDTALHR
                     LYRDMSSAYEKSGRCLDLPSKYASEVKRRGFVHVAERAYVLPLTTRGNIDLLNDIIAN
                     WADGFEAYSLELLITELGKRYLEIFSGYASARQSLRKGVDGYLEIRMVAESLAS"
     exon            30908..31200
                     /number=1
     exon            31457..31600
                     /number=2
     exon            31697..32047
                     /number=3
     exon            32150..32180
                     /number=4
     CDS             37563..38159
                     /codon_start=1
                     /locus_tag="AO090166000012"
                     /note="predicted protein"
                     /old_locus_tag="AO070211000012"
                     /protein_id="BAE61671.1"
                     /transl_table=1
                     /translation="MSQRHAYTAEDILRETVQGLASLKAFFAYDKSGLVLYMARAAKQ
                     NRRLGLGFGQKGKHPTLEDLFIRLLTCLCWAQRLEVECFATTITANSYGLAAHLSRCY
                     GMEHNYVTANYFRCGRQLRKIERHVGVEDCSIILLPSLAKLLWLPDREILRLIDLLSG
                     SFMPTLSSNKQMIEEFHQYRQLYNTVSNRTVSSLSDCW"
     exon            37563..38159
                     /number=1
     CDS             complement(join(38232..38627,38676..38912))
                     /codon_start=1
                     /locus_tag="AO090166000013"
                     /note="predicted protein"
                     /old_locus_tag="AO070211000013"
                     /protein_id="BAE61672.1"
                     /transl_table=1
                     /translation="MDEMPNPAHHPIFEPHGDEVWAMQNLGFERYYRQGSPPEEVVRA
                     VEEAYERETKYHEPPTLHCLGGNECEVFLRCRAPEIEGTIERTLGVEFSKLKRQQPVI
                     FRGEGGQSDYRMAHPSGIGADGFSVFGVVRGSASIVLYPGFLGEPAARYEPKLDNTEL
                     LAVPGQTFVEIRPTGDVLMVWWGFSRELILAKAASPFVLPFMVFDPRGRS"
     exon            complement(38232..38627)
                     /number=1
     exon            complement(38676..38912)
                     /number=2
     CDS             complement(join(47811..47945,48031..50048,50086..50143,
                     50164..50298,50451..50525,50576..50896))
                     /codon_start=1
                     /locus_tag="AO090166000015"
                     /note="predicted protein"
                     /old_locus_tag="AO070227000031"
                     /protein_id="BAE61673.1"
                     /transl_table=1
                     /translation="MRTIVVDHREHRKWRVRHGYIAGHGLAPKAAQGIRQWSSKWLCS
                     FYKQRRMSICDIQATRSKGSPTLSRGKLNVQCYGSAVDTSAEQIGCSLDNVSVLEQKD
                     YWQIAKPLVAELCSQWDQDYERAGCTVGALPHRAVYHGSTNPLDYVYAINSHLCDDHR
                     SDQVNTRHVILFSAKRNFGAANPCLVAIECRNNQRRGSPTAATASKDLQDGVEELYPT
                     SRPRFKEDGVTENSDTGPSEDDGAQSDAFLECHPNSELNTSPHPAADFSRMVRDGVAR
                     KLGSLPPLVDITTDEGEMSPSLGTPGTTGSAATCRDPLFVPPADQDLDILAAIPWNGN
                     QMLPGAVSHAKTIGNWSSGAFQIPTLSDSDMLVDDCGAPDNLDQAMAHMSPLSATSGV
                     IPGADTRLTPDKESPTSCTRTYESLDGRVNDATDLRDSLAQQWPDTDRIILHGSILAY
                     ADIEQILDELQNPQQLSIPTVDFLGDLFSYYRPSSQVYIADTAWPDRLHRGVLRPTPI
                     PQILLLPTYLHGRWSLIEIQACSGAVIHYSFTAIGPGLHEMCDPCDPVYPACTSCRGA
                     IEALSQHLRDMGKLSPEWKFYNRPITSTNGDDGTCLLWTIKQRVNNQSVQEEPSEDFR
                     GSLNREIVARALHAAGESRLSLPSALSSSRRHPGVLPEKVQQRWSAVTGEWDIPIDLT
                     RIRERIARMPLNSTVRIGSKQADRLLQLAFTIASPPVLVELRRQLLHLRQKQTAANCC
                     FQRTPAGVFKAGIWHKDNKDTSRIGLALTCWYVHNHRQQRHQEGYPDPTAQTVVNICR
                     QLPESTRDYHQVEERVKGWYKRAWPWNQLVRIASSPNVLCFLPQGVSFAGKGTISMTD
                     YRSLKKAHYEAFEWASTELSSGQKRRSWQNRWILRNLIEPSICSLNNVSSNDFYRVT"
     exon            complement(47811..47945)
                     /number=1
     exon            complement(48031..50048)
                     /number=2
     exon            complement(50086..50143)
                     /number=3
     exon            complement(50164..50298)
                     /number=4
     exon            complement(50451..50525)
                     /number=5
     exon            complement(50576..50896)
                     /number=6
     CDS             complement(53333..54049)
                     /codon_start=1
                     /locus_tag="AO090166000016"
                     /note="predicted protein"
                     /old_locus_tag="AO070227000030"
                     /protein_id="BAE61674.1"
                     /transl_table=1
                     /translation="MDSMDGAAAWLRFWNQADRSVRDASTRLDVLLTGPEPLLNAAHR
                     MDDLIQQTIKQGVGDHGRQSLIRLLAQSLFFELTSAPHSENDGASYTCTGSIRCRVPG
                     QTFLGALRRLDTSRKEYVLGSRPLGISVTEGSICPGCSRYCVPVRFSVSNMDDKIALS
                     IRLADGQRYSIGGFPHPVRWFMHRQGLTPMYGFAGDGVNTRDDCQTCTKRILRRHGLR
                     ITQLQARRKLRIAHAIQHAT"
     exon            complement(53333..54049)
                     /number=1
     CDS             complement(join(54709..54908,54987..55423,55481..55676,
                     55782..56787))
                     /codon_start=1
                     /locus_tag="AO090166000017"
                     /note="predicted protein"
                     /old_locus_tag="AO070227000029"
                     /protein_id="BAE61675.1"
                     /transl_table=1
                     /translation="MRPKRQQSWFQFVTEEVGASLIYDPNCLPQLIHLTDAPHRRHPA
                     LVSFLGRGKKDRALRSLFADNPSNSISTFGFRLRVDHRTLYSGRPILFTDGDPNQSPQ
                     PPDIGGLAGVEKIPIAWASSSGAQIVDTIVTRFLLPASHVVCIFAEDIGGLVGVQALL
                     RRWIAIGPQATQPALRPRLLVVVETKEVTSGDESLGDAHLAGVLAPPSDAPEVFAGIH
                     MLHVSSASVLSDEARYRPLKEELLKALDVMERDRSECGLHFSAAHLPGLLEKAIRHTA
                     QAHDRTFNLIEKARPPPRPLEWTFHIGHFLRQGNKVAVEAQDIIISSSLMLDAFPPNM
                     HEFHPIDLFRQRYWQPCLDALKPVVGGAAAVHRVQSLESRVINSHIDMINRGASALDL
                     HQGQQEQHRPQHSLACGHALCDACVERYGQPPSRAESTYILEACPLCRQPCLTSIVLL
                     PRTAAVRALTVDGGGIRGIVSLQILLTLQNLLGPHCPLPDLIDVAFGTSAGMSPPQPP
                     PSPRGGGAVSFRPPAVPISRAWLTQCDCLYRRAQVATLLASSTAVDFFHGHVRSYAVS
                     LTVGCTIQTRLNRFCEHTTVAQGDSLGRMYQRVPKSRSPPPPSMAQ"
     exon            complement(54709..54908)
                     /number=1
     exon            complement(54987..55423)
                     /number=2
     exon            complement(55481..55676)
                     /number=3
     exon            complement(55782..56787)
                     /number=4
     CDS             join(59643..59831,59894..60025)
                     /codon_start=1
                     /locus_tag="AO090166000019"
                     /note="predicted protein"
                     /old_locus_tag="AO070227000027"
                     /protein_id="BAE61676.1"
                     /transl_table=1
                     /translation="MYRKKRSIPGLRNVSRRRETIFRKCSELSQFGVDVWVVICAGAR
                     SSVFRSSESELFGSLDRQIMRASHRPTWKGLRDYDRRLRERRPLRLIDRLEVDVPGIA
                     GDQK"
     exon            59643..59831
                     /number=1
     exon            59894..60025
                     /number=2
     CDS             complement(join(65161..66022,66076..66159,66206..66331,
                     66399..66523,66586..67077))
                     /codon_start=1
                     /locus_tag="AO090166000020"
                     /note="predicted protein"
                     /old_locus_tag="AO070227000026"
                     /protein_id="BAE61677.1"
                     /transl_table=1
                     /translation="MGSELGVNPNSKPRVSYTPVSIWWVCWGCTWTTVIALGMAYLIA
                     HRNTPALRVRGLALSLSAIVVLHIYWLSVQFGTMIGALMPGDVEYWIMGTYLPCGIAL
                     FHLSNSQFLYVAKLQRKYVNYDSRCIRPATSLRPKANVLCQFHRLGHTPKLFIIICIS
                     LLCQLTLTVLMWVISRKWHSSWGIPGTEVYGTEMEQKSEMGRGWEWWPSIFWQSFWSW
                     IFAPIVLWKSRRIYDTQGWRVQTLGCAIANLHATPMWLVALYVPAMESVNQYWLPPQW
                     ICLSILVIEIFTIIIPCWEVRRRGASAERMSSLITQKKLQHKKAISRFNSLSPTSTIA
                     NTVTLDLETDNNSVDMISDARNNTLTLNSLDYILEQDPAPLQTFAALHDFSGENIAFL
                     VSVSHWKSSLQQAIRNSTTPGGDCFTGLIREHFNRALRIYVDFISVYHAEFPVNISSK
                     DLKRLEAVFEGPTRALYGDMRDVDPATPFEASDNSSKARLSPASLEGAEQVSQVTNIF
                     YTGDVPETFSTTIFDDAQDSIKYLVLTNTWPKFVRTLQSLADSSDIVGIDMKTV"
     exon            complement(65161..66022)
                     /number=1
     exon            complement(66076..66159)
                     /number=2
     exon            complement(66206..66331)
                     /number=3
     exon            complement(66399..66523)
                     /number=4
     exon            complement(66586..67077)
                     /number=5
     CDS             join(70726..70776,71583..71876)
                     /codon_start=1
                     /locus_tag="AO090166000022"
                     /note="predicted protein"
                     /old_locus_tag="AO070227000024"
                     /protein_id="BAE61678.1"
                     /transl_table=1
                     /translation="MVEVAHQLYLAAAENISSYTTTTITTTTTTTTTTTTTTTTTTTT
                     TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTNTALPLGTITITT
                     TTIDSINIIDYI"
     exon            70726..70776
                     /number=1
     exon            71583..71876
                     /number=2
     CDS             join(73963..74256,74307..74381)
                     /codon_start=1
                     /locus_tag="AO090166000023"
                     /note="predicted protein"
                     /old_locus_tag="AO070227000023"
                     /protein_id="BAE61679.1"
                     /transl_table=1
                     /translation="MGSFWSDAELVTTVYFCSRGFTDGAVSRILGIRGYYRTPRAIRR
                     KIADTLKHFSSLQLANGSWDIDEVDMWLDSLSLDHETVNHLIACNRIDAYIADEHGIL
                     AFVLQNLTSKSQRWGWVVSP"
     exon            73963..74256
                     /number=1
     exon            74307..74381
                     /number=2
     CDS             complement(join(74623..74680,74764..75173,75232..75321))
                     /codon_start=1
                     /locus_tag="AO090166000024"
                     /note="predicted protein"
                     /old_locus_tag="AO070227000022"
                     /protein_id="BAE61680.1"
                     /transl_table=1
                     /translation="MSAQLPSLQDNHRLQVVVAALFLALFLANIDQTIVGTVARTLAT
                     DNRYIDLWTVTFVPMIGVFQILYSHLHSLFSIKIVYLLAIYLFELGSVVYTTAPNSMT
                     MMFGRAIAGAGAAGICTGGFELIGKIIPLDYFLSCIGIMLAILSFAPAVGIFIGSAFT
                     DRSIWQCLILCPYLYGRASASLKPA"
     exon            complement(74623..74680)
                     /number=1
     exon            complement(74764..75173)
                     /number=2
     exon            complement(75232..75321)
                     /number=3
     CDS             join(76654..76668,76746..77324)
                     /codon_start=1
                     /locus_tag="AO090166000025"
                     /note="predicted protein"
                     /old_locus_tag="AO070227000021"
                     /protein_id="BAE61681.1"
                     /transl_table=1
                     /translation="MLDHKVSVTKTDDQHVPPPGQTYSLSERPSTLDVPALPLSSTLT
                     LLPSPSMPPPSQTYNNFVTNATADAIFTDSTATIRLFIVDVGAEKGGIDTEQSLFRPQ
                     FINAAPGDMVLFRFYGAYALYSSDFQDPCHAPRLSQNAVPTRDKIPSHQVSVQSTKPL
                     WFSASLIDKPHLCNNETVFAVNPGNQKEDFLANASMI"
     exon            76654..76668
                     /number=1
     exon            76746..77324
                     /number=2
     CDS             complement(join(78095..78568,78630..78959,79029..79426,
                     79503..79585,79638..79807,79995..80120))
                     /codon_start=1
                     /locus_tag="AO090166000026"
                     /note="amino acid transporters"
                     /old_locus_tag="AO070227000020"
                     /protein_id="BAE61682.1"
                     /transl_table=1
                     /translation="MDKQQYECEDRIPLPELGQHAHSHHVNDNRDLARVGKLPSLQDI
                     CPSIEEVLLSVEQEFCGSHSNILFSGGSAGAVYTYLFVWFSTLCTLATLSELVSMAPT
                     SGGQYHWVAILAPRWCHKFLSFITAWLVILGWLGAFASGVYMASSQIMGFVTITHTAF
                     QPQPYQVMLLYWAYVAFAMFINVGTGSLLPKFEGFVLILHIAGFFVILIPLSYLGDHV
                     SANEVFGSFNNEGGWPSLGLSLFVGMLGSNFAFTGCDAAIHMTEETRNATVIIPRSIM
                     MSIVLNGSLGFGILLVTLFNLQDVDHVLNSPTGYPYIQIFLNATGSIPGSIAMASIVP
                     ISGVATASGNLAAASRMVWSFSRDRGTPWWILLSKVNSRRIPFYSITAIVVAALLLSL
                     IILWSEAVLNAVVSLTVSSLFSSYLIAAGLLLYHRLTGGIRHCGDTMLVVNTTGAPLS
                     WGPFHIPRKWGIATNAFTVCYLTIAVIFSFWPSDVHVNASSMNWAIAPTGGTILFGIL
                     YYITHAKGTFTGPIVEVC"
     exon            complement(78095..78568)
                     /number=1
     exon            complement(78630..78959)
                     /number=2
     exon            complement(79029..79426)
                     /number=3
     exon            complement(79503..79585)
                     /number=4
     exon            complement(79638..79807)
                     /number=5
     exon            complement(79995..80120)
                     /number=6
     CDS             complement(join(83828..83926,83948..83984,84043..84233))
                     /codon_start=1
                     /locus_tag="AO090166000027"
                     /note="predicted protein"
                     /old_locus_tag="AO070227000019"
                     /protein_id="BAE61683.1"
                     /transl_table=1
                     /translation="MIEGAQLLYGQVASYKPRPREDSAAQATPSRRNAIVRLTPLPLF
                     ESPQNEHEEIYNGVAYWYQNFRLQIWSPVASMAEELGWQMGREEIIQRSNRLMAFRPA
                     FRGKSL"
     exon            complement(83828..83926)
                     /number=1
     exon            complement(83948..83984)
                     /number=2
     exon            complement(84043..84233)
                     /number=3
     CDS             86838..89699
                     /codon_start=1
                     /locus_tag="AO090166000029"
                     /note="predicted protein"
                     /old_locus_tag="AO070227000017"
                     /protein_id="BAE61684.1"
                     /transl_table=1
                     /translation="MYRAFQPDFALFPEPINPLEWVHVIDNHIRESFPGEVLFRGVKR
                     LRDQFDDGAELRSTRQKCLQESSQRQFRSLLDMRNEACPNTVNNHSGGVEQSRQISAT
                     EAGENGAAQEGNMHTSTGNTTQGEPPQQSGAAEEDNMHSSTDNTTPREPSPGNGQTEE
                     DTEDDSVYSSTGNTTPGELSPEIEGNRATEDDSIHTSTDNTAPREPSPGNGQTEEDTP
                     TEDDSVYSSTGNTAPREPSPGNGQTEEDTEDDSVYSSTGNNTPLELFPEIHPIDGLTT
                     AAGADFDRLFQELDAGTSDQGPDFGPQPNLGGMMSTMTDAEASTRSSVSNTGNVASFR
                     DLMDMLQDQYNPGFPQWPAAPMRSDLGLNRNQTLSTQSSLHIADSDMIANSRPIENLD
                     QVIADFLVTESIPRPEDPTSNINMTEEETNNMNNCISLQDTLVQQWPDKNYILFYGTL
                     LTRTNVEQVLYELQNSPSLSVFTVDVLGDRLSYHHRPLELHIADATWFDCLHRGILRL
                     TPIPQTLLLPTRINNYWSLIEIHVYSGAVIHYLFLENRSEVQDSSYFPHHPACHSCQA
                     AIKALSHYLEDIGQPCPEWQVESTLLSSIPGDDGIGLIWTMTQRADGQDVQNGPPETF
                     RAHLAHDIVMEALQTATDAPSPPPPQPPPGLSPNSSSSLSLSSPVPASGQQTNSLEKA
                     HCRWSNVVIRSGDPINLTGLWDRVSQMSLDSNTSIGPRLADRLLQLALTIASPPILVE
                     VKRQLEHLRREQSNATRRFQRSAAGVFAAGIWHKNNEQTSRIGLVLTYWYVHNYRQEQ
                     GNSSDPIAQLATDIYNHLPDTARDYSEVEEKVRDWCKRAWPWNQLVRIAGSPNVLCFL
                     PQGITYFPGEDAPSMTEYRCIKKHCFKAIEMILRECRPQLLKFIPQNFFEIFLYNQLP
                     ETQYAIEQWTEEEILAEPLDSDKFDHAFDPVLDTNIDNN"
     exon            86838..89699
                     /number=1
     CDS             join(92230..92356,92699..93126,93132..93185)
                     /codon_start=1
                     /locus_tag="AO090166000030"
                     /note="predicted protein"
                     /old_locus_tag="AO070227000016"
                     /protein_id="BAE61685.1"
                     /transl_table=1
                     /translation="MQNELRNGNYQSKHSCLAAGQTAVFRLVVPFSRVRHFLPPLTHS
                     INLPVTVSGSEPAVLSKTNSSENTTKKRKRETIRESPFAKLTRLVAKRLPNIIQFCES
                     KASLSDILQNEQELQFADKRVDHLKQVDGNKTPSEEQKLLKGLSQLSLAEQFTAWEIE
                     NGWKSRVDTLYDEIRVARTEGQNGTCQMCRKNDSIRQGTWIS"
     exon            92230..92356
                     /number=1
     exon            92699..93126
                     /number=2
     exon            93132..93185
                     /number=3
     CDS             complement(join(94013..94160,94230..94408))
                     /codon_start=1
                     /locus_tag="AO090166000031"
                     /note="predicted protein"
                     /old_locus_tag="AO070227000015"
                     /protein_id="BAE61686.1"
                     /transl_table=1
                     /translation="MSQITSNRPHLFEDDLPESANTERKIFAEWASSVPFEKKADDFQ
                     IHNSKELDTKIVPFLRGIHWYRYRGRNMRHSTTAKAMRLSFQSRYLAIAPAPRESPSK
                     KESDYI"
     exon            complement(94013..94160)
                     /number=1
     exon            complement(94230..94408)
                     /number=2
     CDS             join(95421..95864,95962..96011,96122..96230)
                     /codon_start=1
                     /locus_tag="AO090166000032"
                     /note="predicted protein"
                     /old_locus_tag="AO070227000014"
                     /protein_id="BAE61687.1"
                     /transl_table=1
                     /translation="MACLGDMFPYVIIPPWFKQFCSNRCGSEDLTDWDDGGQGVNSHF
                     AGGAVVYDEPRSGSSEYQPPRPLAYENGQPNLPVSTKGQQYGFVPKEYNYSLTPKIQP
                     IKPASPVSPAEEARAVITPTLRRDRPPSFMSSGEIIALPSPPPLLVQRLTLESPISRH
                     ITTFPRISLQRKLDTAREWVPNSVWELFGVEQSASLMIYI"
     exon            95421..95864
                     /number=1
     exon            95962..96011
                     /number=2
     exon            96122..96230
                     /number=3
     CDS             join(98530..98699,98743..99232)
                     /codon_start=1
                     /locus_tag="AO090166000034"
                     /note="predicted protein"
                     /old_locus_tag="AO070227000012"
                     /protein_id="BAE61688.1"
                     /transl_table=1
                     /translation="MLSIQSTQSHSSSNGVQYELHECALWYAAIGDKRDEVTIRSSLR
                     NGLIGFTHRRIACAHIFWWVLRKPRILLLERALCDTRPGYWEPPGGAAEDQDETPGDA
                     LKREVGEETGLQLSQVTHTLPTQTWTRSKGREDYNWVGLPCIIKVSELETFESRGSSQ
                     RASQPVLKWEDIIRLNPEEHQNFAWATEEEVRCDKYKMFGNHKETALKAFAAVTENCS
                     V"
     exon            98530..98699
                     /number=1
     exon            98743..99232
                     /number=2
     CDS             99822..100370
                     /codon_start=1
                     /locus_tag="AO090166000035"
                     /note="predicted protein"
                     /old_locus_tag="AO070227000011"
                     /protein_id="BAE61689.1"
                     /transl_table=1
                     /translation="MDSTSSPDYKALFLREAERRKEAEERQRKAEEEREQEKEERRRA
                     EEERDQGRELTRHTTFLGLLRDCHILFSLPLRAASPSISTTGKIPQPTGKYCPRRLLP
                     WEDCAVRQQEIYRPVCTYLEPEGKAAEQRFSPRLALEDLGKRFDERPISSEQDLQSYE
                     RFGVENYVRDIIVALQDTSRLR"
     exon            99822..100370
                     /number=1
     CDS             complement(join(100588..100687,101372..101778))
                     /codon_start=1
                     /locus_tag="AO090166000036"
                     /note="predicted protein"
                     /old_locus_tag="AO070227000010"
                     /protein_id="BAE61690.1"
                     /transl_table=1
                     /translation="MFTPPSHEQHIADLPGSMEEVGLGQINCAEKNRDGRSLNLRKYA
                     VNIRFTLHFVPVIRCGSFTDDCISICSAGYLEGYSRCPTASYGRAVAVEIFIQLLFDT
                     LNQALGIEEVSTVVSTLLMKHNIRAISIQLAPLLSCQPSCIVFQFRGFLGWDRIRPNN
                     LFPKVHRP"
     exon            complement(100588..100687)
                     /number=1
     exon            complement(101372..101778)
                     /number=2
     CDS             join(103978..104029,104079..104673,104695..104701)
                     /codon_start=1
                     /locus_tag="AO090166000038"
                     /note="predicted protein"
                     /old_locus_tag="AO070227000008"
                     /protein_id="BAE61691.1"
                     /transl_table=1
                     /translation="MTIDVQDIQITRHLEQIESIKTGIPARTIESLHDLIHQDLLKDM
                     SESMRQLYNPQRHDIYRLATNIKGKSPMYLSPIVDTRQAVEDLLSKWFESRTTVGEKE
                     YMVHLVIERTITLDEDVIPVEEKIKVKKKRKIKKEIKDEIKDKIKEERIPSPIYQADD
                     GIVQSFLSTQSERSSEAVQDSRKRAASESSSILGTIPYRTRRRHVIDEEDMNRIQQE"
     exon            103978..104029
                     /number=1
     exon            104079..104673
                     /number=2
     exon            104695..104701
                     /number=3
     CDS             105176..105595
                     /codon_start=1
                     /locus_tag="AO090166000039"
                     /note="predicted protein"
                     /old_locus_tag="AO070227000007"
                     /protein_id="BAE61692.1"
                     /transl_table=1
                     /translation="MHRPSYVNAILIQSRGRRLAVPCTRCRSGQGRLVFPECRQVPGA
                     FGGACANCKWPDKASQCSVRDEFWHSLDGLREGSRMGGGGRHTRSLGSSQDNPINVDA
                     EIIDLDEPINLDPEEGDHPNDPINLDPEENEEWPEIE"
     exon            105176..105595
                     /number=1
     CDS             complement(join(106244..106490,106550..107424))
                     /codon_start=1
                     /locus_tag="AO090166000040"
                     /note="predicted protein"
                     /old_locus_tag="AO070227000006"
                     /protein_id="BAE61693.1"
                     /transl_table=1
                     /translation="MMPRAEFNYKKGRFHPTTLSTYASLYPISLFSIASLQSCYTATM
                     PQPVEAPRQRWDPSTICEIIDPSQHCTCIGVAKNGDACRNKVSKESREIASHRLEILS
                     MCPINEYLVSKLQEIAGLLLCKRRHQDQATSLSERWCTRLGLSPEQAPIQNPAPSHSS
                     QRRHTRSDRVPTTRAERRISGRSTSLPTTHQQREEVTVAMVQENQIPFHVSSTRPAVV
                     TVSAASGQTGSVVFRSFRKGRDISDVECGICRERHSEDTVYLNCEECAGEFHWRCMEG
                     WLMHRSPRSNFSCPNCRQDRLFDGFHAARPRSSLDAASEASQSATLPAASNSPRRDEL
                     SEQAPAEPELSSESYGPSPMEGVRRSMRPTRRPEYFVPS"
     exon            complement(106244..106490)
                     /number=1
     exon            complement(106550..107424)
                     /number=2
     CDS             join(110360..110406,110466..111089,111143..111293)
                     /codon_start=1
                     /locus_tag="AO090166000042"
                     /note="predicted protein"
                     /old_locus_tag="AO070227000004"
                     /protein_id="BAE61694.1"
                     /transl_table=1
                     /translation="MPEPCELFEYTTGKWIYNDALRHRERRRAFNVSELKRLAALAVQ
                     QKEDDIAGFEKLAEGGFNRSFKITMRDGFQFVARIPYPVTEPKFLVVASEVATIDFLR
                     SHGIPVPKIFGYSAVADNPAGTEYIFMELVQGQNLGDIWFTLSEQERITLVMKLVQLE
                     TRLFGLQFPASGSLYYYDDLPAHDYPAIVPSPSSTRRFCIGPDTSLGLWYGKRLNLSV
                     ERGPCKKTEILWRFSPPEPQKRLRISKHLDDLSNLFSVFAERCTITSPNPTSNIL"
     exon            110360..110406
                     /number=1
     exon            110466..111089
                     /number=2
     exon            111143..111293
                     /number=3
     CDS             complement(join(112332..112385,113319..114342,
                     114831..114868))
                     /codon_start=1
                     /locus_tag="AO090166000043"
                     /note="predicted NTPase (NACHT family)"
                     /old_locus_tag="AO070227000003"
                     /protein_id="BAE61695.1"
                     /transl_table=1
                     /translation="MADYWRPARMITHSDDNTVRLWDPATGTLQQTLKGHTDPVNSMV
                     FSPDGRLLASGSDDNTVRLWDPVTGTLQQTLEGHTGWVKTMVFSPDGRLLVSGSDDNT
                     VRLWDPVTGTLQQTLKGHTDPVNSMVFSPDGRLLASGSDDNTVRLWDPVTGTLQQTLE
                     GHTGWVKTVAFSPDGRLLVSGSDDNTVRLWDPVTGTLQQTLKGHTDPVNSMVFSPDGR
                     LLASGSDDDTVRLWDPATGALQQTLEGHTDPVEFVTFSPDGRLLASCSSDKTIRLWDP
                     ATGTLQQTLEGHTRSVVSVAFSTNGRLLASGSRDKIIRLWDPATGTLQQTLKGHINWV
                     KTVAFSRDGRLLASGSHDNTRLTEPWSCPLIRTHFPG"
     exon            complement(112332..112385)
                     /number=1
     exon            complement(113319..114342)
                     /number=2
     exon            complement(114831..114868)
                     /number=3
     CDS             complement(join(116425..116484,116592..117771,
                     117844..118262))
                     /codon_start=1
                     /locus_tag="AO090166000044"
                     /note="predicted protein"
                     /old_locus_tag="AO070227000002"
                     /protein_id="BAE61696.1"
                     /transl_table=1
                     /translation="MDGLSSAASVIAVIQLTGSLVKLCGGYIQEVRNAREEILILQRA
                     VTGLQDTLQDLQNNLQENKAKDLPTSSRLPSDITACLSDLQALEARLNPGKGKSLMSK
                     MGLRALKWPLKRAEVEGLIKSLERYKSSFLLSLQVDQTMVNNTERINQHVDLGKLEGA
                     IDAGFESFSDRDEVECLLGTRTELLREIIEWALSPSSKSIFWLRGMAGTGKSTVSRTV
                     ARSAKNRNHLGASFFFKRGEADRGNAKKFFPTLTRQLILWKPELRPGVQKALDNDPDI
                     ASKSLREQFERLLLEPLLGLDQRDQPPQNTVIVIDAMDECEHDQDVRNIIRLLPRLQE
                     VKSLCLRVFLTSRPELPISLGFSEIGNQVYQDLALHEIAKEVTEHDIQLFLRHRFTKI
                     QLDRRVPQDWPGDGIIQELVKVSVPLFISAATVCRYIENPKWEPKSRLAELLKDQAKY
                     VSKMDKTYLPILTRLLDDQESDEREQRQLLQEFQDTVGVIILLAVPLSINTLSSFLGI
                     EVDQISNRLDSFRSVLSIPSDEKQPNYAASSTERYLHSSRPWSA"
     exon            complement(116425..116484)
                     /number=1
     exon            complement(116592..117771)
                     /number=2
     exon            complement(117844..118262)
                     /number=3
     CDS             join(118579..118844,118898..119328,119383..119408,
                     119442..119546)
                     /codon_start=1
                     /locus_tag="AO090166000045"
                     /note="predicted protein"
                     /old_locus_tag="AO070227000001"
                     /protein_id="BAE61697.1"
                     /transl_table=1
                     /translation="MAPRLAPSQLVMIRDMISSKSQTTPQMAEAADCSKRSIITISAN
                     LCMFGEVRAPLIPGGRPRVISPVILEALCDHLLENPDLYLDEMAYPSIAWLDQKVARR
                     IAQERNADLRDYYLHQLSDFRSYHLVFIDESGCDKRAGFRRTGWSLRGVAPVQVSHFQ
                     RGQRYQILPAYCQDGILMSRVFQGSTDANLFEDFVEQLLHHCGRWPQPKSVLIMDNAS
                     FHHTDRISELCSNAEFFAELKAFEFKDFLEWSLDVVGLREESAQGHFRHANIEVDEE"
     exon            118579..118844
                     /number=1
     exon            118898..119328
                     /number=2
     exon            119383..119408
                     /number=3
     exon            119442..119546
                     /number=4
     CDS             join(125220..125580,125644..125821,125903..126051,
                     126101..126209,126263..126401,126497..126645,
                     126709..127353,128465..128603)
                     /codon_start=1
                     /locus_tag="AO090166000046"
                     /note="H+/oligopeptide symporter"
                     /old_locus_tag="AO070283000079"
                     /protein_id="BAE61698.1"
                     /transl_table=1
                     /translation="MSGPMSVVNGSAVVSAESDSKSRLVMAPPARDAGDDTDPGALIS
                     SSYIDKNPEELPEKDAPAVVDAIRSLADSDDDSRVATEDEVCDLLHVVDKIPVRLWVA
                     CIAGILERFVWYGATAPLQNYLQNAPGGEVPGALGLGQAAASNIVNALIIGSYIMPVP
                     AAVLADSFLGRYKTMLYSAIIEAIGATILFATSLPVAIHGGAALAGVIAACVLLAVGS
                     GAFKTTVVPFIADQYDATEFRIQTRKKGEKVVTSRELTITYIYNVFYWAINVVGFVAD
                     ATPLLERYVGFWLAYLIPCCLMWLALIPVLLAAITLVVAALRCGISGGFRMDAAKPHA
                     QLQHGRVVPWTDSFVEDIKRSLLTCQVLLLFPIHWLCYNQTFNNLISQAGQMVTYGIP
                     NDMMKIAGAISGIIVAPIIQKGLYPCLTRRKVAFGPIARMTVGFIVLTLSMVYTTVVQ
                     KLIYQTGPCYEAPLACPGSHDSTVPNQISVFLQIPIYLGGALAEVFCLTTGTEYAYNH
                     APKSMKTLVQAIWLAMAGIGTCLALAFTPLTKDPHLITMYAILAGLLGGATVLLWVLF
                     RHLDKSKDVGGIKTEFRRNETIDTGSGSSIHKVDMGITVYADSAIYDRILSLDSLG"
     exon            125220..125580
                     /number=1
     exon            125644..125821
                     /number=2
     exon            125903..126051
                     /number=3
     exon            126101..126209
                     /number=4
     exon            126263..126401
                     /number=5
     exon            126497..126645
                     /number=6
     exon            126709..127353
                     /number=7
     exon            128465..128603
                     /number=8
     CDS             complement(join(131706..131836,131894..132014,
                     132070..133090,133152..133359,134456..134609))
                     /codon_start=1
                     /locus_tag="AO090166000047"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070283000078"
                     /protein_id="BAE61699.1"
                     /transl_table=1
                     /translation="MLLVVALPSSTGHCRLSHFYSRFSSYLSCGNEAWSRLTRCSMSN
                     CQLAALHQRCPQYSMQINRAIMALSTRDTEVNSMTSSLEKQEGELPDWTTDPSNAQNW
                     SLAKKLYNTSIPSLLCLLISFGLAIYSPSHAHVQEDFHISNTLSLLPFTLYVYGLAFG
                     PMISAPLSETFGRRFVYIIMTPLALLFILGAGFAQNFATLAICRLLGGILCSAPLAVG
                     AGTMMDVWSGPNTNRGVVVLMGVAFLGPALGSLVGGWIAEYKDFRWSQWTTLFLGAAL
                     WVYSMGAQETYAIPIRRRLAKKAGLTPPPKPIPDGLAGIKILMTVTLARPLYMLLTEP
                     IVTLCSLYSSLNFSVLFCFLASVPLIYSTNYDFSPGQSGLAFIGIAVGCIIGAMALVI
                     VDAYTLSKHRARHPGEPAPPERMLMAAMMGSPLMPAALFWFAWTSQPGIHWISSIIAM
                     GLFGCSNIMIFVSTMLYLTNVYGAKAGASALAANGLLRYGVGGSFPLFTIPMYNNLGF
                     TWASSLLGFLAIAFAPLPWIFYRFGSKIRQSSAYTA"
     exon            complement(131706..131836)
                     /number=1
     exon            complement(131894..132014)
                     /number=2
     exon            complement(132070..133090)
                     /number=3
     exon            complement(133152..133359)
                     /number=4
     exon            complement(134456..134609)
                     /number=5
     CDS             136881..139439
                     /codon_start=1
                     /locus_tag="AO090166000048"
                     /note="beta-glucosidase-related glycosidases"
                     /old_locus_tag="AO070283000077"
                     /protein_id="BAE61700.1"
                     /transl_table=1
                     /translation="MVHHEKSAVEELLRALTLEEKVSLLAGKNMWETANIDRLGIPSL
                     KMTDGPAGARGSKWTYGSLTTFIPCGISLAATFDPELVQKVGGVLGEETRRKHCQVLL
                     APTMNLSRSPLGGRNFEGYGEDPYLIGKVSTAIIRGIQSQGVAACMKHFIANDTETRR
                     FNVDQTIDERTLREVYMKPFVMALDADPLTAMVSYPKINGYHADLSPSILKPLLREEL
                     QFDRIVMSDWGGLNSTVESLIATTDLEMPGPAVRRGEKLLAAIAQGQIDVAKHVDPSV
                     RRILELLDRVGLLSESSANGAVKNDEAESEKAPDDPNFHRIAREAAQDGLVLLKNEGV
                     LPLQPSSLEKIAILGPNARRPTAGGAGSAAVNPFYITTPEECLTTAIRQVNPGTEIVY
                     EQGIPFSLRPPLLGSKLTTPNGSRKGLEVTFYAGHEFQGPPVATTYWDDSLVYLFSDG
                     DVPESLKGTPYCYQASGIVTPQVSGWYTWSVANTGKAKLFIDDVMIIDNSEWSRITGG
                     FLGCSSEDRTVRMQLQAEKTYRLRVDNIVTLPPIESFDNTLFPNVSGLRVGLAREEDE
                     QAMLNRAVDCARSSDIAVLVVGHNKDSEGEGGDRINMELPGQTDALVQAVCEANPNTI
                     VVVQAASAVTMPWVNQARAIVMAWYQGQENGNALADALLGHCNFSGKTPITFPRQLED
                     HGSHAWFPGQAANDACEFGEQVLVGYRHLDKHGINPLWPFGYGLSYTRFEVTDIRLDG
                     HITTAPASTISIHARVSNVGEQDGSEVVQAYVSPSEQIQKKGLVTYQKTLAGFCKVFV
                     PVGETRDVAIQVSKEELRWYNAEARSWQLDPGRYYCFVGTSAVDIHGELEFHLV"
     exon            136881..139439
                     /number=1
     CDS             139635..141233
                     /codon_start=1
                     /locus_tag="AO090166000049"
                     /note="predicted protein"
                     /old_locus_tag="AO070283000076"
                     /protein_id="BAE61701.1"
                     /transl_table=1
                     /translation="MDPSSSPSSTLPPSVPVACLNCREKHLKCDGNLTGCTRCKDLSL
                     FCHFVPSRRGRRGRPWPYSGAMGDYPPLPVEPTGNAMMTPLDSLACAAPQGDATCSSL
                     PPRIDNQLVTLFFLHFHQAHPFLPPRDAFLHSSPPIYLLDVVQFISVHYLPASNVPDH
                     THQLCTAVQEAEASLEKVQALLLLSIIMHARTQPREAKEWLGDAISLSLDLGLHCREF
                     SEALEIQNPVRAESARRTWWEIFIIDTLLAAVQVDGALQLTVETLDIPLPCEMDEYQD
                     GRLGIVPISLRDMDRQALFHNDGDFSSAAYRAEAATILRKCLIASGNHVSHETINILD
                     VTISAWFHRLPSGKQAMLHHNGDVDQMIFQSFMIMHCASIYLHFPKSYLLAFLPVTSH
                     IFCSRPPTFTSSSANPQIHTAKVYGAAVNLSKLASLTTSVASHSPFFVCTLVLSSIVQ
                     LAVFTADPQQSSRTGRSFLALNIGVLKSMGHVWTIAATSMARIRDVAVELESALARES
                     RALLDDHLTQSVLVDSQGLDVTFL"
     exon            139635..141233
                     /number=1
     CDS             complement(join(141721..142071,142126..142238,
                     142298..142784,142842..143320,143371..143701))
                     /codon_start=1
                     /locus_tag="AO090166000050"
                     /note="sulfatases"
                     /old_locus_tag="AO070283000075"
                     /protein_id="BAE61702.1"
                     /transl_table=1
                     /translation="MKFTKKILTTLGLLGVTEANLGSINTEKHVAQQNAVSKRPPNFL
                     FIMSDDQDLLLDSLSYTPLTMKHMRDKGTTFNNHFVTTALCCPSRVSLWTGRLAHNTN
                     VTDVHPPWGGYPKFVEGGFDKNFLPVWLQQAGYDTYYTGKLMNAHSIENYASPHVSGF
                     NGSDFLLDPYTYDYMNATYQRNHDAPVSYLGRHTTEVLTEKAMGFLEDALSGERPFFM
                     AVSPIAPHSNMNGTYGAGSGPLWMDEPIPEDRHKHLFPEAKVPRKANFNPKEPTGVSW
                     IHDLPFRNETEVDYNDHYYRQRLRALQGVDELVDSLVTRLEQSDKLDNTYIIYTSDNG
                     FHIGQHRLPPGKTCGFEEDIRVPFFIRGPGIPEGAVEDSVSTHIDLAPTFYELAGIPL
                     RDDFDGAPMRILRNNMGTLHEHVTVEYWGQAMLEGGLSNLGKPTVPNNTYKAVRILSE
                     EYNLYYSVWCNNEHELYDLTNDPYQINNLYAKVQTDNSQETRIMGYSLSRVITRLDAL
                     LLVLKSCKGTSCIEPWSVLHPGGSVHNLRDALNEKYDSFYQAQSKVSFDRCEYAYIID
                     AEGPQEALAYRNGYSLDAWV"
     exon            complement(141721..142071)
                     /number=1
     exon            complement(142126..142238)
                     /number=2
     exon            complement(142298..142784)
                     /number=3
     exon            complement(142842..143320)
                     /number=4
     exon            complement(143371..143701)
                     /number=5
     CDS             complement(join(144491..144524,144690..145237))
                     /codon_start=1
                     /locus_tag="AO090166000051"
                     /note="amidases related to nicotinamidase"
                     /old_locus_tag="AO070283000074"
                     /protein_id="BAE61703.1"
                     /transl_table=1
                     /translation="MASNAQSFRQTIGIPRSTASVKDSTLIIIDAQNEYASGQLKVEG
                     VAESRKVIADLLSRYRNGGDGSNIVHVVHEVPAGAPVFTPGTALAEEFEELTPRPGEK
                     IVTKNFPSSFAKTDLHDYLIGLGDLGKKIVLVGYMAHVCISTTARAGSELGYDVVIVK
                     DAVGDRHIPGVEAEQLVAVALNEMGYGGGLTNK"
     exon            complement(144491..144524)
                     /number=1
     exon            complement(144690..145237)
                     /number=2
     CDS             complement(147465..148316)
                     /codon_start=1
                     /locus_tag="AO090166000052"
                     /note="predicted protein"
                     /old_locus_tag="AO070283000073"
                     /protein_id="BAE61704.1"
                     /transl_table=1
                     /translation="MASSFKSVVSITHVTTATAIINIDGINFLTDPVFCPAGSQYIYD
                     GWAKAPNLKDYGFEGRPPSGVLRSTEGPALQLHDLPPIDAVLLSHEDHVDNLDPLGRQ
                     LLDGRKVFTTPDGAHNLQPRPGVVGLRPWETVSATIGGKEFRITGTPCKHFPGGEVTG
                     FILETESFGFNAAGLPNVVYFSGDTVYIDEFEKIKEKWNISVAVLNLGNALFSHPNGI
                     IQITFDGKQAAHFMRVTGAEIMVPIHFESWEHFTEHRDDLLRVFEKEGVANLVRWLTP
                     GVEARII"
     exon            complement(147465..148316)
                     /number=1
     CDS             join(148938..149030,149081..149959,150023..150116,
                     150201..150439)
                     /codon_start=1
                     /locus_tag="AO090166000053"
                     /note="monocarboxylate transporter"
                     /old_locus_tag="AO070283000072"
                     /protein_id="BAE61705.1"
                     /transl_table=1
                     /translation="MSQSNAVDGGYGWIIVLAVFWNNAHHWGILSSYGVFLEDFISNS
                     RISGGTSLDFALIGGLSASQALVISPLITMIHRRFGLRATMALGVLFETAALLGASWS
                     TRVWQLYLSQGVCFGWGLGLQYLSTTFIIPQWFSKKRSLAAGITTAGTGTGGLIYSLA
                     THAMLDRFGSGWSYRILAIIQFVVNTICVLLLRDRMEKPRSERKKATFRLSLCKRYET
                     WLFIGWSFFSVMGFMVIWYSLATYSRSIGLSASQGSIVTAVMNVGQILGRPAVGYFSD
                     VVGRINMTTFATFTSGLLCLLLWVFAKTYSAILCFALFAGILFGTFWTAVGPLRAEVV
                     GLEDLQSFLTIMWLICSVPATFGEAIGLELRTSGEDEFLRTQLFTGFMYIGASLCTLL
                     LRGWKISQEKTPESGDCPGSASTHGECNISSRLSPIVAWEKV"
     exon            148938..149030
                     /number=1
     exon            149081..149959
                     /number=2
     exon            150023..150116
                     /number=3
     exon            150201..150439
                     /number=4
     CDS             151820..153058
                     /codon_start=1
                     /locus_tag="AO090166000054"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070283000071"
                     /protein_id="BAE61706.1"
                     /transl_table=1
                     /translation="MRMTANVLEIQGQFMYLPGCMIVSFDDPLTRTAEVHMISVVPGL
                     ELGRLARTHNIYKNVVHDRISVEEAISELNQLMERKSRYHSAWSLIFLSGLASVAVGP
                     WAFDARPIDMPIIFVLGCLLGFMQNVLAPASPVYSNVFEVSVAILMSFLARAFGSIRV
                     GGEPVFCFSALTQSSIALILPGFSVLCSSLELQSHQIVAGSIRLVYTIIYSLFLGYGI
                     TVGITIYGLLDSNATTESSCPSESLSIYGNEYIQHFVFVAIYCAVAAVLNQARWKQLP
                     VTVFLGVSGYVANYFSQALDSRLASTISAFAIGLLANLYSRLWHGHAAAAIVPGMFTL
                     VSSGLATSGSIMSGLAYAESVKNNTVSKASTSNTAVQQSLYGLGLSMVQTALGITVGL
                     FFSALVVYPRGKQRSGLFNL"
     exon            151820..153058
                     /number=1
     CDS             complement(154748..155413)
                     /codon_start=1
                     /locus_tag="AO090166000056"
                     /note="predicted protein"
                     /old_locus_tag="AO070283000069"
                     /protein_id="BAE61707.1"
                     /transl_table=1
                     /translation="MASKGCRMVVRPHHSSLLDQNQPSLPPPKRPRLLDGCEYPNTRI
                     CSGREPITVPPRQHIVVTALVSSIPENLSKINNVQRTRVELERPKWQRKVAAAATTTA
                     ATAFAATAMAAGAQRRLRRTPSTNDNLVLPCLALGDESSPFLGISSFDNGLEVLVHDR
                     RTEVFDVCNRSDHTILVGLGGLREVGIPVPCVDCLFPLCEKIWDVRHVSRVQWTASWE
                     ETL"
     exon            complement(154748..155413)
                     /number=1
     CDS             join(155525..155731,155936..156094)
                     /codon_start=1
                     /locus_tag="AO090166000057"
                     /note="predicted protein"
                     /old_locus_tag="AO070283000068"
                     /protein_id="BAE61708.1"
                     /transl_table=1
                     /translation="MAYTDALRLEVDDETEAKKQIHVSGCDIPRLCLVAAYSWLQEHA
                     FELTNNDIGNNISFSALQEWEPGQPIQTDSPNDSGKLYIPDDFVVLEPTARQMQKMDE
                     AIEVMAGRVLAEYEKNHPN"
     exon            155525..155731
                     /number=1
     exon            155936..156094
                     /number=2
     CDS             complement(join(161076..162727,162823..162844))
                     /codon_start=1
                     /locus_tag="AO090166000058"
                     /note="ankyrin repeat"
                     /old_locus_tag="AO070283000067"
                     /protein_id="BAE61709.1"
                     /transl_table=1
                     /translation="MTSRIILIKELATISSLSTNVEQQLRYQLLQIEHRTYLWLYLAI
                     DDIHNRFQESLDPTKMSIKLIPSSVNEAYKRILARVPLNQVNTVRLILQIIVSARRPL
                     TIQEMGMALGIGRSSRSQTAAKARINPGILVQRVRRLCGLFVFVNNSKIYLIHQTARE
                     FLVKRNIAHKPSSRYSFQWQDAERTMSQICIRYLGMDDLEANQEQTESDIQCFLSYSA
                     EYWADHVRGMSSSQQQEMVDLVHGVYSTTTGRYRMWFPIFWKSVGLFDGYHARRSLPK
                     LDAVHLAAFNGHSHVLRLIITSEENTINKKDSTGATALMWASYNGYYEAVEMLLSKGA
                     DINAQGRQYETALQVACCRGHDQVVQILLEKGANIHHFSGKYGNALQAASLGGHDRIV
                     QMILEKGAYVNISGGYGGTALQYACLGGHDQVVQILLEKGANIHHFSGKYGNALQAAS
                     LGGHDRIVQMLLERGADVNAGGGHDGSALQAASSEGHVQIVQMLLEKGADVNADGGHF
                     GSALQVASSKGHVQIVQMLLENGANVNDVVLPDVSGKVHSRFPVGCVSS"
     exon            complement(161076..162727)
                     /number=1
     exon            complement(162823..162844)
                     /number=2
     CDS             167110..168024
                     /codon_start=1
                     /locus_tag="AO090166000059"
                     /note="predicted protein"
                     /old_locus_tag="AO070283000066"
                     /protein_id="BAE61710.1"
                     /transl_table=1
                     /translation="MRIAIAGSGAMARYICDEFPKYGHQVVILSRSEKPIFNGRPNIS
                     QVVTDYSVDSLVAAIDNCEMLISMILSYGTDFIDAHLNLIKACQLSPKCKRFVPSEYG
                     GDVETYPDMPLFYYHTREPIRKALREQSELEWTIVSVGWLADYVVPSRNRYLADIGPA
                     FPIDLATNQIVIPGTGNDHIDLTAARDLAAALAMLANAPSWEPYLYISGEKTTWNDLA
                     KLVQQRYPSMTEVKRIGLGQLLNTIQTSTDEEEILLSHYQISTPLGGGSLDPELVQRH
                     RRKFFAGLHFRKPEDLIREAFTNGNTIV"
     exon            167110..168024
                     /number=1
     CDS             join(168705..169837,170036..171632)
                     /codon_start=1
                     /locus_tag="AO090166000060"
                     /note="predicted protein"
                     /old_locus_tag="AO070283000065"
                     /protein_id="BAE61711.1"
                     /transl_table=1
                     /translation="MASAKSELSQTLQDITHAKLRELSRKQEIFLSHKATTLQTVQAL
                     DSKIERLAALSNGLKTCFGIPVVNGRMIRGHTSNHERLEITLANIDRFLKQAQYDPSI
                     SPSIMQRWQQSLLSNLEMQTLKYEFATLFGQLTMEWLSTKKGPPPDDDVSMSEEPEQL
                     PGAEKLESRKQWEDAVFTPLELDTDEIELLLSELFQNPSKDAKDIRVAFKELQRKVQV
                     FEESLTYSRLFSASTLRWTISGLMASDLLTEEKRTVLKDFLNNAIILDELSDVLNMRM
                     TALDAWSWGTEVPIEQRRQLNGTYNIYMHEDLIQAIFLQYLGVKWSVFFKSAFTEFRK
                     ASGVWKSPGSNIPEIDKSRREFFLGYRSPKHSVQSTREKIYQKGSRGAAVFFEEEAGV
                     DEGEDSDDDYDTDNGREVFNPKNPMDAKQNLLHLLATDILIKTQLEGELTCFRSKYDS
                     LNPDLSHATIHAVLGFFGVSEKWLGFFQRFLKAPLKFIDDPHAEPRQRQRGTPGAHVL
                     SDVFGESILFCLDFMINQKTEGELLWRVHDDFWFWSSNHQTCVTAWNAIQRFNKTMGI
                     SLDPLKTGTAQVQHKATKSPTSLDPALPPGQVRWGMLYLNPDSGHFEIDQQMVDSHVE
                     ELNRQLKDQVRSVFGWIQAWNSYATTFFTSNFGKPANCFGRKHVDMMLATHERIQRVV
                     FSLDAEGGKSDVSVIQFLRDIICQRFNITSVPDGYFFLPIELGGLELSSPFIQLVGLR
                     DSLIEDPTTLLDKFLEAERDAYASAKVRYEQRLNSTQHAAIHNQGFYPDDAHTFISFE
                     EYIRYRELLGYGFTGELKEVYEKLLQRPEQQHIECDPNGAVFRELNQLSGHQNLRGIK
                     SNWRNMDAYWKWVAELYGQEIIDRFGGFNIVDPGLLPIGMVSLFRSGRIQWQE"
     exon            168705..169837
                     /number=1
     exon            170036..171632
                     /number=2
     CDS             173432..175114
                     /codon_start=1
                     /locus_tag="AO090166000061"
                     /note="predicted protein"
                     /old_locus_tag="AO070283000064"
                     /protein_id="BAE61712.1"
                     /transl_table=1
                     /translation="MYDDTIPDLCMFGGPMDDLDEKDLNEAIADSIHINPRNGTLGLP
                     ITGSGMDQRKPKLAMMVGKFWKPGSELRIAFMSGTPWQHDQVKKFAPIWTQYANLKFK
                     FVDYDKSSPPDILINFDPSRGSNSYLGTDSAGVARHGRHSMNLGWINEKTSENARRST
                     ILHEFGHALGAAHEHSSPRAEINWNKEAVYARYSGPPNKWDKAKIDHNVLRKIPDKYT
                     KATEFDPDSIMLYAFPGSLTMDGKGTERKHFLSARDKEFMRFIYPFDTHDVGMFNTIE
                     VATGNKSQQLFVTTVPWNRKYSSPPAMVWGFNHLDIPSNRNLRIQANITDKGLDHFKA
                     RIGTWMNSEIHSAGMTWMEVGPDCGFVHTGSVSLRDIPGWQRKPSQNSKRVTFSTPFK
                     HQPKVVCFLTLLDFFQGEDWHVKTYATNIDHTGFTIHMDTRSSGVMHGVCVSWFAYEA
                     GRPDMISGRFSTNDIRVPSQHRHDATSAVIFDKTFSRTPKVLLALDELDYAQAKDLRL
                     RVSTSMVSKDGFTWHLQSWDDSIMYSAGASYLAWAETEKSKSNLNGSGIVIV"
     exon            173432..175114
                     /number=1
     CDS             complement(join(177285..177373,177469..179419))
                     /codon_start=1
                     /locus_tag="AO090166000062"
                     /note="predicted protein"
                     /old_locus_tag="AO070283000063"
                     /protein_id="BAE61713.1"
                     /transl_table=1
                     /translation="MDPGLDDDLFPANKYCPLCGVVLLCEELEDDPETRRPWYAEVRG
                     VAKENFSDIFMTGVGFMSARETLCAPLDEELDYLTADEEALYDVDLLQAESERHGFGL
                     HDSCWMLLQDRLWHTIDSDKIAHSLYNQFYCTPCPYRSSLSFGHDYGGAKRWQRALDD
                     MGMPEDMPPLLQTDPYAIPLLEKLEENAPDVDGRRESPPAYNTTSTDINTGYRNSFGR
                     LSSELLYEVVSYLSVPELLDLRCTSQELSQRLVFSSLPQSFWKSQFARGSSMDFLFPD
                     LEQSRDWFRLYRGTLSILQAKDQSPEQLSLLNRKRIRELLEPIASVVEADSGRSKEPR
                     GRRANCMELRPGQWFVSEGLNQWRAENIYTGYLTLETEYLPHGCHVPRYRIGAFPQSM
                     PRGGEMKISTVQLGARVFISGISLQEGAVGYGGLTGLVTIKVPPRATFNQIEVAFCPE
                     GLRGIRFHFGGNTTSDWVGDTLDKDMSYGVLRIPHSPCGKYHIFAGTDVSTSSTTTDS
                     MTNACKAHKITAIGTIHNESREERSSKPFWLDYPLDLTLPDSYLWQSERPSYDNLRIY
                     QFPTENLGTPYRPLMNIDFGGPNGEWLDSLLSMEVHVSSEFSPILGMTFNYSDKTLRF
                     GECTSDKKLTFSIDGPGGERITDVVGSHHKPEPRNGVPAWRSIRRLRQPNDSLSK"
     exon            complement(177285..177373)
                     /number=1
     exon            complement(177469..179419)
                     /number=2
     CDS             180958..184773
                     /codon_start=1
                     /locus_tag="AO090166000063"
                     /note="predicted protein"
                     /old_locus_tag="AO070283000062"
                     /protein_id="BAE61714.1"
                     /transl_table=1
                     /translation="MATLGEVVDTILGQRVQLRRLQGSGAAGQSGCSIYFARPCDEDD
                     NDTEDKTKRPIAVVKVYPPHRHSDLLDELASYKTLRSLPSPPRAVHPIGVGRTRDEES
                     GALAGVVVYQVATGKAVNTILCELGWITRLRSLVRDAAMDVTNRHKLQIFMEQNRGDI
                     PVDWEAHKALEKQGVDIYFSEALPAFFEQRYQHLLRDLRSAMRAVASVLAKLHTGRRG
                     EWCDAAENALENIRKRIRGWIEEIQTDAAPGYDNAGIGVDRREEMQDMVEYAIHQAKH
                     RATTSLTHGDASSGNFFWDSNIGVTMIDYGGVRLSTDESGKPTGLAEMDTAGFYERLR
                     KYAPSFGVSDDDVTSLQETFWTAYHEHNMSLDPDIVRLVRLRIQMSRLWSAVDKFNQS
                     QDGNQAVVEGEFQRLRSIAKLLRDQGAWKRNILVVSNASGCGKGGIPFLNQELVNGLA
                     GLNGVSVALFLVGDNNSVSQTHHENVTVVGLPGSEANGELLYYMAKVHQPEEFGLPTH
                     RDANCRSPFDLIIGHSRYSSAAAALVRDRFYPAAKLALITHTSPLRKADAAWAWYGGS
                     RQQGYEEATRLAMLDERILPKADLAVGVGPVLTNEAREREWVGQLTRPRWSLTGPRFH
                     ELIPGAHIVKDDKDIRARRPDDPFKVLLAGRADDPAKGVDDAIHAVWKLAESGVENIT
                     IDILGVPIGEVEKRQEEVDQMTGIPALVRFHPFSNDQHVVRRSYQAADLVVMPSTHEG
                     FGMIFTEVAGLGIPILVTEDSGAGQFALDRSRIPAELGDAVVVMDEKAYGIPASIKSS
                     RVGLWADRINQVRQNPIQAVRNARELHNVMRGYSWAHAAEALLDAAMEHHEGDTVQTA
                     HGSLLPYRPLLSPEVDASLRCATTIRNHNGVPEREQAAAVVKSLPEIAPSLNALNEFV
                     SKALGHQVILRPLDGPHVKGFSGAPVFFAHSTFTHSYQTRQTDAAILSQGEELAVIKL
                     FPAGLDNGIAEELSSLEWLLHQTKGDINTPTPIAVGRTTWDEKETGVVTYRVAQGVSL
                     YQLMARLGLLDGPERDDSVTVLKRGVIEAAKTLAKLHSYAVQGRSSEGYLEWYYDAAP
                     GRVNRLRSHAGILLEHTGIDVDKLDEKVHTLIAQSRQEIYRHPQAAVVHGDAHPGNFF
                     FDPRSGRTTVIDVTTLHCSLDENGNPAGTPERDVGHFLHMLRRTGEQLNMREKEMDEC
                     SRAFLTAYKGTAAGKLGIHTLRLLGVCSALSFVGHALQGPSIDGQILKQQAKILDDMF
                     CLDQSGLLG"
     exon            180958..184773
                     /number=1
     CDS             join(185136..185489,185539..186611,186662..187799)
                     /codon_start=1
                     /locus_tag="AO090166000064"
                     /note="heavy metal exporter HMT1, ABC superfamily"
                     /old_locus_tag="AO070283000061"
                     /protein_id="BAE61715.1"
                     /transl_table=1
                     /translation="MDILPNSRQLAVLRISYPIVILVAFFVAFIAHSILIARSTTKNG
                     TTPLGPGGKPLPKRLRSTMNNLRNAQRNVSRRMKLAFAWLAVGVLLTYVADGVIHIMH
                     VLVAKSEKWWCGQAVVIYVVGSFFSHAVILVALLEASPAPTIAHFIPWITALPFELVI
                     LAGTLSVYTTVHHEPVIGNPYGGGPRREGMTKWETMEIVSASIRLLLFSLMVGLYMIK
                     FVHKSNPHETVEFGSASEVAGLLSGSNEGDDSAPEPWIRPTTTPETSWWEYVSSYSLF
                     FPYLWPAKSRRLQIVVVICFLLLIVQRVVNVLVPYQVGVVTDTLSWDNGEIQIPWIQI
                     AVYIFYRWLQGSTGILDSIRSNLWISVSQYSYMELSTAAFEHVHSLGLDFHMNKKMGE
                     VLSALTKGNSINTFLEQVTFQVLPMIFDMAIAVGYFLIAFDAYYALVVAIVTFCYVYV
                     TVRIAQWRAEMRRQMVNASRQEDAVKNDSLMSYETVKYFNAEDYEFDRYRNTVSNFQS
                     AEWHSLYAQNLMNISQNTVFILGLLITCFIAAYQVSTGQRPVGQFVTLLTYMAQLQTP
                     LTFFGTFFRYIQSAMINAERLLELFRQQPSVQDEPFAVPLENCNGSITFQDVSFSYNS
                     KPALQNLSFHCKPATTTALVGESGGGKSTIFRLLFRFYNAGGRILVDGHDVQDITIAS
                     LRKHIGIVPQDTVLFNETLMYNLKYANQAATDEDVYNACKAACIHDKILAFPEGYETK
                     VGDRGLRLSGGEKQRIAIAQTILKNPRIIMLDEATAALDSETEEHIQEALAALSRGRT
                     MLIIAHRLSTIATADNILVLNEGQIVESGTHQELLAKNGKYTSMWNKQIKAQKAAD"
     exon            185136..185489
                     /number=1
     exon            185539..186611
                     /number=2
     exon            186662..187799
                     /number=3
     CDS             complement(188086..188517)
                     /codon_start=1
                     /locus_tag="AO090166000065"
                     /note="predicted protein"
                     /old_locus_tag="AO070283000060"
                     /protein_id="BAE61716.1"
                     /transl_table=1
                     /translation="MQYAESDCHGQPPYLTSAPFQGELYPVKKIGVTIWSHDQGWISY
                     PQEHSSFNNSWTWFDLKITRPAGRDDISKDANLRLETNVHASEDTMCHEIIYRSDQDL
                     RLVQNLEPGDRISIIPRALFPGWTNFVENACIDIYTTPVLI"
     exon            complement(188086..188517)
                     /number=1
     CDS             join(189722..189875,189926..190176,190220..190253,
                     190302..191242)
                     /codon_start=1
                     /locus_tag="AO090166000066"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070283000059"
                     /protein_id="BAE61717.1"
                     /transl_table=1
                     /translation="MGSSSRPWYRIRWFADEDTPEERRLIVKLDLLIVPYAFLAYWVK
                     YIDQANINNAYVSGVKEDLNLQGNDLVQLQTMYTVGAVVGQIPFVYLFTKLPISWLIP
                     ILDIAWGVFTLLQFRASSFGELAAYRFLVGWFEAAFFPGMHYIFGAWYRGDEIARRGG
                     CFYVGLTLGTLTASLIQSGASARLDGVHGLAGWRWMYIVCAIITIPIGILGFFILPGT
                     PDKPNRMVLRRKDVDLAKSRLARAGHGFNPGFQWRAVINIARNWKFWAMLLLDVFFWN
                     GSLNTTAGGYLLWLKSLNRFSTARLNELSAISPALGMFYTLFICFASDLVLGPAWAIT
                     VSHLWNIIGLVILVVWNVPESAKWFAFQTTYAAVAMSSVLYGWINSELRASPVERSLA
                     LVITNTIAQSTTVWTPLLVFKTVEGPRFTKGYSFTLASAICLIATAHLIQYFLKRERH
                     VSHSSVRIE"
     exon            189722..189875
                     /number=1
     exon            189926..190176
                     /number=2
     exon            190220..190253
                     /number=3
     exon            190302..191242
                     /number=4
     CDS             complement(join(192568..193214,193274..193571))
                     /codon_start=1
                     /locus_tag="AO090166000067"
                     /note="predicted protein"
                     /old_locus_tag="AO070283000058"
                     /protein_id="BAE61718.1"
                     /transl_table=1
                     /translation="MEKQPGVMLSDVWDSLKGKQRAQLVLQVVDFEKTLAATKFNGFG
                     SLYYKDDLHSSVDTLPLYVDNSGKEVQNTKFAIGPTNHRSFFDFGRGSLDIDRGPWTS
                     VVEFATAVAKREIATVKSELKYPLMPEGLFYGPRQYQPIAAKKLSTLHNYLKVAPYTL
                     PENSATHASVLWHGDLNLQNIFVDPKESTRILGIIDWQSVSLFPLFTQATRPAFLEYN
                     GPLPETLDKVRLPENFESLNPVEQQKAKVLHQAQALHNLYLARSRQINPVVFEAIQGQ
                     KTLRHQVSVIPGLTIMDYEPCLNSLLRDIQKEWPSIVG"
     exon            complement(192568..193214)
                     /number=1
     exon            complement(193274..193571)
                     /number=2
     CDS             complement(join(194672..194762,194818..195014,
                     195070..196318,196404..196870,196975..197217))
                     /codon_start=1
                     /locus_tag="AO090166000068"
                     /note="oxidosqualene-lanosterol cyclase and related
                     proteins"
                     /old_locus_tag="AO070283000057"
                     /protein_id="BAE61719.1"
                     /transl_table=1
                     /translation="MNHKFASSNKHALRIKNHLNAQEDIEDGKPPFSACTTDREAWRL
                     VVEKDLGRLKWKYLNTQNERDSRPQDLVSRFFLGLPLAIPDSEATKSPSQSISNGLRF
                     HSRLQVAGRGCWADDLKCIVFVTPMLIMSWYITGAEIDEAYAIELANYLFTIQDPTDG
                     GFPTHIGGKTTLMGTMLIYVALRLMGIPSDEKHLIKARACFLEMGGAVYLPSWAKFWL
                     SLLGLYGWEGTDPYPVELWLLPEWTPISPWRWYNIVRQVYLPMCYLSSKRFTMPSNPL
                     LDEIRTEIFTEPYSSIKFASLQGCVLECERHQPQSRVLRTASWALSNVWNPWLRPRVL
                     AVSAERRALEIIKASDNTFNGTGLISLDCFLNMIVFYCEEGPNSKKLKQSQERTLEYL
                     WFSPQGMQVQSIHGAHTWNTSFALQTLVISGVSDHPDLRGCTEDAYKFLLEQQFLDDW
                     PDSPPCHRSSRLGGWPFTTRYHGSTCSDCTGEALKAILLVESQTNIPRLSTEKNIRLA
                     IDHMLMIQNASGGYSSFEPIRSGPFLEHLNGTELFANVMTEYDYTETTSSCITALSLF
                     RERDSSYRAEEVVNAIDRGVRFIHQNQQIDGGWLASWGIAYTYGAFFALEALHCANET
                     YENHAVVKRGCDFILDKQKEDGGWGETIESIMKKTYIQAESSHVVQTAWCCMALIYAD
                     YPDPEPIRRGIRLIMSRQKPSGEWEQEAGVGAGIFTCQLFYYNYIYSFPIRAIALYTQ
                     KYGDDKLL"
     exon            complement(194672..194762)
                     /number=1
     exon            complement(194818..195014)
                     /number=2
     exon            complement(195070..196318)
                     /number=3
     exon            complement(196404..196870)
                     /number=4
     exon            complement(196975..197217)
                     /number=5
     CDS             join(198125..198187,198373..199023,199192..199383,
                     199436..199602,199663..199828)
                     /codon_start=1
                     /locus_tag="AO090166000069"
                     /note="predicted protein"
                     /old_locus_tag="AO080566000042"
                     /protein_id="BAE61720.1"
                     /transl_table=1
                     /translation="MLNSINIPQNAISWAVACAAAMLDFHTRYGDVVRIAPDELAFSH
                     PDAWKDIMGHSKGGLYLEKASWFYRPLEYDPPHIFNEGRQAHSLLRRQLAHSFSDKGM
                     RDQEPMIRGYVDLLLQRLREMGGREDTVDISAWYNYTTFDIIGDLSFGESFGCLKGSN
                     YDEWIESIFRAFPFITALQALSFTPLVKEVLLALVPPSMRDRRERLRDFTRQKMLRRM
                     AIAEERPDLIEGLLKKKEELRLREEVRSTFSSEDDINLSSAAKLPYMLACVEEALRMY
                     PPGAIGPPRVTPKGGAEILGARIPGRTYVSIHHWALYRREEYFTDPHTFHPERFLGDP
                     RFSNDRHNVLQPFHIGPRSCLGRNLAYSEMRLILALLFFNFDMELSDDSQDWIQQKNV
                     IMWQRGPLKVHLTYIHRNSA"
     exon            198125..198187
                     /number=1
     exon            198373..199023
                     /number=2
     exon            199192..199383
                     /number=3
     exon            199436..199602
                     /number=4
     exon            199663..199828
                     /number=5
     CDS             join(201149..201340,201400..201506,201560..201719,
                     201786..201898,201959..202142,202208..202366,
                     202421..202610,202674..202795)
                     /codon_start=1
                     /locus_tag="AO090166000070"
                     /note="cytochrome P450"
                     /old_locus_tag="AO080566000043"
                     /protein_id="BAE61721.1"
                     /transl_table=1
                     /translation="MQLEPVYPRFPFARPSGDEPPAEFHRLLRECPVSRVELWDGSHP
                     WLVVKHKDVCEVLTDPRLSKVRQRDGFPEMSPGGKAAARNRPTFVDMDAPDHMHQRSM
                     VSAFFNDAYVESRLPFIRDTVQYYLDRLIRAGEDGKEVDLVKHFALPIPSHIIYDILG
                     IPIEDFEYLSGCDATRTNGSSTAAAAQAANKEILEYLERLVDKKTTNPSHDVISTLVI
                     QQLKPGHIEKLDVVQIAFLLLVAGNATVVSMIALGVVTLLEHPDQLSRLLEDPSLSNL
                     FVEELCRFHTASALATRRVATVDIELRGQKIRAGEGIIASNQAANRDPEVFPDPDTFD
                     MFRKRGPEEALGFGYGDHRCIAEMLARAELETVFSTLFQTLPSLKLAVPKSEIQWTPP
                     TRDVGIVGLPVTWDRD"
     exon            201149..201340
                     /number=1
     exon            201400..201506
                     /number=2
     exon            201560..201719
                     /number=3
     exon            201786..201898
                     /number=4
     exon            201959..202142
                     /number=5
     exon            202208..202366
                     /number=6
     exon            202421..202610
                     /number=7
     exon            202674..202795
                     /number=8
     CDS             complement(join(203980..204553,204607..204780,
                     204835..204909,204961..205178,205235..205785,
                     205844..205908,205966..206084))
                     /codon_start=1
                     /locus_tag="AO090166000071"
                     /note="predicted protein"
                     /old_locus_tag="AO070283000053"
                     /protein_id="BAE61722.1"
                     /transl_table=1
                     /translation="MTTRKLLLFLGLAGLSLQQKDILKDFCRLWGHQTAVIDRKLYID
                     GGFVNYNPLSEYPDNATNTALLYADFDVNNQGMPAVYNNLTKPTDAPDVNGGILWPDT
                     VNKMIYLYGGEYSQGTPSNFSLWSYDALYNRWQTVSADSTQAGIKRASYGAGVTIQDR
                     AVAFYYGGWLSNTSVPNWGSQSSRALSTMLQYDMLQNTWTNSSGPDTIGRAEGSMVYI
                     PASDGMLVYIGGVQSANNGTTIGQPMDEILLYDISGGKWYTQKATGDVPDQRRKFCAG
                     ATWAEDYSSYNIYLYGGLGAPEGLGFDDLYILTLPSFQWIKWYPNGTDSGYPKNSMSC
                     TVVDGAQMLVMGGTKPNDTDCDIPAIYGMHNVYLGKQNPQDAIWALFRPNLTSYEVPS
                     EIISAVGGSATGGANTTQPADGFDNRDLSVFFTRTYTAATRAPTRTIPTSESSSGSKS
                     KHVGAIVGGVVGGVAGVSLLAALLFFYLRRRKKNSVPTEVEQTQQDVKDPAAAALVGG
                     TGQDDSRRSELAGGYPGQQEAMRSELPAEVAGQRQSARSELGSSALVELEGDIAPYSP
                     TSPTSPPSSPPPSHPLSPTSPHRGS"
     exon            complement(203980..204553)
                     /number=1
     exon            complement(204607..204780)
                     /number=2
     exon            complement(204835..204909)
                     /number=3
     exon            complement(204961..205178)
                     /number=4
     exon            complement(205235..205785)
                     /number=5
     exon            complement(205844..205908)
                     /number=6
     exon            complement(205966..206084)
                     /number=7
     CDS             complement(join(212402..212435,212629..212890,
                     213667..214726))
                     /codon_start=1
                     /locus_tag="AO090166000072"
                     /note="predicted protein"
                     /old_locus_tag="AO070283000052"
                     /protein_id="BAE61723.1"
                     /transl_table=1
                     /translation="MSRPETSANHTVYTQSLPLERYTVGWICALPCELTAARAMLDHR
                     HVRPKNQSKHDENNYTLGSIAGHNIAIVCLPEYGTNKAAIAAKSMQATFPNIRFGLLV
                     GVGGGVPGPITETGPANDIRLGDVVVSLPAGQGGGVIQYDLIRREVDGFRRVGLLNKP
                     PTLLRTAVASLRAERRLGRQLTGLIEDAFAPDDECCEDKCDDDEESEGERWTYPSTGR
                     DFLFSPGYKHRSSGADDCTKCMEAKSAGDIITRRPRKTTHPKIHYGNIGSGNSLIKNG
                     LERDKLAQRDSIICFEMEAAGLMDDFPCLVIRGISDYADSHKNSSWQPYAAAAAAAYA
                     KQLVCSITPQDIDSLAPIQALQLLLSGNRMYKADDTPTCPSVQAVLRKLCNFPLAIVQ
                     ANAYINNRRLSMDDFLQQYEQQFIRPMSQKPRGPWNYDQVVNTTWEVSLTVSSSWLLI
                     A"
     exon            complement(212402..212435)
                     /number=1
     exon            complement(212629..212890)
                     /number=2
     exon            complement(213667..214726)
                     /number=3
     CDS             complement(join(216557..216732,216797..216881,
                     216942..217058,217129..217215,217290..217402,
                     217452..217577,217631..217973,218078..218452,
                     218489..218680))
                     /codon_start=1
                     /locus_tag="AO090166000073"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070283000051"
                     /protein_id="BAE61724.1"
                     /transl_table=1
                     /translation="MDRGKSASGSTSLHPEAGQDQSRDRINVQPIKSWKVYIWDTWEL
                     PPDQRWLLFKVDAFVLTFASTNGDHQIGYFLKNLDLNNINNAFLSGMKEDLHMYGNEL
                     VTSTSIYTVGYVIGQIPSNLLLTRISPRWVIPAVRIPPAYIPSHCVISLTDSPQLEVG
                     WGIATICTSSVQSYRSLYAIRFLVGLFEWIGKRAMVFWLAGSIGTLFSGFLQSAAYTN
                     LNGVHGHAGWRWLFIIDGIITLPLALAGFLFFPNLPQDGKKTWWTTEDEHILSVKRME
                     AIGRAGKEPWTVAKAKRIFLSWHTYLLPCLYIVWNNGYPQPGMGYWLKSFNTNPPPVP
                     GTSFSVPQINNYPMVTTGIFVVVALSWGWLSDGCRGIRWPFIYAGAIITTIFCVLLRQ
                     MPLYENINGRMAIYWLSNIGSGAGPLILSWINEICSADTEKRALIVGLANDLAYVVQA
                     VAPNFVWKTTDFPAAKKGYLWDIVLQCLLVVVTAAIQIQLWRDRRKSSTDREDDGFSS
                     GSQNEEASQQESDVEQGKTIHTKVVAVDN"
     exon            complement(216557..216732)
                     /number=1
     exon            complement(216797..216881)
                     /number=2
     exon            complement(216942..217058)
                     /number=3
     exon            complement(217129..217215)
                     /number=4
     exon            complement(217290..217402)
                     /number=5
     exon            complement(217452..217577)
                     /number=6
     exon            complement(217631..217973)
                     /number=7
     exon            complement(218078..218452)
                     /number=8
     exon            complement(218489..218680)
                     /number=9
     CDS             join(220813..220854,221034..221296,221354..221421,
                     221478..221710)
                     /codon_start=1
                     /locus_tag="AO090166000074"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070283000050"
                     /protein_id="BAE61725.1"
                     /transl_table=1
                     /translation="MTSNQYNLVTTMYYVSWGVVLCCHAAVTNRQGLYAVRFFLGLFE
                     AGLWPGMLVQLCYWYRPDEIAPRIVLVTLLGNFSTVISGVLAFAFNGVTTGGLSGWKW
                     LVLTEGIFTVILGIIVYFLLPDFPSTASWLSERERTFVEARLPSNAPRAAEANFNLRE
                     LLTTLQNKRIWLFLLCWAFFTVGTTGLTFYQPTVIANLGFT"
     exon            220813..220854
                     /number=1
     exon            221034..221296
                     /number=2
     exon            221354..221421
                     /number=3
     exon            221478..221710
                     /number=4
     CDS             222584..223840
                     /codon_start=1
                     /locus_tag="AO090166000075"
                     /note="aminoacylase ACY1 and related metalloexopeptidases"
                     /old_locus_tag="AO070283000049"
                     /protein_id="BAE61726.1"
                     /transl_table=1
                     /translation="MKATDLFHVTALVAGALALEHQQPLIGDLSQDLNHIIDSSPLLS
                     FHRALVQIPSISEHEKNVGEYVLDFLSSQNLTVEKQIVTPESDTEEERFNIYAYVGKN
                     RQPDVLVTSHIDTVPPFIPYSLHAPTSGTSFIRTDLVIAGRGTVDAKASVAAIVFAAL
                     ETLDENPNASIGLLFDVGEENSGVGMKHFSNSELNPTPPTYHTVIFGEPTELSLVAAH
                     KGTLGFKLVAEGKAAHSGYPWLGESAISSLIPVLAHLDTLQDLPPEKGGLLRSETLGK
                     STLNIGRVHGGIAANVVPAHAEAAISVRLAAGTPEDTRTIIERAVAKVTSGDRSVYPD
                     FGDRKAGAPPQYFDVDVDGFEVITVNYGTDAPALKIHDQRTQRVKRYLYGPGSILVAH
                     ADNEAITVGELEEAVRGYKRLIAASL"
     exon            222584..223840
                     /number=1
     CDS             complement(join(224161..225902,225959..226043))
                     /codon_start=1
                     /locus_tag="AO090166000076"
                     /note="thiamine pyrophosphate-requiring enzyme"
                     /old_locus_tag="AO070283000048"
                     /protein_id="BAE61727.1"
                     /transl_table=1
                     /translation="MGLIRRFVGMTGGQIFHEMMQRHGVKHIFGYPGGTILPVFDAIY
                     NSKHFDFILPKHEQGAGHMAEGYARASGKPGIVLVTSGPGATNVVTPMQDALSDGTPM
                     IVFSGQVATAAIGSDAFQEADILGISRGCTKWNVMVRNVAELPQRINEAFEIATSGRP
                     GPVLVDLPKDVTAGILRKTTPTGPAIPRISTYANTDANQKLLTKSISHVAKLINTAKK
                     PVIYAGQGVIQSPNGPQLLKELADKASIPVTTTLQGLGAFDELDEKSLHMLGMHGSAY
                     ANMSIQEADLIIALGARFDDRVTLNIAKFAPAARAAAAKGLGGIVQFEILPKNINKVI
                     QSTEAVVGDIAENLTHLLPHVNRTSMTERQAWFKQINEWKTKWPWNAYTRDERPHLIK
                     PQYLIEELSNLTAGRKQETIITTGVGQHQMWTAQHFRWRHPRSLITSGGLGTMGFGLP
                     AAIGAKVARPDTLVIDIDGDASFSMTLTELTTASQFNIGVKVIVLNNEEQGMVTQWQN
                     LFYEDRYSHTHQRNPDFMGLAGAMHIQHRRVSKPEEVVDSLKWLIHTEGPALLEVMTD
                     KKVPVLPMVPAGSGLHEFITWDAHKDMERRSLMRDRTCGLHG"
     exon            complement(224161..225902)
                     /number=1
     exon            complement(225959..226043)
                     /number=2
     CDS             complement(join(226249..226407,228003..228604,
                     228666..228834))
                     /codon_start=1
                     /locus_tag="AO090166000077"
                     /note="predicted protein"
                     /old_locus_tag="AO070283000047"
                     /protein_id="BAE61728.1"
                     /transl_table=1
                     /translation="MPELHTYKGYYLWHYIPSRAAAVIFLLLFLAATIHHTWKIWKLK
                     TYFCICFAIGGFFEFIGYCARASAYDKTGRMMPYCIQNVFILLGPALFAATIYMVLGR
                     VIIAVKGESRSLIPVRWLTKVFVTGDVLSFLIQGGAAGMMISSDLASIGNKLVIFGLI
                     VQVVFLGFFIISTMIFQARMYRNPTQETSSNVLRWKWHLNTLYLVSLLIMVRSLFRVV
                     EYIMGNDGYLLQHEWPVYVFDATLMWIVMAIIAIRFPIDPEMFRTRPISRAGNALALT
                     ARCQQTSFPRSHICASKLESIRRRNMTVAAQSM"
     exon            complement(226249..226407)
                     /number=1
     exon            complement(228003..228604)
                     /number=2
     exon            complement(228666..228834)
                     /number=3
     CDS             complement(join(229656..230777,230845..230859))
                     /codon_start=1
                     /locus_tag="AO090166000078"
                     /note="predicted protein"
                     /old_locus_tag="AO070283000046"
                     /protein_id="BAE61729.1"
                     /transl_table=1
                     /translation="MAASNCDEKRPICSHCTSSERLCEYSDTTFKVMQSSRISRKRTS
                     SPSVSTESSISNLSPDYSASSQLDASANMLHAELFYHLLTETLPSLCKSGNSRGLLHK
                     EVMNHALATPYLMNELLALAALHLSIIRDTQKEFYRHHSTQLQNHALRMFYETDPHAS
                     MEPPVPAFILSSMLGMHLLCDILIYQDHDFQAFLDRFIHYLRIHRGVRTVIGGNWDQI
                     KETSLKPILKDAEASLQNQTGDGEMCNRLLELIKASKLGPSLNETYEQAIKALQSSFN
                     ASQFGAIVDNIQGALAWPIMVTGEYTDMLVHRRPEALVILAHYAVILYSCRDAWLFGD
                     GGKFLIRSIDRYLGPQWADWLYWPNRVLAESTTPCLDGTSSLPQ"
     exon            complement(229656..230777)
                     /number=1
     exon            complement(230845..230859)
                     /number=2
     CDS             232170..233744
                     /codon_start=1
                     /locus_tag="AO090166000079"
                     /note="predicted protein"
                     /old_locus_tag="AO070283000045"
                     /protein_id="BAE61730.1"
                     /transl_table=1
                     /translation="MVVFSRTLFSLVAILVPIASASRCSPAFIVKPNLPGATILDIQA
                     QERHNFSAVSLGPGTNEGGRYTISFCNITVTHTHAGWNDTIHTQVWLPLEEWNGRFQA
                     LGGGGYATGFGETYLTYAVASGFASASTYGGLPVTNGKDSMPTDLSWALSSENNVNWF
                     LLEDYASKATSDMAVIGQQVTQSYYKKPANYSYFAGCSGGGRQGLQMAQKYPDLFDGI
                     LAVAPALNLQRFIPAGFWSSQVMNEINVYPLPCEVEAFTKAAVEACDRLDGVEDGIIS
                     DPDRCHVRAFDFVGKRYTCDGIQKSLSADSAKIIQAAWSGSHSVSEIDGWYGVNKDAA
                     LGTAYVSTKCSVNNTCYSSGSDLFGNWLRYLVAKDPNLSISNMTQKEFFDALRSSNLE
                     YSGMLGTNDPDLSRFKANGGKVIAWQGMADEVIPPLGTIAYYEEVLKHDPKAHDFYRF
                     FEAPGVGHCYGGLGPVPNEAMSQLLEWVENGHAPAVLHATKGSNNTARHLCPYPLRQK
                     YIGGDPRNATSFTCAK"
     exon            232170..233744
                     /number=1
     CDS             join(235969..236162,236422..236751,236805..237705)
                     /codon_start=1
                     /locus_tag="AO090166000080"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070283000044"
                     /protein_id="BAE61731.1"
                     /transl_table=1
                     /translation="MNPQSKGLAVEDSLATDYLSEHHLELTLDGHYIRWRRDNPIHPR
                     NWPVLRKCFDTGLICLLDFVLFLLGQVIGSIVLPPWSETFGRKRLYLISSALSSVCCV
                     VVGVPHSLAAVIIGRVGTGMLAAIPYTVGGGSVEDMWSSRPRIWVMFLWTIASNLGLC
                     IGPIMGTYVSTLLNWRWLFYIYAIIIGLMSVLFTFIRESRPSLLLTREVDKLCRYTGK
                     RFQALNHDHHPDLRTFLKVALFRPAILFLREPLVFIISIMIAFAFSLLYIFTEALQPI
                     YQTIGFSHTQSSLAFLAIACGIWFSTLTRLLDNRVFDTRRRKNLPFKPEDKLLGLAIG
                     APVLAVSLWWFAWTIPPKASNTHWIVPSVPLAMMGYALNEFDTVLYCYLGDCYLSYSA
                     SATAAVAFLRALLSGVFPLFTKQMFEGLTANVAVSVLAALATVFCIVPPLFIFYGERI
                     RDRSPFAKHSVFIAGELGNKEEDY"
     exon            235969..236162
                     /number=1
     exon            236422..236751
                     /number=2
     exon            236805..237705
                     /number=3
     CDS             complement(join(238034..239562,239614..239881))
                     /codon_start=1
                     /locus_tag="AO090166000081"
                     /note="multicopper oxidases"
                     /old_locus_tag="AO070283000043"
                     /protein_id="BAE61732.1"
                     /transl_table=1
                     /translation="MHSSLTFLTLALCLFAWANGSNHHVRTTGNTVRFNLTLTWEEWA
                     PAGIPRKMILGNGQLPSPLLELRQGDDVEFLVINNLPTNTSVHFHGIEQHGTPWSDGT
                     PGFSQEPIAPGDHFLYKWRATQYGSYFYHAHNRGQIDDGLYGAIYIHPDESVEKPFGL
                     ITNKSSERQAMRAAEEKTQPIMISDWRQLTSEEIWQAEEKSGLDAYCVNAILINGKGS
                     ISCPGQEKVNQLASAEQRQILGNLSLTDIGCTSPLVVAMQGTFRHNYSAVPPSMFSGC
                     VPGNGGTARVLVDPSHRYVSYDLISAAGVSMTTFSIDEHQMYVYAIDGRYIHPTLVDA
                     ITIANGNRYSVLVRLDKPAGDYTIRVANAGVNQVLYTAGVLSYNTLEKTQQHASVASI
                     NIHGAVVSSNYTLLDETKIIPFPVEVPSQEVAQTHILRISHYDASYTWTLGNTTLPLV
                     LEEVSPLLFYPSTAKPDLTLKTLNGTWIDLIFDIHGQIQPPHPIHKHANKFYVIGQGT
                     GAWNYSSVAEAMQHIPESFNLEAPQIRDTYITPPSATEDTWLAIRHHVVNPGAWLLHC
                     HIQVHLSGGMAIGILDGVDEWPEIPEEYSIQV"
     exon            complement(238034..239562)
                     /number=1
     exon            complement(239614..239881)
                     /number=2
     CDS             complement(join(242743..243094,243146..243449,
                     243502..243595,243650..243791,243847..244739))
                     /codon_start=1
                     /locus_tag="AO090166000084"
                     /note="predicted protease"
                     /old_locus_tag="AO070283000040"
                     /protein_id="BAE61733.1"
                     /transl_table=1
                     /translation="MRSSFLLAGVFGSLAAPALAIVHEKVAAVPNGWTLVKQAPESDP
                     ITLSIALARQNLDQLESKLTALSTPGNAEYGQWLDQSGIETLFPTASDEAVLRWLRNA
                     GVTHISRQGGLVNFATSVGTVNKLFDTKFSYYKNGQVQKLRTTQYSIPDDLADGIDLV
                     APTVFFGKQQESVALPTHHKFAAGTKTAAGNVSCADIITPDCLADMYNFRGYKPSASS
                     GSKVGFGSFLNESANYVDLALYEKRFNIPSQNFSVELINGATNDQNWTTASLGEANLD
                     VELIVGVSHPLPVKEYITAGTPPFIPNALQPTPADNQNEPYLEYYEYLLAKPNSALPQ
                     VLSNSYGDEEQTVPEYYAKRVCNLIGLMGLRGITVLESSGDTGIGASCMSNDGTETPE
                     FTPIFPATCPYLTSVGGTQAYAPEVAWDASSGGFSNYFSRAWYQESAVSKYLDQQITA
                     ETKDYYSQYTNFSGRGFPDVAAHSLTPRYEVVVKGKRATSGGTSAAAPVFAGLVGMLN
                     DARLRAGKPTLGFLNPLLYSGALKDFTDITAGSSIGCDGVNPQTGKNVTGGGVIPYAH
                     WNATAGWDPVTGLGVPDFMKLKDLVLSL"
     exon            complement(242743..243094)
                     /number=1
     exon            complement(243146..243449)
                     /number=2
     exon            complement(243502..243595)
                     /number=3
     exon            complement(243650..243791)
                     /number=4
     exon            complement(243847..244739)
                     /number=5
     CDS             complement(join(246438..246478,246537..246606,
                     246657..247444,247510..248071))
                     /codon_start=1
                     /locus_tag="AO090166000085"
                     /note="predicted protein"
                     /old_locus_tag="AO070283000039"
                     /protein_id="BAE61734.1"
                     /transl_table=1
                     /translation="MARTQWPSLGVAALQILSFSLVNQALAQSCAANYPPSAPVASAT
                     ATLGPVPAPDLDTSDPIHLIPAPKVSLYYGSLDSEPSTKAASGSVNMNLELNHDTVVL
                     EYIDAIGSVKCTDESVTVAFKNAAGFEIALQSWSLEENLILITNHLGNCDAEFERGFF
                     KVDQIASDKSNLSITCNASKHPIDKIAETCELSFSSVPAGKLAKRLTLNPSYSIPFSK
                     SLAHNTVLLNEPPYLTVTADEAAFSSEITFSGYLYYDFWAFKLRQLYFDIDAGFSADV
                     ALSAHLAASYNKSFTYNPSDLTYTLVNIPGIVQLGPGVAFGLEMDFSASADVDIAAGL
                     SISMPNGNVHVDILNSVNTVATGWTPTYHPYANISAQANVQADASATVTVEMALSFLG
                     GLIDLSSGLTAKPGIANTFVLDAKLDTEHATNATRVTNSTATGVPTDVHGGGNPCGDG
                     VMEHHSGKYGDSTMGLLLPILRSENKKAHPRDLTCP"
     exon            complement(246438..246478)
                     /number=1
     exon            complement(246537..246606)
                     /number=2
     exon            complement(246657..247444)
                     /number=3
     exon            complement(247510..248071)
                     /number=4
     CDS             join(249961..250143,250219..250556,250623..251082,
                     251182..251847)
                     /codon_start=1
                     /locus_tag="AO090166000087"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070283000037"
                     /protein_id="BAE61735.1"
                     /transl_table=1
                     /translation="MTDDGIELSPTRQRSADIMPMGNPSQSCDNYTAVQQAVSNLDGL
                     EGERGKVQVLAIMVALCLSLFIAALDQTIVSTSLPTISSRLHSASGYTWVGGAYLLAS
                     AAAAPIWAKLSDIWGRKPILLVAVLWFMFSSIVCAAAVNMRMLIAGRALQGIAGGGLL
                     QLVMIVVSDLFSVRSRSLYMGILEFMWTISGGLGPILGGVFSEYLSWRWNFWINLPIC
                     GLAFILLFFYLNVHNPKTRVTDGLKAIDWLGSLSIIGFTLMVLLGLNFGGETFAWNSP
                     QVICLIVFGSLFSIIFFCGEKYVAKYPLMPLKMLKHRSNIAVSLVTLFHGASAKQASP
                     MRSGLMVLPLVLAEGVFSGISGWLIHRTGKYAEQIWIGTVLLTLGTGLFIRLSPTSPL
                     VELIIFQVIGGAGSAILFAPPLIALQAMVAQDDTASATAMLGFIRTIAMSVSIVVGGV
                     VFQNSMAGERSRLEAAGLMDEIVEELTGASAAASTEVIKTLNDPSKIRTVAGAFSSSL
                     QNMWIMYTCMAGVAVLASAFIVNQPLSEEHTETRTGLKEE"
     exon            249961..250143
                     /number=1
     exon            250219..250556
                     /number=2
     exon            250623..251082
                     /number=3
     exon            251182..251847
                     /number=4
     CDS             complement(join(252992..252994,253024..253566))
                     /codon_start=1
                     /locus_tag="AO090166000088"
                     /note="predicted protein"
                     /old_locus_tag="AO070283000036"
                     /protein_id="BAE61736.1"
                     /transl_table=1
                     /translation="MLLLRMEYADRHDIMRPWRKPAQWTLKGHFSNLIQQWTTELSSF
                     LDKPALQNSQMLSFASTGFRTVLQAVSYTRRLVNPGYKEELRLVDVKAGLVDMLRQLK
                     QKAATDSDVDLNYAVIAVPEFFNQTLREMVVDASRKAGIRSALTPVSRTTVATFVSTS
                     TIANPPGLRYAVIDHGMFYLD"
     exon            complement(252992..252994)
                     /number=1
     exon            complement(253024..253566)
                     /number=2
     CDS             complement(join(254273..254361,254412..254642,
                     254690..254997,255046..255315,255367..255628,
                     255676..255894,255944..256154))
                     /codon_start=1
                     /locus_tag="AO090166000089"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070283000035"
                     /protein_id="BAE61737.1"
                     /transl_table=1
                     /translation="MIAVGKQREEDVSDPVLANLLAEDRTPWYKKPNLRRLYLILFPA
                     CMGIEITSGFDSQIINTVQIVYTWNKYFGRLTGDTVDGMPEYEVEPNLKGFLGAAYSL
                     GAILSLPFVPWVNQRFGRRWTVMFGSCISLVGALLQGFSNGVGMYIVARMLLGFGIPY
                     CIVAGSCLIGELGYPKERPILTSLFNSSYFIGQIVAAAVGLGTVTIASNWAWRIPSLL
                     QLAPAMVQVVFVFFLPESPRYLISKDRHEEAFGILAKYHAEGDRNSVIVRAEIAQIER
                     TIKLELEEAKQSWWDMFRTAGMRRRLLISAFLGLFTQWSGNTLISYYLSDLLDMVGIT
                     DSVTKSKINIGIACWGLVSGTALALTAPLFKRRTMYLTCATSLLCVYIGWTISMERFM
                     TTEVRAAAILTIFFIFAYSPAYNLGYNALTYTYLIEIFPYFGRSRGLSWFQFYGRGSA
                     FFATYVNPVGLDRISWRWLLVYCCWLAFELVFIYFLFPETSGRTLEELSFMFEGKEKA
                     NEVAAAVHKQIEVDGKTEGQA"
     exon            complement(254273..254361)
                     /number=1
     exon            complement(254412..254642)
                     /number=2
     exon            complement(254690..254997)
                     /number=3
     exon            complement(255046..255315)
                     /number=4
     exon            complement(255367..255628)
                     /number=5
     exon            complement(255676..255894)
                     /number=6
     exon            complement(255944..256154)
                     /number=7
     CDS             complement(join(256692..257094,257139..259207,
                     261104..261157))
                     /codon_start=1
                     /locus_tag="AO090166000090"
                     /note="beta-glucosidase-related glycosidases"
                     /old_locus_tag="AO070283000034"
                     /protein_id="BAE61738.1"
                     /transl_table=1
                     /translation="MPPDPLPELKQHSILVTLVTSPVLIIRPRVSTKTKPGIDFWHTH
                     PIPELNVPSIRSTDGPNGIRGTKFFAGVPAACLPCGTALASTWDQNLLREVGVLIGKE
                     CLAKGAHCWLGPTINMPRSPLGGRGFESFAEDPHLAGAMAASMITGCESTGVISAVKH
                     FVGNDQEHERRAVDVLVTQRALREIYLRPFQIVARDAGPGALMTSYNKINGKHVVESK
                     EMLDMVRQEWKWNPLIMSDWLGTYTTIDSMNAGLDLEMPGPSRYRGRYVESALQARLI
                     KESTIDSRARKVLEFVQQASRAPVSAVETGRDYPEDRALNRNLCANSIVLLKNQNDIL
                     PLPKTIKKIALVGSHVRTPAISGGGSASLEPYYTVSLYDAVSEALPHTEILYEVGAYA
                     HKMLPVIDRLLTNAVMHFYNEPVGTERILRATQPMSKTAFQLMDFNAPELNRGLFYAT
                     LTGDFTPDVSGVWDFGLTVFGTGLLYVDDELVVDNTTHQTRGTAFFGKGTVQELGSKT
                     LNAGQTYKIRIEYGSANTSPMKAIGVVHFGGGAAHLGACLHVDSAEMVRSAVKAAAEA
                     DYTILCTGLNHEWESEGFDRSHMDLPPGIDALITSVLDVAANKTVIVNQSGTPVTMPW
                     ADRARGIVQAWYGGNETGHGIADVIFGDVNPSGKLPLSWPVDVKHNPAYLNYASVGGR
                     VLYGEDVYVGYRYYEKVGREVLFPFGHGLSYTTFTVSPDVVFSQEVFRPEEPPTAAVK
                     IKNTGKVAGAQVLQLYISAPHSPTPRPTKELHGFTKVLLQPGEERVAHIRMDKYATNF
                     WDEIEGMWKSEEGIYEALIGTSSQNILAKGTFRVDRTRYWLGL"
     exon            complement(256692..257094)
                     /number=1
     exon            complement(257139..259207)
                     /number=2
     exon            complement(261104..261157)
                     /number=3
     CDS             complement(262967..263503)
                     /codon_start=1
                     /locus_tag="AO090166000091"
                     /note="predicted protein"
                     /old_locus_tag="AO070283000033"
                     /protein_id="BAE61739.1"
                     /transl_table=1
                     /translation="MHPLCARCKTIPLHDILQQGHSLWKKSNEPQLSWEIPWYSSLSE
                     LTASSSSSDCAFCKLVRQGLERSFEYEAAQQEARGEIPPASSTEKDAKDPLRKMEGYL
                     DFPMDMSLQLRSSLTDEDDEGDWDISRHSGTANAILTVRISSGVSWGLTLQAEFRVAT
                     VHGMAIYQSLFIQSSTLS"
     exon            complement(262967..263503)
                     /number=1
     CDS             complement(join(263766..264246,264339..264366,
                     264475..264525,264589..265162,265204..266070,
                     266099..266810,266867..266952))
                     /codon_start=1
                     /locus_tag="AO090166000092"
                     /note="predicted protein"
                     /old_locus_tag="AO070283000032"
                     /protein_id="BAE61740.1"
                     /transl_table=1
                     /translation="MELISTRPKKRRCVKERVRVTRACDACKRKKLRCSGTLPCSLCQ
                     RSSQECEYTTSYTRGRLPPIPTLQKPTGNDNVAEHHIQQKSAPNIDRMPASPDTEVIE
                     GHSSSRVDGDASNLPSRDSPEPHQTDMEGHYVGPSSGVSFLLRIQKRLHESISFPLNT
                     PIFSFGDAPLPKSDPSFLLLPSKNEAKELVHRYFDFAFPTHRFLHQQQVESWLEEFYN
                     CLRVPHSLGPGDREIRALLLMVFAQASQYQPESSSNLEDSHMRSVTSPYGSDPSSLCN
                     SAVYFGASEHHLAAETGPVRVTSVQARLAQCFYLLSQSRINHCWSLFGTTARLAIAIG
                     LHRKRRREHPNTVNLIEQECSKRVFWCAYSLDNYLSAALGRPRIFHDDDIDQEYPEVA
                     EDRQITLTSILPPTSSCQSIMLAPVYHAKLSKIISGVLHDLYGIQRSSLTVQASAAAK
                     YGAEMARWRKELTGFLDLPNVNIMKVTYQRQYTVLNLAFYHAQILLYRPFLLKGFTLL
                     TKEPSRRNDKLQGTIDQNIKSCLEAAMKVVSIVRDLSTAGRMYRAFWVLQFTHYYAFS
                     AVVVLYVHYIRSRSRQSTTDADLAYYMAGKQGQDDLASCGSQSSFSQRYVMVLEELRK
                     EAHKATIRGNQESIDQPPTNRPGPGGTENATSRLEELDQLRNIAGSQDAEAYPAASER
                     LDDILGSAQVSYRGVQPVGSFQFPAGPQESEVGSLQGISPESYIADLASWGEFDSLAA
                     TGLGDFGVFFPRYGILSIASFIPSRNVPRQRIRIQIASSPCNTRCSNSQPKMSTGQVS
                     ALLAPVVALNIWTFVMEAWMYKTRIPIYSKMNMKNTITKRELDAMTPASVRWKADNYN
                     HLMEQPTQFYAIALVLALAGQDDKTNILLAWSYVAIRVAHSLVHSTSNHIMSRFSIFV
                     VSSVILAVMTGRAALLVF"
     exon            complement(263766..264246)
                     /number=1
     exon            complement(264339..264366)
                     /number=2
     exon            complement(264475..264525)
                     /number=3
     exon            complement(264589..265162)
                     /number=4
     exon            complement(265204..266070)
                     /number=5
     exon            complement(266099..266810)
                     /number=6
     exon            complement(266867..266952)
                     /number=7
     CDS             complement(join(267433..267499,267866..268867,
                     268923..269059,269111..269284))
                     /codon_start=1
                     /locus_tag="AO090166000093"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070283000031"
                     /protein_id="BAE61741.1"
                     /transl_table=1
                     /translation="MATTSPHDSSMKNDTDHVEYLGDPEKSSSAPQYDRFGSFAKVNP
                     KEIALVRKIDLYMMPILWLMYFLNFLDRNAMVNGKLSSLSEDLKLKGTEYNTCISILF
                     VGYLLGQVPSNMLLNRIRPSWFMAGFMMAWAIVSTLTCLVKDYHSMLVCRLLLGFVEA
                     PFYPGALFMISLFYTRKEATTRMAILYTGNMLASAFSGLIAAGVFAGLDKKHGLAGWQ
                     WLFLIQGVITVGVALVAFFLLPNAPRSTAWLTPEERQLADERIKRDTTQREEGTSTWV
                     GLREACMDYRTWIFALMCNLHLSANGFKNFMPTVVKTLGFNSTITLVLTCPPYLVATF
                     TSVAVSWSSGHFNERTWHVTVSKALAIIGFAVACGTLNIGARYFAMILFVGATYGVNN
                     INIAWTAATLGQTDEKKAVAIAITNTLGNLASVYTPYLWPDSDAPRDLCYSTTYCVNS
                     LDLSNSVAS"
     exon            complement(267433..267499)
                     /number=1
     exon            complement(267866..268867)
                     /number=2
     exon            complement(268923..269059)
                     /number=3
     exon            complement(269111..269284)
                     /number=4
     CDS             complement(join(269997..270085,270580..271237))
                     /codon_start=1
                     /locus_tag="AO090166000094"
                     /note="predicted protein"
                     /old_locus_tag="AO070283000030"
                     /protein_id="BAE61742.1"
                     /transl_table=1
                     /translation="MNCPARRFPLRRPANHVPPIPRWYAHFADGIDRVFTTYIGVQRH
                     HGLDIGLTKCLAAIERWLATDQDNAPAAVERFRVIDGDDTPDSLVFACYWDTESKYEN
                     GIKGLNLTQLYQKLDKSIQPTVGLWCERFVSHVSRLETNYSGTDYLPGLARLPGTKTV
                     AHSYSAYWGAARDRIPDSAFELFEQDENPTATAIPDAMSTSLGKHLTGTNFHNVVHIR
                     TDRPLNLSFFFLFGHTWSGSTSPGVSSCQK"
     exon            complement(269997..270085)
                     /number=1
     exon            complement(270580..271237)
                     /number=2
     CDS             271794..272906
                     /codon_start=1
                     /locus_tag="AO090166000095"
                     /note="predicted amidohydrolase"
                     /old_locus_tag="AO070283000029"
                     /protein_id="BAE61743.1"
                     /transl_table=1
                     /translation="MATQVRLAAAHVAPIFLSAHETTHKAIHLIEQAAKNKANLIAFP
                     ESFISAFPIWSALRPPTENHDLFQRMVRESIHADGQEIQAVRATARKCNIIVSLGFPE
                     KARTSSATLFNSNMIIGNRGDVLVHHRKLVPTFFEKLTWSPGDGYGLRVADTECGKIG
                     ALICGENTNPLARYALIAQGEQIHISTWPAIWPTRLPSQPVAEKHNPQSDAMGKSNYD
                     NVAANRIRAAAHCFEAKCFGVLCAGMLGPDAIDIVSSSSSSVKQSMEQSQRAATMFLN
                     PTGAPMQGFVIDEVTSAQHSADFLQAREGILYADVDLTDCVEGKQYHDTAGGYQRMDV
                     FDLQVNRTRQQPVRFTDTVDLQPDQVPHKGSKGRRD"
     exon            271794..272906
                     /number=1
     CDS             complement(join(273119..273599,273652..274031))
                     /codon_start=1
                     /locus_tag="AO090166000096"
                     /note="predicted protein"
                     /old_locus_tag="AO070283000028"
                     /protein_id="BAE61744.1"
                     /transl_table=1
                     /translation="MVIFDNVSNGYRDIFLPLACEDEVLRGAIRAVAAQHLALRHPGF
                     QGIAEIGRAAIISRLRRDSLQASSDSIVNLRTWATLIVLLVGETITGSPEYSHLLRTL
                     LSLMPSLCQMEATPAYRFLVQQTHMFQFLGQPLLNETQGMNALGFHPSHYLDWTDYEL
                     PPESRHNRVLWVVRQAFIEASQIYILRATTNHDLWDRLESLKQLVSRVDPDEQGAHAL
                     VWVCFIAAADSTDPEHRRFFTERMNQVFAKTKFQNIVAAVRTLPEIWAQQGSGRWTSN
                     LIQLTPTLIM"
     exon            complement(273119..273599)
                     /number=1
     exon            complement(273652..274031)
                     /number=2
     CDS             complement(join(275402..276037,276105..276502,
                     276581..276797,276880..277110))
                     /codon_start=1
                     /locus_tag="AO090166000097"
                     /note="predicted protein"
                     /old_locus_tag="AO070283000027"
                     /protein_id="BAE61745.1"
                     /transl_table=1
                     /translation="MKKLLNILAAGFFGFAVQATVPSNGTAEARLAQIKELLTHQLSE
                     NATIVFPDSEKWYDVTHRAAAPRVNPGYLAVVDIKVANEIGLPFLAVTGTHGWTDDIS
                     KIQDGIQIRMRGLNHVGLGPNNDTAYAGGGVLQYEVVQALYPYGKQAVHGLCECVSIL
                     GPLLGGGHSVLQGDHGFAADSLVSAKVALHNGTVVTASATENEDLFWGLRGAGHNLGI
                     VLEFEVKVYDIHPDPWTFMTLVYEADRIEEYFEAWNELEDTIADPGLVVLNGYYRNLP
                     EINAEKPVLVMELIYQGYDTAAPQYIQAYRAIGPIHEETITDIYWNELFDITNFGRDD
                     RVCVPSQNWAGYSNSIVRWDPASMRESYNIFADLVAIETYNTSTFIFESYGRKGVRDF
                     PDGFNAVPPEERNRHNMLAAFLFWSGDDPTELAVARDFGERLQVASRNGDIAHSYVNY
                     AMGGEQLPQVYGRDVDRLEKLQAIKTKFDPYNKFGFYASLADA"
     exon            complement(275402..276037)
                     /number=1
     exon            complement(276105..276502)
                     /number=2
     exon            complement(276581..276797)
                     /number=3
     exon            complement(276880..277110)
                     /number=4
     CDS             join(278337..278469,278529..278663,278723..278926,
                     278985..279358,279413..279595)
                     /codon_start=1
                     /locus_tag="AO090166000098"
                     /note="zinc-binding oxidoreductase"
                     /old_locus_tag="AO070283000026"
                     /protein_id="BAE61746.1"
                     /transl_table=1
                     /translation="MASTTATALVTKGGKLSKETIPVPTPGEHQVLVKISYVAQNPTD
                     VQSLDANAFGDDAVLGCDFVGTVEKTGDKVSRIKTGTVIAGLIWGGEIKGLGGYSEYT
                     LADERICFPLPEGVTPEQASTVPLAACTALIALFSKDCLNIPQNSGETVLIWGGSSSV
                     GLYAIQIAKYYGLNVVTTCSPRHHDLVKSLGASHAFDYRDAKVVEIIKAATNFNLKYV
                     FDTIGNDSSSVTASHAVSEQGGGLCTVRPGKAFTENVTKQTKVTDVLVWTAFLKEHKY
                     GEFYWPPHKEDHELSAHFFEELPKLLSSGVITPNTPKLLEGLDSVPKGFQEYRDGVIS
                     NYKIVYKV"
     exon            278337..278469
                     /number=1
     exon            278529..278663
                     /number=2
     exon            278723..278926
                     /number=3
     exon            278985..279358
                     /number=4
     exon            279413..279595
                     /number=5
     CDS             join(282991..283368,283415..283965,284018..284306,
                     284366..284716)
                     /codon_start=1
                     /locus_tag="AO090166000099"
                     /note="cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies"
                     /old_locus_tag="AO070283000025"
                     /protein_id="BAE61747.1"
                     /transl_table=1
                     /translation="MTLLQNIVSETPLAAGSALLTAIIVAYVIYQRYLHPLAKYPGPF
                     LASITDLWQVHQFLSLQQPYNLTALHERYGPIVRYGPDKLSITHESAVPTIYQKSAKS
                     MPKTEFYDAYGAAHPNVFGMRDEVMHSVRRRHMSHSFSLSYIKEMEEYLDLNIRILKD
                     KIRYHSEIGEVFALKKALHYYMIDVLGELAFSRSFGVQEADDESRIPPVIEHSLLAAV
                     TGAWPTMTMTLKRWLPYMPHAGLRRLFAGRKACADLASSSVQRRLRDLNDGESSVGVQ
                     NRKDILTNLIKAKHPETGERLTQTDLETEAFGFIIAGTHTTSATSTLLFYHLLHNPDF
                     MRKCTEEIDSNLPSLGPSETAYSITAAEASLPFLRNCIRENFRITPVFTMPLARRITD
                     PAGVTIEGEHLPQGTSVAVCNHAFHHNPVVWGEDHNIFNPNRWNDPNVGAKARLLMHF
                     GLGGRQCIGKAVATTNIYKLLSTLLKEFTFELADEQERVDVDKGLYKGRIPKLFSVGI
                     SDLQGPLLVRARVR"
     exon            282991..283368
                     /number=1
     exon            283415..283965
                     /number=2
     exon            284018..284306
                     /number=3
     exon            284366..284716
                     /number=4
     CDS             complement(284944..286725)
                     /codon_start=1
                     /locus_tag="AO090166000100"
                     /note="nucleoside phosphorylase"
                     /old_locus_tag="AO070283000024"
                     /protein_id="BAE61748.1"
                     /transl_table=1
                     /translation="MDEISTEFLFNVEDMQEAPEACRASSAIKVLVNSNNRKLPIYLE
                     KDGYLRLEDRIEELYDTLEKIMDYEVGMATQSSASSSRARKYLEGWDFNDLATSRDIF
                     YPRVAKLKAIGKGWVDFARAIHAVTLFGRRFGEVIQPISTGSCTKWAQLPKDMYYLAA
                     SIHDLKEIMDMDGDSEANPIVLAHNIIWHNPDIFGSCQCEVEGQEKHSDLVQVLLPSA
                     LKKGLLSNHQVPLEARGAVIFGHNEYSRWFWNDTGYPVVGGPWSPSEAPENEFHDSGI
                     GSDTASSAPKESRSSATLCSRHPSGECRETLTCESYTVGIICALQKELLAVRILFDDR
                     HEDLERAVRDTNHYALGRIGRHYVVAARLPSGEYGTNAAADVVSHLTRSFPEIKFCLL
                     VGIGGGVPSRDNDIRLGDVVVSHPTDIHPGVIQYDLGKTSEENTFERTGSLQRPPRFL
                     MTAISTLMSDPDLPSTRFQGYIKDVTACNPAYKHPGAQHDKLFAQCSGRHVRRARRSV
                     THPLIHYGLIASGNKVIKDAETRDHLGAKYNVLCFEMEAAGIMNAVPSLVIRGICDYA
                     DSHKNKLWQEYACATAAAYAKMLLSVA"
     exon            complement(284944..286725)
                     /number=1
     CDS             complement(join(288477..290386,290442..290618,
                     290669..291080))
                     /codon_start=1
                     /locus_tag="AO090166000101"
                     /note="predicted protein"
                     /old_locus_tag="AO070283000023"
                     /protein_id="BAE61749.1"
                     /transl_table=1
                     /translation="MATERQPECIMSQTQHCLESLGAQSCQEPPNASGDTQQYSNNPA
                     HNDTAGPDDHLQQITCKDRHSPVPNHSQLSIHRYQVKKLRRLQSNGSRLAGPQRGRSY
                     LKLQSFLDYRVQQRRGTCKDGEPVWSDELEDAFHQALEANPPMGRRNWSARGESYGRN
                     ELIADYIYRLTGKRRTRTQVSSHLQVLDSFLKGDPDWERLVREQPADHSNSQTQLVGP
                     TRRSPINCLSSSHYSKDSLVCAVQCLGFGMWVSAPNMPDRIDDAFHVYTRLRRGQPQA
                     PMPLEELTNWRTFFPHLNSLLLEVNDPLSCEIILLEARLQLMDVHPPTGSRLEIGLEL
                     DITNPTLGAAPMSNQRENWTCYNYIYEEGQKTMETYHNIPKPHTTRIRLPFESSWWAE
                     RFTMLTEDKQVAEASGHQHAAKERNQQFFRTLTAVQEIRASEPASLRRLHNQYAGSPS
                     DGSKRMAIILWQFRQTLPIEVGTTICRKLIAAPGRTNEIYLPTPDLDSVRLTPLSSDP
                     IPPSRSTPSMYQSPRTHELLQQHWPLYQPSHHHVTSVFNSAGAFDFTNSITKPEESLS
                     DKTNSASMLDPFPNLQQQTTSQPTSLDVSSGAPRMLQIPDLPLPHTGLGAYGLGHESH
                     LIGPDEPVGSTVGMSGDAGMNGARLETLLEDDLRVTATSQGTVLQDWQQGGSKNSGKK
                     NPRAGDDAHTLEFTQTRAFTDSGYASTKLDNYGHIQSTRDIPTEPPAGPGYASGEQPE
                     VPQTQNFVHVDAARTVYSDTSSVTSLQREGYISELAGDLFTKVSSWQPDSMTMERISE
                     VLPELLRAFALKVGHNAPSQMHRDVMVFIHKNRE"
     exon            complement(288477..290386)
                     /number=1
     exon            complement(290442..290618)
                     /number=2
     exon            complement(290669..291080)
                     /number=3
     CDS             complement(join(291860..291981,292052..292560,
                     292626..292968,293027..293249,293306..293631,
                     293775..293805))
                     /codon_start=1
                     /locus_tag="AO090166000102"
                     /note="amino acid transporters"
                     /old_locus_tag="AO070283000022"
                     /protein_id="BAE61750.1"
                     /transl_table=1
                     /translation="MDASETKPKHAYTESIQHGDLDCLEGLNFQPEGTRKLTPLQTIS
                     ASWIICDSWAGVAATVALAIVQGGPVTLIYGLILIFFLVGACTLTLAELASTYPTAGG
                     QYHWTSILAPKHLSRALSYCCGVSNMLAWIAICTGIAIIPAQLILGIVLFYDSEYQSQ
                     PWHYFLIHQSINGLVLLYNTTLLKKSLWFHDVSFFMTLTSFVIIMVTCLARSASRYEA
                     SSSVWATFLNGSGWNSGGVAFLTGLVSPNYIYAGIDGALHLAEECRNATTAVPRALMS
                     TLVIGFVTSFAFMITMLYCTSDLDTVVASSTGVPIYEMWHQATRSTSAATVFICLLLL
                     AAVFALTGAQQTASRLTWSLARDRALIGSQWTGQLHDTLEVPVWALVFNYAVMFLIGR
                     VYLGSSSAFNAFIGTGLVLQHISYAFPAALLLYRCRSATWLPDPRPFRLPSPVGWGAN
                     LITVCFAVLVLIFYDFPTVMPVTGSNMNYTPAVLGAMAIVAGINWLVYARKWYQGPRL
                     RRSSGEIQK"
     exon            complement(291860..291981)
                     /number=1
     exon            complement(292052..292560)
                     /number=2
     exon            complement(292626..292968)
                     /number=3
     exon            complement(293027..293249)
                     /number=4
     exon            complement(293306..293631)
                     /number=5
     exon            complement(293775..293805)
                     /number=6
     CDS             complement(join(294433..294675,294729..295538,
                     295599..295849,295911..296088))
                     /codon_start=1
                     /locus_tag="AO090166000103"
                     /note="amine oxidase"
                     /old_locus_tag="AO070283000021"
                     /protein_id="BAE61751.1"
                     /transl_table=1
                     /translation="MTSRDGYQWTATTGLRQGVPSIGVISPPTNVLSTTEDWDVVVVG
                     AGYSGLTASRDACLAGLKVLLIEARDRIGGRSWSSNIGGYPFEMGGTWLSWGQPHIWR
                     EVSRYQMRSELEPCFDFSRGVNHFELRTGSQGSSIFSHLEEDALLASALEKFVDVDGA
                     MGRQIIPYPHDAFHNPAARQYDDMSALDRLNALAQSLTPNERAVLESFILLCSCGTLE
                     TTSFFEFLHWWALCDYSYKGCLQHLISYKFKGGQSSFAIKFFRESLRTGRLSYAFNSP
                     VQSINDHGDRVVVKTRDGRQYSGARLISTIPLNVLSSVHFSPPLSPQRMAAANIGHVN
                     QCVKVHAEVSCPDMRSWSGISYPFNKLAYAIGDGTTPAGNTHIVCFGGAHNHIQPEED
                     VEATKMAVENMSPGNMDIKRLVFHNWCKDEFAKGAWFFAPPQLLSKSLDELRCRHGNV
                     LFANSDWAVGWRSFIDGAIEEGTRAAVTVIEELRPAPAVRSHL"
     exon            complement(294433..294675)
                     /number=1
     exon            complement(294729..295538)
                     /number=2
     exon            complement(295599..295849)
                     /number=3
     exon            complement(295911..296088)
                     /number=4
     CDS             join(296667..296888,297027..297116)
                     /codon_start=1
                     /locus_tag="AO090166000105"
                     /note="predicted protein"
                     /old_locus_tag="AO070283000019"
                     /protein_id="BAE61752.1"
                     /transl_table=1
                     /translation="MTAVDITSNYSLFISLYIPAREDESSSRRRPLLRLPLGRHRTPT
                     PKFRHLISKFKFMSAKKELLLAVPQKLQLLKSAGDLVRLNTRNEHARECAGESEEYPE
                     L"
     exon            296667..296888
                     /number=1
     exon            297027..297116
                     /number=2
     CDS             complement(join(299548..299973,300036..300430,
                     300518..300709,300764..301025,301091..301234))
                     /codon_start=1
                     /locus_tag="AO090166000107"
                     /note="predicted protein"
                     /old_locus_tag="AO070283000017"
                     /protein_id="BAE61753.1"
                     /transl_table=1
                     /translation="MDPSSIQTKEKPIEDPNALYLEKGEIVDDVTYDAVFGEITDEGP
                     NYRNVGFFGTVVLMMKTQIGLGVLSIPTAFDTLGMVPGVIVLIAISCITTWSDYMVGS
                     FKLRHREVYGIDDAGALMFGTPGRVVLAAAFCLYWIFVAGSGILGISIGLNAVSTHGA
                     CTAIFVAVAAILGFACSSIRTLGKVTWLAWIGLPCILIAILIVTIAVGVQDRPPTAPQ
                     TDGPWVADFKIIGNPTFAQAITAVSSLVFAFSGTPGFFSIVSEMRDPRKFTPALLICQ
                     AVVTAVYITIGCVVYYYCGSYVASPALGSAGGLIKKIAYGLSLPGLIVTTTIVTHIPA
                     KYIFVHLLRGSKHLISNTVTHWTVWLACTLSITVIAYIIASAIPVFDGLVSLIGALLG
                     TMMCFQPMGCMWLYDNWHKRREGLATKQWWFMVFFSVFVVISGTFLTVAGTYGSVVGI
                     MDSYKTEGGSAAFTCADNSGSV"
     exon            complement(299548..299973)
                     /number=1
     exon            complement(300036..300430)
                     /number=2
     exon            complement(300518..300709)
                     /number=3
     exon            complement(300764..301025)
                     /number=4
     exon            complement(301091..301234)
                     /number=5
     CDS             303184..304131
                     /codon_start=1
                     /locus_tag="AO090166000109"
                     /note="predicted protein"
                     /old_locus_tag="AO070283000015"
                     /protein_id="BAE61754.1"
                     /transl_table=1
                     /translation="MDTTSNEAAIRLEPLGGRGTFTIKTTSVVFLAIALYNAVELLIL
                     ILANFHHHHGIYFWSMLLSTAVGVIPFSIGAIIDLYNLSPLWVILVMIDLGWIFMVGG
                     QSVVLYSRLHLVSRNDRVLRYLRYIIIIDTILLATPMSIIYFATAYSKPTVWARAFYI
                     MEVIQVIWFSVQECVISTFWIVETAKLIRLRPGYDRHRNRTMYEILAMNLAVISMDIA
                     LLVLQFSGYYYVQVPVKATVYSIKLKLEFAVLGKLVYLATHRVDSMGLEISPVMAPVD
                     VAPSTSPSSGASKLHQSMKDSFGLWKPTQTHNAASEGLM"
     exon            303184..304131
                     /number=1
     CDS             complement(join(306585..307013,307068..307151))
                     /codon_start=1
                     /locus_tag="AO090166000112"
                     /note="predicted protein"
                     /old_locus_tag="AO070283000012"
                     /protein_id="BAE61755.1"
                     /transl_table=1
                     /translation="MLFPPRDDGVNLVANATLPNPSVMTIEIGTITMDLKSKDLTIGN
                     ATINNLTLRPGNHSTPLEGVVDMHTVTENLLPLLQAQRDSLRSGYLSLDAVTREVEYD
                     GVMIPYYTEVMRDLVLSAKVPVNDLLINSVQGILHDNSSGLQSVLDDIRERSAAKGDI
                     TSSVGIKHRR"
     exon            complement(306585..307013)
                     /number=1
     exon            complement(307068..307151)
                     /number=2
     CDS             complement(join(307217..307682,307735..307964))
                     /codon_start=1
                     /locus_tag="AO090166000113"
                     /note="predicted protein"
                     /old_locus_tag="AO070283000011"
                     /protein_id="BAE61756.1"
                     /transl_table=1
                     /translation="MADTPSYLTTKAGKYALGAYRGPLEQQHGDGSQVAHVELTESST
                     LKGNGKIRRHWIRFWCCYLIGAIIFLAIFLPLFFTVIIQAISQRVIDDASLVLVEAKV
                     MQPRPESVLLSIQTALRLGVNVPVRLDPNVLHLFNNDQPGNSTYLKVYNDAIVIHGNA
                     SIGVQNQPSPINPDPWKHYIRSVVFEPHAPLSAFGTTNIYLGKLKSHISLKKDLPQNS
                     KCGPRSQKDRNEK"
     exon            complement(307217..307682)
                     /number=1
     exon            complement(307735..307964)
                     /number=2
     CDS             complement(join(310622..311689,311741..311940,
                     311997..312204))
                     /codon_start=1
                     /locus_tag="AO090166000116"
                     /note="predicted protein"
                     /old_locus_tag="AO070283000008"
                     /protein_id="BAE61757.1"
                     /transl_table=1
                     /translation="MGLVELVLETRWLIVGSLFILYFLKKFQAYYRLRKFKGPLSCGF
                     SHFLHTKAVLSLRCERWYKEMTDQYGSIVRIGPNALITSSPELWAHINAVRSPYKRSD
                     WYYHAARFKPGEDHVFSETNNERHDRRRKQMLMGYSGKENLSLESDIDLRVLDFLDLI
                     RNRYLSTEDCLKPMDLAKKVQYLTLDVISTVGLGNSFGMLKADKDVNDYIKSGEEGLW
                     VSNFLMGTGLHWIMQIEWVGRLLGPSTDDLKGFGKMMATTGQMVAKRLQSPTNARSDM
                     LASFIRHGLIGNELWMEAFEQVLAGSDTTASGIRGILLCLLSNPRVYKKLQAEIDGAV
                     QDGRAPSTGIISDAQLRRLEYLQAVIREGLRIFVPVVNIFARDVPPEGDEVIVDGESV
                     QIPGGTWIGYSALGMHLNKATYGEDAEVFRPERWLIDDKDHLANMTRVNDLIFGYGRW
                     KCLGQTVALIEIGKTIFEVHDELPLLTIVGLDILTVLEGAA"
     exon            complement(310622..311689)
                     /number=1
     exon            complement(311741..311940)
                     /number=2
     exon            complement(311997..312204)
                     /number=3
     CDS             join(315706..316020,316072..316341,316397..316538,
                     316590..317326,317376..317466,317514..317629)
                     /codon_start=1
                     /locus_tag="AO090166000117"
                     /note="amidases"
                     /old_locus_tag="AO070283000007"
                     /protein_id="BAE61758.1"
                     /transl_table=1
                     /translation="MGSNEECSWQQRVEQKRQRCANKIPAEWRMPDEVIASLHTPLAD
                     HRNDLIRNDIIRKSGIMTKHELQITEDYTVRELLAALANGSLSSVEVTVAYCKRAAIA
                     QQLVSCLTETMFAEALERAQYLDQLRSQGQVVGPLHGLPVSIKDSFHYKGTEATIGMV
                     SFLDEVSTGNSPLVDILLKLGAVIYVKTNVPQTMMALDSHNNVFGRTLNPWNTTLTPG
                     GSSGGEGALIALRGSPLGVGTDVGGSIRVPALCCGTYGFRPSASRVPNAGTRACSTSG
                     MRFILSCAGPLSTDLDGLEVFFSSVFDIQPSLYDSTVIDVPWRNVTVKPKLRIGLVPE
                     HPVFPLHPPIKRILAEAVQRLEEQGHEIIRLTNEECRIRELNEVALGIFGLDQGALSH
                     VISAGEPVVPALQHIGAQIAKVKQFHKPSLPDMSSMDRLAKLAALNTCRAELKEEYRG
                     MWKQHNLDLCLAPPAQNTAVAHDAFGPAPYTIFLNCLDYPACVIPFGQVNELDATDTF
                     QVGEDQIAPEYDYKSVEGAPCGIQLFTTTMRDEECLQMSKLIDLCLRG"
     exon            315706..316020
                     /number=1
     exon            316072..316341
                     /number=2
     exon            316397..316538
                     /number=3
     exon            316590..317326
                     /number=4
     exon            317376..317466
                     /number=5
     exon            317514..317629
                     /number=6
     CDS             318850..319533
                     /codon_start=1
                     /locus_tag="AO090166000118"
                     /note="predicted protein"
                     /old_locus_tag="AO070283000006"
                     /protein_id="BAE61759.1"
                     /transl_table=1
                     /translation="MRELLCLVFLDITESLFRARIPIIEYRVRDPYLINHHAGLCGSL
                     LPILYRVCLLGAAIRKGSQHPFSHNCFDILREEIVAWAPSVSAAMAGRFSEEEMLLLL
                     TQANLHRNAALLILHRLRFPFGDHDDDAEFLSQTIIREMQYCLAMTKHYPQIYHWSCP
                     LLELRSRTLWAGKTSSRRCRGSNGSSFYPFVANLRLFLTRVWTSRDEGTTRYLFDLFD
                     EDDNLSIPL"
     exon            318850..319533
                     /number=1
     CDS             join(319802..319859,319922..319986,320035..320601,
                     320665..321124,321229..321305,321361..321609)
                     /codon_start=1
                     /locus_tag="AO090166000119"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070283000005"
                     /protein_id="BAE61760.1"
                     /transl_table=1
                     /translation="MSNSDPNDVFPPGTIKLEERQGVESEFKLSPTPSDDPDDPLNWS
                     PLRKAVNFGLTCSYVLFTLVLVDINSLAYRGYMSELGLTYATFNQASGSNFAGLAIGW
                     LLFIPCVPKFWPSPYLLAQCDCAVGMCYLVGKLSQGWRTHWCQSAGSVSEAVVMITIV
                     DLFFVHQHARMNGIFLFMQSLGSTGGPIAAGYIVVSMGWRWMWWMIAIFPGVNLILVL
                     FFFVEPKYIPLVKVATPSTLRVATRSTVDARHSRKTVRQRLAFVTKTDMPIVQHFYQP
                     LLILFSFPAVAYTAITYGTILAWFSANTSSSSYFVLDDPYEFSASAIGLLHLGGFLGT
                     FIATLTVPAQNDSFIVRAAKKNGRVFEPDMRLWMSIPGALLNCAGLFIYGQGIYGFGF
                     ITTADVALTYLPDCYPDILGDALNSIVFVRNGFAMVVRFAFTPWVTGMGIQNSFILIS
                     MLALLPVTLPILLMIYGKRARSSTADKYWKYAARQPVHRKA"
     exon            319802..319859
                     /number=1
     exon            319922..319986
                     /number=2
     exon            320035..320601
                     /number=3
     exon            320665..321124
                     /number=4
     exon            321229..321305
                     /number=5
     exon            321361..321609
                     /number=6
     CDS             complement(322478..323323)
                     /codon_start=1
                     /locus_tag="AO090166000120"
                     /note="predicted protein"
                     /old_locus_tag="AO070283000004"
                     /protein_id="BAE61761.1"
                     /transl_table=1
                     /translation="MSSLSSLSNSSKSIVFYDIAMRPPREKTCCAPNPWKARLALNFK
                     GVPYSTSWVPLPDIAKVRRSLQVPACRKFADGTDFFTLPIIEDPATDASVGDSFDIAV
                     YLQKTYPTSGAGDLFPPQTLDYTFTHPTILIPLSECRDNEFPEYAKFNMNVDAAFTAH
                     TQLALQGFPFDPATAETSKAEFVRRAGMTSWEDFALVGEARQKVMDSFREMLGGLAKL
                     FVRDPSGPFLLGTRPSYADLIVGGWLRMMRATLPQSEWEEVSSWHDGLFGRLHDALEV
                     YAEVK"
     exon            complement(322478..323323)
                     /number=1
     CDS             complement(join(324155..324555,324752..325001))
                     /codon_start=1
                     /locus_tag="AO090166000121"
                     /note="predicted protein"
                     /old_locus_tag="AO070283000003"
                     /protein_id="BAE61762.1"
                     /transl_table=1
                     /translation="MLVLIAGVTGNLGSRMIDSFISRGHQVRGLGRNPSKLPSELRQK
                     LENFVEVSSSVDVTGLEKACHGVDAVVCAYQGHPELVVEVHAPIGEVWALLSAFGSPK
                     LWMPDCILTTVEGFGIGSTRTIAFGANPNIMIRETLDSVDVSKYSVRLHVDRDDLPGV
                     DSYATFFLKQISRHETEMKWIGESSIPDEEGRANLRVWLERTYSGFESCLNKLLAQ"
     exon            complement(324155..324555)
                     /number=1
     exon            complement(324752..325001)
                     /number=2
     CDS             325487..326644
                     /codon_start=1
                     /locus_tag="AO090166000122"
                     /note="predicted protein"
                     /old_locus_tag="AO070283000002"
                     /protein_id="BAE61763.1"
                     /transl_table=1
                     /translation="MTPLTGVRASNKQLTAATVPQVAVFVGATAGIGKAALTELISTG
                     FPVKAYIIGRDEAAFEPALSELRASYSSAILVFLQGEISLLAEAKRLTNIILRREGYI
                     DLLFLSAGFLPFLGRQGTSEPTKITISLLVHVQLKQLIHPTKIVWLLITFTPIAESTE
                     GVELSTAVAYYSRQIFIRRLLPLLRAKAKTTQSQHDASFRPRIVNVLAAGAETSTENL
                     FLDDLQLKQDGHFSVPSYAGHVATMTSVSLRRLSEEAENKNIVVIHHHPGLVYTEIFK
                     KSWGDQWDSSREHARPPAPDDIERSTPAEAGERALYLMTSAKYGGVGVPMGEGEAAGL
                     TVRGTRDGSLLCVGDKLETLSSVSRILDSLEDSGAAETIWSYTDKVIGGYL"
     exon            325487..326644
                     /number=1
     CDS             complement(join(329038..329050,329095..332934,
                     332970..334015,334072..334680))
                     /codon_start=1
                     /locus_tag="AO090166000123"
                     /note="ankyrin repeat"
                     /old_locus_tag="AO070283000001"
                     /protein_id="BAE61764.1"
                     /transl_table=1
                     /translation="MARTARRTKTAAASHRHTADHYWQQALASLDADSKAALSSVSTR
                     KLDIMGAVLSAAEDKRRLCVRKQWKFRLPSGRSVVLRDVLEKVVGWIDRFKAVGDIAA
                     QYSPEHVALPWAAFRFLLTVVCGDAQVFGSMVLALEVVARLATRCRVLEELYLRRPCD
                     ASGVIEEALVRLYAGSLVLLAQIIRFFKKSTGGKMFIQLPLESLAVSSEDIQALEARE
                     AEVLKLASLADTKVLQALDAKVEQLTAGTTTVLQDLNARSARLMDLTAARHKSLETQR
                     LADLLQWLSSTPVALHHRAISAQRLPGSGQWLLKHPAFQQWEASSSSSLLVLHGVPGC
                     GKSTIFSACVDHFRPPTPPSQQIPVPTAPCAYFYCAESPAQPDRASPENVMRSIVRQL
                     AVSPKDGAIDQGVLSVYERELQEAKAIKTDVRALSFEECIALILDLTMVNPAYIAVDA
                     VDELQAQDRATLLEGLRRVISDSASVVKIFITSRDSVHLDNLLPQDAAKIRVTPDLNG
                     GDVAAYVDHQLQTALQKCCILNGTVSSALVNQMSRALIKGSGEMGGLLCIMLIILPCR
                     VRFLWVKLQVDFLCRKKTEDDILGPLASLSANLDQIYGRTLAAILTLDVTAKRVAEQV
                     LSWLLFARRPLSVEVLHGILQLDRYVQLSGRVDIIDICHNLVLVDPGLDTLDFCHPSA
                     REFMQQQDLFSAARANRLIATICLQQCIAGPASDPDASQLSSSTLPVQELYHYTAVYW
                     PEHVRDSENEDEKDTLMQDTVLFVLGANDDESTVSPAFLVWMEWIRSAIKDLPRYHQI
                     SSKFEPLLSTGMSPLFLACVFGLSDLLDRVFALNWSLDIEARSDTGHTGLYLACSYGH
                     DHVVSKLLSHNADMNTKCGSFGTPFNVACFRGHAEVVQTLLAHKTAPRTTAAFSDAFR
                     AACRGAREKVALLLAKAFLPIWTESEYRTALQEAVEAGFRDLVEWLMSPATAGPFSSV
                     IGPSSTPDQKGSTAERLLHTAIKRGQVSVFRSLLRMKPHWQDLLLGDAMALSSLSDHP
                     DMLLALHDLGVNVDGEGVFGSTLRSASLMGNERAVRLLLSWGADPAASGSKGDALQAA
                     AQNGHLQIVRLLLDEGADVNQTGPPRGTPVQAAAFYGHSDVVDLLLERGADMYKGGKS
                     QDALYAAIEGGHEEVAALLLKKGYRVAAGADLPGIMRGSLDRVQRPWEKKRTAVGEQR
                     GIGTDDSDDGLGGPLLTGPDAVDSYEEDCDVSPSDLKDFREYDHPDPPLFKSEARIGT
                     LELSVVAEDADMIRQLILRPDTTQYDVIQAVRAAVTAGQLNSLRALLDEQAAFFQEDF
                     LDLNKQLILACEHGHAHIAQYLSLLVQPEVGGASLDEKTWGTAVQAAVSSGDPDTVLV
                     LLRCQAKPEASHLKAVLSAIQYAVAKRNPSCSKVLWSWLLQERASQGSHRTLVDACLD
                     QQSGGSPESILKDLLDAALWSRNEEMVRTAAAKMEEHGCDTSAILPALASACRRGFRA
                     IKPLLTSERFTQCHLCTASYTAAIFGRRWVLSEILEELARRGFPFSRTPVVDCAFIGA
                     AAHGHVAIIRTLLETSHLREKFAKFSWAITRAMVIAAHRGHEDIVQECLREGADVDVP
                     QEKDTVVSPHWREDGALAIEVAFDKLGPIKLVNPNAEITHNKIGTMDLKIEETAPSPD
                     RRLYRSRSIYTEEWTALQAALAGFAKHTWTLSAIRDDGEITDGSQGAMQQQERIVFLM
                     LEQGCDPNAENDSGETPIETAVRLATARVVQRLIESGVEVPGDDSLVSLAAKRGSFRI
                     VLHLLQAGASVPRTENGSLTPKMLKVLHPRLKSADFNDNPMSMEEARRPVF"
     exon            complement(329038..329050)
                     /number=1
     exon            complement(329095..332934)
                     /number=2
     exon            complement(332970..334015)
                     /number=3
     exon            complement(334072..334680)
                     /number=4
     repeat_region   338208..338231
                     /note="IV right telomeric region"
                     /rpt_family="Telomeric Region"
BASE COUNT        88936 a        80267 c        80104 g        88924 t
ORIGIN      
        1 attaatttta tctaaatttt ttatagaact attaatagac tttataataa aattactaga
       61 aataatattt aaaaataaaa ttattaattt aatataaata ataattaatt aattttttaa
      121 atagttatta ttctttttta ttttaataat aattaatata gtaaaattta ttaaattatt
      181 ttataattat atagaattat aatttagact attaaataat attatattta atagagaact
      241 aatctttact agtaaatttt aattaaatct ttactatttt aattatataa aatttagatt
      301 attaataata ttttatttat aaattaataa ttaaatagaa tatataaact aaatattaga
      361 atattatttt aaatatttta ttaataaaaa gtaaataaat tagctaaatc tatttttaat
      421 agtagaattt atatataata atatttaaaa tataactact agactattat tattttaaat
      481 tttatttaat tatttattaa atttttaatt atatattaaa aatagtattt ttttaaaaaa
      541 gattttagta atataatact atattaaaaa attaataaaa atttataaaa atttggcaaa
      601 atactaataa aataaaatag aatcttaaaa aaaatatttt aataaatatt attaaataaa
      661 attatttaag taaaataatt ctatataatt attaatttaa aatattaaat taaaaatcct
      721 agcttagaaa ctagtattaa aatatattaa actattttaa atattaaata ttataaaaaa
      781 ataaatatat taatttaatt tatttaataa atataattaa atttataata tattctatat
      841 tttattacta gaactataaa tactatatta ttaaaataat attaatttat tattaatatc
      901 taatcttaat aataataata aatagaaaat agaaaaaatt aaagaaaaat aaatttttaa
      961 aaaaaaaatc taatatttaa taaaatagat agaatagcta ttagaatata attaataaat
     1021 ctttaaaaaa aatatagtaa atataaaaaa aaaatttata tatttaaact gacctatggt
     1081 gtcttagctg cctcttttgt ggtagtccta ttgccgcctt tatggttgtt ctacaccaag
     1141 tcctatccac tattaagtat gatcaccact tcttccaagg tacagtttct aataggcccc
     1201 acccagggaa tgtaaaagta aattaggtac aactcgcttg atagtaagtc ctagagtact
     1261 agtctaatcc atccaatata aatagtatat atcctccgcc aaataattca cgatattttt
     1321 accttatata ttaccaattt gcctctacat ctctacgctt ccgctctgtt atattattag
     1381 ttactgactg tgctcttcta atacggtacg cccacccgat cttattctac aacaacaact
     1441 tatagtgtct taccatgtgg cacgcgcagg ggtattgccg cctgaggacc cttcctaaac
     1501 tactatgata ccaataggga agcaaaggct ttgtactatg tatcctcagg aatacactgc
     1561 ttctcttagt gatcagctga caatgtcatc cataagtgat accagtactg aatcggaata
     1621 tctcccagaa gacgaggagg aggacgagaa ggagatagtg aaaacgaaca ctaacaactg
     1681 gctgcaactg gagaatgaac tcaatgaaaa tgagctacat cgaaggcagt accagcaaaa
     1741 gacaattaat attaagaaca gggtctggag tctatggtgc cagtaagtct ataaagctgc
     1801 taagacatat tatacaacag ttaaagtaat actaatcatg ggctaggttc tgcactgcga
     1861 ctaaccgaga cactctaaca cttataaaag aagagccacc aaatattaaa acactctgca
     1921 cattctttga ctttatactt acaacgcgat gtgagtatgt caagtcatct tcgacactac
     1981 aaacatactg gaattactgg gtgcttctga gacgggaaaa agtaggactt tcaattccag
     2041 caatcacaaa agataagatg gtaggagtaa gtttaataag tcactatata cattgaccct
     2101 cctacttagt ccagtactga ccaatcagat ccgacagcgg ctagtagaaa aacacaatct
     2161 tcgaacagaa aagaagacag aaaactcgat cttacgctgg gaagatgtct ttgagttact
     2221 gaaggtactt tggtctactg gaggcgaggc atgggaccca gtacagcttt ccttgatact
     2281 tctacttgcc ggtatgagtg gacaccgacc tgatgcactg ctgtccctca agaatgcaaa
     2341 tgtacaagtt gcattactcc caaccggaag ggaacgacca catatggtcc ttgagttcaa
     2401 accccacaag accaagcgtt atcgggggat gaaaaagaag aagtaagtcc ccttcccctt
     2461 ccataatatg gccttccttg accatgctgc ccatagtccg acgttgggaa taccggaagt
     2521 ccgtagtgag ccttgcttgc tgctctgtcc acagtcattt ttgttatcct tgttgatacg
     2581 caagtccgct ttcagccatc ttagaattac atcagcagcg cagttatacg cattgcaggt
     2641 ccctccagaa gcaggatcgc ttgaacttcg ccctgcaaac cctgaatgct ttctcttcga
     2701 tatcactcct aggactttaa atacctggct gaaacgacta ggtgagctga caggctttaa
     2761 cctatcaatt acatcatact gtctccggag aggggccggt gaagctgtca atagtagctg
     2821 tatgtcctga catgtccaag acacgcgggt gaagtgcttt gctgacctcc ttctaggtga
     2881 gatcagtgaa gctcagcaga atctgcttct ccagcatgcg gccaattcgt ctgtatatca
     2941 ggagcggtac gcgccagatt attttcccaa agattttagc gccgtgtggc gaggcagtca
     3001 gcctcaaaat aaagtaatcc ggatggccag tgggcaaagc cgctcgatcg acctacgtcg
     3061 cccggttgat ctcaatgagg cacaagcagc cgaagccgat gcacagccca aggttcaacg
     3121 ttgcaaggcg cgctgggagc aatctcgatt gaaggtccag atggcatatg gagcaatgta
     3181 caaaggcaag ggaaaaccac tgtatcaaaa agcaatgaag aggcggaatg cctaccacac
     3241 cgcacgtcaa gcggctcgtc gtgagatgaa ggcagtcatc cgagctcggt ttaatgagga
     3301 gcaaccaaca gacgatatta tacggcaggt acatgggctt ccaatgaaat ctaggaaggc
     3361 atataagact gagctcgtcc cccttgagca gcagcgcgcg ttttctcttc ttttccggtt
     3421 tgctcctgaa acagagcgtg atgaaactga gtacagggct gcagtcattg atgcggtgtc
     3481 taaggttggg ccgagccgta aacgccggct tcaggaaata catagcgaag gccccacacc
     3541 tgggtgggtg acagcagcac tccaaggtaa accgcaagtc caattggcgc gacgacaatg
     3601 cctcttgtgt atgatctatg gtgttcgcgg agaacctttc actcgagatt caagcttcga
     3661 gcggcatatc cgtaggatcc ataacaagca aatacagtgt cctgatcctg cctgtcagga
     3721 tatgcttatt ggtcacattg acattgctaa tcatatgcga tatatacatg gagcatagta
     3781 tttctatctc ttataactgc ttttattggt tctcaaggtg tacgttgtat ccgaacccct
     3841 gtttttagag atattgtttt ttccgagaaa atgcgtttaa tagtttatct gagttaagtt
     3901 tatagaataa tacttattct atatatgagg attctgactc tttttcttgc ttgatgcaag
     3961 tctagtaaag ccttacctta ctaattagtc ctatacttac tcgctgaaac acacctgaaa
     4021 gtgaaggttt caagattttc aaaagaggta taaagcatct gaaaaaggga gaagaaccat
     4081 ttctcactta cattcgtgcg gcttagttaa ttataggcgt ttctcttaca ctctacttag
     4141 cttaatctaa gtagtagatc acctattaca atagtattta tacttttatt atacctacta
     4201 gctactgtgc tttgaccact ctttcagata atatcgacta aatataacaa atgtccctct
     4261 agtatatgct gctgctttag agctattctc cgatgttctg taagccctgg actgatatac
     4321 ttctaataca aactgtcaag tatttaaaac tttactgctt cctcgcctag ttgtatagca
     4381 aagaagtcag catactcttg gtcaattcgc cttaaagctg cagtgaattc ttgttgagat
     4441 ttctggagct ttatgaaact agtatcaatc ctgtcgatca taacgcggta gtcatcaatt
     4501 gcagtgcgga gtaagcttgc attgcgagac catatagtac caagcacact ttgtctcaac
     4561 aagacagatt gtctcttgtt atttgcggtt aatgtatcaa ggcggtgaag acaagtacgt
     4621 aattcttgaa ctgctgtata cgcgaggagg acagtttcga tttcagcttg gagcaggatc
     4681 gatgctcgcc gaaccttgcg ataataggca ttctcagctc gtaaatagga ggcctcatat
     4741 actgctcgca tgagacgatc cttctcagta tggagttcct gcttcgacca ctgtaaccga
     4801 catgggagca actccacggc ggagctatgg cccccgtgct gtacaatctg gaactcaact
     4861 gatgtcggtc ggtcaggtcg ggaccaatta tcagtgaaac ttgaagccgt ggaaactgct
     4921 tggggacggg ctcgttgtag ctgggttatt gatagaagag gttgatggag cttatcactg
     4981 gccatagttt accgaagaaa agctcatatc taccgtactg gatccaacat gtattagcaa
     5041 taaagaggaa gaggtatata taaggatata tagctaggaa ttgttgtaaa acaataagaa
     5101 aaatagtaca tagacatgac tttatacaag atcaacccgt gtcatcatta agatactatg
     5161 tctcggatca aagagcgaat cacggcctaa atcattatag taaaatagtc cactacccaa
     5221 taacaatgaa ctctaaaacc tatacaagct aactaaattt ctgaagtaag ctatttctga
     5281 gaatagctat atttatatca aaaagaaaac ctataatata tgcggatata tagtcaatcc
     5341 tttcatatat acattggtaa ttcctgggtc atgctttcct atcgtattac ccaatgggag
     5401 gagagcaaag gacatcgacg gcacgttgag gcaagaagat tgattaatcg tccccctaca
     5461 tctaacccga cattcaggac atggcacata tatatggtct gatcccaatc gtttctcgtt
     5521 atacttctcg tagacaagta aactaaaaca cacgcgatgg aacgtatgac cgcagggcac
     5581 tgcaatgaag tcttgcacac ccgtctcgag gcatataaga cattttatcc ctttctgact
     5641 attaccggga tgggaagatg ttgaagctac aacatgactt tgtctgttta cttcctcttc
     5701 atcttcaata aggatagcgg aatctgccca ccgtagttag tatttgaatt ttacacaaaa
     5761 ttgaatcaga gatttcttac cgcggctatt accgactcga ggaatataca aagcacctgg
     5821 agtcgccaat ctatctcttg agatactgga cctggtagcg gaataacatg gattgtcatg
     5881 atgcgaaggt agcactatcg gcgactgaga gactcgagcc cctgggcatt atagaagatg
     5941 gttagctgga attggagatt tgtatataat cacctactcg aaagccgttc cacgtccgat
     6001 gagtaaagtt ctcggatcac catatggtat aacactgtca cgtgttctct cattcagggt
     6061 aaatgtaagt taactagatg ttgttgagta gagattatga tcatgaaggc ttcataagag
     6121 ggaacttatg atactttata aacgcgaata tagagataaa aactagtagc tatttataaa
     6181 gtatacaata ctataattaa cttttatact ctacattctt acacaaccag aactttattt
     6241 aaactattaa tttagaattc tattttatga ctggcttagg ttctttgcaa agaacttctg
     6301 gaaaagaatt ataatctctt tctagccaat ccgtatattg ctgtatagta aatagaacag
     6361 tcggaatata tatatatctt gatcttattt cttccatcac tctttatatt ggctgttcta
     6421 ttgtggggtt aatctgtgga atatatagta tgtagtatac ttctttatcc tgagcttttc
     6481 ttactctgtt aagtgttcat tattcttgcg gtgactaggt aggtgcttat aaactgttat
     6541 ctaatagagg atcactccac atattatgac aagacgacta aggtacatag agtcaggctc
     6601 acgtatttag caatcacact ctggtggtgt tagtcgacgt gaagcaccca gttgccttac
     6661 aggtgttctc atcgccgtat aacctggggg tccgggcggt acatccttgt atattggggg
     6721 cacctcttta tcccagctaa tgccaagtcc gctgcgctca gagatgcgca aacctgaaca
     6781 catacgaagc acaatagcag ggcccgacgt tggggttatc caggtattgc gctccgcagc
     6841 aatcaactca acgataagac tgtgtttgac ctccaatcct ttactatcct cgacatcaca
     6901 caccgattca cgagtgtagt cgatgctcac ttcaaactgc aacctaatct catcactccc
     6961 taaatctaac ttgtacttcg acccgttact ctccttattg cgtccaataa ctcgtgtttt
     7021 tttgtgaata acaccctccg cttgagactt cgacgcatgc ttagagcagg gatgagatac
     7081 tattttcaca tgctctttga tgtgccattt gacattttgt atgtataaat ggtttcggtt
     7141 aggcttcttg ttatccatga ccccgatcag cgccactcgg acaggaaaac tacccatagg
     7201 gtgcactact gacggcacaa taacatgact ggtcagattc gtccgcggaa acgtgtagag
     7261 taaagatatc tcatttcccg ggggaagggc gcgtttgatg tgcaaaggca tattggatga
     7321 atagcttgta ccaacgatgt cttccgcctg ggccgaaagt acatacgcaa tgccgcctaa
     7381 gggagtgttg cagaaagcgg gcagctgacc agggaacaga tagctaaaag gaaattcatg
     7441 atgacctaat gtgagatgca ttggtctcgt tatgaagttc caatttgaca gctcttcaat
     7501 tcgagtcgca cagcgagaac atccctttac gaccggtttc acagttgtca aatgaattgc
     7561 caacgtcagc ttgagtttga taatcttaat tggtatcgtg tgttccccaa tggtaaatcg
     7621 taagctgccc gagaaaagag cgcccattga gtttgtcggg tccccatggt atataagtgg
     7681 tggtgattca atgataatac ttaatttggc cgtttcactc ggtctagcgt tcctgagatg
     7741 ccctttcgaa caggtatgta ttccctcgct ctgacggaac tctttttgat aggctgtgcg
     7801 aagctgaacg acgtgacgga gggcgaggtg tatgtagtat ttcccgagcc acactttttt
     7861 cgtttctaag cctgcagatg gctttcccga catcatagta ttaactgtgt tgatgttcat
     7921 tgaggctatt gacaaaatgt tgattaaaga gcagaatagc acaaggtata agatagtgtt
     7981 attgaaataa taataggata gaattttgtt atttagtaat ccaaagtgag gtgcaaatcg
     8041 aagtcttagt aggttgtaga agagatccgt ctccttatat attaacgcag atttaacgaa
     8101 ccactaaaag taaataaagc caatttgtag agcatgggta agcttagtct ttaataaaat
     8161 tatctttatt atctatggaa tagtctgcag agtggtccca ctagcagagc aatatttaca
     8221 taaaatatta gattactttt ataatattct aaattttaac aagggctgag gacatatact
     8281 tactggtgaa ggatatttca cagctctact ttggttaata actatatata catctcctct
     8341 caaggccaga caagtttaga gtaaattata aggtagttag ttataagcaa tttctaacaa
     8401 tagcttctag agctatcgat cgtttaatta gtgatagtgg taaaatttat aataagactt
     8461 ctagccaaat aaagtaaggg aatctgaaat acggtatatc ttataagatg tgcgcagtag
     8521 cttaaaacta tagagagcgc tcagagtatt aagatacccc taagtacaag gctaccttct
     8581 ggtaaagtaa cgtatataga cccgagtgta tccagtttac tatccggtga gctgtgaaag
     8641 aacttctttc ggttttaaat atagaaggta tggataaact tcgcagttta ccgtacaaac
     8701 cgatgacaaa ggaacgagat aagcacgtca gtctaagcgg accaaaccag tgtcacgaga
     8761 aaggcgagca gaacaagata catgaagttt gagctttccg ttgcctgtca taactctgac
     8821 atactctgcc caggtgcaac atattttcca ttcctggttt ttccatacct ccagggtctc
     8881 tttagtcgtt tggccggcta acagcaggat tcgacttagc tgtagctcct gagaaagccc
     8941 gtgatggcag tatttgcata atgtatatat cgcaacccga cgtttcgcgg cggcgatgta
     9001 agagaaggtt ccctccacag ctgcacctgg accatgaaga acaaaactaa gctcctgagt
     9061 actttcctcg cttgatttgc aggatacaca gctccaggaa acagttccta tcatactagg
     9121 agcgagtaag tagttgtacg tatctcagct ttattgtcaa gaatcaacca gttacctgct
     9181 accagaaatc aggcccagat caggaacacc gagactatac cgtaactcaa tgtgtgtaaa
     9241 agaactaata caggcatggg ttgtagccat aaacttctat caccggggat agcattaaat
     9301 aattgacaag cgacagacca gactgcaaat aagcctgcgc gcctacgtca taaccgaaaa
     9361 ttaatccacg ctgaggtgtt aaataaacat ggacctaagt acacacgtat ggataaatac
     9421 cttcaattgt taaggagttg ttctatgcga ggcaaattta tataatatgt taattacatt
     9481 caacgaaaca actatatggg ggtcaaggtc ctgccttgag cacctcatcc ccaataaata
     9541 tactttgtgt ataacgcgta gtacgctatt ccctatttgg ggtagcgtcc aacacgaagc
     9601 aagtaagtgc cgcactccgt acggcagcaa aacaataatt gctaatagaa ggtattcgct
     9661 aatccaggcc tgaagctgaa gtgacataac tgacaaacaa taaggtgtga ttctttttat
     9721 atagatgtcc ccgtggctaa gtaccggctg caggtcagtc tattagctgt agtagactcg
     9781 cattattcta gggttgacca aaggctcctt agtagaaagg ttctaggacc gacgagaatt
     9841 atctcacggg taatgttagt ctgttgataa aagaccttat gtcatataac cgtagactaa
     9901 gtataatata tagaggtgga aaatgtagat ttgtatggaa tttctgtgat ccggacctaa
     9961 ttccctttat attaaacgct actgtatcgg caattagcta ttaccaaatc gagccgggcc
    10021 taaaacagaa aacggggttt atcaataacg agtatgaact tctatactgt ataaatagta
    10081 gattgttatt atattataga ttatcattca aagcaagatc atctcttaag ctaaggcact
    10141 attccatatc tccaccatca ggaagagcac aataaaaaga aacagtgaat tattggtttg
    10201 tccactgcac aactgctggg aggttcgata atctatccca acattaaaaa tcccatcatt
    10261 ccactggtgt aagcttatct ctgtccctac acatttctcg taagctctta cttgcgccgt
    10321 taggtgagca atgagaagga ggcgttgaat accagaggag ctttccttat gtgtggccca
    10381 ccatagtgca ctgtgtcctg agttatcggt cagatgaaca ttgactgcag gattccggag
    10441 gatgtgctct acaacttctg tatggccccc acgcacagca agtagaagtg cagtttcacc
    10501 tcgccaattc tggaagttga ttcgggatcc cgttctttga agtaagagta ttgcaatctc
    10561 acaataaccc tccttaatag caatcatcag tggtgtttgt attagcttcc accttttcca
    10621 tcgcccactt ccatagcttg gcggccgctg agctggtgag tcattatata gcaggaggtc
    10681 tttcctggta agaagtagtt gtaccattga gatatctcca ttactgacag ctatcctgag
    10741 tggtgaatat ccgaacctat ccagagaatt tggatctagg tcctctcgcc gtaaaagcgc
    10801 acgggcaaca gctatatttc cggcctgcac ggcatgatga agagatgttg tctgatcgag
    10861 gccgattgtg ttgacattga tattatcttt atgtaataac cactgagcca cgcatggata
    10921 cattcggaat gttgcccacc aaagcggtgt ctggccatgc tcatctttag cgttgatatc
    10981 aactctagga ttgctaagaa ggagttgaac cacagatagt cggccttgta tagcagcctc
    11041 atgcagcgcc gtccatccgt cataatcagt tatacacgga tttgtattct gatggtgaag
    11101 caactgtttg acatcctcat agtgtcctat acttgcagcc agggccaagg gtgttcttcc
    11161 ctcctcatcc tgtacattgg tgtccaaccc actggataga agaagctcga gtatgtcact
    11221 tcgaccgact agcaccgctg tgaatagcgg gttaggccca agccttgagc caacatcaga
    11281 ggtcccgggc aacggacgaa cgcctggatg ttccaaaagc aacctgatca tggccatatg
    11341 ctgcagcgaa attgccctct ggagcggtga gctatgactc ccattcatca tatgcgctgt
    11401 agctcctctg ttcagtagtt gttgcgctgt gtctacactg cggaagccaa cggcgtacca
    11461 gagtggtgat aaggaaaagc tatcgtagac attcacctca atatctggat gtctgagaag
    11521 aatgttcatg gaagaataaa aacctctccg tgcagcgtca aggagtggag tacagccttt
    11581 ggagtccctg tgagtgacat tagtcctggt atcggtaaga agaatctcga ctatacgact
    11641 cctgtcgtgc tgcacggcat ggaataatgg tgttcgagta tgtttgtcta ccgtattgat
    11701 atcggcgcga ccatcggaga gaaagcattg aatgacatca ctgtgcccat gcaagacagc
    11761 tactgcaagg ggtgtccacc cactcatgat atcggggcaa ttaaccagca gtccattttc
    11821 tcgaagaagt cgcgagacag tgatagaatg gctattagct gccgcacaat agagggctgt
    11881 ctggcctaaa gggttggtcg cgttgagctg ggtacttggg ttctggagaa gtagctccat
    11941 cacgagttgg gacccgaacc tggctgcgac tattaacgga gtatttcctt caaacacaac
    12001 atctgccgtg gcccctggag tctgaaggag gatctgggcc gtctggagtt tgtcatattg
    12061 tgctgcccag aacagagctg agctgccttg ctctttaata ttgaacgaat agagagcacc
    12121 cataataatc gaggacatgt ttttgttaat caaggagaac gataaaagat ctttggcggt
    12181 gcaaagcttg ttggtaatac ataaaagcat ctctggaggt agctctgcga gattcatctg
    12241 cacaccaaaa tttcttgaac ccatttcctg tggcggattg agtggttata tagtgaaaca
    12301 gtatacagga gaaggtttga aatagcaaga gggcaggata atagcatgct gttataaagt
    12361 aaagatctat aacaagggaa tactttagga aatctggaaa agagtatcca ttcctgcgta
    12421 taatgcttaa ctttgtaggc gctcagtgta ttattataag cgttttgtgt actgcatgca
    12481 gtttgatata gttttaactt acagtgattt tcttatgaca agttgtattt atcaagagaa
    12541 tgtgaatcat tatgccatat agatatgtaa attggtgtac gattcaaatc atattaacat
    12601 cagtgtatag gttcacatat catgctactt tcgtacctgg caatactcat caatcgagca
    12661 gctagcaaga caacgttacg gatatagata ccatttaaaa tttctagcac caatgcatat
    12721 atcacgagat gccttaaata taatagtccc gtatatttga gtattctggt gtttctgata
    12781 tctatgaccg gttctacaaa aggtaattct ctgtttgata tgcagagttt gtatattgta
    12841 tcaaggaagc tatattcctt acactgtttt agattcttct tatcgagtat aatataataa
    12901 gaagtacact gaaatgaatt gagtggtcgc ttttcaaact agacatactg tcgcatatcc
    12961 gtatgatgta attcaagttc ttgcttcagt agccccatcg tgaacatcct gcgacaaaca
    13021 tggctcagta gtgttggaac aaaattggat gtcgactggc agagttggta tctcttcaag
    13081 ttggctagga attcctaaag gatcattggt ctgatcaaat ggaaaaggtc cggtgggaaa
    13141 attaagaagc ccatatgaca tagtttggct gtctgtagcc gaggatactt caactccagg
    13201 ctgtgatgca ccaaagctct ctggagtcaa cagcttggca gacgggaaca ggcgcctcta
    13261 tatcatggtc aaacactgca gtaacatttg ttgagttctg aacgtacaat ctgagtaaac
    13321 gacggcggaa accgcttatc cagggtattt ctgtactcag tgacccttcc atcacggtct
    13381 tgaataaaca tatacacctt ggcgccggag agaagaccgt agtcatgtag gccttgaacg
    13441 gtacgttctt tccgtcgttt caaacgttct cgcgagttct tggtcctccg gcgttcctga
    13501 tccttttctc gcttagtagc catgatagta ggctgttttc ctcaccaaca gctttaaggg
    13561 gtgagtaccc ttttgtatga tctctacacc gcacttttct aggtttactt tcctcgggag
    13621 tagaatcaaa actaaagcgc tgctaaaagt gcggcctaat caatacttct atccaataac
    13681 attggagcag taaagaagga tcaacacaac accctggaac tttacttata ttgtatatat
    13741 aataccggta gtacattggt aattgatata cagtatacta tttaatggcc ctcttactca
    13801 agaacaaggg cgggtgtcca atcttcttag gaagctgtat ttatttttaa aagatataac
    13861 tgggcattag tatgagacct aaagtgacgc gggctgatga ctcactaagg tagaaatata
    13921 accgtatacg taagttggac gttagacctt ccatgtctgt gagggcccta ctgagtctct
    13981 atatctattc acaactctgt ttctacttta gcaacctgga ttatatactg aagtagctat
    14041 tagtcttact gatcccccaa tggagtaaat actcaaccga gctgcattat ttctatatct
    14101 gtacaatggt ctctatagaa gcgcaagtcc tatatcggca ccttcagaac atcttggctg
    14161 gagattctga ctgggaagta gtttcacagg aggttcactg tttagaccag gatagtattt
    14221 aagaaagtat taagatcagc cccgcatagt atctcccgaa taagaaaaat aacgtcacat
    14281 ccatttgcta agtaagaata gtacatgagg gtaattcatt gacacctttg tcaacagagc
    14341 ttaaaccttg taaaaataag cacaggcgtt gagtagctac catcgcacac ccatgcaccc
    14401 tggctaattg ggtgggtctg ttccctatag aaggcatagt actagcgtat cacccgtgat
    14461 agatattctc atattatact gaattatgat tgcagtcgca tataccaagg caatgggcct
    14521 caggctgatg ctacatccaa cgcactaggg gcccgagtaa gaacatacgt actaaagaac
    14581 aaagcctgtc taattatata tagacttgat gtatatgtag tgacggcttt ctcgtatcgg
    14641 aaagatattg ttatttaact gcgagtctgg gcattgagga gtgagcgcaa aactttgaca
    14701 aggtcaaggg tcctatcaca cttgatgtaa ctacaggata ctgttgcctt tcgaataaaa
    14761 tagtgaattt caataattaa ataacccttc tagacgtctt gcctgatttt gaattgaaca
    14821 gcatcgtaca tgtaacatga tgcaccaagg tacattcaac cctaacttag cggtagtgac
    14881 ccatcaccca attctgcatc atcccttcac cataacccaa gattgtagat tgatctgtag
    14941 gtactggagt atttgcgctc gctgtattcc ttccattgct ccccgccaat gggatgactg
    15001 gccacccacc actatccatc ccatcgaaac atgtactgtt cggataggat ggctcgatca
    15061 tagaagatgc taaggcaagc tcctcggctg gtgtttgatc tccctgggat ggctgatttc
    15121 cctcagccat gatcgtgtgg tcgaacccag tatctatgcc aaaggtagcg gaagtatcca
    15181 aggctaatga gatgggaaag tgtggagatg gctcctctcc gtactcgttg gcagctgata
    15241 tcgacggagg gcagcaatag gattgactcg gcatatgccc ctccgaaatg ctggttggtt
    15301 ggccacacca ttcacagcct ctgatgctta atagatcgtg agaaaaggga cactgaatgt
    15361 acgtccgcgg gtcttgttct tccgaatctc tccaccgtgt ggtgtaggcg gcaagtccta
    15421 ctgtttcgtt catcgagctg tatagagacg tcgaaacatt cccggtggtc atttcggggg
    15481 ctgttaaaga aataaactga tggtcgcttt gcatagtgga taaaacgctg gacgaattcg
    15541 aggttaaatc attgatagta tgattctcag gggggtgcca gtcgctggta tgagtgctta
    15601 ggccgtcggt gtagataccc ataccaatag ttgatgattc aacatagcgc atctccgtat
    15661 tgagcatatt attaaagctt gtggtagtgg aagttggaaa ttttatgcct gtagtacttt
    15721 caacattggg ttgactacca caaatataat cgttgtagcg gtccccaaag gctacactcg
    15781 gcgtatcttg gcatgcacct gctttcctcc agatcaagcc attaccatcc cacagggaag
    15841 ttccacattc agaatccatc aacgactgac aacactgtta gaacaaatca caaagtgtgt
    15901 gcgcgctttc cgtcgtgaga ttcaaagtaa atataataaa gttccactta cagtgttcct
    15961 tggggaaggc ataacccacg gggctccata ctctcgcgat ggactggctt tgaactattc
    16021 cagagctgtt aggtttttga atccaactct ctcgagcagg gagggggatt ctcactttag
    16081 gtaggacata atctaacgcc tgcctggtac ttgggtcgag agttttctct attaattcag
    16141 tggcgggttc gttcgaatcc actgatccat tgtgtcctac atcaacaagg ttgttggcca
    16201 tctgatgatg gcgctctcgg agttctctgc tagctaggtt ctgggctttg tgctttctgc
    16261 gtgtcaccat ggcggggtca cggtctttat tgataggtat ccaatgttct accgtactta
    16321 aaagactttt gagatagcct ttagaaaacg tatgttctgg actgggagag atttggtcta
    16381 tccagttcat tatcttttat tgactatgtt ccactagccc tatttatata tacagcacat
    16441 ggtggccaag acaaaacctt aggatactat tcagacaggg gaacgaaaaa aaaagaagaa
    16501 aattggaatg ctgtctactc tatgtttggg ctctgactgg aatccaataa cggaatggaa
    16561 tgcggatact atttctactg gcactagaga gcagctagat cgggcttaaa taacgatatt
    16621 taagggctta atgaagccct cattctatca aacaagaaat acttttccct gtcagaccta
    16681 tatacgtggt ttcagccttg ttcctcgtta tccttataca cttcaatttt cagaaactcc
    16741 tgcaagatgt cgcttctggt ccttcccaca gaactcttac tgtctattct ggacagcctg
    16801 gataaagcaa gtgatattct ttctttgtgc cgcacacatc ccagtctata cacacaactt
    16861 ctgcgcgctc tctatatatt taatgtcaaa tggcaagaca gctccgcact acactgggca
    16921 gcatctcacg gaaatctgag actcgcccgc atactgggct cctatggtgc caatatcaat
    16981 tccctcatca agggagttcc accgctccat catgctgtaa gctgccagca gactaaccta
    17041 atcaaatggt tcctttcttg ggatcatatt aatatcaacg tccaagaccc cttttataag
    17101 actgctctgc atcacgccgt tctcagaaat aacgaagagg cagtagcttt gttacttcag
    17161 aaagaaaata tcaacgtgaa taaacaggat atacacggaa tgaccccact acatcgagct
    17221 attctcctcg gcaatctatc gattattcag caacttctaa attatagctc aattgaccta
    17281 gagcttcgcg gtatggatgg tcattggggg atctggaatg aatcaccacc gctgtgtgtt
    17341 gccgtcatgc gcggtagact tgatattgtc cgtcttctac ttttgtttcc gatcaacgtc
    17401 aacaactgca acaaagatgg caagtctgca ttacacctcg cagtggataa taacgaccac
    17461 aatctcgtta agctgctcct cgaccagccg ggtatcgatg tgaacatcca agataatgtt
    17521 gagaatagta ctcctctaca taacgctgtc gaacttgcac gtgagtcgat cgttaagctg
    17581 ctgctcggcc agcagggtat taacccgaat gtccgagata gctatggaga tactgctcta
    17641 catatagctg ccaaatttgg agatccgtcg atcgctaagc ttcttctcaa caagcccggt
    17701 ttggagataa atatgaggga ccatcacgga cagactccct tgtggtgggc cacgaagaac
    17761 aatcacctct cccttgttaa gcagctattg gccgagagcc atgtggatgt taatactgtg
    17821 ggtcaggacg cctcaacttc tctccaccat gcagttgaga accgaagctc gtatctagta
    17881 atgctactgc tctgcacgaa cgggattgat gtgaatattt ccgacgagag tgagaagaca
    17941 ccactagagt gggcggtgca tcaaggtgat attcagatgg tcgaaattct tctcttatcc
    18001 cccacgatca agattgaatc ggcactaggt acggcggcta aacttggcca catctggatc
    18061 gttaaactac tcctttggcg ccaacccaac gcagacttaa acttccgtga tggatcaggg
    18121 atgaccgcac tagcccaagc cgcctttgcc gggcatgata atattgtcaa gtacctcctc
    18181 cagagacgtc atatcgatgt gaatctccac gactttaaca gatgcacgcc tctgtggtgg
    18241 gcggctaaaa gaggacactt ggatattgtg gtacaattgg tcaacgacag tcggacagtg
    18301 tttaacagta gactacatcg atgtccacga gacgaagcaa agtattgggg acactcagat
    18361 attgctaatc ttttgactta tgttatagat aagaagaatc cacttactct cttgaactag
    18421 agtaagcgtc ttatctagca tagttctcct ctccagttat aatacaatat agtgcaaata
    18481 ttcctcacca taaccggccg tcttgcccag attcctaata aacacactgc acagggagaa
    18541 gttatatccc tgtggagagt ttttcccacc gtctcgtagg tcaaaagtgt tttactagac
    18601 agaccttaga aatcatggga ctctggttaa tgaatttctg ttgttgctca tataggattt
    18661 agcttatctt caaaaactgg aaactcatac acgagcgcag cttcagaatc gtactgattt
    18721 tccacggtac gatacgccct attgtatcaa tccttaggcc gctagaggaa ggagtaaact
    18781 aatacccacc ttcgaaattc tcttacaagt atctttgaaa gcgcgaccga taaaagataa
    18841 tctgggttgt tctgaagtac tatggataaa ggtgatctgg tctagaatta aaggcgatct
    18901 aaaatggtaa acttttaacg gatgaaatat atcgacaaag ggactgccaa aaggtgtact
    18961 caacgtgcct tataatgaca atgatcgtaa aaaggtagtg gtacaagtat tttaaatata
    19021 ccttactatc acttcatggg tctcagtatc tctgtatatc tgacccatca agctgaagct
    19081 tagctcatat taaaaactat tcctttggag gtcgatttta ccatacagca attatgtatt
    19141 tccctactat tcttatgctt attgcacgat tcagcattct agctgtggtg tccagtgcct
    19201 ttccgcttga ggatttagac gctagtcatt taaaatatct ttttgggcgt ggacagcaag
    19261 accgcctttg cgcaagttag tatttccaat agaaagtcct ctagttaaaa atataccagc
    19321 taactatcaa tagacaaaac cctctatagt gctatagctc aagttaaggc atttcaactt
    19381 gctcaaagct gtgatctaac ggggacaaca atgagcggca acaacggtaa gcctactccc
    19441 tccaacagaa gccgaaaaac tgattcttat gccgttaggc agaaatggta tatccgacag
    19501 aatttaaaaa cagtgaaggc ctccatatcc ctgactgtgc tgatatcgat gaatcattcc
    19561 aggagtttcc cattctccca ggtggtcgta tgtttggagg tgatggaagt aatgaccctg
    19621 gcgctgatcg tattatctac aagataacga atagggatcc agcgagtaag ctgcctagtg
    19681 attttatact ctgtggagtg ataacacaga tagaaggccc caaagatggc tttgttatgt
    19741 gtcctcactc tgagcacgcc caaaattgcg tacactgata cttcttctgg ggtaccaaca
    19801 cccaagcgta tgttgcaact actctatgtt tcaaatataa cagatttcgc ttataaaatt
    19861 gggtggtctt aaatagttta agaatatact agtcttttca gagctgttaa ttgcggcccg
    19921 gtaatgattc atgcactcta atatatttta gtggcttact atcactgggc cattgtctac
    19981 tactattatt gtaaagtaca ttgtatcttt catagtagcc tacgattgaa cttcgtcgtt
    20041 tgttcatctt ttaaaaggat attgtaagcg ttctttcggt gtactactaa tcggtggtat
    20101 tcctgcggag aacgctccag agtttgatta aggcaacggc cgtctttatt tacgtcttaa
    20161 tactctgtac taagtcttgc aaggtatata gtggcataat tatgccattc ggcttcctaa
    20221 aaatgtctgg acactaagag gtgtctttta gtgtaattta taggtctaat tttggctgac
    20281 agtatattat gcctaaagct ataatcctcg gtatcacgtg gtccactaaa tcatttagag
    20341 tctagcgtat cacgcgttat acagtatcgc cctgccacta agaactttgg cacggctcga
    20401 cctagtgctg tgtgtctgga cagttctatt ctcacaaagc gttggatgat ggtcctccct
    20461 aggcagcgcg ctgctatcaa caaagtgttg attccggcct ccagcgatgc tattactatt
    20521 tgttatccat aggtctctaa aaactcaaaa tataaagaat aaactataaa tcccagatat
    20581 ccaagatact gccctgttgt gcggttatcc acgaccgtaa aagttacaag tcacactaca
    20641 gattttcttg tagtagaatt attattctat aattttagac ctgtattatt attttaatag
    20701 acttacaagg taattatata atacgaagag cagacagatc tgaataatta tataaatccc
    20761 gtcttatata catcgtatct aaggattgta cccagagagc acacttaggt ataatatcta
    20821 attactatat ataagtaact agttcaaata gtaaattgta atggcgggaa gctatatagg
    20881 tctgaccagg gcattctgaa tcgttgattc agaattattt gaccttttgg ccttgtggaa
    20941 tacgtgagct ctggcagtat ctcttacata aatataaagt ttttttatta cgcattgtgc
    21001 atagatgcga tatccaggta tagtatcaga ttataaagct ctatatacat tgtatctaag
    21061 tgttgtacct agagagcaca tttaggtatg gtatctaatt actatatgca agcaaccagt
    21121 ttaaatagta gatataaaat ttcttactag gtattgtgca tagatgcgat atctaggtat
    21181 ggtatcaggt tataaagctc tatatacatt gtatctaagt gttgtaccca gagagcatat
    21241 ttaggtatgg tatctaatta ctatatgcaa gcaaccagtt taaatagtag atataaaatt
    21301 tcttactagg cattgtgcat agatgcgata tccaggtatg gtatcaggtt ataaagctct
    21361 atgaatagag atacaagacc ggacatacaa gacagcagat acaagacagc agatacaaga
    21421 cagcagatac aagacagcag agacaagaca gcagagacaa gacagcagag acaagacagc
    21481 agagacaaga caggagagac aggacagaag atacaagatc tttctgggca tgtaatagtc
    21541 tagatagggg aggctccccc ctagtcaata ccgggcaccg gcagcccctt agggatagct
    21601 ggggattgac acagtcgtcg tgtcccgggc ggaaacagga gtaggacatt ctgcccgtcc
    21661 gccattgctg ccgataagct ggatgatata ctcactgatc tcatctttat atcacagagt
    21721 gtgataccct gctgtttgta cctctgcacg gtctgcctaa attccgaggt actgctggga
    21781 tccgccgggt taacctggac gatcgtagtg acgttccact gagagtgctc atcgtataca
    21841 tagaacacga tgttgatctt gcctgtatat gagtttctca atatattttt tctatgagtc
    21901 tgggctcttt gattgttgtt tagttgatgt gtattattga tagcccctgc tgctatatta
    21961 tcattcgaga gctcctccat gggctcacag tataagtcgc cgcccttttg tgtacatggc
    22021 tctctaatgg cattgattgc ccctttggta tacctgttcg gtaaatttcc caattctgta
    22081 gcatacatta ccatcgtgct gctcgcctgt tgatgagtca tattgtcagt tgtcatttgg
    22141 tgatgaaagc cctgtacggc atgtgatgtg ctctcttgga attcggcttc ttcccgagta
    22201 cattctgtat ctactcgtga tggtcttcgt tcagctaccg gccctgcagt agtatggttt
    22261 tgcgatctgt tgtgatcgac atccattgaa ggtgagatat aattccaggt ctctatgggt
    22321 tgcccaaagc cagggctatt attggacatg tgctgcaaag aatcctggtc agggtggatc
    22381 tgactaggcc ggctctctgg cacaaataaa ggtggcgtag gacaataaac ggaattagca
    22441 gcttgactaa ccgcagggtg gggaccgaag aacgcgaaat agacacaatg ccgaacgaag
    22501 gctgttgtaa ctaggtctgg aaccgcggca gtatgtatat ggtccaggaa gagaagtgca
    22561 cgatcttgta cgagggcctt cagcgtaggg tgtccactac gagatttgcg cggtaccgag
    22621 cggctgaccc gagttggggg tacagtaaca acgcctttcg ggcggatcat gtcgaaacaa
    22681 gtgataatat gaccgatgat cgaatcgacg gtcgcgtcgt caacttcaaa gctttccgga
    22741 tcacgggcct gaagcagagc atttctcgcg atcagccggt caggcgcctg tcctattagc
    22801 tcctggatct cgcttgaatc gaaacccaac tgatgggcta ggtgacccat gccagataca
    22861 acacgctcgt tcgcggtggc actccgtggt cgggctagcc gctctttgcg tttcggatca
    22921 cggggcatct gcggataatg gcgcatagcg tacagccaca gctgccggta agcaacctcg
    22981 aactgctcat cggcggatat agcgcgctcg gagaaggtgt attccgatgt ttggatcatg
    23041 catatgttgt tgctagatga tgcgtgtaga cctttcatcg tgagccgtac ggtggatcgg
    23101 gtgcaggggg agagccgtgt caaacagtgg gcccagcttt caaagcactt gaagtcatca
    23161 aagaaggtgt gcagagatgg aacaatgccg gtgaataatt gcagcctcgt taagatggct
    23221 tcccgctcat gcgcgcccaa atctgagaag atctggccgc tcaggaccag cccttgcacg
    23281 gattccgctt ccgcacacgg ggccatcagc tggagcgttt cgactgtccg ctggtcgatc
    23341 ttcgcaattg agaggggatc gttgtcgaca agagaaaacc agaattcctt cacgtagttc
    23401 aaatagtggg cgatttccta cctcaggctg tgtcagacgg gggacatgcg aggaatttgc
    23461 gtaaaccaca cctcatcaca tttaaccgct agcacccggt gcagcatact gatactcata
    23521 gcggtccgat ttcctgggat ttgaagaaca gagtcaaaag cctgttggag gcgagcattc
    23581 ttagcgagcg catctaaacg gctttgacag cttggactca gccgtgccct ccaccgtagc
    23641 tccccaattc ggtttccgtc tgccacatac tgacggatct tatggtaaat ctccccatca
    23701 tttgggcgct gctcgttgga gtgttcctca attagagtag tcctcagatc atctccgata
    23761 tctatgcatc atgtcgctgt cagtttgttt ctcacgtact agagtgtgag tgataccatc
    23821 caggtacaag tcaactgccc accaacgatg gccccgcgtt aaaaccttcg agccagctac
    23881 aacccggtgc cgtccatgca gcccttgtag ctgcccgggg aggaatttta ggtggggcaa
    23941 ttcggattct gcgcttgtac gcagcgactg tgcggtgaca cctggcagtg cgttctcaag
    24001 agccgcggtg agatgatttc gtgagacgat tgccggtatg cgatgggata ttgtcaagtt
    24061 ctggcattgc tccttataaa agatgtcaca caggcgatcg atattccttt ggtcgagctg
    24121 tcgatgtgaa tgtaggtcaa agctaatctc atctaggttt actttggcgg tgcctaggaa
    24181 tttaagatgt ctttcggccg ttatctgaat ttctctctgt tcagccgtga gagactccat
    24241 gtcgcctatg ctggctacag gaagggtgac aaaggaaata ggaaatagga aatgaagagc
    24301 gccgacgaga gagggaggat aggtcttcat tatggcttag ggattggaga gttactcata
    24361 catatatggt catagttatt gtgcgttcac ctaaaattgg tgtgctggtc ccattcacac
    24421 atgcgcccat tttattgcaa ggtcctttaa ggtcacataa cttgacttga ctttcgaggg
    24481 gagagatcct cctttcttat tccaatagac agccgggtcg tattagctcc cattgcctat
    24541 tgacctcaac gataagatct gttcaatgca aaggttacac catgtcgggc ccaatggggc
    24601 accaatcgta caagcagagg atgtgctcta tctcgcccaa cctcacccac cacagaagaa
    24661 accagtcctc tcagggccag atatttacaa aaagcgaata tgcggccaga agcgggatct
    24721 ggttcttcct gagacagtta agctggggaa agcaacccac ctagctttca ttgtgcgaaa
    24781 ggagtcaccg tgggagacct acaggaaggt ctatgactgc cacctagatg gccctcttgt
    24841 agtagcgata ccacgggttc accccagtcg gcttgtggca attaggtcga tcaggaggaa
    24901 agacatcaac gagatacccc gcttctttga acgcctgcaa catccctgta tccatagttg
    24961 tcaacaatgc tttttacacc aggacctagc cttcctcctc tacgagtata tccccgtctc
    25021 gttggaccat atcgttgctt gcgaggccta cctaaatgaa acggagcttg ctgcggtttt
    25081 agcacaggta agtcaatacc aatccccatt tcacgtgtag attcgacagg aacctaaata
    25141 acaagtggaa ggtcctcgaa ggcctgctat atatctcaag ccagcgactt gagcatccac
    25201 aattaacaac tatcaatatt ttggcaacgg agaggggaga ggtcaaaatc ggtcagccca
    25261 atcaagttca tttcggaggt caaacctaag actgtttcac aggcgccctc gacgtatgtg
    25321 taccgttgac cgcacatcaa gccccgcatt attctcatgc cttgaaggca atcacagtgg
    25381 aactgatgca gaaatacaac gacagacata ccgagatcaa gatagatagt acgcaacggc
    25441 ggtccgacaa ctagtttaca accagcttcc tctcctcaat tgcatcaaat gcgtcgatag
    25501 agagactgcg agaggtacgt actttatacc atgtaattgt gaaaggttta tatattgata
    25561 tagagcagca cccactcctg acagaaactc ggtggtgcaa gggccatctg atgggtttgg
    25621 tatcttttgc cttgcggtct tcattcgtgt cttgttctta ttcaacgtag actggaacct
    25681 tgtacggcag tggatcttct ggataggcac tgctattggg tccgcctatc tgatgcaaaa
    25741 caataaattc tgcctcggta caatcgattc aatgacctgc agattgaaag gtccctctta
    25801 acccgttaac tgaatcttga gctctgtttg gtgtgacttc ctgtaccgaa tacctacgct
    25861 tctcttttct cttttctttt cttttttttt acagtcaaaa atgacaaaat caccagtaat
    25921 atcagtttaa ccggctgtta tgtgacatta tttatattgt tactatcaag ttccctgcct
    25981 gccgtataga tgcatttcca ctaaatgata ttgtaaaaag aactcaacca ctgtagtcgt
    26041 aggttttgtc taagtagcgc tatccagaca atcctaccct actagggcga gctctggtac
    26101 accatccgtc tcgggctgac ataccgtacc atatacagtg agacggctga gaagcctcca
    26161 tcgaacaggc tcaacacagg agatgtccct accatattcc tcaaagtgct aacattttgt
    26221 ttctactgat ttcttaattt taatgcgact gagagccatg ctagccagga actaagagac
    26281 aactctttac accgcctttt cccataggta cccgtgacat cttcggatag ctcgatgcga
    26341 gaaggtcaac gttcatgaga gtacccaact gtgagcgtaa ggtataagta aatcatcccg
    26401 gacctttctc tttttttttt tttttttttt tttttttttt tttttttttt tttttttttt
    26461 tttttttttg tttcctccag agcgaaattc gcctttcaag cccacttcca aatctagata
    26521 aggcaagata gtaaacctag gcaaggtttt ctatttgtcc tcctcaacgc aaataatggg
    26581 taaaagcgct aaaaggaaac gcgagcgtga gaaggccctt cttgaacaag ggcggttgtc
    26641 cgagttaaac gttgacagcg atggagacga attgatggat cgagagagtg ctgtacagca
    26701 cggtgatagc acggagtcgg aaagcagatt ttacacacta gaacatcgag cggaagcaac
    26761 aaggatccag cagctcgaag ataaagacta ttacggtata ctgggactcg agaatgattg
    26821 taccgcgaag gacattcgta aagcctattt gaaactaggc cgcctgacac atccagacca
    26881 aaacaaatat ggtgatgcac aggttgcgtt caaaagtaag gccacaagta caccggctat
    26941 ctctccatct cttatctacc aacgttgagc taaccgtcat ctatccagaa ttggcggagg
    27001 cctatgacgt actccaccac ccgaaatcac gagctgaata tgatttaatc gggcttcaat
    27061 ataaaagaaa ccgcgctcga aacgcggaga aggtgttcgg cgaggcattc gcgaacagtg
    27121 cggccgggga cgagtcagaa gatgcgtctg atgattcagg cttagaggac aaacacaaac
    27181 tgcccgaacc tgacgtggaa gtggtgcggg tctatagtga agccacggag ttagttaatc
    27241 agtatctagc gccgcacgac accttgccgc ctaagtcggt ggagaaagca atcctcgagc
    27301 tcaataagaa gattaagaaa attaaccaag aatcaggccg tcccgaagac gaaggactga
    27361 ttaaagtcca tctattgttc ggattcgctt gtagttaccg agaagccggc aagaaggggg
    27421 gaaataatcc cgaggattta atcagaatcc aaaagcagtt cgaccacgtg aagaaggtat
    27481 tttactatcc gtcgtcgtgg caattaccaa atatcccagg cgtcacagcc aaccctccag
    27541 aaacagggaa gggaaacttg gcggatcagg aggccgctaa acgaatcatt ggttatatac
    27601 cgagcagcgg attttgcgga ccctcgttta tcgtggaaaa cccaagtctt cctaccggta
    27661 tgctcattga gcaatatggc gacatcaatg gcgacatggc tagagcatac ctcgctctgc
    27721 cagaggcgga gaaaaaagat gtgcgtggtt cacaggagcg gtatagcaag gccgatcgca
    27781 ccaaatacga tcggatttta ggctggtgta atgtattatc ttcgaaatgg aacccagata
    27841 ctcgcgggtg ccttccgaag tcctatggtc tcattcgctt taaggacggc agaaccgata
    27901 ttcttagccg gaccgccctc agaaaagttc tcggtgccag aactgcggat gctgaggtca
    27961 atcgattcta ccgggagcta ggtataactc ccccatgggc cgctatgcca agattccaag
    28021 cgctccctgg accacagagg gccctcatag agggcgcgta ttattccaat atattgcgga
    28081 gccagggccc ggataaggca aatcggagtg gtattacacg gcgagagttc tatggtaaaa
    28141 catctgagga cacgatcagg acactggtcg aacagaatca acagcaacaa cggcagatag
    28201 aggaactgac caagtctatc acagagatac tgaaacggat gaaggtgtga tacagctgtg
    28261 ggtttgttgt tcttgtatta ctagctaagc taagcacgat attacatacc aatgtgcgcc
    28321 gtaagtcatg tgaccatttg ggcgggtcaa tcaggtgatt catttatgga atcataaatt
    28381 ccttgacgtg ggtgagagaa aagtattatt tatgatgggt tatcttggtt atattctgta
    28441 ctgaatttct ttccgttttc ggtatgattc tggtttcgca attgccctta gctcgattca
    28501 tagcttgtca ggcgcttgtt tcaggcagta gtggtcccgt cgagttgaag actgtctttt
    28561 agccgaacaa acagagccca ggtgatttgc aaattgaaag tggttggcag atagatagac
    28621 aaaacaaggc gaaaatatat ttgggaaatg atatagcgct ggtcttcctg aaatagtgaa
    28681 tccatatgag ctataccagc tatggctaca ggcagaacac aaagccccgt tatttgaata
    28741 ttaggcccaa ccaataaggg aagtgaagca gtaaggaacg gaaacaaaag taacagcatc
    28801 gtgggcgact gacataggca ctccgttatg gtgagaattg caggaaaggc aacgtaaact
    28861 actcaagagc ggggagagga aaagctttgg ctcacttgtc cagctacaat gaccgaagtc
    28921 cgcacaggca ttctatgctg gaaaccagct caaacatcct gtgaagctcc tgagtcggaa
    28981 attcataagg gccggacaac atggccggcg cagctgtcag cgacacagga tatgtattga
    29041 aacttgccaa cgcagtatcc gctgctacac cgaactctcg gagcatagag acacatgcct
    29101 tccacgttga cgaacttccg acctcccctt ccatgctcaa gatgtgaaac atcatgagca
    29161 tggagctgtg agcgcagtat aatcgtgggg tatggaaata cgcattctct gttcgcaatg
    29221 tgtgccacag cgaacggtga gagaggtaca gccataccac acatgaattt gataccagtg
    29281 aaagaagcaa agggaaggca gctggattgc atgggctgtg caggcatacc cggtgaaccc
    29341 tagccagcaa tgtaaccaca tcgcgtaggt gcagcacagt acttgaccac aaggaaccca
    29401 catattcaag cgccgcttca tgggcaatcc cactgcacct caactcacca taccgctgaa
    29461 taactgggga tcccgagtgg gagtgtatgt cactggcagt gatacatata cagaggaatc
    29521 catatgcctg gcggagagag gtgctgggct cgcatgctaa acctgtccag gtggaggacg
    29581 tgggtagaaa ggccctaata tgcgcagcaa gtgccttcac aactgtgata gttcttcccg
    29641 tggggagccc gtcaccaggc cctcgaatta tagcatgcaa aacctgttcc tccgtgtata
    29701 cctgcccctg ctgagtatcc gaagcttctc tggactgagt gacacgttgc aggcaaagct
    29761 tgataccgat ccctgttaga aatgtcgcta cctctgggct cccaataagc gaacgtgaaa
    29821 gtcgttgaat tgcttctagg agagctccat ctgtgttgat attcaccctt tctccgtata
    29881 acataccctt cactagccct atcgaaggcc tggacagata acgttgtaaa tggatttcta
    29941 tagggcatct ctgtaatatt agcaacagta aaaaggtgga tatagatgct actaacctct
    30001 cgcccgagct tagagtattc ccatgagcgc tggagctcga ggtacaactg ctttcttgtg
    30061 gtacccggga cattatctct tttgtttccg gtctgatggg tttcttctcc agagtccgtc
    30121 acaatgagtc ttgctgtttg cacgttgtaa aactgattgt agcaggtata atagcatgca
    30181 agcatataaa ctaggcttaa cgctgtctta tataaaatcc tgttgcttct gtttctgtct
    30241 ttttctttct cattcttaaa cagcattccc tgtcctggta tgcgcactac agtactctgg
    30301 aatcatggaa cggaattgca ctcttttcac gcttctgtgc atgcttgatc gtgacgcagt
    30361 gagatcttta cacctaatga actatttcag cgaccggcgc aggtcagtct atttcgactc
    30421 atagtcatta aaataggttt ggttggacag ccggcatcac tatcctagtg gcttacataa
    30481 aaggcaagtt gtgcagtgaa agcctaaatt tataagtcga gtgatattgc cacttacttt
    30541 agaagccaga tcagcattct atattgtaaa aagcggagct attcctttag tttattaaaa
    30601 ccttactctg gtacaaataa atgtaaccat tgccagaaac ttaaaataga gtttgctggc
    30661 gcgggttagt tccagttcgg gtcatctcca gggcaccctt ttcgataatt acccgttgag
    30721 acattgcccc atacctctcc acatcagcat actgtcggat gtgctaaata agacatgaca
    30781 tacccctcac agtgacaagg gagcttgata cctacgttag cattttccca ttttccccca
    30841 gatatataca atattgcttc taataaaact tgcggcttta caatgtcttc tggtatctcg
    30901 gagagtcatg ggagacgtca taccagacat ttggagggct tgcatccttg gccaattgat
    30961 tcggtacgta cttaacgagg gacaccgtgc atatgctgat tgcatcaagg gagagcttct
    31021 gcgacaaggt acaacagaaa cggcacgctt aactgctgtg aaatatctaa cggcgtgcag
    31081 aacaacaatt cgacttgcac tatcaattat ttcagggaaa gttgcctcat gcgtcgatcc
    31141 agagtcctcg aactgtactg gatataagaa ctggagttgg tcattgggcg atggaatttg
    31201 gttagtcatt attataattg ctctgcgcaa gctctgaccc ccctggtctt acctttccca
    31261 tgccagttgc ccggctgatg attcctccca ccagccaaaa gaaacccaca ttcgaaggtt
    31321 ggcccataag cacacatcac aaggtgacca ggttgactga ccttctatcc aggtgatacg
    31381 ccttgatttc atcgcgcggt cggccgaatc gtaagtcgtt gtcccactca ttgatggagg
    31441 aagctgagcg ttgtaggccg ctggcaaacg tccaatccat tgtcgatagc ttcctcagac
    31501 cactctggca ccaggcctat aatcaagttg atcttattca tataggggag cttcacggag
    31561 atgtccagct cttgagacag atcttgatgg gagcgtatga gtaggcacct ctccggctat
    31621 ctacgtattt cgctatctga ctaatgtact ggagctgctg tgcacccaat ggaacaattg
    31681 agatctgtgg cactagtgtt cggtttgacg atccaaacgg ggatacagct ctccatcggt
    31741 tatatcgtga tatgagtagc gcgtatgaaa agtcgggtcg ctgcttggac cttccgtcaa
    31801 agtatgcatc agaggtaaag cgccgcgggt ttgttcacgt ggcagaaaga gcctacgtcc
    31861 ttcctttgac caccaggggt aatattgatc tgttgaacga tatcattgca aactgggccg
    31921 acggattcga agcatacagc ttagagcttt taataacgga gcttggaaag cggtacctgg
    31981 aaattttctc tggttatgcg tctgcccgcc aatcgctacg aaaaggagtg gatggatatc
    32041 tagaaatgta agtccccctt ccaaatggat taaaataaaa gtcgctcaat gtcaaaacaa
    32101 gttggatcgt tcagggcaag aaagggccgc atgatggcca aaataacagc cggatggtag
    32161 cggagtcctt ggcttcttga aaatcacgtt ttgttctatt ctcctgtcta ggaatgatgc
    32221 tgttgcagca gttagcacac agcattgatt ctacctgtct attgattatg ctctgacaat
    32281 cacttgggaa aagccaaaac gtagaatatt cgatggtcaa taattcacag agctagcgat
    32341 tccgaacaag atctagcata gttgctacgc agaaactagg tataacggca tctaaatact
    32401 agtagagaac agtccaccgt atgatatgaa ttctattgaa gagccttaca gatgataaga
    32461 tggatacagt tttcggatat attgagactt catcttgaat ccccatcaat aggctggctt
    32521 cttaaaaacc cacgttgcaa tattgcacat agcagcaggg gacattttta tagcctgtca
    32581 gtctaaaatg cttcctgcct ccaagagcta acataccgac aaccgtatta cagtcactgc
    32641 agatgaaaac agaagatgag tcaggcgggg ctgctcggta aaacagtctt gggcaatact
    32701 atcctggagc gagttagcgc attgtgggcc cggtgagaaa aatccggagt actgcccata
    32761 aacaggtgtg tactatggta atttggattc cactacccac tttttctata gtcttgccta
    32821 gattctgtag ctatagcgga acgcaccgga agagcaggat atcttcaacg gaggctggag
    32881 acaggggtat aatgttatta cttttcaact tgtaacatac aagtatttct gggtactgta
    32941 tattgtattt gttttctctc tctctttata tatatatata tatatattta ttttttattt
    33001 ttttattttt atttttggac ataagctacg atagatcgta cgtagtacga tcatcgtact
    33061 tttccagcga gaacgggttt taggttttgc tcatgcttgt ggaaaagatc gtctatctac
    33121 tgagagactc cttcctaatc gcctctagtc agttttgatg ctatatacca tgacatataa
    33181 gccaatcacg gttaagcata atgcatgatg aaaatattca aagaaagccc aagataatag
    33241 aaaacaggaa taaaagttac cgtgtattga tattattgag tagatcgttg gttgagacta
    33301 tagattttgg tagataataa tttaaatata ctacaggaga tagactcata tttgtaataa
    33361 gtcggtataa agtactgtac gtaattgccg atggtgtaaa ccgtaaagag atatttcttt
    33421 gacgggatcg acatttataa atccctgctt tattgtgata gaaggttgcc aagaatatat
    33481 gaagtatacc gcatatggtt tagcttataa tatgttcgcc tattctttcc cgcttactcc
    33541 atacggccgg cgatgagagg atagcgggaa agtgatccac aggttagagc cgtaattgag
    33601 atatattctg ggggtcaatc agtttctaag aagatcacca ctggtaactt tctaaattat
    33661 aagtgttgta acacgtttat aaaataatcc aataaggggc gctacaggca aagtgctcta
    33721 ctctcttatt agtccagttg gataaaactt acccaaccag acagatcaat taatcgaaat
    33781 tctttgtact taaatgtatt ttggtacagt cggaggcctt attacagtct tcttctttat
    33841 tataatggaa tgttataacg atattctaac tcaagagtaa aaatctgtta ctctctaagc
    33901 gtcttctaat atcaagagat gtactagctc caattagacc agtgattaat ctaatgcccc
    33961 tcatctcggg tgctatgtct cattgttcag cactggaaat ggaacgctat tagccaagca
    34021 ctggagatgg agactggttt tagcgtttaa gatacattag tgttggggat gtattaccac
    34081 tactagttgt atgaagtcag gaggcgaagt ggaataaaac ttttattacg aatgaaggag
    34141 gagagaaaag tactttactt cgtatttctt aatgaacgca tcaagcgggc tcataaacag
    34201 agaatatata ttataccgtt tatggtatag cgtggacacc acgtaagaag cgagtgacga
    34261 ggtttggttc gcgatggtac caagttaacc attctacaat acattctact ataaatgaca
    34321 cagagcgtat aatcagctgg tattaagagt attacagaat acctggatct tacgtaacaa
    34381 ataaagcata acaaacgaac atggggagga tataacagtt atgatttgtc ttggatatag
    34441 agcaacccac taaagctgtc actgccaaat cgtctggtgt ttacgccaat tgaacttgac
    34501 cataaacaac tcgcctagat agagattgtt aatacataca tcaatagaca ttataatgac
    34561 gatctcacca attcagatat ccgtttgtgc caccagtcaa tattgcctcg cgtgctgagg
    34621 agcagagttc acgaacatat tctgcgctgt accctagcat caaagtcatc ggctccatac
    34681 tcaggtcctc tagactttgg gcccaacatt gtagaagtgc cgtagatgta atcgtgtggg
    34741 tgggatcatt gaggcacatg gggatttggt gatttaagtg ggtgatatga ccaaagcctt
    34801 tttcctgcat tgcatcctcg tacatagcag gtaattccat gttatatcca tattggccga
    34861 gagcgcgttg taaatcagta taccactgat ggactgggcc gtttaggtct tggacctcta
    34921 caacccaatc gccaaactcg acccaggctc ctgacttaga gcatctgggc acagcgtcag
    34981 tgaatattct gattcaatta aaccatccac ttgcctgttt atcccatcca agatgttgcc
    35041 caaattctgc actcgatgcc caatctgccc aatatgtacg taatcgatgt tctgaaagac
    35101 gtcataccag tcaggataat actcaaaatc gtcaacagaa aaatggacgt tcggagtgcc
    35161 tctatgggaa gtcagcagat gttctagagg atgaccattc cataacatac aaatcggcct
    35221 gtagataaat ccagtctatg ccagttacct ataggatgta agattctgta ggatcgtatg
    35281 gtcatgctat aggtgctcac cgttgagtgt ctaaatacat ccgctgtatc atgttagcta
    35341 tgctaaaaag ctaatatgag tcgttcctca ccgaagtcaa ttgcccacac tccgatcccc
    35401 gtaccgatat caaggacctt ctctggttct tcaacaatcg gggcatggaa gagatgtccg
    35461 tcaaagtggg caagcgcaat gtcatgcata tcacctgttc tttgtcaacg caagacgttt
    35521 caatgtcttt aggaggccca cactgtcgac cccgcgcttc taagtccgtg ggccaaggat
    35581 atcggtctgc cagagttagc tattcatgaa cagagccata ccaaacaaga actaacctaa
    35641 ttgttcccca tagtattccc ttccgttcct ctgtattatc tctacagtat ccgtgtcact
    35701 agaataagtt agaaagtatg aaacaagtag ctttcctaaa agacctttct tcgtctatgg
    35761 acgacaagct atccgttgta gataaactat caggcgaaaa tacatcctcg atcacagatt
    35821 ccgaatcagt gagagtgatg tccatcgtaa ttcactataa tgggtgagtg tcctaatatg
    35881 acggcttggg tgagacaaga aaagagaaca cggtcaaagg cttaggatta acaatcagag
    35941 gccgatgaaa gaagaaacag gtttagatta tattatttga gtaaatagga gtgaaatgga
    36001 tctgggggaa attcattacc tgtgcctaag gataaaatat cacatttttg gtttgtattt
    36061 ttaagatgtt ggtggccgtc tacttttagg cctttcttct tttcttgttt ttttatttgt
    36121 tttttatttt cattgttatt ttcattttgg ggaaaggaag aaagataaat acgttacagg
    36181 ggctagaaaa caatattaga acatctcaag ccaatcggaa acaggtaagg actaaggagt
    36241 cagctgcgta ctaagatact aataatctaa catacgaacg atatcagata cgggtcagct
    36301 ctgcacattt ccggtcatgc cccactgtgt tacatacgga gtactccgtc gggtatgatg
    36361 agcagctgac tgcaggtggg atacctaggg tagttccacc cttggttcaa gatatatgaa
    36421 tctaattacg gaaaaaaggc cgcggtctaa aatgggaaca agggtgatca tctgctcgta
    36481 aataatcagg tatataaaac agtataacct gggctaagtc attgttggct atctcagtat
    36541 caatatcttg ccgcttattt aagcttccat gatataaata cattcggacc ctgctaaaaa
    36601 agctactgta atacagaaca acagtaatta tcggcgtaca caccacttta ggattatgta
    36661 ctttaatata tctctactca cattagtgga cccgtctcca agctaaactt gtccatgtga
    36721 tgtttagaat ttctctgcag caatattcca tttacccttc gcatacttag tcttttttct
    36781 cacgggcaat gcatcgtcac gtaagggggc cagaatctaa tttacagaga actggttaag
    36841 ccgggttttt ctgggaggat ttacatctgt gaatcccttg cctgatcacg agaaacttcc
    36901 tattcctggg gcattgcgat aataagttgt agtaagatct ggttatgtat agtgggtcgg
    36961 attacgaagc ctccgtaagg taaacatcta tgtaaggctt tgtaaaactg aaggaaatgt
    37021 agcgaaacac tagaccatat ccatcctctc tagctaccca cggtatccag gtccaaaaga
    37081 ttatggaaag agtacatact ttaggacgga atggtgcctt cctgagctcc tagttgggtc
    37141 agagaaacag acacccgagc taagaaacca ttataggaaa tgacaactga ctattgttgt
    37201 accgggatta gatggatcat tctttacaaa ttactaccaa ccgtttattc gagggcctgt
    37261 gcaaaagtac tccagaatat tttaagagtc caataagaga gcgtaccagt ttatatgaat
    37321 tataccatct acggacaagt gtcttttagc ttcaaactct attttaccga gttgcaaaag
    37381 tactacatgt gggacttaaa atcaattact gtgtggtatg ctaaagaata tatgttctat
    37441 accaaaagtg gaaagcccat aacaattaac ttccggcctt ctccaatctt aactaataaa
    37501 gaaggggtgt aagtaacccg catcttcaat ttttccacac aacccctccc ctgactatcg
    37561 atatgtccca gcgccatgcc tacacagccg aggatatcct tcgtgaaaca gtccaagggc
    37621 ttgcatctct taaagcattt ttcgcttatg acaaaagcgg gctagtctta tatatggccc
    37681 gtgcggcaaa gcaaaaccgg agattgggct tgggcttcgg tcagaagggc aagcatccta
    37741 cgctggagga cctcttcatc cgtctactta cctgcctttg ttgggcccag aggctagaag
    37801 tagaatgctt tgcaaccaca atcacggcca acagctatgg gcttgcggct catctttccc
    37861 gctgttatgg tatggagcac aactacgtga ccgcaaatta cttccgttgt ggacgacaac
    37921 tccggaagat cgaaaggcac gttggggtgg aagattgttc gataatcctc ctaccatccc
    37981 tggcgaagct tctatggctt cctgatagag agatccttcg actaatagat ctcttgtcag
    38041 gcagctttat gcctacccta agtagcaata aacagatgat agaagagttc catcagtacc
    38101 gacaacttta caacactgtg agtaatagga ctgtgagttc cctttctgac tgctggtaag
    38161 cataactcat gatcatctca gctaacgata tgtttataag ccaataggac acgcatccaa
    38221 gtccggtgat cttagcttct cccccgcgga tcaaaaacca taaaaggcaa aacaaaaggc
    38281 gaggcagctt tagccaggat gagctctctg gagaatcccc accaaaccat cagaacatca
    38341 ccagtgggtc tgatttccac gaaggtttga cccggtacag ccagtaattc agtgttgtcg
    38401 agcttgggct cataccgagc cgcaggctcc cccagaaaac cagggtacaa aacaatggat
    38461 gcggagcctc ttaccacccc gaaaaccgaa aacccatctg ctccgatgcc ggaagggtgt
    38521 gccattctat aatcagattg gccaccttca ccccgaaaga tcaccggttg ttgtcgtttc
    38581 agtttgctga actccactcc tagtgttcgt tcaatggttc cttcgatcta gcctgatgtt
    38641 agctacagtt tcttccagcc tacgaacaac attacctctg gagctctaca tcttaagaag
    38701 acttcgcatt cattacctcc aaggcagtgt aacgttggtg gttcgtgata ttttgtctct
    38761 cgctcatagg cctcctccac agccctcacc acttcttctg gtggagagcc ttgcctgtag
    38821 tatctctcaa atcccagatt ctgcattgcc cacacttcat cgccatgcgg ctcaaaaatt
    38881 ggatggtgag cggggttcgg catttcatcc atgttgtgtg atgtatagat gactaagcag
    38941 atttatccac tggagaactg tgtagacata aaagactttc aacactaaat tagagatcgt
    39001 agctgggctc ctatttatat ttttcataac acaatccaca ccgcattgtt gcgctatgct
    39061 acatacccta tgcagtggat ctcgtgaatc aaacccgaat ctccgataga aggtctaccg
    39121 catacgtccc aaatctcagc tgttgtgtag actaaaataa gtgtttgctc ttgcctcgtt
    39181 ggcccgggca agcataccga gacaagtggg tggcttgcga ccaggaatga aaagctttgc
    39241 cgattccggg gcagataaag gtttcctcca acagcgaatt cttgatcaag tgcaatttcc
    39301 aaactacaac catatgattc tctcctcagg ccgatcactc catgacagtg aaacattatt
    39361 gggattactt caattgattt gattgtatgc ggcatgtcga aaatataatc atataatttg
    39421 tcatctacac agtcgataga tatcgatgca agggacttct ctttaaaata ctacatcggt
    39481 cttcatcgaa ggtttgtatg tagataataa agaagtattc gaaaacgcac tggcagtact
    39541 aatagagtgt gttggccaga ttgctcggtt ggagacacaa ccaaacacct aaggtatttt
    39601 gaccgagtgg cgtcacgctt gacagaatat gatacctatg gctttcaaca ggtctttgct
    39661 tagacacttt atcttatcat atataataat tctatcgatc gtccattatt tacgcctggt
    39721 gatatactct aaaagagata accttctcct ccatttacct gtgtctaacg ccagctttgt
    39781 agtgttaaat aatattacaa ctaaatcgaa aacagcacag acttgcttct ccgagtgata
    39841 tcccagattt ctggctttgg cctttatctg gttatatatt tatgtagcaa tatcctcgta
    39901 gatacatgct gggagataca taatcgactt tacttatact gaatatatac gtcgttggta
    39961 acatacaata tgatatataa tgtagatggg ttatagtaac cttaccaggt tcaaaggagt
    40021 gggactgtgt tcagggacct cttcaagtga aagcttagct ttccgcagga ggaataaata
    40081 tcggtattaa tatcatacaa ctgtgattgc gtatgggcag gatagcattt ataaggtggg
    40141 aaaatagtat taagtacttt agggagccat tgagccaatt aactcatgta taatttagta
    40201 tatataattg cacagtgtag ttctttacct gacgttgata tatatgagta cgcggaacta
    40261 taaacacgta accatggctc tccgtaagac tagctactac gagctcctcc cccgaaatat
    40321 cacgtgctga agcgattaaa aaagactcag gcacggttcc gtacctacag ggaggcaggc
    40381 acatagcggc tcaaagtcgt taatcccccc ctctattacc ggcacaagtg cccacttatc
    40441 cattttgtta cctagctaaa ggggaagcta aagcacggga gaaaataagg gattggaaca
    40501 tcggaacata cagtaggcat tttgggagag ctcagaaaaa caaaggttta gccgaggtcg
    40561 agagtttaac caagtatatt ttcttctaat acactataaa ttaatttcat atacaaatta
    40621 cgaacatgaa tatcatcgtg cgatttgtcc cgaacaaagc ccctgtcatg atagtccgaa
    40681 acaaccttgg atctatataa tattagaatt atgaacaagt agtcatatct ctcagaactt
    40741 acacccaatg tgcacagctg cacatgtgcc ccagttcctc aacaggtact tgggaggcac
    40801 actctgtcat tttttgaaga taaggacgat tttgaacagg atatgtaatg agaaggttat
    40861 ccgtatgata gtctcgattc cactccagac cggcctgtgt acggtttaaa cggatcttag
    40921 tgtcattgca gtcaaaattt atgacccagt gtcttttgca atactctgtg gttaggggtc
    40981 ggacatggac gaagattact ggtatgtctc tatgtatact ctattagccg ttgtgtgtac
    41041 gaccgttacg aaatatagat aggaaagact cacggcggga agctcaatcg aaatctccgc
    41101 aagcaacgtc cgatgttttt gttcacattt tggccaactt cctcgcgtag ttgactcagg
    41161 aacatgtcaa tgttgatgtc ttgttcacgc cacatcttca taagatgtgg gaataaatac
    41221 atatcctgaa atgaacgcat gcagcccttt atatgctcga ggctcatccc aaaacagtca
    41281 gctggccgag gaagacgttt gtcttccggt aaacgcccac caagctttag gaataaaatt
    41341 gtactttctt gaagttctgc cagaagatct ggttcgtggt cttgaggatc cattgtacag
    41401 cgagatatga tgttgataca catacaactc aaagaattcg atggatttat atcagagaag
    41461 tgggcttagg ccgttcttat gttcctagaa agacttcaaa ctatcgatac agactacctg
    41521 gattgacttt gagcgggcat ttacattgtg gatactagtg agcacccata tgattgtatc
    41581 ggagctaata ccatatactt actgaaacat aaaggtggaa ttgctgtaat gtattgtaca
    41641 tgttagcgat acatataaat gcatacacgt atgagcagtt acacacacac aattcattaa
    41701 cgcccggcgg ctcagccgaa agggcaacta tcactgatct atcaacacag gttctaatgt
    41761 acatctaccg tatctccttg aagcccatac atagatcctt tcagtatatg tcctctcagc
    41821 tgtcaatatc gtaggaatcc ctgtgggtta gtaattttgt tgatagactg gcttgaaggc
    41881 gcttcttcaa gtgttcaacc tcctatcctc ggcagttgaa gcgcgtctac catctgtggc
    41941 acaaggtgga tggtgtaggt tagttagggg agagtgtcat tgtcttggtc gacgcggtta
    42001 gacggcgtcg agtcggcccg tggtcatggc aaatcgtatt gaggctcgta ctgcctccaa
    42061 atttggcacc cattgctgat cattggaagg cgatttcccg cccaggcaga gggagagatt
    42121 gccccggtga gtacgagtac attgtagcag tgcgatccgt tgcgtggtcc acttccgaca
    42181 tcggaagagg aaatgctcca cggtttctct tgcttgtccg catgcacact ggtctgtctg
    42241 cgcgacattg atccggtaga gatacccatt taatcttgcc atgccggtcc ggagttgagc
    42301 cagcacggtc gcttctttcc aggatagccc atcatacagc tgtcgggtgt gttttcctgg
    42361 gagtgccgca tctactcgtt tgatgtgtct tcctacgtcc tctggcaagg ctttcgtagt
    42421 ggctgcttgg gatcgtgcga gattcaacgt tgttgatttc attctggaga cctgtgcctg
    42481 tgggatagcg tcctcgtggg tcgcggccct ggcctgctct ttagccaggc ccagcagttt
    42541 gttgtcttcg ctggcaggga cccaaagaat cttgatatgg tttccttttc tccgcagtct
    42601 gtttatgagc ttgtacatct ggcagacgaa ctcctggcct gactgttgtc gagggttctg
    42661 tatcgtgagg gccgtcgctt tgttgcttgt gagcaacctg aacctgaagc ctttcagtcc
    42721 caccagcctg ttcaacgtat gtgctatagc cgctagctct gcggagaacg gattctgctc
    42781 tgatcttgcg cccaatgtta cggagaaggt cttcagtttc aattttcgat attgaggtgg
    42841 ctgtttctcg atcgccaccc caaatcctac aaacccgttt cgtgccgagc tgctgatcgc
    42901 gatctgtatt gatccacccg gtatagcctg tgggtccggc atggcttcgc catcggtctg
    42961 catacgtgcc tcccatggtg ctaatgtaaa cgggttaata gtctccagtg tttccatctc
    43021 gatgtttttc agcgcgtccg ctacttggta cagcggcgag cggtgaaatc ttctgaattt
    43081 cttgatccta gctgtgtttc tgcggagagg attggtatct gggagcgtgt ggaggtccgt
    43141 ccacattttc acggcccgtc tccaaaaacg gtgttgcgcc gtggcaatgt gagcctccgc
    43201 ctccgctaca ctagttgcaa cggtgagaaa cgttccgaca atcgcttgcg ctcctaccct
    43261 ttggactcgg ttgatcggtc ccgtggcctt atttttgaat gcatgcatcc agacattaga
    43321 ggcgtagtcc actacagggg tcactgtcga tgtgaatagc tgccgcgctg ttgatgggga
    43381 gagacctctc agtcgtcgaa gctccattac tgcctcaagg cccttagacg ctgcccttgc
    43441 gatgtgttcc ttatatttga gacttgtgtc catcaggacg cccagaatct tgacatggtc
    43501 tttgggttca acagcctgtc ccttgatggt gaagggttct cggtccaatt tggaagtctt
    43561 gggggtgaag tgtatgatgg ctgttttctc tgcttcaaaa gttgccccac ttcgtctttc
    43621 ccagtggagc gcttctttaa tgattccctc aataccttcc cggttgctct gtgcagttgg
    43681 ccccgtcacc catgcagtga aatcatccac gaaaacaatc gcacctccct ggctgtcgat
    43741 ttgtcgctgt acgaggtctg cgttgaagaa gaggaacagg attggggata gcggcgagcc
    43801 ctgcggcagt ccagcctgtg gcaggctgtg gacctcagac aattgcccat tgatttggat
    43861 agtcgccgtt cgttccgagc agaacgcctc cacccaccgg agcagatcct ccggtatgcc
    43921 tcacgctttc atcctttgaa gcaaccgttc tttgcacact ccgttgtagg ctcccttgac
    43981 atcgaagctg atcaaactca agacccgtcg gccgcgccac gccgcgtaga tttgttcctg
    44041 caggagtacg agtgcttgct ccgcggaccg ctgctttcgg gcgccgaagt ggctggtcgg
    44101 gagcaaaccg tgagtctcta ccgcgtgtga gatcctttcc gccaccacgg attccagtac
    44161 cttgcccagc gtcgcgagca gcgaaatcgg tctccatgat ttggcaatgg tgtagttctc
    44221 tttgttcggc tttttgagtg gtatgatctt cgcatgtctc cattgtcttg gcaacgtgcc
    44281 tccttccagc gacgcctgga agagatccag gactctgtac ttgaccgtgg gccaagtcat
    44341 cttccagact attgctggca taccgtcttc gcccggtgcc ttccaagact ttgccgccat
    44401 cagctgtcgt tcgatctcct ccatcgtaat ggcaggcatc tcgactggcg ctctttgtgg
    44461 tcgagtccct tcatcgtcaa tgttgtccgg cagaggcggg aagaatttgg ccagcaattc
    44521 ttctgcctgc tccttgtgat cggtggtggt ggtcccatcc gctctgagga gctgcgggat
    44581 cttcccgaac gctgcgtctt ctcccgactt caggtatctc tcggctttcc atatgttatc
    44641 attgtcggca agaaattgat tccagtgctt tttcttttgt tgccggatgg catcgtggta
    44701 ttgcttcgcc gcgccttggg ccattgtttc taggtagggt acttttcgcc ccgctcgtcg
    44761 ctcggaccgg gcgtgatttc tccagtatgt gtgtatttga cggagctgcg tcaaatcagc
    44821 agtccaccac cgcttcgcgt gtgatgatgg ttttgacttt ggtgttagcg catgcaccgc
    44881 ttccgagacc gccgacatga gtcggtcggt tttctgctgt accgtaccct ccgacggagt
    44941 ggcggcaaga gtgtttgcta tcctggtatt gatctctttc catggagcgt ttttcagcag
    45001 aagtcgtccc tgatgctttg ggagcgacca gggggcatcg aatacggtct caatagcaca
    45061 gtggtccgag ccgtgctccg tccctaatat agcacactta attacggagt ctgccaggtt
    45121 ttccgaagcc aggaccagat cgatagtcga ctcgcagtcc ccgctgtgtc ctccgccatg
    45181 ccatgtcttt gtgcctcgtc tgaggagact gctgagagca cattcattca tgaggtcgat
    45241 gattggatcc gcttcacctt gtcttcccaa agacacgtcg tctcctcccc agagttggtc
    45301 atgccggttg aagtctccca taatcaaaat ctccaccacc acacccgtat cccgccgaac
    45361 tttcgtgatc gcgtcgagta gatggttaca tgcgtcatcc aaagctgagg cattgccccc
    45421 ttcaacgtaa actgatgcca tgaatatcag tcgctcggga agcctgataa ccgctgccgt
    45481 gaggtccggg gactctatcg gtacttgttc cgcctcgact tctttgttaa tccagagcat
    45541 gcttcgtact gcccatctgc cttccctcca ggtagagggg accatcttcg tccatttatg
    45601 gtgtcccatc ggggtggtca agagccggcc ttgaatcctc cgcgcttggg gttcctggat
    45661 cgctaacgcc accgtgttct gagtctcttc atcattcatt aagctctcgt gcactgcacc
    45721 ctgttttctc acgttcagtt gaatgactcg aagagtctta ttcatgatgt gatggataga
    45781 gcttccgaca gttcttgcta tacgattcgt gagggcctcc gcatggaatg cactttggaa
    45841 ccgattggtt gcagcaactg tggtggtgac cctccgcagc acatctcgca cacttttgag
    45901 tacttttaca ttggaatgcc ttatgtccaa tctcttgaca gttgtagcat tgtatcggtc
    45961 gtggtcggtg ttcaaaggtg ctggtcacgc cggattctcc cccagcgtga aagaacccgt
    46021 cggccaggag cctccgtgca tcactacctt tggtcaggta aacgaccatt gacccatagg
    46081 ctttcgcatt ctcctttctg ctcagccatg caatcttggc gacggtggtt tcgttctcct
    46141 caccaaaggc tgccgcagct cctactcgga tatcaccatt ttcatcaagc actgccgttc
    46201 tgttgacgct gtcgactttg atcgggtaaa gttcatcacg gagcactcgg gctcccgcac
    46261 cgaccttggt ttccgccacc ttcttaacca gctggtgttc agcctcatct cggcaagcaa
    46321 ttctgatccg gttggtgttt tttgggtcca ccgtgacagc gcggcaccgc cagttcgtgt
    46381 agttttccat tgtccggatc tcggtctcaa ctgccgttct aattggacct gctgatggtc
    46441 tctcactttc agtatctgcc atcttcgagg tgtctatcgt gcaatatagc gtgtcggtga
    46501 aggtagtcgg tgtcgtgttc cacgatgaga gagtccgtat attgctcggt tggctggtgg
    46561 ggggagtacg ggcaacatct gcataggacg gggatcccga aggattgact gcaacgcgta
    46621 aggattggat ttcgcgaagg atctcctcgt ggccgctctg agcgcatgac tcggggtggg
    46681 cttgcggtgt cgggggtcga ttcgccagta attcatgtcg aaactctgtg agggcagcgc
    46741 caaattcttc tttgactctc tggagttcct ccttgtataa ttcatctcgt cgtctaattt
    46801 ctcttctgag tttgacaatc tctttcacaa gcttggaggt gtctgagtcc tctctttctg
    46861 tcgaggagtc gtccgaagtc gccgctttat cttgggcgac tggcttaccc tggttctttt
    46921 tcttccgctg ggagcgcgta tttctctgct cagtctcgat ctcttgctct tgagcatagt
    46981 gggccggtgg tcttgtcgtg cgtttcggcc tcaccaatcg cggtggtgag ttttcctgtt
    47041 cgtcgcggtc gggcgggtca ggggttcgcg tctcggcccg tcccgacatt ttttcctcct
    47101 ccaagttgtt ttctgttcca aaccagtagt agtacagttc tgtaactggt accaatatct
    47161 actacactat attccgacga gaatacagtc tcggtcgctt catgagcagt tacacattgt
    47221 gtacaaaacg gaaaatgtaa tataatcagg cgagataatg ttggtagggg attgcgtggc
    47281 ccggaaggtg ggttcttccg gcccccgccc acaaagctag ccttagatag ggatggtcac
    47341 gaattgaact tggaggagcc acctttatac cgttgagata tatcctacct tctccgtcgt
    47401 ccctagtttc tctagatctg caaagtcacc gacggaaatg tggtagctta gcatggacga
    47461 gcctagctca atagcagtct gagaatttct ttttattaag caaagtaaga gccctcgccc
    47521 gaaatccgtg gtctgatagt ttccttgttc ttctacttat cctacgggca agtcttttca
    47581 attacgttct gaggagatcg tactgaatca ccaatctgta aatagttgca tgtataacta
    47641 ctaacgcgtg cttgcttttc tcacataaat cggtactgtc tacaaatcgg ccattatcta
    47701 gattctggat tatttctctg tatatttcaa atcggaaata ttccttctta cctagtagcg
    47761 taaaatcaaa gggtgagaat tgacagaaaa tgagatctta aaaaccgatc ctaggtcacc
    47821 cgatagaaat catttgacga tacattattc aatgagcaga tcgaaggctc gatcaaattt
    47881 ctcagaatcc agcggttctg ccaggatctc cttttctgtc cactgctcaa ttctgtactg
    47941 gcccactggg aggcggttgt agagaaagat ctcaaagaaa ttagagggta taaactgtaa
    48001 cagtcggggc ctgtaatcct taaatattac ctcaaaggcc tcataatggg cttttttaag
    48061 gctccggtag tcggtcatag agattgtacc ctttcctgca aaggatacac cttggggtag
    48121 aaagcagagt acattgggtg agctggcaat acgtaccagc tggttccaag gccatgcacg
    48181 cttgtaccaa ccctttaccc tctcctcgac ctggtggtaa tcacgcgtcg actcggggag
    48241 ctggcgacag atatttacta cagtctgagc ggtcggatct ggatagccct cctggtgccg
    48301 ttgctggcgg tggttgtgga cataccagca agttagcgcg aggccaatgc gggatgtgtc
    48361 cttattgtcc ttgtgccaga tgccggcctt gaatacacca gctggggtac gctggaagca
    48421 gcagttagct gctgtctgct tctggcgcag atggagtaac tgacgccgta gttctactag
    48481 aacaggcggc gatgcgatag taaacgccaa ctgtagtagc cggtcagcct gcttgctacc
    48541 gatgcgcact gtgctattta gaggcatccg ggctattcgt tcccttatac gagtgaggtc
    48601 aatgggaatg tcccattcac ctgtgacagc agaccagcgt tgctgcacct tctccggtaa
    48661 gacgccgggg tgtctgcggg aggatgacag tgccgagggt aacgataatc gagactcccc
    48721 tgcggcgtgg agtgcccgcg ctacgatttc acggttgagg ctcccccgga aatcctccga
    48781 cggttcctct tggacggact ggttgttgac acgctgcttt attgtccaaa gcaggcatgt
    48841 tccgtcatct ccgttcgtgc tggtaatcgg ccggttataa aatttccact ctggggacag
    48901 tttacccata tcccgcagat gttgggatag tgcctctata gcgcctcggc aagaggtaca
    48961 agcaggatag acaggatcac aaggatcaca catctcatgt aggcctggcc cgattgcggt
    49021 aaaggagtag tgaatcacag ccccagagca ggcttgaatt tcaattaatg accagcgtcc
    49081 atgtaaatag gtgggcagca atagaatctg tgggattggt gttgggcgga gaacgccgcg
    49141 atgtagacgg tcgggccagg ccgtatcagc aatgtatact tgtgatgagg gtcgatagta
    49201 tgaaaaaagg tcgcctagaa agtcaactgt aggaattgat agctgctgag gattctgcag
    49261 ctcgtccaag atttgttcta tatcagcgta tgccaatatg ctgccatgca gtatgatacg
    49321 atctgtatct ggccattgct gtgcaagaga atctcgtaga tccgtggcat cattcactct
    49381 accatctagg ctctcatagg tgcgcgtaca gctggtcgga ctttctttat cgggtgttaa
    49441 gcgggtatct gcaccaggaa taaccccgct cgtcgctgag aggggggaca tatgggccat
    49501 agcctgatcg agattgtcag gcgcgccaca atcatcaact aacatgtcgg aatcagacaa
    49561 agtcgggatc tggaatgcac ctgaggacca attcccaatt gtcttggcat gtgatacggc
    49621 acccggtaac atctggttgc cattccacgg aatcgcagct aggatgtcaa ggtcttgatc
    49681 agcgggcggc acaaacaatg gatcccggca cgtcgcagcg ctgccggtgg taccgggtgt
    49741 acctaaactg ggcgacatct ctccttcatc ggtcgtaata tcgactagag gcggcagtga
    49801 tcccaacttt cgagccacac cgtctcgcac catgcgagaa aagtccgctg cgggatgcgg
    49861 tgaggtgttg agctcactgt ttggatggca ttctagaaat gcgtcgcttt gtgcaccatc
    49921 gtcttcggat ggacccgtgt cactgttctc ggttacccca tcctccttaa agcggggtct
    49981 gcttgtcggg tataattcct ccactccgtc ctgcaggtcc ttggacgcag tggctgctgt
    50041 gggactacct tcgtttgtca cgtctagcag tgtctcaaaa ctaacctctc cgctggttgt
    50101 tgcggcattc aattgccacc aagcaggggt ttgcagctcc gaactgtcct cccatcagca
    50161 tacattcctc ttagcactga acagaatcac atgccttgta ttaacctggt cagaccgatg
    50221 atcgtcacag agatgactgt tgatggcgta gacatagtcc agcgggttgg tggatccgtg
    50281 gtagacagcc cgatgaggct ggaaggcctt atacatgctg cggagatacg tgagctgtaa
    50341 tgtaggtcag cgaggtagtc agcctagtgt catcctctgc atctatcagg ccgccgcttt
    50401 gatgctttta atcatgacat taatgtgtca catgataaat agtcacatac caatgctccc
    50461 accgtgcaac ccgctcgttc atagtcttgg tcccattggc tacacagttc agccaccaat
    50521 ggtttctgta ggggttgtta gcgagttttt ggcatcatcc agtgtgctca cgtactgcga
    50581 tctgccagta atccttctgc tcgagaaccg acacattatc taggctgcag ccgatctgtt
    50641 cagcagacgt gtccacagcc gatccatagc attggacgtt cagttttccc cttgataatg
    50701 tggggctccc ttttgacctg gttgcttgta tgtcgcagat tgacattctc ctttgtttgt
    50761 agaaactaca caaccattta gaagaccatt gacgtattcc ctgcgctgct ttgggagcga
    50821 gtccatggcc ggctatatac ccatgcctca ctcgccattt tctatgctcc ctgtggtcga
    50881 caactatggt acgcatggcg tgtctcccac cgagaagtgg cgggtgccat ggttacctcc
    50941 tgtgtgcctc gaaaggatcg atccacagac aaagccagac atgagtgttc agtttccgcg
    51001 atgctacccc accacgcctc aaggtgattg gggctacaga ttggcaatgt aagacagatc
    51061 tgagacatag gttgcaacaa tgcatccatg agtcgccaaa gcccctgatg tttccatggc
    51121 tccagatgtg gaacccttgg tcgatcgtag atgatattac ccaacaagat ctcaggacca
    51181 ctagagctga ttgtatgccg caggtcaaga ataccctata ccccacaacg tcgctcacaa
    51241 gactagagtt tgcgccattt tcacatctta gaactacgga aacgtagccc tttgagcggt
    51301 ttaatatttc gtgggaaaag acgtggaagg cctattggta gacatcatat ggtatctata
    51361 ccaattgcat tctataaaag aaattttagt aaaagatcct ctcatataat cgtttaacct
    51421 ttaatatcag aaaagaaaag aaccgtgagc catggagcag caatccacgt ggtgcggttt
    51481 agtgtagagt ttgatatggg gtaatttacg aaggtctatg ataccaggta ttacaatatt
    51541 aaaggcttgg cataatgggt acttaggttt cattctacgc tcggcaagct ttttgtagtg
    51601 tgtacaactc ctatactagt acagagagtg agaagactgg ggcgatccct gtggggatgg
    51661 ctgtgctcca tatattatcc tttctctgaa cctttcagct ttataggacc accgtggaaa
    51721 cggtggttcc gatatggagt agttctactc atgatccgta agcgagccga cccacaggga
    51781 tcaacaacct atctcagtac gacgagcgac ggaaggtttt tctagaccat acaggaccag
    51841 tatacattgc gtcatcactt aaggacgttg actcggtatg cgccgataga tctgacacgg
    51901 ttgaactatc tcccgcaagt ttaacctagt tcgtattttt cgcaaaactc ttttttaatt
    51961 ttttcttctt atgcaatgaa gatagtcagc gccactaaat agataatcgc cgtcaactta
    52021 ctgtgtactg accacgattg accactgaga actattacct gtcttcaacg tggcgttgtt
    52081 ctattccatc caacaatctt ctaattacat aatctcctcc cagtttcgga gccctgtttc
    52141 aaaatctcgg tcgttgaatc gtaccgattt ctgacaaaag cttaacgcac aataactgat
    52201 aactgataat cttctttagt aaataaagta ttatctttat ggaacgctta gcggctggat
    52261 cattctatat gccgggccga tcattcagta gacccgccag ctagtatccc ccgccttaga
    52321 tatccataac tcatatgcac actaacccct ataccagcag acgctactcc gtaagccact
    52381 ccatacttat gaatagttaa cagaacaact atattcctca aaaattcaaa tcttctatga
    52441 aaataagatg ctacctatta ttaaaacctg ttggtagggg atttcgtctg gcggccctaa
    52501 gtagcccaga aagagggttc ttccggccgc caagcgggac tccgcctacg cccacaacac
    52561 tgagttgaaa gctaggcatt ctatattcta gttattgagt acattgactg caattgtaca
    52621 ctgagttgca aaaacggtgc ccgggtgctg tactctcttc tttcaaattg tgggtcctct
    52681 aggctataaa cggataaaat tattattagt atttaactct taatagaatt tattggtgta
    52741 aaatttaact gctaaccata tgtgggctag agtacccaaa cccacaaaat tagaagaaga
    52801 gagtgcagca cccgggcacc gtttttgcaa ctcagtgtat atggggtaat atattttggt
    52861 tcaagttgtg tatcattgtc atgtggccac ttgatggggt ccacatacaa cgacaagact
    52921 gttattgttg ctactatttc tttgacttat ataccagctt tgaagcatcc tctgcccagg
    52981 ggttgttctg gtgatcccag gcgctttatc tttctttctt tctttttctt tgctaattat
    53041 gtgtaactct aagagattcg tattactctg ttgaaacctt taggaaatct ttagttcaga
    53101 gacaaaacca gtaagcatac aatcaattgc gtcttcctat aacggaagtt ttgactttta
    53161 gcggttgaat gaaatgactc aacaccattg atctcatcat gaatgaatgg tagaaaagtc
    53221 gagggcgaaa agatataatt tcgctgtcta ctagatgtcg ccaaccaagg ctcaaggaag
    53281 ggaaaggtct gttactttta atagatcggg catcatcact aacaggggct tcttaggtag
    53341 cgtgttggat tgcatgagca atacgcaact ttctgcgagc ctgcagctgt gtaatccgga
    53401 gcccatggcg ccgaaggatc cgtttggtgc aagtctgaca atcatctcga gtattgacac
    53461 cgtcgccggc aaagccatac atgggggtga gtccctggcg gtgcatgaac caccgcactg
    53521 ggtggggaaa acctccaatg gagtaccgct gtccgtctgc cagtcgaatc gagagtgcga
    53581 tcttatcgtc catattcgaa actgaaaagc gcaccggtac gcagtagcgg ctacaccctg
    53641 ggcaaatcga gccttcggtc acactaatgc ccaagggccg gctgccaagg acatactcct
    53701 ttcgcgaggt atccaagcgg cggagagcac caagaaatgt ttgcccagga acacgacatc
    53761 ggattgaacc tgtacatgta tatgatgctc catcattctc actatgtggg gcagatgtaa
    53821 gttcgaaaaa caagctttga gcaaggagac gtatgaggct ttggcggccg tggtcaccca
    53881 ctccctgctt gatggtctgc tgtatgaggt cgtccattcg atgagcagca ttcaagagag
    53941 gttcaggacc tgtaagcaac acgtcgagcc gggtggatgc gtctcgcact gagcgatcgg
    54001 cctgattcca gaagcggagc caagcggccg caccgtccat gctgtccatg aagctggata
    54061 acaccggccg aagaaagtgc tcgtgagggg cagtgtcaga gagtggggta gttgtagacc
    54121 gctctaggcg ggcacgatct cttacgcccg ttccaatcga caggagacag ccgagaggtg
    54181 gacaccaggg ccacaggtgt tgcaactcga cctggaaaag ttctgcgggc atgttgtgcc
    54241 tcaagccacc atcccagcag tcgccgagcg ccgccagggc aaacggtcga aagagactga
    54301 attatgttaa gccgaactat ctagtaacgt gtggacagcc tagccttacc ctgggacagc
    54361 ggatgtggcg cgggcacttg acacggcttg ttagctgaac aaattggacc atcgggtggc
    54421 gattcgtact gaccattccc aaagaagcgg ctcctcgttc ggagtatggg cgacgaattc
    54481 acgatagcct gcaaggatgc ttgtgattag tggactggat tctggtaata gtggtgcaga
    54541 taaaaaccag ggtgaatgga ttgtcagatg ggttgagatg tgccgggatc caacggaggg
    54601 gaagggagga atgaagcaat gaaaccccta tttttctgag tgagctgaaa ctgggactat
    54661 tacccgcagt ttccggcctg tggacagcgg gtttgtaatt ggtcaatatc actgggccat
    54721 gctgggtggt ggtggtgacc gcgattttgg tactcgttgg tacatccggc ccaaagagtc
    54781 gccttgtgca actgtagtgt gttcgcagaa gcgattcaac ctggtttgta tcgtacaacc
    54841 cacggttagt gacaccgcgt atgatctgac gtggccatga aagaaatcga cagccgtgct
    54901 gctggctact gaagaagcca aatagaagac gttggaaagc ctcaaagcag tgaaaaacac
    54961 tctttcgcat ggcgaaaata tctaacacaa tgtagccacc tgtgcgcgtc gatataagca
    55021 gtcacactgg gtcagccaag ctcgagagat ggggacagcg ggaggtcgga agcttacagc
    55081 gccgccgccc cggggggaag gagggggttg ggggggagac atacctgcac tggttccaaa
    55141 tgcgacgtcg attaggtcgg gcagtggaca gtgcgggccc agtaagtttt gaagggtcag
    55201 cagaatctgg agggaaacga tcccacggat cccgccgccg tcgacagtga gggctcgcac
    55261 cgccgcagtc cgtggcagaa ggactattga cgtcaggcag ggctgtcggc aaagcgggca
    55321 agcctcaaga atataggtag attctgcccg cgatggtggt tgaccatacc tctcgacaca
    55381 ggcgtcgcag agggcatgac cacaggcaag ggaatgctgc gggctagaga gcagacaacc
    55441 tagacacgtt tgattactga aaaggctctg gaagactaac cgatgttgct cctgctggcc
    55501 ttgatgaagg tctagggccg acgcaccccg attaatcatg tcaatatgac tattgatcac
    55561 ccgcgactcc agggattgca ctcgatgcac ggcagctgcg ccgccaacca ctggcttgag
    55621 tgcatcgagg cacggctgcc agtagcgctg tcggaaaaga tcaattggat ggaactctgc
    55681 accacgggcg ttagcattgg cctcgaaagt gtacgagctg ggatactggg tgtgatgata
    55741 gcggcgcgga ttcagcctgc actatcacta ggccatcata ccatgcatgt ttggcggaaa
    55801 ggcatctaac atcaagctgg aggatatgat aatgtcttga gcctccactg ccaccttgtt
    55861 cccttggcgc agaaagtgac cgatgtgaaa cgtccactcc aagggacgag gcggaggtcg
    55921 ggctttttca atgagattga acgtcctgtc atgagcctgc gcggtgtgtc ggatcgcttt
    55981 ctccaagagc cctggtagat gagcagccga gaaatgtagc ccacactcgc tccgatcccg
    56041 ctccattaca tccagcgctt tgagcagttc ttctttcagt ggccggtacc gggcctcatc
    56101 cgagagcacg gaggctgacg acacatgcaa catatgaatt ccagcaaaga cttcgggggc
    56161 gtcggatggc ggggcgagaa cgccagcgag gtgggcatcc ccaagggact catccccgct
    56221 ggtgacttct ttcgtctcta ctaccacgag aaggcgtgga cggagtgctg gctgcgtcgc
    56281 ctgtggcccg atagcgatcc agcgccgtag gagggcctgc acccccacca acccgccgat
    56341 atcttcagca aagatgcaaa ctacatggga tgctggtagc agaaatcttg tcactatggt
    56401 gtcgactatc tgtgcgccac tgctagatgc ccaggcaatg ggaatctttt caacgcccgc
    56461 caggccaccg atgtctggcg gctgcgggga ttggttgggg tctccatctg taaagagaat
    56521 cgggcgtcca gagtatagtg tgcgatggtc cacgcgtagc ctgaagccga aggttgagat
    56581 gctgtttgat gggttgtccg caaagaggga acgcaacgct ctatccttct taccccggcc
    56641 caggaatgag accaaggctg gatggcgccg gtgtggtgcg tcggtcaagt gtatcaactg
    56701 tggtaggcag ttcggatcat agatcaggga tgcccccact tcctctgtaa cgaattggaa
    56761 ccaagactgt tggcgtttgg ggcgcattga gcaagatgcg caacagatga aagagctgtc
    56821 gatgccggac ttctacgtga caacctccta gtcagtccac aggcagagac aaccttatat
    56881 aataagatca taaacagcag ctcaccttga cggccgtacc ggtcgcaatg tccctggcgc
    56941 ttggagcgct ttttcaccat ggtcactatc gccattccgt taattttcta ggatgaagcc
    57001 ggtttcgcac atccttgtac acattttatg ctagatgaac gcaccataaa aaaattatag
    57061 gagagaggag tgttttctat ttggcaaatt ttgggtgtta gttttatttt ggatacccgt
    57121 cgggatgatc agggttttag ctccgactgc gggatccact gcgtgatcac ccgtatggcg
    57181 gactgatcct gcagcttatg tcgtcaggct catcttatag aaagcctagt aaggtataca
    57241 ctacataagt gaaaagtctg agtcgtgatg gtcagaattg atcataacat gtaagtcacc
    57301 taattagtcg cctaacatca tatgaccaca acacctctta gctatataaa cacaacgctt
    57361 agatggtatc atcaatcaat tagctttctg actaccatct tggaacttaa tagccctcac
    57421 ataatataac tagttacctt cctataaggg ccaaagagca tattatcacc agctactcaa
    57481 ttatacgaca cctactccgg cagctactcc agacgatatc actgagggag tacacaagat
    57541 agatgagcta gtggaattta ataaatagtg cattgctgtc ggcgtctaaa aaactattat
    57601 gttggtgcta tcttatcctg attcaaagca tgaaaaaggg acggaagcaa gtactagtta
    57661 agggtaccaa ggcagttgaa tatcccccct tcttgtatcc atggcacttt aggtcatgtg
    57721 gccctgaacg caacggtgca tccaaagatt accacagcga cgcacatggc ccctacactg
    57781 tactttcctg ctggtccctc atccacagcg acaatcagag gcaagccgct ctggatgacc
    57841 ttctgaattg ctgactgaag cccgagcaca aagatagttg agacaataaa acaaccaagg
    57901 caccctgcgc tggacatcac cataactgcc cactttaccc atttgtaact ggaccatagt
    57961 gccaccgtga agaatattgt tgcgaacatg ttaataagca ccaggcaaag cccaactaaa
    58021 actgcaggcc gtgcacttcc cagaacccta acggcggcca gatctccaaa atgctgcaga
    58081 cgttcgaaag tgtccccaag aatggattcc actggcgctg gtaacgtagt ggatatattt
    58141 gcgggaaggg ggtggcattc tgttcggttt gaactaaacc cgatacacag ctgctgggtg
    58201 ccaatagata tcgattcagg gatgctatcg agtacgggat gtattccagg tatatgggca
    58261 gctgctgtcg cgagggcttc aattccttct gttaccattg tgggtactcc aacaggcttg
    58321 gttattaccg cggtcggtac actttcgaca atactcttca tattttcatt taggtcttgt
    58381 gcactgggcg gtagaggatc aggcagctgg cgaggtttca tggtaagcgg ctgtggaaag
    58441 tggtttgtcc agttgacctc gaagaaatat cagtataagc gcaaagagca tctcagtatt
    58501 ggcaagtaca acgaacatga atggttgcaa tccctcgttt ctttacggtt ggactacata
    58561 ggaaggaaat agccaatatc accgccacta gcgatgctac ggaaagaacg ataaaaatca
    58621 gtactgccat tcgctttttc cacaaagctc tcccctgcga ggtgaccggg gacaaggcat
    58681 cttccattcc ggctttatga tcgcgtgatg taaatgtagt ctgattttct ggcccattat
    58741 atggccctgc gatccgaact cgagtaactg tttctgtaat atttgccatg ctaggctcag
    58801 aaatccgggc atgcattttc aaattacaaa acgcactaaa agccttcaca aatagaagaa
    58861 agagatatac cgatagaaga tatcacacac gaaaatttat gaggaaaggt agctagaagg
    58921 ggatggatca gccttgtttt atattaacaa taaaggagat attctaggaa tctatacgat
    58981 gcaatcgtgt ctttacattg ctgacccagg gctggtaaaa aatgtcgaag gatgcccata
    59041 tctttctaga cctccgggat tataaagtgt gtattctgtc tcattcagtg ttttatatat
    59101 ctcacatcct aagtataaaa acattggtta actatataga agatgtcaga tggtcacgta
    59161 ggttgaagtc cttatttaga ttgattatgt tgcttccgtt ggatgaaatc gcttaggaag
    59221 aacaatagcg ctaggcgtaa ttaggcgcat caacagaagc tgggcccatt tagcggccgg
    59281 aagaacctgc tttccgggcc acttagggcc gacagacgga atcctactct ccaccaactc
    59341 ccctcgtagc acaactaacc aaggttatat tagtgtatca cctgtggtaa gctaagctag
    59401 ttgtagatta gtgcttacat aggtctctaa attctaatta aatataattg gaagatatgt
    59461 actttggata ttgcctttca caagcttcag catctataca tactacagtt aaactcgttg
    59521 ttagaatctt tttttaaatc cctgactcag tgggacaaac cattatcaat atatattccc
    59581 gcccatcttc ataataattc ttgacacata cacttctttc tgttaataac atctactgtg
    59641 ccatgtaccg aaagaagagg agcattccag gccttcgcaa tgtctctcgg cgtcgggaga
    59701 ccattttcag aaagtgcagc gagctcagtc aatttggcgt tgatgtgtgg gtggtaatct
    59761 gcgctggagc tcggagctcc gttttccgat cttcagaatc tgaattattt ggctctttag
    59821 accgccaaat agtacgctgg catttccccc cagacataat tgatcgcaca gacactgacg
    59881 ataacttact cagatgcgtg catctcatcg cccgacctgg aaaggactcc gtgattatga
    59941 taggagacta cgcgaacgcc gtcccctaag gttgattgac cggctcgaag tggatgttcc
    60001 tggtatcgcc ggtgaccaga aatagacttt ccgcagagca atgatgcccc actggttgaa
    60061 actacaggca gaggatctct ggcctggatc ttatgaagtc tgacggggcg ggcctctcta
    60121 aatatctata gttgatagca atcagttcta gtattatgtt ggtgttgcgt tacttttaat
    60181 aaagtaaaac attccgccac aagcccagct ggaaagaata gttatggaat atataaagca
    60241 gcttatagaa gaagggctgt gaatattaat ataatttaga tgtagtttgc cgcgcatatc
    60301 aacgactaca caaactatat gactagggca tgaagcggaa gacaattacc ctgatgatgc
    60361 aaattgacaa ccaaacggtg cggcgtttta ttattatgaa tgaattctgt tgctggtatt
    60421 gttatgtatg cttaagtcag gttaggccca gttatcacga cagtagatct taaatgagtc
    60481 ggcactgctg ttgggtgaac aggacataat tcactttgta taagaattgc atatcggtga
    60541 ctctgatgac tttggaaata ctgggcgaat aagcgatcca cacgtgcaag tggcaaatag
    60601 aagacggtag cagggttacc aatctcatat agaatgccct tatcaccaga tagtgttttt
    60661 agaggtgctt cgaagtcctg tggttcctga attgtctttt caccaagtag gcctaaccct
    60721 agtgctggct gttcatattc taaggacata tttaaagaac gggtacttga acgagattta
    60781 gtacttgaat ctgaggagta attgaacggg ttcaaatttc tatattgtgt catctcaatc
    60841 atcgtggtca atggcgctgg tgactgtctt ctgctggata gcgctgtagt ggtctcgtag
    60901 actgaagcgc tgtacgcagt gcctggcggt gggctagtaa gcggtgatgt gagcaatagc
    60961 ggctggtgag tagaattgcc cctattgtct acggggctgg catgcctaga gagacctgcg
    61021 gctattggaa ggatctttcc ctggctcgaa tcacactcat ccgatgcaga atgtgacatt
    61081 tggctcggct gctcgggtag gctatcaggt actgtagggt ctgtcgtgcg caaattcccc
    61141 cttatcgccc ctgacagtgg tggtagatgc cccaagaaag cttggaagat gtcccgagct
    61201 accgcaaatg gggtaagtgt ttgccctaca ggacaatcca cctctctatc cacaccatct
    61261 aaagtcaaaa accggcggct agatagaaag gatgattcag aaggcatccc gcatcgactg
    61321 tgcatcttcc aacgacctat ctccggttgg gtcatacacg gcgtttctga aacggattgg
    61381 gtgtgtggtt ctgaggtcgc tgcgacgcct agatgtagta taccacggat ttggggagaa
    61441 tcaaagccta atgagatggc aaggcgggag aaggtgaccc agcgtcgttg cgattcctcc
    61501 tgggaccggt agatgcttct ctctgcacct cggtggtcga gcaacggcat tgtcccgatt
    61561 aagacgggaa aatactgcat tgtatacaac caaagacgcc gatatgcctg cagaaagcct
    61621 gagcggttaa tatgtcggga ctgtcgccgt gggcgaaact gatgccagag agatgtccgg
    61681 attgtgtctc tcgggccatc gggaattagc ctgcgcaagg ccaaggcaca gggtaagaga
    61741 tactttgtgt cttccatgaa ggtgtacatc gagggtatta tccttcggat agataaaagt
    61801 cgacgtccga gtgctttacg tctctccttg tttgtcaccc gtggcattag ggaaccggat
    61861 ctgagtaact gagagatgta ctcatggtca ttagtggacc acaccggtga ccgaccttgc
    61921 agcagttcca ccgagttggg atccaagtct cctatgtttc cagcccccat gatatatgtc
    61981 catgtatcta atatatgtcg aaggtagtga gcaagctcct aacgttactt agggtcaatg
    62041 actgtagtag ttggttgaaa gaacgggaga cacacatcag gagatttcat acggagcagt
    62101 ctattcatat tccccaccgt gaacccgggc tgcaagccgt gatgttgaag cacttgagcc
    62161 agtatgtcaa gcattggccg gtgttgcttg cgggagtaga tacgctcaat aacacttcgc
    62221 tcacttgtac ttagacggaa gaggcacttt cgtgttgtca atgctattgg ctcggactgc
    62281 gattgaggaa aattgttgtc ttcagtcacg cccacctctt cggggtgttc ccttcgcata
    62341 ttgaagccga ctgtatcccg gaattctatg tattatatta ttgcttgtgt cgcaacaatc
    62401 gctgcagatg tttctagact ctgattcaaa aggaccccca cccgttggct gagagaaggc
    62461 cttattttat aagtggtatg agagtaaatc tataattcat ggcgccaact gtggaaggaa
    62521 aactgagtca cagacactgt attaaaaact atgtaaacca ctgacgagac atgctagttg
    62581 ttatgtctca gatttaaccc atgtaaatac cgagcgtata atcaaacaca aagccattat
    62641 tgataatacc atcatatcat attgcattat atcggctgga ttagtgtcaa agctgacgct
    62701 cttgcccaca atacaggata ttgtccttac ttatctttct catagtacat tgtgctagga
    62761 tgtcgccttt ttgatgggcc atttttattt tagctttgac attgcttctg caatatacag
    62821 aattatatag cgaactgcac ctaacactct gcaaggtctc tctgcattta aatcaaacaa
    62881 atgacacata ttatgtgaag gcggaagcta ttaagaacct tgataggatg ctgtcggata
    62941 gctcggctca agaagaatgg actcatccgt ggcatggata ttgaaccgtc gtgaactatc
    63001 accattagct ctattgggta ggctccgtgg agggtctctt gcaatatgga gagggagccc
    63061 cgcttgttca gcttggcggt gcatccagtg ctcacgaatt tgatcgagag ctactttgaa
    63121 atcatctaag ataactgtgt cacaaaggca tttgaagaca aaagagagct tatgtaacga
    63181 ttcgggttag acacaatctt acaattcctg agcaccagta taccacttac cttccaaaat
    63241 ggctcaatcc caactggaag ggtagtggat attacgccaa aaatggcgca aacatctatg
    63301 atgataaatc ccacagaaag acacatcaga aataacataa taccgaaccg tgggctgact
    63361 tgtatcaggg ttcctaggct caatgcatag cacttattga tcgcatgaca tagtgcatag
    63421 cttgcgtata gccaccaagg atctctggaa gaggtagatt attacagatc cccaggttat
    63481 atatggtagg aatacatacc ggaagaacgg ctccagaacc cttgtcttga gaaagagaag
    63541 ctttccctga ttgaagaagg caaaatttgc gtaggtttcg agtacccaat atggttgggc
    63601 gagaagcaaa gtgcctagaa agactcgcga cccccaaggc ggtaaaaacg gtttaatctt
    63661 gatccatgcg attaggttat gcagggtata agatatattt aggccgatgg cagtgatgga
    63721 caaataccag ccataggttg gtctatggaa gaagatgaag gtaccatggc cagcagccag
    63781 tagaagctat gcaaaaagta tcacagtcaa ggacaagtgc ctttaggtac ggacttagat
    63841 caacccactt acctcaagta taatgagctt gtgtaacatc ttagacttct tcatattgga
    63901 tgcggttaat actaccatca caactagcgc acctaccagg agtccttgac cccaggcttc
    63961 cagaactagg ccatctaaat ctgttggtct atcagctgcg gtatcaaatg atagtgagat
    64021 cattttcgaa agagagagga tatatgattg gtgataacga aagaggaact cgtcagattt
    64081 agatggcttg aataatagag atatacccgg ctatataggt tcatctgttc tatttatcct
    64141 ttaaggaata tcttatggaa atacccctgt gggcattccc tgtagacatt cctctggttg
    64201 gaagaaagaa attcttagct gaagaatttg tgtttgtaga acttactacg gtagcttctt
    64261 gatgactaaa gaaggattag aatctataat cagtttagca cgcttggtat tattttcata
    64321 ctggaagtaa tttaaatgga ttcatttatg gtttcctaaa atgagatatc aagcgtatcc
    64381 cttctctgag catagtagca gaatatttaa cacagttggc aaggagaatg aagaaaatgg
    64441 aggtatagga cttccacctt gatcaaccag tataggatga atatagtgaa tatttatttc
    64501 aattacgaaa gggtcactcg ctgaagggta ttattggccg atttacctct ggtcctaggc
    64561 ttggcaacaa acgcttggcc ttttatatcg aattttccgt ttcaatagaa tactatgatg
    64621 gtctatagtt tacgggctca cttattatct cttttacgct gataagcaat gtgcacaatt
    64681 ttaacgaagg agtcggcgct gaaaccgcca aagaaggaat aatataaagt ataatcaaca
    64741 gcgaggcctg aagagcgttg attgcgcagc ggagcgaagc ggagctagca atatactgga
    64801 cgggttttca ccttctcgac tctgattggc cagcctcttg cgctctgatt ggtccatact
    64861 ttgctcacgt atttggcttt tcattggttc tcaattcatc cgggacatta ttggccgctt
    64921 gccagcttac taatcaagat agtaattgaa ggtcatgtga ttacattgct gcgcacaact
    64981 tttggcaggt ccttgacctg gcactaacta gtacatggtg atatgtagcg aagatgacgt
    65041 aatatccacc acagggctgc gacgccatcg cgttatttct cccccctgtg ttcttggata
    65101 attgggaatc gtgtcgatca tcgaattatc agcttctttt ccgtgctgtc tacaggctag
    65161 ttagacagtc ttcatgtcaa tcccaactat atcagacgaa tctgccaaac tctgaagggt
    65221 cctgacaaat ttaggccatg tgttggtgag tacaagatac ttgatactat cctgcgcgtc
    65281 atcgaatatt gtcgtgctga atgtctccgg gacatccccc gtatagaaaa tgttggttac
    65341 ctggctcacc tgttcggcac cttctaatga cgccggcgat aaacgtgcct tggaggagtt
    65401 atcagatgcc tcgaatggcg tggcaggatc aacatcacgc atatctccgt acagagcacg
    65461 ggtgggtccc tcaaaaacgg cttcgagtct tttaaggtct ttggaagaga tattcacagg
    65521 aaactcagca tggtaaacgc tgatgaaatc gacgtatata cgtagggctc ggttaaaatg
    65581 ctcacgaatc aaccccgtga agcagtcacc cccaggggta gtgctattcc gaatggcctg
    65641 ctgtagcgaa cttttccaat gagacacgct caccaggaag gcaatattct caccagagaa
    65701 gtcatgaaga gcagcgaatg tctgaagagg agcaggatct tgttcaagta tataatcaag
    65761 gctgttcagg gtcaaggtat tgtttcgagc gtcgctgatc atatcgacag agttattatc
    65821 tgtctccaaa tcaagtgtga ccgtattggc tatggtggag gtcgggctga gactattaaa
    65881 tcgtgagata gcctttttgt gctgcagttt cttttgtgtg atgaggctgg acatcctttc
    65941 ggcggaagcc ccacggcgcc tcacctccca gcagggaata atgatggtga aaatctctat
    66001 taccagaata gaaagacaga tcctgtactc aaatcagggg ggtggccatg gatgattttg
    66061 gttgggacag cctaccactg tggtggcaac cagtactgat tgaccgactc catcgcgggc
    66121 acataaagag cgacaagcca catgggggtg gcgtgaagac tatcttacat taggtacggt
    66181 gcttgatact cagcctacca cttacttcgc gatagcgcaa ccaagtgtct ggactcgcca
    66241 gccttgggta tcgtagatcc ggcgagattt ccagaggact attggggcaa aaatccaaga
    66301 ccagaaggat tgccagaata tgctaggcca cctacatatc tgttagataa ccacttcctt
    66361 tggacgaagg ctggacatga aatcctttta tttcttacca ctcccaccct cgacccatct
    66421 ctgacttctg ttccatttcg gtgccataga cctcggtacc aggaatgccc caggagctat
    66481 gccacttgcg agatatcacc cacattagga ccgtaagagt aagctggccg gtcagttagc
    66541 tgaaatacgt caggaaaaga tttaagcgaa aagctcctat cgcacctggc acaggagaga
    66601 aatgcatata ataataaaga gcttaggagt atgtccaaga cggtggaact gacaaagcac
    66661 gtttgccttg ggccttaagc tagtggcagg gcggatacag cggctatcgt agttgacata
    66721 ttttctctga agcttagcga catagagaaa ctggctgttg gataaatgga aaagggcaat
    66781 gccgcatggt aaatatgtac ccatgatcca atactcgaca tctccaggca tcaacgcgcc
    66841 aatcatagtt ccaaactgaa cagataacca ataaatatgg agaacaacga tggcagagag
    66901 cgatagagct agacctcgaa ctcggagtgc aggcgtgttt cgatgggcga ttagataggc
    66961 catacctaac gcgataacag tggtccaggt acatccccag caaacccacc atatactcac
    67021 cggcgtgtat gacacccgtg gtttagagtt aggattgact ccgagttctg accccatgat
    67081 gtgcgatgtt tctcgtacta cagttctaat cagacataag caattggcct aattcagacg
    67141 tggtggaaga atagtgacaa gctcgcctag ggcttatcag caccgctgcg caaggtacag
    67201 tatttattat agtactgcac aagattagtt tacctagtga actagcgtgg ctctgctttc
    67261 caggggtttc agtctatgaa tgtattttaa tcgacaatat atattcataa atagtaaggt
    67321 accttagttt gtaagtgata ttaagaacat tggggcaaat agtcccgttc ggttttctct
    67381 ccctgttcaa ccaagcatga cacctttcga ttggtatgca cgataccatt ggctagctta
    67441 ttaggactac tcataggtaa cttttaacag ctgtacttcc agagtaacac aatatctact
    67501 tatctttatc aaaggaggat atcaggacat caacgcactc gtgatttagg atgccttagt
    67561 ttatcaccgg tgatacacta tactaaaaag gctttagtgt attcttctat gatcgcccca
    67621 ataagaagag gggattacgc cccacataaa ttcttgccta ggttacagga aacaccagac
    67681 acttttccca ttcttctact gaaactcctc cacataagct ttacgctctc ggtagactct
    67741 gtattaattg gtatagtaat agttccatta tatacctcca gtgagtagta aatatagcaa
    67801 tactttgatc ttggcgtaat atcaagaacc aagatcaata gactttgaac taacccttct
    67861 tgattattac cagacaatat aggacgatat aaatttgaac acgagatcca tgttgtactt
    67921 gccattaact tcatttattt aaactaaaga gagtggtttt tttggcaagg caatcatttc
    67981 tacatagtca tggaaactga attggagcaa cccgcggcag ccactttaaa tagtacggag
    68041 gaaacatcgc gtcctataca gccatctaca ccagtgagaa tcactaaggt gccagatagc
    68101 gcggattccg tctcatcaat tattccggga gaattgtcgc cgaccgaatt cgcacacatc
    68161 aacgacaaac gcaagcggag aagctcagtg gtcaatgatg agtacaaagt gcctttgcaa
    68221 aagaaagcaa agttgaaaga ggaaaccacc tcatcagacg tttgtggtac tgccgcggta
    68281 cccttacaga gtattttcag tttagatgca cgagctccag gtcctcggtt gctgccaagg
    68341 ccaattccac agtatagaca gcgaccgcga gtgggctcga tacaacacgg cccaccacag
    68401 ccatatcccc ccatacgcct tgcaccattt cgattctccc accactctga ccaaagcaac
    68461 gaagaaatgt acaacgagct tgctcattgg tatcagcagt aagtctataa gcaaacctac
    68521 gtgagatatt tgctagttat taatcgggtt gcacaggttc cgactgcaga tgtggtcacc
    68581 agtagcttcg gtgatgggta tacgctggga gcaagcagaa gagattggat ggtatttggg
    68641 ctggaacgag attatgcggc gctctagcag atcatcacta gcccgttaaa gtatgactaa
    68701 aactcatgcg ttgtgattat aatatgtcag agtattggtt gtcatactcc gtaggaaaat
    68761 catacatttt tgctttcaga gatataaact cccacatgga tctccctggt ccatgtcccg
    68821 tctgctaagg agcttctccc cctagctctc aaaattctca ggattggtga agtagagact
    68881 gtacgatgct cccaccagtt gttgcagaca aagctaacat ttaaatgtca cagcaacagg
    68941 aaactcccta tgttgaccaa tggaacggtg tcggctccat catggatcta gcacgctgct
    69001 gtgaatacat tgtccttggt tgcttggtta tataaggttt atgttccatt atcagctcat
    69061 atcgatcgag taccaaatag tggaatcatg tatgaccctt atatctatgg gcagagtcgt
    69121 atcccaagag tccttaaata ttataaccct tacccaacct tcctaaactc tagcattgga
    69181 cactcgactg gagcaactgc tcgtgcccca agtttctacg catttcctca gtctcttgac
    69241 acccgccgac tactctgtca cgcatgttga gaatggattg aaaaatagaa tattcaccta
    69301 ttctgggcct tggagggtac gtaggagttt gtattattta ccgagcttga atttaggaga
    69361 gaaaggtatc agcccaatca aatattttca ctacatagta ttaaacagga ttctggctaa
    69421 cctatagata tcacttatct gtgacggggc tttgtgagtt ggttatattg acgctttcta
    69481 tcgtctaggc aagaggaaag gaagatagga acgttggtag gggcgctggg cgcactaact
    69541 gacgtactag gtaaacgagc cagtcacccc acgacttttt ccgcgtctct aggaatgaaa
    69601 ctattcaaaa caccaaaaag tcgacatttc tatataaatt ctggatattt taacgactag
    69661 tacattgaga agctccatga cctagaatac tgtagctaga gtactctgtg agaaatacta
    69721 aagctcggat atgcagtgtg gaaactggtc gattgttgat actaagtaag tcttgtgttt
    69781 acacacatac ctaaagggtg ttgtgggcca taaggccact taggcgacta ataaggtaac
    69841 tgacatactc tggcaaagcg tgtacgcgct gactttctat gtactgtggg agatatatct
    69901 aatgctgatt gaactataac aaggatttag gatatacaga gcaagccctt gctaattctt
    69961 tatctacttc agttcctcac cttcctgcac gacttgggtc aagagattta tcttgcatac
    70021 tgatggagct tttgatatgc tactattagt aatatagtaa taaagatata gttagaagac
    70081 taatggatga aatcaaaaac caaaagggaa gaaaccacag aaactaaggg cttttctata
    70141 atgatcgact actgaggtag ctggttcggt ctctagatct atcatatttt ggctgcgact
    70201 ctgtctctat ttatatccag atattgttct gaatatcaag ggtggccata tcagtcctgt
    70261 ttgtataaga tcttgaaatt ggccctgatt tctaccttag ctaggctatt atcataccat
    70321 tcacatactc attatcgtaa gttaaaatta aatctttaca atggcaaagt tctctactca
    70381 tccgaccggc ccacgtgcat tgttgaacga ttggctacat cgtcttagca ttcccccacc
    70441 agtcacaaac caggcagttc acagccgtta tgttgaaatg ctgctggaga cagaaagaat
    70501 tcctttactt cataacttga ttgcttcggt gtctacttgg ctcttgctgg caggttattt
    70561 agtctttcca gggacatttg tgaccttgcg tgaatctcat ttggtcgcac agatggctag
    70621 caaaagccaa gctgcgacct tgatgaccca tgcgattaat aatcctcctc tgcttgcatt
    70681 agccaccatc tcctgtacat tgggcacagt gggctgcgga tggctatggt ggaggtggcg
    70741 caccaactat atttggccgc cgcagagaat atttctgtat gcagacccca ccacaaattg
    70801 acatatgttc ttcgagctta tatattgcta cggaagacca gcgctcctgc attctactat
    70861 gggttttgtc aatacgattc tcaatgtcta tacggctcgg catggaacat ggtccataat
    70921 ggcaattgtg tcaacagcag tgtcgggttc ttttacagtc accacagcag ttatatatac
    70981 aattttacag tgttatattc ttcgcagaat caagcgcgag catcaatctg ttgttgaagg
    71041 aatttctcca gtaccgccac gacccgaaag ttctagtgga acaagtattt gtgaaccccc
    71101 ccgaagtgga gtgattacag aacacgaaga acggtaatta gagtctctat ggggttttct
    71161 aaacccaccg ggcaggttat atagacttat ttgtataata ttaggacaat cagatttgga
    71221 taatgttaat ttttgatctc cttaatttca agagagaggc agaatatatt ctgcggcggg
    71281 ccaagctttg ccgtgctatg aacttatatt ataataagat attagatatt atatagtgtc
    71341 tatgtgtact atttctcggt gctgcaaata taaaccattt atcacactcc gtatatactt
    71401 ccatttctta ctatcctatc taaggctagc tttctaacta gtagctgttg tgggcggtac
    71461 ggcggactaa atctagctta cggacaaaat aaaatattac caaatttacc aataccaacg
    71521 cactgtatat tagctctacc ataataactt tagatataat aaccctaaag attaggatct
    71581 agtcttatac taccactacc atcactacca ccactactac caccaccacc actaccacca
    71641 ctactaccac caccaccact accaccacca ccactaccac caccactacc accaccacca
    71701 ctaccaccac caccactacc accaccacta ccaccaccac taccaccacc actaccacca
    71761 ccactaccac caccactacc accaccacta ccactaccaa tacagcacta ccactcggca
    71821 ctattactat tactactacc actattgatt caataaatat tattgattat atataagata
    71881 aaactactat cttaaatttt taatcataaa tattctatat aatagtatat tttagagctt
    71941 tattaaatct atatcttaaa gtgcgtggca gtggtggccg aatgtaaaac agcgagattt
    72001 cggtaaaaaa tccgataatc cgaagttttg tccgttagct agatttagtc cgccgtaggg
    72061 cgggacccgc gtagcggccg gaagaaccct ccttccgggc cgcttagggc tgccagacgg
    72121 aatccccgac caacattatt tactataatt ttattttttc tttcactgga gaacgcttat
    72181 ctaatatata tcactcagtt aattgagcgt taatatctct ggcgagttta tttagcgcct
    72241 tagtatttac atcgcctttc ctcatggtgg aaggcatcgc ggagagttga atttattggt
    72301 accctaacca ggcggctacg gataagacag taaaggatac tgatctcatc tcaggtagca
    72361 taaaagtaaa caagtgtagc gacgcagtat ctttcaccag tccctctatc tatctacaga
    72421 tagccgttcg tccttactag ggactttcgc ttcactgccg acacttccca cgccgatggc
    72481 ggataaatga attgcggcta tgaattcgat agttatgacg aagacctcca tgccgtagat
    72541 ggctggtctc ggtatctgcg aggtcactag gattggtact catggaatag cgataatcaa
    72601 atagtgcaag tgggtgttga ggtccctacc tgccattaat ggtaaccact gataacacac
    72661 ttccggtctt tgatctatcg aagaaagccg aatcatagcc tcttgtacca caggtaagca
    72721 ttgcctggtg atgcctgctt cactcgctgt gccgtgtgat gataagaagg ctagcagtac
    72781 gtttatacaa ttggcccgct gttcttgagt gttgatggcc atatcaaccc cgattgcgtc
    72841 tcccaccggc ctctcgttct cgggagcgcg tatcatggat gattctccgg tggaaggggt
    72901 acctgcgtac gaccaagttg gcggtagagc gaagctatca tcagtcactg tcagcaaaat
    72961 atcggaatac aggcactgta tcaggcttct taccttgctg caaggtttga tagccagaaa
    73021 gggagaaagg cgattaaaat cataactatt aattctatga tatatatata cctgatgggt
    73081 tggataacaa gatcaagaag atatagcggg ggtattgttc ttataatatc gctctctcct
    73141 tttagataat ttaaattacc cagggtccta ggaaatattg gttcgtgctg taacctacct
    73201 agcaccagca ccaataagtg cgtgtattaa ctagggaccg atgtagtcaa ggtaaccata
    73261 aattatgcga tacacatacg gaacatagta tgatatagag ttagacttac ccaacacccc
    73321 cttctacatt gcagatacta aatttcattg tcatacctcc tctcaaatct acctttgtat
    73381 cactagcatc gtaatataat catagcataa gaggaaacta gttaataagg cgctgggcct
    73441 atttagacag tatcaacatc aagcgagaag tttcattatt cctcgagtaa aacgatagtg
    73501 aatcgttact tattattgct agggactgga acagccaccc ggtggtcgat aaaagcttcc
    73561 actgtcgcaa acatccaatc acaatcagac attaagcata gccttactac acagtctgca
    73621 ccatatatac ttttgggtag ctcgatgagt cgttcaaggt tgtatattct gtgaagctgt
    73681 ttagagatag cgcttccaag gtacgctaac taacaagtaa aagaccacaa cctggttgtc
    73741 ccttgttccc caggttgttc agttcaatgc acacctgatg ccaattgtac tttggtcgag
    73801 cggtattata cttcaacatc ttagactcaa tatatatagc cgctatataa cgtttttctg
    73861 gaggtctgtt ccaaatctag taccacattc ttcttatagt tatcatcctt taacggatac
    73921 ttcgatagac gataactgca tcagcaagac gagttgatga caatgggatc attctggtca
    73981 gatgcagagc ttgtcaccac ggtctacttt tgctcgcgtg ggttcaccga cggtgctgtg
    74041 tcccggatac tcggtattcg aggatattac cgtacacccc gtgcgattcg ccgcaagata
    74101 gccgatacgt taaaacactt ctccagtcta caactagcaa atggtagttg ggatatagac
    74161 gaagtggata tgtggctgga tagcctcagc ctggatcacg aaactgtaaa tcaccttatt
    74221 gcttgcaatc gcattgatgc gtatattgcc gacgaggttc gtgatacttc aatggcagaa
    74281 attatgacat actaatagtc ctatagcatg ggattctggc ttttgtcttg cagaatttaa
    74341 catctaagag ccagcgctgg ggctgggttg tttctccatg agctactgag ggatacatac
    74401 tgaaacaaaa gatgtactat acagcgtaga tagcctgtca actatgtaag gatgcatcag
    74461 gtggaagaga ggaaaacgtc tatcattgac tctagtggaa ctaaatactg ctgaactgat
    74521 tctcctctct tttctggctg cctaaggtaa cttatagctc tccatggtcc tggcaggata
    74581 ccaggagtac gatagagcgg atcggtcatg caaaatacct cgtcaggccg gcttgagact
    74641 ggcggatgcg cgtccataga gatatggaca taatatcaga ctatataggt gcgttaacaa
    74701 ggaatgcaca tgccaagata gtacataatc aagctaccca gtggcaagtt gacataaacg
    74761 gaccattgcc atatggatct gtctgtgaat gcactgccaa taaagatacc caccgcagga
    74821 gcgaacgaaa ggatagccaa catgattcca atacacgaaa gaaagtaatc aagcggaata
    74881 atctttccaa ttaattcaaa tccgccagta caaatgcctg ccgccccagc tccggcaatt
    74941 gcccgaccaa acatcattgt catagagttc ggcgcggtcg tataaacgac ggatcccagt
    75001 tcaaagaggt aaatagccaa aagatagaca atcttgattg aaaaaagact gtgaaggtgg
    75061 ctgtatagaa tctggaagac accgatcata ggtacgaaag tgactgtcca caagtcgata
    75121 taacggttgt cagttgccag tgttcgggcc actgtcccaa caattgtttg gtcctttaga
    75181 gaaataatat taatattggg aatctccgct tgccaggaaa agcactctta ctatgttggc
    75241 taggaatagg gcaaggaata acgccgccac gaccacctgg aggcgatgat tgtcttggag
    75301 tgagggaagt tgcgcgctca tggttcaaag ggtgtcgtac agaaattgac taaggctgaa
    75361 aggtaaagaa gcaggcaaat atgaaagtaa acactctatt tattagagac cgattgggct
    75421 tacttcatgt ttcaacatct gcttttacta ccaatggtgg aactcatctt tatagtaatt
    75481 ttctattgcg tcttcaggag cgttacgtag cttctttcat tgtcctgtac cagatagtct
    75541 tggaattcag aacggtttag cgtacaacgc gtagtacact agtaacaaat agagcttagc
    75601 gtattcctat ttaaggaaag atattctgcg tcgaaaatgc cgctataacg acccgtttct
    75661 ggaatgcggc atgccaacct ggcagtagaa tatctggcag aaaataaaaa aaaaaaaaaa
    75721 aaataggaaa tttaagaaag taaaatagaa tagagaacag tagatatagt ggctttccag
    75781 ttagtttatc ctaacaatta tatagcagca aatcccaacc gtagcctcca gttgtggatc
    75841 acggggtagg taaactttcg aaatgagctg gttctggtct gatttgcctt ggaagatagt
    75901 catgaattag ttaaccgcgg tacatatcct acaatagaga ttcactcgca aaattggtat
    75961 acaacagagc gctaatagtg caatataact atcttgctgc ctcttatcgc ttactgttgc
    76021 atcattgcat ggttgtttgg cttggcgggt atcattatta tatcaagtac tctgtggata
    76081 ccactgtaat agatttattg ttttactatc tgccttacag ttctctgtgc ttagatggtt
    76141 atatgacagg actattataa tctctatata gttgttcacc aagtattgcg gatattgtgt
    76201 ggacttataa aaaggtcact tgttcaggtt ctgcagaatc acacctcatc ttgcgatggc
    76261 ttacttgccc aatgctgatc gggtctatct atcttatgtg ctgcggctca accttttgta
    76321 acattagctg cgctatgtat tctgtatctt caacgctaat attggcggta cacagtaata
    76381 aaaaataact tgctcataca taggctgtca taaagaaccc atgagaatga tataaaagag
    76441 caacacctcc tctagatcct cccctgtcgt aggatcgtct ttgggaagcc tggcagatat
    76501 tctagtttat atctaccgca tcatgttgcc tttccttgtg ccactagtaa ctcttcttat
    76561 ctggagggta tctccggtgc tgaggcaagt taaatcaaca gtgcaatcac tcttaggata
    76621 ctaactaaaa tagctgtgct ttgccaacat ccgatgttag accacaaggt agcgcagcct
    76681 ccgccgagaa taatcccaca tctacgcttg atgctggaaa taatatactg gaaccaactg
    76741 ttaaggtgtc ggttacgaag actgatgatc aacatgtgcc ccccccgggg cagacatact
    76801 ctctgtctga acgaccttcc accttggatg tccccgcttt gcctttgtct tctacgctaa
    76861 ccttactccc ctctccatcc atgccgccac cttcgcagac atataataat ttcgtcacca
    76921 atgcgacggc cgacgctatt tttactgatt ccacagccac tatacgctta ttcattgtcg
    76981 acgttggggc tgaaaagggc gggattgata cggaacaatc gctctttcgc ccacagttca
    77041 tcaatgcagc acccggtgac atggtcctgt ttcggtttta tggggcgtac gcactttaca
    77101 gctctgactt ccaagatccc tgccatgcac cacgcctaag ccaaaatgcc gttccaacaa
    77161 gagataagat tccatcccac caggtttcgg tccagtctac aaagccactt tggttctcgg
    77221 ccagcttaat cgacaagcca catttgtgta ataatgagac tgtttttgcg gttaatccgg
    77281 gcaatcagaa ggaagacttc ttggccaatg cgtccatgat ctgataaact agtctacaca
    77341 ttttttaaaa ttcatggggc caaagaataa caatcatgtt atcctgcgag gatatagagt
    77401 attctgctgt gtttggaagc tttattatta ttgacaggac tctgctacaa aataagcctt
    77461 gatatagaca gatatacttc ctatcaataa tatattcgcc ctgtttagtg ctggtagtag
    77521 atagggacag tgaaaatctc attaatccat tcatttacta taaagatgac gaggcatttg
    77581 actaccgtag agttatactt acccccgacg tttaccgcgc tttgttgaac ttactcacct
    77641 taacatccag agcacttcgc tataaagata ttactaaact atatacttct atattattac
    77701 atcgtgcagc ctagtatact gacagctgat aatataaaag cgggagaaga gcttgataag
    77761 attgcctatc taataagtaa ttattaaagt gctatttaat tggaattcta agtataagtt
    77821 aaaaaaatat aagaatacta gcgcggtgcg tatacagaaa gaagagaaac aacaactaga
    77881 tactctaaat atagatggag ctccactaac catgaaataa atataaccag attctagttg
    77941 cagtatattg atgctcggta aagataaaag ggatgaaaat gttgaatgtc catcactcac
    78001 cgaggcagaa gctcttgaca tacaaaagac aaagaggtgc aatgacgatg gtcaactaag
    78061 gtgcatgtaa tgcgcagtcc atcaaaacac acgtttaaca aacttccact ataggcccag
    78121 tgaaagtgcc ctttgcatgg gtaatgtagt acaggatgcc gaagagaatc gtccctccag
    78181 taggtgcgat agcccaattc attgacgacg cgttgacatg tacatctgaa ggccaaaagc
    78241 tgaatataac agcaatggtc aggtaacaaa ccgtgaaagc gttggttgcg ataccccatt
    78301 tccgtggaat gtgaaagggc ccccaagaaa ggggagcgcc agttgtgtta actaccagca
    78361 ttgtgtcgcc acaatgtcga attccgcctg taaggcggtg gtaaagcagc agcccagcag
    78421 ctatgagata ggaagagaac agagagctaa cggtcaatga caccacagca ttaagaacag
    78481 cttcagacca caggattatt aaagataata agagcgcagc gacgacaata gctgtgatgg
    78541 aataaaaagg aattctccta gagttcacct gaacctttat tataagtact gaatactcat
    78601 acgtcacgtt tgaagctgca gatactaacc ttgctgagta gtatccacca aggagtacca
    78661 cggtctcgag agaaggacca taccatccgt gaggctgcgg ccagattccc tgatgcagta
    78721 gcaacccctg agataggcac aatagaagcc atggcgatgc tgcccgggat tgaccctgtc
    78781 gcatttagaa atatctggat atatggatat cctgtagggg agttgaggac atgatcgaca
    78841 tcctgcagat tgaacagggt aaccaagagt atgccaaagc ccagtgatcc attcaagaca
    78901 atactcatca tgatggaccg cggtatgatc accgtggcat ttctggtctc ctcggtcatc
    78961 tgcaggaagt gccatccagc atcagctcca aagtctgcac ggagaggatg aaagcattag
    79021 ctactcacat gaatagcagc gtcacaccct gtgaaagcaa aattactgcc cagcatccca
    79081 acaaagagag ataatccaag actcggccaa ccgccctcgt tattgaagct cccaaatact
    79141 tcattggcgg atacatggtc gcctagatat gagagtggta ttaggatgac gaaaaaccca
    79201 gcaatgtgca agatgaggac aaatccctca aatttaggca gaagactccc tgttccaaca
    79261 ttgataaaca tcgcaaaagc aacgtaagcc cagtaaagaa gcattacctg gtagggttga
    79321 ggctggaaag ccgtatgtgt tatagtaaca aaccccatga tctgagagct tgccatatac
    79381 acacctgaag caaacgctcc tagccaaccc aagattacca gccacgctac cgattaaatg
    79441 agtgtctttg caaagcagtc gtaaagatat acaagcaacc ggcattgtgt tgatttgctc
    79501 acctgtaata aagctaagga acttatgaca ccatcgtggc gctaaaattg cgacccaatg
    79561 atactgaccg ccagaggtcg gtgccctgta catccattag gcctcagata gctgacacaa
    79621 atagaagggt agcctacata gacaccagct cggatagtgt agcaagggtg cacagcgtgc
    79681 tgaaccacac aaagaggtag gtataaaccg cacctgccga tcccccacta aacaatatat
    79741 tagaatgact accacaaaat tcttgctcga cggagagtag cacttcttca atggaaggac
    79801 aaatgtcctt acagggtcag tagactttta tgcatgaatg tgggagaata tatttacgag
    79861 agaacacctt cccaagttgc caggacagta caactgaatc ccaagattga caggaatcca
    79921 aatctccgct aactccatca tcagtgactc ctatatctct agtaaatcaa tctcacatgt
    79981 tctgagcctc gtacctgtaa actaggcaac ttgccaacac gtgctaagtc tcgattgtca
    80041 ttcacgtgat gcgaatgtgc atgttgtccc aattctggaa gcggtatccg atcttcgcat
    80101 tcatattgct gtttatccat tgtagctgta tgtgtctaac ggcaacacaa gttctatgat
    80161 cgtatatacc agggggattg acgaaagcga gtttgtttcg aagaggagga agataccagg
    80221 agcggtccga ctataagcta tttcttaaca agaaacacag gatgtaaagt gataaaggtt
    80281 gcttgtttcg tccttgcctc tagtaatgac gcaggataga agcgatctac ccagttaaag
    80341 tttgtggaat agtatgtgta tgaagatctt tttgaacgga atattttcga tacaaatatt
    80401 acaggtaagg agtattatta ccatcatcat tcttgaccca ctgagatatt tagaaaatgg
    80461 tttactctgg agacagtgcc tttgtggcgc tccaggccca ccagctctgg ttaatcgtaa
    80521 gaaccacgag gtagggagcg acaaatattg tgccgatccc tgtggatgtg tttgtctgta
    80581 atacaagttt tgccagccgc ctagaaaata tgttcggtgg tgatactttt gccacagcgg
    80641 gtaatagttc cacctatcta cctcggccga gtcggctctc agtaattctc aaacttgaga
    80701 tctacgtccc tggtggcgct ctctcatgag cctcttacta tttccggcga tcattgagtc
    80761 actgactcat gtcccgtgtc gaaagtctaa gtaaggaatt ctccacactg tcgatcaatt
    80821 cttgacctga atgggcagaa aaaaaaaagt catcgaaaaa cataacggtt tcacacaaag
    80881 gctatcttaa gtaatttcct attgaatgtg gttagctttc agaacgccac agtactcaca
    80941 gcacaagagt tccagattcg atgccaagca attatctaac tccactaact tcgcgtaaga
    81001 taagatagta tagtgtgggg tttgagcgag tagcttttta aattatagta ccctggtttg
    81061 cttcttgaac ttaaactacg gaaatagatc gcgatcaaat aagatcctag caatggcatg
    81121 aaacatcgaa taggttgcgc catacttatg tttaaatatc ctggtgaata gtatctaaat
    81181 aatggtggct tccttagaat aaatttcaca caccttgata gctcatggta gtactatatg
    81241 ctacctttat agagtgttga gactgtgtgt aagatattaa attatcaatt ctgtttacca
    81301 gctctcatat tctattatat tctattttcc tccgtcgcca ctcgtatcac aatgatactt
    81361 ctcacaagtg acaacaaagg gccgatcctt acaattatag catctatttt gttaatattt
    81421 gagaccatag cagtcttgtc acgtgtaggg gtgaagtact gggtaatacg ccgcgtggct
    81481 atggatgatt ggatgattat tgctgccctg gtaagtgtac acttatggaa gctttcccag
    81541 tggacctaat agatatattt ggattttttc aggtatttag tattgcacac acaacgagta
    81601 tagcaattgc agcagacaat ggctatggaa atcaaagctt gcttgcgtct cgactcccgt
    81661 tgattaaaaa ggtatggggt ccaccacccc ttgctgaaac tatgatactg gttgggcatc
    81721 ggaacggatt tattgactgg cagtcaaaca ggctatctat attgcgaatc taaccatgat
    81781 tggtacatta tacttttcaa aaatgagcac agctatcttt atactacttc tacgcggttt
    81841 caacttcaga agtggatttc ctttcctcgc agttattaca atctgggctt tctcatccct
    81901 tcttgtttca gcattccaat gtggcattcc gcatccctgg gaccttgctt ctaacaagtg
    81961 tattaatatg gtatgtacgc aggcgatcga aaaattcgag ctgggctgac tcttctatcc
    82021 agcgggtatg gcaaaactat tttacctcga tgaacatagt tacagaagtg gctcttatcc
    82081 tttggcctac gtacatggtg tgtcgaattc aaatgcggct acaaaaaaaa gctattgtga
    82141 ttgggtgctt tacactaagg gctacgtatg tctactctag gctctctata tccttattgg
    82201 tacaaagctg ccatgctcac tgattattta ggataatact ctcagcgatc ttggaggcaa
    82261 tctatcgtaa taagacagtt aagggcgtcc aaagcattat tcttgatccc tttccggtca
    82321 gtgtctgcac tgaggtgcta ctatttacta ctattattgc gccctgtgta ccacatctta
    82381 agtcggtgat ggagagccta caatccggag ggttcaggct ttatcaatgt ccccggaaac
    82441 aaagtgggca atccgatgaa attggactta ttaatgcgtg actaacataa ctatgtttca
    82501 ctccctctgt tgctttgtgt tctatgggcc atgtattcta agtattcaca aattccatga
    82561 ctcaatcaaa taaaatctgt agtagggcta agaaggagta aaatatcgcc tttcattcca
    82621 gtagttcttg acttatatga acttgtatta gacgggtttc tcgaaatgta ctagccagcc
    82681 aggttcccga agccattcct ttgcaccaga gtcgggagga atatgaaggg atttaggtaa
    82741 aatatccaga aatataatat gaagggaaag aagcatagct acttagtcaa attttaagaa
    82801 tgacctaaac tatggctcta gttgccttat tatataacaa gatatagtag ctttaaagat
    82861 caacaatcag tttgtctatc ttaatagtat ctactcccct caatatccta tctctacaca
    82921 taactaccta gtcgatgggt tttctacgct gaacagtaga tatctgtgtc atcatctcct
    82981 tccatgaatt tcgccatctg gatacaaaat agcaggacct aagacgggcg gtgatactct
    83041 tggcacagtg gttctaacag ttccacatgc accctaccaa agtaaataca ttttgctgag
    83101 ctacgattca taaagaaatg attagacttt ttgttatgga gtaagtctaa acagcaatcc
    83161 ggcgacggga ccgcttagtg gctggaagat gctgcgtgcg gggttaatta gagttgcgtt
    83221 tatctgaggc aaagtggggt attatccctt tctagaatag cgcctaaacc aagtcacttt
    83281 ctgtttatta agaaccaagg gtcgatagta gatctatcga tagattatgg agagattagt
    83341 agcagtataa tattctataa taggaatagc gtatcaccag tactatgtac atagtagtgt
    83401 cacattaggc ctcaactgct tcgaataact ggggtcaata ggcaatgtat atcatcaaca
    83461 gcgctgcatc tgcacccctc ctggctatat agattgacgt ctgattctgt gaaacatttg
    83521 ttccactttc ttcaaaacta tatgttattg gctatttgag caggaatcag cttacttatt
    83581 actaagttgg taggtttggt cgagttatac atgtcactga ccatgcagta ggtattatac
    83641 ttgtatatct tatcgaatat cattctgact agggatatag taatctttct acgagaaaag
    83701 atttagcgct agcctttcat acaaccaaag ctatgaaaat tgttttaata aacatccaac
    83761 tactaagacc gtagcattga ggcagcggaa aactgtgaga acatattttg acgagtccag
    83821 ttatggatca gagactcttg ccacggaaag ctgggcggaa tgccatcaac ctgttggagc
    83881 gttggatgat ctcctctctt cccatctgcc aaccaagctc ttccgccttt tcccagtgta
    83941 tacctaccat cgatgctacc ggggaccata tctgaagtcg gaaactgtca atatgtatta
    84001 gtaatctatc actgtctgcc agaccatgat ccttggacct acttctgata ccaataagcc
    84061 actccattat agatttcttc gtgctcgttt tggggagatt cgaagagggg taacggtgta
    84121 agtcgtacta tagcatttcg ccgtgatgga gtggcttgtg cagccgagtc ctctcgtggt
    84181 cggggcttat aagaagcaac ttggccatac aaaagctgag cgccttcaat catattggtg
    84241 tcagatgggg tttcactgaa tgtcagcttt tgtagaggta actcgtaact gttgactgtc
    84301 gttgtgcttc tttgcttagg gccgttaccc tcttgtgtta tttgaggtga tgatggttca
    84361 ctcaaggtca tcgaagagat ggatccaatg tctcctgtct ccactgggag tgtcttaggt
    84421 gtcgacggtt gtggaggaag cgatgttccc tccatcacac ctggtacagc ttgtgccgtt
    84481 gaatcgttaa gtgagaaata aactattcta tattggcgct ggtaaagata ataattatta
    84541 atagagacta ttattggaga gatattggat aggattttat agatctctac agaaatcaag
    84601 acctaagtta atcaggcgag aactgtacca gattatttaa gttgtgttaa acttaaatct
    84661 gcttagtgta tcaccggtga tattttttgg ttgtcaattt gtcataacct atgaggtaag
    84721 gtttaagatt aactaaacat aatttggaaa gacttatgac caaaggtaat atagagatat
    84781 acttctacaa tagcaccaat actggattct gtgtagcatc cctatactaa tgtaaagtgg
    84841 gattagagaa ccagtaaaga acactctatc aaaaagtctt agccgcttct agaatctcca
    84901 tcttttgaga gtttactata ataccaactg ttttataacc atagatcttt aggctatagc
    84961 ccccagcggt aatttatctt aagaactttc ggctatgtaa tagcaataca gaatttgtcg
    85021 aattgatggg tgtgtattat tatccggaga tatactaaac tataatagta accaatatca
    85081 acagcacagt atagtctgac aaggattctt ctagtataga taatatgtac agtagtaact
    85141 ggtaaatttt gtgattaata atatagattt agagaataat ggatctgatg gtagatcatg
    85201 gattcacagt cgatccaaaa ccatatataa gaaaaagctt aattcagtgg gtcgacgaac
    85261 tctaccgata tatgacgaat agggagtata acttaaaagt tacaagatta ccgaagacta
    85321 atactgtaat actcttgaaa gactgaatac cctgcggtaa aaggttctgc cgctggtcaa
    85381 cagttggagt gacgtatcca caaatgacga tagtcttgtt ctagaagatt ctttaacagt
    85441 tattgtaaag tttaatagcc aaagttgtcc aaaacagtta taaattcaac tctagtctcc
    85501 actacataca atgtgccgtt tattgcgcta tcccaaaaga aaaggaaaaa aggaaaataa
    85561 caagagcaat tatttatcag aaatctagcc tatactattg tcataggaga tagctaaaga
    85621 tagtgatata ctattatcaa tttatcaatc attcttcacg agaacctaat actccgggca
    85681 acttcttatg ctgaaggcct aataaaagat tttccacaac ataaggccct gaagcgatca
    85741 agagagacat tagagggaag gtgcacttga tctacacgtc ttaacccttc gcctatctgg
    85801 ctccccaggc ttgcaacgta cattgcgttt cccgacccat agttttcaca caatgagcca
    85861 tggagccatc acttcggtac ctatatgtgc tttttggtac aacagcctgt tggtcaaatg
    85921 agtattccaa atcatgcttc cccggtcgat ccacgcctgt aaaactagtg tctgggcact
    85981 ccacacactg cttctttctt gatcgtcaca cagtccttac atcgtatcaa taaatcctac
    86041 cgctgggtgt ataaaagcaa gtctcgttct aaaaagggac tagctcaggg gaaaggatca
    86101 ggacgccgac tttgtaacta agtatatcca ctactgtctg ataggagaac aactagggcg
    86161 tgtgcagacc cgtgagtgtc tgaccatgtc tgatcgtcag taaacccctg agaggcacac
    86221 caaatggaac catggaacct ctaccactca gcattggagg caagtgaggc cctaggcaca
    86281 aaacacaggc gtatagatta tagtgaatga ggctggatat atatccaact ccgcgcgcct
    86341 cccttatcac atcgctggcg catctttagc agtctgcgac atatgacact cggaaatcca
    86401 ctggatataa atggataaac atggcagtct ataatatcca aactactaat gtgagaggga
    86461 gcttctcaca ggaccctcca tctctcggga aactgcgctt ccaatgccgt ctttggactg
    86521 cggaacatat caactgcatc tcggagatgg agtcgatatt tgaacagaac aggtattggc
    86581 aaattgcggt acgttggttg gcacttggat aacctgccca gttgctgatt gatcttgcag
    86641 aaaccattgg tagccgaatt gtgctcccag tggaccagag actgtgagaa tactagctgc
    86701 actatagagg tattggtatg cctatcattc ctacattatt taggtccaag ccatcgaaga
    86761 caaagtcttc agacaggagg attgacgcct agcttattat tcgcttacca aaactctagg
    86821 taaactatct ccgcgatatg tatagggcat tccagcctga ctttgctctc ttccccgagc
    86881 ctatcaaccc ccttgaatgg gttcacgtca tcgacaacca tatcagggaa tctttccctg
    86941 gggaagtgct gttccgtgga gtcaagcgac tgagggacca gttcgacgat ggagctgaac
    87001 tgagatccac gcgacaaaag tgtcttcaag aaagcagtca aaggcaattt aggtcgctac
    87061 tggatatgcg aaacgaagcc tgtccgaaca ccgtgaataa ccactctggc ggagtagagc
    87121 aatcacgcca gataagcgcc actgaggccg gcgagaacgg agccgcccaa gaaggcaata
    87181 tgcatacatc cacaggcaat actacacaag gcgagccgcc ccaacagagt ggagcagcag
    87241 aagaagacaa tatgcattca tccacagaca acactacacc acgcgagcca tccccaggaa
    87301 acggtcagac tgaagaggat actgaagatg acagcgtgta ttcatccaca ggcaacacta
    87361 caccaggcga gctatcccca gaaatcgaag gcaatagagc aaccgaagat gatagtatac
    87421 atacatccac agacaacact gcaccacgcg agccatcccc aggaaacggt cagactgagg
    87481 aggatacacc aactgaagat gacagcgtgt attcatccac aggcaacact gcaccacgcg
    87541 agccatcccc aggaaacggt cagactgagg aggatactga agatgacagc gtgtattcat
    87601 ccacaggcaa caatacacca ctcgagttgt tcccagaaat ccatccaata gacgggctta
    87661 ctactgctgc tggagcagac tttgaccgcc tctttcaaga gttggatgcc ggcaccagtg
    87721 atcaggggcc agacttcggg ccacagccaa atctgggcgg catgatgtca actatgactg
    87781 atgccgaagc ctcgaccagg tcaagtgtat ctaacactgg taacgtggcc agctttaggg
    87841 acctcatgga tatgctgcag gatcaatata accctggatt tccccaatgg ccagccgctc
    87901 caatgagatc ggaccttggg ctgaatagaa accagacact ctcaactcag tcttccttgc
    87961 acatagccga ttctgatatg atagcaaaca gtcggcccat agagaatctt gatcaggtca
    88021 ttgctgactt tctggtgact gagtctatcc cgagaccaga agacccgacc agcaatataa
    88081 atatgactga ggaagaaacc aacaatatga acaactgtat aagcttacaa gacacccttg
    88141 tacagcaatg gccagacaaa aactatattc tgttttacgg caccttatta acacgtacca
    88201 acgtggagca ggtcctatat gagttacaga actcaccatc actttcagtc tttacagtgg
    88261 atgtacttgg tgaccgtctt tcctaccatc atcgtccgct ggagctacat attgccgatg
    88321 ctacttggtt tgactgtctg catcgtggta tacttcggct aacaccaata ccgcagactc
    88381 tactgctgcc tacccgtata aacaattact ggtcattgat tgaaatccat gtctactcgg
    88441 gggcagtgat tcactattta tttcttgaga acaggtcaga agtacaagac agtagttact
    88501 ttcctcatca ccctgcctgt cattcctgcc aagcggcaat caaagcattg tcccattacc
    88561 ttgaagatat tggccagcca tgcccggaat ggcaggtgga aagcacgcta ctcagctcta
    88621 taccgggcga cgacggcata ggtcttatct ggacaatgac gcagcgtgcc gatggccaag
    88681 atgtccaaaa cggaccacct gagacttttc gggcacatct cgcccatgat attgtgatgg
    88741 aggcgctcca gacagcgact gatgcacctt cgccgccgcc cccccagccg ccgccggggt
    88801 tatcgccaaa ttcatcatca tcgttgtcat tatcgtcccc agtaccagcc agcggacagc
    88861 agaccaactc attggagaag gcacattgcc ggtggtctaa cgtcgtgatt cgcagtggtg
    88921 accctatcaa tttaactggt ttatgggacc gagtatccca gatgtccctg gattctaata
    88981 catctatcgg ccccaggctg gccgatcggc tattacagct agcactcacc attgcctctc
    89041 cacccattct agtggaagtg aagcgccagc tagaacatct acgccgggaa caaagtaatg
    89101 ccactcggcg ctttcagcgc agtgctgctg gagttttcgc agctggtatc tggcataaaa
    89161 acaatgagca aacctcccgt attggtcttg tattgactta ttggtatgtt cacaactacc
    89221 gccaggagca ggggaactcc agtgatccaa ttgcccaact ggccaccgat atatataatc
    89281 accttccaga taccgcccgc gactacagcg aggtcgagga gaaagtaaga gactggtgca
    89341 aacgcgcatg gccttggaat caactagtac gcattgctgg ctcaccaaat gtgctctgct
    89401 ttctacctca aggcataacc tactttcccg gtgaagatgc accgtctatg accgaatacc
    89461 ggtgtatcaa aaagcactgc ttcaaagcta tagagatgat acttcgagag tgtcggccgc
    89521 agttactaaa gttcatccct cagaacttct ttgaaatctt tctctataat cagcttccag
    89581 agactcaata cgcaattgag cagtggacag aggaggaaat tctagcagaa ccgctagact
    89641 cggacaaatt tgatcacgcg ttcgatccag ttttagatac aaacatagac aacaattaaa
    89701 agggactgct atatagtcca cccgtttggt acatattgtt tataaattta tttcttacca
    89761 ttgtttccca atgtaaataa agcggtagct atgtcgccta taattagtac tacgattaac
    89821 gtcgagttgc ctagtacaac catggagcgt ctttactatt aattaacctc tgacctccca
    89881 acccactaca atatagtttt aagacaaggt cacaaggaaa agcttattag atcatatagc
    89941 gttacataat taatatctaa ctatacacca tagtatacag aaaatcttaa aacctagtct
    90001 agactgcggt atatcctctt cattatatac taggccatat actatatcct caatgaggat
    90061 acccatagat attgaggatg ttgccgcagt ctaaatatat agcacctcta ttccttgtaa
    90121 aaagccgtat gtggatctgt atagattaaa aagcatttta taagagctta tgtagctgag
    90181 ggcctgaacc ttgctgaggt aactcctaag gtctctcgca gtgttgtgag cagagcaact
    90241 taacgtgcaa tgagagcggc ttttggcacc ccactaacga tatcaataga tcacccaagt
    90301 ttacaatatt gtataatact ctatccaatg gagtaggtag tataaaggtc atagatttag
    90361 tagaatgcaa ctcagcagta gacattataa aatcaatagt ataaataaag atactaatcc
    90421 tgtaccagat taagtaaact atttattcca gttcctacta gagcttaaaa caagattctt
    90481 gattctacag ctgcttcttc tctataagta atggactgga atgcttacat ggaatgttcg
    90541 tttactagat atattaatta caaccgatgt ctgagtgcat aaatagtcta actggatcat
    90601 aggtggtttt cttcttattc aatcctctct tgttgatagg tttgccctgt tccaattagt
    90661 tatataaatt atcccatcgt gacccccatc accacgatat acggtactcg caacaatgtc
    90721 cccatccaat acgcctcaat actcggatgc cacgaaagag acacttgaat atcttccgac
    90781 aatttttacg cacgagggtt attatgaaat agctcaattc ttgatgacgg ccctatcggc
    90841 gtccgatgtc agctcattgc ttgtagcgct tcaaattcaa tcctcgacct cgctttacca
    90901 gcgttatcgt cgtttccttc atccattacg ggatatagat ccctcaatgc gggcctttga
    90961 tccttggata cgtgacaagt gccagatcct cctcctgggc cctgattgca gattattgat
    91021 gcaacgtatc atggacccag aagcatacta cacagaaagg agctgcgacc gtgatcgatt
    91081 ggagatatgg gtcatagcaa taccgcccaa gtcgcaaaca attaccaagc gagcctcaag
    91141 gttggttcgc gtctgtcaca gggcgcaaaa ctatgcaaga cgtcaaagag cctattgcaa
    91201 gcttggtaag atcatcgatc aaggacttat tcttaaacag tatgtcgatg atcaggacct
    91261 agtaccgtgc aatggcccca ttactacatg cgagaatata cgtggggaaa gtgtcgatgt
    91321 taaggtattt gatttgttaa tgtcggtttc gagcgcgtgt gtagagaaga tgtttgttgt
    91381 tgggcttgac tacgcaggat tggagtttcg cttggagtgg gatataaggg gggataaatc
    91441 aaccagaaac tggacagcag cagatggtct tccatgtata aacgctgcca atccatacaa
    91501 ccttgagact ggaacgacta tgtattcgga tgagcgccca aatgaaggaa cacttgcctt
    91561 cttttctttc gcaccttatt gtcgacaacc tatcctgtct attcccatca cgcaggttcc
    91621 aagaagacca taggttgtaa ggtcgtgcga ggatagactt cataggctgc gctagagcac
    91681 gatctaatat atacagaact aaaagactac agtaaagttt ttggatttat agggagggaa
    91741 ttaaacacgt gaaaaaacgc agctagagta tttactatgt ttttctgttg tacctttctt
    91801 aaaagaatat caatactcca aatgcgtatg ttaacttggg catccttgta ttacagtagg
    91861 caattacttt tatcctctgc ttgacaaggt atcaacgcta ataaatattg aataaggcgg
    91921 gaatccctgt gaaatccagg ccatcttact tcggaaagcc ctcgaaattg atttaactct
    91981 cgttgaatta tttgttttgc tctaaggagt agcggtgtaa agaggtccag cagcaatgaa
    92041 cggtttttgg ctgacaggaa aacgtgttcg agtgatcctt gcactgcagg ctgcgttctg
    92101 ccgggccttg taactactgt tctggcgagt gtttggaaga gcagctggtc gtgagcggaa
    92161 agatcgtctt agtgggccca ccgtgctccg agtacttcgg tcattgaggg gtgactcaga
    92221 tattcggcca tgcaaaacga attacggaac gggaactacc aatcgaaaca cagctgtctg
    92281 gccgctggcc agacagctgt gtttcgattg gtagttccat tttctcgtgt gcgacatttc
    92341 cttcccccgc tcactcgtac gcccttctac taaaatatat ctgtggggac ccatctcgcg
    92401 gtccaaaggt caaggagact cgctatggca ccgcaagaaa ctgaagttat atctgccttg
    92461 aacttgctct gcaatactcc cggtgacatt ctcaatgctc atcgtcatct agcacttcag
    92521 actttggttc aaattggacg cttgctcaat actagccgga atgaaaatga gcacctttta
    92581 catggcattg atgtggaaca cggtaatgga tcttcggaaa atgccgtcat tcctaagacc
    92641 gtgatccctc agacagatgc ttcttcggaa attatagact tacctgttca tgcaaaagat
    92701 tctatcaact tacccgtcac cgtatcaggc tcagaacccg ctgtattgtc gaagacaaac
    92761 tcttcggaga acacaacgaa aaagcgaaag cgagagacca tccgagaatc tccttttgcc
    92821 aagctcacca gattggtagc gaagcgactc cctaatatta tacaattttg cgagtccaaa
    92881 gcttcacttt ctgacatcct ccaaaacgag caagagctac agttcgcaga taaaagagtt
    92941 gatcatttga aacaagttga cggcaataaa acaccaagcg aagagcagaa gcttctgaaa
    93001 ggtctcagtc aattatctct ggctgaacaa ttcactgcct gggagattga gaatggttgg
    93061 aagtctaggg tggacaccct atatgacgag atccgagttg ctaggaccga aggccaaaac
    93121 ggaactgtta gtgccagatg tgccggaaaa atgactcgat tcgtcaggga acatggatat
    93181 cctgaatcag atcataacgt tgtccggaag ggaatccaaa gagggatcac tcagattcta
    93241 ttcttgaggt caatggagga agtctccacc acgcctatac aaaaaagagc cacccgggga
    93301 atacttgctc tggtaacaat ttttgaagcc gcttcgttcc aaactatctc gaatctggaa
    93361 ctacaagcac tgggagaagc cttacttaaa ggcaacgaag gcgataaaac cctcatgttg
    93421 gtgcatgatg tttcgaagtg gtttgaaaac atgaccggag attttaaaat gatctcgcaa
    93481 acaacaaaac ggggacgacg agatccgcta cagactacgc atgccccttc tcatgttccc
    93541 agcataaact ctcatgaact cacgaccttc tctacccttc cacgagtcga atcgaacagc
    93601 cagggaatgc cattacatcc ttcactcatt gagttccagg ctagacctgg cggggctggc
    93661 atgttgccaa acgcagggtc acacgatttg gctcaattct ctagaaatac aactaatgct
    93721 aattgcgtct tgactggaaa ccccaatcca tacagtgagt cacacgagct cagtctattt
    93781 tccaggggtc cttccagtgt ttcagctcaa tcacaattgc ctcgtcaacc tctgtgttct
    93841 tcattcccaa gtgatgtttc taggccgtct caaaccttcc gacaaagtcc taccccacat
    93901 gagggttctt ccatccccac tattcccgca taataattcg tacaatctgt ccgctagagc
    93961 aagatgaaaa gtaggcgcaa ctttggttcg atctttactt cttggtttac cttcatatat
    94021 agtcgctttc cttcttggag gggctttccc gaggcgctgg ggctattgcc aagtatctcg
    94081 attggaatga taaacgcatc gcctttgctg tggtggaatg gcgcatattt cggccccggt
    94141 atctgtacca atgaataccc ctgtctcttg ttagtcgccc gttctgagtt aaatggatac
    94201 tatatacctt gtcaagaagg ttgagtgacc ttaagaaggg aactatcttg gtgtctaact
    94261 cttttgaatt gtgaatttga aaatcatccg cttttttctc gaacggaact gaagatgccc
    94321 attctgcgaa gatctttcgt tccgtgttcg cactttcggg taagtcgtcc tcaaacaaat
    94381 gtggcctgtt cgatgttatc tgcgacatca ttaaggccgt gttcccgttg aagttagtga
    94441 gttatttgct tcaaggtgga aggagagttg ggtaatgagg ggttaaaatg attgtatggc
    94501 ggggtacgga gaggctcctg agcgaccttc acacgtgatt gaagattacg agacccttgg
    94561 gcaccaattc agaaatatac ctgacacaag ctgatttcga caagcaatcg gatttcctta
    94621 gctctcgaaa catttctaag ccagggcccg tgttcgctta acccaaatcg ggcgcctttg
    94681 cccgtaattc tccacgtctg ctgtgttgtc cggaaattac atgttccaat ctcctgccca
    94741 cccatagtga gaacagtgaa gtcgttatta atggcttctt cacacagcca gccaattagc
    94801 agtaaactgt tacacatcct tataatcgcg tgtgatgggt ttaggcttta tgctgcacaa
    94861 ctacaacatt ttagtcttag aggaacaggg atgcagtata ggagaaaatg gaggttgcgg
    94921 aaagcagcac gcgcagttct actgtgggtc caaactacaa ctcgtgaata agtttggcat
    94981 gctgaagcaa ccgtatgcgc tacatactgt gcaatatctc ctgcttcatc ctgacaggaa
    95041 acaagtgaaa agggtatagt ttatatgcaa gagatgtggc gcttccaata ggtacgagat
    95101 aaaacacttt gggttgactt gcagggtcgc tttctgggac ttggcaagca tttcgccatt
    95161 agttacacaa agatcaaaac atggttggtt tagagcccta cttctcttgg aaggttatcc
    95221 atctgtataa gcatgaggca tgctggcttc caggtttata atctcccgta taatattaaa
    95281 gtattgtatt tataaagcca agatggtttg gccatttcgc tgcatatcat ttcatacgac
    95341 aaattggttt aatcctaaga ttatactggt gatctgtgct tctcctactt acagccttat
    95401 tattctttct tttttacagt atggcctgcc tcggcgacat gtttccgtat gtaataatcc
    95461 caccatggtt caagcaattc tgctccaatc gatgcggctc cgaagatttg acggactggg
    95521 acgatggtgg tcagggtgtg aacagccatt tcgcaggtgg tgctgtcgtt tatgatgaac
    95581 cacggagtgg ctcttcggag tatcaacccc caagaccgtt agcctatgag aacggccagc
    95641 caaacctgcc ggtgtcaacg aagggtcagc aatacggctt tgttccaaaa gagtacaatt
    95701 actccttaac tcccaagata cagcccatca aaccagcttc accagtgagt ccagcagaag
    95761 aggccagggc ggtgatcaca ccaaccttgc gcagggatcg accaccaagt ttcatgagta
    95821 gtggagaaat tatcgcactc cctagcccac ccccgcttct agtagtaggt gatctttgtc
    95881 ttgaattcga gtattacccg ttaaggactg gttttttata gcttccaccc ctgcctagca
    95941 gaatatacga cgtggttgaa gcagagatta actttggaat ctcctatttc acggcatatc
    96001 acgacttttc cgtgagtgag cgaaggattt tgttttctgc tcgcatccaa cagaaccctg
    96061 gggaagacca tatgatctcc tgccctctag tcatcggcgc ttcacacctt gctgaaacta
    96121 gtcgaatatc actccaacgc aagctagaca ccgctcgtga atgggtacca aattcagtct
    96181 gggaactatt tggagtggaa caatctgcaa gtcttatgat ctatatataa gaggcctgtc
    96241 tatagctctt tttagaacat cgaatccata tatagccgct ctggctttgt ctagatagga
    96301 atatacaagc ttcctctgga gcagctgttt tgttcccata aacctttcca acatggacac
    96361 ttccaacatg ggcacttcca acatggacac ttccaacatg gacacttcca acatggacac
    96421 ttccaaaatg gacgccttcc aattcgcaat gggtcgccgc gattggccca aggtagactc
    96481 tgttcgggtt tcctctcttt cctgtgacta ctgcaaccaa cactatgttt taacattcaa
    96541 gtacgataaa cgcaacgtta gcctgaccgt taatcacttc aagtttttac gtatggaaaa
    96601 caaacgcaac agactagtat ggcttgagaa ccatgtcctg gaaactcaga actttaccac
    96661 atatacgatg cattatactt gtcctacttt ggaagacatc gcatatgagg tctttagcaa
    96721 ggaccggccc tatctaatac atagttgctg tggctttatg tgagttctgt catatcattc
    96781 ccatcctatt cttactaatt actacagagg ggggcttgtt gcgaactacg tgaaagacgg
    96841 ctatctttcg ccttctgata tagcgtcctg taagtaccat cgtataatat aatacacgtc
    96901 cctaagctaa taactgtcaa taaccagcat catgattgat gtagcctgaa ggcagtcagt
    96961 ggacaaccca ttcagtgatt atctctcaag gttttagtgg ggcaaaagac tgtatctaaa
    97021 tatttatcca ttgtagatcg caatatacaa gagctaagat ctttagcctt atggattaac
    97081 acaaccaaac tggtataaac gcgctcattt taagcaatcg ctaaacactt aaaagacgca
    97141 acaccacttc aacaaaaccc tgcctctcaa tcattttaaa cattcctatc attggatgtt
    97201 tatatagttg tattaagcct ataacttcga tcaaagcttt ggtacgtgtt tatgtagaaa
    97261 ctatttctat atgcaatata cttatttttc cacctgcaag ggttagcctg cgccaacgcc
    97321 accttcaacc aactgttgat cctgaacatt ttcatgaagt gcaccaccac ctacaataca
    97381 tattatcaga gccctatcga tggaacagaa cggcaatatc gcccaacctc gagtgaatac
    97441 agctattgta tggactcttt gttcggtgat gcttgaaaac ccccacggct tgcgctatag
    97501 aattgtccac attgaggcaa ctgcagcttc tgctgatcta catgccgtgg tatatttcag
    97561 gttgaccgct aagacaatca ctgagcttct caaaacatac acacatcaac attctggata
    97621 taacataaat agttggttga aaggctacag ataccttttt tcattattag ccgagtgttg
    97681 gtgttgtata cactttggag acttgcagga attttgggat acagaggagg atggtgaact
    97741 gccgccctat atgtgtaaca gtgttaagtt agacgtgctg ggactacttt cctctttagg
    97801 attatatgat aactagccag cctatcatat atgaacgtgt tttacgtcat agtaaacaat
    97861 aggaaactcg ataattagct aagtctgaag gcaaaagtat cggaaagcag aatcccatat
    97921 ttcgccacta cttttttatt ggtgccttgg tggtcttacg cataatgttg agtcaacgtt
    97981 ctccgcaaga tccccttcta ttcttaccca cttttgcgca atagtaggtg ctcggtggct
    98041 tagcggcttg gtgcactcgc ttcattctgg agtcggaggt tcctatcact ctcagtgtgt
    98101 ggggaagcgt aaaaaaatga gatagggatc atcctcttac agaagacatc cgctagcagt
    98161 atcctctcac agaattaccg tgtcacttgt ttggaacaca ccccggatag tctactggaa
    98221 tcggacatgc taccgatgca ccaaagactg cctgagacca ttctatcgca gctggagagc
    98281 agcacggttt ccttgtcttt ctttcttgct ttgttgcttt ttcccccctc ctctattcaa
    98341 tgacagcaca tcagtaaaag gccacgtaat ccatgtaccg tcaaagtttt aggtcaggga
    98401 attccttcgc caggctgcct ccaatacatg cactgggcgt gcctcgtatt gctaagacca
    98461 gggcggctgt ttgtcccagg atagaacgta taaagagggc cagagctttt cccaaggggc
    98521 gagtacccaa tgctatcaat tcagagcact cagtcacatt caagttcaaa tggcgtccag
    98581 tacgaactcc acgagtgtgc cctctggtat gctgccatcg gtgataaacg tgacgaggtt
    98641 accattcgat cttcattgcg aaacggactt atcggcttta cgcatcgcag aatcgcgtgg
    98701 tcaatttaga ttacaccaca ctgccttcta catcagagtt agtgcccata tcttctggtg
    98761 ggttttacgc aaacctcgta tccttcttct tgaacgcgct ctttgcgata ccagacctgg
    98821 gtattgggag ccacccggtg gggctgccga agatcaggac gaaacaccgg gagatgccct
    98881 aaagcgagag gttggggaag agaccgggtt acaactgtcc caagtcactc atacgctccc
    98941 gactcaaacc tggacacggt caaagggacg cgaagactac aattgggttg gccttccatg
    99001 tatcatcaag gtctctgagc ttgaaacttt tgaatcacgc ggaagtagcc aacgtgcgtc
    99061 tcagcctgta ctgaaatggg aggacattat acgactgaat cctgaggagc accaaaattt
    99121 tgcatgggca acagaggagg aggtgcgatg cgacaagtat aagatgtttg gaaaccacaa
    99181 ggagactgcc ctcaaggctt ttgcagcagt gacagagaac tgctcagtct aagtatgggg
    99241 tgtgtggatg gaatgaggct gaaggatgag gctggaggat gaggctggag gatgaggctg
    99301 gaggatgagg ctggaggatg aggctggagg atgaggctgg aggatgaggc tggaggatga
    99361 ggctgggagg ctagaataat aaaagtcacg cgagaaagaa gtaaagtcaa gaaggtcagg
    99421 attaattcca aactttagac tagtcttcag aaatgtgata gaagatgggt acccactgaa
    99481 caaaaagcag agaaagccaa tacatgctgt ctgggtgatt ctgtaccaac aaggcctgta
    99541 ctccgtcata atacattcac gtgatcgtaa gtctccattc tctatctctg gaattcgatc
    99601 caaaacaaac cgctgggcag agtttccatt cctagaaaca cgtcattgcc tccatgtata
    99661 atattagcag cttacactgt actttctatt tacttaacta taatatttct gctatctatc
    99721 cctgacaact tgggagccta tttacgcgtc gccgttttat catgcctgcc tagtcaagag
    99781 ccaatcgaaa ccaataccat ttcactatct ccgtacaact tatggatagc acaagctcac
    99841 cagattataa ggcgcttttt ctgagagaag ccgagcggag gaaggaagca gaagaacgcc
    99901 agcggaaggc agaggaagaa cgggaacagg agaaagagga gagaaggcgt gcagaagagg
    99961 aacgagatca gggcagagaa ctaacgcggc acaccacctt tctaggactt ctccgtgact
   100021 gccatatcct tttctcgctt cctttacgag ccgcatcgcc gtctatatcc acaacaggaa
   100081 aaataccgca gccaacaggg aaatactgcc cgcgacgcct tctaccttgg gaagactgtg
   100141 cagttaggca acaggagatt taccggcctg tttgcaccta tctggaacct gaagggaagg
   100201 ctgcggaaca gcgattttca ccgcgccttg cgctggagga cttgggtaaa cgatttgatg
   100261 aaagaccaat aagcagtgag caggatctgc agagctatga acgatttggt gtggagaact
   100321 atgttcgtga tattattgta gctctgcaag ataccagccg cttgagatga atttgggctg
   100381 ggcgatggag ttatgttcga gaatcatgcg aatgctcttg atcccgtcga agctagccat
   100441 ctttaacgaa atgaattgtc gagttcctag cgttcaaaac cagatcaatt ttgtattcac
   100501 cgagtcgatg gtggccataa tactcttcta acaacagttg agtacaagcc accccacaag
   100561 ctatccattg aaaaccttcg cgcaggatta cggccgatgg acttttggaa agaggttatt
   100621 cggcctgatt ctgtcccaac cgaggaaccc gcgaaactgg aacacaatgc agcttggctg
   100681 acaggatctg ctgtgaccca agagtaccat gtgatgatcc aggagggact taagtactcc
   100741 tacttgagta acggacttgc gctggttctg ttacatatcc cttgcgatga gccaagcacc
   100801 ctatactacc acctctgtga gccaaacatg gagatcgatc tagataatga ctgcagcttc
   100861 gagcagccac tgacggctat tgcacgggta ttatgtctgt gtctcatgag ctttagcgcg
   100921 cgacttcgcg accaggcgta gcgaaatgat acagagccgg gtataccagt ttaggagacg
   100981 agttttgatt atactcgctc gcaaattcca gaaagagaat tacggcagca cccaccgggt
   101041 tcgaaatata gtccctcaga gagctctggg cgcactgtct cggaatatct gccaccgtcc
   101101 tctcctattg agtctcccac gaaaggacgt cgaataccaa ctcactctcg agttcaatat
   101161 gccccggata cagtagaccg tggggattct ccagattccg atactgattc tgctcccggt
   101221 gggcggaagc gtggcttcag ccaggtctca tcgtctccat tatcgccatc cgttcaacga
   101281 cccgcacgtc agacgggctc ccggtttaat gaaagcagcc ggcgtcacca cagagctcaa
   101341 ttttgtaccc agcgatgtct gcttggccta cagcaagggg gcaagctgga tggaaattgc
   101401 ccgaatgtta tgcttcatca gcagggtgga aacaacagtc gacacctcct cgatgcccag
   101461 agcttggttc aatgtatcaa acagcagctg gatgaaaatc tcgaccgcga ctgcacgccc
   101521 ataggacgct gtggggcatc tagagtaccc ttcaagataa cctgcactgc atatggatat
   101581 acagtcgtcg gtaaaggaac cacatcttat cactggaacg aagtgaagcg tgaagcggat
   101641 atttaccgca tactttcgaa ggttcaagga tctgccgtcc ctgtttttct cggcacagtt
   101701 gatctggcca agacctactt cctccatgga gccaggaaga tccgctatat gctgctcatg
   101761 gcttgggggg gtgaacatat taaaaatatc caggctaacg atgtagccag acgagaggtt
   101821 tcaaggtcca agaaacagat tcggtcttta ggagtattac accgggacct ttgtacggag
   101881 gattatagcg gccactccgc aacaacattt cccccgacta agtccattta ccgctttctc
   101941 aaccgctttc tttattagat tactttaatc atctaattac ctctttgatt cttgtataca
   102001 actatcgtac ataactatgc ctcgtccagc cattgatctt gagttgtaca aggctgagat
   102061 tacggctttg taccaaagaa atgagccagt ggctgcaatt caagattatc taaaagagtc
   102121 attcaacctt cagctcagca agcgtacgct tgaatcacgt cttcaagaat ggggtttact
   102181 acatcaggat cgtacagtca gtatcaatac tgatgtacag gcacgaataa aagtactctt
   102241 tttccaggtt ggtcttgaag ataaagatat tctttatgtt ttacatcagg aaggagtgac
   102301 tctatcacct cgtacgctca gacgtatgcg taaaagtctt ggacttgtac gccgcactga
   102361 ttctcctttt gagagacagt gtcaaactga agctatccta caagctctta tcgaggaatc
   102421 tgaggaaggc aagattcaag gatttggtag aggattactc caccagcata tgcgtacaaa
   102481 agggcatatt attactcggt aaaacttgac tccttcctac acttgtacat tatactaatt
   102541 atatcaagag cgcgtctttt tcaagcttat cgtacaatat tccctgatcg agtctttgcc
   102601 cgtcgttatc agctgcagcg caaacgagga gaatatattg tacctggacc aaattatatt
   102661 tggtcagtgg atggttatat gaagcttgag ccgtacggga ttgaaatata tgcaggaata
   102721 gatgcctatt ctcgatatat tatctggatt tactgtggta ttactgctcg tacagctcta
   102781 agtgtcttaa atcagttttt agacattgtt gaaactgtac agctacaacc ccaaaaaatt
   102841 cgatctgatc atggctcaga aagaggtcgt ttccagaata tctatctaca gctccagcag
   102901 gcgtacgacc cttctattca gctagctgat tgctggatag aaggacgaag taccgagaat
   102961 caaaggatcg aggcttggtg ggagcaactc tcaaaaagtg cactctataa atggcgggta
   103021 agttattcta cttctgtaca agatgaattt ctaataaaat agacatactt ccgtacactg
   103081 aaggatgaag gtcttttcag taaaagctgt actgctgatc agattgcctt actaagtatc
   103141 tacatgccta tgattcgtac agagatttat agctatgtag aactttggaa tgtccatcga
   103201 atccggaagc aacggaatcg gcccaattct gttgctggaa aaccatatat gctttatcat
   103261 catccaaaac aagatgtaca agactacggg cttcctatta aacaagaagt tctggatgtc
   103321 caacgacaat ctgtacatgg atttggtaag taatctctag atatcttctg tacatactga
   103381 atactaatca atatagatat tgatgagtat ctgccagcag agactcttca attctgccgt
   103441 acagcattgc tggggattgg ctttgaccct gaaaagccac caccacttcg gccagaggat
   103501 gaggcagccc cttttcgtac aatctatttg gagctaagag agattattag ctttcatata
   103561 gatctctttg ttgagccatt tcttggctta tcatcccgac caacagctgg ccaacgttca
   103621 aatcccgaga tagaatagtg ttgtacaaag aaaaagttag atttctttat acaaaaaagt
   103681 ctaaaaaata ctttcttctc tataagaata ctatgtccca tcagactatt attttctcgt
   103741 acatactgac tgtcaagtgt caagatgtcg tttgaattta ttgatctaac ctcatctcct
   103801 tcctcctctt ctcatccaga tactgcattg tttgtacccc agaggattcc atcctttgcc
   103861 tctcgtacat cccaatctcg tttattatca ggccaacgag gagctactgt aacatcaaga
   103921 cagagccaaa caccacgtcg tctattcttc tttaagatta tccttacatt tcatcttatg
   103981 acaatcgatg tacaagatat ccaaatcaca agacatctag agcagatagg tatgattagc
   104041 ccttgatatc ttgtacggag aatactaatg tacaatagag agtattaaaa caggaatccc
   104101 tgctcgtaca atcgaatcgt tgcatgatct tatccatcaa gacctcctga aagatatgtc
   104161 tgaaagcatg cggcaattgt acaatccaca aagacatgat atctaccgct tggcaaccaa
   104221 tatcaaagga aagtctccga tgtatttgag tccaattgtg gatacacggc aagcagttga
   104281 ggatcttctt tcaaagtggt ttgaatctcg tacaactgtt ggtgaaaagg agtacatggt
   104341 tcatttggtc atagaacgga cgattacact ggacgaggat gttattcctg ttgaagagaa
   104401 gatcaaagtc aagaagaaaa gaaagatcaa gaaagagatc aaggatgaga tcaaggataa
   104461 gattaaagag gaaagaatac cttcccctat ttatcaagca gatgatggta ttgtacaatc
   104521 ttttctctct acacaatctg agagatcctc tgaggctgta caagattctc gaaaacgtgc
   104581 tgcaagcgaa tcatcttcaa tattgggtac aattccctat cggacaagaa gaaggcatgt
   104641 tattgatgag gaagatatga accgaattca gcagtatgga ccatttatta gtagagaata
   104701 gctttttatt gcttagtcgt acggttgcct aaggcagatt aattcaatgt tgtgtttctt
   104761 gttttttcta cttaaaaatt tctagatagc ctcacctctt tctgacaaca acaacaccac
   104821 caccaccacc atcactgcgc cccccaccac caaccaccat gtctgcgtac gtgtacaggc
   104881 gataaaatgg ctgagttttc atatctaact tacatgtctg attttctatg tactaacacg
   104941 ttattttgta cataatagta accagcgttc tgctgtccct gcttttactc ttgaaggatg
   105001 gttccgccgt atgtacgaga acctcccgcc tggccaaaat ccaatcctgc ctaccagcag
   105061 gcttgacctt cttgccccgt ttgtacatac ggacgaggga cgccgtatgc ttcgttccct
   105121 tccaggggag gacgtggcat ttatctgcgg caggatatct gcacgtcaaa tccagatgca
   105181 tcggccctcg tacgtcaatg ccatactcat acaatctcgt ggacgccggt tagctgtacc
   105241 ttgtacacgt tgccgcagtg gacaaggtag actggtgttt cccgaatgtc gccaggtacc
   105301 aggtgcattt ggcggagctt gcgccaactg caaatggcct gacaaagcaa gtcagtgctc
   105361 tgtacgagat gagttttggc attctctcga tggtttaaga gaaggttccc gaatgggggg
   105421 tggcggccgg catacacgga gtctcggttc ctctcaggat aatccaatca atgttgacgc
   105481 agagatcatt gatttggacg agccaatcaa cttggatcct gaagaaggtg accatcctaa
   105541 tgatccaatc aacttggatc cagaggaaaa tgaagaatgg cctgaaattg aataggtacg
   105601 tacatatttt attagtttag tttgcacagt tgtacatcat catcagcacc agcatctgcc
   105661 cccctagtcg tacagggttt gtatacggca cctgagcaag acttgcacct ctacgtggtg
   105721 ctcaggacta gtagccaaat tggtggtgaa actaagcaag tctatggtta tccattctgc
   105781 cggcagaaat tgataagacc tgttgttgcg gagtggccgc tataatcctc cgtacctttg
   105841 gccagaaaat attctgtgga gtaccgagct aaacagggcc ttgattattg acttccattg
   105901 ttctcaatta gacccgcgac cggtaaagcg gcggcgaagg tagtcgaaca aattcaatta
   105961 cgaagaggca catgagcgaa aacagctttg tgcatcctga cttaagtttt atacccaata
   106021 taagtatact taatatgacc tctacagtac gtccttcaga aactgggcat tgtcaaaatt
   106081 tctacacgaa gttcactttt tcgcagaaca gtgtgcgctg tctgcacttg attattggac
   106141 ggtcttccta catttcatca aagaaatatt gctgtacaaa aaactatgac tgttcttaat
   106201 tggaatacta tttcttcaac agtcttcatg cccgggtctc gggctaagat gggacaaagt
   106261 actccgggcg ccgagtgggc cgcatagaac ggcgaacccc ttccatgggc gacggaccat
   106321 acgattctga cgacaattcc ggttcagccg gggcctgctc tgatagctca tccctccggg
   106381 gcgaattaga agcggccggc aatgtagcag actgcgaggc ctcgctggct gcatctaagg
   106441 atgacctcgg gcgtgcggcg tgaaatccat cgaaaaggcg gtcttgccga ctagaaagca
   106501 tgttagccac aattttgcga agccacgaca ttatacctag gtctcatacc aattaggaca
   106561 gctaaagttg gaccgagggg agcggtgcat gagccagccc tccatgcacc gccagtggaa
   106621 ctctcccgcg cactcctcac agttaaggta taccgtgtct tcggagtgac gctcgcggca
   106681 gatgccacac tccacatctg agatgtcacg gcccttacga aaagagcgga acacaacgga
   106741 cccggtttgc ccagaagccg ccgagacggt caccaccgct ggccgggtgg atgacacatg
   106801 gaatggtatc tggttctcct gaaccatggc gacagtgact tcctctcttt gctggtgggt
   106861 agtgggcagg cttgttgatc ttccagatat gcggcgctcc gcccttgttg tcgggacccg
   106921 gtcgctccgg gtatgacggc gttgtgacga gtgtgaggga gctggatttt gtatgggtgc
   106981 ttgctctggc gagaggccca gacgcgtaca ccaccgctcg ctcaaggaag tcgcctggtc
   107041 ttgatgtcgc cgcttgcaga ggaggaggcc ggcaatttcc tgcagctttg aaacgagata
   107101 ttcattgata ggacacatac ttaggatttc cagtctgtga gaggctattt cacgggattc
   107161 tttggacacc ttgttcctac acgcatcccc atttttggcg actccaatgc aggtgcagtg
   107221 ctgactaggg tctatgattt cgcagattgt tgatggatcc cagcgttgac gaggcgcttc
   107281 gacgggttga ggcattgtgg ctgtataaca ggattgaaga gaagcaatgc taaacagaga
   107341 tattggatat aacgaggcat aggtagaaag agtagtagga tggaagcggc cctttttata
   107401 attgaattct gcacgcggca tcatctagtg aagcttgtga taaaccgcgg ccgcattgtg
   107461 ggtgatatcg agtattcttg aaccccacga agatgactag gactagaaac attgtcgccc
   107521 cattccatta ttcgcccttc tgcgttttga aattcttgac caacgcacct gcagagacct
   107581 aacattccgt acagcaaaga cctgactaaa ttagtactcg atctgctcgg ctgaatgccg
   107641 ctgaatgcca ggctggggaa gctgcttctt agctgaccga tataaaaaaa gatactgttc
   107701 tctaatcgtg ttctatcgga cacgcactcc ttgacttcac ccaatattgg gttcacgcaa
   107761 ctgttattat attggtattg atggagcctt caaagggaga cggacctgtc tctggaactt
   107821 cagcggctag gctggtagcg atataacata tcccatcatc cacagcttgt tattgtagtt
   107881 gatcattatc tcggtttatt ccccttaatt aaatacataa ataaccagac ctaatttcct
   107941 gcactgaaag aggaaagaaa aagtaaatag tagcttagat attcaatagg caaagctata
   108001 tatctgctag cgcagaggac tgttttatac tagagtccgc ttataactta ctttttatag
   108061 aagagcaata aaaacactaa gcatctatag tctttcagag atgagtagca ataacgtcct
   108121 gaaaaaaacc cgctttcttt aagacaaccg gcatatttga cctaatcttc cccttctttc
   108181 ttggtagtag agctgacgtg caccaatcaa acaatattta aaagtgatta ttcctccatc
   108241 ttacttctat gttacttcta tctctacttc tatctctatt tccatcttga cgcccatctt
   108301 ctacgctcag acttggccgc tgtttgcaaa gcctcagccc tttcactcta tccttgagaa
   108361 ttggacctaa gtcatgctta ctcttgttag gttgtcaatg aatcatagca ctcatttatc
   108421 ccatcctgaa tggcgcacag actatctaga ctatcccata gaaagcatat tgaccaaggc
   108481 gcggtttcga cgttcagaat aaacccgacg tctaatattt ggacacccac agccaattgc
   108541 ttttaccctg ttcatcggat ggtacaggaa tatgcgcggg tcatgcaatg tcgttcatac
   108601 ggtaaacatc acgttcgagc agggtcacat tgtgcctttt ttttttgttt tttgaatccc
   108661 ctactgtgtt ctgccatccc atcagattct acaaaagcag cagatcgctg agtgtcaaca
   108721 atgtctcagg ccagccgcgc gcgagttgtc gctcgtttca ctttgaggag tgtctagggc
   108781 atgcttcata tgtgataggc tggtactgtg tacgctagtg ctcacttcag aaggcgctaa
   108841 cttacgtaca ctaccaaaaa cgacaagagc tgcaggagcg agtgatgtga taaagtacgc
   108901 atgatgttgg ctttagatat ggcgaatagc ataggcgaag gagagctcag cggaaatcca
   108961 gtggtattgg ttgttgttga gtgccataga cttgcctcgg cggcaaatta ttggacagaa
   109021 gcttaccgcg cagactaatg gagatactta tgtcgatcgc aattgctgca catgatacca
   109081 ttctcggcgt ctggagttac ggaggctgct gaccaacacg aaaccatcct taattataat
   109141 attcaattaa tgttcattct tctgcaggtt tagcgctttc ctgtgctcat gcgcggggct
   109201 tcgcatgccc aaagcaccga gctcaaaatc atgcgcataa cacacaatta taaatactgt
   109261 agtttttacc gtctaatgta cattgttgct tgactttctt ctatacccgc ttctatctcc
   109321 ggaaccttgc aaatacaaaa ctgttacctt tctaaaagtc ctcattaaat actgaaactg
   109381 cgaggctgaa tagctatcga accatctctc tttctactac gcaataagta tgttctccac
   109441 gcagaaaagt gcttcatacc tgttaaccct ctgtatcaag aaataccacg atgaagaaag
   109501 cagttaaaag tgccgtcagc aaggctgtcg aaggaaatgc ctggaaaaaa tttacgaacc
   109561 caagcgctgg gcgcgggcag acgactttcc cgaagggtca agcggagcaa gaacggcttg
   109621 gggtgcgatg ggactatgat ggggaggtta caaaagggga ggtggtgtac cataagttcc
   109681 agatgcaacc gaacgctgga aaagtcccgt ctcctatcaa aagatggaga gaagatcatg
   109741 gtggaaccca cgctgttatg gctactgccc tggttaagaa ggatggttcg aaggaagatg
   109801 tcgagaaggg attggacgaa gccacaggct caatctagaa ctgaagggtt cctcgtttaa
   109861 actatggtcc ccaatcccca aggaatcaac actagccagt gcagcagcaa tgcacagtag
   109921 ctggcacacc agcagaacaa atatcgcgat cagtttttgt gtcctttttt tctcttttct
   109981 ttcctgcatt tagttacctt aagatgtatt tctttcgaat ttatatacat aaggtcaaag
   110041 ctggcgactt gtttgattaa gacataagcc acatagcttc cttcaggggt ggctgggacg
   110101 gttcggatga cgtaatcaaa ccaaatcaaa ttaaaatcaa ttaagtcaaa cacttcctga
   110161 gacgcgactg acgtgtgatg atcacgggct acaggtgctt aaaagaagcc ctgcccgtcc
   110221 actctcccac tgcctaaccc ttcgtccaac catggctaag cgtttacatg gcagaatttt
   110281 ctcttttctt ttccagttac gccccaccct ccacaagaca aacttagcac ccggacgtgc
   110341 tctttcgaca gttcaaaaga tgcctgaacc ttgcgaattg ttcgagtaca cgaccggaaa
   110401 atggatgtat gttgcgggct agcacctcct tcctgttgaa ctgctcgact gatgtccaaa
   110461 tttagctata atgacgcgtt gagacatcgc gagaggagac gtgctttcaa cgtctctgaa
   110521 ttgaagcgcc ttgctgccct agcggttcag cagaaggaag acgacatcgc aggcttcgag
   110581 aagcttgccg aaggaggatt caaccgaagt ttcaagatca ctatgcgaga cggcttccaa
   110641 tttgttgcac gaattcctta tcctgtcact gaaccaaaat tcctagtggt cgcaagtgaa
   110701 gttgcaacga tagattttct ccgttctcat ggtattccag ttcctaagat ttttggttac
   110761 tctgccgttg cagataaccc tgcaggtaca gaatatatct ttatggaact tgtccaagga
   110821 caaaacctag gtgatatctg gtttactttg tctgaacagg agaggataac actggtgatg
   110881 aagctcgtgc agctggagac tcgtctattt ggtttacagt tcccggcaag tggaagtctc
   110941 tattactacg atgacttgcc agcccatgac tacccagcca ttgttccaag ccccagctcg
   111001 acccgccgct tctgtattgg ccccgatact tcgcttggat tatggtatgg gaaaagactc
   111061 aacttatcgg ttgagcgcgg accatgtaag tatgcttcgg gttgaaatat ccaaatacaa
   111121 atgccttggc agttaacttt agaaagaccg agattctttg gcggttctca ccgccggagc
   111181 cacaaaagag attgcgtatc tcaaaacatt tggacgacct ctccaacctt ttcagcgtct
   111241 tcgcagagag atgtacgatt accagcccca atcccacctc gaacatattg tgaatctgga
   111301 gaaatatcta aaaattgcgc ctcaccttat accgcgggat tgttctgccc ttcatcgtcc
   111361 agttatacga catcccgatc ttcaacctaa taatatattt gtttctgata agctagaaat
   111421 taatgggtta atcgattggc agcatagtac agttctccca ttatttctac aatgcggcat
   111481 cccacaaagt ctccagaact atggtgatga gatctcagaa tcactgcaaa ccccttcttt
   111541 accaaggaat ttcgatgaat tagaggagat acaacagttc cagcatacgg aacttttccg
   111601 caagcgtcaa cttcactatc tctatgtcaa attgactgcg gagaataatt ctgagcacta
   111661 caatgcctta acctatcatt tcaacaccct aaggcggcgg atttttcacc atgccagtga
   111721 cccttgggag ggtgacaata tagccttaaa agctgattta gttacagtat caagaaattg
   111781 ggaagaagta acccttgata ggagatcacc ttgcccaatc ttcttttctg atgacgagtc
   111841 gagtgaatgt ctgcgactgg cccatgaaca atctgacgct gataaacaat ttcaggcttg
   111901 ccaagaagca attggagttg caaatgaggg atgggtgcct gttgcatact atgatgaagc
   111961 aaaagaacgc gagagaaaat taaaagcaga cgctcttgat gctgctgaaa cagcggagga
   112021 gagggctaga atcgaagaaa actggatttt cgacgacttt tgtgaggagg agtacacttg
   112081 aatcttaaaa tagcccatgg gcctccacat attagcaaat gatatgaact aaatcttgtc
   112141 tcgagcttta tacgcagctt cactacattt gaggtgtctt ttttcagaga ctacagtgaa
   112201 gtgcataaaa ggtttttcct tttatttcca tttttctcaa actggttcag cctatttcat
   112261 catctttatt aactaatcca gtttcaccgc cttactctct attctttatt cttggcctcg
   112321 ctgccaaggc gctagccagg aaaatgagtg cggattagag ggcaactcca gggctcggta
   112381 aggcgctgtt cttatgcgtg ggaccggtaa cgagctgaat ggtgcgctac ggaacaaatg
   112441 gggaggtata tagaaaagaa gataggacca catctattgc agaactaatc gctgaccttc
   112501 aagatttcag gtcaggaggt gcgaatatat attcgcacct gactaagcat cctagccaag
   112561 gatctagcta agctagctat cgcgccctat ggatttgcca ctgtattaga actagaaacg
   112621 agtagcatgt tcttgaaaga catgcctaaa taaatactgt ccgtctccca ggcccttttt
   112681 ttgtaaagat acttgaaaat atagggatta aggaaacaaa aattcattga cattggttat
   112741 ttccggaatc caaaaaaaga gatccgacct gacagatgtc ctaaaacgag tatgttcgac
   112801 ttggccgctg aacaagaata cctagcttcg ggagggagcc ataggacttg ctgtccattt
   112861 acagctatcc attctctctg tagagatacg tgtgggtcca tatttggtga atcggcgata
   112921 ggcttgccat aggtgaattg gaccttgagc gatcctaggt tagtggcgag ataggagctg
   112981 tcttgcgaaa attcaacctc cgtgagaagg ccatgagtgc tcaggatttc cttcagagcg
   113041 cctgtgactg gatcccagag ccgcactgtg ttatcatgcg agccggacgc cagtagtcgg
   113101 ccatcgagtg agaaggccac ggtctcaacc caatcaatat ggcccttgag tgtctgttgc
   113161 agagcgcctg tggctggatc ccagagccgc actgtgttat catgcgagcc ggacgccagt
   113221 agtcggccat cgagtgagaa ggccacggtc tcaacccaat caatatggcc ctcgagcgtc
   113281 tgttgtagag tgcctgtggc tggatcccag agccgtactg tgttatcgtg cgagccggac
   113341 gccagtagcc ggccatcgcg tgagaaggcc acagtcttaa cccaatttat atggccctta
   113401 agtgtctgtt gcagagtgcc tgtggctgga tcccagagcc gtattatctt atcccttgag
   113461 ccggacgcca gcagccggcc attggttgag aaggccacgg acacaaccga acgtgtatgg
   113521 ccctcgagcg tctgttgtag agtgcctgtg gctggatccc agagccgtat tgtcttatcg
   113581 ctcgagcagg acgccagcag ccggccatcg ggtgagaagg tcacgaactc aaccggatct
   113641 gtatggccct caagcgtctg ttgcagagca cccgtggctg gatcccagag ccgtactgtg
   113701 tcatcatccg agccggacgc cagtagtcgg ccatcgggtg agaagaccat ggagttaact
   113761 ggatctgtat ggcccttaag cgtctgttgt agagtgcctg taactggatc ccagagccgc
   113821 actgtgttat catccgagcc ggacaccagt agtcggccat cgggtgagaa agccacggtc
   113881 ttaacccaac ctgtatggcc ctcaagtgtc tgttgtagag tgcctgtgac tggatcccag
   113941 agccgtactg tgttatcatc cgagccggac gccagtagtc ggccatcggg tgagaagacc
   114001 atggagttaa ctggatctgt atggccctta agcgtctgtt gtagagtgcc tgtaactgga
   114061 tcccagagcc gcactgtgtt atcatccgag ccggacacca gtagtcggcc atcgggtgag
   114121 aagaccatgg tcttaaccca acctgtatgg ccctcaagtg tctgttgtag agtgcctgtg
   114181 actggatccc agagccgtac tgtgttatca tccgagccgg acgccagtag tcggccatcg
   114241 ggtgagaaga ccatggagtt aactggatct gtatggccct taagcgtctg ttgtagagtg
   114301 cctgtggctg gatcccagag ccgtactgtg ttatcatccg agctggacgc cagtagccgg
   114361 ccatcgggtg agaaggccac agtctcaacc caacctgtat ggcccttaag tgtctgttgc
   114421 agagtgcctg tggctggatc ccagagccgt actgtgttat cgtgcgagcc ggacgccagt
   114481 agccggctat cgggtgagaa ggccacagtc tcaacccaac ctgtatggcc cttaagtgtc
   114541 tgttgcagag cgcctgtggc tggatcccag agccgtatta tcttatccct tgagccggac
   114601 gccagcagcc ggccattggt tgagaaggcc acggagttaa ccagatctgt atggccctca
   114661 agcgtctgtt gtagagtgcc tgtggctgga tcccagagcc gtattatctt atcccttgag
   114721 ccggacgcca gcagccggcc atcgggtgag aagaccatgg tcttaaccca acctgtatgg
   114781 ccctcaagtg tctgttgtag agtgcctgtg actggatccc agagccgtac tgtgttatca
   114841 tccgagccgg acgccagtag tcggccatcg ggtgagaaga ccatggagtt aactggatct
   114901 gtatggctct taagcgtctg ttgtagagtg cctgtggctg gatcccagag ccgtactgta
   114961 ttatcgtacg agccggatac cagtagttgg ctatcgggtg agaaggccac ggagttaacc
   115021 ggatctatat ggcccttaag tgtctgttgt agagtacctg tagctggatc ccagagccgt
   115081 actgtattat cgtacgagct ggacgccagt agccggccat cgggtgagaa ggccacggtc
   115141 tcaacccaat caatatggcc cttgagtgtc tgttgcagag cgcctgtggc tggatcccag
   115201 agccgtactg tcttatcgct cgagccggac gccagcagcc ggccatcggg tgagaaggcc
   115261 acggactcaa ccggatctgt atggccctca agcgtctgtt gcagagtgcc tgtggctgga
   115321 tcccagagcc gtactgtgtt atcatccgag ctggacgcca gtagtcggcc atcgggtgag
   115381 aaggccacgg actcaaccca acctgtatgg cccttaagtg tctgttgcag agcgcctgtg
   115441 gctggatccc agagccgtat tatcttatcc cttgagccgg acgccagcag ccggccatcg
   115501 ggtgagaagg ccacggagtt aaccagatct gtatggccct caagcgtctg ttgtagagtg
   115561 cctgtggctg gatcccagag ccgtactgtc ttatcgctcg agcaggacgc cagcagccgg
   115621 ccatcgggtg agaaggccac gggcacaacc gaacatgtat ggccctcgag cgtctgttgc
   115681 agagtgcctg tggctggatc ccagagccgt actgtattat cgtacgagct ggacgccagt
   115741 agccggccat cgggtgagaa ggccacggtc tcaacccaat caatatggcc cttgagtgtc
   115801 tgttgcagag cgcctgtggc tggatcccag agccgtactg tcttatcatc cgagccggac
   115861 gccagcagcc ggccatcggg tgagaaggcc acggagttaa ccggatctat atggccctcg
   115921 agtgtctgca gttctgcact ccagttctcg tgaacttgtg ggaagcggca gatccaatca
   115981 ggaagctcag attggaactg ctcgcgaatt atggccgttc gaggtgcaaa taccaaccct
   116041 gcataataaa tctgaagagg cgctgcatcg actatctgtc gatttttcag gacaaaccgc
   116101 tttgcatcat gtagaaaggc ggccagagta gaattgtcat tacggtccta ttcttattag
   116161 tatgacttgt ggataactgt ctactataca cttactgaca ccagcgttcg gagactgtcg
   116221 agcatatcta ttatctctga tataagaccc agtaggctca tcgcttccat ccaatgaaga
   116281 aaatgtttct ggaggaacag ccgcacgtct tctatgttcg tagataaagc atggctattt
   116341 ttgagatgat atgtccagta gcgacaggag tattgcaatt ccgacggtag acatttgtag
   116401 atatccagag ggtcgatctc tgccctacgc gctccagggt ctgctagagt gcagatatct
   116461 ctccgtagaa gacgccgcat agttcttagg caggagtttg caatatcttt atgtttggct
   116521 ggcgcatcca cacgaaactt ggttgtagtc tggaccaaaa attccggaaa tgagagatgg
   116581 agaatcctaa caggctgctt ttcgtcgctg ggaatgctaa gaactgaccg aaaggaatcc
   116641 aatcggttgc tgatctggtc cacttctatc ccaagaaacg aagatagtgt gtttatagaa
   116701 agaggaacgg caagaaggat gataactccc acagtatcct ggaactcttg tagaagttgc
   116761 cgttgttccc tctcatcact ctcttggtca tcgaggagtc gcgttagaat tggcagatat
   116821 gtcttgtcca ttttagacac atatttcgct tggtccttga gaagctctgc gaggcgcgac
   116881 ttgggttccc atttcggatt ttcgatgtag cggcacacag tggcagccga aataaacagt
   116941 gggacagata ccttaaccaa ttcttggata ataccgtcgc caggccagtc ctgagggact
   117001 ctcctatcaa gttggatttt cgtaaatcga tgtcgtagaa ataactgtat gtcgtgttct
   117061 gtcacctctt tggctatctc atgaagggcc aggtcctggt atacctggtt cccgatctct
   117121 gaaaacccaa ggctgatggg gagctctggt ctactggtca ggaagacccg aaggcaaagt
   117181 gattttacct cctgcagacg agggagcaat cggatgatat ttcgaacatc ttggtcgtgc
   117241 tcacattcgt ccatagcatc tataacaatc acagtattct gaggcggttg atcgcgttgg
   117301 tcaaggccaa gcaacggttc aaggagtagt ctctcgaatt gctccctgag tgattttgac
   117361 gcgatgtcag ggtcgttgtc aagtgccttt tgcacgccag gtcttaactc tggtttccaa
   117421 aggataagtt gcctggtcaa cgtcgggaaa aacttctttg cgtttcctcg gtcagcctcg
   117481 cctctcttaa aaaagaagct ggcacccaga tgattacgat tcttggccga ccttgccacc
   117541 gtccgagata ctgtggattt acctgttcca gccatccccc gcaaccagaa aatgcttttc
   117601 gaggatggcg aaagagccca ctcgattatt tcccggagga gctcggttct tgtacctagg
   117661 agacattcga cttcgtcgcg atcggagaat gactcaaacc ctgcatctat tgcgccttcc
   117721 aactttccaa gatcaacatg ttgatttatc cgctccgtat tgttgaccat actaatcatc
   117781 agggaactat atggtctttc aatcaactat atagagtcag agaaacatag tcgatatacg
   117841 tacgtctggt ccacctgtaa agataagagg aatgatgact tatatctctc caggctcttt
   117901 attaggccct ccacctccgc gcgctttaag ggccatttca aggctcttaa gcccatttta
   117961 ctcattagac ttttcccttt tcctggatta agcctcgctt ctaatgcttg gagatcggag
   118021 aggcaagcag taatatcgct gggtagccgt gaggacgtag gtaggtcttt tgccttattc
   118081 tcttgcagat tgttctgcag gtcttgaagt gtatcttgaa gacctgtaac tgcccgctgt
   118141 aggatgagaa tttcttcccg tgcatttcgt acctcttgga tatagcctcc gcacagcttc
   118201 acgaggcttc cggtcagttg aataacggcg ataacgctcg ccgccgagga tagaccatcc
   118261 atgttgacga acacaccata aagatcagat cttctcgcag acgaggacga tagcgatgca
   118321 agaggaagaa tataggttcg aagtcatgtt gggcattcct ggcgagcaaa agcggggttt
   118381 gtcattttcc gctgatgagg ctgtgaaggt ccatgcacca cataagcctt tatgactagt
   118441 taattttact attttatagt cagcaaaagc tatgactggc cgaacgggtg gtcgtcggtc
   118501 gactctcggc ccgaccgaga cctatcctgt gcctgtcctg gccacctcat caacttataa
   118561 cagcacgaca cgaccattat ggcgccacga cttgctcctt cgcaactagt catgatccgt
   118621 gatatgatca gcagcaaatc gcagactact cctcaaatgg cggaagcggc ggactgcagc
   118681 aaacgttcga tcataaccat tagtgccaat ctctgtatgt ttggcgaggt ccgagcgccc
   118741 ttgatccctg gcggccgtcc tcgcgttatt tcacccgtta tactcgaagc gctatgtgac
   118801 cacttgctag agaatccaga tttatacctc gatgagatgg cctagttttt gtacgatgaa
   118861 ttcgacgtat atgcatctac gtatactatc agccgagccc ttcgatcgca tggctggacc
   118921 aaaaagtggc tcgacgaata gcacaagaaa gaaacgctga tctgagagac tactatttgc
   118981 accagctgtc agatttccgc tcgtatcact tggtctttat agatgaatca ggttgtgaca
   119041 aacgggctgg cttcaggagg acaggctggt ctctccgcgg tgtggcacct gtccaggtgt
   119101 cccatttcca gcggggtcag cgataccaga ttctcccagc atactgccag gatggcatat
   119161 tgatgtcccg agtttttcaa ggatcgactg atgcaaatct gtttgaggat tttgtcgagc
   119221 aacttcttca ccattgtggt cgatggcccc aaccgaagtc cgttctcatt atggacaacg
   119281 cgtcctttca ccatactgac cgaataagcg agctatgttc aaatgctggt gtaaagttgt
   119341 tgtacttatg accttattct cccaatctca acccgatcga agaattcttt gcagagctca
   119401 aagcatttgt aagacgaaat tggcaaaaac actcgggcta ggaatttaaa gatttccttg
   119461 aatggagctt ggacgttgta gggttaagag aagaaagcgc acaaggtcat tttcgacatg
   119521 caaacattga agttgacgag gaataattgt agatgcatcg tatattgtgc agtatatact
   119581 tttaagcgga tggcatcata tcaagtttaa ctcaagtttg gctctgataa ttgtcttcat
   119641 tacaaggttt tctggtaagc caagcgatca ggacttaagc ataggcttag agtgaattgt
   119701 caatcattac caactcctgg aagagaagat tggatatgtg tagtgttcat gtgtttgtct
   119761 cccttgaggg agtaaccgtg acaaagcgca tatgaggtaa tacatacacc aatgctgatt
   119821 aatgtgcacc catcaataaa gctagcgtct tgacagtggg gcccaactaa tggaaagagt
   119881 gttaaattgg tgaagctggt tttgcagttc cctgtatcgt ggcttgctta tccgagactg
   119941 aatgatattt tttttgttct cagctcgtgt ccgacaggac tccaacaagg tccattttat
   120001 ttcttgcccg gtatacatac atgccctcga ccttagtgat tctgatatta gacgattact
   120061 tgaactcgat cttgaggccg ctcgggcctg gatacgaagc tcgcattggc gttatctcaa
   120121 tgttaatcct agcaacgctc ttcgtgtctt aaaataaaag agggaagaag ataaggcctg
   120181 ggcttcggtt ggtttgatgt aattaacctc caggatttga gacgtgcggt ttggaaccaa
   120241 ggtccgggat ttttgacaat atatcaatga ctcttatgca accccttgta agcggcatca
   120301 ccctgtttac ctgagtcagt gctgctgctt gtgatgatac ttgtattacg gtcactttct
   120361 aaatatctac ttagtaggga ccgccggcat tttatagtat aggttcgagg tagcagattt
   120421 taacataata tatattttga tacactaata gtagacctat tttactagct atctattttc
   120481 tcttgatata ttgtagctgt cgtgtccatc gactccgcaa tgcagtgtgt ttccgatgtg
   120541 taaagaatct ctccatatct ttccaagtat atcttttttc cttcaagatc aaaataagtt
   120601 cgtcctcagc ttctgagaag cgcctccctg tcttgcagta atcaaattct tcactctctg
   120661 caaaaaccgg ctctgatcca ccaagtgctt cgtcgaattc tgggcttcta gatatatctg
   120721 tatgtttgtc tcttcttgtc tgtgccgggt aaggtaagaa acctctaatc acaaatgagt
   120781 tacctaggcc tccgggcgag agctctagat atccattgat tgcaattcgc tcggaatagt
   120841 gttgctcagc tggatcagac gtctcttcta atgaagtagt atcggagtcc cgggtaaaag
   120901 agtgtttcaa atgttgttga tgctctcgat gtaaaggttg ataggctaag ggtaccggtc
   120961 tgacaaagcc tgccttcgga agacgttgtc tttgcacaga tttagaagat gtagagggtc
   121021 ttatcttagt cctcgggcgt tttggctgag aatctgaccc tgcgctagtt tgtctttttc
   121081 gctgaaggcg gctttgtggc ccaacctctt cgtcgctagt acttgattga cgctgaaaat
   121141 cgagatcatc aggatcatcg ttatcttcac tggaaaggat cgtctctgca tccaaagtag
   121201 gagatataat tctctgtggt actacaacct ccacacgtgg taccttatat ccactagttc
   121261 ttacatgagg ctgtggctgg ttgttccggt tgggtgatat gtgttttgaa tggtgatcat
   121321 catagctcct agcttgcttc tctccaggtg aatattgatc ctctggggtg caggacagag
   121381 cagtagactt ggtgagtgtc gcgtctacct ctatagagga ccgatgatct ctcgtttggc
   121441 ctgaggtata tatcagcttg ttaggccaca tctatagagg ctgaagggct gtatgataat
   121501 atatagctta ccgtcttggt ggttgttcac gatatgttcc tgtaaagagg atctgtctga
   121561 tccgctatgc ggtagcatac aatgaggatg tatactaggt agatcctcag tcttacttag
   121621 cctgcgcaac tgtgacttca cactgtaggg gctatcgcct tcctctacgc ccttgcccag
   121681 attagggctt ggtatagagg acacgtgatt tgtagaaaag tgctccgggg cgggggggag
   121741 actgaacagc tggtggctgg aagacacctg cagatttggg cattggaggg actcaggttt
   121801 ctctctgcaa aggctattgt ctaaagccct tgttattgag ggagttgttt ccacagtcgc
   121861 agatgatgga ttatatacgg cttcggcgat accggagttg gaagctcctt ccagggatga
   121921 ggctagactc tcaccaggaa atgagactag tggtttcttt ggaagggggt gattcagaga
   121981 ttgtatcccg ggtagtgata ataatgcagg ttcaggagct ggctgttctg tcttgcttgt
   122041 ttcttgagct aatggtaatg tagctttgct gtggggtgga tgggatttgg aagactttgg
   122101 ggacttgggg gcactggggg gcttatagaa ccgaatatta ttcattctta gaagtatagg
   122161 aaaccactaa gaggttgctt gcaggtcacg tattgattgt agactggccg ctggtatggg
   122221 ggtagttggg aaggttgggt attgtgatag tttaataaac ggagtagact gcagtctcag
   122281 cagacggatt ttattcatat taaccacaac catatttata tttaatctat gaggatataa
   122341 tctgcgggct atacatagta ttaaagatta gctgttcttc attacatagc atttgcccca
   122401 agtcgataag gcaagtatgc tgcatacctg acttattgca tatgtaaaga atgtacagag
   122461 tccagactta acaaaatttt tgccacccag ctctcagtgg ggttaaacta attatagcta
   122521 ttttaataat aaaagcggca attctataaa gcagcaagaa cattttccta aagcagtaat
   122581 tgtctttact ataatgggca ataagtccca cagttggaac cacggtaact aaatggggca
   122641 ggacccacac ccaaacggga aggaataact acaaaagcgg ccatattaca ccggatgaga
   122701 ttttatttta ttaaaaatat aatataatat aatataaatt taaataatta atttttatat
   122761 ttttaaatta aatataattt attttttatt tttattctag aaaatagttt ttatttactt
   122821 taatatataa tataaattat atatattatc tagtatattt taaaaaattt ttataaatta
   122881 ataataaata gtatactaga taaaaaaata tatttaatta taattaatat tttaactatt
   122941 atattattta tataatatta atactgtatt attaaattta taattaatta taaataattt
   123001 attctttccg cgctctttat ttttaatagt aatttttaaa taatatagat actataaaat
   123061 agagagaata attaaaatat taataactct cttatagtaa gatataataa tattaataaa
   123121 caaatataaa gaaataatta gatttaaaat ataaaaaaaa aaagatttat aatatataga
   123181 agagatatta taaaataaag aaaaataaaa tataaaaata gtagaaaaaa acttatttaa
   123241 tattttatta atattaatat tattattata gataactatt atttatttaa taataattta
   123301 tatagaatta atatttctat ataaaatatt taatatattt ttaaaatatt gattatttaa
   123361 tataaataac gcgttaatta ttatctagag ataattaatc tagaaaaaaa gagtgtaatt
   123421 attatagaaa taataataat tatataaaat aactatatag tatactttat tctagatata
   123481 tagatattct agtggctgaa cagtgttttc gatatttata tttattattt ttttaataat
   123541 atatagtagc tttattaaaa gaattgatta ttatatataa agaatcttag aagttctcgg
   123601 ctataaatta atactgtagt tattagtaga aaatcaagaa ttagtcttct atctctagta
   123661 tctactacct agtgctttgc ccacgtatcc ttacctagtt gacaggtcct ctaccctgac
   123721 tagtagatat tcctctgaca ctaacttagc tcgggtaact actttagtag tagatattaa
   123781 gtccattgca aagccagttt tattaaaatt atagatatcg tccggttgaa ttccatacta
   123841 tattatagtg atttgtacgc gttcaaacca ctcacgtaga agcttaggat cctcacattt
   123901 agcgcgctga tagttgtagc ggcgagagaa gcgggatttc agctcatctc tgcgctgaac
   123961 tagatgagat acccatttct gacctacagt actaggtata ggatcaccac gtttagcaag
   124021 cagaatattg gccatttctc gtacatgcgc agaccgggga ggcgctccac gttgatctag
   124081 tgataggacc cagcgtacta aggaatcctc ctcattctga gtcaatttat aaccattagc
   124141 acgcacttca ttgcgtgcag gaataccaga aagccgacgg cgtataatag taggagtaag
   124201 attaaaaaca cgtgcagctt cacgaataga gctaatttct tgctttttaa tagctgagat
   124261 agcaagtaga actctgcctt ccttttcaat tgattctttt aaatttttaa gcgcttttgg
   124321 tggcatggtt ggtggttgaa ttaggtagac tttttagcca tggtcaaaaa cgcgtgaggt
   124381 ggaacgctcg gttgcgcgga acgctcggtt gccggctacg ttacgttaaa atggctgggg
   124441 gattacgtaa gttaaccgtt cagccacgcc ggccttagca acgtgtacaa atgctgtcgg
   124501 ccttcgttct ggcgatcagc ttcagctcaa acgataacta taataccaat ttttgacaat
   124561 tagggatcta gatatacttt gtcacattat ctaggtaggt acaagaaatc gtggttgtct
   124621 acatcagagg ggcttgggtc aacatttgtt tttataaaca gtatgagaaa gatatatact
   124681 ttctacaacc taaagaactg aggaacaatc atcgataacg acttgaatct agagaacgaa
   124741 acagaacatc aaacttgaca acgaaagagt gaaccacaag tatactctac tgaacagtgc
   124801 attttatact taaactgagg gcagagagcc taatttcgcc atttcaagat gaaatttctc
   124861 atcttgccag tgatacgagg gttacatcgc ctcagctgac acatttaccg catcgggtgt
   124921 agtgctctgt ttatctcgcg tcgacactta ttaactgacg aactagcagc aataataact
   124981 ccgagtatga tcgacccctg tcgtcaaatc atgtgctgtg ggagcactga aaagacttaa
   125041 tactgccaac taccccggcg ggccggcggt tgattctaat tctactctcc aacgcgcagc
   125101 ctgctcaatc taccggtctc ctcttctctc cccctacata ccctttcgtg aaccttttcc
   125161 gctcccagaa ttaggcgaga attgtcattg ctcggccaag ttattcacta tctaaacaaa
   125221 tgtcgggccc catgtccgtt gtgaacggct ctgcggtagt ttccgcagag tcagactcca
   125281 aatcacggtt ggtgatggct cctcctgcac gtgatgcggg cgatgatact gaccctggtg
   125341 ccttgatttc ttcgtcgtat atagataaga atccagaaga gcttcctgag aaagatgccc
   125401 ccgccgttgt ggatgccatt cgctccctag ccgactcgga tgatgacagt cgcgtggcaa
   125461 ctgaagatga agtctgcgat cttctccatg ttgtggacaa gatccctgtc cgactgtggg
   125521 tggcatgcat cgcgggtatc ttggaacgct ttgtatggta tggggcgacg gcccctctgc
   125581 gtgcgttaaa atcgtctccc cgcacctttt atgattaggg accgtagcta accatctcct
   125641 tagagaacta cctgcaaaat gcccccggcg gcgaggtacc cggcgctttg ggcctcggcc
   125701 aggcagctgc atccaatatt gtgaacgcac tgatcattgg gtcctatatt atgccagttc
   125761 cagcggctgt gctcgctgat agtttcttgg gccgatacaa gaccatgctc tactctgcca
   125821 tgtaccgtgc tattctattt ttatcccttc accccacgtc ctttatggtg ctagttctgt
   125881 gtagaggcta acaggttaac agcattgagg ccatcggggc aacaatttta tttgcgacgt
   125941 cattgcccgt cgctattcat gggggagctg ctcttgcagg cgtgattgct gcctgtgtgt
   126001 tactggctgt tggatcaggg gcattcaaaa ccacggtggt cccgtttatc ggtgggcgaa
   126061 agtctctgcg cccgaagaat gttacgctga tcttttctag ccgaccaata tgatgcaacc
   126121 gagtttcgaa tccagaccag gaagaaagga gagaaggttg tcaccagtcg tgagctaacc
   126181 attacgtata tctacaatgt gttctactgg tctgtagaat atctcccctc cttgtaacca
   126241 aaacgtctga cggtgaatat agggctatta acgtggtggg tttcgtggcc gatgctacgc
   126301 cgctgttgga aagatatgtt gggttctggc tcgcctactt gataccgtgc tgtctcatgt
   126361 ggttggccct tattccagtc cttcttgccg caattacttt ggtcagttca ttcattctat
   126421 aacccgtttg ggagtgaccg actaacgact ggaggtttca gttcgagtat caccgaccag
   126481 caacatcatg ccacaggttg tggctgccct gcgctgtgga atttccgggg gctttcgaat
   126541 ggatgctgcc aagccacacg cccaacttca acacggtcgc gtagttcctt ggacggattc
   126601 ttttgttgag gatatcaaac gaagtcttct aacatgtcaa gtattgtgcg tgaaggcccc
   126661 cagactgtcc ccaagttaca tctaccaggt ctaacatgaa gataccaggc tgctattccc
   126721 catccactgg ctatgctata accagacctt caacaatttg atttcccaag ctgggcagat
   126781 ggtcacctac ggtattccca acgatatgat gaaaatcgcc ggggccatct ccgggattat
   126841 tgtggcacca ataatccaaa agggattgta cccttgccta acaaggcgaa aggtggcatt
   126901 cggaccgatt gcacgcatga cagtcggatt catcgtcctg accctctcca tggtctatac
   126961 caccgtggtt caaaagctca tttatcagac aggaccctgt tacgaggcac cgctcgcgtg
   127021 cccgggctcg cacgacagca cggtgcccaa ccagatatcc gtctttctcc agatccctat
   127081 ctatcttgga ggtgccctgg cggaagtgtt ttgtcttacc acgggaaccg agtatgccta
   127141 taaccacgcc cctaagagta tgaagacact ggtgcaggcg atctggctgg cgatggctgg
   127201 catcgggacg tgcctcgccc tggcgtttac cccgttgacc aaagatccac atctaattac
   127261 catgtatgct attttggcgg ggcttctggg tggtgcgacc gtcttgttgt gggtgctgtt
   127321 ccgccatttg gacaaatcca aagatgtcgg cgggtgagaa actgcggtaa cctctggata
   127381 ggatagggca atagctgctt attggtttta accgtggtga acatggagat gtcggtctag
   127441 gtgtaaatca gggtggtgat gggtgcttgg aagttgtcat tatcggttct actactccat
   127501 gaggataact cgcagatagt attgatatga gtactatgaa taaatactcg aatcctgctc
   127561 tgcatcttga catcgcgccc tagtgaagag aacatcaagt attgagatca aaggctgtga
   127621 cataacaagg ggcgtcttga gtttagataa acacaaagtt acttccagga ccatggtaca
   127681 agtatatgac ctgttggacg aaggcctcta tatgagatac cttggaattg acttgcaaat
   127741 tccgtatcat ctatttgtaa gagccactca ggcctgaacc tctgccatgg cccttgatgc
   127801 attcggtgtc attgagtttg ctttctagcc ttgtgccaca ctgcgagtac aaaagcctgt
   127861 agctgaaaaa tctatacagc ctgagacgca atgtcctgaa tcagctgctt cacttcctcg
   127921 tcatccagag ccttcacacc aagcagctcg ttgtcgtcct ttctccacgg aaagccgtaa
   127981 tcaggccgtg aattaccata acggatgagg tcgcccataa cctggaaaga aacgtgtcca
   128041 gttctaaagt cgtctaatgc ctttgcaaaa accttctcca tgtcaacact ggttattttc
   128101 cagccgtcct tgcctagagc ttcttgcgct atgtctgcga cctctctctg acttttctga
   128161 atactgtaga tataaagcgc cttgttctct gtctcacgcg ggttaagcag agcggcggcg
   128221 gtcgctttgc ccacagagtc cagcgtagtc catgcaatag acaccttgcc gtcgttcaac
   128281 aaagcgatag tcctcttgtt caagtcgatg ttcataaatc cggtttttag gttccagtca
   128341 aggaaggcac cgtttgaaat tgtcgtatac gtaatcttgc cccgctcagc cagctggcga
   128401 atatgttcaa atgctctaca cttcccagtg aagactggaa tagaacatct gttcttgttg
   128461 gtaggatcaa aactgaattc agacggaatg aaacgataga caccggtagc ggcagcagca
   128521 tccataaggt ggatatggga atcaccgtct atgctgacag tgcaatctat gaccgcatcc
   128581 tgtcccttga cagcctcgga tagagagtct atcgagtcgt agttgaccac cctcgtctcc
   128641 actccttttg gaaaaggatg tccttccttt cgagtcagca ctgtgacttt gaatcttgcc
   128701 acgtcgagta gagcttgtaa cactttgctc ccgacattgc cagtagcctg tgctctggtc
   128761 agcactcatt cccttgtcaa ggtaggctct ggtagaactc acaccagcca ctgcgacgtt
   128821 cttgatctga tacatgttca atgttgttgt ggtgcgaaac ccagttgtct ttagattgtc
   128881 gaaagtctag ttctgtttgc agctggttac taacaaagga tgtgacccta catgatataa
   128941 atacagtgaa gtactcacgc ctctgctctg aggtgcggaa cacctccgtt aattatttcc
   129001 aatacttttg taatcagcaa ctgagacata tcgcctcgct gtgatgctga cataccggct
   129061 ctattcaatt tataagacaa ggtccgcagc ccatccagaa agtataattg cttgggaggc
   129121 cagtctggtg ttgttccaga gacccacagc cactgatgat ccattgatgg atggattaca
   129181 taccaagacc atttaaataa ccatcatata cgcgcttaaa gcaaaacagc gtggcttggc
   129241 agtctcgtat tgcacataca gacgccacaa gacacacaaa gacctctata atcctttact
   129301 caccacactc cactattaca acccgaagag gaaaataaac cgttctcttt cgtccagtcc
   129361 acacatggtg cggtacaggc agcaggtccg atagacagtg caggcggttc agttgtgtct
   129421 gagttgtctg agaaggtaaa gcagtgggtc ccgtctgttc ggcgtctgtc ggaacgtgct
   129481 ttgcaccgag ccaccgagat accggggagt tactttgctg ggcaggtgaa cactggagtg
   129541 atctagcttt tgtccttcct tggatattga agctctggca tactaagccg gctctgaaat
   129601 tatgattcca atgatgtact acaagccgcc tccctttcct tcccaaccct gaacctgcca
   129661 caccttcaag atacagtgtc cacctttatt gcgagaatgc gccgtggctt cctagagtta
   129721 ttggctcgcc attacgaagg ggcagtacat aatgtgacat ctggaataga ttgcagtctt
   129781 ccccacatag cgatctagac gtcagatgta ttatgtcacc ctcacgccag cggagcatgt
   129841 tttgcactca taaagactaa gtaatgcgat cctgatggag agggcgtttc ggccacagcg
   129901 aggttgcatg cgattatgta tcatgatgga agccctagtg gaggatcagg ttatggaaac
   129961 tgttcatccc tggccctggt tatttctgta tgagagctta gtttccgggc ggctccaagc
   130021 ttctaatagt ggttggtttc acctaagcca gtctccacga tgacatgagc ggtggtctat
   130081 ctcgtgacgg atcattcgtt tcaagcgata aggtgtaacg gttatagaag agcctaaaac
   130141 acataaggcc ttcgataggt agtatggtgt cggacttaac cttatctctc acaagcagat
   130201 tccgtttcgt ttcacggaca ccgatcccga tctcatatga tgttggaaag ccttctccaa
   130261 aacttcaaat gataagtcta gaacgcccac atcaatacag actcctattt gcagtagttt
   130321 ccaatctttc ctacagttcc atctattgtt ttacatccaa agaattaacc caaggaatcg
   130381 ccatggcagt ataaagcgaa gtggtccgag aaattcgaga ggagctgctc tgggaggaag
   130441 acgaccttga gcaggtcgtc aaaaacgctc acaaatggga cattcccgag ctggacaagt
   130501 acggcgtcat ctcatcgaga ggctttcttg agttcaccga ctggctggtc cgaagctggg
   130561 ttcctactga gtcaaccaaa ggtcgcgaca tctactacat ccttcgtgtg ttctatttcg
   130621 ccctgtccca agagccgttg ggctctcgtc tgactaagat tcaaccgctg agtttgaaca
   130681 agcccctcaa gctcctctct gactgggtgg tccaatttgc caaagagatc ggaagcagca
   130741 tggacaagcc ttcctcaatc cattaatgag gctgccatta cgacattccg aaactctccc
   130801 ctcttccgtg ttttcgattc tgagggggat gccaagaact ggacaacatt caataagttc
   130861 ttctaccgga ggctcgacaa ccctcgcaag atcgcgtgtc ccgatgatta tcatattgtg
   130921 gccttccctg ctgattctat cttcgccggg gcgtatccta tcagcgagga ctcagaggtc
   130981 gtcctgcaaa agaaagagtg gagagtggtg aaagatgagg taatattgaa gaatgtcccg
   131041 tggaaaacaa aggaacactt caggcatccg tacccttgat gcccccgaca ctccgggtta
   131101 tcagttcctt cagacccgag gagtggtgat gtaaacaatg agtacttgag cagggttgcc
   131161 gtgcttccca ttggcatggc catggtttcg tctgttaacg tgagaaagga gcttcaaggc
   131221 caaaagatca aaaagggtga agatatctca tactttgcgt tcggtggctc ggactgcatc
   131281 attatgtttg agcggaaggc aagagtttcg ggttttcctg attctgacag agccttcccg
   131341 tgcacatttc tgctatggtg aaaagttgtg cagggcttac ttcaaataca aagagcctaa
   131401 atctttccga tcccgttgcg gtttgccttc cagggaatgc ttcgaggtga ggaagtccag
   131461 aatggtaggg gctggttgct tcgttatgat gttttaaatt gttcattgtg tccatgttac
   131521 tattatggat atgttcttag ctacaattcg atactcttct tgcacgtctc cgtcaaccgt
   131581 tggacctgga tgagatctct tgtctgtcgt cgcgatcgta ggcaactcag ctgtaggtat
   131641 ttgtggatgg ctttaagccc cagtgactct tcgtatcttc agtgacttga cgttggctat
   131701 gagggtcatg ccgtgtaagc gctggattga cggatcttac ttccgaaccg atagaatatc
   131761 caaggcagag gagcaaaggc gatagcgagg aagccgagca ggcttgatgc ccaagtaaaa
   131821 ccaagattgt tgtacactat atcaatcagt cagctaccgt cccaggccag tggttagagt
   131881 gacgacaact tacttgggat ggtgaacaag ggaaaagaac cgcccacacc atatcgcagc
   131941 agaccgtttg ctgccagagc tgaggcccca gccttggctc cgtacacgtt cgtaagatat
   132001 agcatcgttg agacctgcat ttcactcggc gttagcacca tatcacattg taccaggtag
   132061 aaggcgtaca aagatcataa tgttcgagca gccaaagagc cccatggcga taatactgct
   132121 tatccaatga atcccaggct gtgaggtcca ggcaaaccag aataatgccg caggcatcag
   132181 ggggctcccc atcatcgcgg ccataagcat tctttcggga ggtgctggct ccccgggatg
   132241 tctggcacgg tgcttggaca acgtgtatgc gtcgacgatc accaacgcca tagcaccgat
   132301 gatacagccc acggcaatgc caatgaaagc cagtccagac tgacccggtg agaagtcata
   132361 attggtgctg tatatcagcg gcaccgaggc aaggaagcaa aacaacacgg agaaattcag
   132421 cgaggagtag agggagcaga gggtgacgat gggctcggtg agcagcatgt agagaggtcg
   132481 tgccagtgtg actgtcatga gtatcttgat tcccgctaga ccatcaggaa tcggctttgg
   132541 aggaggagtc agtccggcct ttttagctag gcggcggcgt atagggatcg cgtacgtctc
   132601 ctgggcaccc atcgaataga cccatagggc cgctccgagg aacaaagttg tccattgaga
   132661 ccatcgaaaa tctttgtatt cggcaatcca tccgcccacg agggatccta gagcgggtcc
   132721 caggaaagca acccccatca acacaaccac cccgcggttc gtatttgggc ccgaccagac
   132781 atccatcatg gtcccggcgc ccacggcgag aggtgcagag cacaggatgc cacccaacaa
   132841 gcggcatatg gcaagcgtcg cgaaattctg ggcaaatcca gcacctagga tgaatagcag
   132901 ggccagtgga gtcatgataa tatacacgaa gcggcgccca aaggtctcac tcaacggagc
   132961 ggagatcatt ggaccaaaag ccaggccata cacatataag gtgaatggga gtagcgaaag
   133021 ggtgttactg atgtgaaagt cctcttgcac atgagcgtgg gatggcgaat agatggccag
   133081 gccgaaggat ctatttgcat gcgaaggtta gtttgtttat cgagttccca tctctagaga
   133141 gaagcactaa cataagcaga caaagaaggg acggaatcga cgtgttgtat aactttttgg
   133201 ccaaactcca gttctgggcg ttggatggat ccgttgtcca gtccggtagt tctccttcct
   133261 gcttttctag agaggaagtc atgctgttga cttctgtatc gcgagtgctt aacgccatga
   133321 tggcacggtt gatctgcatg gagtattgtg gacatctctc tatctatata gaagtgtata
   133381 tgtgcatgtg actcgagacc aatcggttat gacggatgat ctatcagata aacacggcgc
   133441 aagagaagcc cagtaaggaa tagcccaggc tcaggtaaat ataccggtta tacggaatgt
   133501 acattggtca ttgaagtttg cgctgtgttt ggggatcacc tctatcctca gttgcacttg
   133561 tggccaatcg tttgccaccg ttgaagcccg gcggatattc cttcgaccca ctaattcggc
   133621 gagaagcatg ccctacccta aggcattcgg tacccgggcc aaaaaggtaa cctgaggact
   133681 gcagaccttt atggtcaatc agatgttctt gctacctgct cggtgggtag agccttgtcg
   133741 aaaccgtgcg tataatggtt ggtttataac tatgcactca aacctttcaa ttgcttcccc
   133801 acgaaacgaa gtacatgtgg taaagtatac agcgatgtgg agatttatct catattacct
   133861 tgctttgcat tgaacttaag aatcaatgaa cacaggggaa aaagccttcg ataagaaatt
   133921 gcggtcgcag ttcaacattt ggagcagtag ggttaagggc gtctttaccg cattcggaaa
   133981 tggatgaggc cgatcggacg gcaacaaggg aaatccatat actctcgcta ctggaaatag
   134041 aactacgcac agcgatgctc acaataggtt tataaatcaa gatagagtat tacccttgct
   134101 cctacaataa cactgcctgc aacttctttg gctacactca attagtcttt cgatagcgat
   134161 tccattgcaa tatccccgtg gtaaaataca tgttttaaga atgaatccgt agtatagccg
   134221 attcacatac atctggaggg ggcatatata aaatgggaat gagacgtatc agggtagtca
   134281 ataaataaga aagtcaaggt ggttgtctaa ggcgcttaag gtcaatccac agcaataaga
   134341 tatgactagt cagagggggc aaaagtaggt ctgtactcaa gggaggttct caacatattc
   134401 aaccgtttcg gtttgctttt caacccgccc ttcgtcaggg atattgcaga cgtacgatgc
   134461 aaagctgcga gttggcaatt gctcattgaa catctcgtca atctgctcca agcttcgttg
   134521 ccgcagctca ggtacgaaga aaaacgtgaa tagaaatgcg acaaccgaca gtgacccgta
   134581 gatgaaggca acgctaccac caatagcatc ttgtgtgtac gggttcacaa atacaataat
   134641 caagccgaca ccgtaggcgg aaaagccgga tagcgtaacc attttctctc ggacggacgt
   134701 tggcggaacc tcagaagtaa tgacccaggc gagagggccc caggtagtct ggaagcagaa
   134761 gaaccagagc atcaacatga caaccgttgc tacctgcata gagtatgaca tatgcgacgt
   134821 gccgcgtgtg gtcaacccgc cgatgaccat catacatgca cagagaagtg ctgcaccacc
   134881 aagcatgaca ctgcgccgcc ccgatcggtc ggccgtgaac atgcttaaca gattcgctac
   134941 cacgccaata acatatacaa cgacagacat aagtagcact tcgcgaaacc caatctggga
   135001 gaggaaaaca gcttggtagt tcgcgacgaa ggaaatccct tgagcctgtt ggaagacctg
   135061 agcaccgaca catatgattg tcctgcgaag gttaaccgca ctagagaagc aatccttcca
   135121 gctggtggcc tctcgcaatg cccgctcttc ttccaatatt tgttggagta ttacgacctc
   135181 ttcttcggcg gggaacccgg agccacggag acggcgaagg gccttagttg cctcatccag
   135241 ccggcctcgt ctgatcagcc agtgtggtga ctctggcagg aagggtaggc tgatccagcc
   135301 catgaaagga ataccaattt gtgccacgac aacgactcgc caggcccagt cggtggtgat
   135361 atgacgacac aagtagacga tgagtgcagc tgcgaagccg ccaatcataa ggaatgcgtt
   135421 gtatgtgccg gccatcagtc ctcgcaacga tggcggggca cactcgcctt gatatgtggg
   135481 gatggcgttg gtggcaatac cgccgccaaa atacacaatt gctttgccga caacgaattg
   135541 agcgtagctt gtggtgcaag tcgactcgat gatgacaccc actgctaccg caaaggactg
   135601 gatgtaaaga gtcatcttgc gtccgaaccg ttcattcaac ggtgtgccac atatgacgcc
   135661 cagaataaca ccaacgtaac ccataccagt tccaatagac tgatttctag aggagagaat
   135721 ccatttctcc tgggccggat catatgaacc aaacctacgc aagaactggt ccaagctcat
   135781 gatagctgac caccaggcct ggtcgaatcc aaatccagca gatgataaag agccaaatat
   135841 catgaccatg aatatggtcc aggtgaggtt ggacgtggct gaagacatcg tggtgtctgt
   135901 gcgaggtgcc atatgataga ggatatttgc aggaggtaaa aattggaatt gggttgacga
   135961 taatgagttt gaactacgaa ctaggcgcaa ccgctgctcg ccttttatca catttcctgc
   136021 cccaggaatt ttgcagcagg ccttgttcag tattcgcctc cgcctatggc aggcaaatac
   136081 ggggttggtt tatggggaag caatatctag ccccaactta ttccttgtcc ccgcttcgtt
   136141 cgtatcctag tgcaaccatg tggaatagcg tttgtttgaa ccacatggtc tatagccaag
   136201 agggaatatg gttcaatcct tgtctgttcg tggttggata agccgtcctt cagatcatcg
   136261 tatggtatga ggctagtggc acatccacgc tgatgtacct tcatatgcaa ggttattacc
   136321 tcgacagggt tgtggaagtt cgatgaccgt ccgctcgaaa aataaatata tctacagtaa
   136381 atgaagaaac attgaagttg tcatctcgat attagggcaa gcaaacgagt acaccagtcg
   136441 aacggaaaca tgtagggcct tcccggctgg tacacttagt ttagttccta gtcttggctc
   136501 cagactctag actatcccac cgggagtcta aatcatcttt tcacggagcc tatcgaatcg
   136561 acccaccatt tcggcgacca gtggggctaa gccccattta ttccacgaat tctaagatac
   136621 cgaaatctca gcgtcaccga gtgggttctg tccgatccac cacgctgcgt ggcgatgatg
   136681 ccccggatac gagcagtata ccatgacgct ggctttgggg ttctctctcc aactccgcat
   136741 tataaaggtt gcgggggaaa ttgagaggat gaagataccc agatttacac gttgtacgct
   136801 caatcatttc tcttcttctc gtagctatca ttattccgtt cgttgtatct ctctcgaagg
   136861 gggtcctgaa tccgatgaat atggttcacc atgagaaatc cgccgtggaa gaattacttc
   136921 gggccttgac cttggaggag aaggtttccc tgttggctgg gaaaaacatg tgggaaacag
   136981 cgaacatcga caggctgggg atccctagtt taaagatgac ggatgggcca gctggagcga
   137041 gagggtcaaa atggacatat ggttcactga caacattcat tccttgtggg atctctttgg
   137101 ctgccacatt tgatccggag ttggtccaaa aggtgggcgg cgtcctaggg gaggagacac
   137161 gacgcaagca ctgccaggtc ctcctagctc ccactatgaa tttgtcgcga tcccccctag
   137221 gtggtcggaa cttcgagggc tacggcgaag acccgtactt gattgggaaa gtatcgactg
   137281 cgataattcg gggtattcag agccaagggg tggcagcatg catgaagcac tttatcgcga
   137341 atgataccga aacgcggcgg ttcaacgtcg accaaaccat tgacgagcgt actcttcgcg
   137401 aagtgtacat gaaacccttc gtgatggctc tggatgcgga cccattaact gccatggtca
   137461 gctatccaaa gataaacgga taccacgcgg acttgagccc ttccatcctc aagccgcttc
   137521 tgcgtgaaga attgcaattt gaccgcatag tcatgagtga ctggggtggg ctgaacagta
   137581 ccgtggagag cctgatcgct actaccgact tagaaatgcc agggccggcg gtgcgacgtg
   137641 gtgaaaagct cctcgctgcc atagcacaag gtcagatcga cgtcgccaag cacgttgatc
   137701 ccagtgtcag acggatttta gaactacttg atcgggtcgg tctactgtcc gaatcatccg
   137761 ccaatggcgc cgtaaagaac gacgaggctg aatctgagaa agcgccggac gacccgaact
   137821 tccatcggat cgctcgtgag gcggcacagg acggtcttgt tctcctcaag aatgagggtg
   137881 ttttaccctt gcaaccctcc tctcttgaga agattgccat cttgggtcct aatgcccgcc
   137941 gtccgacagc gggaggcgct ggcagtgctg ctgtcaatcc attttacatc accactcccg
   138001 aagaatgcct tacgaccgcc atccgacaag tcaatccagg gacggaaatt gtctacgagc
   138061 agggtattcc gtttagtctg cgcccacctc tactaggtag caagctcacc acacctaatg
   138121 gttcccgcaa gggccttgag gtaactttct acgccggaca tgagtttcag gggcccccag
   138181 tagcaaccac ctactgggat gactcccttg tatatctctt cagcgatggt gatgtcccgg
   138241 aatcgctcaa gggcaccccc tactgttacc aggcatctgg cattgtgaca ccccaggtat
   138301 cgggttggta tacatggagt gtggccaata caggaaaggc taagctgttc atcgacgatg
   138361 taatgatcat tgataattcc gagtggtcac ggataaccgg aggcttccta ggatgctcca
   138421 gtgaagatcg gactgttcgg atgcaattgc aggcagagaa aacatatcgc ctgagggtgg
   138481 acaacatagt gacactacca cccatcgaat cctttgataa tacactcttt ccaaatgtct
   138541 cgggcctacg ggttggcctt gcccgggagg aggatgagca ggcaatgcta aaccgcgcag
   138601 tggattgcgc cagatcatcc gatatagctg tcctcgtcgt cggtcacaat aaggactcgg
   138661 aaggtgaagg tggggatcgc atcaacatgg aattgccagg ccagacggat gcactcgtcc
   138721 aagcagtatg tgaggccaat cctaatacaa tcgttgtcgt tcaggcagcc agcgctgtaa
   138781 caatgccgtg ggtgaatcaa gcccgcgcga ttgtcatggc ttggtaccag ggccaggaga
   138841 atgggaatgc cttggcagac gcccttctag gtcattgcaa cttctccggt aaaacgccta
   138901 tcacctttcc tcgccagctg gaggaccacg gctctcatgc atggtttccc gggcaggccg
   138961 ccaacgacgc ttgtgaattc ggggagcaag tattggttgg atatcgtcat ctcgataaac
   139021 acggcatcaa tccactttgg ccgttcggat atggattgtc ttacacgcgg tttgaggtca
   139081 cagatattcg ccttgatggg cacataacca ctgcaccagc ttccaccatc tcgatccacg
   139141 ctcgcgtctc caacgttggc gaacaagatg gctccgaggt agtccaggcc tacgtcagtc
   139201 cgtccgagca gatccaaaag aaggggctgg tcacctatca aaagacactt gctggatttt
   139261 gcaaggtgtt cgtacctgtt ggagaaacca gagacgtcgc tattcaggtc agcaaggaag
   139321 aattgcgttg gtataatgca gaggcgcgtt catggcagct agatccaggc aggtactatt
   139381 gctttgttgg cactagtgcc gttgatattc acggcgaact ggagttccat ctggtgtaga
   139441 taatatataa ctacaggtag aggtatataa tttggttgtc ttgagacatt agggttcatt
   139501 gggccctgtg gcgtggctta gcgcttagca gggtgggtca cctgattact gtgtagttca
   139561 atacggtatt taattcgacc gcatcccatc attcatcgtt ctaaatttca cgataatcca
   139621 ctcagcctta caacatggac ccctcgtcca gtccctcctc taccctaccc ccttctgtcc
   139681 ccgttgcctg tcttaactgt cgcgagaaac atctcaagtg cgatggtaat ctgacaggat
   139741 gtacccggtg caaggacttg agtctctttt gccactttgt accgagccgc cgagggagac
   139801 gaggacggcc ttggccctat tcaggtgcaa tgggagacta tcctccacta cctgtcgagc
   139861 ccaccggcaa tgcaatgatg acccctttag attccttagc atgtgctgct ccacaggggg
   139921 acgcgacctg ttcatcgctc ccccctcgga tcgacaacca gctggttacg ttgtttttcc
   139981 tccatttcca tcaggcccac ccattcttgc cgcctcgcga cgcattcctg cattcttctc
   140041 ccccaatcta cttgctggac gtggtacagt tcatcagcgt acattacctc cctgccagta
   140101 atgttccaga ccacacccac cagctatgca cggccgtcca ggaggcagaa gccagccttg
   140161 agaaggtcca agccctttta ctcctatcga tcatcatgca tgcacgaacc cagccgcgag
   140221 aggcgaagga atggcttggt gacgcgattt ctttgagtct ggatctagga cttcactgcc
   140281 gggaattttc tgaggctttg gagatccaga atcctgtgcg ggctgagagt gctcggcgta
   140341 cgtggtggga gatcttcatt attgataccc ttctggcggc tgtgcaagtc gatggtgctt
   140401 tacagctgac agtagagaca ctcgatattc ccctgccttg tgagatggac gaataccagg
   140461 atggccgctt ggggattgtt ccaatctcac tgcgtgatat ggatcgtcag gcactgttcc
   140521 acaatgatgg cgatttctca tccgcagcgt acagggccga agcagcgaca atacttcgaa
   140581 agtgcctgat cgcaagcggg aatcatgtct cccatgaaac tatcaatatc ctcgatgtca
   140641 ccatttcggc gtggttccac cggttgccca gcggcaagca ggcgatgttg catcataatg
   140701 gtgacgtgga tcaaatgata ttccaatctt ttatgataat gcactgcgcc tcaatatact
   140761 tgcacttccc aaaatcatat ctccttgcat ttctaccggt gactagccac atattttgtt
   140821 ctcgaccccc caccttcacg tcgagttccg caaaccctca aatacacaca gccaaggtat
   140881 acggcgcggc ggtcaaccta tccaagcttg cctccttgac gaccagcgtg gctagtcata
   140941 gccccttctt cgtctgcact ctagtcctaa gttccatcgt ccaactcgct gtctttactg
   141001 ctgatcccca gcaatcgagc cgtacaggcc gaagcttcct agccttgaat atcggcgtcc
   141061 taaaatccat ggggcatgtg tggacgatcg cggcgacttc gatggcgcgc atccgcgatg
   141121 tagctgtcga gcttgagtcg gcgcttgcca gggagagcag agcgctgtta gatgatcact
   141181 tgacccagtc cgttttagtc gactctcaag gtttggacgt aacattttta taacgcgcac
   141241 tcaatctccg tatccctcct tccccatggg gccaaccgcg cgtaatttca gctaattcaa
   141301 aatcacagca caagtgctac gtctgcaagg gggcctagaa ggttcgaggt attatccaca
   141361 ttcctgttgt atcataaatt cgatcaatat acgtgtgtat aaccgccata tatatacgcg
   141421 aacgtgacta cctcccagtc atcctaaacc agagtggctt caggtagcac caaaaagtac
   141481 atgtcaccat agagctcaag cctcgtgaaa ttcaagtcaa gcttactacg gggctaagga
   141541 ggtatttgca gttcatgccc ttcgtaagtg actgtgatag ttgttgtgat ttagaatctt
   141601 cagtaggtgt atcttgatga taacctattt actcatgtct atcttctgct taatacacaa
   141661 gttcagtgat gactaccaaa ccctcttcca aaatgtgcga cccaaccgac ccttcgggct
   141721 tcatacccaa gcatccagac tgtatccatt tctatacgcc aatgcttctt gtggaccctc
   141781 tgcatcaatg atatacgcat actcacatct gtcgaatgac accttggact gcgcctggta
   141841 gaaggagtcg tacttctcat tcagggcatc ccggaggtta tgcacggatc caccgggatg
   141901 caacacactc catggttcaa tgcaagaagt ccctttgcaa gatttcaata ccaaaagaag
   141961 ggcatcaagt cgtgtaatta ctctcgaaag gctgtacccc ataattcggg tctcttgtga
   142021 gttatctgtc tgcaccttgg catacaggtt gttgatttga tacgggtcat tctatcgatc
   142081 gtcagctctg caaacaaatc catattgagc agcataatga cataccgtga gatcataaag
   142141 ttcgtgttcg ttattgcacc atacggaata ataaaggttg tactcctcgc tcagtatacg
   142201 aaccgccttg tacgtattgt ttggcaccgt aggcttacct ggttcaatgt aagcactcta
   142261 gtgaaggcag gttataggta atataacaag ctcttaccaa ggttagacaa tcctccctcg
   142321 agcatcgcct gcccccagta ttcaacggtt acatgctcgt gcagagttcc catattattt
   142381 ctcagaatgc gcataggagc accgtcgaaa tcatccctga ggggaatacc agccaattcg
   142441 tagaaggtcg gagccaggtc aatatgggta ctgacggagt cttccacagc cccttctggg
   142501 attccagggc ctcgaatgaa aaatgggact cggatgtcct cttcgaaccc gcaggtcttt
   142561 cccgggggaa gtcgatgctg tccgatatga aagccgttat ccgaggtgta aatgatataa
   142621 gtgttatcaa gcttgtcact ctgctctagc cgagtaacaa gactgtcgac aagttcatcc
   142681 acaccctgta gcgcacgcag tcgttggcga tagtaatggt cattgtagtc cacctcagtt
   142741 tcgtttctga agggaaggtc atggatccaa ctgactccag taggctgttc tccagtcagt
   142801 ttctcggagc ttcctgaaag agagggagag agacaactta cttcctttgg gttgaagtta
   142861 gccttacgtg gcaccttggc ctcagggaaa aggtgtttgt ggcggtcttc cgggataggt
   142921 tcgtccatcc atagaggccc acttccggca ccgtatgtcc cattcatgtt ggaatggggc
   142981 gcaattggcg acacggccat gaagaatgga cgttctccac taagagcgtc ttccaagaac
   143041 cccatggcct tctccgtcaa cacctcggtt gtatgtcttc ctaggtaact aactggagcg
   143101 tcgtggttcc gctggtaagt tgcattcata tagtcatacg tgtagggatc caggaggaag
   143161 tccgacccgt tgaagccaga gacgtgtgga ctggcatagt tctcgatgga gtgtgcattc
   143221 atcagttttc cggtgtagta agtgtcgtag cctgcttgtt gcaaccacac cgggaggaag
   143281 ttcttatcga accctccctc aacaaacttg gggtatccgc ctgctcatgt gttagtaaca
   143341 gtgggaggtt tctcgagaca aggcgcttac cccacggtgg atgaacatcc gtaacgttgg
   143401 tgttatgtgc taaacgtccc gtccataaac taactcttga tggacaacag agggcggtgg
   143461 tcacgaagtg gttgttgaag gtggttccct tgtcccgcat atgcttcata gtcaatggcg
   143521 tataggacag tgagtccagt aagaggtctt ggtcatcaga cataatgaag aggaagtttg
   143581 gaggtcgctt cgagactgca ttttgttggg caacatgctt ctcggtattg attgagccca
   143641 ggttagcttc agtcactcca agcaggccca aagtagtcag aatcttcttt gtgaacttca
   143701 tctcgcttgt tgagcttcag tcaaactccc tgatgttacg gaccaccagg cgacacacgg
   143761 atgttatata aacgctgcaa aatccgtggt ttgaagctaa tcttgggact agcaccccat
   143821 gggcctccaa gagtaccaca atgattattt tccacgacga tcctaagctc gtaaatagag
   143881 tttgcgctct gaaggattcg ccgaatatag tggaattctg ctctccacaa actcggcgat
   143941 agactaactt cgatgcattt tcattgtctt tctagctcga ttccaaacta ctggaatatt
   144001 ttcccacagt ggattctagt tagctcccat gtatcgtctt tgaatatttc ccgtcactcc
   144061 caccgggtgg cgtgccaaac tgcggcccaa ggagagaagt cggcatactc cgttgtagtg
   144121 gcccagtaca acttcctcat caggacatcc ttacgatgct aagatttcaa agcattactt
   144181 gtgctgttct gtatttactc tagcgttggc tccacgtgga gtcgacattg acgaaggatt
   144241 ccactccaat gggtaacgca ttcatgcttt acctctggag ggtaatgaaa cttgcgttgg
   144301 agaaagaccc acaatgtctc gtcacggggt aattcaagac actccgaaaa gacagagtgt
   144361 ttgttgggac agaataaagg catggaacgg tcaatggtgt gggggttatt cgtctgccta
   144421 cttcgacttg gcatgcatta atgctacaag gtctgatgcc tgcctcaaac gtacgacacg
   144481 gcctttagta ttacttgttt gtgaggcctc ctccatagcc catcctatga aagacggcct
   144541 tgttgatccc gtccacaaga aacgaaagta aagcatagaa atcaatcgag acatcttgca
   144601 tttcaactag atacaaaatc catatgagaa gaatagccta agagctaatc tcctccgcag
   144661 aaacaacagt tccaaaagca tcggccaact cgttgagagc taccgccacc aattgctcgg
   144721 cctcaacacc agggatatga cgatcgccca ccgcatcctt cacaataacc acatcgtagc
   144781 ccaattcact gccagctctg gcagtagtgg aaatacacac atgtgccata tatccgacta
   144841 ggacaatctt cttgcccagg tctcccaagc cgatcaagta atcgtggagg tcagtcttag
   144901 cgaaagagct cgggaagttc ttagttacga tcttctcacc gggccttggt gtcagctcct
   144961 cgaactcttc tgctaacgca gtgcccggag tgaacacagg agcaccggcc ggcacttcgt
   145021 ggaccacgtg aacgatattg gagccgtcgc caccgttgcg ataccgagac agtaggtcgg
   145081 cgatgacttt gcggctctcc gccacgcctt cgaccttcag ctggcccgag gcgtattcat
   145141 tttgcgcatc gatgataatc agagtggagt ctttgacaga ggctgtcgaa cgaggaatgc
   145201 caatggtttg gcggaaggat tgagcattgg aagccatggc tgaactagtg gtgttgtctc
   145261 aggaaggatg gttttgtgat ggttggaatg attttggtct gctagaatga ttgacacact
   145321 ttttaagtag gtaaatgttc tggtctgtgg tcgattggtc agtccacctg gtggcccatg
   145381 ccattacatt gaccaagaaa tgcatccgta atcaacggtg gggtttgtca gaatcccgcc
   145441 ttggttgttg gtgggatgcc ggtgggcttc cggtgggttc cgctccggtg ggatatcgga
   145501 taattctgga gaagtgccac tgccccagtc gcggacgtat cgtcatattg tcttggcttc
   145561 tatactcata ctaattgctt tagtgtcgta tgcttcccgt gtctatgatg cctgcgagtg
   145621 gaataggccg cttttactgt cgctatcaag gttgtaacgc cagttaccgg cgccaggaac
   145681 atcgaactcg acatgagagc cagcactcca gccctagaac agcagattgt cccttctgcc
   145741 atcgcagttt ctcccgcagg tatagtgatt ctacaagttc ctcgtcgtaa ggtaccgact
   145801 gactaccata gcgacactct ccgccgacac atacggcgag accacgagga ggaacaacta
   145861 gagacctctc gcgcgactcg cgcatgtcat tcctgccgtg taggcaaagt tcggtgtcga
   145921 ggtggaaacc catgcaagca atgtcgggag aagggccatc gttgcatctt cgaggatcca
   145981 attccttcac agccaaatgc accagatact ccgccttgtc tcgatgagag catagatcct
   146041 gaaccttcag agctccatca acacgatccc gggtaccagg ttgaccagta catccaatta
   146101 tacttcgctc gcttccatcc ccggtggccg tttcttcatc gtgccacttt cagtgcttca
   146161 catgagccat ccctcctgct gtatgccgtg gtgatggttg gcatgtgggt gtccgggaaa
   146221 gattctagcc ggagggcagc actggatcta cacaggaggc tgggcactct tattcgtcaa
   146281 cagcaggtta gctttttgta tttctcttgc cttgtatggt taagaaatgc taacggcagc
   146341 aacaccatac aggccacctg gcaagattta agtaatcatc aacagagacc agcctcagcc
   146401 tggccaattg ccacctacca aggcgtcctc ctctatctga tattctctct cctgtcggcc
   146461 ccgcactact ctcactcact tgacttgact attcagcttc ccgtatcaga ccggaggata
   146521 ctaacagctc tggtacagac gtgccttaga cacaacgtgt ttttttaccc agcaatggta
   146581 gggcgatatc aggatatcga cgatgttaca tgtatatggg tgggagtaga agaaataaag
   146641 cggttgggtc tagctctgta taaggtatgt aataggtgcc ggggcggcct gcaaggcgaa
   146701 tcagaagaga gtaactccag gttactttgt ctttccgacc tgcggtttcc agcacccgat
   146761 agcaaccatt tatgggaggc taagtccaat atggagctct ccaatctact agcacaaacc
   146821 tccagagata tgaatccgga gggaggtcat gagatcaaat tgatatcgga aagtggggga
   146881 tggttggata atgttgatcc cgggttcaat tggatttgat tcctattgca tgcatataga
   146941 tttcatgtaa atgatataat tatgattcct gtccaagaaa gaatacaaaa catgacgaag
   147001 tcacggagtt tcccaggaat attcgtgata tagcacacac ctataacatg atgggagtcg
   147061 cttaactgaa tgtcaattgt caatatcctt gtgacacgcg atgagactca cgaatatggt
   147121 acaaagcaac agttacacat tcctgaagct ataataacag gcgtccaccg acgcatgatc
   147181 cgactccgtg cgacttcagg gagcatagac atactgatca tgcatgccca acaaccatac
   147241 gctgaagtca aaccgagagg ctgcgggtca gatatattaa tttctcaatg gggatttgtc
   147301 cttgcgagga agtgtagaga atcaatattt attcgatctt taagcaagaa tgcgtttaca
   147361 tttcgtctat atacgaatac acaatatcaa acagtacagg aaataacaca cgccactgat
   147421 atggccacat ttcctgtcac taacatagac gaggagtggt gagactagat aatccgggct
   147481 tccacacctg gggtgagcca gcggacaagg ttagccaccc cttccttctc aaacacacgg
   147541 aggaggtcgt cccggtgctc ggtgaaatgc tcccaggact cgaaatggat cggcaccatg
   147601 atctcggcac cagtcacacg catgaaatga gctgcttgct ttccgtcaaa cgtaatttgg
   147661 atgatgccgt tcggatgaga gaaaagtgcg tttccaaggt tgagaaccgc gaccgatatg
   147721 ttccactttt ccttgatctt ctcgaattcg tcgatataca cggtgtctcc ggagaagtac
   147781 accacgttgg ggaggccagc cgcgttgaaa ccaaaggatt ccgtttctaa aatgaatcca
   147841 gtcacctcgc ctcctgggaa gtgcttgcat ggggttccag taatgcgaaa ctccttgcct
   147901 ccgatcgtag cggagacagt ttcccacggg cgaagaccga ctactcctgg tcggggctgt
   147961 agattatgcg ctccgtcggg agtagtgaag accttgcgac cgtccaggag ttggcggccc
   148021 aagggatcca agttatccac atggtcctca tggcttagca gtaccgcatc gatcgggggg
   148081 aggtcgtgga gttgcaatgc cgggccctcg gtgcttcgga ggacgccact gggcgggcgg
   148141 ccttcaaatc cataatcctt gaggttggga gcctttgccc agccatcgta gatatattgc
   148201 gatccggccg ggcagaacac cggatcagtg aggaagttga tgccgtcgat gtttatgata
   148261 gcggttgcgg tggtgacgtg cgtgatgcta acaacgctct tgaatgaaga tgccattttg
   148321 agtgatccgc agaagtagct tgaagttgca gtcaaatgaa gaatgttgat gagacctgaa
   148381 acatggtaac tgaggttctt aaatattcaa attctcgcaa agagaaacct atatctcggt
   148441 caatagtgtt ctcctaatca tcactcccac cggaatatta gtaacttgcg aagaatttat
   148501 aacaattgtg agacataatc aaattcatca ttacacccac cggcgaccat tgagctttac
   148561 gaatttcatg ttagtgatta ttcagtgtag actaacaggt attgccttct gctgccttct
   148621 cctgggattt ctcatcagag ggctattgcg tagcggtcac tttatcgagt tttctttgct
   148681 ttgacatgct tgacaagtcc ccttaacaag ggagaaatca gaacatgctt ggtaatgcac
   148741 tgtgggtata ttagtagtcc tcttttaatt cttttaaatt ctttttttac ttatttcttg
   148801 tttcacatcc actttttccc attggcctgc tcatctacga accgccatcc aagtccctaa
   148861 attcgttaat gacagtgtgg ctatctgcga ttctcaacca ttcgctctcc taagcctgag
   148921 tagcatcagg ttgcaacatg agtcagtcaa atgcggttga tggaggctac ggctggatta
   148981 ttgtcctagc tgtattctgg aataatgccc accattgggg aattttatca gtagggtggc
   149041 gtgtcctttt tatctggtaa ctgcaaacta accttcccag agctatggtg tcttcttgga
   149101 agacttcatt tcaaattcta gaatctctgg tggtaccagc cttgacttcg cgctgattgg
   149161 cggactatcc gcatcgcagg cgctcgttat atcgcccttg attaccatga ttcatcgtcg
   149221 ttttggtctt agagcaacta tggctctcgg tgtgctcttt gagactgcgg ccctcctggg
   149281 agcgtcctgg agtaccaggg tttggcaact ctacttgagc cagggcgtct gctttggatg
   149341 gggtctcggc ttgcagtatc tatcgaccac gtttattatt ccacaatggt tcagcaagaa
   149401 gcgaagcttg gccgcaggga ttaccacggc agggaccggt actggaggat tgatatactc
   149461 gctagcaact cacgcgatgc tagaccggtt cggcagtggt tggtcatatc ggattctggc
   149521 gattatccaa tttgtggtta acaccatatg cgtgctcctc ttgcgggatc gtatggagaa
   149581 accccggtca gaaagaaaaa aggcaacttt tcgcctcagt ctctgcaaga gatacgaaac
   149641 ctggctattt atcggctgga gctttttcag tgtcatggga ttcatggtca tctggtactc
   149701 gcttgctacc tattctcgat ctatcgggtt gtccgccagt caaggatcga tcgtaaccgc
   149761 cgtgatgaat gtcggccaga ttcttggtcg acctgcggtg ggctatttca gtgacgttgt
   149821 gggacggatc aatatgacca cgtttgccac gttcaccagc gggttgctct gtttactgct
   149881 ctgggtgttc gccaaaacat attcggcaat cctttgcttt gctttgttcg cagggatcct
   149941 ctttgggacg ttctggacgg taagtcgatc ttgacctcac tgcggcgcag attgctgatg
   150001 tccacgactt ttgaaactcc aggctgttgg gccactcaga gcagaggttg tcggactaga
   150061 agaccttcag tcgttcttaa ctattatgtg gcttatctgc tcggttcctg cgacctgtac
   150121 gttccccgtt tgatacttca cttcattcat catatctctt gcatgtcttg actggactcc
   150181 ggctctaatg actttgacag ttggagaagc gatcggcctt gaacttcgca cgtccgggga
   150241 ggatgagttt ttacgcacgc aactgtttac cggcttcatg tatatcggcg catctttatg
   150301 cacattactt ctgcgaggct ggaagatatc ccaagaaaag acgccagagt caggagattg
   150361 ccctggttct gcgtcaaccc atggcgaatg taatatctcc agcaggttat ctcctattgt
   150421 ggcgtgggag aaagtttgag tagtggacgg cggtataagc agtatacagc ttgaattggc
   150481 tctacattaa aaatgttcat taaatggttc gttcctggcg cttgacatgg ttccggtcgg
   150541 ctgagccacc aatgggaaaa tgcaccacag ccgcggggat tacgcgggcg atcacgtaat
   150601 ttatttctcg gttgttacta aaaattactc cacatccatc gtgtcaacaa aagtcctcga
   150661 ccacccaaat gtgaaaggaa aaaatccaag cagacaagct tcctgtcttc ggctgctatg
   150721 caccagtcgt tcttactctc tgctccacat gccttgcaac cgaacgttac ccactgggcc
   150781 ggattcttcc cccagactga gtaaaactcc gcaatggctg aaacacttcg ttcgtcccga
   150841 ataagccgac gtcacgtcca cgatggtttc tttctcaatt ttcctatgcc acttacggac
   150901 actttctcct ttgtccccta aatccttcaa ataccttcct gcgagaagaa tgtggaaggc
   150961 ctcgtgacgg tgaatcttcc ctccccccca tctcctgaca taactttgac gcctcggccc
   151021 ggttttaacc ctcggatcat ggtggcagcc gctggacaca atgtcgcaac cctatgagtc
   151081 gaacgatcgt tatcatgcaa ccgctcctgg tgctgccgct agctaccatc acgcatctca
   151141 ctccagtagt gacctaggtg acggcgataa tgtcccccgt ccccgccgtt cttctccgcc
   151201 gtccttcctg aactccttat ccaatccttt gcgtgccctt cgcgaatctg gagcacgact
   151261 cgccgctcgt ctcggtcgtc caacagatgg gggagatgct cttgatgcag ccggtcaccc
   151321 cgaacagtac ggggcgatgg aggatgtacg cttgctcgac atgatgccgg acgggcgagt
   151381 cccccgggac tcataccagt cgaagctgca gaatactttg gtctcggaag ctcggtttct
   151441 agtccggaaa ttgggcgtcg gtgggaagct tccaggggat gccgacgtac cggacgagcg
   151501 ggatgtcaat cgtggtgtct tttcctacct tctgcagcat caaatggatc agggtcatca
   151561 tcgaaatgtt agtcaaacca gcatatccac ggtcgcatcc caagacgaac cttccccatc
   151621 gggctccaat aataagaagc gtcgcaagca aaagtggtat gaggatgagg agggagatcg
   151681 gtccaagggc aaacgaccca tgaaacagat tcgattgacc aaacatatcg cggcgatcct
   151741 gactcgccaa cgatacatca tgcagctgtg ccgcgcaatg atgaaatacg gcgcccccac
   151801 ccatcgatta gaagagtaca tgcggatgac agccaacgtg ctggagatcc agggccagtt
   151861 catgtacttg ccgggatgca tgatcgtctc cttcgacgac ccgctcacca ggaccgcaga
   151921 agtccacatg atttcggtgg tgccggggtt agaattggga cgtctagcac gcacgcacaa
   151981 catctataaa aacgtagtcc atgaccgaat cagcgttgaa gaggccatca gcgaactcaa
   152041 ccagctcatg gagcgtaaaa gtcgctacca tagcgcatgg agcttgatct tcctgtccgg
   152101 gttagccagt gtcgccgtcg gtccctgggc ctttgacgcg cgacccatcg atatgccgat
   152161 tatctttgtc ctcggctgcc ttctcgggtt catgcagaac gtgctggccc cggcgtcacc
   152221 cgtctattcc aatgtcttcg aggtcagcgt cgcgatttta atgtcctttc tggcccgtgc
   152281 atttggcagc atccgagttg ggggagaacc ggtgttctgt ttttccgctc tgacccagtc
   152341 ctccattgcg ctgatcctgc ctgggttctc cgttctgtgc agcagtctcg agttgcagtc
   152401 ccatcagatc gtggctggct cgatccgatt agtttatacg atcatctatt ctctcttctt
   152461 gggttacggc atcacggtgg gcatcacgat ctacggtctc ctcgacagca atgccaccac
   152521 agagtcctca tgcccctccg agagtctctc catctatggt aacgaataca ttcaacactt
   152581 tgtgttcgtc gcgatctact gtgcggtcgc cgcggtgctg aatcaggccc ggtggaagca
   152641 actcccggtc acggtattcc taggtgtgag cgggtacgta gcgaattact tcagccaggc
   152701 gttggatagt cgactggcca gtacgatttc cgcgtttgcc attgggctgc ttgccaactt
   152761 gtattcgcgt ctgtggcatg ggcatgcggc ggcggccatt gttccaggca tgttcacctt
   152821 ggtctcgtcg ggtttagcga cgagcggatc tatcatgtcg gggttggcct acgctgagtc
   152881 ggttaaaaat aatacagtct ctaaagcgtc cacctccaac acggccgtgc aacaatcact
   152941 gtacggtctg ggcctcagta tggtccaaac cgccctcgga atcactgtgg gtttgttctt
   153001 ttcggctttg gtcgtgtatc cccgcggaaa acagagaagc ggactgttca atctttgaac
   153061 ttgcttgtaa tatattgaga agatttatta ggtatctagt atcatccttg acgtatgata
   153121 gacattttgt atccttgcat gttggttggc cgacggtaca gtcaaccctc gatatgggga
   153181 atcaatttag ctagctttct taattcttta taccaagatc atcacccaat ccatactaaa
   153241 acatagatat aaaagacggg ctagtatcat agaacattct agtgggctga ggcctcggtt
   153301 tgaagagagt tttcgatgta gtatatatat ttttgccgtt gctaggtata tgttactgtc
   153361 tagtttgaaa gttctggaat aagagagaga gagggtagat cttcgtggtt taaaatagct
   153421 attcgcttct acgtaatcat gtatgataaa atatcagtga taccgatata tctatacata
   153481 aatacctgag atgtggtgtg gtccatccat ggaaagaatc atctacgaag tgggacaacc
   153541 cgcttccact cattagcacc caccatgtag tccctaggag aatgagggcc cacagaggat
   153601 ttcagaaaca taatgattca gctatccttg gattatgatc tgcatggatc gccaattccc
   153661 cgcacccagc ggaattcaaa tccgaggcat gcacatgacc ttaatagttc ggtggtgcgc
   153721 tatcgccagc ccaatattgc ttacccaagt gtcgtcgggc gacatcgaag agcatccatg
   153781 cagctgttaa ttacatgtaa ttggacattg cattcggccg aaatgaggtc cctgtatact
   153841 ccgatagttt ctgcacaggg tttaaagcga tgatagtgat gatattgatc ctatctggct
   153901 tacccgcaat cgcgagcatc gaggtagacg acaacattgg cgccaacgta ccctcgtcta
   153961 caagcgaacc agactccttt tgcctggcat tgctggaata ccccggatga tctacactgc
   154021 cccaagcgac aggatgctgg ccattcatgg tgtaaggcat gttttttagg gcgcttttca
   154081 tgcctccatg cagctctggg gagcgtcgtt tattcattct ctcagcctac atacagtaca
   154141 atgcataaat gactatcttt cccggagtag gatgggtgtc gcagctgagg catgttccgc
   154201 gagtaacgcg aatagtctgg attgcgtatg caatgcaact ttcagcgctc tcgaagcacg
   154261 ccacactgtt ctccacttcg gtcagtagat tgcctggcca tccactatga ggggttggag
   154321 accatgacta caccaactcg catggtagta atctcgcatc aatgaggggt gctattcttg
   154381 ctgcagcatt tcagctgcgc ccctcattac agacaagagt gggtatggta taggccaatg
   154441 ggatctacag gtcgtgtagc gctcggcact cccgtaacgg tctctaccga gacttgtgag
   154501 actccaaggg ggagtctagg aaaggggcac tggagagaaa agctcacgat tgggaactga
   154561 ctgagggacc tgcagaacgg ctagtgcgaa agtgtggccg tgacggtatg gacgcttgag
   154621 ttgtatagac attggcacta cagggcctaa gatcaagagt gccatctcac ttattccttt
   154681 ttacaatatg taaagaccca tatcctgtct ggcttcagag cattatatcc acttacagat
   154741 tattctttca taaagtttct tcccaactgg cagtccattg aactctgcta acatggcgga
   154801 catcccatat cttttcacaa agagggaaga gacaatcaac acatggaact ggtattccta
   154861 cctctctaag tccccccaga cctacaagga ttgtgtggtc agatcggtta cacacgtcaa
   154921 aaacctccgt tcgtcggtcg tgcacgagta cttccaagcc attatcgaac gaactgatac
   154981 caaggaacgg actcgactca tcgccgagcg ccagacaggg caggaccagg ttatcattag
   155041 tcgatggggt tcgtcgaagt cgtctttgag ccccagcagc catggcagtg gcagcaaaag
   155101 cagtagcagc agtagtagta gcggcggcgg cgaccttccg ttgccacttt ggtctctcaa
   155161 gttcaactcg ggttctttga acgttgttaa tcttgctcaa attctcagga atactactaa
   155221 cgagggcggt gactacaatg tgctgacggg gaggcactgt tattggttcg cggccactgc
   155281 atatgcgagt gttagggtat tcgcatccat cgaggagcct tggtcgtttc ggaggtggaa
   155341 gggacggttg attttgatca agaaggctgc tgtggtgagg tcgcaccacc attctgcaac
   155401 ccttgctggc catgtaatct gctaacaggc gagttagcca gacgcaaaga atttcaggga
   155461 gaggatccag atcaagtggg aatatctctc gggaaatcca gtgtcgaaat cgcaattctt
   155521 caaaatggcg tacacggacg cgctccgtct ggaagtcgac gacgaaacgg aagcgaagaa
   155581 gcagattcat gtcagtggct gcgacattcc aagactgtgt ttggtggctg cttacagttg
   155641 gctacaggaa cacgcattcg agttgaccaa taatgacatt ggcaataata tttcattctc
   155701 cgcactccaa gagtgggagc ctgggcagcc cgtacgtctt aaatcactcc actattagca
   155761 tccagacctg acaaacttgg cagattgagg accttgaaat cgacgaggtc tatgaaaggg
   155821 ggttccaaga cgacaatgcc gaaagttata aggaggtgta cgatcgttac aaccaagcta
   155881 cgccagtatg tccctacaga accgcacatg atcttacaag gctaaagaac tacagatcca
   155941 aacagattcg ccgaatgact cgggcaagct atacattcct gatgacttcg tcgttttgga
   156001 acccactgca agacaaatgc agaagatgga cgaagctatc gaggtcatgg ctggtcgtgt
   156061 tttggctgaa tacgagaaga atcatcccaa ctaggcggtc atgtcacatg cctgtagctc
   156121 acctgactgc cgtcggtggc tagtagtaga aaaattcaac ttcagttgct gagcttctac
   156181 ctcccggtgg tgtttcgtaa caacggtcgg ggacagtcgt ggatagttat tgctatatat
   156241 atatgtgaga tgctaggcaa ttgtagggct gtattgaaca cagcatactt tgaagtcttc
   156301 aaaaagagtg atgagcctaa gaagctgtag cctcctctgt atagcccgtt gctttaaata
   156361 ctatatttaa tgagacagat ttctgtcgca tatactttta aggaaccgag agtgctccgc
   156421 aggtcaggtt cgggctcggg ccgagtacct ctcccaaaca gccacctcaa atgatgctga
   156481 caaattgctt cagtgcataa atcagttact tagttggtga gttaaggtag gggttcttgg
   156541 caacgaacga cttggaacca ttggtttcgc tgctcaagga aatatgggaa gatccaggaa
   156601 gaatactacc gtgttaacaa gtggctcgtc cacaagccat actcccaaca agcacaccaa
   156661 ccggttgccc gtttctgagg tagacttaat ctccattaga gtattacata tacaccggtg
   156721 ccgagatact aaaagaatga tagcaccgaa ggagacaact gcgaagggta cagcaagcat
   156781 atcgctagcg caaggagaca accgctcttt ccctgagaaa tcagattgaa gtcctacaga
   156841 gaaccattga gggactagat cgaacgttcc aagcctacca taacgaagtg gaaacatcca
   156901 acctactatg ctctgatacg accttacgag gaaatccaca agagatccgc gaacaatttc
   156961 ttgcaatttc tggagcttcg gggatgagtg gggatcttgg aggtgccttg cgaacagatg
   157021 gaaacgcatc gaacgaacgt gatacaacga aggaataata gaagccgacg gttagcccgt
   157081 ccgagttcgc cccttcagat ggcaaatcgc gaacaaacct atcaaccgtc tcgattatca
   157141 tctggacatg atccatccaa ttcatcacca atggttgtcg cttcgaactc aatgccatgc
   157201 aatgatggtc acggaacttt tcctcttctt gtcagccctg catatctact ttccccttct
   157261 atggcctact tccgggagat ttcttttgaa cgccgactgc atcgagcttg tttgaaaaat
   157321 gggtacgact tgctggtaga tccgactact gatcccgaca atgtgaggag agtattcagg
   157381 ctcccattga ttttctcaga tcgagattca atagtccaat gggtgcaagg gcttcttgaa
   157441 gctggcttag aggaagcccc agagatgtgg gacatgccct tcttcctgct aggaggagcg
   157501 ggaactattg tccccgaaga gatcaaggag ggagacctat ccttcccctt aattcagtgc
   157561 ctatgaacaa acttattact gcattggcac atcagtcacc agagctgcaa tcggtccaca
   157621 gtgcttatgg ccttttagct ggtcatggtc ttgatgggga gtggtttggt tcatatgacg
   157681 tagagggcta tctcaaggag aaaggcatct cccttgatgg tgatactaca ttctgcaaag
   157741 ttcctgaaaa tatatcccca acggagcttc cacctcccgg caccgttcct tgccatgaaa
   157801 attctaatca atgtcattct tctccattat acggtgttgg agaaactcag aatgatttta
   157861 atagaaacgg ctcttggacc tttgatgtga acctatttgt taatcgtaag cgccgattgg
   157921 agccaagcca ttgctgctat actaatcgga atagatctca ctcagtctgg cctttacttc
   157981 ggacgctgtc ccgcgtttcg tcgagaagat gtggagaata tatttcgcct tgcagtgtgt
   158041 tgaaccagga gcagacaaag tgatgtgaga agacgtagtg gtagtggata cactagaagc
   158101 acctgtgtta gcaccatacc tcgtccaaag cgacagaggt gactaatgca gtcaggaaca
   158161 cacgttaaac gacttagttg gctttgagat ggaaaaatga tgctgtgggc aaaaggtcaa
   158221 aggttgtcga aataggttgt tggcagaaga aaagccaaac tagatggaag aggatgatat
   158281 ttatgggctt caaggggccc acacccagac agaatacaag aaacatggag taatgattca
   158341 ctagatgacg agcaaccaaa aagtccgagt ccgcaaacag tcactactcc caagtataat
   158401 agacgtccag cgacttgaag tcatcaccaa cacccagtga aggactcctg aagagacaga
   158461 gcaaaagaaa ctgaagaaac accaagattt atgacttagc cagtcttagc agctactagg
   158521 aataggaaca ttaagattta tcctaatcaa caatccagac ctcccagctc acttcactcc
   158581 acgtcagacc cagaagagcc ggcgaccagc tctggttaag tgatggggat gttctgctct
   158641 tagttcagaa gcagttccat tacatcttca ccacacttca tctcaattgc tttagcttca
   158701 acgacatctc tagtaagtat aatatacgca tcctggccca acataagtcc acccattctc
   158761 tagatgtcat catatcgcac atgctcgtgg aagtcgtctc ggtggcgttt ttgcgtcccg
   158821 ccgccgaacg ttccgtgcac cttccccata atgcggcgca aagcaagata ctcgttttgc
   158881 tctctctcta cgaggacttg aggcacaaat agagcaatgt ctctgcggca cgtttggcga
   158941 caggctccac gtttccctcg gacctattcg actgaaacat gtccgtgctg ctttgataca
   159001 ttaccggtgc aagggaatcc cgagagcatg cagctttttg attcattccg atgtcaaaga
   159061 gaccaaagag acctcggcat acgagcaagg tcaccctttg taaggtcaat tggtctcctc
   159121 aaaacttgtt gaacattgcg tcactgagca tatgtgacat tactgttgcc tggtcgctgt
   159181 tgaaatcccc ctgattgcgg cttgcccaca ataggctaca atgtggttga tagaatgacc
   159241 atattgctat catgcaaatc atgaacaatg gcatcttcta tctccgagac ctcaacacat
   159301 tacatatcga acctgtcctt gacaaattca gtatcatacc atagagaacc tctagaacgg
   159361 tgccagctca gctgtaacct gcaagtccaa caaccagata ccatgtctga ttaggttttt
   159421 atctatcgtc atgagaactt ctcgagcctt ggcagctggc ataattatca cgattttggt
   159481 taggccactg ttctcaatat ttgctctatt caggtctgac acgagatcgc tgagatatat
   159541 taagagctga tttaaaaata ggacctatat gattgcgatc ccaatagctg gaccaaaaga
   159601 ctgggcgaaa aatataatag atatactaag cagtatatcc tccacagata acactgtttg
   159661 ggcagcattc tacggtccgg agatgccgat accgtaggca aggccagaga agacagtata
   159721 tataataagt tctgtaaagc tggtgatgat tttggtggtt gagacccgcg gtaactgcta
   159781 ttatgatcga ggcaaaatgt ataaacggtg cgtagtagct aatggcgctg gtcccgaagc
   159841 tgtggataag tatcctaata gtgccggtaa taataatagg gagtattata tagccgctct
   159901 tggcggaagt atatttatgt ataacttgat agtaaatagg taataatact taagtatgtt
   159961 actaaacata tatctagtaa taacgcggcg gtgctttaca atgtgaaaag gaagagcagc
   160021 agcgtctcca catttttgat tcgaggtcca gtagagggtc cttggcagat ttcaagcttc
   160081 tttacgatta aacttcccta gatatccgtg actttcgcac agcctaacct ccttgcaagc
   160141 tacctaattc aagatatcga gttctgcagt atacttgagc tgtgctgtga ttaattctat
   160201 ggttatgttg agacaataat agtttctgaa tatatatata agctcttgat ataaagctta
   160261 cgtgttttat aaagacaagg atcgatcggt catagcgatg atactctcaa tatatcatat
   160321 ccagagtctg caaggcatga atgcctagcg attggagtcc aatcattgaa caagatagat
   160381 tactcgcgat gaaacccgca acctgggctg tccaaagaga aattgctttc aaagacaatc
   160441 gaatcctgta ccctgaaaat gagatttata gttgtcaaat aaaaatctaa atcctccagt
   160501 tataacaaca gtgctccctg gtaatagatc gggaaatatt gaaatagcat tcgggatagt
   160561 ataactacac ccacagaagg ccctcgtaga gacaactctt atatagcaat gccctagaac
   160621 tgctctatgc attgcaggct attactggag tgtttgaacc tttcaatcaa tctatatctg
   160681 gatgcgtgtc atgcccagtt tggcagtatt tgacagcctt tcttgtgtag tcgagggcgc
   160741 ttgggcctta taattagttc gctgatacta attgataatg cctgactatc ctagattctg
   160801 gacctacaag atctagaaca ggcctgtcag ctatagagta ctgaaagaga gcgacttcta
   160861 aagggattgt ttggatatac actatttcag ccacttctct atccgtgaat tgttgagagt
   160921 catcaaacct agaaaacact aatgacgatc atctatgaaa acgacagtac tgaaaaaggt
   160981 ccaagcatcg caacgtcttt gttccagata tgactagatc ccacaaccaa caatagtcac
   161041 atcaggtcac aattgcgcca gggtggccaa ttacattaac ttgaaacgca gcccacagga
   161101 aaacgagaat gaaccttgcc actaacatcc ggcagcacca cgtcattgac attagctcca
   161161 ttctccaaca gcatctgcac aatctgaaca tgtcctttgg aagaagcaac ctgtagggca
   161221 gatccaaagt gtccaccatc agcgttgaca tcggctcctt tctccaacag catctgcaca
   161281 atctggacat gtccttccga agaagcagcc tgcagggcag atccatcgtg tccaccacca
   161341 gcgttgacat cggctcctct ctccaatagc atctgaacga tccggtcatg tcctccgaga
   161401 gaggcagcct gcagggcatt tccatatttt ccactgaaat ggtggatatt ggctcctttc
   161461 tccaatagta tctgaacgac ctggtcatgt cctccgagac aagcatactg cagggcagtt
   161521 ccaccatatc caccagatat gtttacatag gctcctttct ccaatatcat ctgaacgatc
   161581 cggtcatgtc ctccgagaga ggcagcctgc agggcatttc catattttcc actgaaatgg
   161641 tggatattgg ctcctttctc caatagtatc tgaacgacct ggtcatgtcc tctgcaacaa
   161701 gcaacctgca gggcagtttc atattgtcga ccttgagcgt tgatatcggc tcctttgctc
   161761 aacagcattt ccacagcctc atagtagcca ttatatgagg cccacatcaa agcagtagct
   161821 ccagtgctat cctttttgtt tatagtattc tcctctgatg tgatgatcaa tcttaacaca
   161881 tggctatgtc cgttgaaagc cgccaggtgt actgcatcca atttgggcaa cgaccgcctt
   161941 gcatgatacc cgtcaaataa cccaacagat ttccaaaata tagggaacca cattctatat
   162001 ctccccgttg tggtgctgta tacgccatgt accagatcaa ccatttcttg ctgttgtgac
   162061 gaggacatcc ctcgaacatg gtcagcccag tactctgctg aatatgacag aaaacattgt
   162121 atatcagatt ctgtttgttc ttggttggct tccaagtcat ccatccccaa gtatcgaatg
   162181 cagatttgag acattgttct ttcggcgtct tgccattgga aggagtacct tgagctaggt
   162241 ttgtgggcta tatttctctt aacaagaaac tccctggctg tctggtgtat gagatagatc
   162301 tttgagttgt tgacaaatac aaataggccg cataatcgcc gtactctttg aaccaagatt
   162361 cctggattta tcctagcctt tgctgcagtt tgcgacctgg aagacctccc tattcccaat
   162421 gccattccca tttcctgtat tgtcaaagga cgccgggcac taacaataat ctgaagaatt
   162481 aatctcaccg tattaacttg gttaagtggg actcgagcga gaatcctctt atatgcttca
   162541 tttacggaag atggtattaa tttaatggac atcttagtgg ggtcaaggct ttcctggaat
   162601 ctgttgtgga tatcatcaat agctaaatat agccacagat acgtgcggtg ttctatctga
   162661 agtagttgat atcttagttg ctgctccacg ttagtcgaaa gacttgatat tgtagccaat
   162721 tctttaactt ttatatttat aacaagatca atcttcttat aaatctggtt attttcctac
   162781 ttcccttaca gatatatatg cggaaatgag tccgttatag acttaaaatt attctagatg
   162841 tcattataga gtcggctgat aataagaaac tttaaccagt tcttctgtgt taatgacctg
   162901 gtctggttat agaaattctt aagctattaa ataagttagt tctagtctac tagacaatat
   162961 tcatcaagcg tatcaagtac ataaatagtc tttagagata taggatctga cgtcgctgtt
   163021 aagagaattt gccaaagctt actaatctct tgtcaaagtt tctccctatt tctctcccaa
   163081 gataacactg tatgttataa aaaactgggt tgttaattaa agagttggtg taatattata
   163141 caaagcgctg tagcaagatt attttacttc tcgttattct tgaaaaaaaa gtaataaact
   163201 aatactgtta aactgtatgc ttgaaaatta ttattaataa gtaatttagt aaatatagat
   163261 tttctatagc tagggttagc tgatatctag agaagatcat tacagcaact attccaccaa
   163321 cgaagataat ataaattttg taaagtctat tggtatattt ctggtattcg attaggatta
   163381 atattcttct actacttata gttatatatt ttaaatactt aataatattt cttttactag
   163441 actgttaaaa tctgaactat ctatttaata taatactatt cttgttaatt atatgcttta
   163501 tctaattatt cgttagtatt tttaatattt ttatttagat tttctaggga gcctacaaag
   163561 tactatataa ataaaattat attactattg aatactaggc taatctaagt attacttacg
   163621 ataaatattt atagccaggc ttttttgcga cacttaaccc tttagtaaat attctagtag
   163681 ttttttaata tataatgcta ctgctaaggc agtatatcct taccattact tatttttgta
   163741 taaattagag taattgtaaa taccgcgaat cacaatatag aggaaatcta atattaatcc
   163801 cgctgtctct atttcaaaat ataatactct agtttatatg cggagctatt ctcttgtcta
   163861 tctatattta atgatagaac ttccagatac aacaatacta tggtgaagat atagtttatt
   163921 gttcttacgc tcgcttctgg tctctttcta ttctcttaga tatatattgt agttgtcttc
   163981 tacaactaga tggttatact taatctggaa caaccgatca ctctattaat taagtctagt
   164041 aaaagctttc tagatttttc gggttcttct aatcgtactt tggagatatt ccggaaagtg
   164101 aggattgtta gtaagctcgg cggttcttat agtattaact actactagca acaatctaga
   164161 agaactgttt aaagatccag ttcgagtaaa tttactacca gctctaactt tacctatatt
   164221 atactaaagc acttctctat agatgtttgt tggacagcta atcacgatat caccaagcta
   164281 tatattactc gcggtggatg ggattctttt tccaacacca actatcaagc taatctatag
   164341 agacttaaag aacatgtgga tcatattgtt cgcaactata gtagctgtag tatagctata
   164401 ttatcctgca ggcaggcaga cgattacaat ataatgtttg ctaatttaat ctaatatata
   164461 gatattcgga tctctaatat cttgtttatt aagaattccg aaacttttat caagtatttc
   164521 cttggctgct gctgcctcga ctggaagggc gtagatctat ttgatttgaa actcttcttg
   164581 tagagggcaa aacattgtaa tcgaagtttg gttaagatac agttatgggt tgctcagata
   164641 gcggcaatga ttaataaacc tttgaaagaa gctgaagaat aaagggaaag gcctgcttgc
   164701 tttaactcta ctctaccagg ctgctgagta gttttgtcaa gcgacaatta gagggccaat
   164761 tccccgttta atatgggtcc aggcagacta acaatttagt ttggttatgg aaccactata
   164821 tcccgcaccc ggcttggcgt gcggggatac tagttggagt tattcagctc ctgagtgttt
   164881 agatagaaga gcaccctgag ggctatagaa taacgtagct aaggatataa tagatttaat
   164941 taattaagat atattaattt cccgtatttt tactacctga aggcatttta attcctcatc
   165001 tttgaacatt cgcaatggac cgtcctagag aaggctgtct cccttttcca agaggatatg
   165061 gtgagcggta tgcacatttt tctatgttga agtcgacgct ctcttttaga cccgaaattc
   165121 actcttcagc ttatgctctt gagctgaatg gattgctaac tggacaatag cggtatgaaa
   165181 aggttcatcg atattaggca caacatttac ggtgtcggta cccccatttc cgtttcacca
   165241 ttacgtcggg ataggaagat gtaagccctt tgtatgcagt cgatgcaacc atagtgttgc
   165301 aagcgagacc tcgacaggaa gtagcctgct tactgaatgg tatcatcgtg atactatata
   165361 ccacatcaat accctgtcat ccacttgagt acttagactc tcatcctttt ctttgctttc
   165421 taacaaaaaa gccgaaattg tctataaatg gggacccgta tctttgctgc gtattgtgtg
   165481 ggatagagtg ttctttatac ataggatcag aattgaggaa agcgcataaa gtctgggggg
   165541 catgggcgga aagaaagttc aacaagagga agagtctcat tgtgccagca gccgagcttg
   165601 aacaattgga ccaagaaacg gactccccga tgtggtcctg tttctaccgt gcaagtgagt
   165661 gaactatacc ggtgtccacc atctgccgag cacacctcac gcaatcgttc ttttagtcct
   165721 tgacgatcca aagacaagcc gcctgtcgat atctggaata tctccacatc ttatggtaga
   165781 caggaagaag caccgtataa tgattgattc agataaggcg ctgaatcttc ctgggcccac
   165841 aatggccagt cagagatgga gcatcgattt tcatatggcc aatctctttg agaccgactg
   165901 gaatagagaa aagagtgtgc ttattagata tatcatgcat ccacactgct ggctattggt
   165961 tgatcggttc ctgggagacg gcgttgagaa gcaggacctg cgggcattta tacaagcgat
   166021 cgagatattt tagagaactg accgaacact ttggatgccg gacctaatcc atgacacttc
   166081 tgaatatcca tgttatgacc atgcggcgcc ctggatcaag cataactgtc ctagataggg
   166141 ggcaggcaac tttaaccgca cgcatatgtc ctcgagccca tttataatcc gtgacatcca
   166201 aacgttgatc acagtggcta ctaacgagca tggaaagccc cttggccagg gagcgaggtg
   166261 gcgttctttt gttgctaatg ttcctgtcga agtcataatg atcatcattg atacgcttta
   166321 cgagagccgt ccaccttgtc ccgagagaat tcaagatact cgcaacgtgc tagaggcctt
   166381 tcaatggaac ctacctgatt tatactcgca gaggcgctgc aaccctaggc tcatattcga
   166441 ggcgcaagat gccattaaag cagggactta aatcgattgg gtatatttct gccttgggtt
   166501 acacgagcta ttgttgcacg aggactggta ctgcaatagt ggattatatt ttcgaggccg
   166561 gatactatac ctagttgaat gctttgaagg gcatatatga aacggtacct agatagggta
   166621 gttagacaat acgaaggaaa cagtatctca cgtatatcct actttccaca acacaatcct
   166681 tgtataatag tgttttccct gccatagtta aattcagttg gaaatgttac catatctagc
   166741 ttcctactgc ggaatcatta tctatgaata agcagtcatt acagcagcag gttaaactca
   166801 acacatcaaa accgcagtat tatattataa agaacatcaa tatccgccac tcggaacccg
   166861 cggcgcccgt cttgtctaga atatcaagta gttagttagt tagttataaa tcgttattaa
   166921 tgtagcatat tagtgaacag gtgaattaca aagtatttgt aagccatagt gagcttctca
   166981 aaatacaatc ctaccctgtc tatagcccat aaaaacgggg atatacgccc agcactcacc
   167041 cgtcatgtct ctatcaattc acactttatt caacttccac tccatattac aagaccaatc
   167101 caatccatca tgcgcattgc tatagctggt tctggcgcca tggccaggta tatctgcgac
   167161 gaattcccca agtatggcca tcaggttgtt atactgtcac gaagcgaaaa gccgatcttc
   167221 aacggccgtc ccaacatttc gcaagttgtc acggattact cagttgactc gttggtcgct
   167281 gcaatcgaca actgtgagat gttgatctcc atgatcctct cctatggaac tgatttcatc
   167341 gacgcgcacc tgaacctaat caaagcatgc cagctcagcc ccaaatgcaa gcgttttgtc
   167401 ccatccgagt acgggggtga tgtggagacc tacccagaca tgcctctctt ttattaccac
   167461 acgcgcgagc ctatccgaaa ggcattgcgg gagcaatcgg agttggagtg gacaattgtt
   167521 agtgtcggtt ggctcgcgga ctatgtggtt ccttcaagga acagatatct tgctgatatt
   167581 ggtccggcat ttcctatcga ccttgcaacg aaccagattg tcatcccagg tacaggaaat
   167641 gaccatattg acctcaccgc ggcccgtgat cttgccgcag cattggcaat gctcgccaat
   167701 gcaccttcgt gggagcccta tctctacatc tccggcgaaa agactacttg gaatgacctt
   167761 gcgaaacttg tccagcagcg ataccctagt atgactgaag tcaaacggat tggtcttgga
   167821 cagcttctca atacaattca gacatcgacg gatgaagagg agattttgct atcacactat
   167881 cagatatcca cgccactagg aggcggctcg ctcgatccgg aattggtgca gcgtcatcgc
   167941 cgcaagtttt ttgccgggtt gcatttccgg aaaccagaag atctcatcag agaggcattt
   168001 acaaatggta atactattgt ttgagatcgt gttagcttag acagcagccc ctcggacagg
   168061 tagatagtgt tgagttaggt tatttactga tgcctggttc gttagactcc aagtgtctcc
   168121 agctagctat attagctagt ttcggtttgt tgatagagaa tcaatccttc ttctctcccc
   168181 cccactgctt cctagtagcc agatcatata attcgaaggc ctgccttctt tttctaatac
   168241 agctctctcc ctcagcgctc tcccgcctat agcccttaat agtatttgca aaaggctagg
   168301 cctttagtta tggtttatta aactgacaaa gtgcctaaaa acaaatgtgg atattttgaa
   168361 tctacactga aaataaattg gaataagtag tgtggagaga aaaagggcac tagtttgtat
   168421 atcctagaag gaatatcctg cgttgatgag tacacagggc cttgtattct atcatatcat
   168481 gatttgcggg ttcacgcaag tcctgttgcc gtatttggga atacgaggtt ccattcaatg
   168541 agtttggttg atataaatac cccgcctcta ggtaaccaac tcgactacca ggcagccata
   168601 cgactagcgt agccctcacc cgcaaggctg ggtataaaag gaccaccatc cctcagtcaa
   168661 ctcctcatcc gtttgataac tcaagtcaac gggaaatcgt aaccatggca tctgcgaaga
   168721 gtgagctctc ccaaacgctg caggatatta ctcatgccaa gctgcgggag ctttccagaa
   168781 aacaagagat cttcctcagc cataaagcta cgacactaca gaccgtacag gcattggact
   168841 ccaagatcga gagacttgcg gcgttatcta atggcctcaa gacgtgcttc ggaattccag
   168901 tggtgaacgg tcgcatgatc cgtggccata ccagcaacca tgagcgcttg gagatcacgc
   168961 ttgcaaatat cgatcggttt cttaagcagg ctcaatatga cccgtctatc tcaccatcca
   169021 tcatgcaacg atggcagcag tctctactca gcaatctcga gatgcaaacc ctcaaatacg
   169081 agtttgccac actttttggc cagctgacca tggaatggct gtcgactaag aaaggtcccc
   169141 caccagatga cgatgtctcc atgtctgaag agccagagca gcttccgggc gctgagaagt
   169201 tggagtcccg gaaacaatgg gaagatgccg tcttcactcc gcttgaactc gacacagatg
   169261 aaattgaact tctactcagc gagctcttcc agaacccgtc gaaagatgct aaagatatac
   169321 gggtcgcctt taaagagctc caaagaaaag tgcaagtgtt cgaagagtca ttgacgtact
   169381 ctcgtttatt ttccgcgagc acactacgat ggacgatctc gggcctgatg gcgtccgatc
   169441 tgctgaccga agaaaagcgg acggttttaa aagacttctt gaataacgcg atcatcctgg
   169501 atgagctctc cgatgtgctg aacatgcgca tgacagccct ggacgcttgg tcctggggta
   169561 cagaagttcc catcgaacag cgacgccaac tgaacggaac ctataacatt tatatgcacg
   169621 aggatctgat ccaggccatc ttcttgcaat acctcggtgt caaatggtcg gttttcttta
   169681 agagcgcctt tacggagttc cgaaaagcga gtggcgtgtg gaaatcgccc ggaagtaata
   169741 ttccagaaat tgacaagagc cgtcgcgagt tcttcctagg ctatcgatca cccaaacaca
   169801 gcgtgcaatc tacacgggag aaaatatatc agaaggggta ttttgtctcc cagcttgtcg
   169861 actatgaaga acaagaccga agcctagacc aaggagagga agaggccgat tttgcgcagt
   169921 ttagtgctgc acaagtcccc atgcaaacgg cagcttcaca gtcatatggc aggaaacgca
   169981 caaagcagac agcgcggaaa agcacaacag tatggcccaa aaaggagagc tgtaggtcga
   170041 gaggagcagc agttttcttc gaggaggaag ctggcgttga tgagggtgaa gatagcgatg
   170101 atgattatga tactgacaat gggcgtgagg ttttcaaccc caaaaatcca atggatgcca
   170161 aacaaaacct gttgcacctc ttagccactg acattttgat caagactcaa cttgagggag
   170221 agctgacttg ctttcgctcg aaatatgatt ctctaaaccc ggacttgtcc cacgcaacta
   170281 ttcatgcagt ccttggattt tttggtgttt ctgagaaatg gctagggttt ttccagcgct
   170341 tcttgaaagc accgctcaag ttcattgatg accctcacgc tgagcctcgt cagcgtcagc
   170401 gaggtactcc tggagcccat gtactcagtg acgtgtttgg ggagtccatt ctcttctgtc
   170461 tcgactttat gatcaaccag aagactgagg gcgagctcct ctggcgagtt cacgatgact
   170521 tctggttctg gtcatcaaac catcagacct gcgtaaccgc atggaatgcg atccaaagat
   170581 tcaacaagac aatgggaatc tctctagatc cattaaaaac aggtactgcc caggtccagc
   170641 acaaagctac aaaaagcccg accagcctcg atcccgcctt accccctgga caggtcagat
   170701 ggggcatgct atacctcaac cccgactcgg ggcattttga aatcgaccag caaatggtag
   170761 acagccacgt tgaggagttg aaccgccaat taaaagacca ggtcagaagc gtctttggtt
   170821 ggattcaggc atggaactcg tatgcgacaa cattcttcac gtccaacttc ggcaagcctg
   170881 ccaactgctt cgggcgcaag catgttgata tgatgctcgc cacccatgaa cgaatccagc
   170941 gcgtagtgtt ttcccttgat gctgaaggtg gcaaaagtga cgttagtgta atccagttcc
   171001 tccgggatat aatctgccaa cgctttaaca tcacctctgt gccggacggt tacttctttc
   171061 tcccgatcga acttggcggt ctcgagcttt ctagtccctt cattcagctg gtaggcttac
   171121 gagactctct catcgaagat ccgactactc ttttagataa attcttggaa gcggaacggg
   171181 acgcgtacgc ctcggccaaa gtgcgctacg agcaacgcct caacagtacc caacatgcag
   171241 ccatacataa tcaaggcttc tacccggacg acgcgcacac atttatctca tttgaggaat
   171301 atattcggta tcgtgagcta ctcggctatg gcttcactgg tgagctaaag gaggtatatg
   171361 aaaagcttct acaacgcccc gagcaacagc atattgaatg cgatccgaac ggtgccgtgt
   171421 tccgggagct gaaccagctt tccggccacc agaacctgag aggaatcaaa agcaattgga
   171481 gaaatatgga tgcgtattgg aaatgggtgg ccgaactcta cgggcaggag attatcgacc
   171541 gattcggcgg gtttaacatt gtcgatcctg ggctgttgcc tatcgggatg gtgagtttgt
   171601 tccgcagcgg gaggatccag tggcaggaat gagtttttca ttttgaaata gtcagattgc
   171661 atatgttaac tactgttcct accaatggta actcccctct tgttttatcc ttagtccgtc
   171721 attgaagcgg gagcgctttg gggggaggct ttctccggcg tgcatttgta gcagtgcaaa
   171781 tatcagtacc tttcactgct gtagagcatg tcatagaagc actacccgat ctctagttag
   171841 taaagaggga gattggttat ttatcctttg tcggaaatta tacagaataa gcccaggatg
   171901 tagatgtgtt gacttcaaaa taagacaaca taatgtaact tcgcaatagt acgtgccgct
   171961 aggtcacaga gaagattgtt gcactgctgt ttgaaatact aaaggatatc cattcgcttg
   172021 cacagcaata cgagccatgc caagagacat aggctgaagg ctttgtctac atgtacaagc
   172081 ctggaaacca acattgacac tcccgagcaa aaggtttagt aagtaatagt attggacagg
   172141 ataggtctat gcttcatgac tggattgtta cattcatcac tccataatcc aaccgccagc
   172201 tatccctata caaggagcca acattgcagc atgtcagtag ttgctaatgt aaccccggac
   172261 tgcaacaacg ctgaattctg accaagtact atatcatcac tgtggatatt ttcaatagta
   172321 ctacaaaaaa gctatttgca ttcgttgtgt aaataggtat tattcctccg ctacagaaca
   172381 tttcagatag acatttccaa ggattccgtc acttgtctcg aaatactctg gtgttccaga
   172441 ttcctggatc actgtcaaag ggccactggt atctgcaagt atcggtagag atactattaa
   172501 taataccacc acggtggtaa tcaatcttgg acaagtatac ggaagttccc cacacccagg
   172561 gtataaatta gccctgttca atataattcc aacatagtac cggaatccac tggtctctag
   172621 taacgttaag tccgggagga tggccgtcag gtccgaacag ggggcactgt tgtggattgg
   172681 tgctcgacat ggtgagctga gactaactca cgttgcacaa gcattcctga gaaatctgga
   172741 gatacaaccg ctgctggctc cttccactgg ccgacctaca tttatgacct atacggtata
   172801 accggctctt tcagctgtcc ttgcctctca gtggagttga ctacctcaca ctactttact
   172861 gatctggagg tctgtcagac agtacggcta gtaggaggtg cccatattgc gacaatacga
   172921 caccagccat gtgtaaagcg tcttgaattc cgacgtccag ttacatgggt gtcatctatg
   172981 ttcgactaag gttgtctcgt tccatggttg ggttatatgt cggaatatac ctaactctta
   173041 gatcctctca tacgtaatag aaaaccaaga gccgatagca gattcgattc aacttgctgc
   173101 tacaatccga tatactcaat agaaagcata ttttatagtc gatgacgaag cctgtgtcgt
   173161 gtaccacgtt atgcgatata cccgcgcagc tgcattcggt aaaggtgaat atgaaggcaa
   173221 aaggatatcc ataaacttat ataggatgat gtcaccagta tatatgttac attggagatg
   173281 ctatttgcgc ttccctcttt catcttaaaa gcgaggattg tgcaccaaaa gcagtctacc
   173341 ttcgacatag atcccaccac tttattctgc tgccacttca agtaccacct atacaaccac
   173401 aacaaatctc aacggagata atatcatcac catgtacgac gacacaatcc ccgacctgtg
   173461 tatgttcggc gggccaatgg acgacctgga cgagaaggac cttaacgaag caattgccga
   173521 ctccatccac atcaaccctc gcaatggaac tctggggctc cccatcaccg gttccgggat
   173581 ggaccaaaga aagcccaaac ttgccatgat ggtgggtaaa ttctggaaac ctggcagtga
   173641 actgcgtatt gctttcatga gcggcacacc atggcaacat gaccaggtca agaagttcgc
   173701 tcccatctgg acgcagtacg ccaatttgaa gttcaaattc gtcgactacg ataaatcatc
   173761 gccgccagac atactgatca actttgaccc atccaggggt tctaattctt acttggggac
   173821 cgacagtgct ggcgtcgcta gacatggtag gcactctatg aatctgggtt ggattaatga
   173881 gaagaccagc gagaacgcaa ggcgttcaac tatcctccac gaattcgggc acgccctagg
   173941 tgcggcccac gagcattcca gtccgcgcgc tgagatcaac tggaacaaag aagctgtgta
   174001 tgcaaggtat tcaggcccgc caaacaagtg ggacaaagca aagatcgacc ataatgtgct
   174061 tcggaagatt ccggacaagt ataccaaagc caccgagttt gatcccgatt caatcatgct
   174121 ctatgccttc ccaggctcgc tgacaatgga tgggaaggga accgagcgca aacacttcct
   174181 ctctgctcgg gacaaggagt tcatgcgatt catctatccc ttcgacaccc acgatgtggg
   174241 catgttcaac actatagagg ttgcaaccgg caacaagtcg cagcagttgt tcgtcaccac
   174301 cgttccctgg aacaggaagt attcctcgcc tccggcaatg gtctgggggt tcaatcatct
   174361 ggatatcccc tctaatcgga atctcaggat ccaggccaat attactgaca aaggtctgga
   174421 ccatttcaaa gcaaggatcg ggacatggat gaacagtgag atccactctg ctggaatgac
   174481 gtggatggaa gttggccccg actgcggttt tgtccatact ggaagtgtct cccttcgcga
   174541 tattcctggc tggcaaagga aacctagtca gaactcaaag cgtgtcacct tctcgacacc
   174601 attcaaacac cagcccaagg ttgtctgctt cctgacactc ctggactttt tccagggtga
   174661 agattggcat gtcaagacct acgcgacaaa tatcgaccac actggcttca ccatccacat
   174721 ggataccagg tcgagtggcg ttatgcatgg ggtttgtgtc agttggtttg cctatgaggc
   174781 tggccgaccg gacatgatta gcggacgctt ttcgacaaac gacatccggg tgccgagcca
   174841 gcacaggcat gatgcgacgt ccgctgtgat ctttgacaag accttctcgc gtacgcccaa
   174901 ggtcttgttg gccctggatg agctggacta tgcccaggca aaagacctgc gcctgcgagt
   174961 cagcacatcg atggtgtcaa aggatggttt tacctggcat ctccagtctt gggacgattc
   175021 aataatgtac agtgccggcg cgtcctacct tgcctgggct gagacagaaa agtccaagtc
   175081 taacttgaat ggaagtggga ttgtgattgt atagagacaa cgatagtgat agtcgttcgg
   175141 atagcaaatt atattaatat ttattttcat tgccttatgt gcacatttgg ttatctcttg
   175201 gtataaccca ccactgcccc aaccctgggg tcctcaagtg acttgtaggt acctgtaaca
   175261 accgtgacct gttctcagaa aattggatca tgaatcccac tacttctact ccgttagtta
   175321 gcaactagtc acagctacct tgcttagtca gtttcgtgtg aaggacgcgt acaaagagat
   175381 ccgttgtgta tcacagctgt tgagattgag cagaccattg atctgcctat ttttgataat
   175441 gcctcaagca gtcggtgggc ggattggatg cgggtggcag gtcgtgtcgg gtttagaccc
   175501 agggtataga cggaggatcc tcctagaaag tattacagag acgttgggga agtaagcaat
   175561 ccgagctaac ttgttgattc atctatgaaa tgcagaacaa gacttgggtt gttgcacata
   175621 gaaggtaaag aaatactgcg catatatata acggaaggtt agtcggtttg tatactaata
   175681 gacagtgaga taagctctca gagcatgcga ggaaaatatc aagcctccag ataaaacgct
   175741 gccttcgaaa atgcaagttt aggttaatct agagaaactg ctttacctat cgcatagcac
   175801 agcatctaca ccatcgcata ccataccgtc tgttggacga gcaacctact ggggtgacta
   175861 agcgtagtgg tcacgtggcc aagggctcaa aactcggggt gccattggga tgatcttggt
   175921 aagatacatt ttgtggtaat gggttgagct tctgggaaag acgtaatgga atttttgccg
   175981 ctgtattaga attctatgaa gatggtgttt tggtgaatta tagagggaag ctgtgatgtt
   176041 tatgtgccgt tcttttgata gctagtgtcg acagacaatc gagtgcccga gtaaaacttt
   176101 atcaattata gaaaaaggga tgaatcaccg cagcagggca attctctcgg ccaatcgtga
   176161 actacatatt agagttaatt attaagtcag actttatccg ttgcgtggct tttgactctc
   176221 gtagtggtct ctgaggacac aatgttgcca atagatctct atatcaggcc taagaggtac
   176281 cacaaagttg tacgttacat tttggggggc tagactgaat attaagagat ggtcaaacgg
   176341 cgactgtact tagcagcgct ctgagccgac caggacccaa tcggtatact cgaagcgagg
   176401 gatatacgac agcccgacga atataagatt gaaggcttaa ccttagtgtc aggtaaagct
   176461 ttattttgga caccgtgaaa tcggtaactg ccggattagc tagaatccag ggtcgaaatc
   176521 gcgcatgtga gcgatatttt ccgaatttct aaccacaacc gagaagcaca gccattaatt
   176581 gtggcatcgg ttggcaagtc tctttaacga agccataaca tatcgctcta tagtctatgg
   176641 aagtggatat gaaaataacg actagtagtc gaggcctaat tgttgaggct cgagggtcat
   176701 gttaacttta attggaaaga gaatctaaat ataaagcttt cctaacatca aaagcacaga
   176761 aagtgtcctg ggcttatatc agcagcgcac agcacatata tcagtctcct tattgcaatc
   176821 atcgcagatt accagccaca aaatatcgat ttatgacagc tatcattgtt gagtatctta
   176881 tcctagtaag ctacgactgc atagaggtaa cgacataaac aggatatctt tcaggaagat
   176941 attgttgcac ctgtcgtatc cccgaataag ccaaagctcg aatgcttgtt tgcttcgcta
   177001 gacggcccta tgcatgactt catagtgcgg taacagacag accagccaag tctcaattta
   177061 tccagccagc tcgatccatc tcttaattaa gttgtcatgg aatctggcct tcattagagc
   177121 cactgggcaa ttgaatttga atacccaact ctttaaagtg cctctcacca tactgtcatg
   177181 tgtcagcacc cggaaacacc aatacttgga tggttttact cacgcgctgc gtggccacaa
   177241 atccggtaat aatgcgtccc tgagggagat tttcaagata gcagctattt ggacaaacta
   177301 tcgttgggct gccggagccg tcgaatggat cgccaggctg gaactccatt tctcggttcc
   177361 ggtttgtggt gacctgggta gggttagaaa tggaggtcta ggtgggcaga ggtagaatac
   177421 gcaccctaaa gccataaata cagctggcat cagtattact tatcgtactt cctacaacgt
   177481 cggtgatccg ttccccacct ggcccatcaa ttgaaaaggt caatttcttg tctgaagtac
   177541 attcgccgaa ccgcaaggtc ttgtcggagt aattgaatgt cattcctagg atcggagaga
   177601 actctgatga gacatgcacc tccatgctga ggagggaatc aagccactcg ccattaggcc
   177661 ctccaaagtc gatattcatc aaggggcgat agggcgtccc tagattttcg gttgggaatt
   177721 gataaatccg tagattatca tagctgggtc gttcagactg ccacaaatat gaatcaggga
   177781 gagtaagatc tagaggataa tccagccaga agggcttgct agatctctct tcccgcgact
   177841 cgttatgaat ggttccaata gcagttattt tatgtgcctt gcacgcgtta gtcatggaat
   177901 cagtagtggt agaagaagtg cttacatcag tgccagcgaa aatatgatat ttcccgcagg
   177961 gcgaatgagg aattcgaagg acaccatagc tcatgtcctt atccagtgta tccccgaccc
   178021 agtcagatgt agtgtttccg ccaaaatgaa agcggatccc ccgcaggcct tctggacaaa
   178081 atgcgacttc aatctgattg aatgtggcgc gagggggcac cttgatcgtt accaggccgg
   178141 tcaaaccacc atatccgacg gccccttctt gaagactgat gccggaaata aatactcgtg
   178201 cacctagctg cacagttgat attttcattt ctccaccacg cggcatagac tgtgggaacg
   178261 cgccgatccg gtagcgaggg acatgacatc catgtggaag gtactctgtt tccagggtta
   178321 gatatcccgt atagatattt tcagcgcgcc attggtttaa cccctcggac acgaaccatt
   178381 gcccaggtct taactccatg cagttcgccc ggcgcccgcg aggttctttc gaccgtccac
   178441 tgtccgcttc tactaccgat gctatcggtt ccaggagctc acggattctc ttgcggttga
   178501 gcagggagag ctgttcaggc gattgatctt tggcctgaag gatagacaat gtaccgcgat
   178561 ataaacggaa ccaatcgcgt gactgttcga gatcagggaa taggaaatcc atgctggagc
   178621 ctcgagcaaa ctggctcttc caaaaagact gtggtagact cgagaatacc aggcgctgcg
   178681 aaagctcttg acttgtacat ctcaggtcaa gcagctcagg caccgataag tatgatacaa
   178741 cttcatataa tagttctgaa gacagccggc cgaaggagtt acggtagcca gtattgatgt
   178801 cagtagatgt cgtattgtac gccgggggag attctcgtct accatccaca tcaggtgcgt
   178861 tctcctccag cttttccaat aggggaatag catagggatc tgtctgtaag agaggtggca
   178921 tgtcctctgg catgcccatg tcatccaacg cccgttgcca tcgcttagca cccccataat
   178981 catggccaaa ggagagacta gatcggtatg gacatggggt gcagtagaac tggttataca
   179041 gagaatgtgc aattttatcc gagtcaatcg tatgccacag acgatcctgc agcagcatcc
   179101 agcaggaatc atgaagacca aagccgtgcc tttctgattc cgcttgcagt aaatctacat
   179161 cgtatagcgc ttcctcgtcg gcggtgagat agtccaactc ttcatctaac ggcgcacaga
   179221 gagtctcgcg ggcgctcata aaaccgacgc ctgtcatgaa aatgtcgctg aaattttcct
   179281 tggccacacc gcgtacttcg gcgtaccagg gacgccgggt ctcggggtcg tcttccagtt
   179341 cttcgcacag gagaaccacc ccacatagag ggcagtactt attcgctggg aacagatcgt
   179401 catcgagccc tggatccatg ataggctgtc tatagctctt tatatatacc caagaagacg
   179461 agttaaggga tcagatggcg gtgaacgtcg tttcagattt tttctcggga ttgatgatta
   179521 accgcactcg ccagttggct ctcccttaat gccaagagcc ttcttttcca taatctccgt
   179581 gagcaaaact tgcgtgtcca agataaccag ttacatcctg ctatatagag gcagagcgag
   179641 aggcctcttg acaaatttct gggatggggc cctctgtcgc ctccttttgg gtttctctaa
   179701 cccagcacct ttgactggct cggtcagaac actttggaat cttgattctc gtgatgttct
   179761 cactgttctc ggctgggaag cgcccggacc atctgtttgt tagccgagat tatttgtttc
   179821 gcgtgctact ttagcttttt gacgggccag accacgaagt cgtttcttca gaggaacccc
   179881 ttgatttgcc ccatctagtt ctccactaca ttctctgatc agcgctcaag aatgccacaa
   179941 ggaatcttat cacaagagtc cagcgcatat ccgtatgcaa ccgcagagtt cagggatagg
   180001 taggagcaga ggcaggaagg tgccttggct gaatagccct gctgccctaa aatattgctg
   180061 tttgggaagc tgactaaagt acggaaatat tttccatcag cccttgcgcc aaacatgcaa
   180121 cagtagcaag atcgatcgga gcgcaaagag acctcaactc cgctcaaaca attgttcagc
   180181 ttgcgtaagg agacttatgg aatgctgcca atagtacctg acactaattt agaggtccca
   180241 ccgaggaaca ttcaggccat cgatagtatt gcatcattgc ttctggacac tagtcacact
   180301 acgcttaaaa atatttttca acacatgcag acgaaacacg ggaagaagtg gatgttggtc
   180361 ggataggggg aagggaagac aagagcatag ctcgtagaga gtggagaaaa tgggaaattt
   180421 tctacgagct tcaggcccac tttcaactca gctcagctca gctcaagcca cgagaagggc
   180481 atggagatgg actggtcagg tacttgtttc ggagcgtcag ctcaatggcg aatgtagtgc
   180541 atggtatgta gcaacctagc acgtcgtatg cagattgtga tgtattgact gcgaagcaca
   180601 gtcagccacg gattcaataa atgttgggac atgcgaccag atgccatctt ggtctggtgt
   180661 atcgcgatct tagagttttc gatcctgacg atcggcaatc aaattatgta tttttggtaa
   180721 tacaggccat gtatgggacc gtattcgatc tttgctgcat gggtattgga tataccgtcg
   180781 gtccatagaa ataatgaagt actgccctgc tgtcagtgac gaacagaata gagtcaaagt
   180841 cagagcacga tgcagaccat acccccttcc tccccattta cctcgaacca cccgcacgat
   180901 gcagacaaaa tcaaccacaa tgacaacgac gacctatgca tcactgctct ccccgagatg
   180961 gccacccttg gggaggtggt agacactatt ctcggccaac gggtgcaatt gaggcgtctg
   181021 caaggatcag gcgcagctgg tcaatcggga tgttccatat actttgctcg accatgcgat
   181081 gaagacgaca atgacaccga agataagacc aaaaggccca tcgccgtcgt caaggtctac
   181141 ccaccacacc gccacagcga tctgttggac gaattggcta gctacaagac acttcgctcg
   181201 ttaccaagcc ctcctcgagc tgtgcatccg attggtgtgg gaagaacccg tgatgaagaa
   181261 tctggggctc tggctggggt tgttgtatat caggtcgcta cgggaaaggc cgtaaatacg
   181321 atactttgcg agctgggatg gataactcgc ttgcggagcc tggtacggga cgcggctatg
   181381 gatgtgacga accgtcataa attacagata tttatggagc agaatcgtgg cgacattccg
   181441 gtcgattggg aggcgcataa ggctctcgag aaacaaggcg tcgatatcta cttctcagag
   181501 gcgttgccgg cgttctttga gcagcgatat caacacctat tgagggatct tcggtctgct
   181561 atgagggcgg tggcatccgt cctggccaag ctgcacactg ggagaagggg agaatggtgc
   181621 gatgcagccg agaatgcact ggaaaatata aggaaacgga tacgaggatg gatagaagag
   181681 attcagacgg acgcggctcc aggatacgac aatgccggca ttggagtaga ccgacgggaa
   181741 gaaatgcagg atatggtgga atatgctatc caccaagcaa agcaccgagc cacaacctcg
   181801 ctgacccatg gcgatgcttc gtcgggaaac ttcttctggg attcaaacat tggagtcact
   181861 atgattgact acggtggcgt gcgtttgtcg acagatgaat cagggaaacc aaccggtctg
   181921 gccgagatgg acaccgctgg attctatgaa cggctgcgga aatacgcacc gtcgtttgga
   181981 gtcagcgacg acgatgttac gagtcttcag gagacattct ggactgcata tcatgagcat
   182041 aacatgtccc ttgatccaga cattgttcga ctggttcgtc tgcgcatcca gatgagtcgg
   182101 ctctggtccg cggtggacaa gttcaaccag agtcaggatg gaaaccaagc agttgttgaa
   182161 ggggaattcc aacggctccg ttccatagcc aagttgctgc gagaccaagg agcttggaaa
   182221 cgtaacatcc tcgtggtttc caacgcaagt ggatgtggta aaggtggcat accattcctg
   182281 aatcaggaac tcgtcaatgg cttggcaggt ctcaacggtg tttctgtagc actatttctc
   182341 gttggagata ataattccgt ttcccaaaca catcatgaaa acgtaacagt ggtcggtctt
   182401 cccggttcag aagccaatgg agagctcctg tactatatgg ccaaagttca ccaaccggaa
   182461 gaatttggtc tgcccaccca cagagatgcg aactgtcgct ctcccttcga tctcatcatt
   182521 ggacactccc gttattccag tgccgccgca gccttggtcc gcgatcggtt ttatcccgca
   182581 gccaaactgg cccttatcac gcatacgagt cctctgcgga aggcggatgc agcgtgggca
   182641 tggtacggag gatcacgtca gcagggatat gaggaagcaa cgagactagc gatgttggac
   182701 gaaaggatcc tcccgaaggc cgatttagcg gtgggggttg gtcctgtgct caccaacgag
   182761 gccagagagc gcgagtgggt gggacagttg acgcgtccac gatggagttt gacagggccc
   182821 cggtttcacg agctcattcc tggtgctcat attgtgaaag atgataagga tataagagca
   182881 agacgaccag atgatccatt taaggtgctt ctagctggta gggcagatga tcccgccaag
   182941 ggggtcgatg atgcgatcca cgccgtatgg aaattggcgg agtcgggtgt ggaaaacata
   183001 accatcgaca tacttggggt gcctatcgga gaggtggaaa agagacaaga ggaagttgat
   183061 caaatgactg gtataccagc actagttcgg tttcatccct tctccaacga ccagcatgta
   183121 gtgcgtcggt cttatcaagc tgccgatctg gtggtgatgc catccacaca tgaagggttc
   183181 gggatgatat tcaccgaggt tgcagggctt ggaattccta ttctcgtaac agaggacagc
   183241 ggtgctgggc agtttgctct ggaccgaagt cgtattccag ctgagttggg cgatgcagta
   183301 gtagtgatgg atgagaaagc gtacgggatt cctgcctcga tcaaaagcag tcgcgtgggc
   183361 ctttgggccg atcgaattaa tcaagttcga cagaatccaa tccaggcagt acgcaatgcg
   183421 agagaattac ataatgttat gcgggggtat tcatgggcac atgcagcaga ggcattacta
   183481 gatgctgcca tggagcatca tgaaggggac acagtgcaga cagcccatgg ttctctcttg
   183541 ccatatcgac cgctccttag cccagaggtg gatgcttctc tccgatgtgc tacaacgatc
   183601 cgtaatcata acggagtacc ggaaagagaa caagctgccg cggtagtgaa gagtctacca
   183661 gagatagctc catcactaaa cgcccttaac gagttcgttt ctaaagcgtt gggtcatcaa
   183721 gtcattctac gaccattaga tggacctcat gtgaagggat tctctggagc gccggtcttc
   183781 ttcgcgcatt ctacctttac tcacagctac cagacaagac agacagacgc tgctatcctg
   183841 tcgcagggtg aggagctagc ggtgatcaag ttatttccag ccggcctgga taacggcatc
   183901 gcagaagaac tgtcgagttt ggaatggttg ctgcatcaaa ccaagggcga tatcaacacc
   183961 ccaaccccca ttgccgtggg gcgaacgaca tgggacgaaa aggagactgg cgtagtcaca
   184021 tacagggtag ctcaaggagt ctccctctat cagctcatgg cgcgtttagg tctgctagat
   184081 ggacccgaac gagacgatag cgtcacagtg ttgaagcgtg gtgttataga agcggccaaa
   184141 accctggcca aactgcattc ttacgccgtc caaggacgct cgagtgaggg atatctcgaa
   184201 tggtactacg acgcagcgcc aggacgggtc aatcggctgc gttcccatgc cggcatatta
   184261 cttgaacaca ctgggattga tgtggataag ctcgacgaga aggttcatac actcattgct
   184321 cagtcacggc aggagatata tcgtcatcca caagcagcag tagtgcatgg tgatgcccat
   184381 cccgggaact tcttctttga cccgagatcc ggtcggacca ccgtcatcga cgtgactaca
   184441 ttacactgct cgcttgatga gaacggcaat cccgctggca cacctgagag agatgtagga
   184501 cattttcttc atatgctgcg ccgcacgggg gaacagttga atatgagaga gaaggagatg
   184561 gacgagtgct ccagggcatt tctgacagcg tataaaggca ctgcggccgg aaagttgggt
   184621 atacatactc ttcgactatt gggtgtatgt tctgctctgt cttttgttgg acatgcactc
   184681 caaggtccat ctattgatgg acagatcctg aaacaacagg cgaagatatt ggatgatatg
   184741 ttttgtctcg accagtctgg gctccttggt tgagtctgtc caagtgcata caattgtcca
   184801 tcctggccca ggcataaatt acctagattc tgatagatca gtaactaatg tgtatttatt
   184861 atcaatggat atccacctca gctcggcaat gaacagatcc acttctcagc tgaactgccg
   184921 tgttaaatta ccggacgtgt atggtacaat accacccctt accataacaa tgttggtgga
   184981 tggacccgct ttactaggac tagtacggag tagatctgca ccagagataa tattaattaa
   185041 atagtaaacg acaacttcat tccttactta tcctatgtat tcgtcgacat ttcaacccag
   185101 tcgacaatcc tgcggatgat agggcggtcc tgaatatgga catccttcca aactcacggc
   185161 agctagccgt cctccgcata agctatccca tcgtcatttt ggtcgctttc ttcgttgcat
   185221 tcatcgcgca ttcaatactc attgctaggt ccaccacgaa aaatggcacc acgccactgg
   185281 gacctggtgg gaaaccgctg ccgaagcgat tacgaagtac gatgaacaat ctccgaaacg
   185341 cgcaacggaa tgtatctcgg cggatgaagc ttgcttttgc ctggttggca gttggggtcc
   185401 tgttaacgta tgttgccgac ggggtgattc atataatgca tgtgttggtg gccaagtcag
   185461 agaagtggtg gtgtggacag gcggttgtgg tatgttgatt tttcctcatt cgcagaatac
   185521 cagctgagga gtaggtagat ctacgtcgtg ggatcgtttt tctcccatgc ggttatcttg
   185581 gtggcactcc tcgaggcctc ccctgcgccg accattgcgc attttatacc atggatcaca
   185641 gcgcttccgt tcgagttggt gattctggcg gggaccctgt ctgtatatac aaccgtgcat
   185701 catgagccgg tgattggaaa cccgtacggt ggaggacctc gacgggaggg aatgaccaaa
   185761 tgggagacga tggagatagt ctccgcgtct atccgtctcc ttttgttctc tttgatggtt
   185821 ggtctgtata tgatcaagtt tgtccacaag tctaaccccc acgaaactgt cgagttcgga
   185881 agtgcaagtg aagttgctgg attactgagt gggtcgaatg aaggagatga ctcggcgcca
   185941 gaaccgtgga ttcggccgac taccacacca gagacaagct ggtgggagta cgtcagcagc
   186001 tattctctct tcttcccgta tctatggccg gccaaatctc gtcggttgca gatagtggtt
   186061 gtcatctgct ttctgttact tatcgtgcag cgtgttgtca acgtcctcgt cccataccag
   186121 gtgggagtcg tcaccgatac gctctcctgg gataatggtg agatacagat cccatggatt
   186181 cagattgctg tgtatatctt ctatcgctgg ctacaaggaa gtaccggaat cctggactcg
   186241 attcgatcca atctgtggat atccgtaagc caatactcct acatggagtt gtccaccgct
   186301 gcatttgaac acgtccatag tctaggattg gactttcata tgaacaagaa aatgggcgag
   186361 gttttatctg ctttgaccaa gggaaactcg atcaatacat tcctagaaca ggtgacattc
   186421 caagttttgc cgatgatatt cgatatggcc attgccgtgg gatatttcct tatcgcattc
   186481 gatgcatact atgcactcgt cgtggccatc gtgacattct gctatgtcta cgtgactgtc
   186541 cgtattgctc aatggcgagc cgaaatgcgg cggcagatgg tgaatgcctc cagacaggaa
   186601 gatgctgtga agtatatcct tccttcctta tctcttcggt atagaactaa cccccataca
   186661 gaaacgactc gctcatgtcc tacgaaacgg tcaagtactt caacgcagaa gactacgaat
   186721 tcgaccgata cagaaacacc gtatctaact ttcaaagcgc cgaatggcat tccctctacg
   186781 cccagaacct catgaacatc tcgcaaaaca ccgtcttcat actaggtctg cttatcactt
   186841 gtttcatcgc cgcatatcaa gtctccaccg gccagcgtcc cgttggccag ttcgttactc
   186901 tcctcaccta catggcgcag ctgcaaaccc ctctcacctt cttcggtaca tttttccgat
   186961 atatccagtc cgccatgatc aatgcagaac gtctccttga attattccgg caacagccct
   187021 ccgtgcagga cgagccattt gcggtcccgt tggagaattg caacggcagc atcaccttcc
   187081 aggacgtctc attctcatac aactccaaac cagccctcca gaacctgtca ttccactgca
   187141 agcccgcaac aacaacagcc ttagtcggtg aatcaggtgg tggtaaatct accatcttcc
   187201 gtctactctt ccgcttctac aatgccggcg ggcgtatcct cgtcgacggc cacgatgttc
   187261 aagatatcac tatcgcctca ctgagaaagc atatcggcat tgtcccccaa gataccgttc
   187321 tcttcaacga aacacttatg tacaacctca aatacgccaa ccaagcggcc acggacgaag
   187381 atgtctacaa cgcctgcaag gcagcctgta tccatgataa aatcctcgcc tttcccgagg
   187441 gctacgagac caaagtaggc gacaggggtt tacgcctaag cgggggcgag aaacagcgca
   187501 tcgcaattgc gcagactata ttaaagaatc ctcggatcat catgcttgac gaggctactg
   187561 ccgcactgga ttccgaaaca gaggaacata tccaggaggc attggctgcg ttgtcgcgtg
   187621 gacggacgat gttgatcatc gcacatcgac tgagtacgat tgccactgct gataatatct
   187681 tggtcttgaa tgaggggcag attgtggaga gtgggacgca tcaggaactg ttggcaaaga
   187741 atgggaagta tacctctatg tggaacaagc agataaaggc gcagaaggct gctgattaaa
   187801 gactaatgtg tataactatt ataatactac aagccattta ttttggttat aggtaatgaa
   187861 cactgttccc gagttgtata cgttaccaga acaaaccaac tctgcatact ctaaactact
   187921 tgaataaagc aaataaatgc aaactaaagg aacctcttca tttactatgt caagcgtaac
   187981 actaaagttt ccggtcggcg ctccgaaata tcaggagcaa tcttatcgta tttctacatg
   188041 cagcccctca attcttgatc aacatgggat actaccgtgg aagacctata tcaaaacagg
   188101 cgtagtataa atatcaatgc aagcgttttc cacaaagttc gtccagccag gaaacaacgc
   188161 ccgaggaatg atagagatcc tatccccagg ttcaagattt tgaaccaacc gcaggtcctg
   188221 atcactgcgg tatataatct catggcacat ggtgtcctcg cttgcgtgca cattggtctc
   188281 cagccgcaag ttcgcatcct tggagatgtc atctcttccc gccggtctag tgatcttaag
   188341 atcaaaccat gtccaagagt tgttaaagga gctatgttcc tgaggataac taatccaccc
   188401 ctggtcatgg ctccagattg tgactccaat ctttttcacg gggtacagct cgccttgaaa
   188461 cggcgcagat gtcaaatatg gtggttgccc gtggcagtca ctctccgcat actgcatttc
   188521 gtccgcccta gagatctggg gtagcagcca atattcggcg tactctaaca tttacaggac
   188581 aaggtcggac gggaaccatc gtttcagaat attgaaaact gaaatagcat aatccgaatg
   188641 gcgtgggtag tgcactgttt gcttctcatc gatggagact gccatgactc cgagtgatgt
   188701 tcatatctag agaggaacag accaagagag gctaacgata ttccgccagc taggagagga
   188761 gcttatcctc ggtattgagg cccctgaact gtggttttgc gtttgactga cagtctgaaa
   188821 gacaagttgt ctgtataacc atgtcacctg accaaggtga gcacatgccc cgcacttgcc
   188881 cttcactacc ctgctacctc aggcagacat ataccctcaa atacgaggca cactatcctc
   188941 ctgtacaatg acaggagtta gcaaggctag aaaatagctt gacaattcac tatagagtat
   189001 aaaaggttca ctgtgatgtt atcgcgattc cataaatgta gagcatccta acttgagagt
   189061 tggaatgata tcttgcctga acaatatata tctagttagc ttacctgaac tcacactgct
   189121 aacatataat tttccgttga gtagccaagt tcaaaaacca aatctgaata agcttaccat
   189181 gatcttgata atttcgaacc cgcactgtcg ctttatttat gttgtgagac aatcagccag
   189241 gtagatctcg agttcttacc tcatgtagcg cagatatgca atgagaatat taaacactac
   189301 actagagatg ccttgattat aggttagcag tgaaccacgt tggatgtaaa gtatttgttg
   189361 atatttgacc aaactaatcc gtagtttaga agtatactcg gcacaatatg tattatagaa
   189421 accttatcag aagcagctat gaaacgattc aatggtcgtt gctagctcac tatgcaaatg
   189481 ccgggttaac atgcggaggc tgagcacgtc ttatagccac ctcctggcat gattcttggc
   189541 ctgcattaga ctaccgcacc taccatgttt cgtctgaatc gtagagatat ctcgattctg
   189601 caagtggccg gatgacgcga ctctgatcgg cggtcacgta atgagccgta actgacatct
   189661 tctgtatgaa tgtatataat cttctgcgat gcaatgacct gcctctcgag ccatcgacac
   189721 aatgggctct tcatcccgtc catggtaccg tattcggtgg ttcgctgacg aggacacacc
   189781 tgaggaacga cgactgatcg tgaaacttga cctcctcatc gtcccttatg ccttcctagc
   189841 ttactgggtg aaatatatcg accaggctaa catcagtggg tttttcgttc tcctgactgt
   189901 gtcactcgta gattaatggt tttagataat gcctacgtct ctggagttaa agaggacctc
   189961 aacctgcagg gcaatgattt ggttcagctg caaaccatgt acactgttgg ggccgtcgtg
   190021 gggcagatac cttttgtcta cctatttact aaactgccca tttcctggtt gattccgatc
   190081 ttggatatcg cgtggggtgt cttcacatta ttgcaattcc gagcaagttc cttcggcgag
   190141 ctagcagctt atcgatttct tgtcggatgg tttgaagtat gtcgtcctct atttgttgta
   190201 aaccaatgct gactaccagg ccgccttctt tcccggaatg cactacatat tcggtaggcc
   190261 tttccattga gcaaagttag catttcaact gacatgtaca ggtgcctggt atcgtgggga
   190321 tgaaatcgcc cgtcggggtg gctgtttcta tgtcggcctc acactgggaa ctctcacagc
   190381 cagtctgatc caatccggcg catcagcccg acttgatggc gtgcatggtc tcgccggttg
   190441 gcgatggatg tacattgttt gcgctatcat caccatccca atcggaattc taggtttctt
   190501 catcctgccc ggcacccccg acaagcccaa tcgcatggta ctgcggcgca aagacgttga
   190561 tctcgcaaag tcgcgacttg ccagagccgg ccatggcttc aatcctggat tccaatggcg
   190621 ggctgtgatt aacattgctc gcaattggaa gttctgggcg atgcttctgt tggacgtctt
   190681 cttctggaat ggctctttga ataccactgc aggtgggtac ttgctctggc tgaaaagtct
   190741 gaataggttc tcaacagcgc ggctgaatga gctgtctgct atttcacccg ctctcggtat
   190801 gttctacacg ttgttcatct gttttgcgtc agatctcgtg ctgggaccag cctgggccat
   190861 cactgtctca catctctgga acatcattgg tctggtcata ttagtagttt ggaacgttcc
   190921 tgagtctgct aaatggtttg cctttcaaac gacctatgca gctgtggcga tgtcgagtgt
   190981 gctatacggt tggatcaaca gtgagttgcg ggcatcacca gtggaacggt cgttggcgct
   191041 ggttatcacc aacacgattg cgcagtcgac gacagtgtgg acgccgttgt tggtttttaa
   191101 gacagtcgaa ggaccacgct ttaccaaggg atattcattt acattggcga gtgcgatctg
   191161 tctgattgcg acggcgcatt tgatccagta ctttctcaaa cgggaaaggc acgtttctca
   191221 ctccagtgtc cgaattgagt aactttgcta acgaacgttg cagaaaagag caaaacgccc
   191281 aaaccgacgg ggagagttcg atagaaactc cagtgcaggt gcaaacgaaa gttagcgtgt
   191341 aggtgacaat tgttcactac gatgtatgcg atctatcacg caatccgacc ccgcgaagat
   191401 ggcatttttt cgccctacta ttaaggaatc tgcatcggca attatacatg ttgtctataa
   191461 tggaggaaat gacgacttct gatccctgtc atgcgtgaga taatacccca atggcgacaa
   191521 cattcattaa gtataccaat attcaggtat attcaacaac cagtagagag agcggtaaat
   191581 cagaaggatt atcaccatga gcaacataca aacctataaa ccaaggcaga tactacgacg
   191641 agcttctggc aggccaacga tagggcactt atcgcccatt caatggaaag caatcaatca
   191701 atgtcgtccc cggtgatttc cactgacttt gctcatgaga tagcacccca aaagataaat
   191761 ctgccgctga acacactctg acatactgaa ttgggatatc tgggagttgt agtattgtaa
   191821 agtaaccagc agtatcccac tgaatcttcg ttttcttcga atgttgggat taggtgactc
   191881 cgacttgggg ttggaacaac catcccaaga gctccctctt tgatgtattg tcacgtaaaa
   191941 ggccggtctt ttcccagtta tggccattct gttgtagagg tggaccccat ggtggaatgg
   192001 aaatttggct gaacgaagct aaggaccgtg tatccatatc atacattgat ctgttcactt
   192061 gcaggcggct aagaggtata aattgaaaga ttatctgacc gaggatataa tagccgtctt
   192121 ataatccaat cttcatatag agacgaggaa catatatcag acgcttataa tatatggata
   192181 aattgattag agtggcactt ttagatagaa tgcaggaatt agcctaggcc taacgccgac
   192241 tcaggcatca cttgcaaatc aattcacagc agatatgaat aattaatcga caaatggtaa
   192301 tacttcaagc cactccttcc gctcctcttc atttcttgcc tcacgctgca gaaacctctc
   192361 cactccctca tctagctgtt tcctcgacag ctcataatcc tgttcattca ccctcccatc
   192421 ccaatgctta aagcaccccg tgtcgctggt aaactcctcc atgagcctca cgccttgagc
   192481 ccacagttcc acatctcgct cctgcttctc accttcatct gctgagaact gcaacgggca
   192541 aggtattgat gaagctccat ccgagtctta cccgacaata ctcggccact ccttttgtat
   192601 gtctctgaga agactgttga ggcatggctc ataatccatt atcgtcaacc ccgggataac
   192661 actgacttga tgccgaagtg tcttttggcc ctgaatagct tcgaagacaa cagggttgat
   192721 ttgtcgtgac cgcgcgaggt agagattatg tagtgcctgt gcttggtgca gtacttttgc
   192781 tttctgctgt tccactgggt tcaaggactc aaaattctcg ggtagacgga ccttgtctaa
   192841 tgtttcggga agaggaccgt tgtattccaa gaacgctgga cgggtggcct gggtgaagag
   192901 aggaaaaagg cttacagatt gccagtcaat gatccccaga atccgagttg actccttagg
   192961 atcgacgaat atattttgca agttcaaatc cccgtgccag agaactgatg cgtgggtagc
   193021 agaattctct ggaagggtgt aaggggctac cttgaggtaa ttatgaagtg ttgaaagttt
   193081 ttttgcggcg atgggttggt attgtcgcgg tccgtagaat aggccttctg gcatcaatgg
   193141 atactttagt tcgcttttta cagtcgcgat ctcccttttt gcaactgccg tcgcgaactc
   193201 tacaactgag gtccctgagc acagatataa ttagcagata taacatgttc acggaaactg
   193261 taaagacgct tacacggccc acgatcaatg tccaatgacc ctcttccaaa gtcgaagaac
   193321 gaacgatgat ttgtcggtcc aatcgcgaac ttagtgttct gtacctcctt gccactgttg
   193381 tcaacataca agggtaatgt gtcaacgctc gaatgaagat catccttgta gtacaagctt
   193441 ccaaaaccgt tgaactttgt cgcggcaagt gtcttttcaa agtccacaac ttgcaacaca
   193501 agctgggctc tctgctttcc tttcaatgag tcccaaacat cgctgagcat tacaccaggc
   193561 tgtttctcca ttagaatata ctcagcgcca acggggttac cagttgctct ggagctccat
   193621 gcatagacct gcggaacagg caagttcaga acatttcgta actgcggggg gtcagtgaga
   193681 gataagaaag gtgaaaggaa gtgtcagctg gtggaacaat ctcacaaagt ccatagttgc
   193741 aacctcactt gccgttgtga agtgaggtcg accggcgtta ggattgggta atttggcaac
   193801 tatttcgcgt ccattatcca tagtcagtag aaagacttta ttatactggc cctcagaagt
   193861 tttcaaaact cgagcgcagg attgtgctgc aacaacagaa gcagcaatgc ccaggagctc
   193921 ttggagctcg aacttaacgt aacgacacgc aagttgctcc tgctcgcgcc agagccatcg
   193981 acccgacgta aaccgcctga atgcgtcaat gtcatctttc gtatctgaaa ctgttagcat
   194041 ctcgcaactc tgagctagtg cacattaatt ggctttacct ttcacattcg acgggggttg
   194101 atgcatcgtg tgttgatcag catggaagtg gcgcctcatc aagctgcaac caagggacaa
   194161 accgggaggc ggcgcagtat ttaggacatt tttaaatgta gcgactggga aggccctcat
   194221 ggtatgtgcc cgaggtcaaa ggttatgatg tggatgtgag cgttcgacga gagaacggga
   194281 ctggggtcac tagacagacg caaggcgtat tccggcctaa gcattttagg attatttatg
   194341 taagcaatga attataacgt tagctaacta atatgaaaac cttggccacg cggagagtca
   194401 tatacatcgt agcagtgaca cgactcggta tataaacaat gggatgagct tatagaacag
   194461 acacaatggt atagaatata taagatcact tattcatatc cttaatgtta ggtctccgtc
   194521 atcaattcca tattataatt aatagctata cttatagtct cattatctct gtatataaat
   194581 tatatcccta acagccagtc tcaagtaaca tgttatgttc agctactcca gctgtagcga
   194641 ggtctagtac tgcatacgta taccgtctga atcagagaag cttatcgtca ccatatttct
   194701 gcgtatacag agcaatggcc ctgataggaa aagagtagat atagttgtaa tagaatagtt
   194761 gactgtaaaa gaattcatga gggtccaatc tcattcttca gtagggccat gacttaccag
   194821 gtgaaaatgc ctgctcccac acctgcttcc tgctcccatt caccacttgg cttttgtcgg
   194881 ctcattataa gccgaattcc tcgcctgatt ggctcaggat cgggatagtc ggcgtagatt
   194941 agtgccatac aacaccaagc cgtctgcacc acgtgggaag attctgcctg gatataagtc
   195001 ttcttcataa tggactgtgc attgtttagc ttggcatgat ttacttggat aaatagttaa
   195061 atggcctacc tcaatagttt ccccccatcc gccgtcctcc ttttgcttgt caaggataaa
   195121 gtcgcacccc cgtttgacaa cagcatggtt ttcatatgtt tcgttggcac agtgaagtgc
   195181 ctccaaggca aaaaaggcac cgtaagtgta agcaatcccc caggacgcaa gccaacctcc
   195241 atcgatctgt tgattttgat ggataaagcg aacaccacgg tcgatggcgt tcaccacctc
   195301 ctctgctcgg tagctgctat cacgttctct gaagaggctc agtgcagtga tgcatgaaga
   195361 ggtggtttcg gtgtaatcgt attccgtcat tacgttggca aaaagctcgg tcccattcag
   195421 atgttccaag aaagggccac tgcgaatggg ctcgaaggag ctatatcctc cagatgcatt
   195481 ttggatcatg agcatatgat cgattgccag ccggatgttt ttctcggtgc taaggcgagg
   195541 gatgttcgtt tgactttcaa cgagcaaaat tgccttcaat gcttctccag tacagtctga
   195601 acaagttgat ccatgatatc tcgtggtgaa cggccatcca cctaagcgac tagaacgatg
   195661 gcacggaggt gagtcaggcc agtcatcaag gaactgttgc tcgagcagga atttgtaagc
   195721 atcttccgtg caacctctca ggtcaggatg gtctgaaacc cctgatatta cgagggtttg
   195781 aagagcgaaa gatgtattcc aagtgtgtgc accatgaatg ctctggactt gcatcccctg
   195841 tggactgaac caaagatatt caagagttct ttcttgactt tgtttcagct tcttagagtt
   195901 gggcccttcc tcgcaataga acacaatcat attcaagaaa cagtctagac tgatcaatcc
   195961 agtaccgttg aaagtattat ctgacgcctt gatgatttcc aaagctcttc gctcagcact
   196021 tacagccaga actctcgggc gcagccatgg attccacacg ttggacaatg cccagctagc
   196081 tgtgcgtaga acgcggctct gcggctgatg acgctcacac tcgaggacgc atccctgcag
   196141 agaagcaaat ttgatagacg aatatggctc agtgaatatt tctgttctga tttcgtccag
   196201 aagagggttt gatggcatgg tgaacctttt actggagagg tagcacattg gtaaataaac
   196261 ctggcgtaca atgttatacc atctccatgg actgatgggt gtccattcag ggagaagcct
   196321 tcgtattttg agagatatcg ttagtagatg gtaggtcatt cgggaagaaa ccagggagaa
   196381 aaagagggag aacgaagtca taccagagtt cgacgggata ggggtcagtt ccttcccacc
   196441 catacaagcc aagaagagag agccagaact tcgcccagct gggtaggtac acggcaccgc
   196501 ccatttccaa gaagcatgct cttgctttga tgagatgctt ctcatcagag ggaatgccca
   196561 ttaggcgcag agcaacatag atcaacatgg tgcccatgag cgtggtcttc cctcctatat
   196621 gcgtgggaaa cccaccgtcc gttgggtcct gaattgtgaa aagataattg gctaactcaa
   196681 tggcataagc ttcgtcaatc tcagcaccag tgatgtacca agacatgatc agcatcggag
   196741 ttacaaagac aatacatttc aagtcatccg cccagcaacc acgtccagcg acctggagac
   196801 ggctatggaa tcggagacca ttggagatag attgagatgg gctctttgtt gcttcagaat
   196861 ctggaattgc ctggcagtta cttagcattg tactcattct gcgaggctgg gaggttgtaa
   196921 caaacaagta acaaacagga gagacagaga atcaatatgg gtttatgcac aaaccagagg
   196981 aagtccaaga aagaaccgtg aaaccaaatc ctgtggtcta gaatctcgtt cattctgagt
   197041 gttcaggtat ttccacttca aacgtccaag gtccttttcg acaaccagac gccatgcctc
   197101 gcgatcagtg gtgcaggccg agaatggggg tttcccatcc tcgatatcct cttgggcatt
   197161 taggtgattc ttgatcctga gggcgtgctt gttagatgac gcgaacttgt gattcatgtt
   197221 gtgtatattc tacctcggac ggggaaagaa ggaggcctat gggagtgttc gaggtctttg
   197281 gaatgagcgt ggcggcatgc tcgatcttat agaatgaaag aaagctcaac gggatgttgc
   197341 atcttaggac cgacgtatac gaattgcagt gtatatatga aaacggcaac tgaatctact
   197401 acatacaagc tgtaaggttt caagcgtaat cgtcatgacc tactgtcatg ttacatgatg
   197461 gaacgtcttg gagcggaaat caataccgaa gagctacgtg tacacaggag aatgctctaa
   197521 gcgatgttgc aattagtcta ttgggtaatt tagagctacg tgtacacctt tgggtagcaa
   197581 tcccttcgga atcaatgtgt ttcgagcgaa ggaattctac aggtcggcaa tgaatatctt
   197641 gttttcgggt gatatgatgt gtctcaggga gtcgtacact tgccagctca tccccccacc
   197701 ctctccccca aaagcccagt gtatctagat ctctagactc tacaattttg tgcggtaata
   197761 caaccttctt gctgcatgcg gataagattg gtgctcgtcc acggaattgg gataccgttt
   197821 agctgtttca aactttaaag ttatgtcatg tcaactttgt acttttgtaa tcaattgatc
   197881 tacggttcgg gtgaaaatcc aagcgcgtga ggttgcatgt cagcgacagg aatgttcgca
   197941 ttccagattt ccatttgcgt tgctcacatc cgtaaggcaa ccagttagca atgttcagac
   198001 ccttttgcct ctttgctaca gccattcgga ttgtgatcag gattagaaga tagaacgaaa
   198061 tcacgtattt tcgatatttt ctaacactaa tatcctccca cgtttggagg atttctctca
   198121 tatgatgttg aacagcatca atattccgca gaacgccata tcatgggcag tggcatgtgc
   198181 ggcagctgta tgtttaccct gtacaccttg cgcgcttctc tctaatcaaa acaggccacc
   198241 ttttgccttg cgagcagcgt tgtctataac atatttttcc acccgctcgc caggtatcct
   198301 ggtccgctat ctcacgccgc ctcacgcgtc ccgtacttta tccgcgtatt caagggcact
   198361 cttccgtttg atatgctgga cttccacaca cgctacggtg atgtggttcg tatcgccccg
   198421 gacgagctag ccttctctca cccggacgca tggaaggaca ttatgggcca cagcaaggga
   198481 ggcttgtatc tagaaaaggc tagttggttc taccgacctc ttgaatatga cccaccacat
   198541 attttcaacg agggtcgcca agcacacagt cttttgcgtc ggcaattggc tcatagcttc
   198601 tcagacaagg ggatgagaga tcaggagcca atgatccggg ggtatgttga tcttttacta
   198661 cagaggctgc gcgaaatggg tggcagagaa gacacagttg acatttccgc ctggtacaac
   198721 tatacaacct ttgatatcat cggcgacctg tcattcggtg aatcatttgg ctgcctcaag
   198781 ggctcaaact acgatgagtg gattgaaagt atatttcggg cgttcccctt tatcacagct
   198841 ctgcaggccc tgtcattcac tcccctagtc aaagaggtct tgctggcctt ggtacccccg
   198901 tctatgcgtg acaggcgtga gaggctgaga gatttcacgc ggcaaaagat gcttcgtcgg
   198961 atggcaattg cagaggagcg gcctgacttg atcgaagggc ttttaaagaa gaaggaagag
   199021 ctggtacacc ctccactcaa tcattaggtg tcactactaa ctatttcagg gtttgaccat
   199081 agacaagctc accgccaagc ggaaaccctg gttgtcgccg gctccgagac aacggccact
   199141 ttgctctctg gtgtcactta cctccttctc aaaaacccgg aagcctacca gaggctaaga
   199201 gaggaagtac gctcgacgtt cagcagcgaa gatgatatca acctcagctc agctgctaaa
   199261 ctaccgtata tgctagcctg tgtcgaggag gcattgcgca tgtatccacc tggtgctatt
   199321 ggtcctcctc gtgtaactcc gaaaggcgga gcggagatat taggagctcg gattccagga
   199381 agagtattta caacacggtc ttcaactacg ttcgtcgcta atatctcctg tatagacata
   199441 cgtttccatt caccattggg ctctatatcg gcgtgaggag tatttcacag atccacatac
   199501 tttccaccca gaacgattcc ttggggaccc tcggttctcg aatgaccgac ataacgtcct
   199561 ccaaccgttc catattggcc ccagaagttg tctaggtcgc aagtaagtat attatcttcc
   199621 taaaaaaaag aaaaagagga aaactgacca atcctctttc agtctcgcat atagcgaaat
   199681 gcgcctgatt ttagccctct tgttcttcaa ctttgacatg gagctatcag acgattcaca
   199741 agattggatt cagcagaaaa acgttataat gtggcagagg ggtcctttga aggtgcattt
   199801 gacctatatc catagaaaca gcgcttaatt cgttcattgt atataaatca tcttaccggc
   199861 aaacttttga ctagaatggt ccgtgggtca aagttcgggt gtaatgaatc tgagccaaac
   199921 aaggttcctc acccactttc ggttatgata tgttctcgat aaccgggttt taaatcatat
   199981 atttagatag tcgtgactat aaatcaaata cttatcattc gaactggtgg ttttcatttt
   200041 ggctgcctct tttgcttttg gtttgtttca acccgatgac caatattgca cactgcccta
   200101 tcactggcct cggccacaag ttcagcgtca atccctcggc ggatacgacg tactatatta
   200161 cgatattact actacagcac cgtcagttat tggcgatgga ggtattacca tataggttac
   200221 ttatcctagt agaaggcaat tcaaagtcat tagtgctgtg cttcaaccta ttccccaagg
   200281 agaagttcgg acttatttgt cttatcatca gtgataatta agatattgtc aagaaagctc
   200341 agtatgagga tctgccgtga gatgggttca ggagtgaaat atgattgaag aaatgagtac
   200401 atcattgcta taacaggtgc aggaggcggt tggttatgat tgagagaaac atacatctta
   200461 ccaaagcgca cagcgtccgg cttatatgaa ctctgtacaa gactcacact gtgttcgctg
   200521 ggctcgttta cccgctacgc ttcgctaacc gaatagcaaa tgataaaccg ggatattgta
   200581 agcatgacag cccttggcgg gacagactcg catatggtct aggcaggata gctgtggaag
   200641 caagtgctgt ctttccaaga cattctaggt ttgagttccc tgactcaaga gtccacaccc
   200701 attctttcca tttcggaatg gcgtggtcga gaattgactc tgcagtaact ggaattacta
   200761 taggtaacag aaacagaatt ggcaaatcga gaccaatgcc acgacttctt tgttactcag
   200821 atctgacttt atggcttttc ctacccatgc ataaagcccg taatagccgc gggtgtgcct
   200881 taataccagc atttccgcgg accaaacgcc aataacatat atttaaaaca atgtctcata
   200941 tgacatcagg atgtggtgtt gcctgatgct ggagggggtg tcgcaggatg acacattgtg
   201001 gggtgatcgg ttctcgacgt aaaaacatat attagaaaga tggcacacac agagctgatg
   201061 aagattaccc tataaagaga gcgtttaagt ctaacaatga gttcaggttt gcagaatttc
   201121 agcattgtac ctggcctttc atgctaacat gcagttagaa ccagtgtatc ccaggtttcc
   201181 tttcgctcgc cctagtggcg atgagccacc cgcagagttt caccgtctcc tccgagaatg
   201241 tcctgtttcc cgcgtggaac tctgggacgg aagccatccg tggttggtgg taaaacataa
   201301 ggacgtatgc gaagtactta cggaccccag actatccaag gtataagcat gtagacaaac
   201361 ctccgtgaag cacggacgaa tcaactaacg ttgtcgcagg ttcgtcaacg agacggcttt
   201421 ccggaaatgt cccctggtgg aaaggccgct gcgagaaacc ggccgacgtt cgttgatatg
   201481 gacgctcctg atcatatgca ccagaggtat atctctccaa taagtgctca cagactatct
   201541 ggtactaatc ggggtgcagg agtatggtca gcgccttttt caacgatgca tatgtggagt
   201601 ctcgccttcc gttcattcga gacactgttc agtattatct cgatcggttg attcgggcag
   201661 gtgaagatgg aaaagaagtg gatctcgtga agcatttcgc tctgccaatt ccctcccatg
   201721 tgagtactac acgtatgaag tgtcactttg tggtcgtttg gattaacgat cggatactgt
   201781 cacagattat ctatgacata ctcgggatac caattgaaga cttcgagtac ctaagcggct
   201841 gtgatgcgac gcggactaat ggaagtagca ctgccgctgc cgctcaagct gccaacaagt
   201901 aacgccattc catgtcaatt acgtgtgagt atgacactta actgatatgt ttctgtaggg
   201961 agattctaga atatctggag cggttggtcg ataagaaaac tacaaacccc agccacgatg
   202021 tgataagcac cctcgtcata cagcaactaa agccaggaca tattgagaag cttgatgtcg
   202081 tccaaatcgc atttcttctc ttagtggctg ggaacgcaac cgtcgtaagc atgattgcct
   202141 tggtatgatc agattgccca cagtctagat gtgttaaata gcttggactg atttatcaca
   202201 tctatagggc gtggtaacct tgctcgagca cccagaccaa ctatcgcggt tactggaaga
   202261 cccgtcgctc tccaatctat ttgtggagga gctctgtcgc ttccacacgg catccgctct
   202321 cgctacacgg cgtgtggcta ctgtggacat cgaactccga ggacaagtct gaacccttcg
   202381 tgcatcagtc ccttctccaa ctactaacta ttaatactag aaaataagag cgggggaggg
   202441 catcatcgcc tcaaatcaag cagcgaaccg tgaccccgag gtcttcccag acccagacac
   202501 cttcgacatg ttccgaaagc gaggaccaga ggaggctctg ggtttcggat acggtgacca
   202561 tcgttgcatc gcggaaatgc ttgcgcgtgc ggagctagaa actgtctttt gtaagcaaag
   202621 gttcatagaa cttgtgcttt gatttggaaa cttacgagtc gatacttttg tagctacctt
   202681 attccaaacc ttgccgagcc ttaagctggc ggtcccaaaa tcggagattc aatggacacc
   202741 tcctactagg gacgtgggta tcgttggact tcccgtgact tgggatagag attgagatga
   202801 ggaaggaaat gtgagattcc aaattgactt ttggaggacg aggcgtattt gtattccaaa
   202861 ttgtaaattg cgtaatattg aaatgttcat ttgacgtgtt caacacttaa cttttcatag
   202921 cgagtttacg aggaatagac tcgcaagtag atctgtgatt aacgtgtgaa agaacgttgc
   202981 gaattcccag atcaatatcg tctagcttac atcaagagac attaatttag cggttcaaag
   203041 aagcgtcgta ctcccatcaa ggttaaatct tgcacgaaga ctatcccaaa atcaacctca
   203101 acaaggaaaa atactttaca cttcgcactg tggtttctct tctccgtagc tttcatcccc
   203161 agtttgtcac acacacagca caatcaaatc cccaaacagc acattattaa acgataccgt
   203221 cgatctgcaa actctctcaa attagcagag gttaagttcg gtgggttccc caaaacctag
   203281 tctaacatcg cctccagttg gactctctta aaagcctcgc acacctgagc atgcatcaag
   203341 ggaacgcatt cttcggatga tccacccctt accgataggc ttagatgaac cccgatcagc
   203401 tttacaccgc tacatcccct tcattcacga gccagattac ccattagtcc aatgtctatt
   203461 acataattct ttgctatgga cctttctagg gtcttacatc ttgtttgccc gtggctctta
   203521 cattgcatgt ccaaaccgac ttctgcgagt cggacgctga agcgcacact agccctaagc
   203581 aggacctata tagattagct gaggtgtata acttagacta aggctaattt gctacacggc
   203641 aaggaaagac agcaccgcca cttttgaaag tatagaaaca aaaaaaaaag aaaagaaaag
   203701 aaaagaaaag taaagtaaac atatagaaat gttataataa ttactgcaaa ttaggtatag
   203761 aacaagatta tcgaaccagc tagacactcg aaaaagagtt tcagcccgcg ttgcaaagta
   203821 tataaaccgt cgggtcatct atcaacattc aaacattcac ccgggtaagg atgggacaga
   203881 tcagtcctga aacgagtatt gctactcggt gtaggtgttc ctttatggct atcgttgtga
   203941 gcatcattgc aatggctgct atgacttcta ctattcgtat caagatccgc ggtgtggaga
   204001 agtaggggag agagggtggg atggtggcgg agagctaggg ggcgaggtag gcgaggtagg
   204061 tgaatagggc gcgatatctc cctctaactc tacgagagcg gagctgccga gttcgcttct
   204121 cgcagactgt cgttgcccgg cgacttcagc aggcagctcg cttctcatgg cttcctgttg
   204181 cccggggtat cctcccgcga gctcactgcg cctcgagtca tcttgtccgg tgcctccgac
   204241 aagggcggct gctgccggat ctttcacgtc ttgttgtgtt tgttccactt cggtcggtac
   204301 actgttcttc ttcctccgcc gcaggtaaaa gaacagaagc gcagccagta gggatacgcc
   204361 cgcgacgccg cctacgacac cacccacaat cgcgcctaca tgcttagact ttgaaccact
   204421 ggatgactcg gaggttggga tcgtgcgtgt gggtgcgcgg gtagcagcgg tgtatgtgcg
   204481 cgtgaagaaa accgacaggt cccggttatc aaagccgtcc gcgggctgtg tggtattggc
   204541 gccccctgtg gcactataga aatggtcagc ttcaaatttc cggctgcaat tacccatgat
   204601 acgtacgatc ctccaaccgc ggagataatc tcggacggaa cttcatagct cgtgaggttg
   204661 ggtctgaaca gtgcccatat cgcatcctgg ggattttgct ttccgaggta cacgttgtgc
   204721 attccgtata tcgcagggat atcacagtcc gtgtcgtttg gcttcgtacc gcccatcaca
   204781 ctgcttctaa tcagatatac acgttggcac gacttccgtt gcaatggtac ttacagcatc
   204841 tgggcgccat ctacaacagt gcaggacatt gaattcttgg gataaccgct gtcggtaccg
   204901 ttcggatacc taaaccgtgt caactaaatc accctgacct atgcaaggcc caaaacgtac
   204961 catttgatcc attgaaaaga cggtaaggtc agaatataga gatcatcaaa gccaagccct
   205021 tctggagccc cgaggccacc gtagagataa atattatacg aggagtaatc ttcagcccag
   205081 gttgcgccgg cacagaattt tctccgttga tctggtacgt cgccggtcgc cttttgagtg
   205141 taccacttac cacccgaaat gtcatagagc aagatctcct gatggatgtt agtcgttgaa
   205201 gtccaagtcg agagggtgac tatgaggtac gcacatccat aggctggccg atggtagtgc
   205261 cattatttgc ggactgcacg cctccaatgt acaccagcat gccgtcactt gctgggatat
   205321 ataccatcga cccttcggcg cgaccgatcg tgtccggacc cgaagaattc gtccacgtat
   205381 tctgcagcat gtcgtattga agcatagtcg acaaagccct ggaagactgc gatccccagt
   205441 tggggaccga cgtattcgat agccatccac catagtagaa ggcgaccgca cgatcttgta
   205501 tcgttactcc agcgccgtag cttgcccttt tgatacctgc ctgtgtgcta tcggcgctga
   205561 ccgtttgcca tctgttgtag agggcatcgt acgaccataa cgagaagttg ctgggggtac
   205621 cctgggagta ctcgccaccg tagaggtaga tcatcttgtt gacggtgtcg ggccatagaa
   205681 ttcctccgtt gacatcaggc gcgtcggtgg gttttgtcag attgttgtat accgccggca
   205741 taccctgatt gttgacatcg aagtccgcgt agagcaaggc cgtatcttca gaaaaggaga
   205801 ggtcagtagt cgccgcgagg ataccggtgg atgacggaca tacttgtggc attgtcggga
   205861 tattcactca gagggttata gttcacgaag ccgccatcga tatagagcct gagatggtca
   205921 gtgggatcaa tcgtcaaacc tgagtatggt taatagaggt cgcacttgcg atcgatcaca
   205981 gccgtctggt gtccccagag ccggcaaaag tccttcaata tgtctttctg ctggaggctc
   206041 aatccggcga gccccaggaa tagaagtaac ttcctcgtcg tcatgggttc aagagggaca
   206101 gtatcttcta cgggcctctc tctttctctg gggaagaaat atcgcccacg atcattcgta
   206161 ttctcgggtc gtcttcaatg atgaggttca caggatgact ggtgtcagcg agtttggaga
   206221 gatcagatcc tctcagcctt gctgggaaat ggccccaaaa tgacccatct attagcgtgt
   206281 ccagtggatc tgcaaggccc tccatgtcca aactaccgag gggatggatt gggcgaatcc
   206341 gggactttat ccagcttgtc cagcagtggc tgagcttgcg atctccactg cggttaacct
   206401 tttcgagtct agattgcaca gtaacgcatc ctttgccaag ccatgtttgt tgtctgagag
   206461 tgagggcctg ccagactccc aagactttcc cactgtgctt cccctgtctc tcactccctc
   206521 tctagccttt ttcgattttt agtttgtctt ttctaatcca attcaatgct cttcagcagt
   206581 tcctgattta actatcaagc attcagtgga cggatgaatg tcgattgtga ttgaactttt
   206641 cccggccccc acgcgaacca gccgtagtgg aactgccgat ccttcaacgt tgcctggtca
   206701 catatcccca gctgctttgc ttttctgact tcttgtcgag tggggtaatt aatgctctgg
   206761 atgttctcgt cctttcttca tatcccggaa gcaccgggaa ttaaactgaa tccccagcag
   206821 aaacgttgaa tgttcatcct tcattggagg gtttgccaag aactttgcga tccttcagct
   206881 atgttgtgga aattaggcac aaactgaacg agagaaaaaa tatctcgcga tggccaacaa
   206941 aacctaagca tttataagcc tataacccca tgtaagtaag acaagctaag aatgaattct
   207001 agactcggac gtaccgttca cacggtacta tatacatggg tcttctgttt tactctgcct
   207061 tccactgtgg gtccgtgccg tcgagaaacg gtggagaggc ctttgcactc tctcttctta
   207121 gagatgtaga tgttcttttt tgtataatgg gtactcgata aacaattaga aatctgtcgg
   207181 gagtacttgg aatttctacc attatttggt cacacagaat gatgtgtcta taaagcttgt
   207241 agtctcggat aacccctcca ggacgatgct atcgtcaagc tcggatcagt tatatatatc
   207301 gggatctccg agataactca actatgctac ctagcgaaac caattattcc tctagtgata
   207361 agaggtataa catgcttagg tcttgttata gcgacatttt atttatttat tttttaattt
   207421 ccagtctcct tcgtggttta gtatgggctt tcctgctctg gagttgtagt ggcgctatgg
   207481 acatgtccgg agtcgcgctg cctctcccgt aagcgggatt ttcccatatc gtaacttggt
   207541 ataaccgtac catcgttgga gtctgactat atggtggaaa gtaagcaaca gaaaatatac
   207601 atccaccatc tgtagcggct cagcaattca taaattcagg gagaactcta cgaacgttgc
   207661 caacataaga gcaccgtcca aattacaaga tatttggtac ctttaggggg ttctggtaga
   207721 tactattaag gtcgcttttt tccttttttc tttcttctgt tcttgtttgt tctctttttc
   207781 tagaacgttt agatacaatt gagctgcatt ccgtatctag ctctagctat agaagtatgt
   207841 tctgaagcgt ttgtggacaa gcctccacga gttacggtcc gtggtgtagt cagcagactt
   207901 caaacaaatt tataggataa gatcgatcag ttttatgcgc atgagacgta ggtgtgagaa
   207961 atgatagagc tcattacata tctgtaggta catgtgtgct cgggcgtgcg aaatggaaat
   208021 attcattgga gtggtgacta ttcactttcg agggaggcag ctattgattt gagcaggtgt
   208081 tccgcctcgc ttgagctctt ttgaacatgg aatcctcttc acatagggtg atacagttca
   208141 aagtctgcta ggtctagaag atcctcgcct ctgtcagttt ccattcggta gaacctgcat
   208201 ctgttctccc cgatcatgga atggcccaac accaaccatc actcacgatc tggtgataag
   208261 gagtccgata tcacacaatt taagtcttga tagactggac cctacggact gatccagcgg
   208321 gcctggcggc gcatgcatga cccttttagg aaaaccaggg atatcacgat ggaagtacag
   208381 gataaataag aagcactaac caaccgaact tgactatcca tcatttcctg atactacact
   208441 gaaagtctct gttcatcctt atccctccgg cgcaatgata acagctctgg agaccaccaa
   208501 gttattgggt tgcgccaatg caagttattg acaactccgc tctactagta gtccgtcgag
   208561 gtgagtccca agaattgaaa ccctgcctgt tgtagtaatc gagaattttt ttactactcc
   208621 gtacatacac ggcatgtcca taggaaaccc atcaatctag aattggagac cctactctta
   208681 ttcctttttt cctttgatac cattcttgtt cctccttctg taatcgacac tcagtagttg
   208741 attacttgat gaccagttcg atgatgattg atggagttga ttcaatctaa gtagtactga
   208801 acggatgaaa tgagtaactg accgcctagc ggtccgcttt cataaaattg gcaggttaaa
   208861 tcggtgacat ctctctttcc cccttctgcc ggtaatgagt gacaccatcg aacaaactga
   208921 taagtggtgg gacccacggg aatagaacca gtaaaatata actgatagga aagcacttgg
   208981 ttcagtagaa gacgaaatca ttggcttttc ttcccttttt tgtatattta tttttattta
   209041 tctttattta ttttttattt atttatataa tttgtttaat tattttcctt ctactccgat
   209101 ttttaaaacg aatcctaaaa aaagaattgt tacagaaagc agtaattact aatgtttact
   209161 tctatatctt tcccattttt ccctgttaat caccagtggc aagtcgacga tagagtccat
   209221 atcaacaaca ctatcccgtc atcatcgcgg caggttcaag tacttttcga cttcccgaac
   209281 acggggattc tgacctgaat tggctgataa atagccttgg agatacagcg caggtccccc
   209341 gcgttttgcg ctccaatagt tggtcgatcg aagtaagcta cgactcccct gaacgaccca
   209401 cgaccacttc tgcgcaaatg cttcagtcac ttcccagcct tgcggatccc aaggctcttc
   209461 ccaaacaagg acgcccccat acccactcct cacacattga aactcccgta tatcgcggca
   209521 aaactgcgcg gcatcgtacg tagacgtatc ctgacgtatc aagttgtcac gaacttcagc
   209581 cactggcaag aggtaaatcc aaggatggtg ggggacattg cattgaagag ccgtgggctg
   209641 aagagtggct ggcaagatgt tcaagaagga ttcgctgacg tccactgcag tgaagtggac
   209701 cgcgcgccgg gtgacatgcg tgaagtcgtg tatccaagaa tctctgcatt agccaccaga
   209761 gaccgaggta ttgaactgaa ctaagcttgg aagtgtttct gtatctaggc atccccgtag
   209821 atagcgctga gatatctacg ataagaactg gttgataaac tgctgcgtct cctcagaatc
   209881 tggttgacaa gcggtaaagg agcttatgtc acctgggaac gaaagccgac ccctgtacag
   209941 gagcttgttt cgatcgaaag aagtaagttg caagccggtg gatgagctct ccgaatgatg
   210001 ctctgttggg gttgggtgca ggataaggca gagatctagc cttcctcctt tgattgacct
   210061 ttattgcatc atcgcacgat tgattatcat atgtcagcga gagaagccgt aaggcccact
   210121 ccgagcgggg atacctacgg ctagccctct ggtttatccg atcttgaggt tttttctctc
   210181 cttaggatcg gttttggcgg ttcaatcgtc tctatcccta gcttgcagct gctgcggcat
   210241 gagctgcaag ggaatatgct ccgaacataa ttaccgagga gagggtgctt ttatcatgtc
   210301 ttagatctgc cggcgtgtct cgcttgcgga tgtcgtggtg cagtggggtg cctagcaaag
   210361 gaaagatggg gagaggaaat ggtggtgaac gccagtaggg gttgcgttgt tatgttggca
   210421 ataggatcgc aatgaagcga taagtgttga attggtctag cccggtagta ttagctgcaa
   210481 ttcctccagc atgctccact cttagttctt ggacgtaact tcaacatcag atgtgtgtac
   210541 agatgcatat ataccgtcgc tgcataccgg agcccttcct cacccgccta ctctccacac
   210601 cacattactc caggcttctt tcgacctccc cagaccaacc acaccaacta gcaactacat
   210661 ttactacaag ttccctgaca tggccgtgtt gacttgcaag acctactgta ttctccgaaa
   210721 attctttgcc tgtgacgaat gtaagcatcg gaaagtttgt tcttcgcgtg ggatttgcgc
   210781 caactgcatc cgcgacgcca aaagatgccg atattcctct ccacaccgca aaacatgcaa
   210841 aagttcaaca ctccacctca tctatactgg tatcggtctg aatatcaacc ttaggatgag
   210901 ttgggtagtc acacaagtag ttaagctcaa agactggcga gcgtgtcgcg gaataagact
   210961 attgtgaggt tgccctatta attaaaagtg gtctattgaa tacgatagaa catggttgtg
   211021 cttttgctgg tctgtgaatc ctagttagtc aaacctatct gtgactatgt tattatgagc
   211081 tcacctgcac cgcatcaaat gagctgtgtc ttttggttga ctttcctgag tttccgcaga
   211141 aaaacctcta gcatcacaat gttgtgattt tgagcgccga ggttctttcg gagaaggtga
   211201 aaactttcat ttgcaatcac ggtcgcctcc gtgcttctct tggtttcgag aagtgctgtg
   211261 cacaaggaca cggtggggaa tattatttgc ccatcatctc caccgttcga gatatcatcc
   211321 ctttcgaggt ctagaagctg gcgagcaacc aactctaact ctccatattt cttctgatgt
   211381 gtcaacaaca aggaaagatt ctgaagaata gcacacttcc ttgtggtgtc tagactctcg
   211441 ttgagcatcc atcgcagata ggcttccacc tctggatagt atccgagttg gaagagtaaa
   211501 ccacagtact tgccaagcca caaaaatgtc atcgctttag gcgcgccaga gttcatcatc
   211561 aaatggatcg tgttggagta gtggatgcgg gcaccttccg tatccccacg agacaaaagc
   211621 atttggccat actccgccac ttgacctagc aactctgggt attcagtata gagcttcgct
   211681 gaaacgatca ggcgcacaag tttgcatgcc aacttgtacc cgtatttaga tttggggctg
   211741 tctttgtacc gggtcattat tcgagccagt agcatttgtg cctttatgaa gctgcccgta
   211801 agatcttctg ttgtctccat cttttccagc accagaagaa gtttccggca atctccttca
   211861 gctttctcca gtcgtccctt agataacgcg tataaagcag aatagtacaa gtggcctgtt
   211921 tggataatac cctcctgggt ctgacataaa agctggcggg tgaatatact gagtatctga
   211981 gaaaacgccc accagccaga ccacgcgagg catgtggaaa gctcagagca aaataagaga
   212041 agtaacggag ccggcattgc taagtaccga ccaatgtcga gagccttgag gcaaatggcg
   212101 cttgctgctt tgccatgctt atcaagaaac ccagatagta gactatgtag cctacaggca
   212161 tcatccaagt gcaggtgttg ggtctctata cctggaagag agcatacaac aaacgtgtgg
   212221 atgtgtggca ggatattcct aatatagacg ttggtttctt gtctggaatc cctatttttc
   212281 agaaaggcgc ggagaacatt tattgatcgc cttgatcgat catcgaagct ctgaactgac
   212341 caagcccatt tatgcacgac agggtgtatc caaaagtgac catccttcca ttgctggtgt
   212401 attaagcaat aagaagccaa gagctcgaaa cagtcctgca tttgatatac tttaggggta
   212461 agcgttgctt ttatcggcct gcgtcgaggc gcacaagggg gatacttaca gtctacgata
   212521 ccaggaatac aaatctgcat ccactctggc aagatgttcg tgttacctag cagagaacaa
   212581 gtgaacatag tctccgctgc aagtttattt tcagcctgta tagctgacag tgaaacttcc
   212641 cacgttgtat tcacaacctg atcatagttc caaggtcctc ttggcttctg actcatgggc
   212701 cgaatgaatt gttgttcgta ttgttgtaga aagtcatcca tggatagtct tcgattattg
   212761 atataagcgt tggcttgaac gatagccaga ggaaaattgc agagttttct cagaactgct
   212821 tgaacggatg gacatgttgg tgtatcgtcg gccttgtaca tcctattacc tgagagaagc
   212881 agttgaagcg ctgcggcatc atctagacct gaaatgtcaa atgccttgtc cacagatctt
   212941 tgtaagtccg gacgacgact cgtaattagt attctgctat ggtctgcgtt tggaatgtaa
   213001 tcttcgatat tgaactcgtc aatgttgtca tagttatcga agacgataag ccacctactg
   213061 ttgctctttt tgccgagcca gctcttcaat gaccggatgg cgccctgcat cgttctgggg
   213121 gggattgggt catgcaatag gaggcttgtc acatcggaaa atccaaacat cgtcgctgca
   213181 actcgctcac cgtagtgtac aataagactc cttagaacgc actgcgctat gcaactcaaa
   213241 cccaattcaa ccgaggacct atccctggcg tctacccagc agattgctag ggagtctttg
   213301 gtcatagtgt gcgcataatg agcggctatt tgagtttttc caatacctcc gatgccgtat
   213361 aaaagtaaag ttcggggagc cgtcgcgtct tttgagaagt attcctggat ctgactgagc
   213421 acatcctggc ggcccatgaa ccggggattt cgcgcaaaag gcagatccaa gtcaactgac
   213481 aacatggtcc agtgacctga agcagatgtt agaaaaagga ccttattacc gcgacagtga
   213541 aggcttacaa ttctcaagat cgggatgtct tgctgtcata tcaagggacc ctatcaacct
   213601 caaagtatgg cacaacttta gtctgtatat agaactacag gaagagcgct gagatttaag
   213661 atttaccttg gattggcgcc aggctatcaa tgtcttgcgg tgtaatgcta cagacgagtt
   213721 gctttgcata tgccgctgcc gccgccgctg catagggctg ccagctgctg ttcttatgag
   213781 aatctgcata atcactgata ccccgaatca caaggcatgg aaagtcgtcc atcaatccgg
   213841 cagcctccat ctcgaagcaa atgatgctat cccgttgtgc gagcttatcg cgctcgagcc
   213901 cattcttgat caaggagtta ccggatccta tatttccgta atggatcttc gggtgtgtag
   213961 ttttccgcgg gcggcgagta ataatatcac cagcactttt tgcttccatg catttcgtgc
   214021 agtcatccgc tccggaggag cgatgtttat atcccggact gaaaaggaag tccctgcctg
   214081 tgctggggta ggtccagcgt tcaccctcgc tttcctcgtc atcgtcacat ttgtcttcac
   214141 agcactcgtc atccggtgca aacgcgtcct caatcagccc cgtcagctgc cgtcccagac
   214201 gtctttcagc tctcaggctg gcaaccgccg tccttaacag ggtcggtggt ttgttcaaca
   214261 atccaacccg acgaaagcca tcgacctccc tgcgaataag atcgtactgt atcacccccc
   214321 ctccctggcc cgcaggcaag gaaacaacca catcgccgag acgaatatcg ttcgccgggc
   214381 cagtctccgt aatggggccc ggcactccac ctcccacacc aaccaacagg ccaaaccgga
   214441 tatttggaaa cgtcgcttgc atcgacttag ctgcaatagc cgccttgttg gttccatact
   214501 ctggcaaaca tacaatcgcg atgttgtgac ctgctatcga accgagggtg tagttattct
   214561 cgtcatgttt ggattggttc ttcggccgta cgtggcggtg gtcgagcatg gctctcgcag
   214621 cggtcaattc gcaggggagg gcgcatatcc accccacagt gtatctttct aagggcaggc
   214681 tttgggtata gactgtatgg ttcgcggaag tctctggtcg gctcattttc aagtttcttc
   214741 ttcttcttct tcttcttctc tattaaacaa aatctttatt tttcgaggga agagaatgcg
   214801 aactgtccct agagacgtcg ttagggctgg atacaaggaa ggatgaagtg cactggagaa
   214861 gaggtgtgtt acgggattca ggttgaggct ggggcacggc gacgcgggcc ctaattaatg
   214921 ggagctgtta gagaaaggag taaacaacag ccgcagcgct agcaaaggat tcctgtacgt
   214981 cagccaacca gacatcatgg tgaacttcca tgtcaagttt gaaaccaatc agccccgcgt
   215041 ctacgcgcct aggagaagac tgtgcctcag cagagaaggg gatatcatat aaccactacc
   215101 atatatctat atatcttaca tagagatatt atattcgaat cttagtctct ttaactactg
   215161 tagttctctt accttttcgt tttcttgtta taattaatat aatgtctagt attatagata
   215221 aataataata taacaatcat gagttcctat tctgaaatcg agggtcgcat ccctaaagcc
   215281 tgcgaagccg ctaacgtgtt aaacacccaa atatatcagc gttgtcgcgt caactttgac
   215341 gttccttatc aggaactctg ggcacgtttt aagggatgaa caactcgatc tttacttcct
   215401 atcccacaca aagcgcttga taaagtacag gaaaaggcgc taatttgttt gatttaacag
   215461 cttgatcttc tatattctcc gcctactcct gcgataatcg agcttgctgc gaatcagatt
   215521 ctttgacgga atgccgacgg tgaggcgcgt acagttggca atactgggtc tatcgcttta
   215581 gtaaacgtct acctgagggg tttgaattga tcaaacagaa acctaaggaa agaaatcgac
   215641 cgaatgtgga agaacttggt gaaattcaac attaatacga tcgtttagag ggcattatct
   215701 tggagcatac ggcaattaca aatagccgga tcaagataat ccgttgcctt gtacacgata
   215761 agaattggac agatattgca tctaattatc ttagagagga gagatgaaga aaatctgact
   215821 gagttttaga tacgttgctt ttcttttcgt acagcacatg cactacccag catatgggat
   215881 tgtctaatct gagcaagacg acttaaaacc ttgacaaggc acccaggata agtagccaaa
   215941 tggcgaaacc aagaaagtcg tacaacttca gtatagtggc caggctaata ttctatagaa
   216001 cctcttaatg catactgtcg gcagaaaata tcacgtcgtg aattgttgcg gagtggccgc
   216061 aatggtttcc ggtagacggg ctccaattac tttcaggcgg agcgatttta gggctgaagg
   216121 ggctgaaagc agagcagcaa ggacgccaaa tcgaacaaat taaaaaatag tggtgagcac
   216181 caacatacaa caggagggat tcgctagtgg tcacgcaccc aactactaac ctcccggcgt
   216241 gtggctgaag tacggctgag cggacagaaa gccctgttct ccacacccta tggtcgtatg
   216301 tgatggtttt tagttgtaaa gagctatctg tattactata caatacctgc attgctgtgc
   216361 aaggagaccc ctagcatcta ctgaaaagct atctgatact tcggcgacgg tgtctcaaaa
   216421 gagatctgtc cttaatcaat gcgtaaatct gatgagattc ggggtttgct ggccttacga
   216481 aggcagctca tgataccatg cgttatagtg tattgcagtt ttggacttag ttttatacca
   216541 tgtgagatat tggatgttaa ttgtccaccg ccacaacctt ggtgtggatt gtcttcccct
   216601 gctcaacgtc gctttcctgc tgtgatgcct cttcgttttg cgagccggat gagaagccat
   216661 cgtcctctcg gtcagtagac gacttgcgtc gatctctcca gagctgtatt tggatagcgg
   216721 cggtcacaac gactgtaacg taaaactagt caattaagcg ctgatgaaat ggaacaaggg
   216781 cacctagcac actcaccgag tagacactgg aggacgatat cccacaaata gcccttctta
   216841 gctgccggaa agtcggtcgt cttccagaca aagttcggag cctaacacca cgggttaggc
   216901 ttatgtattg ctagacgaaa agatgcctaa aatggactta ccaccgcctg aacgacgtat
   216961 gcgagatcgt tcgccaagcc aacaattaat gctctcttct cggtgtccgc tgaacagatc
   217021 tcgttgatcc agctcaagat gaggggacca gcaccgctct gttatcattt agtgtgttag
   217081 ctcactgtcc tgatctttct gtgatcatgg ggaagcaggg gaactcacgc caatgttact
   217141 cagccaatat attgccatac ggccgttgat attttcataa agcggcatct gtcggaggag
   217201 cacacagaag attgtctgca aagaaagaga ggaagtcagt aagcttgccc atagaccctg
   217261 taaccaaaat caatgttcag agggctcacc gtgatgatcg cgcccgcata gatgaaaggc
   217321 cagcgtatac cgcgacaccc atcggacagc caaccccagc tcaaagctac cacaacgaaa
   217381 atacctgttg taaccatagg atctaggcta cagttagtat agttctaaca cgtttcgcca
   217441 ggaatactca cagttattaa tctgcggcac cgaaaacgat gtgccaggca caggaggagg
   217501 gttcgtgtta aagctcttca gccagtaacc catgccgggt tgcgggtaac cattattcca
   217561 cacaatgtat aggcaggctg gatcctgtta gtttgttggg gtacaataag aaagcaagga
   217621 tgccacgaac gaagaagata tgtatgccag ctgaggaaga tccgcttagc cttggcgact
   217681 gtccagggct ccttgccagc acggccaata gcctccatgc gtttaacaga aagaatatgc
   217741 tcgtcttctg tcgtccacca cgttttcttg ccgtcttgcg ggagattggg gaagaacagg
   217801 aagcccgcaa gggcaagtgg cagcgtgata atgccatcga tgataaatag ccagcgccag
   217861 ccagcatggc catgcacacc gttgaggttt gtataagcgg ctgattgcaa gaatccactg
   217921 aatagcgttc caatagagcc ggcaagccag aaaaccatag ctcgcttgcc aatctcacgg
   217981 ggagtgtacc acgatccgag gaggtagtgg ataccaggtt agaagccgga tctggacatg
   218041 agtcagcaat gtgcgactgt aagaatgaga gatataccca ctcgaaaagc ccaactaaga
   218101 agcggatagc gtatagtgac cgataagact ggacactgga cgtgcaaatc gtggctattc
   218161 cccatccaac ctccagctgc ggcgagtctg ttagcgatat aacacaatgg ctagggatat
   218221 aagctggagg aatacgcacc gccggaatca cccatcgagg tgaaattcta gtcagcagca
   218281 agttggaggg tatctgccca attacatatc ccactgtgta gatagacgtg ctagtaacaa
   218341 gctcgttccc atacatatgc aagtcctcct tcatgccact gagaaaggca ttgttgatat
   218401 tgttaagatc gagattcttc aagaagtaac cgatctggtg atccccgtta gtctggaccg
   218461 ttttgtctct gtaaagagac taacatactg aggcaaaagt aaggacaaag gcatcgactt
   218521 tgaataacag ccagcgctga tcaggtggaa gctcccatgt atcccatata tagactttcc
   218581 atgactttat cggctgtaca ttgatccggt ccctggattg atcctgtcca gcctctggat
   218641 ggaggctcgt cgatccactg gcacttttgc cccggtccat gttcgatgcg tggttgactt
   218701 gtcagagctc aattgacagg tccgcaccgg gcctgtggct gtatttgaat ctatgtaaac
   218761 atgatattca tattcgacat ggcctcattg atactcctca tcacgccatc tcctatcttg
   218821 cgactagttc agaagcctcg tgcctattcc ccgtgctgaa ttacgctgtc gcaaaagttg
   218881 aaggtgttgg atgcaacatg ttgtgataca ctttccgtgc cgactatgct ttaaaccgtt
   218941 acagcttatg tcgaagaacg ttaaaatgag attccggtag tcataactgt gatttgaagg
   219001 tcaggttttg atggtcggca aatatgatag cgccataccc tagcgtaatt tgacattccc
   219061 cactatatat tgggaggcca tgacaggcct ggaacacata acaaaggaag tggtaatggc
   219121 gattaacagg ttaagaaagc gttgggactt acgctatacg caaggtttgt ttcttctgtc
   219181 gcggtggcca tttaaccgtc tgcctcggac tgctgatggg agtctagaaa ggaagaaaac
   219241 acaaacagtt tccgaagtag ctatatacct agttctacta ctacatgtgg gacagcgacc
   219301 caagcagaca aagacaccaa tgcaagtgga ttgtgaagta atgaacatag tcaacactat
   219361 gaggcctcgt ttttcttttt tcgccctggc agggatgaga ttatatccaa ttgtggatcc
   219421 accaaacccc gaacatctgc cggatgcata tgggtagtat catgcttttc cttgtcgcag
   219481 ttcactggtt ggctcgacat atgaagctat gtatgtttgc tcggttatta tgtcgtaggc
   219541 taagtgaccc gacatgaaaa gaggaccgag tagatctaat acggaggata ttttcttaag
   219601 tcggtctacg catgtattga atttaacaca ttccgaattg acttgacctc cgacgcgcac
   219661 gtacagatat tagtaaaaga aacctacagc ataaggtagt agtgttggga ttgccgacct
   219721 gcactcggaa ttggatatac cccttcgtct aaaccacgtt tatgaaatcc gttcaaagtc
   219781 cctcggaccc taatttatac gagccaagac cgccaataaa tggtgtgatc catgtattcg
   219841 cccgtagcga aataagcaac ccatggcatt tccttcattg gtggaccgtg ctgaacccgg
   219901 gaggaagcca agcaagtgat aaagtctctg attgataagg aatcgggcaa ttgccgagat
   219961 attcacacca tatgccccag attgaaaggt ttccattcat gtatatccgt gggcgatgta
   220021 ctccccctct ggtaatctgt ggtctagtcg acgcagtcgc cacgggcagc agctttccca
   220081 attctaggcc ccagacatat gttagaaagg aacaaatgcc cctccgagct ctaatcagct
   220141 aacaggtcct gcagctgcgg gggatctcgg gttgatacgc catgtttctt gcgaacgcac
   220201 ctcaacgagg ggttctcctt gcgcaatcac gcttggctat ggcaaaacga taagcgacct
   220261 ccctagccaa ttatggtcat ttataattca tagcaaaacc agatcataaa ccctcttgat
   220321 atgcccttgg tcttccggta catatcccca aaaacactcc gactattcgc catttaacgt
   220381 tttcaagatg tctttaggac tttctgaaaa gaacgacacc ccagatgcaa cctcgacgac
   220441 tattaaatct agcgacatct ctgtggagga atcgccggat cagcgaaggg gaaacctgca
   220501 ctatgtcaag agaacagaaa atggctcgct tcctgaatat gaaggagatg ttatcccagg
   220561 gtacgacgct aatcttatgc gagcgcgagc cagtcttagt agcgcggaag aaaagaagtt
   220621 actacgccga atagactggc acctgattcc actcttggcg atcatgtaca tgctgaagag
   220681 tgtcgacttt accaatgtaa gttcagccag tgattaggtt taccatatca gtctacatct
   220741 taaccttgga aggtctcgta cgctcaaacc atggataaag gaacgtcgcg caatatccta
   220801 acagagctta aaatgacgtc caaccagtat aatctggtta ccacgatgta ctacgtgagt
   220861 gtaccctgat ggaacgggaa ggcccaactg atgtttccaa gatcccctat ataatcgccg
   220921 aggcaccctc caaccttctg ctgaaaggcg tacgaccatc tatctggcag gctcgaatca
   220981 tggttagtaa acgagttcga agctaagaga gccccaaacg ctaaggatca caggtatcct
   221041 ggggagtagt actctgctgc catgcagctg tgaccaaccg acagggtctc tatgcggttc
   221101 gctttttcct tggtctcttc gaggccggtc tgtggccagg catgcttgtc cagttatgct
   221161 actggtatag accggacgag attgctcctc ggatagtcct cgtcacactt ctaggtaact
   221221 ttagcacggt tatcagtggc gtgcttgcct tcgcatttaa tggagttacc actggtggct
   221281 tatctggttg gaaatggtaa gggactctcc attgtcggaa aagaaaagct cctggattca
   221341 cgctgttttc caggttagtt ttgaccgaag gcatctttac cgttatactg gggatcatcg
   221401 tatacttcct cttaccggat tgtatgtata gccgcagggt caacaggagg tactgaaatc
   221461 cgttaactca tgtacagttc catctacggc atcctggcta tctgagagag aacggacttt
   221521 cgtcgaagcc cgcctcccga gtaacgctcc gagggcagct gaagcaaatt tcaacctgcg
   221581 cgaactcctc accaccttgc aaaacaagag aatctggctc ttcctccttt gttgggcctt
   221641 ctttaccgtc ggtaccacgg gacttacatt ttaccaaccg accgtgatag caaatcttgg
   221701 atttacgtga gttattacgg ccgtgacatg taagggcagc atgactaacg cgcgttgcag
   221761 ctccatgggg gaaagcctac tgttaaacat tccttctgca gttttcgctg tgatcttaac
   221821 cgtcgtcttt ggtatcttag ccgacacggg aagaattccc cagccggcga ttcctctcgc
   221881 tttcatgatt gtcattgaag catgctatgg cgtgctctac gcatttccga acaccggggg
   221941 cgtgtacgcg gcaaccatct tagctggagg attctcaact gcatggtaag ttgccaatcc
   222001 atacattctc atcgctcatt gtacgctaaa gcccgatagg tacgtgatga tgtggccctg
   222061 gcgagtgcaa actaccgagg gtgccacggg ctctgccttt gcaatcgcct ttgcgaatag
   222121 ctacggccaa attggagggg ctgtggggtc tcaactattt aattcgcggt atgcgccgcg
   222181 atacacgact tcttttggca ttgcgatggg gttcgtgggg atggccatca taatgaatct
   222241 tattacttgg ggatttacgt ggagggtcga cgtggatacc aggaaactaa agagaatccg
   222301 gctcgcagct gccaagcaga accaggcggt gttggacgat gtggatattc atgccgggga
   222361 gaagcggcag taagggatct gcatttcgta tttgaaggat tgagaagagt caatggttcg
   222421 ctaggacgca tgcttggtct gtaatattct agtcaatgcc tgtaaaataa gttagaggcc
   222481 aaggcgccat agcggggacc gattgtctta tcagtttctc ccctcaccgt gtagatgaac
   222541 cttttctcac actccgacca ccatctgcaa aagagttgga attatgaagg cgacggatct
   222601 ctttcatgtt actgcgctgg tagccggggc tctggccttg gagcatcaac agcccctgat
   222661 tggggacctg tctcaggatc tcaaccatat catcgactcg tcgcctctgc tttccttcca
   222721 ccgggccctc gtgcaaatcc catccataag tgaacacgag aagaacgtgg gggagtatgt
   222781 cttagacttc ctctcctcgc agaacctcac tgtggaaaaa caaatcgtaa cccccgaaag
   222841 tgacactgaa gaagaaagat tcaacatata cgcgtatgtt gggaagaaca gacagccgga
   222901 cgtgttagtg accagccaca tcgacacagt cccgcccttc atcccttact ctcttcatgc
   222961 accaacctca ggcacgtcct tcattcgcac ggacctcgta attgctggtc gtggcacagt
   223021 ggatgccaaa gccagtgttg cggcgatcgt ctttgccgct ttagaaacac tcgacgagaa
   223081 tcccaatgcc tcgatcgggt tgttgttcga tgtcggtgaa gaaaacagcg gcgtgggaat
   223141 gaaacatttc tccaattctg agctcaatcc gacgcctccg acatatcata cggtcatatt
   223201 tggagagcca acggagctca gtctcgtcgc agcacataaa ggaaccctag gattcaaatt
   223261 ggtcgcggaa gggaaagcgg ctcattctgg gtacccctgg ctaggtgaaa gtgccatctc
   223321 atcgcttatt cctgttctag ctcatcttga taccctgcaa gatcttccgc ccgagaaagg
   223381 tggcctcctt cgtagtgaga cattgggcaa gtccaccttg aatattggcc gagtgcatgg
   223441 cggaattgcc gccaacgtcg ttccagccca tgctgaagca gcaatttctg ttcgccttgc
   223501 agcggggact ccagaggata ccagaaccat tattgagaga gcagtggcaa aggtaactag
   223561 cggcgacaga agtgtttatc ctgattttgg cgatcgcaaa gcaggcgctc caccgcagta
   223621 cttcgatgtc gatgtggacg gctttgaagt gatcactgtg aactacggaa ccgatgctcc
   223681 tgccctgaag attcacgacc agaggactca aagggttaag aggtatttgt atggacctgg
   223741 aagcatcctt gttgcgcatg ccgataatga ggccatcacg gtcggcgaac tggaagaggc
   223801 ggtgcgtggt tacaagagac tcatcgctgc ttctctatag gcgtttcaga atgcgttgag
   223861 tacatctaca tagccctaga gtacttgggg gtttggctct tgtgtactgg atctccgtat
   223921 tggggttaaa ttatcaaggc aagaggcggg gtgaagaaca cggttgttat cggtcgcctt
   223981 ataaacaatc tttaaagctt acaagttcgt agatgttgag agccttgtga gaactgaacc
   224041 tatagtctag attgggcatg cgacttctgt ataattctcg atcagcacca ctcctggagt
   224101 atcacttttt agctacattt acaaacgcgt gacgcgtggt ccagagggtt gccttcaagc
   224161 tcaaccatga agcccacatg ttctgtcccg catcagactt cgtctttcca tgtctttatg
   224221 tgcgtcccac gtaatgaact cgtgaagtcc cgagcccgct ggcaccatcg gtaacaccgg
   224281 taccttcttg tcggtcataa cctccagcag agccggaccc tctgtgtgga taagccattt
   224341 cagagagtca acgacctcct cgggtttgct gacacgtcga tgctggatat gcattgcccc
   224401 tgccaggccc ataaaatccg gattacgctg gtgtgtgtgc gagtatcgat cctcatagaa
   224461 taaattttgc cactgcgtca ccattccttg ctcctcattg tttaggacga tgacctttac
   224521 cccgatatta aattgactgg ccgtagtcag ttccgtcaag gtcatgctaa acgatgcatc
   224581 accatcgata tcaattacaa gcgtatctgg acgcgctacc ttagcaccaa tggcagctgg
   224641 aagaccaaaa cccatagtcc caagaccacc agaggtgatc aaactacggg gatggcgcca
   224701 acgaaagtgc tgagcagtcc acatctgatg ctggccaaca cccgtagtaa tgatggtctc
   224761 ttgcttgcgg cctgctgtga ggttactcag ctcctcgatc aagtattggg gtttgatcaa
   224821 gtgtggtcgt tcatcccggg tataagcatt ccacggccac tttgttttcc attcgttgat
   224881 ttgtttaaac catgcttgcc tttcagtcat gctggtccgg ttcacatggg gcagtaggtg
   224941 tgtcagattc tctgcgatgt ccccgacaac tgcctcggtc gactgaatca ccttgttgat
   225001 attcttgggt aggatttcaa actgcacaat acccccaagg ccctttgccg ctgccgccct
   225061 cgcagcaggc gcaaacttgg cgatgttcaa tgtaactcga tcatcaaacc gtgcgcccaa
   225121 tgcgatgatg agatcggctt cctgtataga catgttcgca tacgctgatc catgcatacc
   225181 cagcatatgg agggacttct cgtccagttc atcgaaggca ccgagtccct gcaaagttgt
   225241 tgttaccggg atggacgcct tgtctgcaag ttctttgagc aactgaggtc catttgggga
   225301 ctggatgact ccctgtcccg catatatgac aggcttcttc gcggtgttaa tcaactttgc
   225361 gacatgggag atcgacttgg tgagtagttt ttggttcgca tcggtgtttg cgtaggtgga
   225421 aatgcgaggt atagctgggc cggtaggagt agtctttctc aggatacctg cagtcacgtc
   225481 cttcggtaga tccaccagaa cagggccagg cctcccactc gtggcaatct cgaacgcttc
   225541 gttaattctc tgaggtagct cagcaacgtt acgtaccatc acgttccact ttgtgcagcc
   225601 tcgggatata cccagaatgt cagcttcctg gaaagcatcg ctgccgatcg ccgcggttgc
   225661 cacctggccg ctgaagacga tcatgggcgt tccatcggac agagcatcct gcatcggagt
   225721 aacgacatta gtcgcaccgg gcccggaggt gacgagaacg atccctggct ttcccgaagc
   225781 ccttgcgtag ccctcagcca tatgcccggc gccttgttcg tgcttgggga ggataaaatc
   225841 gaagtgcttg gagttgtaaa tggcgtcgaa gaccggaagg atcgttccac cagggtatcc
   225901 aactgccgat gtgcgtgtca gtaagccaga ggaaataaag tgccgctaag aggcatacat
   225961 atatgtttga caccgtgtct ttgcatcatc tcatggaaga tctggccgcc cgtcatgcca
   226021 acgaatctac gtatgagacc catcagtacc cacgacgctt caaaaagcag tcactattct
   226081 catacgattc attcgcttcc cctgatcctg aactcactgg agctccatta tccggtcctg
   226141 tcatgggagc ggctgcactc atatagggtt ctgtgtttct ttacgccagc ccaattagcg
   226201 actgttggtg ggatcgaatc gaacatgtgg gtaaagctgc tctatgactt acatcgactg
   226261 tgccgcaacc gtcatattcc ttcgtcgaat gctttctaac ttcgaagcgc aaatgtgcga
   226321 ccgaggaaag gaggtttgtt gacatcgtgc ggtaagagcc agggcattgc cagcccgact
   226381 gatagggcgt gtgcgaaaca tctcaggcta ggggtgtgac aagatagacg ggtgaggaca
   226441 gaacataatt tcaacagtta ttttgtactg gccgctggtc ttactatttt atgttttcga
   226501 gatgctgtat aagtgtgagc atgactcatg ctagggccag cgataccgga cgcttattct
   226561 ggacaagggc ttacagccaa gctattccaa cgttaattct aacctcatcc gtgactcatc
   226621 cgggttgatc cttgactata atttcctggg gaccaaaaca gaccgcgcga ttggccgtgt
   226681 caggcgtggc cagagtcccc ggaagctgtc tctccaatag catattgtga gttcacgatg
   226741 tctccaccag cgacatttca ttccatcgct caatggcaag ctactccata ccaaacaaat
   226801 gaacaaggtt tgcccaactg ctgtctctcc taccccattt tttctgatta cgaattttcc
   226861 ccttaatctg cgaaaatctc tgtcagcacg tctgttctcc cgagtcaacg cttaggcctc
   226921 cgacctcgcc ctgactgtaa tcttggcttc gctgtctgta gtcttgctct cgtaccagtc
   226981 attgatcgat gccttggccg cgggaggctt gagatacagc gacccatctg gaaaccgttc
   227041 agagacatcc atcgctcctg gcctggccct agagtcacaa gaaatcccca cacaaacaga
   227101 tctagaggga cggaactgta aaggaaaggt tcatacctgc ataggatata tttttcaacc
   227161 tttgcataat cgtttcgagt gtccaaagga tcctcccaga gtcaattgag gactcaacca
   227221 accacagcct caacattagt tgcaaggcga gaaacaaaag gtgatgcacc agatgggtgg
   227281 acgaggtctg gctcaataag tcccgtcaag atgtactctt gtagcctggc ggggtttttc
   227341 ctcatgacat gcatactgcc gttatcaaag cattcccatc cagcaatgat ggcccatcca
   227401 agtcgccaaa acacgatccg tgaccacact ggatcactta tcatgacccg caccagctgt
   227461 cggtaatcga tttagtccaa agccccctgt tgccttggag gacttgaaag atttcgctgc
   227521 gagtcgctct acattgatca acaaatcttt ggctaacgcc tcaacttttc taccaacgct
   227581 cctgataccg gctgtgcgcc acagccacat aaggtatata tataatcaac aaattatatg
   227641 gtgcccatat gtgttggtta gcatattgaa tgtcaaacta acgagccgcc catgaatatt
   227701 aaacttcgtg gcttaaatca tctgttccca cgtaagtcaa gccgaaatat attatcgtgg
   227761 aaatgacgtt ataatatttc ggatccgctg tctaggagat agccatataa ttagaggcga
   227821 aagaacaagt ccccaggaag cagctattag aggaatacag gaataagagt atcttcgagg
   227881 tatcttttca ggtgagtggg tcatctcagc agaaagtatc taagtagatt taaagggctc
   227941 tatgccgtcc cccccgtccc gttcagcttg aacctttcag ggacgtgcga gtatgtgcat
   228001 acatcaatgg ggaacctgat tgcaataatg gccatcacta tccacatcag agtcgcgtcg
   228061 aagacatata cgggccactc atgttgtagc aggtatccgt cattgcccat aatgtactcc
   228121 acaaccctga atagagaccg aaccatgatc aaaaggctga ctaggtacag ggtattgagg
   228181 tgccacttcc atcgcaaaac attagaggag gtctcctgcg tagggtttct gtacattcgg
   228241 gcctggaaga tcattgtgct gataatgaag aaccccagga aaacgacttg cacaatcagg
   228301 ccaaagataa caagcttgtt tcctatgctc gcaaggtcac tggaaatcat catgccagca
   228361 gcaccgcctt ggatcagaaa ggacaagaca tcgccggtga caaagacctt ggttaaccag
   228421 cggacgggta tcagtgagcg actttcaccc ttcaccgcga taattacccg gcccagaacc
   228481 atgtatattg tcgccgcaaa gagggctgga ccgagtagta tgaagacatt ctggatgcaa
   228541 tagggcatca tacgtccggt cttgtcgtaa gcggacgctc gagcacaata acctatgaat
   228601 tcaactgata ccgttaacat gcgcaatctc catgagctaa tgggcaacta tccatatgca
   228661 cttacagaag cccccaatgg caaagcaaat gcaaaaatag gtctttagtt tccatatctt
   228721 ccaggtgtga tgtatcgttg ccgctaggaa aagcaagaga aaaataaccg cggcggccct
   228781 cgagggaatg taatgccaaa gataatagcc tttgtacgtg tggagttccg gcattatgtg
   228841 tgtgacaagt gcagttgaag ccagaccccg tgaggaattg cgagctaagg cgtttggccg
   228901 aatgcgaatg agaacactag tccgtcggac caaggcaagg ctgtatgaat agttatatgt
   228961 tgaaatacat gcactaggag gatcagagac ctatcctgcg acaaaatttg gcgcgtctcc
   229021 actccaagcc attctttatt atttatacta ggcccgcaac taatgtgagg ctcctcgtac
   229081 ctttcttttt tctttttttt cttttctttt cttttctttt cttttctttt ttcttttttt
   229141 tttttttttt gagatacgtg tagctagctc cagatgaagt ccaatctcct atatccagat
   229201 gctgtgtgcg gctatgaagt atagctgatg cactctgacc taaacgaatt tcacgttatt
   229261 attatcaaag gactgtaagt tttcatacta ttccgagttg taaatgatca taaagctgcc
   229321 catattgaga gcgggataaa attctgtttt aacactaaag gctcttgcct agaacgagcg
   229381 accttaacag aggtaaccca tctggtcctt ctcctactct cctctgattt ccaactgcct
   229441 ggcaatgtga taatggcccg tgcatacgag gaaatggaag aagatccacc cgcgccactc
   229501 attgcaaggc gggtcatata aatatttggc acaacaagct gggaaagaaa tacgcgtatg
   229561 cacgggccac ttatgcactg ccatatcgta agccaagaaa aaagcggttc accagaatgt
   229621 tacattttcc gtagaaatgg accactccca gtcctctatt gggggagtga agaggtgcca
   229681 tcgagacatg gggttgtcga ttcagccaag acgcgatttg gccagtacaa ccagtccgcc
   229741 cactgcggcc caagatatcg atcgatagac cggattagga atttgccacc atcaccgaaa
   229801 agccacgcat cgcggcaaga gtacagaata actgcataat gtgctagaat aacaagcgct
   229861 tccggccgac ggtgcactag catgtcggta tactccccag tcaccatgat gggccaggca
   229921 agagcaccct gtatattatc aacgatggca ccaaattgtg aagcattgaa tgacgattgc
   229981 aaagccttga tcgcttgctc ataggtttca ttcagcgaag gccctagctt tgaggctttg
   230041 ataagttcaa gaaggcggtt gcacatctct ccatctcccg tttgattctg caagcttgcc
   230101 tcagcgtcct tcagaatcgg cttgagtgat gtctctttga tctgatccca attgccccca
   230161 atgactgtgc ggactccgcg gtggatacga agataatgga tgaaccggtc tagaaaggct
   230221 tgaaagtcat ggtcttgata tatcagtatg tcgcagagaa gatgcatacc aagcatggat
   230281 gataagatga acgccggtac cggtggttcc atgctggcat gagggtcggt ctcataaaac
   230341 atccgaagtg catgattttg taactgcgtc gaatggtgtc tatagaactc tttctgggtg
   230401 tcgcgaatga tactaagatg taaggcagcg agagccagga gctcattcat cagatatgga
   230461 gtggccagtg cgtggttcat cacctccttg tgtaaaagcc ctcggctgtt tccactctta
   230521 cacaaagacg gtaatgtttc tgtcaacaga tggtagaaca gctcagcatg aagcatatta
   230581 gcagacgcat ctaactggct agaagcagaa tagtctggtg acaggttgga aatggatgac
   230641 tcggtagata ccgatgggga ggatgttctc tttctgctaa tcctgctaga ctgcataacc
   230701 ttaaacgtcg tatcggaata ttcgcatagc cgttccgatg atgtgcaatg ggagcagatt
   230761 ggccgttttt catcgcacta tagatcgtta tggcgttgtc tcaacgacaa tggatgttgt
   230821 ttaccttgat gtgacgacgc ttacattcga tgcagccatt ccgcgatttc ttatgcgtcc
   230881 tccgcggcat cggtacggtg atggttcgat cgcgaaagag gtaccgagtt aagccaagct
   230941 taacagccgg atatggtcat tagctgtgct gatgaaggtc gcctcctcaa ctcaggtctt
   231001 caggtgccgt tattagctta gagcaagcaa attacaatct aacatccaca ccacgctatg
   231061 cccgtccagt aacatcacat gacccgcacc gaaagtagat cgggattgat gccgccctgc
   231121 caaacgggtc gacgccgctt aaaatgcact gtcgaggttc gtccctgtat ttttatagac
   231181 atgtatcaca agtacatatc gcctggagga catacatcat cccaattcaa ctatagacgt
   231241 cgatggaaat ccttgattag attgattatg ttgcctgaat ctagtcataa tacgtcaaga
   231301 gtcctacaga gcccagagtt tgcgtcagtg ggaatgcggc cgtcatctgc tcatggacct
   231361 agactttaga tacaacagcg cttctcacta ttaacactta tactatcgat cttggtagcc
   231421 cccgtagcat cccttgatcg atggcgaaga ctggacaagc catggttctc tggccacctc
   231481 gttccctctg cggtctattt ttgagataat tagcagttcg gacgtggcgt gtacggcacg
   231541 atatatcagg aggcaaagcg aagtgtgtga gattcattag acgatatatg agactccgca
   231601 ggaactctca acccatattt ggttcgacca gatgactcag tctgaggtaa aatacgcgta
   231661 tagacgattg agacccgctc actcgggtca ttatgataac tttttaaggc ttcactccgg
   231721 ttggccttct taagtaaaat gacacattgt agatactgtc aggcccggaa agacacttcc
   231781 ttggtctgtt ccagtccaag tatgggtgac ttatctgagc aagtgtgcag gactgtcaca
   231841 tgagagagcc tcctgaaaac cgcacgatag cgcgtaatca ctgcgctaca gaagtaacga
   231901 ctgcagttaa cgagaatcta tcctgttgcc ggctaattgc agccaagtcg ttatgaaaag
   231961 gagggtaggg gtaggcagag cgagagtgct gcggatacgc gtatacaata ctttacgcca
   232021 gtgtggatcc aacgggtttg cacttggaaa tatttttgcc tagaacggca tggtagttaa
   232081 tttcaaacca agtacacata tttatgaagc gcgccatcct gtcccaaagc cctcaattta
   232141 tattctattg tgaatctaag ataaaaaaaa tggttgtctt ctcccgcact ctattctctc
   232201 tggtcgcgat tcttgttcca atagcatccg cttccagatg ctcgccagcc tttatcgtga
   232261 aaccaaactt gcctggtgct acaatcctcg atattcaagc tcaggaaagg cataactttt
   232321 ctgctgttag tcttgggcca ggaacaaacg aaggcggccg atatacgatc agtttctgca
   232381 acatcaccgt cacccacact catgcgggct ggaacgacac aatccatacc caggtatggc
   232441 tgccgcttga ggaatggaat ggcaggtttc aagcattagg aggtgggggc tacgctacag
   232501 gctttggcga gacctaccta acatacgctg tcgcaagcgg attcgcatcg gcttctactt
   232561 atggaggcct accggtgaca aatgggaagg acagtatgcc cacagacctg tcgtgggcgt
   232621 tgagcagtga gaacaatgtg aactggttcc tgttagagga ttacgcatcg aaggcaacaa
   232681 gtgacatggc tgtgatcggg cagcaagtta cccagtccta ctacaaaaaa cccgcaaact
   232741 attcatattt tgccggatgc tctggtggtg ggcggcaggg gctgcagatg gcacagaagt
   232801 acccggacct tttcgatggg atcttagctg ttgccccggc tctcaaccta caacgtttca
   232861 ttcctgcagg cttctggagc tcacaagtca tgaacgaaat caatgtttac ccattgccct
   232921 gtgaggtcga ggctttcact aaagcggccg tggaagcttg cgatcgactg gatggagttg
   232981 aagacggcat cattagcgac ccagaccgct gtcatgttcg ggcgttcgac tttgtgggca
   233041 agaggtacac ttgcgacggg attcaaaagt ccctcagtgc tgacagcgcg aagattatcc
   233101 aagccgcttg gtctgggtca cactctgtct ctgagattga cggttggtat ggggtcaaca
   233161 aggacgcagc tctcggcact gcctatgtgt ctaccaaatg ctctgtgaat aacacatgtt
   233221 actcttctgg aagtgacttg ttcggcaact ggctcagata tcttgttgca aaggacccca
   233281 acttgtcaat tagtaacatg actcagaagg agttcttcga cgccctgcgc tcttcgaacc
   233341 ttgagtattc agggatgctc ggaacaaatg accctgacct gtcaaggttc aaggcaaatg
   233401 ggggcaaagt gatcgcctgg cagggaatgg ccgacgaggt tatcccaccg cttggaacaa
   233461 ttgcctacta tgaggaagtg ctgaagcacg atccaaaagc tcacgacttt taccgtttct
   233521 tcgaagcgcc cggtgtcggt cactgttatg gtggactagg gcctgttccg aatgaagcga
   233581 tgtcccaact gcttgaatgg gtcgagaacg gccatgcccc tgctgttctg catgccacta
   233641 aaggtagcaa taacacggcg agacaccttt gtccataccc tcttcggcaa aaatacattg
   233701 gaggagatcc cagaaacgca acctccttca cctgcgccaa atagactttg ccctttgacg
   233761 acttggtcga gattcttacc gataatttgt ggtgcttacc cgcaaggctg tattcggtca
   233821 gagaagtcta gttcatcaag atggggttcg gcaatgctca taccagagag cttcttatcg
   233881 gcctccaacc agctacgcta cgtcttaaaa gttgagatag tgggaactat agtagtccct
   233941 gaagaacgga cacaagtcat agagcctagt ccagacaggg aagggtccta tttgtcgtaa
   234001 acatcccgtt cgcgtcaggc accagcaggg cttctatatc agtgattggt gtggtatttg
   234061 tgctgtccaa agtgtatata tcctaggaat agtcctctat gagcatagta agtcaaaatc
   234121 tgccatacag tgtgtcaaga agacgaatta cctaaggctg ctagccggcg cccttctcga
   234181 ccagggttcc agtagtagag ctgagctgct cccaatttcc aaaatagaac atatatggcg
   234241 cctacaagct acggcgtaaa ctgagaagat agccagggca ggtggaaagt aggcttcgca
   234301 gcctctcaaa ttagcgagcc cccatgcaac acctccagag ctttgacagt ttgagcaatc
   234361 ctcctagccc aaggaagaaa aggttgtgct ctaccataca aggcacagta gcataattct
   234421 ttgtttcctt cactgcagca tccggcgtgg cctgctggcg actgcagggt ttcctttcta
   234481 agatattcta acccacatta gcgcatcaga tttgtcttcc tggggcttgt tgcgaatcga
   234541 ggcttaacca aacctcactt gattcatttg aataccgaga gttggatcgt ggtggaatca
   234601 ccggtcattt ttttacggct gtccttgtcg gccccgccgg cgacacgtaa catacccaac
   234661 acaccaacac accaaccact tgcacgattg tttaccgcat actcctgcag catggaacga
   234721 gactatggct aattaataaa gcactatcta ggctctgcta cacgccgagt attgaaagaa
   234781 cgcctgtcac attgccgccc gccgaccata atgcgacata acacattacc tggaccgcgg
   234841 aatgaagact ggctgatggt ggaagtactt ggtcgagatt tttggtccct ggggccattc
   234901 attaattacc cgcaatagcg tggactcacc gatttattgc gccactctaa ttatccgtaa
   234961 agtgtgcaat ttgaataatt aaatctccgt gatgaaatac ttggcatttc cgaaagagtg
   235021 ttgggcgtcg gcggattaaa gcagttttat aacctaccct ctttcacttg gactgactca
   235081 gtgagttcaa tccacatgta gccatgggaa tctctgcaaa gaagctcaac ccttcaattt
   235141 gccttcactc gtactgttcc atgccaaggt aaacgcttga ctattagtgg atgatcattg
   235201 ctgggattta ggtttggtgg aaggaaataa catgcgggat ggtgtaagga atcctgattt
   235261 gatacttcta ccacgcaagg ggctaccgcg ctacgcattc ttcactggga gatcttcata
   235321 cccgaaacgt aaagtatatg tgagccgtag agcagtgata tgtctattca aatggactca
   235381 tacatgtgag gagcacgggc agctctcaaa ctctagacct gactataata agagagacac
   235441 cacactcgtc atacttccgt gctgacctga ttcgacatac agtcatcatg tcgtgaagca
   235501 atataaagcg cccgcaaaat tgcatttgag tgacgatctg gtatgtatcc cctgttgatc
   235561 atctatcttg catgtcagtt cgctcttcca gcgcgttgta gtaggttcaa aaaaaacctc
   235621 ttgatttaca ttgagcagtg acattagaca ctggtaccca ctagttccac atatcaacgc
   235681 aagcttgatg caaggcttag ctatacttac tgaagtgtga cgtatctctt tgacaactat
   235741 aggcaactgc ccaaatagca gtacctgacg ggaatgtaga ttttgagaaa cccttgcgct
   235801 cttggtttac tacatacaga atgctatgct tgaagaacaa aacattgcat ttatagtgac
   235861 tcggtcactg ctgaggcaag ctggcatttc ttgagatttg aacgacatat tttaattaga
   235921 tcctttcctc aatttcggca accgtgctat acttctatcc cgaaagtcat gaatccacaa
   235981 tcgaaaggat tagcagtcga agattccttg gccaccgact acctatcaga gcatcacctt
   236041 gaactcacac tagatggaca ttatatccgc tggcgccgtg acaatccgat tcatccaaga
   236101 aattggcctg tcttgcggaa atgctttgac actggtctca tctgccttct ggactttgtt
   236161 ctgtatgcca ggcccacttg aaagccagac gcgcttttag ctaatgtctc gacaggacag
   236221 cctctagtac tgctggcgta tgtgctagaa agccgtcacg ccaaagagac cgctaacagt
   236281 tataggcatc ggcagccgca gaggccaaac atgaatatgg gattggatct gagctatcca
   236341 ccttttgctt tataacagtg tgaggcacca tgacgcctat gctaatcaca tactttgggt
   236401 tgactgactt gcgcttcgta gattcctgct tggtcaggta atagggtcga ttgtcttacc
   236461 cccatggtct gaaacattcg gtcgcaaaag actctatctc attagcagtg ctctaagctc
   236521 agtctgctgt gtggtagtag gcgttcctca ctcccttgct gcagtaataa ttggacgcgt
   236581 ggggactgga atgcttgctg ccatccctta cactgttggt ggaggcagtg tcgaagacat
   236641 gtggtcttct cgaccacgga tatgggtgat gttcttgtgg accattgcat cgaacctcgg
   236701 cttgtgtatc ggacctatca tgggcacata cgttagtaca ttgttgaact ggtatgttgg
   236761 ccccggtctg taccacagcg ggtcattcaa cttatatttc acaggaggtg gctcttttat
   236821 atatatgcga tcatcatcgg gcttatgagc gtcctcttca cgttcatccg ggagtctcga
   236881 ccatctcttt tgcttacacg agaagtcgat aagctctgtc gctacactgg aaagcgcttc
   236941 caagccttaa accatgatca ccaccctgac ctccgcacct ttcttaaggt tgctctattc
   237001 cgacctgcta ttctcttcct ccgagagcca ttggtattca tcatatccat catgattgct
   237061 ttcgcctttt ctcttctcta catcttcaca gaagcactac aaccgattta ccaaacaatt
   237121 gggttctctc acacacaatc ctccttagcc tttcttgcca tcgcctgcgg catctggttc
   237181 agcactctca cacgactcct cgataatcga gtcttcgata ctcgccggcg caagaaccta
   237241 ccgttcaagc ccgaagataa attgttaggc cttgctatcg gtgctccggt gctggcggtc
   237301 agtttgtggt ggttcgcctg gaccattcca ccaaaggcat cgaatacaca ctggatagtg
   237361 ccatccgtcc ctctagcaat gatggggtac gcgttgaatg aattcgatac cgtactttat
   237421 tgttacttag gggattgcta cctgagttac tcggccagcg ctacagctgc ggtggctttc
   237481 ctccgcgcct tgctatccgg ggtatttcca ttgtttacca aacaaatgtt tgaaggcctt
   237541 acggcaaatg tggctgtttc agttcttgct gctctggcaa ctgtgttctg tatagttcct
   237601 ccgctattta tattctatgg agagcggatc cgagaccgaa gtccgtttgc taagcatagc
   237661 gttttcatag cgggggaact tggaaataag gaagaggatt attgatctat gtatgtatag
   237721 atatatccag gacattgctc ttggtagaag ctatctcaaa tgtaatatac tccaatattt
   237781 gccgaatttt ggaagggttt gatatgtatg gtgggtgagg tagctttgcc ctagttacgt
   237841 tctttggctg tctgtcatat caatggcatc ccgtgactct agacggaaga ctttgagacc
   237901 ttaataataa atgtacaata tttacagctc atccgtgcag tgaccgaact tgaaatcatt
   237961 tcgtaacgta ctaaacatta aatgttctaa aagctaacgt aaatctctat ctaaaaacca
   238021 catgttcata tcgtcaaacc tgaatagaat attcctcagg tatctcaggc cactcatcca
   238081 caccatcaag gatacctatc gccatcccgc cactaagatg gacctggata tgacaatgga
   238141 gtagccatgc accggggttc acaacgtgat gacggattgc taaccaagtg tcctcggtcg
   238201 ccgacggtgg agtgatgtac gtatcccgga tctggggagc ttcgagattg aaactctccg
   238261 ggatatgctg catggcttca gcaacagaag agtagttcca tgctccggta ccttggccaa
   238321 tcacgtagaa tttgttggcg tgcttgtgaa ttggatgagg gggctgtatc tgaccgtgga
   238381 tatcgaagat cagatcaatc catgttccat tgagtgtctt cagagtaagg tctggcttgg
   238441 cggtggaggg gtagaatagt agcggcgata cttcctctaa tacaagaggg agggtggtgt
   238501 tgcccaaggt ccaggtgtag gaggcgtcgt aatggctgat tcgcaggatg tgtgtttgcg
   238561 caacttcttg agatggcacc tcgaccggga agggaatgat cttggtttcg tccagcagcg
   238621 tatagttcga agagactacc gcgccgtgga tattgatcga tgccacggaa gcgtgctgtt
   238681 gcgtcttttc caaggtgttg taggacaaga ctccggcagt atatagaact tggttgacac
   238741 cggcattcgc tacacggata gtataatccc cagcgggctt atccaatctg accaggacgg
   238801 agtaccggtt gccattagca atggtgatgg catctaccaa tgtaggatga atgtagcgtc
   238861 cgtcaatggc gtaaacatac atttgatgct cgtcaatcga gaacgtggtc attgagacac
   238921 cggctgcact gatcagatcg tagctcacat atctgtggga tgggtccact aggacacggg
   238981 cagtgccacc gtttccaggt acacaacccg aaaacatcga aggcggcact gcgctgtagt
   239041 tatgacggaa ggttccctgc atagctacta ccaatgggga ggtacatcca atgtcggtca
   239101 ggctcaagtt gcccaggatt tgcctctgtt cagcgctagc gagctgattc accttttctt
   239161 gaccaggaca gctaatcgat ccttttccat tgatgagaat ggcgttcacg cagtaagcgt
   239221 ccagcccgct cttttcttca gcctgccata tctcttccga ggtcaactgc cgccagtccg
   239281 aaatcattat aggttgcgtc ttctcctcgg ccgctcgcat ggcctggcgc tcgctgctct
   239341 tgttcgtaat caagccaaat ggtttctcga cggactcatc cggatgtatg taaatcgctc
   239401 cgtagaggcc atcatcaatc tgccctcggt tatgggcgtg gtaaaaataa ctcccatatt
   239461 gtgtcgcgcg ccatttatag agaaagtgat cacccggcgc aatgggttcc tgcgaaaagc
   239521 caggcgtgcc gtcagaccag ggagtgccat gttgttcgat ccctggggca tcatgtcatt
   239581 aataggtctt gaaccaagtg aagaggggcc taccgtggaa gtgaacggat gtattagtgg
   239641 gcagattgtt gatcaccaag aactcgacat cgtctccttg tcgcaactcg agcagcggac
   239701 tggggagttg accgtttcca aggatcatct ttcgagggat gcccgctggg gcccattctt
   239761 cccaggtaag tgtgagattg aatcgcaccg tgtttccggt ggtgcgcaca tggtggttcg
   239821 acccgttagc ccaggcgaat agacataggg ccaatgtcaa gaatgtcagt gaagaatgca
   239881 tgccgaatta aacgcgtcca gaagtgacgg tctccggaca caagcagcga ggcacccaca
   239941 tggctcacat ggtccatata taacgattcc acgcaggggg cctaaaacag aaggctataa
   240001 aaagaaaaca acaaaaggaa ccccgattat ggtgccgatt gccaggagaa tgcctcaatt
   240061 tcaagtgatt ggtggtgttg cagtggcttg gatagtgcat atacgggata gcaatccaac
   240121 aaataataga gtcatctgga gccccataac atttgaaatg aacccgatcg acgagaaatg
   240181 gagacctcga gtgggttgtc aatgtcgctc cattaccatg tcgggaaaag ggggccccac
   240241 cgatctattt caataatcgt ctctgcccag agtgctgggg ccccttgcct tgagttgggg
   240301 acctaaaatc gttcggtcga attccaatca attgcttcac attcggctgg gctctgcgga
   240361 cggctccact catgtgagct ggacgcctgc aactaagcgt atattggttg tcctttacag
   240421 ccgcaactcg acgccatgat aaacaaaggt catttgataa gaagggaatt ggattacggg
   240481 aaatttcatc acctgttgca gaagtcaaaa cctatgtaga ccacgtggct ggctcctctc
   240541 agccccgtat gttgtatctg aactggcaga tatcagttcc cccatggtga agtagatatc
   240601 atcgctcgga cctggggccg cgccgcttag ccacctcgcc aaaatcttca ttggctcacc
   240661 tgtccctgtt ggacgcctaa gacttcccat gacagggagg gcgaggctga gttggccaag
   240721 acagccttgt agtgcatctg ataacgctaa attagtattt tacctaaccg gccaatcaat
   240781 ctagtttata tgtcatattc ttagcgtctc gcacgtcaat tattgtggga ttcgtgtcca
   240841 gcgcaataga tttcatgtcg gcaaggctga ggtaattgcg gacggcgtcg ttggcgagat
   240901 tcacagggac acagcctggg ctggtaacta tgtctccaat aataaaggcg tctgtctctg
   240961 agctttgggt cgccagacgt ttcgccaggc ccgatacgta gattctcaaa tcgcattgag
   241021 tgtctgggga cgggacgtgg atgttgtcca tgatcgtagt aatcgccaat gtatgaggtg
   241081 tcgtatgtag acatgaccgc tgcgtcctct cgagctgtcc actttgcagc tgtaaggtac
   241141 ccagcgcatc ggagaatatg atggcaggag tgccaaaggt tgaggacgat ctgaacttaa
   241201 cttctggaag gtagcagtcg gatgcttacg agtgcagaga cagacaggag tcatataaca
   241261 tgcattctat acgtatccca taaagctgag ggtatccaag gaattgcggt acaatcagtg
   241321 tccctatttt gtagattgca tcgttcgtcc tggtctggtt aagtcgctga aggcctcagt
   241381 gatatgtatt ggtaatacat tcatgtgacc ccagatacgc gttatgattg cagtatcatg
   241441 gtaatacact tacacagtgg aagacgtcat gacgctcgcc actgggaagt ctcaatcgac
   241501 acctccagaa gcaagatggc tgattttgat atctgagacg aagctattct atgccactat
   241561 taggtgctat gtgcacctcc agagctatgg tggcatcctg cacataaccc ctattcacaa
   241621 ggatatcaag ttcaatcaca ataagatctc ttctaccccc gctaccatac aaaagtaaga
   241681 agggtggcga accatggtac gcgttgatct ctaccaatga ctgtcagaga agcaatagga
   241741 ttgtatcacc cgacgttgct attgtcgctg atgtcaacgt acagcatcat gacctcattc
   241801 gaaatcgtgg cctacttata ccaacacgag cctaaatctc cttctcaatt tctcaatttc
   241861 caagttattt cagaaaaaag acactaccat tgggacctca accagcaaac atggaatcaa
   241921 aacacaacac cagaaaggac tctgatcgtg tccgcctcag ggacgacgat acaggctcta
   241981 ccgaacccga acaagtagac caacaaagca gctttgctga cttggaccct actaaggagg
   242041 tatatgtcgc ttgagctggc cttgagtata gcgatttcat gctgacacac taactttcct
   242101 tagtacactg cgtcctccca gactgccggt acaggcttcc aacctgagcc tgccgcaccg
   242161 cgctccagtt cctcatacca tttccaacat gatcaactgg cacacccaga cgaggagttc
   242221 catagaccac aagagtagaa agggatatgc actgtatgtg agaaatgagt cgtctttctt
   242281 taagccacgg gccgttccgt ttagtctttt ttatgaatga tcttaatcat tggacaatgt
   242341 tgctttgtac ttgggagatc agagtatgat aacttatctc aatgttcact acgaaatact
   242401 taaaatataa ttaatcacat aaatcgtatc gccctacatt tgtgtatcat cccaccatga
   242461 cttgactcgt aacttaccca atagcgctga ttcttaagta ttgctatttt agctatgctg
   242521 gaacatatca ttgcaatgac gccatcaccg ttggttggaa gatagctatt actttgccga
   242581 gatcagaaca ctcgtgaatg gtaaaatatt gtgagtgaat atggctacaa tcatgtgtaa
   242641 gaataatctt aacatgacat cttcgtattg tctctttacg gcagatccta ttttacatag
   242701 taacgataca taagccgtct ctcaaaacaa gcaaggcctt tattacaaag acaggaccaa
   242761 atccttcaac ttcataaagt cagggacgcc caagcccgtc acaggatccc atccagcagt
   242821 tgcattccaa tgggcatagg gaatgacgcc acctccggta acattcttac cagtttgggg
   242881 gttgacgccg tcacatccga tggatgaccc ggccgtgata tcggtgaagt ccttcagagc
   242941 cccgctatac aggagggggt tcaggaatcc gagagtcggt ttaccggcac gcaaacgggc
   243001 atcgttcaac atacccacca aaccagcaaa gacaggggca gcagcggatg ttccaccgga
   243061 tgtggcacgt ttgcccttaa cgaccacctc atatctaccc atcccgttag acagattcag
   243121 gtatgtgtag agagagggga cttacctggg ggtcaagctg tgggcagcta cgtcagggaa
   243181 tccacgaccg gagaagttgg tatattggga atagtagtcc ttggtctctg cggtaatctg
   243241 ctggtcaagg tacttgctga ctgccgattc ctggtaccag gcacggctaa agtagttgct
   243301 gaacccgccg gaggaggcat cccatgcgac ttcaggagca tatgcctgag tgccacccac
   243361 tgatgtgaga taggggcaag ttgcagggaa aattggtgtg aattctggag tctcggtgcc
   243421 gtcgttagac atacatgagg cgccaattcc tattgtaatc agtacttagg aacagcaaca
   243481 atgtgcacca cggtcgcata ccagtgtcac cagaagactc aagcacggta attcctcgca
   243541 gacccatcaa gccaattaag ttgcacactc tcttagcgta atactccgga acagtctaca
   243601 aactctcgtc agacaggcgg aaaccccgca aatatgttgg agggcttacc tgttcctcgt
   243661 cgccgtatga gttggagaga acctggggga gcgcagagtt aggcttcgcc aggagatatt
   243721 catagtactc caggtagggc tcattctggt tgtccgctgg cgttggttgg agggcattcg
   243781 gaataaacgg gctggaatcg ataagcaatc ttctcaacac cagttcaaga tggatcaagc
   243841 acttacggtg taccagcggt gatgtactcc ttcactggta gagggtggct aacgcccaca
   243901 atcagctcca catccaagtt ggcctcgcca agggaagcag tggtccagtt ttggtcgttg
   243961 gtagcaccgt tgatcaactc gacggagaaa ttctgcgatg gaatgttgaa ccgcttctca
   244021 taaagggcca ggtcaacata gttggcggac tcgttcaaga agcttccaaa gccaacttta
   244081 cttccggagg atgcgctggg cttgtagcct cggaagttgt acatgtccgc caaacagtcg
   244141 ggagtgatta tatccgcaca ggacacgtta cccgctgctg tcttagtccc tgcggcgaac
   244201 ttatgatgag tgggaagagc gacgctctcc tgctgcttgc caaaaaagac tgttggggcg
   244261 acaagatcaa ttccatcagc aaggtcatcc ggaattgagt actgcgtagt gcgcaacttc
   244321 tgaacctggc cgtttttata atacgagaac ttggtgtcaa acagcttgtt cacagttccg
   244381 accgacgtag cgaaatttac caagccaccc tgtcgagaga tatgagtgac gcccgcattt
   244441 ctaagccaac ggagcacggc ttcatcgctc gcggtgggaa agagcgtctc gatcccggat
   244501 tgatccagcc attggccgta ctctgcattg cctggggtcg acaatgccgt caatttggac
   244561 tcgagctggt ctaggttctg gcgtgccagg gcgattgata aggtaatcgg gtcgctttcc
   244621 ggcgcctgtt tgactagggt ccaaccattc ggaaccgcgg caaccttctc atgcacgatt
   244681 gctagcgctg gcgctgcaag ggaaccgaac actcctgcga ggagaaatga tgaacgcatg
   244741 atgggaggct ctcgcagcca acacacaaat ccaatcgaat ggaaatttta gagacgatcg
   244801 aaaggagagg tgggaacacg atccccacgg gggatttata tgataatccc attttctccc
   244861 tgcgtgtccc ctttctcccc ccgtttagac tagtgcaagg ggagaaacgt gagatggacg
   244921 atgaatggtc gcttccagca tgtcgttaca tgaaaggatt ggctgttgcg tgatttccga
   244981 ctcgaattcg gaaacgaaat gagactttga ttaagacaat caatcaaaat aaattgcaaa
   245041 ctagcgcatt gtcggcgtgg gtactccgac ttctgctatt gttctgccga ctccagtgct
   245101 tgaggcagat aagcaaggtc aagcctcgtc caggtgacca atcagacccc acatctcggc
   245161 cgatcaactc caattcaaga aggtgacatt ggagacctcg acgccgtgtc attttcatcg
   245221 ccctaagtgg gctcacggcg tccgtcggag gtggccggaa gagccattcc ctgagtcggt
   245281 cccttggaaa agaagtccag ggaatggtat ggaggagcgt ctcgttaccc agcatcacac
   245341 gagaactcaa tataagggat ccagtgtgac atacggagag ttgttttgac ccctttttcc
   245401 ccaaccagtg gccgaggtca gggcgtgttt tccagagggt ttcctccaaa ctctattttg
   245461 ggactagtgg ggtctgaata ggtttagtgt ttatctaaga ggctaagccg aaatgggtct
   245521 agcttatgct gtaaaccttg tggctttgct atcttttgtc ttatgaatga agaaagaatt
   245581 ggtataatca aagtaaaaaa aaaaaaaaaa aaaaaaaaga atatagcaaa agggatctgg
   245641 ttgactagta gcaagatgtc acctgactgg tagaattgta ggagtcagcc tcgcctcgat
   245701 ccaaacatga ccggaaactt acctcactaa cggcaatata tatattcccc gactattggt
   245761 cacgacaaac atctctttct acatttactg tactgtttaa gtatactgcc ataccgtgtt
   245821 acgtgttctt ctgacttgct gaccttcttg tagtctgcta aggacactct aggctgatca
   245881 taacacaccg atcaccagtt ggatgaccta gtttttgatc agagggatac aacctgataa
   245941 ggcaagaccc tctactacgg ccaggaattc ccaatgccaa gatcacttta acctagtcac
   246001 ccacactctc aaacgtgcct ccgacgttga actatatcca agctggccag cttctggtat
   246061 agagctccca caagcgttag caacactcgt tgttgaggtc tacctcaagc caccactctg
   246121 gacctctaca aattgttaaa agaatgcaac cagatgcact aagtcaagcg aagaggtcag
   246181 cagtaatttc atctggccta tttagaattt atattctctt ttttgaatta caatacagaa
   246241 ttcgatgtgg ggtgaaggta cagtattctg taattctgtt attcctaatt atatagccca
   246301 ggggtattag atattttccc aatgtgtgga cttagtgata ttaagttatc atcatcttca
   246361 tctccatcta ctacacgcat atcaccaaga ttctgccagc accaacagtc attatatagt
   246421 ttcaatgagt ggacagttca agggcacgtc agatcacgtg gatgtgcctt cttgttctct
   246481 gctagacgat agtaagtatg gaaatgagta gggaaacgga gagaaaaaac acttaccgga
   246541 tcttaaaatt ggtagcagaa gtcccatagt ggaatccccg tatttaccag agtggtgctc
   246601 catgacctag tcacaaaagc atcaagactg aaaataaagt ccgatttcaa gctaacccca
   246661 tcaccgcatg gattacctcc gccgtgcaca tccgtgggga ctcccgttgc cgtagaattt
   246721 gtgacacgtg tagcatttgt agcatgctct gtgtcgagtt tggcatcgag cacaaacgtg
   246781 ttggcaattc ccggttttgc ggttaatcca ctgctaagat caatgagccc tccgaggaag
   246841 ctcagcgcca tctcgaccgt cacggtggcg ctagcatcag cctggacgtt ggcttgcgcg
   246901 gagatattgg catatgggtg gtacgttggc gtccatccag tcgccacagt attcacgctg
   246961 ttcagaatgt caacatgcac attgccattt ggcatggaaa tagacaggcc tgcggctata
   247021 tctacgtcgg ctgaggcgct gaaatccatc tctaggccga aagctacacc aggaccaagc
   247081 tgcacgatgc cggggatatt gacaagcgtg taggtgagat ccgaggggtt gtacgtgaag
   247141 gacttgttgt aggaggcggc gaggtgcgcg ctaagagcca catcggcgga aaagccggcg
   247201 tcgatgtcga agtacagttg ccgcaacttg aaggcccaaa agtcgtagta cagatagcca
   247261 gagaaggtga tttccgagga gaaggccgct tcgtcggcgg taacagtgag gtacgggggc
   247321 tcattcagga gaacagtatt gtgggccagg gacttagaaa acggtatgct gtaggaggga
   247381 ttgagtgtga ggcgcttggc gagtttgccc gctggcactg acgagaaaga aagctcgcag
   247441 gtttctagat gtactagtct tagctcactg ctcaaacatt gatgcataca gaaaccataa
   247501 aatgcgtacc agcaattttg tcaattggat gcttagaggc attgcaggtg attgacaaat
   247561 tggacttatc cgaggctatc tggtcgacct tgaagaaccc tctctcgaac tcagcatcac
   247621 agttgcctag gtggtttgtg atcaggataa ggttctcttc caatgaccaa gattggaggg
   247681 ctatttcgaa gccagcagcg ttcttgaagg cgacggtcac agactcatca gtgcacttga
   247741 cactgcctat agcgtcgatg tactctaaaa caacggtgtc atggttaagc tccaggttca
   247801 tgttaacaga gccagaggcg gctttggtag agggctcaga gtccaaggag ccatagtaaa
   247861 gagagacctt gggagctggg attaaatgaa ttgggtcaga agtatcgaga tctggcgctg
   247921 gtacgggccc aagtgttgca gtagcacttg cgacgggggc ggagggggga tagtttgcag
   247981 cacaagattg agcgagtgcc tggttcacaa gactaaagga aagtatctgg agagcggcca
   248041 ctccgagaga cggccattgt gttctcgcca ttgcagctat gctagaagta gggagtaaaa
   248101 cgagagaaag gagaaggaga cgaggaaaaa aggaagaaag actgaacgaa agaatgcgtc
   248161 tcaaatgagt gacttcaaaa gattgtgaca gaacgagtga ctaggcctga tatctagcat
   248221 gatgaaggat acatgcacaa tttaaatata ctatcctgag ccactacaaa aggggtattg
   248281 gagaacattg ggctgcggag ccatattagg aatctttcta gccgctaaag aaaaccgttg
   248341 gagctctaaa ccttataatg tacccaaagg atcatcctct ggcggatctc agagcataga
   248401 taagagacct agatatattc gttcggtaat agatacaacc gccaagcaac catgtggtat
   248461 tcaagtgggc aagccaagca tttgaaagcg aaattattac gttaaccgtt gccaaggtac
   248521 tcgatctccc aaaagcagca caggtaagcg acaatgtaaa tcaccctaag cctaaatgct
   248581 cttgtcatat ggctggctag ttgtctgatc tctagacttg catcggcccg tcgcgaatcc
   248641 tgattctctc atggcgagag agcggcagcg ttgccaaata ttctggcaat cagaccattt
   248701 ggcaaatcag tgtgcttatt acgagcacga gccataacta gacctttctt gctccatcct
   248761 atcgtctgcg caatgacatg tatgtggatc tttacggagt atttcattct gttgccctac
   248821 tttgtgtccc cacccgagtg tatgggcagt ccactatgaa ggttaggcta ttttgacatt
   248881 gtatacctta gaatccactt acctttgcta ttattatcga gtcgataaga gtgaaaagtc
   248941 gagccatccg acagtatact atagattggt gttggcacca tcttgcctgg ctggcgtggt
   249001 ggaccatgcc caaatgcatc tattaggcaa gatcggcaat cccttccaca gaaggattct
   249061 tacatactca tgcaatcgag cacctgcgcc tcacttatca tcttgggacg agcctacata
   249121 ccaagtctgt tgttccgctt ggatgcttcg cctcgtgaag ccgaagataa tgatcgaaaa
   249181 gtattggagg gcaaggaagc gaataaaagt gagaaaggta aaagagacat cgtagccaga
   249241 tgtaggtcca ttagggaaat ctcttgaaga agggcgcggt gaagatcaga ctcttagcta
   249301 tgagtgccat tgatacctcg ccactctacg ttaagtcggt gacctcctgt gaccattcta
   249361 ggcaatgctg tcagcacaat gtccctgtcc ggggatccaa agaacacagt tacaatacca
   249421 ttattttgaa ccttcgggtg aggcgctgtc atggatccct tgagtaagag atagcgaagg
   249481 gacaatactc agctttatgt actaactaaa ccccttcagg tgacatacag tgatgccgcc
   249541 taatcagcaa ggtagaagga aatatgccac tgagccagga atgtccagga cgatggttac
   249601 ataggcgcag ttagaattgt gttggcacgg gtgacgtggg tgcctcgacc tacaacgttt
   249661 agtacggcaa caatgctaac cataatcggt gggaagggca aagttcagca aaggaataaa
   249721 gaatgataaa agcagctatg gtggttgatt atgcacacag aggtctggac ccgtcggaat
   249781 ctgtcatacg ccgaggcaag atcgcattgg taatcacgat gggtccctcg tattgactct
   249841 ccgtacccca gaaagggaca gccctactca aaagtatttc tttcgcttag gtctacatat
   249901 ggtgaggttt gcctcgatgc aatctaccag tagagcctca atgttacacg atcacacaag
   249961 atgactgacg acggaattga gctctcgccg actaggcagc gctccgctga tattatgcca
   250021 atgggaaatc cttcacaaag ctgtgataac tatacagctg tccaacaagc tgtgagcaac
   250081 ttggatggac tggaaggaga gcgtggaaag gtgcaggtgc ttgccatcat ggtggctctc
   250141 tgcgtaaggt ccctgcttct gttgcatgtc atgctattga gcagtacgga ttgggtcgct
   250201 gacactccag ctttgtagtt atcccttttt atcgctgcct tagatcaaac gattgtctct
   250261 acctctctac caacgatttc ctcgcggtta cattcggcaa gtggctatac atgggttgga
   250321 ggagcatacc tcctggccag tgcggcagct gctcccatct gggcaaagct atctgatatc
   250381 tgggggcgca agcccatcct tcttgttgct gttctttggt tcatgttcag ctctattgtg
   250441 tgcgccgccg cagtaaacat gaggatgtta attgctggtc gagcactaca aggtatagca
   250501 ggtggtggtc tcttgcaact ggtcatgatt gttgtgtccg atttgttcag tgtccggtca
   250561 gcaccaaccc cttgttatca tgatatattt tctgacaggt gaaactcgct aactgctttt
   250621 aggtcacgaa gtctgtatat gggcatcctt gagtttatgt ggactatttc cggtggcctc
   250681 ggaccaattc ttggtggtgt attctcggaa tacctctctt ggcgatggaa cttctggata
   250741 aatcttccta tctgcggatt ggcatttata ttgctcttct tttacttgaa tgtccacaac
   250801 ccgaaaacca gggtaactga cgggttgaaa gcaattgatt ggctgggaag tctgtctatc
   250861 ataggcttta ccctgatggt actcctgggt cttaattttg ggggggaaac gtttgcctgg
   250921 aactcgcctc aagtgatttg tctgattgtc ttcgggtctc ttttctcgat tatattcttc
   250981 tgcggggaga aatatgtcgc caaataccct ctgatgcccc tcaaaatgct gaaacatcga
   251041 tcaaatattg ctgtatcgct ggttacatta ttccatggtg cggtgagtta cctgtggact
   251101 aacaccttcg gtatgaaaca ccagatctga cagtgctagg tattcatcgc ttgtgagtat
   251161 tggctaccac tatacttcca gtcagccaag caagccagcc cgatgcgctc agggctgatg
   251221 gtccttcccc tggttctggc cgaaggggtc ttcagcggga tttctggctg gttaatccat
   251281 cggacaggca aatatgcgga acaaatctgg atagggactg tccttcttac cctcgggacc
   251341 ggcctattta ttcggctcag tccaacgtcc cctctagtag aactaattat attccaagtg
   251401 attggcggag caggatcggc gatcttattt gcgccccctc tgattgcgtt gcaagcaatg
   251461 gtcgcccaag atgacacagc aagtgccacg gccatgctag gcttcattcg cactatcgcc
   251521 atgtcagtct cgattgtagt tggtggggtg gtctttcaaa atagcatggc aggagagcga
   251581 agcaggttag aagcagcagg actgatggat gagattgttg aagagttaac tggcgcttct
   251641 gccgctgcca gcacggaggt aatcaagacc ctcaatgatc cctccaagat tcgaactgtc
   251701 gcaggtgctt tctcatccag tttacaaaac atgtggatta tgtacacctg catggctggt
   251761 gttgctgttc ttgcgagcgc gttcattgtg aatcagcctc taagtgagga gcatacagaa
   251821 acgaggacag gtctcaagga agagtaggct gggtgttaca tgaacatttc agaagtttca
   251881 acatcagaag atgagcacgg tttgcatacg accacttggg aaaaatatcg taaaggcaat
   251941 gagtggctga atttgggtcc aaatggacaa acccattact ctgtacagta catctcttta
   252001 catgaattca tcactccact cttatacctc gttgtatcct gagtagctgc tagtagctca
   252061 agagagcttc catatgtatc tgaagcgcga catgcctaag ggcttgctag tcaatgtcaa
   252121 ggccgccatg gtccctaaga accttgaatc ttgcgacact tctgcaacgt cgggcacctg
   252181 acgaacccac atttcctata tgatatgggg cctattaaat gctccctcct caatacattc
   252241 tttcagcacc gtaatgtact atggttttgt cacgtcatcg ttaccatcct aaagctcatg
   252301 gtcaaataca ccacgttgtt taggtgtatt gcgacatatc ccaggagaca ttgcaactaa
   252361 agcaccacgt gctgccccaa acgcggccag cgagaaggat tcgcgtagtg tacctccgat
   252421 aatctcgatg tggtccccaa ggccctcgcg aactgcttgc gccaatagat gaccatcagg
   252481 gccggtagtc aaaatcacaa ctcggtcgac gacttcgggt ataatatcgt caggcgaggc
   252541 atcaggtaaa cggcggacta gccttctatt agcttttatg cttcaggttg taagggtgaa
   252601 cgcaaggggc aaaagctcac atctcaaaac agcaaggtat gttctcaggt tagtagcgac
   252661 tacctcaacg aaacgcctct cggcagcatg tacgtcctcc catgatagaa cagcctggga
   252721 ttgtccagag ccccacttcg ttaggtcaag aggatactca tcaaagtggt gatcttggtc
   252781 attctcagaa cccaggagct gggaatcaag atcatcccgg atcaaggttc gagcctgtct
   252841 cacagggcca tagagcgccg ttttagaagt cccaattgcg atctctatac tgagatcctc
   252901 cacgcgatta acgagtcggt ccgtaatata gctatcgatc attgtgctgc ccatatgcaa
   252961 agcagggaaa tattgatgaa tgcgctcccg ttcacttttc ccggtgtcag ccccagcact
   253021 aacatcgaga taaaacattc catgatctat gactgcatat cttagaccag ggggattcgc
   253081 tatggtggac gtagagacaa aagtcgccac agtcgttcta gaaacaggtg tgagagccga
   253141 cctgattcct gccttccgac ttgcgtccac caccatctcc cggagggtct ggttaaagaa
   253201 ctcaggcact gcgatgacag catagttgag gtcaacatca ctgtctgtag cagctttctg
   253261 cttcagctgt cgcagcatgt caactaaccc tgctttcaca tcgaccaaac gcagttcctc
   253321 cttataccca ggattgacaa gccttcgcgt gtacgagact gcctggagta cagtgcggaa
   253381 tccggtacta gcaaatgaca gcatctggga gttctgcagc gctggtttgt caagaaacga
   253441 gctcagttca gtcgtccact gttggatgag attagaaaaa tgtcctttca gggtccattg
   253501 cgcgggtttg cgccatggac gcataatatc atgccggtct gcgtactcca tccggagcag
   253561 taacatatga cgaacataga tatcctcagg tccgggcgcg atcgcagcga tcaccgaaac
   253621 attatcggac gtgtgcgcat acgcagcagt actatggact aattagccaa cgattaaacg
   253681 aagatcatca atccacggaa gcggatgaca gacagtagct cagggcccag atcaattccg
   253741 atcggttggg ggcctcgcgc atccgcagcc agaaaaagcc ctagtccaag accgaggatc
   253801 cagagattga agatcatatt tcactcacga accatgttct cctaaaaatc agaggaacgg
   253861 tgatctgtta tatctccact gctaaaatac actgaacacg aatttttcat gagcccactt
   253921 cagcgcgcgt tttcggatct ggaccattat aggccccgta tttcggtaat ttccgcttca
   253981 aggctagccc ttatgagaat ggcttctatg catggataac ttcggttatc ctattggaaa
   254041 aggcccggta catccgcgac ttagcatttt catgcacatc tgcatttaac aaacatacac
   254101 ctcaccttaa cttacgaacc taagccaaga agaggaagaa gctagcgaaa gaaaggaaaa
   254161 ataacgttcc aacaagttcg atacaggact agacctcgtg ggtatgaaaa gtcacatcag
   254221 atagcactgg actgtaaaga caatttcata aggtatcaat atagaaaagc acctaagcct
   254281 ggccttccgt cttcccatcc acttcgatct gcttgtgcac tgcagcagcc acttcattgg
   254341 ctttttcttt gccctcgaac actaggaatt tcggttagcc caagcacaga ctactgacgg
   254401 gaacaactta ctaaacgaca gctcctccaa tgtccttcca gacgtttccg ggaaaaggaa
   254461 gtagataaat accaactcga aggctagcca acagcagtaa accaggagcc atcgccagct
   254521 gattctatcc aacccgacgg gattgacata tgtagcgaag aatgccgacc cgcggccata
   254581 aaactggaac caggagaggc cacgagagcg accgaagtaa gggaagattt caatcaggta
   254641 agctgcatcg tcagcgaata gtccagcaga atatctgtcg gggacctact gtaagtcaaa
   254701 gcattgtagc ctaggttgta tgccggggaa taggcaaaga tgaagaagat agtcaggatt
   254761 gcggccgccc tgacctctgt tgtcatgaac cgctccatgg aaatagtcca gccaatgtac
   254821 acgcaaagca acgatgtcgc acaggttaaa tacatcgttc gccgcttgaa cagaggcgcc
   254881 gtaagagcta aggcggttcc agagaccaac ccccagcaag caataccgat gttgatcttg
   254941 gacttggtca cactgtcggt gatgccgacc atatccagca agtcgctgag atagtaccta
   255001 cgcatcgtca gcgccgatcg ctatatcaca gggaacgaga catacgaaat caaggtattt
   255061 ccggaccatt gggtaaacaa tcccaaaaac gcggagatga gcagccgacg ccgcatcccc
   255121 gcggtgcgga acatgtccca ccagctttgt ttcgcctctt cgagctcgag cttgatggtc
   255181 cgttcaatct gggcaatctc cgcgcgcacg ataacggagt tacggtctcc ctcggcatgg
   255241 tatttggcca gaatgccgaa ggcttcttcg tgtcggtctt tgctgatcaa atatcgaggg
   255301 ctctctggca gaaagctata tacgttaggg tgatgttacc agtatgcggt gcggccctgc
   255361 acatacaaaa caaagaccac ctggaccata gcaggagcca gctgcaacag tgaagggatt
   255421 ctccacgccc agttgcttgc gatagtcacc gtgcccaggc cgacggcagc agccacgatt
   255481 tgaccaatga aataggatga gttaaacaag gacgtgagga ttggtcgttc cttgggataa
   255541 ccgagctcac cgatgaggca agaaccagcc acgatgcaat atggaatccc aaatccaagt
   255601 aacatgcgag ctactatata cattccgact attccaatta gcacgcggtg ccttcgatgg
   255661 gtaaaagata gttacctccg tttgagaacc cttgtagtag cgcacccacc aagctgatgc
   255721 aagacccgaa cataaccgtc catctccttc caaaacgttg attaacccag gggacaaatg
   255781 gcagagaaag gatagctcca agggaatatg ccgctcctag aaagcctttg agattcggtt
   255841 cgacctcgta ctcgggcata ccatccacgg tatcacccgt tagtctcccg aaatctatgt
   255901 atcttgtcag aaaatgattc ttctatgcag ggaagacact aacatttatt ccaggtatac
   255961 acgatctgca ctgtgttgat gatctgtgag tcaaaccccg aggtgatctc aatgcccatg
   256021 catgcaggga agaggatcaa gtacaatcgt ctcaggttgg gcttcttgta ccatggggtc
   256081 cggtcctcag ccagcaagtt ggccaggaca gggtctgaca cgtcctcttc tcgttgcttt
   256141 cctactgcaa tcatgttgac cgcttccggg gtacttgacc tttgatattg agagtaatcg
   256201 ggacgcagat catctttata tccctactat accaatacaa cactggccaa gacaagccaa
   256261 gaaagactct taccgcatac gagacggaca ttaccacagc tggtggcctt acatacactt
   256321 atttgcggtt ggccagtggg ggagaaagaa tcttgaataa agacctcgca accgaggccg
   256381 ctaaatggca agcacacggg agcttgagag gattccacca atcgctccgg ttatctcaac
   256441 atttaagccg gagaaatctc cctaaccgac tgccaagagg ggcctaaggg cctggggtat
   256501 tctagactag gagtgatcag tagtcgcggt ggctatcgta tacgaagata taatcacctg
   256561 cttaccccgg attgtgtcaa aagataggct cgctggtgcc cccacagcat taagctaaag
   256621 tctgggtaaa tgaattcaaa ttatccggag tgaattctct ttgaggctaa gttagaggta
   256681 tagatcactg gttataagcc aagccaatac ctcgtcctgt ccaccctgaa tgtccccttc
   256741 gccaagatat tttgacttga tgtaccaatc agagcttcgt agataccctc ttcgcttttc
   256801 cacatgcctt cgatttcatc ccagaagttg gtggcgtatt tatccatgcg aatatgggcc
   256861 actctttctt ccccgggttg caaaagaacc ttggtaaatc cgtgcaactc cttggtcggg
   256921 cgaggtgtgg gagaatgagg agcggagata tacagttgga ggacttgcgc tccggctact
   256981 ttgccagtgt tcttgatctt tacggcagca gttggcggct cctcgggtct aaagacttcc
   257041 tgggagaaga ccacatccgg agacacggta aatgtcgtat aggaaagacc atgcctgcat
   257101 cgttagtcat aatccaacac caaaggacaa gcacataccc aaatggaaat agcacctccc
   257161 ggccgacctt ctcgtagtat cgatatccaa catagacatc ctcgccatac agcacccttc
   257221 cccccacgct agcgtaattc aaataggccg ggttatgctt cacatccacc ggccacgata
   257281 atggcagttt tccggatgga ttgacgtccc caaatatcac atccgcgata ccatgacccg
   257341 tctcattacc tccataccag gcttgaacaa tccctctcgc cctatcagcc cagggcattg
   257401 tcaccggcgt cccggactgg ttcacgatca ctgttttgtt tgccgcaaca tccagcacag
   257461 aggtgatcaa cgcatcaatc ccgggaggaa gatccatatg cgaccggtca aacccctcag
   257521 attcccattc atgattcagt ccggtacaga gaatagtata gtccgcctct gcagctgctt
   257581 taacagcact gcgcaccatc tctgcggaat cgacgtgtaa gcatgctccg aggtgcgctg
   257641 caccgccacc aaagtgtacc acaccaatcg ctttcatggg actggtattc gcagatccat
   257701 attcaatccg aatcttgtat gtttgtcccg cattgagagt cttcgatccc agttcttgca
   257761 ccgttccttt gccgaaaaat gccgttcctc gagtttgatg cgtggtgttg tcgacgacga
   257821 gttcgtcatc gacgtacaat aagccggtgc caaagactgt gagaccaaag tcccacacac
   257881 ctgaaacatc gggcgtaaag tcaccggtta gtgtcgcata gaataggcct ctgttgagct
   257941 ccggcgcatt gaaatccatc agttgaaagg cggtcttcga catcggctgt gtggcacgta
   258001 gaatacgctc cgtccctacg ggctcgttat agaaatgcat gacggcattg gtaagcagcc
   258061 ggtcgatcac aggtagcatt ttgtgcgcat aagcgcccac ctcatagaga atctcggtgt
   258121 ggggaagagc ttcgctcaca gcatcgtata acgaaacagt atagtacggt tctagcgaag
   258181 cgctgccacc gccggagatc gctggagtac gcacatgtga ccctaccagg gcaatcttct
   258241 taatggtctt tggcaagggc aatatatcgt tctgattttt caaaagcacg atactgttgg
   258301 cacacaagtt tcggttcagc gcccgatctt ctggatagtc ccttccagtt tccacagcgg
   258361 atacgggtgc tctgcttgct tgctgaacaa actcaagtac ctttcgtgcg cgactatcaa
   258421 tggtggactc cttgatcagc cttgcctgca gggctgattc cacatatcgg cctcgatacc
   258481 gcgacgggcc tggcatctcc aaatccaacc cagcattcat cgagtcaatc gtggtgtaag
   258541 ttcccagcca gtcactcatg ataagcggat tccacttcca ttcctgacgg accatatcca
   258601 acatctcctt actctccacg acgtgcttcc cgttgatctt gttgtaggac gtcatcagtg
   258661 cccctggacc tgcgtcacgg gctacgatct gaaaaggtcg caggtagatc tctctcaacg
   258721 cacgctgggt gacaagaaca tccacagccc tccgctcatg ctcctggtca ttacccacga
   258781 aatgttttac cgcagagatg accccggtgc tctcacagcc tgtgatcatc gaggcagcca
   258841 ttgctccggc gagatgcggg tcctccgcga aagattcaaa tccccggccg cccaacggtg
   258901 atcggggcat attgattgtt ggaccaagcc aacagtgcgc gccctttgcc agacattctt
   258961 ttccaatcag aactcccact tcgcgcagta gattttggtc ccaagtcgac gccaaggcgg
   259021 tgccacaggg caaacaggca gccggtacac cggcgaagaa cttcgtgcct cttataccat
   259081 tgggaccatc ggtggaacga attgaaggca cgttcaattc gggaataggg tgggtatgcc
   259141 agaaatcgat gcctggctta gttttagtgc tgactcttgg cctaatgatc aggacgggtg
   259201 aggtaacctg cgagaagggc gatcttgtcc tcctgcgaga tgtgggagag cacgtaatct
   259261 atttccaacg ccatttccgc atctaggtgt gcatttctgg gactgaatcc gactcgttcg
   259321 ttacgagtac atccaacgaa caagccgtat caataaatac ccaggcggca gatcgacatc
   259381 ctagtggata acatgacggc cctcgccccg agattccgtc gagtggggac ggactccgca
   259441 tgtcagatta tcattcatgg ataattcgtg ggggctcagt ctcagaatga ttgaccccgc
   259501 atgtggcatt aaaaaaggtg ccccatcgcg gtacgagtag acaccttcat tgggagttgg
   259561 ctgccaactg ccagtcactg cgacgatgtt tatccggatc acggggtcca ccaaggtttc
   259621 ttaccctata cggctagtgt cattcctatc tgggtgatac tcccgggggc tcaccttgga
   259681 tctatgaagt taccctccgc gaaaagccct taaactgtat gtattatcta gatccacaac
   259741 cagaaaactc gcgaaatttc aagtagtgta gatatttatc cctgagatac tctaagaagt
   259801 tcgagccttg gtcctggggg attttcgtaa gcttgctgat cgctgcattt tctttgcaca
   259861 caaatatata tcttcctatt attcagagac agcatgtttt caggaacatg ctaacccgag
   259921 cctcaaccga tattaggagc ctcaagagct ctcggagaat tgatgaaaac attgaatcca
   259981 atcttgattc ttaaggtgat ttcaaagaat tgttaacaat gacaagctat ataggaaatt
   260041 gttccggcca tgagcaagag cagtatatcg cggactagag ttcctccggt tccgccaggt
   260101 ttatttatcg ccagacacga catcagtctt gtcgcaaaac cacgcgagat accatcatag
   260161 agacttgacc ctgacatcac gcatttcaac taaaggtaat accataggcg atgacagggc
   260221 gcattgatgt acgcgaccag gaacagcctg gagaactaac cgcagcactt tgctcaaaat
   260281 ctgaaacctg ttaagtctca cgttccacat cgttcatacg atacgcacaa tgcaatactc
   260341 tgtccccctc gcacaccatc gcagccgatc gctcgaccct agaaggcctg tttatgaatt
   260401 actagaagtg ccaggtctcc cggatggcca ccaggatcga gtggacaatg gccccatcgc
   260461 gcgtgcatcg ttggcggcga aacttggtcc ggcccggggt ggggtgaggg gcagttgaag
   260521 gtgatatcca cgattgtcgc tgacgctgat agcattggat aagttacctg ggacggtgct
   260581 ggtgatgaca tcttggtgac cagagggcta ctatccgctt gagacatagc agcactgatc
   260641 cccatgatga ccgacggcaa agaaaagcgc attacctcaa cccaggtttt gcttcagaaa
   260701 tgttgatgga attacgaacg atgagtggga agtgaagtgg ctgacgtgaa tggcttgtgc
   260761 tacactttga gggagcttgc cggagaatct gaataagggc cttttctttg gttgggtctg
   260821 tgaagtggag actaagccct cgatcgcatt gaacgatggg taggcagcga tgctactaag
   260881 ctcaatctat atgactacgt aggaggatgt ttgtctatat acaacagatt tgtcccatgg
   260941 tccgggtcac aggcagtcag ggagggagtc aagcatcctc gattccactc atcggatccg
   261001 agtcttgcca catcacgaaa ccaccagtaa agtcggttgc atatgtctgc aggataaact
   261061 gagctgatac ttctctaccc ttacagagat tttggaatca tacaagagta actaaaattg
   261121 agtgctgttt cagttcgggc agtggatcgg gaggcatctc ttcttcaggt tcctctgtca
   261181 ggactctttc cgggacaaac agccgtggtg tcaggttgaa gacaggtgat ttgtccgcgg
   261241 aaggcgagag cctctctaga aatcggagcg atttctccaa aaggcgaaca agggtcatcg
   261301 aaacacctcc ggaggtatcc tttgtcagga tcggggagtc gatgatacct attcgctcat
   261361 aggtctcact gtccttgtcg gtacgtctaa ccaacaaacc gaaccgatgg tccatgaacg
   261421 gagaaaaccc gtggttacca tctggaaggc gggcgaggaa gagtacaaac aactgctgct
   261481 ggagtaatac tggctcaggt gccgtatcaa ctcccgcctg aaggtagaaa gtctcatttc
   261541 ccacctccac ttccaccact ttatcaacga tcgaattctt cagaggcggt aagagttcat
   261601 cggagaatgg aggcctatcg tctgcaggat agagactttt gactggcaag agtggcgcgt
   261661 gcagccgaag atgcccacta ctgaccgtgc catatacatc aggcccgtct ttctcaacgt
   261721 cgcaatcctc gaaagttgct agttgctcgt agtctgcaat gccacgcttc cacctacatc
   261781 tctcgatgaa atggtataca ataaattgaa caggcccttc ggcagaggcc caagaccatg
   261841 atggggcacg atacgatgtt ggcttcttta gtggctcatc gcggttcagt gcacaccaca
   261901 gcaaaccttc gatcagtccc ttcctccaga ttccggcaag gtatgcatcc ctggatgtct
   261961 gcgctattgc gtctgccaca cctgataatg ctgggaatcg gtctgactgg tgggtgattg
   262021 aacgttgggt gtattcctca atcatttcat accatcctcg gtaattgact tctgagtcgc
   262081 cgtctgggcg tgggtcaaat atggttcttt tgatcgatgc tgtttctcta agacggtcta
   262141 ggttatggag gttacctagt cttagatccc catcctcagc ccggctgatg gcccgacact
   262201 cccagaagag ctgtcttgca ccatatagta gaatgcgctg ggcgagatac cgctcctgta
   262261 agcaccaggc tctgctctgg agtggctctg acgagaccgg atctcggcca aatgtccatc
   262321 gctctcctgc tggaggtagt agggataaag ctagacagct ggtacgtccg ttagggagag
   262381 atcgcaccca gtctattgaa cccgaatgat ctcgaggccc aagaaatcct tgatcatccg
   262441 catttgaatt tgacgctcca atcactacaa aggcatccat gtagactttg gccattctgc
   262501 tagcttcgac ctcccagtca tgctgatcat tctgaacaat acaaagtgta tcgatccaga
   262561 gataccgtat cccaagtcga cgtgtaatga gaaccgcctc ctggaagact tgagacatgt
   262621 cctcgatacg tacctctcgc ttgcgatcct ccagattctc agttgttgtc gcgaatggaa
   262681 tgcattttcc ccaacagtgg ctcaaagcaa cgtagcgagc agcgcgatcc accttgttcc
   262741 ggtcatctcg aaggcatacc aaccctgcgt caagccctac tgggctgaca tcaattaccc
   262801 tagttgggag tagtggtgat tgcgaagcgt ccgcacattg catctgatga tcattgatgc
   262861 atgagtccat ccaagtattg atgaccgaat acgcctgttc actgtccgct gattgtgcga
   262921 tagtccggcc taagatcaat tccgccaatg ggtcgtctaa gaagcattaa gatagagtcg
   262981 aactttggat gaacagggat tgataaattg ccataccatg aacggtcgct acacgaaact
   263041 ccgcttgaag agtcagaccc catgagaccc ccgacgaaat tctgacggta agaatggcgt
   263101 tggccgttcc actgtgccgt gatatgtccc agtctccctc atcgtcttca tctgttaaag
   263161 atgagcggag ttgcagcgac atgtccatgg ggaagtccag gtatccttcc attttgcgta
   263221 ggggatcctt cgcgtccttt tccgtagagc ttgccggagg gatttctcca cgtgcttctt
   263281 gttgtgccgc ttcatattcg aatgatctct ctaggccttg gcggactagc ttgcaaaacg
   263341 cacagtctga cgacgacgac gacgcagtca gttcactcag agatgaatac cacgggatct
   263401 cccacgacaa ttgcggttca tttgacttct tccagaggga atggccctgt tggagaatgt
   263461 catggagagg aatggtcttg cagcgagcac agaggggatg catggttgac aaggaacgaa
   263521 ctgatttggg tgggcaagtt tacaaatcct cgtatatgaa gtttcacact aaccctattt
   263581 gtccatctta tccgtcttat cctgcgccga tctcgagcaa attgatgaaa gaggagagat
   263641 tgtatgcctc acaaagatta aacctcagaa cactatcact gtacatgttc cctaaaggcc
   263701 cattattccc tctcagactg ccccctataa gtcacagatc ctgtacatgt ctcctacccc
   263761 aacgctcaga aaacaagcaa cgcagcccgc ccagtcataa ccgccaagat caccgaagaa
   263821 accacgaaga tggaaaaccg gctcatgata tggttgctcg tagagtgcac caggctgtgc
   263881 gcaacacgaa tggccacata ggaccatgcc aggagaatgt tcgtcttgtc atcctggccg
   263941 gccagtgcca atacgagggc tatcgcgtaa aactgggttg gctgttccat gagatggttg
   264001 taattgtctg ccttccatcg gacactagcc ggcgtcatcg catcgagttc gcgcttcgtg
   264061 atggtatttt tcatattcat cttggagtat attgggatcc gtgtcttgta catccaggcc
   264121 tccatgacga aggtccagat attgagggcg acgacgggtg ccaagagggc agatacctgt
   264181 ccggtagaca tctttggttg ggaattggag caacgtgtat tgcaaggaga agatgcgatt
   264241 tgaattctaa catcagtaag aaaaacgtgg gggccgagga aacatttatt tatagtaatc
   264301 atggatttaa tttattatcc tcggaatcag tcagtcacct gatccgctga cgcggaacgt
   264361 ttctgccttg ctatacgagg taaaactaat cgaaaaagtg tagatgagag atgattgctt
   264421 atcagagata ggtccttgaa aaaggcgtat agtgtggatc ggcattggta tcactaggaa
   264481 taaagcttgc gatactgaga attccatagc gagggaagaa aactcctgca agaagaaaga
   264541 ttactcaacc ttcgagcctt ggaggtatat cgaacggaaa gaggttacca aagtctccca
   264601 aaccagtcgc agcgagagag tcaaattcac cccagctggc cagatcagcg atataagact
   264661 cggggctgat gccttgtaga gatcccactt cggactcttg cggtcctgcc ggaaattgaa
   264721 atgaacccac aggctgtacc ccacgatagg atacttgcgc tgagccgaga atgtcatcaa
   264781 gcctttcgct tgctgccggg tatgcttcag catcttgaga gccagcgatg ttccttagct
   264841 gatcaagctc ttcgagcctt gatgttgcat tctcagtgcc gcccggacca ggcctatttg
   264901 tgggtggctg atcgattgat tcctgatttc cgcggattgt ggccttgtgt gcctccttgc
   264961 gaagctcctc caagaccata acgtagcgct gggagaaaga agactgggat ccgcatgatg
   265021 ccaggtcatc ttgcccctgc tttccagcca tatagtacgc aaggtccgca tcagttgtgc
   265081 tttggcgaga gcgactccgg atgtaatgga catagagtac gacgacggca gagaatgcat
   265141 aataatgggt gaactgcaac acctgtcagc ctttatttga cactgaacgt ctgggtttct
   265201 tacccagaaa gctcggtaca tccttccggc tgtggataga tcacggacaa tggaaacaac
   265261 cttcatggcc gcttccaagc aagatttaat attctggtca atcgttccct gtagcttatc
   265321 gttccgtctg ctaggctctt tggtgaggag tgtgaagccc tttaacagaa acgggcgata
   265381 cagcaagatc tgtgcgtgat aaaaagcgag attcaagaca gtgtattgtc gctgataggt
   265441 aaccttcatg atgttcacat tgggaaggtc gaggaaccca gtcaactcct ttcgccatcg
   265501 tgccatttca gcaccgtatt tcgctgcagc tgaggcttgg accgtcaggc ttgaccgctg
   265561 aatgccgtat aagtcatgta gcacgccgct gataattttg gatagctttg cgtggtagac
   265621 aggggccaac atgatacttt gacagctaga ggttggcgga aggatggagg tcagcgttat
   265681 ctgcctatct tcggcaacct cagggtattc ttggtcaata tcatcatcat ggaaaatgcg
   265741 gggacggccc aaagccgcac tgagataatt gtccaagcta tatgcacacc aaaaaactct
   265801 cttcgagcac tcctgttcga taaggttgac tgtattcgga tgctcccgtc gacgtttccg
   265861 atgtagaccg atggcgatag cgagacgagc tgtcgtaccg aagaggctcc aacagtgatt
   265921 aatccgagac tgcgacagaa gatagaagca ttgagccaga cgtgcctgca cactggtgac
   265981 acgaacgggt ccagtctccg ctgctagatg gtgctctgac gcaccaaagt agaccgcact
   266041 gttgcataaa gaagagggat cagagccgta ctcaaaaggc agggcagagg aaaaacactg
   266101 ggctggtaac agacctcatg tgtgaatctt ccaagttact actggactct ggctgatatt
   266161 gtgatgcttg tgcgaaaacc atgaggagca atgccctgat ctcccgatcc ccagggccaa
   266221 gagagtgagg cacccggaga cagttgtaaa attcttcaag ccaggattcc acctgctgct
   266281 ggtggaggaa ccgatgcgtg ggaaatgcaa agtcaaagta tctatggact aactctttag
   266341 cctcattctt gctggggaga agtaggaagg aagggtccga ttttggtaaa ggagcatcgc
   266401 caaaactgaa aatgggtgta ttcaacggaa atgagatact ctcatggagt ctcttttgga
   266461 tacgaagtaa gaatgagacg cctgaggatg gcccgacata atgaccctcc atgtcagttt
   266521 gatgcggctc cggggagtct cgcgatggca ggttactggc gtctccatcg actcgagacg
   266581 atgaatggcc ttctatcacc tctgtgtccg gtgatgcagg catccgatct atattggggg
   266641 ccgatttctg ttgtatatgg tgttccgcga cattgtcatt gcccgtaggt ttttggagcg
   266701 tcgggattgg tggcagcctc cctcttgtat aacttgtcgt atattcgcat tcctgactag
   266761 aacgctgaca caaggagcac ggaagagtgc ccgagcagcg tagcttcttt ctatattgct
   266821 actcagtttt atgcaacccg gatatcgtat cgaactcgca acgtaccttt tgcaagcgtc
   266881 gcacgccctg gtgacacgga cgcgctcttt aacgcatcgg cgtttcttcg gacgagtgct
   266941 aatcaactcc atgggaaagt atgaaagaag tgctatatcc gaatgaatgg aataaaatat
   267001 ctggaaagga aaaggagcag aggttcaatt actgcacgga aaaggtaagg tgattttccg
   267061 gacggtcaac cccgcaatga tactcatgtc aagccctaaa ccggtgggaa ctagtagtct
   267121 tggaaggaat gggacgtcca attaccacta atggattgat tatagacgct gtactggata
   267181 cttagcacta ggcccagcca tcgagtcaaa tcggtagtct catagcattc atacgcaaag
   267241 tatatgcttt atccgaggaa tagagccaag cggacaagag aaaccaactt taacctcggt
   267301 cacaggtaaa acaggagtta aacttatgtt acaaatgcaa ttggggcact gtcatggagg
   267361 actatcactg agtatcgttt ccgtgtcgga aaagcaaacc ggaaaagcaa gaggggttga
   267421 cgttttccga ccctaactcg caactgagtt actcaagtcc aacgagttga cacaatatgt
   267481 agtactgtag caaagatcac ttgtacagat taagggcagt gcatataagg caaaaagagc
   267541 aatgacagag aagaaagaaa cagttctcgc caacgcgctt gcgaaattac atctttactg
   267601 agaggtccgc ctttcggctt gctttcaact gtgttggtaa tccttaatat gacatgtaag
   267661 tagtatcttc ctcaatatta tcataaaaaa agacaccgcc cactgactaa ttctgctctt
   267721 acttcaatag gcatagaggt tgattacccc cgagtctact tcccgaagct ttctgttttc
   267781 tcgcgtcaag ataattcgca tgacccaagc tagaatgacc actccgaccg aaaatccgat
   267841 actgcaatac attgcgaggc caaaccgtgg agcgtcactg tcaggccaaa ggtaaggcgt
   267901 gtagacactg gccaaattac ccaatgtatt ggtaatggca attgcgactg ccttcttctc
   267961 atcggtttga cccagcgtcg cagcagtcca tgcgatgttg atattattca ccccataggt
   268021 ggcacccaca aataggatca tggcgaaata ccgcgcacca atattcaggg tcccgcaggc
   268081 aaccgcgaaa ccaataatcg cgagggcttt cgaaacggta acatgccaag tacgttcgtt
   268141 gaagtgtccc gaggaccatg acactgcgac ggacgtgaac gtagcgacga gatatggagg
   268201 gcaggtgaga accagtgtta tcgtggaatt gaagccaaga gttttcacca cggtcggcat
   268261 gaagttcttg aacccgttcg ccgacagatg taaattgcac atcaaggcaa agatccatgt
   268321 gcggtaatcc atacaggctt cgcggaggcc aacccacgtg ctggtgcctt cttccctctg
   268381 cgtagtgtct cgtttgatcc gctcatcagc aagttgtcgc tcctcagggg tgagccatgc
   268441 cgtcgagcgg ggtgcgtttg ggagtaggaa gaaggcgaca agagcgaccc cgacagttat
   268501 taccccctgg atgagaaaaa gccactgcca ccctgcaagg ccgtgtttct tatcaagacc
   268561 agcaaatacg ccggcggcta tcaggcctga aaaggcgctg gcgagcatgt tgccagtata
   268621 aagaatagcc atgcgagtgg tcgcctcttt gcgagtgtag aacaaagata tcatgaaaag
   268681 cgctccaggg tagaatggtg cttcgacgaa gccgagcaga agtctacata cgagcatgct
   268741 gtggtagtct ttgaccagac atgtgagagt agagacaatt gcccaggcca tcataaaccc
   268801 ggccataaac caggaaggcc ggattcgatt gagaagcatg ttggaaggta cttggccaag
   268861 aaggtatctg gtcatccggg tcagtatatg ctccgtagac gtagtcatca ctggggtcat
   268921 acccaacaaa gagaatgcta atacatgtat tatactccgt cccctttaat tttaggtctt
   268981 cagagagact gctgagcttg ccatttacca tggcattgcg gtcaagaaaa ttcaggaagt
   269041 acattagcca aaggatcggc tagtgatcgt caaaatggtt caattttcag gagtttaggg
   269101 cggaccaaac catcatgtag agatcaatct tcctcactaa agcaatctcc ttggggttga
   269161 ccttagcgaa ggagccaaat ctatcatatt gtggggcaga cgaagacttc tcagggtccc
   269221 ccaggtactc gacatggtcg gtatcatttt tcatagagct atcatgagga gacgtggttg
   269281 ccattgcgat cgaacttgct tggagaagac agtccttgat tgacaatgct aagagaggac
   269341 tgggcatatc aaccaaagga gatgcctcct tttatacctg attagctcgt aggcttgagc
   269401 taaatacgta gacttccatg tccccacatc tccgcaacaa gataatccgg ggtaaagcag
   269461 tccaacacaa ttgccgacaa gaatggtatg ccaagcatgt tgcgggggag cccaaccgta
   269521 agcgacgtac gtgaagtcaa gctggaggtc aatgttcaac ctccgattgg atctacagat
   269581 tgttatcgga tatatctgtc catttccgac gctcaattga acaagctttc ttgataccgg
   269641 aaaacgtgct gccattgcgg atggatcaca tacctgatgt gtagggaact gagattgtgt
   269701 tgtaagttgg cgatgtttcc aacgaaagat ctggtttgat cattgtgttc aatgtaccag
   269761 agtgggtcgc atgacgctgg gccgacatac atgaatgtca ttaatgcatt tcacttgatg
   269821 cctcctagaa taccgatgtc tttataggga atccaaagag ttacatgacg atttcgagga
   269881 aaacgccata aacgcatcta cctcacgcca tacatacgtt acctctatag ccggcatacg
   269941 acaagttcac tttgcttgaa catgtttttc cgattgatac caatgcgtat agagctttac
   270001 ttctggcatg atgaaacgcc cggcgatgtg gaaccagacc aggtatgtcc aaagaggaag
   270061 aaaaaggaaa ggtttaatgg cctatctgtg gtccagcgta gcgcttactt gcagcgaaac
   270121 cgcgatttgc gtagttttaa tttctcggac gtaaatcact aacttcggtg agggatacac
   270181 attttatcat gccagtgccc ggcaagcaat tgagatattc gaaatgtgca tcgccgcgcc
   270241 ttagtaccga gacctcatgc cacgtccgaa attttcgtct atccccgaaa gtcttcgcat
   270301 gccgaatggc accagtatat atagccagat gcgatgggtg cttcttagcc cagatttcca
   270361 ggtcagcaag gcttctgaag aatccggtca cacaggactc gtttgactgc cctgaccatt
   270421 cgggcgaaga ggtgggaatg ttagataggt atctcagtcc catggaaccc gtctcggagg
   270481 ggttctgcca taagtatgac aggccctctc ggagagtcgg ttccaatttg tcttcataag
   270541 aacgtttctc atcttcgtcg caattgttcc agaactgacc agtccgtata tgtaccacgt
   270601 tatggaagtt ggtacccgtg aggtgcttgc ccaaggatgt cgacatagca tcaggaattg
   270661 ctgttgctgt gggattctca tcctgctcaa agagctcaaa tgccgaatca ggaattcgat
   270721 cccgagcagc gccccagtat gccgagtatg aatgcgctac ggtctttgtg cccggcagtc
   270781 gagccaggcc aggcagatag tctgtccctg agtagtttgt ctccagacga gaaacgtgac
   270841 tgacaaacct ctcacaccag agacccactg tcggctgaat cgacttatcg agcttttggt
   270901 acagttgagt gagattcaat cctttgatac cgttctcata ctttgattcc gtatcccagt
   270961 agcatgcaaa gacgagtgaa tctggggtgt cgtcaccgtc aatcacccga aaacgctcca
   271021 ccgcagcagg cgcgttgtcc tggtctgtag cgagccaccg ctcgatcgcc gcgaggcact
   271081 tcgtcagccc aatatcgagt ccatgatgtc gttgaacccc aatatatgta gtaaatactc
   271141 tgtctatacc gtctgcaaag tgagcatacc atcgaggtat agggggaaca tgattagctg
   271201 gtcggcgtag agggaacctt ctggcaggac aattcataac tggcagagtt ggggggttaa
   271261 taatcgtctg cgatgcaaag gctgttcacc aagggataaa cgctatttta gtagtccata
   271321 gggttacatc aaggccattc attttgaata gtggagcaac tggggctggt gacaagacct
   271381 caagtcacgt aatgtctaaa tgtcaccata ttagaggcgg aaggaaagcg gaacgagagc
   271441 ggaacggacc gcaaaacccg attggagccc ggacgtagag atgttccgaa ccgaggccat
   271501 agatgtggag tcgtgaccct cacaagcccc cattatacat acaatctttg gttaaaagca
   271561 ttcctggtta gaattattac tgtgtgctgt cccctcctta tcggtatggt gctatgtaga
   271621 ggaggattta tatgtgctgt ggatcgagta gagtgcaaag gagaccctct catgctgctc
   271681 cgttaagttt cttggcttgg ggtaggtttg gggaagcata aaggtctttg ttatatatct
   271741 agtagcgccc tctgtctcct cgttagaacc aactttgaac accgtcgatc gcaatggcca
   271801 ctcaggttcg acttgctgcc gcccatgtcg cccccatctt tctctccgct catgaaacaa
   271861 cacacaaagc aatccacttg atcgaacagg ctgctaaaaa caaggcaaac cttatcgcgt
   271921 ttccggagtc tttcatatct gcatttccca tctggagtgc cctgcgcccg ccgaccgaga
   271981 accatgacct ctttcagcga atggtccggg aatccatcca cgcagacggg caggagatac
   272041 aggcggtccg cgcgactgcg agaaagtgca acatcatagt gagccttggc ttcccggaga
   272101 aggcccgcac aagcagtgca accttattca actcgaatat gatcattgga aaccgggggg
   272161 atgttctcgt ccatcaccgg aaactcgtgc cgacgttctt cgagaaactg acttggtcgc
   272221 ctggggatgg ctatggactg cgggttgcgg atacagagtg tgggaagatt ggggccctta
   272281 tctgtggaga gaacaccaat cctctggctc gatatgctct catcgcccag ggcgagcaga
   272341 tccatatctc gacctggcca gccatatggc caacccggtt gccatcgcag cctgtggcgg
   272401 aaaaacacaa tccacagtct gatgcaatgg gaaaatcaaa ttatgacaat gtagcggcga
   272461 acagaatccg tgcggcagcc cattgcttcg aagcgaaatg cttcggagtt ctctgcgccg
   272521 ggatgttggg acccgatgcg attgatatcg tttcctctag ttcatccagt gttaaacagt
   272581 ccatggagca atcccaacga gccgcaacta tgttcctcaa cccgactggg gcacccatgc
   272641 agggatttgt gatagatgaa gttacatcgg ctcagcattc tgccgatttc ctacaagctc
   272701 gggaaggcat cctgtacgcc gatgttgatc tgaccgactg tgttgagggc aagcaatacc
   272761 acgataccgc cggtggctac cagcggatgg acgtctttga tctccaagta aatcggaccc
   272821 gtcaacaacc agtcagattc actgacacag ttgacttgca gcctgaccag gtcccgcaca
   272881 agggatcaaa aggcaggcgg gactagcggg cttcgatcag aatatgttgt gcctccactg
   272941 ccacagtctt cattgattcg gtaagaccag gaccaaatac tacagaatga tatactactg
   273001 aggaggcccg aaacccgacc agagattaag agggatctca acccacaata tgaatggtta
   273061 gatatgcaaa ccaaatttgt acctcctact acccactggc acaatgacat ttaatgatct
   273121 acataatgag cgtgggagtt agctggatca aattcgacgt ccagcgcccg gagccctgtt
   273181 gtgcccagat ctctggtaag gtccggacag ctgcaacaat attttggaac ttggtctttg
   273241 cgaaaacctg gttcatgcgt tctgtgaaga atcgccggtg ttctgggtca gtagaatcgg
   273301 cggcggcgat gaaacacacc caaacaaggg catgcgcgcc ttgctcatca gggtcaacgc
   273361 gtgacaccag ctgcttcaag ctctccagtc gatcccatag gtcgtggttg gtagtggctc
   273421 ggaggatata aatttgggaa gcttcgataa aggcctgtct gaccacccaa agaaccctat
   273481 tgtgcctgga ctcggggggt agttcatagt cggtccaatc aaggtagtgg ctagggtgaa
   273541 agcctagggc attcatgcct tgggtttcat taagcaacgg ctgtccgaga aattgaaacc
   273601 tgtactcatc attagcgtca actcaaggaa tacagggcat tgctgactca catgtgggtt
   273661 tgttgtacaa gaaagcgata ggcgggcgtc gcctccattt gacagaggct cggcatcagg
   273721 gagagtagtg tgcgcagtaa atgagagtac tcgggactgc ctgtgatggt ttcacccacg
   273781 agtagaacaa tcagggttgc ccacgtgcga agattaacga tgctgtccga ggatgcctgc
   273841 aaagaatcgc gccgaagccg ggagatgatc gctgcacggc caatttctgc tatgccctga
   273901 aaacctggat gtcgtagagc cagatgctga gccgccacag ctcgaatcgc cccacgcagg
   273961 acttcatcct cgcatgctag aggtaggaaa atatctcggt agccattgga aacattatcg
   274021 aagatgacca tgactggggc tacttggctg gcgactagca tgtattagcc acttagaggt
   274081 aggacccggg agaggtgtaa cttacaatgc gagaggtaca ttcggtcttc aggacccaat
   274141 gaaggaatcc atggaattat agtgctgcac aagtccggag ctcgcgacga ccagtaatca
   274201 caaccctttc ctccatcatt gttgtacgaa ccggagcatt cttgccattc cacctggtcc
   274261 tgctgggttg tggtgccctc gaagtacctg actgacccaa cacgaggttt ctcacctagt
   274321 gcatctggtg ctattaaggt ttcactggca cgaggaactg cggatttgct ttgagactca
   274381 gaatcaagcc aagcctggcg atccttcact tcttgtacgg tcggatatgt gctagccttt
   274441 gtggctgccg ttctaggttt gcgcttgtta cgatttggac cgtcgtcctt ccatcggatc
   274501 ttctgaggcg ttggagcacc cgtgggtgac tgattattgc aatgcgattg aggtggcact
   274561 gtggccggaa tggcacatcc tttcaatttc ccgcgcgtgg ctatgcctgt ggaaaagcga
   274621 aaccgaccga gacctgagca ttcaatacct tttttctggc acttatagca ggtaggatgg
   274681 gcgccgtcgc agacaatccg tcgcttagta cactgaaaac accctgcaag agcacgttag
   274741 ccggttgact ttgaagcctc ccgaaaggac tacgttatct gaaagcgcac ctcgattttt
   274801 aacacttctg gagctcattt agtctggggt cacagactgg tatagaacaa aagggcattg
   274861 taggaacgct tgaatgaatg ttgctgaatt gattgccggt ggaggtgttt ttgcggggaa
   274921 gtccgacttt tgtcttgttt gccgttagtt ggaagcttat cttatcaccc cggatcaagg
   274981 atactcctat atcatccatg tacgagtatt tcggggagtt cccgactcag gtggctcgga
   275041 agatggttcc tccggccgct aagcggtccc acaatagttt aggcctagct agttttagat
   275101 ggccataagt tccacaggga gcgactcttc gaccgttgag atattataca aaaagatctt
   275161 ctgcgttctc ttacaaacac tattagccag tctaatggca ggagaacgcg catttttcac
   275221 gctaactgac cagtaccgat cctttgtttc tcgaaagtgt gaagcatctt tgattatcgt
   275281 aaaccctgca gtctcatccc agaccagacc tggaggctga cgaagggggt gagtttatac
   275341 atctatatcc cggctctttt tactttcctc ccagaccgtc accatcattt catcgtcgcc
   275401 ctcaagcgtc tgcgagggaa gcataaaatc caaacttgtt gtaaggatca aactttgtct
   275461 tgatggcctg gagcttctcg aggcggtcaa cgtcacggcc gtacacctgc ggaagctgct
   275521 cgccgcccat ggcgtaattg acataagagt gggcaatgtc accattgcgg ctagcaactt
   275581 ggagcctttc tccgaagtcg cgggcaacgg cgagctcagt cgggtcatca ccggaccaga
   275641 acaggaaggc agccaacatg ttgtgcctgt tgcgctcctc cggtggaaca gcgttgaagc
   275701 catcggggaa gtcacggacg cccttgcggc catacgattc gaagatgaag gtggaggtgt
   275761 tgtaggtttc aatggcgaca aggtcagcga agatgttgta gctttcgcgc atggatgcgg
   275821 ggtcccagcg gacgatggag ttggagtagc cggcccagtt ctgactcggg acacagaccc
   275881 ggtcgtcacg gccgaagttg gtgatgtcga agagttcgtt ccagtagata tcggtaatgg
   275941 tctcctcgtg aatggggccg atggcacggt aggcctgaat gtactgggga gcggcagtat
   276001 cgtaaccctg gtagatgagc tccatgacta gaacaggcta gagcattgtt agcaagtgct
   276061 gctagatgtg atctgcggca acaaagacga ggctagttat tcaccttttc agcgttgatc
   276121 tcgggcaagt tgcggtagta accgttcagg acaaccaggc ctggatcggc tatagtgtcc
   276181 tcgagctcgt tccaggcttc gaagtactct tcaatcctat cggcctcata gaccagggtc
   276241 ataaaggtcc atggatccgg atggatgtcg taaaccttga cctcgaattc aaggacaata
   276301 cccaagttgt gaccagcacc acgaaggccc cagaagagat cttcgttttc agtggccgag
   276361 gcagtgacaa cagtaccgtt gtggagagcg accttggccg agaccaagct atcggcagcg
   276421 aaaccgtggt caccctgaag cacgctgtgg ccaccaccca ggagaggacc caggatggag
   276481 acgcactcgc agagaccgtg gactagagaa agcatgcttg tcagttgatc gtgcttggcc
   276541 tgcttgtacg ggattcatgt gagagggctt gagagattac cagcttgttt tccatacgga
   276601 tacagggcct ggacgacttc gtattggagg acaccgccgc cggcatatgc ggtgtcattg
   276661 ttgggaccga gaccgacgtg gttgaggcca cgcatgcgga tctgaattcc atcctggatc
   276721 ttgctgatat cgtcggtcca gccgtgggtg ccggtgacgg ccaggaacgg gagtccgatc
   276781 tcgttcgcga ctttgatctg taacagagtc agataatgtt cttttcatgt tgaacagctc
   276841 gtcctgtacc gtattcacaa catcgtcttc ggtagctacg tcgacaacgg cgagatagcc
   276901 cgggttgacg cggggagcag cagcacgatg ggtaacgtca taccatttct cggagtcggg
   276961 aaagacaatc gtggcgtttt cggagagctg atgcgtgaga agctccttga tctgtgccaa
   277021 cctggcctcg gcagtgccgt tggacggcac tgtggcctgg acggcaaagc cgaagaagcc
   277081 agctgccagg atgtttaaga gcttcttcat cttgaatgac tgtacctgat attgctcagg
   277141 ctgatcaggt caaaaggcgc tgttggacgg aaaggaggac tgcgcttcta ggagagaaga
   277201 agggcgagat gagcctggtg gaacaatcca tcatttatat tttttttgac tgctgtggcc
   277261 gaacatcacc agctgtcttt gacaaaccca gctcttgttg gcatagctta gaaaactcat
   277321 cggtccggtc caatgaaact ctcgtgctgc tatgtctgga tgaaaagcat tcaccgatac
   277381 gacagtccag cattcgttcg cgacaaattc tacgtcgctt cgagttgcga tttcttcgca
   277441 gacaatattg ttaccagcat cgtgaacaac actcaacgga gtctgcagtg gagagcacgc
   277501 atgaccctgc cttacattag ttctctcgag cttcttgcaa tgcagaatgt gctcgaacct
   277561 atgcgtgacg gtttggcggc gtcggcgcca tctatggcga gcccctggtg atcgctaaga
   277621 cgctgcagct gttttccgcg gggccggcgc ttgcacttgc tgtggggagt aaatctcctt
   277681 ggcgggcagc aaaatggaag cgctgcgtcc tatcctgaat ttggcttaac tcgtgtgaat
   277741 gtccttgcct tgaatcaacg cttgatccac tgggttcgag tactgtacac acaaaatcaa
   277801 gtacggagta tcttcatcct ttttactagg gtcgggcaac gcttgagcca ttatgaacga
   277861 agctgttgaa cgtactgcgc tacagacaag ctctccccct aacggattgg taagcggtcg
   277921 gccgcgatgt gggtgcgcaa tttttatcaa cgaaattggt gcaaacccgt caagctccac
   277981 cgccaataaa tgtgggacct caacgattga aggaaactcc aggcgcgcgc tggtgtagtc
   278041 tcggacatct gcaagcgcca acgtcatacg gagtacattc aagccaaatg cgtgcgttaa
   278101 acactccatc tttcgcagca attctcagtc aaatttagtg ttcacttcat tggagtgatg
   278161 acgatatcaa ggtcgattac aaatctcacc gcgggtaaac gatccttata gatagaggca
   278221 cgggaacccc cgctaagttg gacacacata aaacctgcag ctgctgagaa aggagagacg
   278281 attcaccttc agaagcaaga cgtccatcga caagaatagt acccagaaca tcgaaaatgg
   278341 cttctaccac cgctacagct ctcgtcacca aaggcggcaa gctgtccaag gaaaccattc
   278401 ctgtgccgac tccaggcgaa catcaggtgc tggtgaagat ttcctatgtc gcccagaacc
   278461 ctaccgacgg taagtcatgg ttccagttcc cctcatcctg tgatcgttga agctaagcct
   278521 ctgtctagtc caatcactcg acgccaatgc cttcggtgat gatgcggttc tcggttgtga
   278581 ctttgtcggc actgtcgaga agactggcga caaagtgagc aggatcaaga ctggcaccgt
   278641 gattgctggt ctaatttggg gaggttggtt accgtctcgg atatcctcat tctacttatt
   278701 atctaaagtt ttgtttgaac aggcgagatc aaggggttgg gtggctacag cgagtacacc
   278761 ctcgcagatg agcgcatttg tttcccgttg cccgaaggtg tcactcccga gcaggcctcc
   278821 acagtgcccc tcgccgcgtg cacagcactg atcgctctct tctccaagga ctgtctcaac
   278881 atccctcaga actctggaga gactgttctc atttggggcg gcagctgtga gtcgaattga
   278941 tgacatgtgg cgtatcaata acattgggaa ctcacgcatt gcagcaagcg tcggacttta
   279001 cgccatccag atcgccaagt actacggcct caacgttgtg acgacttgca gtccccggca
   279061 ccacgatctt gtcaagtccc ttggtgctag tcacgctttt gactaccgtg atgctaaggt
   279121 ggtagagatc atcaaggctg ctacgaactt taacctcaag tacgtcttcg acaccatcgg
   279181 caacgactcg tcctcggtca ctgcatcgca cgcagtctcc gaacagggtg gcggcctgtg
   279241 cactgttcgt ccgggcaagg ctttcaccga gaacgtgacc aagcagacta aggtgacgga
   279301 tgtgcttgtc tggacggcgt tcttgaagga gcataaatac ggggagtttt actggcctgt
   279361 aagtcaccgt tgagattgaa catctaaagt tgtttattaa tcagattcgc agccgcacaa
   279421 ggaggaccac gaactttcag cccacttctt cgaggaactg cccaagttgc tctcttctgg
   279481 agtcatcaca ccgaatactc cgaagctcct cgagggactc gactctgtgc caaagggatt
   279541 ccaggaatac cgtgacgggg tgatctccaa ctacaagatc gtgtacaagg tgtaagagca
   279601 tgagatgaat cgtaaacaag ttgcgtcact gtttcgtatg atgctcctgc taatgctcct
   279661 tcacgtgccg ttgccaaatc gctaggttag atataactct gatttgttat tctggaaggc
   279721 gaactacgat gaaaatatag tgggctcctt gatacaccca acactaatca tgtaatactt
   279781 tttgttcctt cgcttctata gcatggctta gactatttag tattcagcat attggtaggg
   279841 tcattttgtg gtgcttttaa acaggaggac aggaagttta cagaaatatt gtcaggtgag
   279901 tattttgtaa cttgagccta cagcaattca gatttgctga catcaatgtg tgatagacga
   279961 cgaggataag cgcttctatg atttgactag gtgtattatt ctgtcagcag taatgcatag
   280021 tcccctggac agtgctgtat atcaaacgct agttaggacg aggcactgtg aggtaggaat
   280081 gaactactag cgttactcgc actaagtaaa gtagactatt cacacaaagg gaggcgagag
   280141 tacaggtcaa ggaatgacag atcttgatcg ataaagtcgt cttgactgaa gtgcataagg
   280201 agatcgtccg aagcctgtcc gatatttcgc atgatacagt cggtattcca gatatctaaa
   280261 gagacagagg acctgactct aacgtggtct cctacagaca ggttaatgac tgtgtccaac
   280321 ctttaaaaga ggatatgttc cgcggaggga aggataccga gtgtatcaaa tacggtgagt
   280381 agtctctcga tgcaacagcc ggctttctga gtgatcaggc tgtttttgcc aatatgcttc
   280441 atgacgcgca gagcatcttc tatctcctgc cggatttcag caaccgaagc agtatcgaag
   280501 acctcgggtt cgtgcttttt cacaataagc attgcaaagt aatgtaaggt caccgtcaac
   280561 actaagctac tcgtaagccc gggataattt aacagttgga gatcctgcca tacttgtata
   280621 attgcaggta taccatgccg cgaacgtgtt gacggatgtc tcgtgagccg tgctaaggga
   280681 actgattatc ctgaagattt tgcgcaccgc gtcccagtca ttctgtaata cttgaggcag
   280741 cctttccttc aaacggtcga ctatttgtgg ttcacttgaa ctatctctga gtaaaaccag
   280801 aaagtgggca attaagggga agttcacaat catgcgcagt cggtagtagt gtatcgatag
   280861 caatatgcgc acagctgtat gacagtccat cggtactggg aagccagcta gctcggacgc
   280921 caatacgagg cctcctatcg tggatagatt ttgggaccac tcctcattct tccagcatag
   280981 gtccgtccac cgggtgacaa gggcatgagt cttatcgttc gttgacactt caatgtttcc
   281041 attgtatagg gaccctgtgg catgctcgat gatagtatgc gaccgcctaa cgtaccataa
   281101 gccacgatga tgagatcagt gggatccgaa gctaataggt cttacgcaag gtgacccatg
   281161 tattggtcac taatcgggga attaacccca gggagcgctt gactgctgat cgtaaggcat
   281221 tcaggaatca tatatggccg gccttgggtc aaacccataa tcctgcttct aatgttagtt
   281281 tgacgagggt tcagcgggtg gctcaatact ttcctgtcat tcttgaccac tccgtcccat
   281341 agacgaagtc gaagtctagt ctcatccgag tcgctagagg catctgtcgc ctggtgatgc
   281401 agcccaacgt ggaacgccgc cttcacacat aatgcatgag atgtataact ggatatcgag
   281461 cgctggtggt tttgcttata ctcaactacc aataagagtg actggactaa cagattgtgt
   281521 taatgagatc ttatcagtta aaagccgtaa tggagatgtc tcacctagct catagctagg
   281581 acgctctagc gtcctggagt ctagtaacgc aacagccttt ttatagaatg tctctcgttg
   281641 tagagagcct aatgaggctg ctgcaagagc ccaaacaata ttgcacaatg ctagcaaaac
   281701 cctccgaaat tttggtgggc gttgctgtac agcgttgtag tatccctcga gtaaaattgc
   281761 tttatcgatg tacgggagga caatgttcgt agtggaaaag tacctctcga aaagaaccag
   281821 tgcttcttcc tttggtagta gagatgtttc atgaagggct tgggaaacac ctgcctccgc
   281881 ccgagtacat gtacctgttt gggacgcctg gttgtgacgc tgcgcgcagt gataacatga
   281941 actcaggttc ttaacaaccc cggacactgg tagatagagc attgtcgttt ccgcaaagac
   282001 gctagagaga aggcgaaaca tgccataatt ggagctgggg cctaggatct taattcgtgt
   282061 gcttcctcaa cccaaatcca caaacatacc gaaatatccc acgacattat cagtttcttc
   282121 ggttaatgca tttgttgaga gtacatcaac cggtgcaccg tcctccacag ttgttcgatc
   282181 gttacaatgc accacttcct gctgtctctc ttggtccgta agtgccattc caactgcagc
   282241 tgtgcgtgac tcggtgaccg ctcgcaactg ctcttcaagt ttctctatct tctttagtaa
   282301 gtcacctcgc tcgctgtata ttcgttaggg tgtccgtgca tatcaggatc cagaaatgga
   282361 ggcccaccgt cccagcttag ccgtacgact gcctttatga atcggtctat atgagcactc
   282421 caaacgtcgg ctttgacatc gggagcagct tggccgggtg ccttcacact gcttaacgtc
   282481 agatctttgc gatccagatt cttcgagtca agctacttac ctttagttta cggcgacgac
   282541 actcgacgca ggcaagctct gttcgacgca tcccacgcat ctttcccata tctcaagcgt
   282601 tcctaaacag taacaatcaa cgtccagatt ttgtgtcttc cccacagcga tcatccccag
   282661 gtcacgggag gctccccacg caacttgacc aatcggatca ctgcttcccg ctgatttcta
   282721 tccgagggta tcaaaccctt accgtaggag gagtgcagct gcatccgtac tatccaagtg
   282781 gtttgtagct ctggaatatg ggtccctcaa tctgcgggca tgatgcagtt gttgcggggt
   282841 gaatcctact gtactcaccg taaaagctcg gctatcatct cgtacctacc cgaggaggcc
   282901 ctaagttgaa catatatagt agtacacatc ttgacttaca catggggtaa gactccaagt
   282961 actactagga atcacatacg gcaagtcaca atgacccttc ttcagaatat cgtgtcagag
   283021 acgccgttgg ctgcgggcag cgctttgctc accgcaatca ttgtcgcata tgtcatttat
   283081 caacgctacc tgcacccact ggccaaatat ccaggaccat tccttgcaag tatcacagat
   283141 ctatggcagg ttcaccagtt cctgtctcta caacaaccat acaatctcac cgcactccac
   283201 gagagatacg gccccatcgt tagatacgga ccagacaagc tcagcattac acacgagagt
   283261 gctgtcccga caatttacca gaaaagcgcc aagtccatgc cgaaaaccga gttttacgat
   283321 gcttatgggg ctgctcatcc aaatgtgttt gggatgcggg atgaagtggt aagtctccgg
   283381 ctaagatctg aaattatgca actcatggtt ctagatgcac tcggtgaggc ggcgtcatat
   283441 gtctcacagc ttttctttga gctacatcaa ggagatggaa gagtaccttg atctaaacat
   283501 acgcattctg aaagataaga ttagatacca cagtgaaata ggcgaagtat ttgccctaaa
   283561 gaaagctttg cattactata tgatcgatgt tctaggtgaa ctcgcgttta gccggtcttt
   283621 cggtgtgcaa gaggctgatg acgagtcgcg tattccgccg gtgatcgagc atagcctttt
   283681 ggcggctgtc accggtgcat ggcccacaat gacaatgacc ctgaaaaggt ggctccccta
   283741 catgccgcat gcagggcttc ggcggctctt tgctggccga aaggcctgcg cagatcttgc
   283801 atcgagcagc gttcaacgac gcctgaggga tctgaatgat ggtgaaagtt cagtcggagt
   283861 acagaatcgg aaggatattc tgaccaactt gatcaaggcg aagcaccctg agacaggcga
   283921 aaggcttacg caaactgatc tggaaacgga ggcatttggt ttcatgtact gcaccccgat
   283981 ttgattcttt ggcaacatag ggttaacgat ctcacagtat tgccggaact cacacaacta
   284041 gcgctacatc cacacttctc ttctaccatc tcctccataa ccctgacttc atgaggaagt
   284101 gcactgagga gatcgactct aacctgccgt cccttggacc gagcgagact gcgtactcta
   284161 tcacagccgc agaagcctct ctcccatttt tacgaaactg tatccgagag aacttccgta
   284221 ttaccccggt tttcacgatg ccgttagcac gtcgtattac tgaccctgcc ggagtaacga
   284281 tagaaggcga acacttgcct caaggagtgg gttgatttgc atctcaaaca tgctttcctc
   284341 agggtctaac cattatttga actagacgtc agtcgctgta tgcaaccacg cattccatca
   284401 caaccctgtc gtttggggtg aggaccataa tatattcaac cctaatcgct ggaatgatcc
   284461 aaatgttggt gctaaagccc ggctcttgat gcacttcggg ctgggtggcc ggcaatgtat
   284521 tgggaaagct gtggcgacta ctaatatata caaattgctc agtactctgc ttaaggagtt
   284581 tacgtttgag ctagccgatg agcaggagcg ggtggatgtg gacaaggggt tgtataaagg
   284641 cagaatcccg aagcttttca gtgttggaat tagtgacctg cagggacctt tgctcgttag
   284701 agctcgagtt cgttgacaga tttaagggat ttctcacact tcgttggccc aagaggggaa
   284761 ggaatacttt gcagctaatc tgtagtcgat actcgtacaa atagcatcat acctagtcgc
   284821 agacgaactc gggcataccg ctgaggttac aggagcgatt acctattatc atgccgccac
   284881 cgtggatgtg gtacattgtt cgaccttagg agccctgtga aatttccgga catctctgca
   284941 gtttcatgcg acagaaagaa gcattttagc gtatgctgca gctgtagcgc atgcatactc
   285001 ctgccacaac ttgttcttat gtgagtccgc gtagtcacat attcctcgaa taacaagact
   285061 cggtactgcg ttcataatgc cagctgcttc catctcaaag cagagaacgt tgtactttgc
   285121 acccagatga tccctagttt ccgcatcctt aataactttg tttccagaag caatcagacc
   285181 atagtggatg agtgggtgag tcacggaacg gcgtgctctt cggacatgcc gaccactaca
   285241 ctgggcgaaa agcttgtcat gttgggctcc aggatgcttg tatgctgggt tgcatgctgt
   285301 aacatccttg atataacctt gaaatcgtgt ggatggaaga tcagggtcgg acattaacgt
   285361 acttatagct gtcatcagga aacgcggcgg acgctgcagc gatcccgttc gttcaaatgt
   285421 gttttcctca cttgttttgc caaggtcgta ttgaataacc cctggatgga tgtcagttgg
   285481 atggctaaca acaacatcac cgagtcgtat atcattgtct ctcgagggca ctccgccccc
   285541 tatcccaact aaaaggcaaa acttgatctc aggaaagctt ctggtcaaat gggaaacaac
   285601 atcggcagcg gcgtttgtac cgtattcgcc agatggaaga cgtgcagcaa caacgtaatg
   285661 acgcccaata cgacccaatg cataatgatt cgtatctcgc acagccctct ccaaatcttc
   285721 atgtctgtcg tcaaacagta tgcggaccgc taggagctct ttctgcaagg cacatataat
   285781 tccaactgtg tagctctcac acgtaagagt ctctctacat tcgcctgatg ggtgtcgaga
   285841 gcataaagtt gccgaactac gactttcctt cggagccgat gaagctgtgt cggacccaat
   285901 tccactgtca tggaactcgt tctcgggtgc ctctgatggt gaccatggtc ctcctactac
   285961 agggtatcca gtatcgttcc agaaccatct ggagtactca ttgtggccaa aaatcaccgc
   286021 gccgcgagct tctaaaggaa cttgatgatt gctgagcaag cccttcttaa gagccgaagg
   286081 caaaaggacc tgaacaaggt ccgaatgctt ctcctgccct tccacctcgc attgacagct
   286141 tccaaaaata tctggattgt gccaaatgat gttatgtgcc aatactatcg ggtttgcttc
   286201 tgaatctcca tccatgtcca tgatttcttt taggtcgtga atagaggcgg cgaggtagta
   286261 catgtccttt ggcaattggg cccatttggt acaggagcca gtactgatag gctggataac
   286321 ttcaccaaat cgccgaccaa acaacgtaac tgcgtgaata gctctggcaa aatccaccca
   286381 gcctttcccg atggctttaa gtttggcaac acgaggatag aaaatgtcgc gactggtagc
   286441 caagtcattg aagtcccaac cttcaaggta ctttcgtgct ctcgatgagc ttgcgctgct
   286501 ttgtgtggcc atgccgacct catagtccat gatcttctcc aaagtgtcgt agagctcttc
   286561 aatccgatct tccaggcgaa gatagccatc tttttctaga tatatcggga gcttcctgtt
   286621 gttcgaattc acgaggactt taatggcgga agaagctcta caggcttcag gtgcctcttg
   286681 catatcttcc acgttgaaga gaaattcagt gctgatttca tccatgctgt cgtgcttcaa
   286741 agatgcacga aaaaggtgta agaggacact ggtcccattg actaaccacc ctcgtttgtc
   286801 ttcttcgtcc caaagcacaa agaatctccg acgaatcgac ttgagctttt ctatatatcc
   286861 atttcgtatt atatggatag ctgtgtcctt gtggcctatg ctgaatgccc tgccagtgat
   286921 gacctgtccc ttatatacac ggacatcatg atatatgcaa ccctcgggag gccttggcag
   286981 ccgcgacggc ttaattagat aattggcgtc tgaggcacct gtgaatgtgt tagcaaagaa
   287041 accagccttc ttccacagcc ctcttaccag cgttgtatct ggcttccgaa caccaaccaa
   287101 gcacatgtcg agccctttcc aagtcaaaga tgcttatatt ctcaatatga ggcactgtat
   287161 gttggatata ggatgtgcgg cttctgtcca tgttgtaaat caaatgccag aggattgtat
   287221 ggccactttg tcttgttggg attaacattg tcgaaaagcc cttgataaag agctttctgt
   287281 tgaagctatt gactcgttta gtttgagcca accctgccat catattaagt ggaatctcta
   287341 gacctgtacc ggtctcagtt ctccacggaa ttgggtagcc tctgacgaca acgggattcc
   287401 tgaacaagtt gtgccagcat tgagcattag aaggtgtaaa ttgcttctcc ctttcctcaa
   287461 aagtgaaatc aatactacaa aggatatcgg gccaagacag cctgcctgac actggttgcg
   287521 gcgtgctaga gatatggtga atactaataa ccggcatgca gcacgcaact ccaaagtcat
   287581 atggagaaga gcgtagggca gcaccaagcc atgcaaactg ttcaccgatc tcggccaccg
   287641 aatctcttgt gccgaaagcc tcaacgttaa actttgattc atgaagccat gcggtgacct
   287701 tggcattgtc aggaaagtca cctagaacaa cacaaattag gattaaatta aagcattcta
   287761 gatttggaaa cttacatatt tgtcgactgc caggtccagc gcggactata tccttaacca
   287821 gctgaataat atgcccacca gttgagggcc atgtctggca aaggtattgt gcacaaggca
   287881 aagcctgtgc atcctcggct gaccctgtaa gtgtaatggc tccctcaact gcctcacctg
   287941 gctcctccgt atacccttgt tcgtcgagga aggatagtgg attccattcc atcacaaaag
   288001 tcaccgtata agcttctgca gatgactttc ggctgatctt gtgagaggat ggcagggatg
   288061 taagaatcct cttcctgatt gtctccataa ggtttggctt tgctggggcc aaaaggagct
   288121 ctctacgcat gcttgcaaga agccattcat acgaggcgac attgaaaagg aaatctttat
   288181 atgcaaagag ttcaggcata ctagtttctt cgctctgttc ttcgtctgca tccgcattgc
   288241 cgattattgg ttcattgatg ctaggagacc gtgggatggg atcttgctgc tcttctaggt
   288301 gtttattcca gaaggtccat atctcatcca ggggcattgc ttcagagtcg ctagtctcca
   288361 tgtcagaaag actctcttcc tgacgaaaac acatgtcctt gaagcagctc acaactttac
   288421 tgagagataa gcaaagttag gattaagttt catgttatat cttgggaata ttggactcac
   288481 tctcgattct tgtggataaa aaccataaca tcacgatgca tctggctagg tgcgttgtgg
   288541 ccaactttaa gagcgaaagc tctgagcaat tctggaagga cttcagaaat tctttccatt
   288601 gtcatcgaat caggctgcca ggaggacact tttgtaaaca aatctccagc caattcagat
   288661 atgtagccct ccctttgtaa actagtaaca ctcgatgtgt cagagtaaac cgttctggct
   288721 gcatccacat gcacgaagtt ctgtgtctgt ggcacttcgg gttgctctcc tgatgcgtat
   288781 ccagggcctg caggaggttc ggttggaata tccctagtgc tctggatatg cccgtaattg
   288841 tctagttttg tagatgcata acctgaatcc gtaaatgctc gagtttgtgt aaattccagg
   288901 gtatgtgcat catcgcctgc tctaggattt ttctttcccg aattcttcga cccaccttgt
   288961 tgccaatctt gtaaaactgt gccttggctt gtggctgtca ctcttaggtc atcctccaaa
   289021 agagtttcga gacgcgcccc attcatacca gcatcaccag acatgcccac agtactcccc
   289081 accggttcgt ccgggcctat caaatgactc tcgtggccga gcccgtaggc cccaagacct
   289141 gtatgtggta gaggtaggtc aggtatctgg agcatcctag gtgctccact ggagacatcg
   289201 aggctagttg gctgactggt ggtctgctgc tgcaggttag gaaatggatc aagcatcgaa
   289261 gctgagttcg tcttatcgga caagctttct tctggtttgg taatgctgtt cgtgaaatca
   289321 aaggcgccag cagagttgaa aacgctagtg acatggtgat gggaaggctg atacaagggc
   289381 cagtgctgct gcagtagttc atgagtccga gggctctggt acatgctagg ggtcgacctg
   289441 ctcggtggga ttggatccga agaaagagga gtaaggcgaa ctgaatctaa atcaggagta
   289501 ggaaggtaaa tttcattggt acggcccggg gcagcgatta gctttcggca tatagtggtg
   289561 ccgacctcga ttggtagcgt ctgcctaaac tgccagagga tgatggccat tctcttgctt
   289621 ccatcgctag gagaccctgc atactggttg tgcagccgtc gcaagctggc aggctcgctg
   289681 gcacggatct cttgaactgc ggtcagggtg cgaaagaact gctggttacg ctctttagca
   289741 gcatgttgat gtccgctggc ttcagccact tgcttgtcct cggtaagcat cgtgaaacgc
   289801 tccgcccacc atgacgactc aaacggcagt ctaattcttg tggtgtgcgg cttggggata
   289861 ttgtgatatg tttccatcgt cttctggcct tcctcatata tgtaattgta acaggtccaa
   289921 ttctctctct ggttactcat cggtgcggcg cccaatgtag gattggtaat gtcaagctcc
   289981 aggccaattt ctaaccttga ccctgtagga ggatgaacgt ccatcaactg aagtctggcc
   290041 tcaagaagta ttatctcgca gctcaagggg tcgttgacct ctaagagcaa cgaatttaag
   290101 tgcggaaaga aggttcgcca gttcgtcaat tcttccaagg gcataggtgc ttgcggctgg
   290161 cctctccgga ggcgggtata cacatggaac gcatcatcaa tccggtctgg catgttggga
   290221 gcactaaccc acatgccaaa gccaaggcat tgaacagcac agacaagtga atctttactg
   290281 tagtgactag aagataaaca gtttatagga cttctccttg taggaccaac tagttgagtc
   290341 tggctatttg agtggtcggc cggttgttct cgaactagcc tttcccctgc agctcttgtt
   290401 acgtcacgca gaggactata tcctggtatt gttgaactta cagtctgggt cacccttgag
   290461 gaacgagtca aggacttgta agtgactcga gacctgtgtc ctcgtcctcc gcttgccggt
   290521 taacctatag atatagtccg caatcagttc gtttcgacca tacgactccc cgcgtgcgga
   290581 ccagtttctc ctccccatcg gtgggtttgc ctcgagagct acagtggccg tcaacatctt
   290641 gctaagctcg gcagataatt ctgcttacct tgatgaaatg cgtcctccag ctcgtccgac
   290701 catactggct ccccatcctt acaagtgccc cgacgttgct ggaccctata gtctagaaaa
   290761 ctttgcaatt ttagatagct ccttcccctt tgaggaccag ctagccttga gccattagac
   290821 tgcaggcgtc gcagcttctt aacctggtat cggtggatcg atagctggga atggtttggg
   290881 acgggagaat gacggtcctt gcaagtaatt tgttggaggt ggtcgtcagg tcctgctgta
   290941 tcattgtgtg ctggattgtt tgaatactgc tgagtatccc cagaggcatt aggaggctct
   291001 tggcatgact gagcccctag actctcaaga caatgctggg tctgggacat tatacactct
   291061 ggttgcctct cagtcgccat gagttcggac cactcgaata cgctctcaca aggataaatt
   291121 ctaaaccgaa ggtgtcgagg gtgggaaata tttcttgcct agtaaataat atacaccgac
   291181 ttcccttgac gaggctatca tctcatcgaa tagaatttcg ccacatggcg ccgcaaaatg
   291241 taagcagaga aggccacctc attcgacaaa cacagaaaat gagctagccc ggctaggtat
   291301 ggatgattcg tgatacggca actgatcgga gcatcttctg aacaaggtcc accagatcga
   291361 gaaagcaggc catcgcggct gtggggcaag gctacatgcg gccaggctat agcatgtata
   291421 ccgctggtat acccagcaac attgcagcga ccaacagctt tggatggtgc cctaacgtgc
   291481 cgggcacaat gtatcagcag aggccaagtc tgccactgca aaagaatgtc ggcggagcgg
   291541 cctacgacat cggtaacccg attggggcgg gtatggaaat gattgagaga tcagaatctg
   291601 acaccatcga gctgccggtg ctcttcgtat tagagaactc ctatgatata attatattat
   291661 ttatatagct ttgtcagctt gtttaaaggg gttaaccaaa ccgtgttaac ttaagttaca
   291721 cgtttcatat tgtatatcac cgaggggctc ccactccgcc cccattggtt ttctcccctt
   291781 gaaaacttat caagagaaga agtataagca agatgacggt ggtagtaaat acatgagata
   291841 gtagtacccc agcacgggat tatttctgaa tttccccact ggatctgcga agtcgtggac
   291901 cctgatacca ctttcgcgca tacaccaacc aatttatgcc agcaacaatg gccatggcac
   291961 cgagcaccgc aggcgtataa tctggaagtt ccgtcccaca ggtcaataaa cgatataagg
   292021 tacaacagtc atggtagcag ctcgaactca ctcatattac tgccagtgac cggcatcaca
   292081 gtcgggaagt cataaaagat taacaccaac actgcgaagc acacagtgat tagattggct
   292141 ccccaaccca ctggactggg caatcggaac gggcgtggat ccggcaacca agtcgccgat
   292201 cggcatcgat acagcagcaa cgcggccggg aaagcgtatg aaatgtgctg tagaactaag
   292261 ccggtaccga taaaggcatt aaatgcagat gatgatccta agtaaacacg gccgatgagg
   292321 aacataactg catagttgaa caccagagcc cagacgggga cttctagggt gtcatgcaat
   292381 tgtccggtcc attgactacc gatcagggcc cggtctcttg ccaaggacca ggtaaggcga
   292441 gatgccgttt gttgagcgcc cgtgagagcg aagacggctg cgagcagaag gaggcaaatg
   292501 aacacggtag cggccgaggt ggaacgtgtc gcttgatgcc acatttcgta aattggaact
   292561 ctgccgacaa tgtcagattg atgtccgaac gtacagggtc agcagggcag gacacggaaa
   292621 ctgacccggt agacgatgcc accacagtat ccaaatcact ggtacagtat agcatcgtaa
   292681 tcatgaaggc gaaagaggtg acgaagccaa taaccaaggt actcatcaga gcacgaggaa
   292741 cagcggttgt tgcattccgg cactcttctg ccaagtgcaa ggcaccatca ataccagcgt
   292801 atatgtagtt gggagagaca agacccgtga gaaaggccac tccgcccgag ttccatccac
   292861 tgccatttag aaaggtggcc catacactac tagatgcctc gtaccgagag gccgagcgag
   292921 caaggcaagt caccatgata atgacgaaac ttgtgagggt catgaagact gtcaatctga
   292981 ttagatgtcg tagcctgcta ccgggtcaag aaggatgggg acgtacagga tacgtcatga
   293041 aaccagaggg acttcttcaa cagggttgtg ttatacaaca ggaccagccc attaatggac
   293101 tggtggatta agaagtagtg ccacggctgc gattgatact ccgagtcata gaagaggaca
   293161 ataccgagga taagctgtgc tggtatgatg gcaatcccag tgcagatagc gatccaggca
   293221 agcatgttgg agacaccaca acaataactc tggataccac atcaatgttt accttggctt
   293281 atatcgggtg aaggagagga cataccaacg cccgactcag atgcttcggg gccagaatgc
   293341 tcgtccaatg gtactgcccg ccagcggttg gatatgtact ggctagctcg gccagggtca
   293401 gggtacaagc accgaccaaa aagaagatca aaatcaaccc atagatgaga gttacgggcc
   293461 cgccctggac tattgcaaga gctactgtgg cagcaactcc cgcccagctg tcacaaatga
   293521 tccagctggc ggatatagtt tgtaaagggg tcagtttccg cgtaccctct ggttgaaagt
   293581 tgagtccttc cagacagtcc aggtcaccgt gttggataga ttctgtgtag gctaagaatg
   293641 agtcaggacg acttaggtgg aggctgagcg atccggtaga gactcacgtc tttcggtatc
   293701 gaggcattgt tctgggccag tggacttggt ttagtgacgt gcatctcaat acttcaggaa
   293761 cgattcatcc ttaccgtgtt taggctttgt ttcggatgcg tccatggtgt actatagaag
   293821 agcagcccga ttgtggctgg tagacaagag gttgagaacc cgataccagc aactatagcc
   293881 atgatttgta ctccgacaga cctcaacaga cagtatatat accaggatac caactcagag
   293941 tgacatctct gaccttatcg tggcttttgc ggggttcgaa ttaactttcc cagggttacc
   294001 aaattgggta aaaaagaaga gaaaaatgct ggcaaaggaa ccggatgatt ctgcactgat
   294061 aagcttcctt cacggacttg gcaaacgcaa acattggtac atcaaggatc ccggaggtcc
   294121 aatgacgtct gagaaaccat ggtcccttgt ggctcgtgcc attatctgag gttcacagtt
   294181 ggaggtgtta gttacgttag ctacgaaatg tcaccaccaa ctagaatata gccagacact
   294241 acagtatctt tgtttggaaa agaagaatac aattagacag tgctatcaag acaagctgac
   294301 tacacccgtc ggattcatac tacatacatt gtgtacaaaa tgccaagatt tcgaacgaaa
   294361 cgaggaataa gaaagggggt ggctaacaga catatccttt cacatcatca tgacctatca
   294421 tactgaagat atctataaat gagaacgtac agcaggagct ggtcgcaact cctctattac
   294481 agtcaccgct gcccgagtac cctcctcaat agcaccgtca atgaagctgc gccagccaac
   294541 tgcccagtca gagttcgcaa agagcacgtt tccatgccgg caccttagtt cgtctaatga
   294601 cttggacaga agctgtggag gcgcaaaaaa ccatgcaccc ttagcaaatt catccttgca
   294661 ccagttatga aacacctgca ggatcagaag tcagcaacct tattcgatat gtgatgtcca
   294721 aaacctacta atcgcttgat atccatgttc ccaggcgaca tgttctccac cgccatttta
   294781 gtcgcctcaa cgtcctcttc gggttggatg tggttatgtg cacccccgaa gcacacaatg
   294841 tgtgtgtttc cagcgggcgt ggtaccatct ccgatggcgt aggcaagctt gttaaaaggg
   294901 tatgaaatcc ccgaccagga ccgcatgtca gggcaagaga cctctgcgtg gaccttgacg
   294961 cattggttta catgaccaat attcgcggca gccatgcgct gtggacttag agggggtgaa
   295021 aagtggacgg agctgagcac gttcaatgga atagtagaga ttagacgggc tccactatac
   295081 tggcgaccat cgcgggtctt taccacaacc ctgtcgccat ggtcattgat cgactgaact
   295141 gggctgttga aggcgtatga taaccgtccc gttctcagtg actcacgaaa gaatttgata
   295201 gcgaagctgg attgaccccc cttgaattta tatgaaatca aatgctgcag acacccctta
   295261 taggagtagt cgcataaagc ccaccaatga aggaattcaa agaaacttgt agtttccaga
   295321 gtcccacagc tgcagagcag aatgaagctc tctaatacag cgcgctcatt tggcgtaagt
   295381 gattgggcca gcgcattgag acgatccaaa gctgacatgt catcatattg ccgggccgca
   295441 gggttgtgga aggcatcgtg cggataggga atgatctggc gccccattgc gccgtctaca
   295501 tcaacaaact tttccaacgc actggcgagg agtgcatcct tcgaagggtc aacggagggt
   295561 cctcatgtaa gacggttctc atggcgggtt gaacaaacct cttccaagtg gctaaagatt
   295621 gatgagcctt ggctgccagt gcgcagttca aagtgattca cgccccgaga gaaatcgaag
   295681 cacggttcca actcgcttct catttggtaa cgggagacct ctcgccaaat atgaggttgc
   295741 ccccaactta gccaagtgcc tcccatttca aaaggatatc cgccaatgtt agacgaccag
   295801 gagcgacctc caatacgatc gcgcgcctcg atgagaagta ccttgagtcc tgtggtaatg
   295861 ttcgcagtca acgcgtctgt ctattaggac ccgacaaagg aatggcgtac cggcgagaca
   295921 ggcatctcga gatgccgtga gacccgaata tcctgccccg acaacaacta catcccagtc
   295981 ctctgttgtt gaaagtacat tcgtgggtgg cgatataaca ccaatagatg gtacaccttg
   296041 acgtagacct gtcgtcgcag tccactggta cccgtcacgt gaagtcattg tattcgggct
   296101 ttgctatact actggttcag acagtgctga ggacgccggc tcttagaaaa cgaagtaata
   296161 tagtctgaag atggcacggg gagcgacctc tagatatagc tcccagacgg agaaagtgga
   296221 atcatgataa gaatggacac accacgtctg atttagctgg tatacgtgaa gttgccattt
   296281 ggggataata cggagagaat ttgggagtaa gaaggttgtg atagtaaatg aaccggaggc
   296341 tcctcgatgt ggaggtcgat gaaaattacc gcattcgggt agtcaagaga gaaaactacg
   296401 ggaccaatca caaccatctt gtggatccct ggttaaagga atactacgga gtacatgtat
   296461 tattcttaat cctaaaattt tgtatctact gcaatatttt gtatttcatg tactagcctt
   296521 gcttttgtat ttctattgta ctggaattct agatacattc gctctacaaa gctctgcagt
   296581 agtgatctat ataatcctcg gaccaacaca tggaccagac ctagctacaa ttatatcacc
   296641 aacgaaatca gattgaaatt ggtagcatga ctgcagtaga tataactagt aattattcgc
   296701 tttttatctc attatatatt ccagcaaggg aagacgaaag ctcgtcaaga cggcgtccac
   296761 tcctgaggct tcctcttgga agacacagaa cgcccactcc aaaattccgc catctaatct
   296821 caaagtttaa gttcatgtcg gctaagaagg agttgctgtt ggccgtgcca cagaagttgc
   296881 agctgctggt gctgttgtcg agaagataac ctcccttttc tacgatgtat ggtgcgacac
   296941 tgttaggaca attcgggcaa gaaataaatt ggtctggata gaacataccc tgcaaaagca
   297001 aacaagatat taaagaagta attcagaaat ccgccggcga cctggtccgt ctcaataccc
   297061 gcaatgagca tgctcgtgaa tgtgctggtg aaagcgaaga atatccagag ttgtagacaa
   297121 gtggcgatac cacgcgaatg gacagcatcc gtccaaatcg cccgcgttgc gagacatggc
   297181 gtcaatgata tccaagaacc gactggcggt aagctgcaca aggagaccct gagtattaaa
   297241 aatggataag gaccttgcta agagtgtttg gcctccagta cacgtggtgc cgtcgcatga
   297301 gggttgtgga tctccttaga gcagcgatca tggacagttg atatatagca tgcttacata
   297361 gagaactcgt atagggagga atcaatctat acacaggttg agccgtagtc atattggcag
   297421 tggggccaga tctacattga tagttgagct ctagtaattt atccagcgca tacattgaag
   297481 ctattcccct ctacgtacgt tcgcggaagg tgcgaaggtt gccatgcaga tcatgtagta
   297541 tgactttgtc ttggcatttc cagcccttca aatcgctttc gactaaaata ttccaaaatc
   297601 gcctagttag ataagacctt aacatgctaa caatctacag acacggccgc atacagaacg
   297661 gcatggcagt ccgtgtctgg cacatcgtaa gaactgccgg cacagttact gccactccag
   297721 gtggtcacat tgcagccact ggcacactgt tagctgttga agattagggc tcatgaatta
   297781 cgatacatac tcgttctgac taacgcgaat cgaacgctta ttcgacggaa caacgacgca
   297841 cttttgtgag ctggagttca ggacggagaa ggaatcgtcc gttccaccac aggtatcgtt
   297901 tgcgtacatg tgaacggtga ccccgaaatc cgtctgagtg ggtgtcgctg agctatctgt
   297961 ggatgtggta ctgctactgg tgagagtggt gctggtggat gagctggaag tcgtgttgtt
   298021 ggcggatgac gacgatatgg ctgtcgcagc ggtgtcactg ttgcaggaga gtcaaatgct
   298081 gtttctcttg tgagtataag tatcagagca agaaactacc ttgaagagct gtccttgtga
   298141 gcattgcgac tacccacaac tcctcccacc acggctgcga ccacaataat cacgactgct
   298201 accgtagtgg cgattatcca ggtccacttc ttcttattcg aagcctgtcc tgtcgctagt
   298261 ggtggattcg ccgcatggtt tggtatggaa ggatgtgcac catagctttg cacggtagga
   298321 ttcaagtact tttcgtttgg atctggcacg aagacctgag gagcggagtg ttctgaatcc
   298381 gggatccaga aagcgggcgg cacggacttg gaatccggag agaatataac ttgtggcgca
   298441 gagtttgggt cctcctctac tggaatgcgc tcctatattg tactgtccat ggttagtttt
   298501 cgcaagtccc ttcgtcattc ctgcaccaca ggtggatcaa cggaccatcg caagggagag
   298561 cgcgcaagaa taacttgggc catgaccatg ttggcgccga ctttgggggg acactgtctt
   298621 caatttaatc tgttatgcct caggaatatg cgtctcaccc tcagatgatc ctgcgttgac
   298681 ttgcgaccct cgcgaccagt gaagaagcca agcgggccgt cggggcgacg cttatgcagg
   298741 ctaaacacac tggcgttgtg gaagtcgccc ataagccttg ggatcggctt cctgatggac
   298801 gtttggagaa aagtaagggc cactgtattt taatgaggtg ttgacccgcc aatccagttg
   298861 cagtaggcta tcccgacaag acccaagatg tccaataata agggttgttg gccggtatcc
   298921 accgcgctat atcgctaaga ccgtcgtaaa tgcatgagca caaaagtatc ccgattgggg
   298981 gctattttac ctcgaatcat tctctcttaa actgtgcttg ctctttaggt ttcttcagat
   299041 taattagtac tcagtttgct cggcgtatgt tgactgcact gcttatagtc ccatcacttt
   299101 caaatcagta ggaacgtgat ctggtaaaac tacttccata tatctaatta ccgtagcgat
   299161 aggagtcgaa ccaggatata tatataaaac aagtgctgtg acctgtatac ctgtgcccta
   299221 gaagtcaggg agctaaaggt tggaaattac atcacgcact gttgtactac ttatgagcca
   299281 cattgtctag aataggtcaa ctgcagtcgt actgtattat tgccttcatc actcattttg
   299341 tgttctaaag gtgagtcttc gacttgaccg aaaccctgca catccgcccg acaatagttt
   299401 aggcaatcct atgccctgac ctacatagtc cttctaagaa ggcgttacca ctacaatcag
   299461 cacgggacag agattttaga atttttatat tgagatttca cattttgtct ttccgttaat
   299521 catacactct gttgttatat atacagttca cacagaccca gagttgtccg cgcaggtgaa
   299581 ggcagctgag ccaccttctg ttttgtatga gtccatgatc ccaacgacgg atccataggt
   299641 cccagccacg gtcaggaagg ttcctgaaat gactacaaag acactgaaga aaaccataaa
   299701 ccaccattgt ttcgtggcga gaccctccct ccgcttgtgc cagttatcat agagccacat
   299761 gcaacccatc ggttggaagc acatcatcgt gcccagcaag gctccgatga gcgacacaag
   299821 tccgtcaaac actgggatcg cgctggcgat aatataggca atgacggtaa tgctgagggt
   299881 gcaggcgagc caaacggtcc agtgcgtgac ggtattactg atgaggtgtt tggagccgcg
   299941 aagcagatgg acgaagatat atttcgctgg gatctgtagg tgggacgaag atgattagct
   300001 gtgttgcaac agatgatcaa tgggattcga ctcacatgag taacaatagt ggtagtaacg
   300061 attaaacctg gcaaggaaag tccataggcg atcttcttaa tcaatccacc ggctgagccc
   300121 agggctggtg aggcgacata ggatccacag tagtaatata ctacacagcc aatcgtgata
   300181 tagaccgcag tcacaacagc ttgacagata agcagtgctg gagtgaactt gcgagggtcg
   300241 cgcatttcag acacaatgga gaagaacccg ggagtaccgg agaatgcgaa aacgagtgag
   300301 ctcaccgcgg tgatcgcctg agcgaaggtc ggattgccga tgattttgaa gtccgcaacc
   300361 cagggaccat ccgtttgtgg tgcggtgggc gggcggtctt gaacgccaac ggcgatagtg
   300421 acaatgagga ctagagaaag atgagacaca gcctggatca acacctcagg tcgatagtag
   300481 cgatcgactg gggagacaca ggtataaggg aacttactgg caattagaat acacggcagt
   300541 ccaatccatg ccagccaagt gaccttacca agggttcgga tgctactaca ggcaaagcct
   300601 agaatcgcgg caaccgccac aaagatcgcg gtacaggcac catgcgtgga gactgcattt
   300661 aggccaatcg aaatcccgag gataccggag cctgcaacga agatccagtc taatgccatg
   300721 tcagtgaggc ctgtttggag cgagtcaatt caagataacc cacacaagca aaaggcggct
   300781 gcgagaacga cccgccccgg tgtaccaaac atcaacgccc cggcatcatc aataccatac
   300841 acttcgcgat gacgcaactt gaaagatccg accatatagt cggaccatgt cgtgatacag
   300901 gaaatcgcga tgagtacgat cacgccggga accatgccga gggtatcaaa ggctgttggt
   300961 atggaaagaa cacccagccc gatctgcgtc ttcatcatga gaaccaccgt tccgaaaaag
   301021 ccaacctagt gtctcgttag tcctgcatac tggctgccat agcatctgcc accggcgaga
   301081 atgtacgtac attccggtag ttcggccctt catccgtgat ttctccaaac acggcatcgt
   301141 aggtaacatc gtcgacgatt tcacctttct cgaggtaaag ggcgttggga tcctcaatcg
   301201 gtttctcttt cgtctgtatt gaagatggat ccatgatgaa ggcgaggaaa tgcaaattgc
   301261 caggggtgat gatattaggg taaagggaag ctcgcgaccc cgggacttta tataccaacg
   301321 ttttcggaaa cgcttctggg ggaaccgtac gtcattgatt taatcgaatt tccagaaaat
   301381 caataaataa gtcacgaaac gttccgaacc gaccgactcc atttttcttt ccccaggtcg
   301441 actagccttt ttttggggat gcccgatgcg gagactggag agggcattgc ccagtggcag
   301501 tggcaagtta gggcaaacca gcctcagaca acaagcggtg cggggttaac cgctgcatct
   301561 gtttccttct ttgggaaatt gaggctgtga tagagtctca ttcgatcgtc tcccatcttg
   301621 acccgctaag atgcaaacgg caaatttgat gagacccacg agttggaacg gccacaggcc
   301681 aatcaggtga ctccaccgga tcgcttggat ccgctttttg atgccgggct aatttgaacc
   301741 ttcgactagg ctccagtggc agacaaagaa tgagagagag ataagagaga taatagagat
   301801 aagagagata agagagacag agagggaaag gaacaagaaa taaacaagca aaaaagccgc
   301861 attcaaaaag tgtatcaacg tggttgcctc actcaatatc gccgatccct aaggtcttta
   301921 atacagatca cccgagactg ataccgttag aggattttta cacgaacctc tgggcttggg
   301981 caatgacata gtctaaggcc gtcctgagag actcatccca tatctcacga catccgttca
   302041 ggaatggaac tctaatgtca ccctaatgca acctaagtgg tccctcccaa tgaaagtcct
   302101 cgcccctgaa tgtaatcaaa ttcctagcgt tgtgatatgc ggaggaagac ttgagacatt
   302161 tttctagagg taaaaaatag gtttcgctca ccgagacgag gcaacgaaac actctcttcc
   302221 ctgatggtgg cgcgttgaaa acttttccat cggcgaagac caggttgaga agtggaggat
   302281 tggaggcaca gagggcggga gagtttcgta acttttccgt cggaaaacct agattaggct
   302341 atcggcctga gatcagtccc cttcactcag tgtatctcgc gatttacgga acctcacggc
   302401 tagtggaagt gttgatctgt taccgtcgtg cgtctctagt tccactgtcc tcgacctatc
   302461 ttgtcgcagg aaactgggtc cataggagag atccactgta gaaggaccat ctaactacgt
   302521 tggggattaa ttacgtcgcc aagagaatta tcggcgaggt ggtaagtctc tatctcggag
   302581 ctatcacgaa aggacgatac cggctgcggg caaaccgagt ggcggcgctg acgacttggc
   302641 atttgcggcc cgtgttcgtc gtgccctaag ttctaagctc agtaagggcc tctgccggac
   302701 tctcaccggt accaagtgag gcttcgtaaa gggcctgaaa tgaatggatc tggcaagatt
   302761 ttcattggtt atggcggtac caatcctaat tcacccaaca caatgcgtaa gtcctccaca
   302821 ttgtttgtct ccccatattg tgggggacgg gagcttattg gaatcggtgg aagtccaacc
   302881 aaatcgttca tctggagcag tggatcctcc tcgacgaatc cgagcaactt gacacgtcgt
   302941 ctagttagtc cacgagaacc ccccacatcg acatgattca tgagctttca ttgctccccg
   303001 cattttcatc tagtgccaga tgaaatccgt ggatgtccat gcagttcccc ctcccctcaa
   303061 acaagataca tgaacgcacg ctcgctgcga aacccatacg tctttccaca caagaatttt
   303121 gacagatcca agttctttgc ctcagtcatc agatgcaccg gcgtataatg cgaacgttat
   303181 tccatggaca caacctcgaa cgaggctgcc atacggctag aaccattagg tggacgaggc
   303241 accttcacca tcaaaaccac cagcgtggtc tttctcgcaa tcgctctata caacgcggtt
   303301 gagcttctga tcctgatcct ggcgaacttc catcatcatc atggcatcta tttctggtcg
   303361 atgctcttat caaccgccgt gggggtcata cccttctcga taggtgccat cattgacctc
   303421 tacaacctga gcccattatg ggtgatcctc gtcatgatcg acctggggtg gatcttcatg
   303481 gtcggcgggc aaagcgtcgt cctctactcc cggctacatc tcgtgtcgcg gaatgatcgt
   303541 gttctccgct acctccgcta tattatcatc attgatacca ttctcctcgc cacgccgatg
   303601 tccatcattt acttcgccac tgcctattcg aaaccgacag tatgggctag ggccttctac
   303661 atcatggagg tcatccaggt catctggttc tccgtccagg aatgcgtcat ctccaccttc
   303721 tggatcgtcg aaaccgctaa gctgattagg ctccgcccgg gatacgaccg ccatcgcaac
   303781 cgaactatgt acgagatcct ggcgatgaat ctcgctgtta tttcgatgga tattgcgctc
   303841 ttggtgctac agttttcggg ttattactac gtccaggtgc ctgtgaaggc aaccgtatac
   303901 agtataaagt tgaaattgga atttgcagtc ttgggaaagc ttgtatatct cgcaactcac
   303961 cgggttgact ccatggggct cgaaatatct ccagtcatgg ctcccgttga tgtggctccg
   304021 agtacctctc cgtccagcgg agcttctaaa ttacaccagt caatgaaaga ttcatttggg
   304081 ctctggaagc ccacacaaac gcacaacgcg gcgagcgaag ggctgatgtg attttacctg
   304141 gagtcggctg gggcgcccac tctgttatct agcgcttgcc tgtgtcacac cgcgttgttc
   304201 cttgtacata tgcatgtatt aaatatatga ctaatgacct ttggtacttc aaatactcgc
   304261 tttagttgcc tgaatcggaa gggctcctta ttttaactca acctctccta ggggaaccgt
   304321 taaatataat gtacttatac aaatgttcaa ttccctggca ttggccggta caatgagcgt
   304381 taaagctgtt ccggcctctg ccagtattga atgtattatt gttatgcaaa tagaagtagg
   304441 cgcataaagc tatcgtcaat actttgaatg gtcttatgag ataaagggtc atccttccat
   304501 ttgtcatatg gccaaatact aaaagttatt gtccaccttg actgaagatt gaatcacagg
   304561 cacacaatgg ccaactgctg acacgcccta aacgttactt gggaacgccc gatcctcccg
   304621 gggcaaaacc cacaagtacc tgatgcctat gcggatggga tatctgcaca gataccctct
   304681 cctcatgtat gtgtataaca taccagatca ccacaacagt cgtccgacaa cttgcaagcg
   304741 ccaaactcta cgatcgtgtt agccttctct ctcctacatg ctgatatgat aggagacaat
   304801 aacatacact gttgatagtc acgttcaacc aaacctgcag gctgggtgat ggcagcggcg
   304861 ctggccagag cggtgagggc agcgataagg ggatttcatt ctgtctcgcg tttcgtggtg
   304921 ttgtgatgtg atgatgttgt tgataaatat caagcgattg tgttccttgg atgttttgat
   304981 gaatctgatg atagtaatga tagctcaaaa gaagagcata tttatatctc ccacatttaa
   305041 tcgttcctca caccaacacc aatctaccac caccggggta catcctatcg ctccttccca
   305101 ttctaccaac acgttcgaga tcagcaagtt gatgtcataa ctcctgttgt agcattgtgg
   305161 cgataaggcc ttggaacgtc tggccttcaa tgcggacttg ctcggcttac tgtatatgtt
   305221 gacactgaca ggctattggg atgagattgt gatattaccg ggcttaatat tgaagccgag
   305281 gtactctggt gaggtgaagc tcaaattgta ctattgtctc ggattctgtt tggctcgtgc
   305341 gtctattgac agaagagcgg ttgggtaata tggctcagtt attggtcctc gaacaaggct
   305401 gtggggctga tgcgacaatg gcagatccgt caaagtctta cctgccagtg cgcctggtac
   305461 gttgatctca acatgactgg agtacaacgc gcactcttgc aggacttctg ctaaccgtca
   305521 gagagtcaca acattacgtg tcatggcaag tagagacatg tctatcacac gtcccccatc
   305581 cacgtttagg aaatttgacc cttctcgatg ctgttcacat gagagtctgt tccatcaatt
   305641 ttcagctgcc aagaaggaag atcatctcgg cggctggtca catcacaaag agcctgcctg
   305701 caacctatgt ctctaattcg ttgcgctgaa cgactctatt gcttagctgt gcttaacttc
   305761 actaccatca gcgccgtatg ggccaacgcg atgagcctgt gtcatatgtc tatgtgctat
   305821 caggtatagg tactactcac accgatatga ttagtgcgtg ggcaagttga attcttctaa
   305881 tgcagtaata atacagcaac agaattatcc atccaattac agtgcaccat cataaggtaa
   305941 gcatgctacg ggacgctcgg catagaaagg tcaaggtcag ccgatgagga tggctcaatc
   306001 aaacgctgat cctcttgctc aaaaaaaaaa aaaaagttac catcgctatc ccgacggtgc
   306061 tgaacacgtc gaagatatga atagctagct gtgtatcaca gtcgcgtgct tgagaactac
   306121 atatataccg tgtgcgatgt aaaaagcaga ggcacccgaa attacacggt acttctgatt
   306181 atcagttagt ctggaatccc gaaggccaac caagactttc ccaaatcgtg cagacttatg
   306241 tcagacctgc cccgtagcgt tgttgtacga accctaccac tagcatatgc aatctactgg
   306301 agctggatag ccaaaagaaa gtgagtcagg cttagaacaa ggatgtccag atctgcctgt
   306361 atgttttggg tccgtcatca acaatgttta gatatggagt acttacgctc acacggagtg
   306421 taaaaacggt gacatatccc cctcgcatcg gactgtatac gtcagtataa gaaactgcaa
   306481 cggtagaata atcgccaaat gttcacacaa tggctatcag agataagaat tataatatat
   306541 tatcgaatca acgtgatcta aactagggtt cataaggttt tgtatcatct ccgatgcttg
   306601 ataccgacgc ttgatgtgat gtctcccttc gccgcactcc gttccctaat gtcatccagt
   306661 accgattgga gaccggaact gttgtcgtga agtatccctt gtaccgagtt gatcagcaaa
   306721 tcattgactg gtaccttcgc cgaaaggacc aaatcacgca tgacctcagt gtaatatggg
   306781 atcatgacgc catcatattc cacctctcgc gtgacagcat cgaggctgag atacccgctc
   306841 cgtaaagagt ctctttgcgc ctgtagcaga ggcaggagat tctctgtaac tgtgtgcata
   306901 tctaccactc cctcgagtgg tgtcgagtgg ttgccgggtc gcaacgtcag attgttgata
   306961 gttgcattcc ctattgtgag atccttgctt ttcaagtcca tggttatggt tccctactgt
   307021 ttcattagcc actatatgat aaataaccca accgggtgag tacatacgat ttctatggtc
   307081 atgacggatg gattaggcaa cgtcgcattt gcaaccagat tcacaccgtc atctcgcggc
   307141 gggaaaagca ttttgggatc ttcgatcgag aatccagcga acgaattgag agctgcaatc
   307201 ttagctccta cgctcactat ttttcatttc tgtctttttg gcttctgggc ccacacttac
   307261 tgttttgagg gaggtccttc ttcaacgaga tgtgactctt cagctttccc aagtatatgt
   307321 tggtggttcc aaacgcagac aacggggcat gtggctcgaa caccacactg cgaatgtaat
   307381 gtttccatgg gtcaggattt atcgggcttg gctggttctg gactccaata ctcgcgttcc
   307441 catgtatgac tatagcatcg ttatagacct tcaaatacgt gctatttccc ggctgatcat
   307501 tgttgaatag gtggagaaca tttgggtcaa gacgtacagg gacgttgacg ccaagcctaa
   307561 gtgcagtttg gatgctgagc aaaacagatt ctggccgggg ttgcatgacc ttagcttcca
   307621 cgaggacgag agatgcgtcg tcgattactc gctgggagat cgcctggatg atgacggtaa
   307681 agctggacct attagctatg acttggtggc tgaatatatg ggtgtgagac atacaacagt
   307741 ggtaggaaaa ttgccagaaa gataatggca ccgatcaggt aacagcacca aaatcggatc
   307801 caatgccgac gtatctttcc gttccccttc agcgtgctgc tctctgtcag ctccacatgt
   307861 gcgacttggg atccgtctcc atgctgctgc tctagaggtc ctcgatacgc tcccagggcg
   307921 tactttccag ccttggtggt gagatacgac ggtgtatcag ccatggcctt gcttcctaat
   307981 actgtggcgt gttccaggca ttagggaaca tggtggttgg catatatgta taggtgagtg
   308041 gactcgagtt cttctagtat ccacataact agcttgagta aaagatttgc tgatgagcca
   308101 tgcatgtgat atctgtccat ttcgtaccct cgaaagcatc acatcattgc gtgaggtgat
   308161 aaataatcaa aaatgtaccc agagggagct ccaacaaatc cagaacaata taagctaaaa
   308221 tccagaatgg gaaagtgatc aaccccgggt tttttgatgc tccgtgatga tcggcatagg
   308281 cttcacagaa acggtaggca ttgcgagtcg gttcccgaaa ttgggatcca cttaagcagt
   308341 tcaatatcat gttcgtcgcc ctcctgtaca tacaatatgt ttgtgattca attactggtg
   308401 gtctcagatt acatgtgcga cgtgagttgt gagcttacac aaatgaaccc atgcaagagc
   308461 ctgcgattta tatacgctca cagaaaatta accacccaga gcggtcgtgg aacgggaatc
   308521 aagctcatgt aaattgccat cataccacca ccttctggca gattgttatc acgttgaggg
   308581 ttgtggtagc cagccctgtg caatgtatta tcccagcacg ttgcatacga cttctccccg
   308641 ttctaagagg actaaagata cggactaagg ccgaaaagtg cgtatcgtat ctcctccgag
   308701 cgatcaacat cgctacgata gcggaaagga tagtaaagag ccggctgcaa cagacaattc
   308761 atgtcgcttc aacggtcaac ctcctaaaac accggaaggt aaacatcgcg agaaccctaa
   308821 taaacgttag ccttggcata ggcaagtcac tatgtgagga ttacaagctg ggtcaaaggt
   308881 atggctacaa accggactct ctcgatattt agtcagaatt aacagactga ggctaaagct
   308941 gattggggaa tccataaata tgcccctgcg caactcacct caacttccag catcagcgat
   309001 gtgctgatac tttgcccagt tttgtctgca ttatctttct ttcatggttc caattcaacc
   309061 aggcgtttct ttgctttctt ttcccccgca cgacccggag cttcgattag aggagaagcc
   309121 cacagggtgt gacttacacc tacgttgcct atactgccac agtcagttct atagtcgtcg
   309181 aaaagacgcg cgattcgatt gttcgtcttt ggaaagtacg tacggcggcc ccctgagatt
   309241 acatatcacc taatcggtac cttaacgctg agctctaccg cacacagaac tggaatatat
   309301 catatcctgg tgtaggctaa tactcttgat gctaataggc gttaagggcg gagtgttcga
   309361 ccggtaatga aggggtacta ccaacgtgaa ctgctgtcct gtcgacacgc gcattaggtg
   309421 gctgtgtcgc caaacggtgt ctcgtatcca agcgctcata tacctttcta tccttgggct
   309481 ttttatcaca ccacggcctc acagcatcaa accaaagcca attcgccaga tggacttgtt
   309541 cagatattca agcttagccg caagatgatc aagtttgcaa cacccacgat gaacgaggtt
   309601 cataccagcg aaataggcgg ttttctcctg gttgaggaag tacagtcgag tctctctttc
   309661 tcttcctgtg tggtgatcaa cgctctccgt aagcagctga acacggtgtg ctctcgaaca
   309721 catgaacact accaagcttt cgccgatatt gttgtttaca aaagttatat gcggagctag
   309781 acggcacggg acatggtttc aaaggctgtc aagtggattt gcgacatact ggagacattt
   309841 attgccttgg tcccgacctc gaatcctttt gcattggcga ttatagtaca ctattgcgtt
   309901 gtcctacacc ggctgagaaa gtgctggtgg attgcatcat gggggaagcg gtgatgaatg
   309961 tcattgtagt ggctttgttc tgtagcctgg gctcttgata cagtgaatga acaatattgg
   310021 gtgaggcaag gaacatacag gttccctttc atatccgtga gcgcagccga tttgatatac
   310081 attattaggg atgcggaaat atttgcactc gcccgtccat aatatacaaa atgtgttgcc
   310141 caactctacc cacctccatg tgtgtttgaa cacttactat gacaaggccc accgtttcac
   310201 ccacacttga ccaggcgacc tgaaaatatc gagaacagca gatgcagttc tacgtggttg
   310261 atactacaaa ctcaccaaaa catgttcttg gcacttgtgg aattgagcga gctccacgca
   310321 aaagcagtgt tgggcccacc tgtgcaactc tggagctgat gtcgagaaac acaacctcct
   310381 taggattgat ggaatctgac cttgcagtgc tcaatgcact tccagtaaac tgctcaatac
   310441 gttaagcgct tgctccttcg caatatcact tccctacctc ttgccaggaa tatcatacta
   310501 gagacagcta cccaactgct cccttgcagt cactgtaacc cacatgtcac ttacagcaaa
   310561 aaggccgttg acattttttc tacgccatgg ttgttctgga ttggcaagag cccaatcaaa
   310621 gttacgcagc gccttccagc acagtcagta tgtcaaggcc aactatggtc aggagaggga
   310681 gctcatcatg tacctcgaaa atcgtcttgc cgatttcaat taacgccacc gtctgaccga
   310741 gacacttcca gcgaccgtaa ccaaatataa gatcattgac tctcgtcatg ttcgccagat
   310801 gatctttgtc gtcaatcagc catcgttccg gcctgaagac ttccgcgtct tccccatagg
   310861 tggctttgtt gagatgcatg cccaacgcag aatacccaat ccaagtacct cctgggattt
   310921 gaacagattc cccatccacg atcacttcgt cgccttcagg tggtacgtct ctcgcgaaaa
   310981 tgttgacgac cggtacaaag atccgcaatc cttccctgat taccgcctgc aggtactcga
   311041 gtcgtcgtag ttgggcgtca gaaatgatac cggtcgaagg cgctctgcca tcttgaaccg
   311101 caccatctat ctcagcctgc agcttcttgt acactcgcgg atttgacagt agacaaagta
   311161 gaataccgcg gatccccgac gccgtggtgt cggatccggc cagaacctgc tcaaacgcct
   311221 ccatccatag ttcgttgccg attagcccat gtctgataaa cgaagccagc atatcgctcc
   311281 gcgcattggt cggactctgt agtcgcttcg ccaccatctg cccggtcgtg gccatcatct
   311341 tcccaaagcc cttcagatca tccgtggatg gcccgagaag cctcccgacc cactcaatct
   311401 gcatgatcca gtgtagacct gtgcccatca gaaagttcga cacccagagt ccttcttctc
   311461 cagatttgat gtagtcattg acatccttat cggccttgag catgccaaag ctgtttccta
   311521 ggccgaccgt gctgatcacg tccaatgtca agtattgtac tttcttcgcc aggtccattg
   311581 gcttcagaca gtcttccgtg gacaggtatc ggttgcgaat gagatctaga aagtccagca
   311641 cacgcaagtc gatgtccgat tctagcgaca gattttcttt tccggagtac tatagaggaa
   311701 tcagcggttg gaacaagcta ccttctgggg ggagacagac tcccattaac atctgctttc
   311761 gcctccggtc atgcctctcg ttattcgtct cactgaaaac atgatcttcg cctggcttga
   311821 accgagccgc atggtaatac cagtcggacc gtttatatgg agaccggacc gcgttgatat
   311881 gagcccataa ctctggcgat gaggtaatga gtgcatttgg gcctatccgg acaatggagc
   311941 ctacagaatc ctatcagacg ggaatgtcgg gcccacgtga tcatgatatt acgcaccgta
   312001 ctggtccgtc atttctttat accatctttc gcaccgcaaa ctgagcacgg ccttggtgtg
   312061 cagaaaatgg gagaaaccac agctaagtgg gcccttgaac ttccggagac gatagtacgc
   312121 ttggaacttt ttcaagaagt agaggatgaa aagactgccg acgatcaacc agcgggtctc
   312181 taagaccagc tcgactaacc ccatcttcga ccagaaagtg gaattggttg aattgacatc
   312241 aataccggta agagagaaag cattttgaat gtgcaagtgg gggacgatgg tcggctcatt
   312301 cttcatatac ggagtcctaa aggctagtca gggttggggt gggggaagtc cccgcttata
   312361 cgaattgatc aaccctctac gacgaacgac atcaatgcta gacgcacacg aggggaggac
   312421 tctacagtgc tcatagccta ttcaccgcat gctgctatgg agaaactttt ctgcagaagc
   312481 gattatcccc acttcccgcg tcatgatgat ccgttaactt catccacccg aactccattg
   312541 gcttcatcgt tttaattgcg cagtagtcgg gtatacttgc agctgcctag ctgactttgt
   312601 tcaacttcca caccagttgc ttatcactga ttgattctgt ctcggatgag gttagaatcg
   312661 gctttatccc tgtcatttat attggtaagt tgtggtcgag ttgctactga ggtggtaagg
   312721 ccggagggga gaaagaaaaa tccaaaaatc caaaaatgga aaataaaatg ataataaaat
   312781 acagggaact tcggagaacg agtggtaagt ttataattgg tctccaagtc cgcttgaata
   312841 gggtttgtct tcgagggaaa agctatcaaa tacacacctc ggctatgatg gagaccgggt
   312901 gttgccgtgc cggaggtatc acgaccgatg aataatcata tacataaatc tagcgaaaca
   312961 aatcctgctg agcatcgtgc acagaaacta aacctcccct atattgaccg ctttgcgact
   313021 gattcattac ctctagatat atcaccacgg tggcagtcat gcagtcgaat atcgaacctg
   313081 aggcacccaa ccacactcga tgccgattgt gtggcttttc aaatacccct tggaaaagct
   313141 cggactggag tgctaggatc tgtctcccgg catcaacaca tgcctaccgg aaggcttggt
   313201 attggtatat ctttctaaac catatttttg aataatagtt tcattctcaa aaagattgtc
   313261 cctggtggcg aaatacaaaa ggcatgaggt aattgatctt tcatcctttc caattgctgg
   313321 ttcagttcga gtgttctgtt ggggtcgaag gtgaatcctg aggctcttac taacacaagg
   313381 ctggcaaaag ccctgtaacc attgctattg gctttcaggt aaagggaatc ggacagcttg
   313441 ctcctatcta ctatgcactt gagcacattc gcacacccct ttctaagctt ttgtaaaggc
   313501 ttgttcgaag caacaagaac cgcaacagaa ggtccgcaag aatatgcggt ttatccgcca
   313561 agcgtaccgc acatttgcct tggtctcggg actcactttc atccatgctc gattctctgt
   313621 gccggcaggt gcctctttcg ccagtgtcct agtctccgtg atcatctgga gtctgtcacc
   313681 tcttgccgga gaaatagccc gtctcctcca gtacgacgaa gtgatctaca tggctagtgg
   313741 ttttgtttgg cttgcactga acttccgtgg gctggagcag accggggcgt cgttttcatg
   313801 gtggaaagcc atctgtggct tggccgggac gacctgtgct tttggtccag gggctgcctt
   313861 tgcgtttggc tgggaccgga gagaagggat tctggaccgg atgtcttcgt ataatcgtag
   313921 ccagtgaatt cgtccgaata tgcagcggaa aatgcatgga cctctattgg acgccctggt
   313981 gctgatgtca cccgaggtct ggtgacttat aaatgctcta aatacttccc tttcttttct
   314041 cctcacctgg tgtataactt aaagcttctc cagaagtgcg accgttggtc cttgccatcc
   314101 ttgtttatga tccaaccggc gatggatgta ttgcctccgc cagattaccc tcctgctcac
   314161 cccagcgagc atcctcacat tccaactcga atcccacgcg ccacccttga aatattgcaa
   314221 gctctctgta tccgtggtga tgtccagaaa ttccgggaga ttctggactc gcccctttct
   314281 tcgtcggggc gcattgacat atgtgacttc tgtgggacaa tgatcgaagt catcaaacga
   314341 aacgatgcgc gcatatgtcg aatcgaaggg aggtcatcga tgcataaatt cggaaccgtt
   314401 ccccccttcg gcagaaacct gccgcgtcac cgactaccca ggataatgat tcagagcatt
   314461 agggccaaga gaatcaccct ggggtaaaaa gcataggcgg cataatccac atcgagtaac
   314521 ggtggtcgga cgcgtatacg ttcttagaat gctacgtatt attctcgggg cccataagct
   314581 tgaccatgcc gagacttcga ccgtatatat ccgagaatgt ttgatctggt aacatctgca
   314641 tctatgccaa aaccatccaa acgtgcattc gttcctcact ctgtggctca tagaaggtct
   314701 tctttcaggt ctcgactgtg tccctttcaa cccaggggtc agtgccacgt catggaagtc
   314761 agtcatgaga attcgtcgta attgtggatt cccatagtag atttctatca cggaggtcgc
   314821 gatgcaccac ccagaggggg cagatccctt ccttggaccg ttgaagctgc ccacccagtt
   314881 tccttggaag cccaattcac ctatgctatc gttgctccgg gccgtgaatg gcctttgtcg
   314941 aatctcgtct gtgccgtgga tgaaataagc tacgaccatg ttgacggccc caaggaatcc
   315001 tggtacagca aattgtgatc ttttcaagag gtacaatgta ctccaactca ttaaagatgt
   315061 ccttccaact ccagccagtt ataccatctc cgatcgccgt atagccataa cgagcacaag
   315121 caatcttgcc tgggccccca tattgctcac aaacaccaaa tggtatggga caacgagcaa
   315181 ggcccttatc atgaaccaga caccattacc aactcgaagt cgccgcgaaa cttcaggtat
   315241 cttgtataat tctgaagtaa tatcgcgtac atggttttcc acagcgaatt tcatggcttc
   315301 ccaagtcttg ttcactggag cctcagagga ctgtttagta gatcagagag gccctcaatg
   315361 cgcgcgaccg tggggataat cgaagtggat tctccttcaa tattcataaa cccgtactgg
   315421 tccttttttt tccttgaggt ctccacagtg cagaggcatt gagccaacga gagtcttaac
   315481 cgagccggtg gattcttttt ctccggagcc tcggctgtcg tacgccatca gagcattaga
   315541 taacgtgggc aaatcccatg ttcttcaagt cccctgtcaa tcagttacat cgtttatggt
   315601 tcaagctttg cactcatcca gtgtcagata cacaccgaac gtgcaagcga agaagttcgt
   315661 agactcacca catctctcca atcaaaccgg accgttgcag tgagaatggg ctccaacgaa
   315721 gaatgcagtt ggcagcaacg ggtcgagcag aaacgacagc ggtgcgccaa caaaatccca
   315781 gccgaatggc gtatgccaga cgaagtaatc gcttccctgc acactcctct agcagaccac
   315841 agaaatgatt tgatccggaa tgacattatc cgcaaatctg gcatcatgac caagcacgag
   315901 ttgcagatca cagaagatta cacggttcga gaattgttgg cggcattggc gaacgggagt
   315961 ctaagctcgg tggaagttac tgtggcatac tgcaagcggg ctgccatcgc acagcaactc
   316021 gtatatccct catttcttgg tttctcatgt ctgaagcgct aaccattata ggtttcttgt
   316081 ctgacggaga caatgtttgc agaggccctt gagcgagccc aatatctcga ccaactccgc
   316141 tcccaaggac aagttgtcgg tccccttcat ggtctgcccg tgagtatcaa ggacagcttt
   316201 cactataaag ggacagaagc taccatcggc atggtttctt tccttgatga ggtgtctacc
   316261 gggaattcac cgctcgtgga tattctcttg aagctggggg cggtcatcta tgtgaagact
   316321 aatgtgcccc agacgatgat ggtgagattg cttaatccaa tgatcgtatc aatcgtatca
   316381 aagctgagac ctttaggcac ttgattcgca taataacgtc ttcggacgta ccttaaaccc
   316441 gtggaatact actctgactc ccgggggatc gagtggtggc gagggtgctt taattgcgct
   316501 acgaggatca cctctgggag taggcactga cgtgggcggt aggtccaatg catcgaatgt
   316561 gtcgctttct ttggctgaca gactttcagg ttccattcgc gtccctgccc tttgttgcgg
   316621 aacttatggc ttccgaccca gtgcgtccag agtccctaac gcaggcactc gcgcctgctc
   316681 aactagcgga atgcgattca ttctctcttg tgctgggcct ttgtccacgg accttgacgg
   316741 gctcgaagtt tttttcagct cggtgttcga tatccagccg agtctatacg actccacggt
   316801 cattgatgtg ccctggcgta atgtcacggt gaagccgaag ttgagaattg gtcttgttcc
   316861 ggagcatcca gtctttccat tgcatccccc aatcaaacgg atcctggcag aagccgtaca
   316921 gcgtctggaa gaacaaggtc atgagattat tcgcctcacc aacgaagagt gccgaatcag
   316981 ggaacttaat gaagtagctt tgggtatctt cgggctagac cagggcgctc ttagtcatgt
   317041 catctccgcc ggcgagcctg tggtgcccgc actacagcac attggcgctc agattgcaaa
   317101 ggtgaaacag ttccataaac catccctacc cgatatgagc tcgatggacc gtttagccaa
   317161 gttagccgct ctgaacactt gtcgcgcgga actcaaagag gaataccgag ggatgtggaa
   317221 acagcataat ttggatcttt gtcttgcgcc gccggcacaa aacacagcgg tcgcccatga
   317281 cgcctttggt cctgcgccat acaccatttt cttgaactgc cttgatgtat gccgtcttca
   317341 ctctgtttgg ggtttcccag ctgacatatc attagtaccc ggcatgtgtc attccattcg
   317401 ggcaagtcaa cgagttggat gctacagaca ccttccaggt tggcgaagat caaattgcac
   317461 cagaatgtgg gtatacgagc gattgattct ggcagcatga ctaacgtcta tagatgacta
   317521 taaatcggtc gaaggggccc cgtgcgggat tcagcttttc accaccacaa tgcgcgacga
   317581 ggagtgtcta cagatgtcaa agctaatcga tctgtgtctg agggggtaaa tcgaaagtag
   317641 aacaacgtgg cgatggctct atatgctcgg agtttacaag ataaagacgc caggataatt
   317701 aggtatccta ctactaccag cctatctcac ggggaattaa cactatttaa ttctatatga
   317761 ctctagtctt ggacttccaa tccttgtaag cttagtatat cccagtagta gcatgccatc
   317821 gtaactccct tcaagaaagt atggtgattc tctagcaata tatatttatg tccggtcctt
   317881 gctgatacat accgcgaagc ataatataaa gataacaacc aagatgcgca gtgattagag
   317941 acatttcaac attttcttta tctttgaacc atgggaacaa tatagaaacc atattgtgcc
   318001 agcctatgta ctcagtaatc cacaagtcgt agtggtagac acgtgccaag cccgaattcc
   318061 tcaactccaa caccatctcc aggttctcca ccgtctctga atctacattt ccacatctac
   318121 gccaacatgc gcccatctac ttgtgatcga tgccacgccg acaggtcccg ctgtcttgca
   318181 ggactaggag agatatgcta ccgctgctat cgtttgcatt acacatgtac ctactcccgg
   318241 cgacgccagc gcccagggcg aaagccacgc gttgcctcgg tcgcagcatc agcatcagca
   318301 tcaacacagg atcgcagtgg catatctccc acttcagaca cctgttttga cttctctgtt
   318361 caacccgcac atgagcttga gaatcaagag tcgctgtcaa caaatgcacc aaaaatcgag
   318421 cttctgcgtt tgctacgccg cgaaagttta gtgtcacgcg cgtgcgagta tacgtcggtc
   318481 gaggtctgca agttcttctt actcagagag tcgttaagtc gtgagatgag ccagatgatt
   318541 tgcgcccgca tcagggaggc tccaatgcta ctgcttgatc cttatgcggc tgtaacccgc
   318601 gtcctgcgct ctaccgcaaa ccggccagtc tgtagtgaca gtgactgatc aagctgtgca
   318661 tctgcattgt aggcgctgcg taatgcccaa attacgaacc ctgagcatgc ggggaacctt
   318721 ttatccttgg gattaagtct ggtgacattc catcgtctaa tctctgggtt ttcggcgagc
   318781 acgatttgcc gattcaccct ctcattgata cgcccgctct attattacga acagttacag
   318841 gagtcggaca tgagggaatt gctctgtctg gtcttcctcg acatcaccga gtctcttttt
   318901 cgagctagga ttcctatcat cgagtatcgt gtgcgggatc cgtacctcat aaaccaccat
   318961 gcgggcctgt gtggatcgct cctacccatt ctctatcgtg tttgccttct tggggccgcc
   319021 atcaggaaag gctcccaaca ccctttctct cacaattgct tcgatatact tcgtgaggag
   319081 attgtcgcat gggcccccag tgtgtcagct gcgatggctg ggcgcttttc ggaggaggag
   319141 atgctgctcc tccttacaca ggctaatctg catcgcaatg cggcccttct tatcttgcat
   319201 cggctgcgat tcccttttgg agaccacgat gatgatgccg agtttctttc tcaaacaatt
   319261 atcagggaga tgcaatattg tctagcgatg accaagcatt atcctcaaat atatcattgg
   319321 tcctgcccgt tgctggagct gaggtccagg actctgtggg ccgggaaaac atcctctcgt
   319381 cgctgcagag gtagcaatgg ctcaagcttc taccccttcg tggcaaatct ccggttattc
   319441 ctcactcgcg tctggaccag ccgggacgag gggactacac gatatctgtt cgacctattc
   319501 gacgaggatg ataacctaag tattcctctg tgattgccga gatagtgatg tatcaaaaac
   319561 gtatcggtat gtatggactc cccgaaaagg gtgtatctta ccaatgcacc ggctggttcc
   319621 gaccagctat tggtgtgtgc tagccgagcc gattgtaacg acacgtatcc ctgccttaaa
   319681 cttcaccccc gctctaccga gaaaaggaag attgatagcg ctgcgacaag cataaagctt
   319741 cgagtaagcc cgcatcccac ttccaggatg tgtacagttg tcgattttta tcttgctcac
   319801 aatgtccaat tcagatccca atgatgtgtt tcctccggga acaatcaagc ttgaagaacg
   319861 tatgttaccc ttgggtgtcg caagcactag gaggtgaaga gtcccacact cactatttca
   319921 gggcaaggcg ttgagtcgga attcaagctg agtcccactc cctctgatga tcccgacgac
   319981 cctttggtac ggaaacccac ttccccatgc ttctgcagct aacgaaaagt gtagaactgg
   320041 tcccctttaa ggaaggccgt taactttggg ctcacctgct cgtatgtcct cttcaccctt
   320101 gtgctggtgg acatcaatag cttggcctat cggggctaca tgtcagagct gggtttgacc
   320161 tacgcgacct tcaaccaggc gagtgggtcg aacttcgccg gactcgcgat cggatggctc
   320221 ttatttatcc cgtgcgttcc aaagttttgg ccgtcgccct atttacttgc tcagtgcgat
   320281 tgtgcagttg gcatgtgcta tctggtgggc aaactttcac aaggctggag aactcattgg
   320341 tgtcagtctg ctggctctgt cagcgaggcc gtggtgatga tcaccattgt ggacctcttc
   320401 tttgtccatc aacatgcgcg tatgaatggc atctttctgt ttatgcagag cctagggtcc
   320461 acggggggcc cgatcgcggc tggctatatc gtcgtctcaa tgggctggcg atggatgtgg
   320521 tggatgatcg ccatcttccc cggcgtcaac ttgatcctgg tcctgttctt ctttgtggag
   320581 ccaaaataca tcccccttgt agtcggccat tctgggcgct ccggtcttga tcaagaaagc
   320641 gcaatataat acgacgatga ccagaaggtt gcgacaccat cgactctccg agtagctact
   320701 cgttcgacgg tcgatgcccg tcacagtcgc aagaccgttc ggcaacgcct ggcattcgtc
   320761 accaagacgg atatgccaat cgtccagcac ttctatcagc cgctgctgat tctcttctca
   320821 ttccctgctg tagcctacac ggccatcaca tacggcacga ttctcgcctg gttttcggcc
   320881 aatacttcat ccagctctta cttcgtctta gatgatccct atgagttcag cgcctccgca
   320941 attggcctac tccaccttgg ggggtttctg ggcacattca tcgcgactct gaccgtccca
   321001 gcccagaatg actcgtttat tgtgcgagcg gctaagaaga acggaagagt cttcgagcca
   321061 gatatgcgtc tctggatgag cattccgggc gctcttctaa actgcgccgg tttgttcatt
   321121 tatggtattg gattgggaag agcaagatcc ttgtctcccc acatacatat ctccactgaa
   321181 gaagctaaca accggcatag ggcatgcact gggcgatgct cgcggtaggt caagggatat
   321241 atggattcgg atttattacc acagccgatg tggccctgac ctatcttcct gactgctacc
   321301 ccgacgtgag tacatcaaga agagatagtc aagggggctg taaagctcac acctgtctag
   321361 attcttggtg atgcgctgaa ttccattgtg ttcgtccgca atgggttcgc aatggtggtt
   321421 cgctttgcat tcaccccttg ggtcactggc atgggaatcc agaattcctt tattctgatc
   321481 agcatgctgg ctcttctccc cgtgaccctg cccattctct tgatgattta tggtaagagg
   321541 gcacgttcaa gcacggctga taagtactgg aaatatgccg cacgacagcc agttcacagg
   321601 aaggcgtgag tagagttgac aacggggctt gtggcgactc gtcctcgtag atcagtcata
   321661 gtattacgca aaggaaatcg aagaactcag tgaagatgaa gaagactcta atctactcta
   321721 gtatggggga atcacattag ttgctctgcg gcacctggtc attatagttg gtggtatatc
   321781 gcttgaatag acatctctgt aagatttgga aggccaaaag gcttctaagc aaatcgaaat
   321841 ggtgcgccaa gccgacattt cattttaggg ccgatcgctg gttgtggcgc agtacggacg
   321901 ttgtggaggc tgtaacgtgt tcgacaacga ggtgcacacc caacttggac acccgtctcc
   321961 gtcgctagac tcgttgactg aagtctgttc tctccgtact tactccggag tagtagtgag
   322021 tctgcctttc aaagagggtc ttgtgattcc gtcatgaacc gtggttttct gtccatttat
   322081 ggagataatt cattacggtt gggtaatcta gagaaggaac atacttccta gctcgatcat
   322141 tcttaaataa ggaatgtagg agcaaggagt tgtgatcatt caatattgtc aacatcaaac
   322201 gatagatagc ataaagagat aatcgtccgg acccaacacg gttatcgtac aaatacatat
   322261 cactgactac aaacaccaat tcccatagta atacagaagg cagatgctta ggcccaatta
   322321 agataaggaa agttgttatt tcaattataa cttgctatgt acttcatgaa ccccgaggca
   322381 aatcgatact atcctctatt accgctattt ttcatctcgt aaccatgcat ttcccgatca
   322441 taacagccgt ttatacaatg tggaatcttt gtgatatcta tttcacctcg gcatagacct
   322501 ctaacgcatc atgtaaccgc ccaaacagac cgtcatgcca actcgacacc tcctcccatt
   322561 cactttgtgg gagggtcgcg cgcatcatcc ggagccagcc accgacgatc aagtctgcat
   322621 agctcggcct tgtaccgagg agaaagggcc cactcgggtc ccttacgaag agcttggcca
   322681 gaccacccag catttcccgg aatgaatcca tcaccttctg tcgcgcctcg cccaccaacg
   322741 caaagtcctc ccaggacgtc atacccgcac gtcggacgaa ttctgcctta ctggtctcgg
   322801 ccgtggcggg atcgaagggg aaaccttgca gcgccagctg ggtatgtgcg gtaaaggcgg
   322861 cgtcgacgtt catattgaac ttggcgtatt cgggaaattc attgtcgcga cactccgaga
   322921 gcggtatcag gatcgtcgga tgcgtgaagg tgtagtcgag tgtctgaggg gggaaaaggt
   322981 caccggcgcc ggaggttgga tacgtcttct gtaggtagac tgcgatatcg aaggagtcgc
   323041 ccaccgacgc atccgtggcg gggtcctcga tgatcggcag ggtaaagaag tcggtgccat
   323101 cggcaaattt gcgacacgct ggtacttgga ggctgcggcg cacttttgcg atatcgggca
   323161 aagggaccca ggaggtcgag tagggaacgc ccttgaagtt gagtgccagt cgggctttcc
   323221 aggggtttgg ggcgcagcag gttttctccc ggggaggacg catggcgatg tcatagaaaa
   323281 cgatcgattt ggatgagttg gacaagctgg acaagctgga catggcgacg atgagagcac
   323341 tgtgatctga aggtgtgtct tctttatgcc gtgttaatga agaggaacaa ccgtggtatt
   323401 tataaaagaa ctcaaagaag taaatgaatg gaattgagtt tactcatgtg gggccaatcc
   323461 ccatgattca ctttgactca tgaccgctca tcctgactgg ccaaagctcc atcgcgtctc
   323521 cactaccgtc ctccggcagc atgcctcagg cttcgttcgg cttcctcagg cctttgcctc
   323581 ctcaggctgt ccgctgcctc aggctccatt ctttctatgc acatatgtgc cgacccagtc
   323641 aagcagttaa gtggacggtt cagaacgaga acctcacgct attacatttc tagagccggg
   323701 actaacaaac atttgcacac tcggacactc ggacggtgag gcggacggac aggattcttc
   323761 aagtagctca ttgcaaaaga gtacaaccgc catcctcaaa ctaggtagag caacacatca
   323821 ccccatctca tgtccacacc acacagatgc cgaaagattc ttacatatct aaatacatca
   323881 gctggattcc aggttgacta ctccaacatt cgatatatat tgcttcgcac aaagagtttt
   323941 gttcccggct gatagaacct ctgcctcacg gactccgtcc ttgcattctg ggtatttgga
   324001 tccagtgtac ccttcttttg ctcttgctac attgaccagg tatggccaac actgttgaat
   324061 agcttcccaa agcctaataa tcacccatta gccgacttta aaagtaaaat tcgcgtgggt
   324121 aacaggcctg gacatactct atagccttta tgggttactg agccagtaac ttgttcaaac
   324181 aactctcaaa tccactgtac gtgcgctcaa gccagacccg gaggttagcc ctgccctctt
   324241 cgtcagggat cgaggactct ccaatccatt tcatttctgt ctcatggcgg gaaatttgct
   324301 tcaaaaagaa ggtagcatag gaatcaacac cgggaagatc gtcgcggtcg acatggagac
   324361 gaacgctata ttttgagacg tcaacgctat cgagggtctc acggatcatg atgtttggat
   324421 tggcgccaaa agcgattgta cgcgtggaac cgataccgaa cccctcgaca gtcgtgagga
   324481 tacagtcggg catccataat ttgggagaac caaaagcaga aagaagagcc caaacctctc
   324541 cgataggggc atggactgtt ccagtatatt cgtatacctt gacgacggcc atggttgggc
   324601 agtaaagtga tgacaagctg ctggaatgtg agcatggggt cgtaagtctc ctgcattccc
   324661 agagtcatgt cgcgccagtc gcagttccaa ctgttggcaa cgaagcgctt cacgcccatt
   324721 cgttctgcag cgcggagcaa gagtagctga ccctccacca cgagctctgg gtggccctgg
   324781 taggcgcaaa cgacggcatc gacgccatgg caggctttct ctaggccggt gacgtccacg
   324841 gaggagctga cttcaacaaa gttctccagc ttttggcgga gctcgctggg tagcttggaa
   324901 ggattgcgac ctagtccgcg aacctgatgg cctctcgaga tgaagctgtc gatcatacgg
   324961 gaacccaaat ttcccgtgac accagcgatg aggacaagca tgattgtgag tgctagagga
   325021 gaggtttctt ttgacttgtg aattgaggta gtcgagagtc gagagtgtta cagtaacata
   325081 tgtgcacaag tttctacatg cggatgattt tatagcgctg tatcggacgg acattgcatt
   325141 cagagccggg gaaaattgtc gttggggagc cacaaaacac tgacccaacc gaattagagt
   325201 gtgtaaatgt ccttttacct tccaggcgtt tttccatcct cggttcttct ttaatctgac
   325261 tcttacagct atttgtcagc ggatccctct tcggcctgtc gacatttccg aacccgacag
   325321 ttgttccctc cgggttagtg tctaattacc aggtaaccgc agcatagaga tttgtataaa
   325381 gtgccttcga aagcaagtat gtttttgaat gtcctcgaaa tttccatatc gtgatctcgg
   325441 aagacaccaa agcaagacaa aactgtccac gattactgtt cacaatatga ctcctttgac
   325501 cggagttcga gcatcaaaca agcaactcac agctgctaca gtcccgcaag tcgccgtttt
   325561 cgtcggtgca acagcaggaa ttggcaaggc agccctgaca gagcttatct ctaccggctt
   325621 ccctgtgaag gcgtacataa tcggtcgcga tgaggcagcg ttcgagcctg ctctgagcga
   325681 gttgagggct tcatactcat ctgccatatt ggtatttctt cagggggaga tctctttgct
   325741 ggccgaagcc aagcgcctga cgaatattat ccttaggcgt gagggctata ttgacttgct
   325801 tttcctctcg gctggcttcc tccctttcct tggacggcag ggtacgtcag aaccaaccaa
   325861 aatcacaatt tctttgctcg tccatgttca gctcaaacag cttatccatc caaccaagat
   325921 tgtttggctg ctgataactt ttacaccaat tgcagaatct acagaaggcg ttgagctatc
   325981 cacagccgtg gcgtactaca gccgacagat tttcatccgc cgtctccttc ccctcctccg
   326041 ggccaaagcc aaaacgactc agtcccaaca tgatgcgtct ttccggccgc ggatcgtgaa
   326101 cgtactcgct gcgggtgctg aaacgagtac cgaaaaccta ttcctcgacg acctgcagct
   326161 caagcaggac ggccatttca gtgtccctag ctatgcgggg catgttgcta ccatgacctc
   326221 cgtcagcctc aggcggttat ccgaggaggc agaaaacaag aatatcgtgg tgatacacca
   326281 ccaccctggc ctggtgtata ctgagatctt caagaaaagc tggggcgatc aatgggacag
   326341 cagcagagaa catgctagac cccctgcccc ggatgatatt gagcgctcga ctcctgctga
   326401 agctggggag cgcgcgcttt acctgatgac gagtgctaag tatggtgggg tgggtgttcc
   326461 aatgggggag ggggaggctg ctgggctgac tgttcgcggg acgagggatg ggtctctcct
   326521 atgtgtgggc gataagctag agacattgag cagcgtttct cggattcttg actctcttga
   326581 agacagcggg gctgctgaga cgatctggag ttatactgac aaggtcattg ggggttactt
   326641 gtaacttgac tataaccagt gttggccgga ctcaagttgt attgggaatg tatgtacgga
   326701 gtctgcggtg taagtattgt atgtcttcgg accccggaga agaagcaagc tatcgggttg
   326761 gattatcaat cataaactgc tactgataga taaaatccag tatcatccag tactgcagct
   326821 gactagagca catcttgcaa tctaccccct tccatcatgg tgcggtactc ggatagcagg
   326881 agcatcccgg ttgggcgaga actccagctg ggcgggaacc ttgttcgtct ctccttgcgc
   326941 agctgatcaa ccctggccct atcgccacta cgcagcgcaa caatatccca gaccgcatgc
   327001 tcattcctca cccaggatct atccaggatg tccagtacct cactggggat accgtcaacc
   327061 aggctccccg cttctgactc tagaatcact tggagttctg agacggtagg gttggcatcc
   327121 tcagacgcaa actgctgtgc ggctgcgacc aacgcgcggc cagaaacctt cagacccttt
   327181 gcgtactgga ggaacgtttt gagaaggacc atgttgtcgg ccttcccaag tgcagcttcg
   327241 agcggtgtct gaagcctatt gccatcctcg ccgccttcat cctgccgaac atctctctcc
   327301 agcacccgag gcgcgttggg gtccgcgccc cgctccaaaa gcagccggac tacccttggg
   327361 cgcttccaat ccaaagcact gaataaagga gtactgtgat cactaccgtc cgagtcaaat
   327421 ctcgcacctc gatccaggag gagattaaca aggctggggt cgccaataca gcatgcaatg
   327481 tgaagggcct tgatgtgatt ggagagacac ccaagttcgg ggttggcgcc gctgtccaga
   327541 agacattgca ctattctttc catgtcaagg atagccagtc ggtcgcgcgt cctttgtcgt
   327601 gtatggtcgc cttgtagcat taataggaaa ctggagagcg cggccatgag tgccgtagtg
   327661 ctgttttgcc cattgtcctc gacaatgtgt tcgagctggt ttacatccgc cccacgatcg
   327721 ataaggagct ggaccacgcc cgagtgcatg ttgtacgctg catgttgaag tggcagttcg
   327781 ccgctagggt taactgcatt gacgtcgacg ccctggtcca ggcagcgcag tacagaacgc
   327841 tcggagccac agatagaggc gaggccgagg gtataaggac tagaagccac gtattccatt
   327901 ataaattcga atgcgtcgca attgtggtcg agtgctgcct ctgtcaaggc gtctctgacc
   327961 gcctgtttgc gttcgtcagt cgcttcctct gacaccgttt ccagcagctg ctcaagcatt
   328021 tccttccgag ctgtcgacca agggcctgtt gacaatacag cgaggggatt cgtgaccaca
   328081 tcggttgtcc ccatcgagat cgtcgctcct tgcgataaaa gctctttcac aatggcaggg
   328141 tgattatttc tgcaagcttc cgacaaggct gtcggggcca gctcgtctac atctgtttcc
   328201 cattcctcat caccgtctcg tgatgatgcc tctccgtctg ttggtgcaat tgaatgacca
   328261 ttgggatcag ctccgttatc aagaagtagt cgaacaatgt ctagatgccc agcgcctgca
   328321 gcagcagtga gtgggagacc cagaccgttg gtgctcttaa tgtccaggtt cggatttgca
   328381 ccttctccca gaagctgttc gacaaccttg gtatgcccgt tcagacatgc aatgtataaa
   328441 gctgtgcccc taccggcagg cgcgttgtca aaacgtgggt gagagacgag atcgtcgaca
   328501 cgtgctcctg ctgccagcag aagacgaaca tggttcgcct tcccatctgc ggcagctgat
   328561 actagtatgg tcgtttctgg cggcccggag tgtttgagaa agaaatccaa gatcctagta
   328621 tcgtcgaggg ccaccgcttc ttgataggca tccgcactgg ggctagcggg actgggccgc
   328681 gcaccgtgct caatcaaggt cttcacagcc attagttggc ggccgcggat agccataatt
   328741 agtggctctt ttgtccttgc gttgccaccg tctacatcag ctccatgttc gagaagggtg
   328801 ttcataactt gtcggtggcc atagtgcgca gccccggaca gcgcagttgc tggcgagaac
   328861 tcggagttac tgttgacatc cactccgtgg tctatcagga gcttgacaga ttcattatcc
   328921 cccgcggttg cagctaccac gaggaggttc ccaaacacgg cgttgctggc tagtctcagg
   328981 aaaccccgac cagaggtacc tgcgcgcata ccgctgccgg atttacgggc tcgctggcta
   329041 gaataccggc ctaggatcat cctgagcagc gcgcgcattc ccctgttcat gaacctgcga
   329101 gcctcctcca ttgacattgg attgtcgttg aaatccgccg acttgagtct ggggtgcaga
   329161 actttaagca tcttcggtgt cagcgatcca ttctctgtcc gtgggacgct agcccctgct
   329221 tgcagcaagt gtagtacaat gcggaaagaa ccccttttcg ctgccaggga gaccaggctg
   329281 tcgtcaccgg gaacctccac gccactctcg atgagccttt ggacaactcg ggcagtcgcc
   329341 agcctgacgg ccgtctcgat gggtgtttca cctgaatcgt tttcagcatt gggatcgcag
   329401 ccctgctcaa gcatcagaaa gacgatcctc tcctgttgct gcatcgcccc ctggcttcca
   329461 tcagtgattt cgccgtcgtc ccttatcgct gacaaagtcc aggtgtgttt tgcaaagccg
   329521 gccagtgcgg cttgtagtgc agtccattcc tcagtgtaaa tggacctgct acgatataat
   329581 cgcctgtctg gcgacggagc tgtctcctcg atcttcaagt ccattgttcc aattttgttg
   329641 tgtgttatct cggcattcgg attgacaagc ttgataggtc ctaacttgtc aaaggcaact
   329701 tcaatggcga gggcaccgtc ctcgcgccag tgtggtgaca cgacggtatc tttctcctga
   329761 ggtacgtcga catcggcccc ctcccgcaga cactcttgga caatgtcttc atggccgcga
   329821 tgcgcggcga tgaccatcgc acgagtgata gcccacgaga atttcgcaaa tttctctcgc
   329881 agatgacttg tctctagtaa cgtccttata atcgccacat ggccatgggc agcggcgccg
   329941 atgaaggcgc agtcaactac aggagtgcga gaaaagggaa accctcgtct agccagctct
   330001 tccagaattt cactcaggac ccagcgccgg ccgaagattg ctgctgtata cgacgcggta
   330061 cagaggtggc actgagtgaa gcgctccgaa gtaagcagtg gtttgatcgc gcggaaccca
   330121 cgcctgcagg ctgaggccaa ggctggcagg atggcgctcg tatcgcagcc gtgttcttcc
   330181 atttttgcag ctgcagttcg caccatttcc tcatttctag accagagcgc ggcatcgagc
   330241 aggtctttca gtatcgactc ggggcttcct ccgctttgct gatcgagaca ggcgtcgacc
   330301 aaggtcctgt gtgagccttg gcttgctcgc tcctgtaaca gccaactcca taaaacctta
   330361 gagcaagacg ggttccgctt cgccacagcg tattggattg cagaaagcac ggcttttaga
   330421 tggcttgctt ctggcttagc ttggcatcgg agtagaacaa ggaccgtatc agggtctcca
   330481 gaagacacag cagcttgaac agcagttccc caggtcttct catctaagga tgccccgccc
   330541 acctctggct gcaccagcaa ggagagatat tgcgcaatat gggcgtgacc gtgctcacag
   330601 gccagaataa gctgcttgtt caagtccaga aagtcctcct ggaagaaagc tgcttgctcg
   330661 tccagcaggg cgcgtaagga gttgagctgg cccgctgtca ccgcggctct gacggcttgt
   330721 attacatcgt actgagtcgt gtcaggtcgt agaatcagct gccgaatcat atcagcgtct
   330781 tctgcaacca cacttagctc gagagtacct attctggcct cactcttgaa gaggggcggg
   330841 tccggatggt cgtactcgcg gaagtccttc agatcggagg ggctcacatc gcagtcttcc
   330901 tcgtaagaat caaccgcatc ggggcctgtg agtagtgggc cacccagacc gtcgtcactg
   330961 tcgtccgtcc caatgccccg ttgctctccc acagccgtgc gcttcttctc ccagggacgc
   331021 tgtacacgat ccaagctccc tcgcataatg cctgggagat cggcaccagc tgcaaccctg
   331081 tagcccttct tcaacagtaa cgctgcgacc tcctcatggc cgccttcaat ggctgcatac
   331141 agtgcatcct gcgactttcc gcctttatac atgtccgcgc cccgctcaag caggaggtcc
   331201 acaacatccg aatgcccata gaatgcagca gcctgtaccg gcgttccgcg cggtgggcct
   331261 gtctggttta catccgcacc ttcgtcaagc aggagcctga caatctgcaa atgcccattc
   331321 tgagctgccg cttgcaacgc gtcgcctttg cttccggacg ctgcagggtc cgctccccaa
   331381 cttagtagaa gacggacagc gcgctcattc cccatgagac tagcgctgcg aagcgttgaa
   331441 ccgaatacgc cctctccatc aacgtttacg ccaagatcat gcagtgctaa tagcatatcc
   331501 gggtgatctg agagactgct gagagccatc gcgtccccta gaaggagatc ctgccagtgc
   331561 ggcttcatgc gcagcagtga gcgaaaaacg gagacctgac cgcgtttgat cgctgtatgt
   331621 agcagtcgct ctgcagttga gcccttttgg tccggggtag aagagggacc gatcacgctg
   331681 gaaaacgggc cggctgtcgc cggggacatg agccattcga ctagatcgcg gaacccggct
   331741 tcgacggcct cctggagcgc agtgcggtat tcgctctccg tccagattgg aagaaaggct
   331801 tttgcgagga ggagggccac tttttctcgc gcgcctcggc acgcggctct gaatgcgtcg
   331861 gagaacgcag ctgtcgtgcg cggcgctgtc ttgtgggcta gaagtgtttg aacgacttcc
   331921 gcgtggccac ggaaacaagc aacgttgaaa ggtgtcccga atgagccgca tttggtattc
   331981 atgtcggcat tatgggagag aagctttgag acaacatggt catggccgta cgaacaagca
   332041 agatagagac ccgtatggcc tgtatcactc cgcgcctcga tatcgagact ccaattcagc
   332101 gcaaagaccc ggtccagcaa gtctgagagc ccaaacacgc acgcgaggaa aagcggcgac
   332161 attcctgtac tcaggagcgg ctcgaacttg ctggatatct ggtggtaacg gggcaagtcc
   332221 ttgatagcag agcggatcca ctccatccag acaagaaatg ctggactgac cgtactttcg
   332281 tcgtcgtttg cgccgagcac aaaaaggacc gtgtcctgca tgagagtatc tttctcgtct
   332341 tcgttttcag agtctcgcac atgctccggc cagtatactg cagtgtagtg gtacagttcc
   332401 tgcacgggca gcgtactgct ggatagctgg gatgcatctg ggtctgatgc tgggcccgca
   332461 atgcactgct ggagacatat agtggcgata agccgatttg cgcgggccgc agaaaacaga
   332521 tcctgctgct gcataaactc tcgcgcggat gggtggcaaa agtcaagggt atcgaggcca
   332581 ggatcaacaa gaacaaggtt gtggcatatg tcaataatat caacccgccc cgaaagctgc
   332641 acatatcgat ctagctggag gatgccgtgc agcacctcca cgctgagtgg tcttcgagcg
   332701 aagaggagcc aagagaggac ttgctccgcg actcgtttgg ctgtgacgtc gagtgtgaga
   332761 atcgccgcca gcgtccggcc atagatctgg tcgagattgg ccgagaggct tgccaaggga
   332821 ccgaggatat cgtcttctgt cttcttgcgg cagaggaagt cgacttggag tttcacccat
   332881 agaaacctaa cacgacacgg aagaatgatg agcattatgc agagcaaacc tcccctatat
   332941 acatttccga ggaagggatt cgaacttaca tttctccaga gcccttgata agtgcccttg
   333001 acatctggtt taccaacgca ctcgatacgg tcccattgag gatacaacat ttctgcagcg
   333061 ctgtttgtag ctgatggtca acgtaggcgg caacatcccc gccgttaagg tcaggggtca
   333121 ctctgatctt agcggcatct tgaggcaaga ggttgtccag atgaacacta tcgcggctgg
   333181 taatgaatat cttgaccaca cttgcggaat cggatatcac gcggcgcaag ccctccagca
   333241 gggttgcgcg atcctgtgcc tgaagctcat cgaccgcatc gaccgctatg tatgccggat
   333301 tcaccatggt gaggtccagg atcaacgcga tgcattcctc aaacgaaagc gcgcggacgt
   333361 ctgtttttat agctttggct tcttgaagct cccgctcgta gacggagaga acgccctggt
   333421 cgattgctcc gtccttgggg ctgacggcga gttgccggac gatgctgcgc attacatttt
   333481 cgggcgaggc ccggtctggc tgggcgggag actctgcgca gtagaagtaa gcgcatggtg
   333541 ctgtgggtac agggatctgc tgcgatggtg gtgtgggcgg gcggaaatgg tcgacgcagg
   333601 cggagaagat tgtggatttg ccgcacccgg gcacgccatg caggacgagg agcgatgagg
   333661 aactagaggc ctcccactgc tggaatgccg ggtgtttcag tagccactgt cctgaaccgg
   333721 gaagccgctg ggcagagatt gctcggtggt gcagagcgac tggggtggat gatagccact
   333781 gaagtaggtc cgcgagcctt tgggtctcca gggacttgtg cctcgctgcc gtcagatcca
   333841 tcagtcgcgc agatcgcgcg ttcaggtctt gcagaacggt tgttgttcca gcggttagct
   333901 gctcgacttt tgcgtcgagg gcttgtagga cctttgtatc cgccagggat gccagcttaa
   333961 ggacttctgc ctctctggct tcaagtgcct ggatgtcctc actgctgacg gccaactgaa
   334021 gaacgccaga aaaaagacgg actagctcga ttagtgaatc aacgcaccaa cggattctag
   334081 aggcaactga atgaacatct taccgccagt agatttctta aagaacctga tgatctgtgc
   334141 taacagtacc aacgagcccg catatagccg taccagtgcc tcttcgatga cccccgaggc
   334201 atcacacggc cggcgcaaat acagttcctc aaggaccctg cagcgcgtcg caagacgggc
   334261 caccacctcc agagccagga ccatggaccc aaacacctgg gcgtcaccac agacgaccgt
   334321 aagcaggaat cgaaatgccg cccagggcaa ggcaacgtgc tccgggctat actgcgcggc
   334381 gatatcgccc actgccttga accggtcgat ccacccgaca accttttcca gcacgtcgcg
   334441 gagcacgacg gacctgccgc tcggcagcct gaacttccat tgcttgcgga cgcagagccg
   334501 ccgcttgtcc tcggcggcgc tgaggacggc gcccatgatg tcgagcttgc gggtggacac
   334561 ggacgagagg gcggctttgg agtcggcgtc gaggctggcg agggcttgct gccagtagtg
   334621 gtctgccgtg tgacggtgag aagctgctgc tgtcttcgtt cgccgggcag tgcgtgccat
   334681 tatgggattc tgttagactt gggttgtaac gtaggactct cggtatgttt aatttttctt
   334741 tttctttggt tgttgtgagt actaagatta ctcgctctct cttctttttt acgctccgcg
   334801 gcggaggtct tttccatttt atagccgctg ttgggggcaa agaaacgata gccttgtccg
   334861 gcacgagcct cctgggaacg tattgtttta tcccacttgg agcctggtag caacatccct
   334921 gtcgtattgg cgcccgagca acacgtctgc ctaaccgttc gccaaccagg ctcaggagcc
   334981 atgatggcca gacaaggcga cgcctctcca tcttatcgta ccgcaacaca acgactttcg
   335041 cattgaacac tcaaagagca gataagcggg gaaagtaatc gatatgggcc atgcagcatg
   335101 agagaaaagt acgtagattt gccagctaga gccttgtcaa tacaacacaa ccgctgtcaa
   335161 tcctacattt acaatacaac gctagcgacg atcgctccgc ttgggaggaa ctcaagacaa
   335221 ccctgcaaga aacgatttcc tccgtctgat tcggcgccgc acgtcagcgc caaacaagga
   335281 gtggatcaac cccaaaacaa agtctagaac cgtacgtaaa tgggggaaca cggccgcgct
   335341 atgccatgcc atatgttcca tcgatattgt gaattaggca aaccaagggg ggataggaaa
   335401 agtagattga tatcataagg cgtaggatta acgtgcgtaa ctggacgcct atatgaggct
   335461 gtagccatga aagccgtctg tgcgtgggtg actgcgaacc ttaggtctcg tgcgttggat
   335521 gatgaggatt tagtcttact tgttgttagc caggatagtt gagacaattc ctgatgcccg
   335581 attagatgga gtgggagtct gtagcagtta ctttgttgta ttgcgatgca ttcctgcaga
   335641 caaagaaatc tgacacttgt ttaacatatc tattctgcac ccgcctggct aacgacgcca
   335701 taacctcagt gaaccatcca gcatcaggct cctcattggt tataagagag gcagtcatgc
   335761 atggtagttc tggtcgtgaa ataggacaga aataaaaaaa aaaaaagaaa agtaaagtaa
   335821 attgaaagaa gaaaagaaga cattctaata ttaccagcaa tccagcatcc ttaacactgc
   335881 ttatgcctgc ttacagtcgc atctgtactc gtggccctgc ccttcttctt atccgcgctc
   335941 tcctctccct ccctgtaatg tctctctacc cagaactccg ccgactaatc tatccaggga
   336001 gaatcaacaa cgggctaatg atactcgctg tgttgctatt gtatcttgta tgcgagtgct
   336061 ccgagtgctc gcgccattct cagcggcagt cccctgctta ctcgcctagt ggctgtcgcg
   336121 ttcgccaagc ccgcgaggct tggtgtgcac agggcgctgg gggtgtttag tacacacagt
   336181 agtgttaggg gcttcgccga cgctgatgag taccctaagc ggtaggttct cgcggctgcc
   336241 gctgaagaca gacaagggcg aaagagcgga cgggaacatt cgggtggacg aaattgcgca
   336301 ggcgatgctt caacgaggag gtgaaggtga ggatcaaggc gttgtccgtg gcccgaccag
   336361 gtcctgatcc aatgtatacc ggatgtgcct attccaccca gtgtgatggt gagcttctat
   336421 ccaagttgtg aggctcacta ctgtgcgaac cttacacact tgccttgttc cggcctttta
   336481 ccacgacttt gtaagtaccg gctattgcat cctgtcttgc aaccccctgg ttcatatgcg
   336541 gacaattatt ctgtgtgtcc agaagcacaa ggcaacggag cgtcccccgc actagggtag
   336601 gtgaaagaac acagaactga cattaggccg tggtccaggc gctggtaacc cctgcccctc
   336661 aatgaactgt tcgccgggac tatcggtcat caagcagtca ctaatcggcc tgcaagaaat
   336721 catcaggaca tccatatgca tgcatatgca tgtttgcccg aatagccaca acacagcaat
   336781 tcgtacaggg taactccgcg gcttatggtc attcctggct agaaatgtat ggaggagact
   336841 gttgaaagtg gtgaggatat tttacaagaa accatttcgt taatcttgga ataattgtac
   336901 agttctattg tttaaaaaag aattggtggt tcataagata tcctcggaag gcttgtacga
   336961 acattttccc atggtttgga gagagcacaa ctgggattca aacattaagc cagcaacaga
   337021 tactcatcat ttgcttcagt ttcatctcgt ttttgcgaat gtcgctagtc ctgactgact
   337081 gatggcatct ttgatatgaa tagacctgag ctgcgcctca acgcttgtgt ccagctacac
   337141 tttcaccctg cagctatgtt tgccaccgtc cacctatcct cagtgtcacc cagtctctcc
   337201 tcatcattgc ttgtagactt tggcagtgga atgacatatt ttctgtggtg ttcatgttca
   337261 tgccgggtta gcacggtatt acagcttact aggaacagct actatgagta gaccgcccct
   337321 gggattaact aatagatttg ttaacataat aagtaccata cataagtgta ggcagatatg
   337381 cagtaaggcg gctaaatcct tttagtctga tctattatat tcgagtatgc atctatattc
   337441 ctaataattc attattagag gcttacttga ttactttcta ttctactaca agttactagc
   337501 ttttaaaaat agataataat ctattataaa tatagttagc ctctcttagt agaatttctt
   337561 ttaaattatt atagttataa agagagtaat tactatataa ttattagtct acacactatt
   337621 tttctttcta ctgttttaaa tagattataa tagacttttc gaaactaaat cttatataag
   337681 atatagctca gtatatattt cttatatata attagagtgg tacgggtaac ccgagaaacc
   337741 cgacccgaac ccgccccaac ctggctcccg gttcaagtcg ggttctagag ccaaaacccg
   337801 accctaaatc tagaaaaccc gccccgaccc gaaaaaggta atgtgatcta aaaatctaga
   337861 ttttctagat tttttttata tttctatata gatctagatt atatatatat atatatatat
   337921 aaaatatcaa ttcaatatat atagaaatag tagagctttt aaaatcacta tactaggcct
   337981 aattaggtaa agcgcctaat ctataagcga caccttacct aactaggttt agcctatggt
   338041 ttagcggggc cccaacgagt cgggttgatc tagattggcc cggaaccgga gccgggtcgg
   338101 gggcggtttc tagatctagg acccgaaccc ggcccgaata ccactctata tataattata
   338161 gattaatact atatatttag atatatatta tattataatt agggtcaaca ttagggtcaa
   338221 cattagggtc a
//