LOCUS       AP007162             1779707 bp    DNA     linear   PLN 16-DEC-2016
DEFINITION  Aspergillus oryzae RIB40 DNA, SC102.
ACCESSION   AP007162
VERSION     AP007162.1
DBLINK      BioProject:PRJNA20809
            BioSample:SAMD00067075
KEYWORDS    .
SOURCE      Aspergillus oryzae RIB40
  ORGANISM  Aspergillus oryzae RIB40
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Eurotiomycetes; Eurotiomycetidae; Eurotiales; Aspergillaceae;
            Aspergillus.
REFERENCE   1  (bases 1 to 1779707)
  AUTHORS   Sawano,T., Tanaka,T., Machida,M. and Yamada,O.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-JUN-2004) to the DDBJ/EMBL/GenBank databases.
            Contact:Toshihiko Sawano
            National Institute of Technology and Evaluation, Genome Analysis
            Center, Department Of Biotechnology; 2-49-10 Nishihara,
            Shibuya-ku, Tokyo 151-0066, Japan
REFERENCE   2
  AUTHORS   Machida,M., Asai,K., Sano,M., Tanaka,T., Kumagai,T., Terai,G.,
            Kusumoto,K., Arima,T., Akita,O., Kashiwagi,Y., Abe,K., Gomi,K.,
            Horiuchi,H., Kitamoto,K., Kobayashi,T., Takeuchi,M., Denning,D.W.,
            Galagan,J.E., Nierman,W.C., Yu,J., Archer,D.B., Bennett,J.W.,
            Bhatnagar,D., Cleveland,T.E., Fedorova,N.D., Gotoh,O.,
            Horikawa,H., Hosoyama,A., Ichinomiya,M., Igarashi,R., Iwashita,K.,
            Juvvadi,P.R., Kato,M., Kato,Y., Kin,T., Kokubun,A., Maeda,H.,
            Maeyama,N., Maruyama,J., Nagasaki,H., Nakajima,T., Oda,K.,
            Okada,K., Paulsen,I., Sakamoto,K., Sawano,T., Takahashi,M.,
            Takase,K., Terabayashi,Y., Wortman,J., Yamada,O., Yamagata,Y.,
            Anazawa,H., Hata,Y., Koide,Y., Komori,T., Koyama,Y., Minetoki,T.,
            Suharnan,S., Tanaka,A., Isono,K., Kuhara,S., Ogasawara,N. and
            Kikuchi,H.
  TITLE     Genome sequencing and analysis of Aspergillus oryzae
  JOURNAL   Nature 438, 1157-1161 (2005)
COMMENT     URL:http://www.bio.nite.go.jp/dogan/Top
FEATURES             Location/Qualifiers
     source          1..1779707
                     /db_xref="taxon:510516"
                     /mol_type="genomic DNA"
                     /note="SC102"
                     /note="phrap>=30:1-1779631"
                     /organism="Aspergillus oryzae RIB40"
                     /strain="RIB 40"
     CDS             complement(join(10122..10823,10857..10914,11027..11079))
                     /codon_start=1
                     /locus_tag="AO090102000002"
                     /note="2-keto-4-pentenoate hydratase"
                     /old_locus_tag="AO070290000096"
                     /protein_id="BAE61118.1"
                     /transl_table=1
                     /translation="MRLQSSRIFDIYTPNPLRHQLNPLPKHSPHLTPSGFENGDRLVG
                     YKLGNIAKVMQDAFGLDHPDYGFLLASTFVYEGTTLNLKQYIKPFVELEPAFILREPL
                     RGPNCTVADVINAVDYAIPAIEIIDSRVKNWAIDRLDTLADNGSTGSVILGGTPRRLT
                     DLTLRDTRGTLRFNDREVMSGNTANILGNPLSATAWLFNRLAAYDIEFKPGQVIFPGS
                     CLQAVQMEEAGHWTSRLRAGGPSNLTWYNFHKYLFFNKKWSWPARLGFRYIQ"
     exon            complement(10122..10823)
                     /number=1
     exon            complement(10857..10914)
                     /number=2
     exon            complement(11027..11079)
                     /number=3
     CDS             13026..14246
                     /codon_start=1
                     /locus_tag="AO090102000003"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000095"
                     /protein_id="BAE61119.1"
                     /transl_table=1
                     /translation="MCSSSTPETEQFKTPIELCLHDLDIIRRVTLPDLKVIRMISPLY
                     RPSIIPSDASASLQEYLDFSPKHLLQQLLDIGSMDSDIKALIWCPVAAHRRLMPEERI
                     IGFIKQLKEWKNTIGILFHKLGVDEALSEPINFDLATLANISIPPPPHANLPRDFCLI
                     LVLYVFYRTRLSWALSIYNGGESDLELETYHFTYQLLRFVTTALDSPRPSSDDLPFGC
                     EALRVGLSPILFLAGQSCPRPTWLRWILFELDRSGREGVCNSKAFATSLEVLSTLEKR
                     VRREPRRPDVEYFTPPHQRVISVIFPGLNGRGYVTYYAQIRPGEQIDSQESHIPLCIA
                     SWASSANGGRPVVTTCDGTDVPFSEWVMDRPLVKEWAQWLTFSEFDLTQTLHDHINGS
                     RLLVDRDKVAGSKW"
     exon            13026..14246
                     /number=1
     CDS             complement(join(14319..15675,15809..16248))
                     /codon_start=1
                     /locus_tag="AO090102000004"
                     /note="predicted flavin-nucleotide-binding protein
                     structurally related to pyridoxine 5'-phosphate oxidase"
                     /old_locus_tag="AO070290000094"
                     /protein_id="BAE61120.1"
                     /transl_table=1
                     /translation="MQRKLGYTNAVKDAWPTIRNIMPEQHRVFHTSKLPFIPITTVDE
                     DGRPWAAIVAGPTGEPGFVHSPDSQNLSIHAHLWDGDPLLDTVNAGVDPSSALSTIAQ
                     RSLAAGLGIEFSTRRRNKFAGTIQRVECQSSLDYKLHLRVTQTTGHWEPQGRLPEEVV
                     AFIRQADTVFVGSIYKSSPSDLHKFPPHVGMNARSGLPGFIRVSPSDGRTVVVPDYSG
                     NRFMSTLGNIETSGVVGLTIVSFTTGDILYLTGTAKNLVGPLALEIMTRHAAITTVNV
                     TGFVFVRDALPVRQQDGTPVERSPYSPKIKYLVEETGAKGLDSKEHKAKLREVVQVSS
                     DLAVFKFQVISKPGAGDLRIRPGQAIVLDFMNWIGPPQYQHMKDTAPSSINDDRVRTW
                     TVSSAHEERNATGFELIMREMKGGAVTGALFDRLRKYRSTRLGQRIVFDPPVVADIVG
                     VTGDFFMDNDKLDALWVAGGIGITPFLAMLRALAERGSAAEGDVMLVLATREPSVMLY
                     MMRPSLERIASTVRINITIFTHDSEFDYGNLKSNQNICVHRDRVVPDFWRDIPRGKDV
                     FICGPSAFGDSVADGLRAVGFSPSQIHREGFY"
     exon            complement(14319..15675)
                     /number=1
     exon            complement(15809..16248)
                     /number=2
     CDS             join(16665..17003,17054..17245,17297..17389)
                     /codon_start=1
                     /locus_tag="AO090102000005"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000093"
                     /protein_id="BAE61121.1"
                     /transl_table=1
                     /translation="MAAPMTVPVYHYFDLGRLGRGEVVKLFLMDAGIEIKEVRYPYDE
                     TWGENSKKLQQQGITRTRKLPVLEYQGLILSQHIPILRFFARDLGRYDGETNAEKFLV
                     DAVSDIYIDWRFQWVANLTERSEKYKNEVAPEYYNLLDQYYRDQAGPYLLGNSVTYVD
                     FAVYQSIDNDERTGTLPSSLPESLVKFREAFEQRPNIAAYLKATRLG"
     exon            16665..17003
                     /number=1
     exon            17054..17245
                     /number=2
     exon            17297..17389
                     /number=3
     CDS             join(19340..19364,19378..19499,19608..20052,20117..20238)
                     /codon_start=1
                     /locus_tag="AO090102000006"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000092"
                     /protein_id="BAE61122.1"
                     /transl_table=1
                     /translation="MSDGLTISPLSVASAILGTTTLFSLGMRTWRLFKPTWNCRPLKS
                     ESRWNFDFFHWNYLLGFVLVTITIVIGMVEDPPSVRMNSLPLSILLVQVGFTLVIAGI
                     LAKLGVRQPFKVSSLPAGEVFRPGILVIIEDVVAVDGARDKAYRAALLTRYAASVRFQ
                     RLIEALNWSWGLGGCLMGVLLIAVISTVRDQTFAFGLGWVIPWIWAGVWAVITTYWVK
                     SALREKKRSWPEGRWTNAV"
     exon            19340..19364
                     /number=1
     exon            19378..19499
                     /number=2
     exon            19608..20052
                     /number=3
     exon            20117..20238
                     /number=4
     CDS             complement(join(20733..21425,21508..22203,22264..22323))
                     /codon_start=1
                     /locus_tag="AO090102000007"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000091"
                     /protein_id="BAE61123.1"
                     /transl_table=1
                     /translation="MVGIPGRSKGCKTCRRRKIGCDLQEPQCGQCKKSGRHCEGFDKD
                     IAFIHRTPQGLLRKGQEQCQGPAPWETSCGANSTSTKQIPPQINNAAIYVDGMLHTFL
                     VAFLPSSPILPLSHHSNITVPPAPWMRIAIALPRRGPLLSTALQALCMTKIARAHGDQ
                     ALLMQGMAAHTQALRALQNAINDRNTALTDETLAAIRVLGTYELHEGTMGSVVGWTSH
                     EEGVDQLVQLRGFNSSQYESELGQALFGEVRRSAMIRGLQFFKGSFFSETRWCIEPWG
                     TKPKDYVQQLYDIGLLLPPILEELHTIQSLPNAPRRAQIWQRCQHLEDRFSAWHARLL
                     TLFPTPPYWEEPAELMDRSSDIRPGPFEASFDFLNIHVADSLDFFWALRILLHTVLRR
                     LSGAPEQSDAIIGACACNIARSVPYFTQPKCGFLGVQWLIFPLKTAFSAFRQMGWEIE
                     WEWSRGVLVAMKNRGISYGGDIVDAQWGERVR"
     exon            complement(20733..21425)
                     /number=1
     exon            complement(21508..22203)
                     /number=2
     exon            complement(22264..22323)
                     /number=3
     CDS             23339..24016
                     /codon_start=1
                     /locus_tag="AO090102000008"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000090"
                     /protein_id="BAE61124.1"
                     /transl_table=1
                     /translation="MTRLPLPVPAPIDPSYQPTASIEKVPSTTPIEYILAILERDGGV
                     ILTDLVSKDELSAIEQDLKPWNQKHRRHLNPTVDGDAFTTIPPQTTLIPGLVGKSKTI
                     AQICEHPVLEQLRQQILRDDFVLYREGNAEPNTLDPLLSLSVSMNIGYGAPRQLLHRD
                     DNVHNIRHTRNPFVPWSFKQASQFGCLIAGCEVTRENGGTMFVPGSHKWDDDRWARAD
                     EVCFAGM"
     exon            23339..24016
                     /number=1
     CDS             complement(25728..26168)
                     /codon_start=1
                     /locus_tag="AO090102000009"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000089"
                     /protein_id="BAE61125.1"
                     /transl_table=1
                     /translation="MVSIAALHQAQRELSNSRLIGNEQFLGELDTVEGARNSPRFYEY
                     LYHKQQALYLLRTRYHEAPYQDSYGVIASVFLFIWLACLESGRNTWAYHLNGLKEIMQ
                     AQILSMDLAQSTSLTAAFSRFYEYFDTSYAMLVQTIFPFQPVYA"
     exon            complement(25728..26168)
                     /number=1
     CDS             complement(join(27157..27584,27647..27759,27836..28269))
                     /codon_start=1
                     /locus_tag="AO090102000010"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000088"
                     /protein_id="BAE61126.1"
                     /transl_table=1
                     /translation="MHGSLLKLALLSFSLGSSAAVLPRDTGRTSAPSGCSTVGTSGDY
                     STIGDALTALGSSTADACIYIAAGTYEEQLVINYAGHLTLYGETTDTQTYKQNTVTIT
                     HTISSPEAGSLDNSATVNIKSDLVSVYNINIANGYGSGAQAVALVANADQLGFYACQF
                     TGYQDTLYAKAGHQYYINSRIEGAVDYIFGDASAWFENCDIVSNGAGYITAMSRETTS
                     DTAWYAIDHCNIKAASGVDLTGDVYLGRPWRVLARVIYQYSVLPDIINAKGWHSMADG
                     ATPLYYEFNNTGAGSDTSDREYLSTIDAPVTKETVLGDDYKNWVDLSY"
     exon            complement(27157..27584)
                     /number=1
     exon            complement(27647..27759)
                     /number=2
     exon            complement(27836..28269)
                     /number=3
     CDS             join(28893..29305,29360..30167)
                     /codon_start=1
                     /locus_tag="AO090102000011"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000087"
                     /protein_id="BAE61127.1"
                     /transl_table=1
                     /translation="MISLNSIFLLSLVGLSRAAPSRSETSPDRTIKPRAACTPTAGGS
                     SSTDDVPAIQEAITSCGDGGIIIIPADTTYYLNSVLDFKGCSNCDFQVEGLLQFTSST
                     DYWNGKTAMITVSDIDGLKLRSVTGSGVIDGNGQESWDKFAEDSSYKRPTLLYITGGS
                     NIEVSGLRQKNPPNVFISVKGDTSNAQFTSLTMDATSNSDNLPKNTDAFDIGASTYVT
                     ISSVAITNDDDCVAFKPGANYVTVENVSCTGSHGISVGSLGKSSDDTVQNVYARNITM
                     INSSKAAGIKTYPSGGDHGLSTVKNATFEDFIVDGCDYAFQIQSCYGEDDTYCEENPG
                     DAVLEGIVVKGFTGTTSDKEDPVVANLNCGSKGTCDVTISGFEVKAPSGDAKILCGNT
                     PSDLGVTCSSGASG"
     exon            28893..29305
                     /number=1
     exon            29360..30167
                     /number=2
     CDS             join(30292..30317,30462..30488,30572..30649,30780..30989,
                     31137..31335)
                     /codon_start=1
                     /locus_tag="AO090102000012"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000086"
                     /protein_id="BAE61128.1"
                     /transl_table=1
                     /translation="MLLMNSPGLPLNLPMKFSSPLTVKLQTLQNQFDLGICRFEYMLG
                     HNRWVHPECFSHSLQGCFVCVFYRTIINHTTSRESFRKSIIDVIPGYTSRSSKEKPVL
                     IISDIATEQDLPLLRRFHDCNVLNRSAVAEPLSLSIYYAGSKYVTSHSVLLCGVNNCD
                     IRSKTLFSRLATVSLYAPN"
     exon            30292..30317
                     /number=1
     exon            30462..30488
                     /number=2
     exon            30572..30649
                     /number=3
     exon            30780..30989
                     /number=4
     exon            31137..31335
                     /number=5
     CDS             join(32600..32939,33010..33145,33202..33748,33799..34295,
                     34351..34408)
                     /codon_start=1
                     /locus_tag="AO090102000013"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000085"
                     /protein_id="BAE61129.1"
                     /transl_table=1
                     /translation="MKVSLWLTLLGVNLSLALAVGTDFPASCQAFSPDTRAANAHREF
                     TEYVPAGTNLSLPYNDATCARPNQVVTVDLCRVALYVETSNRSSVTTEIWLPRNWTGR
                     FLGTGNGGIDGCIKYEDLAYGAANGFAVVGSNNGHNGTTAASFYQNSDVLADFAWRAL
                     HLSTVIGKEITQAFYGEPHRKSYYLGCSLGGRQGINSAVEFPDDFDGIIAGSPAVDFN
                     SLVSWRASFFPITGSANSTDFISVSTWKDLIHAEVLTQCDTLDCVNDGIIEDPSLCNF
                     CPEALKCTDDRINNCLSPAQVEIVRKVFSPMYGEDGQLIFPAMQPGSELEAADQLYTG
                     KPFRYSKEWFQYVVYNPSWDPAEFDIHDAKVADDLNPQNIRTWPNDLSNYEKRGGKII
                     TFHGQQDGKITSFNTERFYNHLATAMNMSSSELDNFFRFFRISGMSHCSSGPGAWAFG
                     QGGSPAPAMTPFNGNENILAALVAWVEHGVAPETITGTKYVDDNPELGISFRRSHCRY
                     PLRNTYIGGNHWECTLP"
     exon            32600..32939
                     /number=1
     exon            33010..33145
                     /number=2
     exon            33202..33748
                     /number=3
     exon            33799..34295
                     /number=4
     exon            34351..34408
                     /number=5
     CDS             34750..36423
                     /codon_start=1
                     /locus_tag="AO090102000014"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000084"
                     /protein_id="BAE61130.1"
                     /transl_table=1
                     /translation="MHGTRRLRRGSRHRQPSPKRQRTETPDASTSASIAQPAAELSEA
                     KPAQPNAPVDSPGESKKQPTPETNQRGGDEKTPNERHHVNHEQHRSIGGRTAVFQNQH
                     QSANIKCPGYPLFWFLPERFAAYAYRSTDILSFTESPPEIPTYKEPRLGTVPVGMVLN
                     IPDHVDESAGIRARVAFDVAVLHVSLEPPFWTIASRTGRLLNSTDYCLNPSFATEKLR
                     LIKVREMIQTHIIELTTYRHRFLLVLRSWRKERRLWEVRLAISQVRRGNNAIFQHPLT
                     HEDLDRLCLWYREQQAADDRGEIDPSSFGRVTGMVNPCAKELQPNSQGGFVNDSIVTR
                     FEKLKEATRGVLARISTLQAQEHEERRRQREQHAKREQGAPDRGHNGICLPGDALLVD
                     FEFDTEDPFPSASVIDPLPTDLEHRAAHYHWHVERHGVWAPKGLFKRATYLNTFQLAG
                     PDDLSFFDKPRAEWPRGHQGLLFEHVDYVDDFQVHPWGIPATRFAQALRQQPRYTAAA
                     IYSKKARMVLKSIEHWYFTNKEVAFGGIQDWPLPCGVRDGLLEVIQELQ"
     exon            34750..36423
                     /number=1
     CDS             complement(join(36973..37522,37577..38901))
                     /codon_start=1
                     /locus_tag="AO090102000015"
                     /note="deoxyribodipyrimidine photolyase"
                     /old_locus_tag="AO070290000083"
                     /protein_id="BAE61131.1"
                     /transl_table=1
                     /translation="MKGALSVIGLSRVAFLYSFPLSSRARSTLTPTIIRNMPQKRKPS
                     QNGTRENGTNSTSDTNKRGKSDLSSPHPNSRQAEEFGIVLRQFYPPEMSNERCQAYND
                     GTLERPMETLNRVCEETVDARLSIRPNAAVVHWFKSDLRLHDNRALRKAYEVAREHSI
                     PLIALYILSPEDLTAHLSSPARVDLTLRTLEQLKLDLGELDIPLHMETQESRRDIPQR
                     IIHLCQEWGANHLFANIEYEVDELRREAKLVRLCVENGIAFDVLHDTCVVPPGLLSSQ
                     QGKQYAVYSPWFRSWQMFLMDNPEHLEVSEEPGSNPGNARKVFKDLFASEVPGAPNNK
                     RLSDEEREHFRQLYPAGEHEGLDRLESFLEEKATAYDDMRNSLSKQTTSVLSPYFASG
                     SLSARTAVAKAKKANKNQLDRNELGFVSWISEVAWRDFYKHVLVRWPFICMNKCFKPE
                     FTDLEWEYNMDYFNAWCEGRTGFPIVDAAMRQMKSSAWMHNRSRMIVASFLSKDLLID
                     WRRGERYFMEHLIDGDFASNHGGWGFGSSTGVDPQPYFRIFSPLRQSERFDPDGDYIR
                     RWVPELREIEGSAIHDPYDRGAGDLAEKNGYPRPIVDHATRRALALDRYKKAAGGKSR
                     "
     exon            complement(36973..37522)
                     /number=1
     exon            complement(37577..38901)
                     /number=2
     CDS             39685..40848
                     /codon_start=1
                     /locus_tag="AO090102000016"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000082"
                     /protein_id="BAE61132.1"
                     /transl_table=1
                     /translation="MSLDKLPNEILCLLPFYIDNIETFTNAASSCRRLRDCLYTALPN
                     TILRLAAASAPTFFSPHPHFLVAATARQVSDWALGDETRTLALREAFQGGIDSLYEFC
                     LQHAGLTLEDIRRTHLARFSIINPLSDKIDKMAGRQWFATPNFWNGGVSEPYTIYTEA
                     DRATFQMIIYGELFGRSMDAFLQPEKNLPYFDIRTRIDYFTYCLPDWVCSSYPGFARL
                     ATGPYAPHLERPSEGDQVALHHILHCGRWRRMWAAAIRSVLGGDDAFTDEDEEDEHWR
                     KRMLRNALQSQGLEGMQLVTLPVDKIDNEYVQKVRKMKQQIDQLNEPPRVEMLGKGAL
                     TPVSFAPDPPHDVEIPCRNMWGPWTFNPDAASDTDSEEESDPDWELNFEVIEQ"
     exon            39685..40848
                     /number=1
     CDS             join(41684..41715,41794..42640)
                     /codon_start=1
                     /locus_tag="AO090102000017"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000081"
                     /protein_id="BAE61133.1"
                     /transl_table=1
                     /translation="MFASRTSSRSICFPLGAAKTISDISSSQPKVIEMPSRTTSSLLE
                     SRWAPRPEETKRSSSTPRGQNHTRGPNHPPPSQELARFMKIVGRLKWKLPFLAEGYRL
                     ATLPADSGVDVAHAEIMFKIDFFEYYALLERAIVHLLGVFGVTVTGAITRSQSTPRLG
                     RNRSIAAMHRYHANVLDTLERESCPLHSVLGTGNVREQLRKAKELRNRWKTADMSKEE
                     AEKDSFHRPEESAMPLESYDFDHILSEIFVGLEDGLALAREQVARVENGTGNALSGDS
                     EADWDFIVDAMDWEAV"
     exon            41684..41715
                     /number=1
     exon            41794..42640
                     /number=2
     CDS             complement(join(42869..43194,43252..43319,43382..43764,
                     43827..43894,43944..43980,44031..44215,44268..44388))
                     /codon_start=1
                     /locus_tag="AO090102000018"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000080"
                     /protein_id="BAE61134.1"
                     /transl_table=1
                     /translation="MQQLFPSSEWNSTAYLCADDSRQTALVDCVTSNGTTKEEFITQR
                     LTEESCNIKPRQGPPLIEGSTLAPLILATFFFTIRISAKSFNLGGGWGWDDLTIIISY
                     IMGVAMFVLNIYMIKYGFGKNIWDIPFDDITQFYKYFQGFAVMYKIQISLAKISVCLF
                     LLRIFQSRMFRTLAYTLIGINASIGITWALVDGLRCSPVHLAWDGWANEDPGTCIDFI
                     DAILGNCLVNIIVDAIMVLMPVYEVSKLQLPLYKKLTVGLMFVMGSVLTIIGIIRVVV
                     FWNNRWGQNQTAGIYPLIHWSVIESQVAIICACLPSSRALLNHFFPGIFSGSTKRTYA
                     TGPSNWYAKGQSNGQSKINKSVSYTVQYSSSSQRDDSNDLNDSNDSNSVVQLVDIDRK
                     PNY"
     exon            complement(42869..43194)
                     /number=1
     exon            complement(43252..43319)
                     /number=2
     exon            complement(43382..43764)
                     /number=3
     exon            complement(43827..43894)
                     /number=4
     exon            complement(43944..43980)
                     /number=5
     exon            complement(44031..44215)
                     /number=6
     exon            complement(44268..44388)
                     /number=7
     CDS             join(49284..49436,49499..49910,49971..50120,50171..50304)
                     /codon_start=1
                     /locus_tag="AO090102000020"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000078"
                     /protein_id="BAE61135.1"
                     /transl_table=1
                     /translation="MKAVLSLTALQLLASYVTGLPLQDSSLAKNIKRQNTSSWNPPSE
                     LVTPLNEVWEHEMSTYSDPLGFRNYGFDQVIDGKGKINYCVRWDSTQSVTQAQREQVE
                     TAVRRSFNKWIGELAGFDGFPYETVDVNVVGWAVKDKGLLQGDTSGIEVYTTTDEEGI
                     PQCDPGCGRFFHQDNDYSACAAGADRHYDQSLWLTDGFEGGAGGDWGQRIGQEYFMQN
                     LDLEDIHILLHEMGHTFALDDFYDWTPTGQTSFIMLAGSAMKITEFDAWMARDWWRHL
                     KSRYSL"
     exon            49284..49436
                     /number=1
     exon            49499..49910
                     /number=2
     exon            49971..50120
                     /number=3
     exon            50171..50304
                     /number=4
     CDS             complement(join(50743..50884,50953..51392))
                     /codon_start=1
                     /locus_tag="AO090102000021"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000077"
                     /protein_id="BAE61136.1"
                     /transl_table=1
                     /translation="MNLPQVVPFVLLSTTFVFAVVELGLTGHLVSYFSQGSKEYRYDP
                     SRNGYTSQTVTVAVPPILAFILFNSVWTMLVSAATAVIPWVFRTKADTNAALNKLITI
                     GLLVLYFVTTVFWLASFADMAARLSYTAGKSDYVNAVIAFAVLIWFLFCALTLVVVLG
                     ICGVLKSDLPGYRALGKQDPPATAPQSTQMDQV"
     exon            complement(50743..50884)
                     /number=1
     exon            complement(50953..51392)
                     /number=2
     CDS             complement(join(51905..52266,52322..52505,52589..53016,
                     53081..53222,53287..53556,53625..53906))
                     /codon_start=1
                     /locus_tag="AO090102000022"
                     /note="amidases"
                     /old_locus_tag="AO070290000076"
                     /protein_id="BAE61137.1"
                     /transl_table=1
                     /translation="METPKEKPSWQEIAQGVQKTRDDSIAHVDPPIPSLPTALPNRVI
                     DIPRQLLSSSEVSITETSAEDLVVSLAAGELTATAVARAFLRRAAIAQKLTNCIYELL
                     PERALAQAERLDNYLVEHGTPAGPLHGLPISVKAHVGIAGRDNTAGFVGWVGRKNTDD
                     AKIVKILVDAGAVVYARTTEPQGLMALETCSNITGNTVNPHNTALSAGGSSGGESALQ
                     ALYGSPLGIGSDIGGSIRSPASNCGLYGLKPTNGRVPLIGCAAYVIGCETILGTLGPL
                     SPTLGGIKLFMKTILAAKPWTTDPSLHQIPWRDNESHIYRDGKKKLTVGVLWDDGVVK
                     PAPPVARALQEMMDRLKAFPSDVEVIEWKPYKQKEALEILTRLYAPDGGKAFAENLAL
                     SGEPYLPLLAWTLRDTPGVEELSLHEVWEWTLKREMFRYSYLQEWNTVAPKMDVILCP
                     AYPTPAPLLDTSRYWGYTSIWNLLDYPAIVFPVTKVDPTRDAKDPTYTPRNEFDSWCH
                     NHYDTQKQQEAPVCLQLVAKRFEDEKVVQALEVIKEKIGLPFVDCLA"
     exon            complement(51905..52266)
                     /number=1
     exon            complement(52322..52505)
                     /number=2
     exon            complement(52589..53016)
                     /number=3
     exon            complement(53081..53222)
                     /number=4
     exon            complement(53287..53556)
                     /number=5
     exon            complement(53625..53906)
                     /number=6
     CDS             join(54616..54789,54806..54875,54937..55403)
                     /codon_start=1
                     /locus_tag="AO090102000024"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000074"
                     /protein_id="BAE61138.1"
                     /transl_table=1
                     /translation="MKMQAGTASGHEDRGLSLWVVNSIFIGLATLAVIARFVARKLKN
                     LVLAADDWAILIALALLLTLTDASKLLDWVLYGLFIACRGYGLGRHREVVPEADIAVF
                     LQLLYYFQIFYILAPPTVKLSLLLLYRRIFLSSRFLKIVYTIGAIVSIWAIIMTFLAI
                     FNCKPISAFWTGQGECIPFKQFAIGYAIVNIITDLAVWLMPIPNMWKLQLPTAQKVAL
                     TLIFVLGLMYGPLGPLGG"
     exon            54616..54789
                     /number=1
     exon            54806..54875
                     /number=2
     exon            54937..55403
                     /number=3
     CDS             55477..55878
                     /codon_start=1
                     /locus_tag="AO090102000025"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000073"
                     /protein_id="BAE61139.1"
                     /transl_table=1
                     /translation="MLVLGNWDVTFDYARGFMWSIIEVSLAIVCTCLPTMRVILKIIF
                     SRSFARALGFSSLTPRRQSSSKRGWRRASQYNEIQGPWTVRPGAENQHHSDVTTGVER
                     GDGATTVRGIRVLEEVKVELQHIKAPPDAAP"
     exon            55477..55878
                     /number=1
     CDS             join(56814..57031,57101..57338,57396..58307)
                     /codon_start=1
                     /locus_tag="AO090102000026"
                     /note="monocarboxylate transporter"
                     /old_locus_tag="AO070290000072"
                     /protein_id="BAE61140.1"
                     /transl_table=1
                     /translation="MSEMGMQEKFSGQPSRNDDHAQHADEPQAQPEHPGTGDTCARQG
                     AEQEKPPPNGGLQSWLNVAAAFCVFVNTWGLITTFGAFQEYYRTVLLRNESSSAISWI
                     GSIQATLIPMVGMVTGPLVDAGYLRILILSGSFLIVFGMMMTSLATEYYQVLLAQAFC
                     TGLGGGISYIPAMVVLSSSFTTKRAVAIGCASIGSSVGSVIFPIMFRRLQPAIGFPWA
                     VRCIAFINLLMSIIACSILCRHPGKKTQARSLVEWKALKHPTFMLLSVSLTCVMLAYY
                     VPIFYVATYARVKLNTETNLSFYLVSIINGASAFGRTVPYLLGSRINTIFVLISCTAA
                     SAVAMYTWIATSNTAGFIVWACYWGFLSGVLVTAPTSIVAHPVFTPDKNYLGTRMGMM
                     WGISSFGALAGAPIAGALVDLEHKNFVRAQVFSGSLMVGAVLLQVWPTIAALRYDRNK
                     DREAK"
     exon            56814..57031
                     /number=1
     exon            57101..57338
                     /number=2
     exon            57396..58307
                     /number=3
     CDS             complement(59521..61101)
                     /codon_start=1
                     /locus_tag="AO090102000027"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000071"
                     /protein_id="BAE61141.1"
                     /transl_table=1
                     /translation="MEASRVEWPTLRMADPNAPGNVTRNLQQRIRDHHQDSNDILQYA
                     QDNQGSLPDEAVKVIERWRDLTQDLLDWMGAKQELRDITGDIKCDDYALTTETEPPRL
                     EKYVQARKTAPPPAYYQSSYSSGSSPPASPSNLAQDREIAVKMWDPYVASQYRCLTPA
                     DITSQAEKARKSTARRDGGATLASIQFVAAKHLRSGDLSLTLRSAQEADIARTHRRWV
                     KIFESDSVIDLPLWGVVVHDMPLKWVGGLSTPAARQRVINDLLAANIFTWGGDVDVLH
                     VRWLSSPAPGTESSAMVVEFTHPEAANCAIRHGTIWESKLLKTVLYVRPPCIRRCFSC
                     QQFGHLSSICLNESICCFCAERHDTRDCPRRTEAGDRVHKCANCGGPHAAASKNCSYY
                     AEQIKKVQDGTTYRQRYYRIPIYMQGLENSEDGASSSVTSRSCSDSAEHDSASSESER
                     DLGEIPSEERPLSSLEGASRDARSVRRATSQSHKQRGLDQRGPRKLPAVISLQMARQA
                     PPLAWLRLTQASLELSLY"
     exon            complement(59521..61101)
                     /number=1
     CDS             complement(join(61712..61855,61916..62854,62938..63615,
                     63693..63748,63812..64077,64147..64412,64485..65541,
                     65603..65849,65918..66170,67326..67598))
                     /codon_start=1
                     /locus_tag="AO090102000028"
                     /note="pleiotropic drug resistance proteins (PDR1-15),
                     ABC superfamily"
                     /old_locus_tag="AO070290000070"
                     /protein_id="BAE61142.1"
                     /transl_table=1
                     /translation="MVFELTGILGKWLKPIQGHTSEDDARREGVGGHPGVLRCNKLSK
                     LGDTELTDKVTAQSRRRQGDRAHEVHHGGLKIRGLIRNQAQVCRRHQLANPATWFSRK
                     PPPCRAILQRLTGTIRQGEMLMVVGRPGSGCTTVLKALANIREEYLAMEGDVWYGSMD
                     AGTAKQARANQVAFVGEDDIHFPTLSVSTTLKFALNTRRSTSDPDRAQHLQQDLQTVL
                     ELMGLAQAAHVRIGSDHIRGVSGGQRRRVSLAEALCTRASLFCFDNPTRGLDSSTAIR
                     FLTTMRKYTTRSQCMTAMSLYQASDLAVAMFDKVLVLNDGHVAYYGPATSAKAYFESL
                     GFYRSPKISVSDFLASMSGTPECRTPREALDRPVPIHPADFETRFRESSLYQQTVSDA
                     ATPPQSKTVGKPKASGYALPLYRQVYECTVRHYQIFLTDRAAWIAEAAGTIVQALLLG
                     TLFRNQRDVTQGLYTRGSALFFCVLIMGLQASAEFGNTFVQRPILLKQKALRFYRPGA
                     YALGQILADIPWKFIFIMYSLPIYWMINFQRTAGHFFTWLVCLYMGLMALSVMFRAIA
                     VFTNSITRAILPVGLLLNVFIIYTGFYITPPGMKVWLFWIRYLDPMYYIFESVALNEI
                     GTSSYQCSSGDIVPRGSAYNETSYQACAVSGSVAGELSLSGRLYLMAEYGFKNTHLWR
                     NVGINAGFFVFFSVVVMIGMERFRNAAEHMSTIFYRRLPSWVSASASRSADIEEPPIV
                     AETKDSKPSSNHDVKAIGRLETTQSVFAWQELSLQLGDDKRLLHEVSGWLQPGKMTAL
                     MGMSGAGKTTLLDTLAQRIQIGRLSGGLYLNGQTLPASMGRRTGFVHQNDIHLASSTV
                     REALQLSACLRRPATVSWDEKMDHVEMLIQLLEMEDIAEAIIGVPGAGLNLEQRKRVS
                     IGVELAAKPDIVLFLDEPTSGLDGNSALSIVQLMRRLSDAGQTILCTIHQPSAQMIEQ
                     FDNLLLLVPGGKTVYFGPLGSRCQKILDYFARYTRRCEETENPADYLLAVSAEPDKDW
                     FQTWRQSPEYGSTQEQLQKMLQVQEVKDSSSSESDRTYAASYLNQLRVVTQRAFTNYW
                     RDSDYVLGKIQLNIWMGLMNGLTFLQLSNDLTGARGRMFSIFVGVITGPVLSLQIEPR
                     FILLRDQFLARENESRVYHWSIFTISALLVEIPFTLLGGLIYWLLWYYMVGYLTISTR
                     AGYAFLMYELYSLFVASLAQLTASLFPTVLAAQVATGFIWLVVNTFNGPLSPPPLTPR
                     GWRWFYNISPLFYFIEGIGTNAMHALQITCRDSELTTFQTPAGETCASYTAEFFGLAN
                     STGYLVDPNATGLCEYCAYADGDEYVKQYDMSYSQRGNNVGIFIGFILFNYTMAVLAT
                     YLIFIFKWRKRRSN"
     exon            complement(61712..61855)
                     /number=1
     exon            complement(61916..62854)
                     /number=2
     exon            complement(62938..63615)
                     /number=3
     exon            complement(63693..63748)
                     /number=4
     exon            complement(63812..64077)
                     /number=5
     exon            complement(64147..64412)
                     /number=6
     exon            complement(64485..65541)
                     /number=7
     exon            complement(65603..65849)
                     /number=8
     exon            complement(65918..66170)
                     /number=9
     exon            complement(67326..67598)
                     /number=10
     CDS             complement(68011..70170)
                     /codon_start=1
                     /locus_tag="AO090102000029"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000069"
                     /protein_id="BAE61143.1"
                     /transl_table=1
                     /translation="MLYNFVSIRSAPLAKRRKVRRACDFCRQHRVRCDGRLPCGQCVT
                     NKVECNKPSQHSHSHLHPNQHPHSSSSGNRELQPSAPSSFPPPQPAPPSTPNQAVVSQ
                     QVRPRLSSPRNPSIHHAAVAPLSQHLDSFAGFISRVNSFCTVVSQMSTQPSPHQPIES
                     APADVPCSSRDLLRRVEPVLSQLTPDSLNELQATLFDIFWTRYYFLMPIVSSEDLANK
                     SDGQSEPLRQALMAYCLQSIYHAGLHNRLLSIQKGMVSSDHGENPSQSPLVAKLFVTL
                     FQQALATNNAYLLYAEPTLADVQRHLLMAAFLLNSGEPQAAYNILGVAMRLTQSLDLQ
                     RLPRTHLPPQELETRQRIWWKLVHLDFHCSRLLGKPMAVSLNDKTITMPHPTPESSVA
                     APDLTYYSASISLTVAARQVAESLENHLHAVSGTVDSVNMIERYAHHLSREIKHLYEW
                     KDRILNAKLFPNMTLACGAYQPDAVTATEDGLKHDHDARLSFHLAPAVILQRTLLELQ
                     YHDIVLWVHHSFIQFPSRGLVPQRSPQADVHATTAIQHALTVTDLIRLRMLYHDVLYG
                     SSEIYQYLWNAVLTLIGFMLAYPLCYWFPRAQQHVERSLQIFEAAGPVNPIASRAAHL
                     TRYLLGRVSALMELLSSQSSAPHDRNDSRGVQTLGPVEPEKRQQQQPPLFTSEDDALW
                     SCADIVNPNIWYGYCHEINDMLMDVPEISLGTELFTS"
     exon            complement(68011..70170)
                     /number=1
     CDS             complement(join(71528..72023,72101..72153))
                     /codon_start=1
                     /locus_tag="AO090102000030"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000068"
                     /protein_id="BAE61144.1"
                     /transl_table=1
                     /translation="MPPLIPYHVSAGSNPVVKFGGALVTEFLEPPPGRCFCFRQRYAL
                     KPPIDEGDPDYERINEALNHPSGPPVHFHPFQNEYFRVEQGRMCLEVDGQTRILTPED
                     GEVQGRAGCIHRFYVAPDSTEDMVIILSASDPGMDYQLDRVFFENWYGLWHDYLVHEG
                     KMDFIQLLCVCYCSSFLEPIER"
     exon            complement(71528..72023)
                     /number=1
     exon            complement(72101..72153)
                     /number=2
     CDS             join(73537..73555,73613..73809,73866..74353,74428..74797)
                     /codon_start=1
                     /locus_tag="AO090102000031"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000067"
                     /protein_id="BAE61145.1"
                     /transl_table=1
                     /translation="MLRLFDRWGVSSMVHAKDIALESITIRRWEDGAVLSTMPVNKAY
                     GQQTVVHRADLHNALITKALALENVRLKDGTVVTGDVVVAADGIKSVLRGEMLGSLAM
                     QPIPTGDAAYRIMLSREVMEQDPELKALLDSPSATRWIGPHRHVIAYPVRNHDLLNIV
                     LLHPDDHEAEESWTTTASKQTMLRQYHGWDPRLLKLLDLVKEDEVLEWKLCSYPSLNL
                     WTKGHIALLGDACHPMLPYVAQGAAQAVEDAAALAILLSIIPSRHAIPEALRAYEMSR
                     KPRAEAIQQSGMANRTILHLPDGPEQEARDKQFLASRSSAANPDKWADAETQKLLWGW
                     DAEEHALATWSENMRPPHLESSL"
     exon            73537..73555
                     /number=1
     exon            73613..73809
                     /number=2
     exon            73866..74353
                     /number=3
     exon            74428..74797
                     /number=4
     CDS             complement(75030..76286)
                     /codon_start=1
                     /locus_tag="AO090102000032"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000066"
                     /protein_id="BAE61146.1"
                     /transl_table=1
                     /translation="MTRSTPFHLTSYLSAGPDPLHKLTPNAPHILVIGAGVTGLTNAW
                     HLLDAGYKVTIVSKEWASDGRTQRLTSQIAGALWELPPTQCGGVRLTDQELTEADLKT
                     AQRWALESYAIYAKLAANTELARAFGVRMPLCASFHTYYVKDDEPTHAKMEVARKLAP
                     GRFHWGMELAGKYGVDVSSNGGMKDAYEHPAPVIDTDVAMAFLMRLVRSKGARMQTDN
                     IVGNLRDQESHLLRMYGADAIVNATGLGAREIASDLGVHSLRGGILRVINDGSEFPKI
                     ESSIIVAADEDAEGKYIDIAFIVPRSDNILVLGSIEQAHEMDLDLTPDSPVIKAMRKR
                     CEDLVPVLKNARLDPQYPFAQGLRPYRNSKIRVEREGRKTLGGQDSRIIHCYGHGGAG
                     WSLAFGTSKACMELVEGVVRKPSSRL"
     exon            complement(75030..76286)
                     /number=1
     CDS             join(77267..77328,77439..77829,77860..78009,78040..78376,
                     78419..78899,78963..79131)
                     /codon_start=1
                     /locus_tag="AO090102000033"
                     /note="acyl-CoA synthetase"
                     /old_locus_tag="AO070290000065"
                     /protein_id="BAE61147.1"
                     /transl_table=1
                     /translation="MLYPYGRHVFKPLPTPNGPSLCFLDAECLDTHYSTTHDLRLWSQ
                     RFAAGLRKSGLRPGDRVLMFPGDDLFFPVVFMGIIMAGGIFTGANPMSVPRELAYQLE
                     DSGATYIICARASLDTAIEAARLVDLSRDKVFVFDNTLCDGHGVGERPVKKGGICMGR
                     TLDTRAGRSNPRAELLQRYDGTAKSRRDNPQELRCQSAAVHAKRARKRCLCFLPMYHS
                     MAQMIMIAATLALNTPVYIMPKFNFIQMLGYTQKYRITDYVVVPPIVVALAKHPAVKK
                     FDLSSVEDIGCGAAPLGKKVSEQLQALWPPGKVNIRQVQLKMLMNVCHRTTCSMVNWD
                     PREKGFSAAVGELNANCEAKIMAEDGVTELLERNQRGELWLRGQNVMKGYWRNPEATK
                     ATTTEDGWLKTGDVAFVDDHGKFYVVDRLKVSAMFDQYRRLLTVATQELIKVKGNQVA
                     PAELEALLLEHPAIADAAVIGITTDNDEGPRAYVVLKPGQVASAKDIVQFIEGKVSPI
                     KRITGGVVFIDVIPKNREDSA"
     exon            77267..77328
                     /number=1
     exon            77439..77829
                     /number=2
     exon            77860..78009
                     /number=3
     exon            78040..78376
                     /number=4
     exon            78419..78899
                     /number=5
     exon            78963..79131
                     /number=6
     CDS             complement(join(79246..80740,80791..80928,81105..81115))
                     /codon_start=1
                     /locus_tag="AO090102000034"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000064"
                     /protein_id="BAE61148.1"
                     /transl_table=1
                     /translation="MPILQSLIYPLCFTSLTPAQELEPGLEMPEAPPRRRKRGRRSMT
                     GCRTCRARRIKCDEAPTKCNNCTSTGLKCEGYDLCRLPIKRKSPLGRIPEVELCLAWV
                     PTADERRCFSYFQYRSIPSLAGFFDSQLWQQLALQMSRADPAVYHAANALSALHEDSE
                     TTKLLLVGENLRRPLHRFALEQASRSFALLNRRCASQDPERVEIVLICCLLFVLAELL
                     LGQYTRALQHLRGGLRILKEAQNTQKQCIPLCVIQAFRQLDVQSAHFGSGPLLFANDG
                     LKELSDEDFRRPLHRLEDVRHNMSSLLHAGVHFLANRWRLSSTEVQTNYGKLCLKQQR
                     ILSLYTRFHHQFETFYDRYYPSLSYRAQQSADIVRLQYRSQLVAVKTCLMKKPVPNDL
                     IPEYEALLLAHEAYMAKFSERPTITLDLGIIPGLHTVAVNCPRYPLRLRAIKALLAWP
                     HYEGIISSTFAASIAIVSLKAELEAKDQKGTSCVIGEAEEKLARYLFDTVTSTQNIPN
                     WTTVRASRFLEHYKETKPSPVPESNQKSDTHRQKKLVYR"
     exon            complement(79246..80740)
                     /number=1
     exon            complement(80791..80928)
                     /number=2
     exon            complement(81105..81115)
                     /number=3
     CDS             complement(join(83015..83417,83486..83739,83799..84266))
                     /codon_start=1
                     /locus_tag="AO090102000035"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000063"
                     /protein_id="BAE61149.1"
                     /transl_table=1
                     /translation="MSPSPRSLLAPLLLATCVSAESVAISRAETALTTLQTWYNSSTG
                     MWNTCGWWNGANCMTVLADLALVDDSESVNNTVKEVFANTFSVGPVSNPYPDRNNDSY
                     YSSAVQSKRSVDATQWLDGSYDDDAWWGLAWIAAYDVTGIEDYLDLAAGIFKHLSQAW
                     PSKCGNGGIDSDFQHIYVNAITNELFFSLAAHLANRASDRDYYVDWARRQWTWFKDSG
                     MINVNNTINDGLSSDCKNNGGTIWSYNQAVVLGGLAELDRAVSNESYVDAAAKLANAS
                     IAYFADDNDIIHESCEPDSCDSNETQFKGIFIRNLKLLHSVAPNDVYAKVINASANSI
                     WQNDRNAQNQLGVDWAGPVSQVDASTHSSAMDALVAAIGI"
     exon            complement(83015..83417)
                     /number=1
     exon            complement(83486..83739)
                     /number=2
     exon            complement(83799..84266)
                     /number=3
     CDS             join(85864..86086,86141..86360,86415..86528,86713..87571,
                     87624..87729,88252..88358)
                     /codon_start=1
                     /locus_tag="AO090102000036"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070290000062"
                     /protein_id="BAE61150.1"
                     /transl_table=1
                     /translation="MVADTDAVAQINPSQEGQDGTVSSYLVIPNDSDRQPNDHGHDEE
                     SALLSSPTAYDERKVELSTSVSTIVAVLILGEFISNADSTLVMAATAKVSSEFNKLQD
                     ASWLSTGYTLGVCAAQPMYGKLSDIYGRKALLLVAYTLFGLGCVVSGIGRDLWTVIIG
                     RAVSGIGGAGIMTLGSVIITGMRSRKTLLIMGLCSRNRLFLLQIPFIVLGGLLVIAKL
                     NITYHATSKASIRRVDFLGAGLLGASVVAIIMLLDRGGHAFPWISLPSFLLGGIGIAL
                     LILFVWAERVAAEPIFDLRILARPNVASSYMVGFLQITSQLGMLFSVPLYFQVTQRAS
                     ATVAGGHLVPAVVGNTVGGLLAGTFIRRTGRYKALLVIGGLVAAITHVLMLIRWNGHT
                     NFGESLYIIPGGMGTGIASASAFVAMTALLEPQDMAMATGGYMLIVSFAMTTGITMTN
                     TVLGLGFKHQLEQNLHGKGAEKIIRRATSDTNYIAKLEGNIWEIVVGCFVAGLKNTYG
                     LCNSWMVNGTTACTVRYKQRMSVSQGSVLYREWK"
     exon            85864..86086
                     /number=1
     exon            86141..86360
                     /number=2
     exon            86415..86528
                     /number=3
     exon            86713..87571
                     /number=4
     exon            87624..87729
                     /number=5
     exon            88252..88358
                     /number=6
     CDS             complement(91511..91927)
                     /codon_start=1
                     /locus_tag="AO090102000037"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000061"
                     /protein_id="BAE61151.1"
                     /transl_table=1
                     /translation="MHSFKTKLPRHPKPIIHPCKSTTEPIIIQRHEHLASFTQSTHNT
                     IDHIIAMLVGKVGKQRQRRGELEGVLHVTINRHDLKRSTYIRSGHGNLPFRACFPRSI
                     ASNGHDVGSWNCLDVEVQGGFGVAFEHEEGGDGCCS"
     exon            complement(91511..91927)
                     /number=1
     CDS             complement(join(92155..92726,92783..93020))
                     /codon_start=1
                     /locus_tag="AO090102000038"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000060"
                     /protein_id="BAE61152.1"
                     /transl_table=1
                     /translation="MLWWLCVALLLVHHSLAGCPAVVLPQPDIWPDGKFLYPNGAPQC
                     FTQGSIMNISWETKYKTTNLYLVHGANYDDPVALTLNTAATWHEWRVGYPTRDDTKPF
                     VLRLVNAQGTPEDMAVGGIWSARFWIGWNQDTSSSSTLAPTPTPTEPATVIDASRSHT
                     TTSASPANSAQSNSGSSSHGKAIGIGIGVGLGVPLCSAVILALLFLRRRRNQPESVVH
                     GGPFAPPASDKSYTNSTVPEDMCLEGKQVYELCGESSRTEADSSHVRYELA"
     exon            complement(92155..92726)
                     /number=1
     exon            complement(92783..93020)
                     /number=2
     CDS             join(93554..94558,94619..94948)
                     /codon_start=1
                     /locus_tag="AO090102000039"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000059"
                     /protein_id="BAE61153.1"
                     /transl_table=1
                     /translation="MTLSRFRNVPLIVAPLVVFLLLNYFFWFRKDTNDAGEEFLQPQN
                     NTNVDPGSNSSGCPKLPGIHDVLVVLKTGATEALEKVPVHFNTTLKCIPNFVLFSDFE
                     EQIAGVQALDVLRSVDEDIKQTKAEFDLYNRLRDAGRAGLTAEDINDDPSTPSGKPDN
                     RGWLLDKWKFLPMINETLNIRADAKWYVFIEADTYVVWPNLLSWLEKFDPSQPYYMGS
                     GVRILDVVFGHGGSGLVLSQAAMHKVSDYRAPRVKEYDDFTAGQWAGDCVLGKALKDA
                     GVGLFFANPMLQGDTPWTFSHYGPNNNDHHWCTPVVTYHHMTPDDIRETWAFEQSWWA
                     NTQSHTLLHADVFEEFVRPQIEQMKENWDNASSDENIEGSNSREDCQAQCEKDRECHQ
                     YSYETGKCLTSKVARRGSSKAGIGSGWMPERINKTMESLGHCRNVRWITPKS"
     exon            93554..94558
                     /number=1
     exon            94619..94948
                     /number=2
     CDS             complement(join(96819..97672,97722..97887))
                     /codon_start=1
                     /locus_tag="AO090102000040"
                     /note="voltage-gated shaker-like K+ channel, subunit
                     beta/KCNAB"
                     /old_locus_tag="AO070290000058"
                     /protein_id="BAE61154.1"
                     /transl_table=1
                     /translation="MSLPTAKLGKSGPEVPRLGLGLMGLSAFYGTIKPDSERLAFLDT
                     AYELGETFWDSADMYGDNEDLIGKWFQANPSKREHIFLATKFANRRRPDGSFFVDSSP
                     DYVHQACAKSLARLGINTIDLYYCHRLDRTTPIEKTVQAMAQLKAEGKIRFLGLSECS
                     AESLRRAHAVHPIAAVQMEYSPFSLDIESPQYRLLETARELGVVVVAYSPLGRGLLSG
                     EITSPDQFEENDFRRFAPRFSRENFAKNLELVRVIRCLAERRGVTPSQLTLAWLMAQG
                     VDIFPIPGTTRVERLKENLGSLRITLSEEEERQFREACSAVEIVGSRYPEAISATLFA
                     DTPPL"
     exon            complement(96819..97672)
                     /number=1
     exon            complement(97722..97887)
                     /number=2
     CDS             complement(100124..101071)
                     /codon_start=1
                     /locus_tag="AO090102000042"
                     /note="predicted iron-dependent peroxidase"
                     /old_locus_tag="AO070290000056"
                     /protein_id="BAE61155.1"
                     /transl_table=1
                     /translation="MSSRVPIEPQRVDAPLTQSATFLVVSVKDSSDAIKTVRSTLASV
                     DDLSKNVSIRDLAAQFACTVGIGSNIWDRLTGLPRPAELHPFREIKGEKHTAVSTPGD
                     LLFHIRSDRRDLCFEFERQLMDLLGDSVTVIDQTVGFRYFDVRDLLGFVDGTANPVGP
                     SVSDTILVAEEDTSGTGGSYIVVQKYVHDLQAWKSLSSEKQEAIIGRTKWENIELDDA
                     DEGQQQSHKSLATIEENGEEHEILRDNMLFGNPSSGEFGTYFIGYTRRLWVIEKMLER
                     MFIGNPPGLHDRLLDFSKPLTGVTFYAPPASVLAGLEDD"
     exon            complement(100124..101071)
                     /number=1
     CDS             join(103191..103391,103454..104624,104680..104791,
                     104852..105029)
                     /codon_start=1
                     /locus_tag="AO090102000043"
                     /note="amino acid transporters"
                     /old_locus_tag="AO070290000055"
                     /protein_id="BAE61156.1"
                     /transl_table=1
                     /translation="MAIPSKGPAQHAREILPNRQPKSDGPAIDNSDVARQQEYIVSQE
                     ERQNLSRGLSQRHVQMIAIAGAIGTGLFLGLGGAIATGGPLGALLGYIFVGLIVCCIQ
                     YALGEVSALMPVTGSFVRHAELLVDPALAFAIGWNVVYGSFLAVPSEISAAVVLIQYW
                     TDINAAVWVTILIIVSATVAITLVRVYGEIEFFFALLKLLLVVFVVILGLVIDLGGIP
                     GKPRLGFHYWKEGLFVEYIATGAWGRFLGFWAVMTNAVYSFSGVESLAMAAAETKNPR
                     HNIPKACRRVFVRVTVFYLAAVLVVGMLVSSSDPRLQDDSGTAAQSPFVIAASDAGIK
                     AIPSVVNAICITSAWSASNQSMLAGTRTLYGLAVKGHAPKIFLKTSSWGVPYMCVAAQ
                     TAVSFLAYMCVSNSALTVFYWLLDLTAAGVLVSWIAIAFNHIRLLQALKAQGIPTTEL
                     PWHNPITYFSSWFAFLACILILFTGGFAVFTAGNWDPASFVSSYLDIPLVLLAYGLYK
                     YIRGTKIIPLTEVPVHQALEEARNDPENVPIKPAKGWKRLNVLWA"
     exon            103191..103391
                     /number=1
     exon            103454..104624
                     /number=2
     exon            104680..104791
                     /number=3
     exon            104852..105029
                     /number=4
     CDS             complement(join(105461..105739,105792..105964,
                     106227..106436,106492..106606))
                     /codon_start=1
                     /locus_tag="AO090102000044"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000054"
                     /protein_id="BAE61157.1"
                     /transl_table=1
                     /translation="MLFIKAIALTGLAVSQVSAHGLITRVKGHNGIDMPGLTIQDGIP
                     RDCPSGACGAQKDTAIIRDAEFGSVKASPLGRTLGAGPVNPAIVINNFMGAGTHKRSR
                     VPASHRRVQSTIDDAMAILPGTESGAVTGKGVKENGMQLYAGKGANIGLPTASPDGVV
                     TMIYHQVNQDGAGPLSAEIDPSSGGTDPKAFKSARVIQNIPGVAGFSTSSAMDYAVKV
                     QVPQGMKCTGTVGAAKNVCIVRVRNNAISGPFGGSGAFTQ"
     exon            complement(105461..105739)
                     /number=1
     exon            complement(105792..105964)
                     /number=2
     exon            complement(106227..106436)
                     /number=3
     exon            complement(106492..106606)
                     /number=4
     CDS             join(110518..110755,110807..110916)
                     /codon_start=1
                     /locus_tag="AO090102000046"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000052"
                     /protein_id="BAE61158.1"
                     /transl_table=1
                     /translation="MAYNPQRAPPRAPRRRRPPQPPRYPGSHIVTLFTGNQELWFVQV
                     KLDPGVVPSFEEYENAVKQGKAELTLQDNRKKDKEGQMPPPDGIEKLLDGIGEARLKS
                     QRLPHIQPALCPR"
     exon            110518..110755
                     /number=1
     exon            110807..110916
                     /number=2
     CDS             111734..114190
                     /codon_start=1
                     /locus_tag="AO090102000047"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000051"
                     /protein_id="BAE61159.1"
                     /transl_table=1
                     /translation="MESCKLTSSVLLRVLKGVAAATLLDESSYERLVQCFACGDRVAE
                     GADSHTGNDVAHGRPVGDWLAMVPDISCEDKEKQLLVQHLAELVLAIALLRESGRRTQ
                     NPSLAAVSDADLAIVWSMIRGALLSDLFPDSKIRASRSAQGFLSVPLCSIVQNGNIEE
                     LFRLHVWLPDGQRGTPDFAVHSHQPFGQSWILAGAGVDHSFDVHPTTDGTAATHAEYK
                     LVWQDAKGTDKTYKTHQISSTIENTGNLVQVTAKDSKLHVRNMSYAIPAAAFHYTEVA
                     PDTLHATLFFFDASRGFVKDAPVLGPKDLDSSTQQRDPGGVTPAVLATMVDAVRSWET
                     LMEEGDQHAQRAEWEHALRSFSHALSLCGPAGNLPASGNYRHIVLGKLGYTNRRFGRY
                     EKAEEYLQSALDGLGSTSFHVELRGEMGVVYRHMNRLDDAKREFEIQYNMAVELNLEY
                     AMCRSIGNLAMVNYQLSRDLLPLAIDQLKERVRLARSIRASPGSGEKAQAIIWETVGL
                     SRLSLCYTACGFANDAIATSLESMKVALSTKDPTVVAMSRLFYGRALYLNGQREEALQ
                     QFNPTGTCTPAMALCKEPSDEHLGYLRELVEAGADMDLIDEQGYSALDYAVFCGDMQT
                     EEVVLDGLRRQFGKQANDKLLQRQREARVRKCYRELFQESLRPVLLESRNEVSQLQHL
                     RRVYAASLVADEEKIKIFDGLKFVWYRDFLRNGRLPRSNHGLTQNYRDIEPECAPEYI
                     VFISYRWINGDPACLASPDDTNHTQYHRMITAIEAFLEAHGSLNPERLGIWLVCSEIH
                     PPEEMTYAYRYLGLGLHRSG"
     exon            111734..114190
                     /number=1
     CDS             complement(join(115547..115690,116800..116908,
                     117679..118968,119022..119269))
                     /codon_start=1
                     /locus_tag="AO090102000049"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070290000049"
                     /protein_id="BAE61160.1"
                     /transl_table=1
                     /translation="MSIDEGHIGHGASLEKKNSDVYRENRPLMVTEEEAFARARNSPD
                     EALPLCITFSHNDRENPRCWPKWRKWYITIFVSMLNVITTWCAGSISSGATAIQSEFG
                     VSEEVTTLCLSLYVLGYAVGPVLLAPLSEYFGRQPVYVVSWFLLFIFQLPIALAPNIG
                     TIIVCRFIAGFAGGAPLTNTGGSISDLWERNHSGGPMAIYGLSSTFGPPMALVVSGYM
                     ALDLGWRWIFWIMMAISGGWWVLLVLTIPETRHTIILQRKAKRVRALMRKENLKSAET
                     VTDASASGRKGLDELFKITLTRPFRFLFTEPITTFSAIYNGFLYGLVYLFNESFPLVF
                     GPGKGHGFNVGQQGLSFLGMAIGPIIAFCFYPLQERYYLRRVKEHDGKGVPEARMWMA
                     RLGAIFIPISLFWFGWTSYRSVHWIVPIIASAFFGAGIYIVILSILNYVVDSYQTYSA
                     SALAGVILVRNLVGAGFPLFATQMYERLGYEWASSLLGFLAILLVPIPFIFFYMGRAI
                     RLRSPKQSISEAHLISLILTIVSNSENPQSQHLQHTQNPQELSPAALTSTTQPGFTKT
                     VFCSLGIAILSSSGKQLYVMNADIQAGYRE"
     exon            complement(115547..115690)
                     /number=1
     exon            complement(116800..116908)
                     /number=2
     exon            complement(117679..118968)
                     /number=3
     exon            complement(119022..119269)
                     /number=4
     CDS             complement(join(120182..120528,120596..120793,
                     120854..120948,122421..122485))
                     /codon_start=1
                     /locus_tag="AO090102000050"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000048"
                     /protein_id="BAE61161.1"
                     /transl_table=1
                     /translation="MSLEPDYNPDFNLGMRTEVQQLNQVLMSSSTGMGFIMLLSGEPG
                     VGKTLTAESVAEEMRQPLYIMSASELGETAVEVEEALEQVLELTSKWNAILLLDECDM
                     FLEARSTSDIRRNRLVSIFLRQIEYYRGVMFLTSNRISDFDPAFESRIHLTIHYPALD
                     IQSRLHVWKTFIQIGHLETKIRDKDLKALAKLELNGRQIKNIVKTARLLCKQERVPLA
                     MEHIQMVLQVKKGSLL"
     exon            complement(120182..120528)
                     /number=1
     exon            complement(120596..120793)
                     /number=2
     exon            complement(120854..120948)
                     /number=3
     exon            complement(122421..122485)
                     /number=4
     CDS             join(124070..124097,124292..124702,124778..125314,
                     126123..126354,126450..126678,126760..126833,
                     126904..126976,127075..127158)
                     /codon_start=1
                     /locus_tag="AO090102000051"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000047"
                     /protein_id="BAE61162.1"
                     /transl_table=1
                     /translation="MRHLLRFIDYTDFIAAGGPNHFSWNVIRSEADELLFRHTAHSGA
                     KTFEAVKVNSVTFTPSPTLDTGPGRPVSASYTQKSDGATGVVGFKYIIDASGRAGLLN
                     TKYLKNRKYNQGPKNVAVWAYWKATGKYGEGTPRENSPYFEALTDESGWAWFIPLHDG
                     THSVGVVMDQGMMSQKKAVSELSTNARYLSWLKLAPRLNGYLTGGKMVADLKTASDFS
                     YDSSSYAFPYARVAGDAGCFIDPFFSSGVHLAITGGLSAATTICAAIRGDCDEVAAAR
                     WHSTKVKEGYSHWLVIVLSAYKQMSNQAEPVLSDVGEDNFDRAFNFFKPIFIDFVFSI
                     PCCHPRAVLNLQYGRDMGSRSTRDPILQVQGKIYVQSHLPPPTHKDDCLPTRHDPLRM
                     LRVSGNSSLISYIQGQHPGVKVHNNSFIGAASYNIFVGISVATIFGAAFFFDLFWPDR
                     YESPSVRLAWKICAVVVSVMMLSSALLMTCPYHWYGRRLCEKVLVGGREETCSSVPNE
                     SQGCCLGCFSLARVGRDCCQYGAKSNYGRNLENGENIPETEAKPMTM"
     exon            124070..124097
                     /number=1
     exon            124292..124702
                     /number=2
     exon            124778..125314
                     /number=3
     exon            126123..126354
                     /number=4
     exon            126450..126678
                     /number=5
     exon            126760..126833
                     /number=6
     exon            126904..126976
                     /number=7
     exon            127075..127158
                     /number=8
     CDS             join(127811..128236,128420..128635)
                     /codon_start=1
                     /locus_tag="AO090102000052"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000046"
                     /protein_id="BAE61163.1"
                     /transl_table=1
                     /translation="MTISNKEKPVFVLVPGASQNPAHYAHLLHLLQSAGYGATTGLLP
                     SIGAQGEVTAADDADYVRNRLILPVLDIGNRDVILISHSYSGMPASAAARGLGPADRA
                     AEGKTTSVVGQIFIATILPRGGLSVIDSFGGHLPPHMYIDSGTDLVLESLPRSELGHR
                     GLPRPGRLHSHPQGPRRSVRGPGRHGPGHRGEVDHPRGHGWSQCTIIGPGGAD"
     exon            127811..128236
                     /number=1
     exon            128420..128635
                     /number=2
     CDS             complement(join(130334..130564,130623..131709,
                     131761..131802,131857..132203))
                     /codon_start=1
                     /locus_tag="AO090102000053"
                     /note="predicted hydrolases or acyltransferases
                     (alpha/beta hydrolase superfamily)"
                     /old_locus_tag="AO070290000045"
                     /protein_id="BAE61164.1"
                     /transl_table=1
                     /translation="MLISSVSLLLASAGLSQALPHAGTKRAESDGLNWAPCNLDLPEG
                     LEPASTVPVDCATLEVPLDYTNPDSKPLDLQLVKISASKEPVKGSIIFNPGGPGASGI
                     DELYLQGKGEVYRDLFGGHWNVVGFDARGTGHTIPFACDVPRPGIKRSLSRRNNETLP
                     QADMYSLLKRKAWNDAKVLVDACYEDQQETGRFLGTTFVARDMLKIVDALNEDGKLRF
                     WGRSYSTILGQTFAAMFPDRIDRMLLDSVVLNDDYHAGHWITATKAAEDSLYHFFTEC
                     INAGPTDCPVIANFTGPATTPDALMKEMRTAFQELVDNPVTLPDEYEPLPWWQPGGID
                     LLTEFKYTVFSLLYRPEQYPTLYAYILTALTRNYEVVINPSQAATVPPTWNQGPNNFH
                     GIACADAHFRADKPEDMYSLVQSQAVTGSFADGFSPQVWPCAQWKFKAAEQFEGPYHG
                     INTSYPILFINSPYDPVTPLSNAWEASAHYLGSRVVVHEGHGHGFMNHPSSCSQNIVK
                     EYFDEGKLPEVGTRCKPDMTGFEYAKLLVAAASGNSTVARRGLGSNQMRRSGQGMFGH
                     QI"
     exon            complement(130334..130564)
                     /number=1
     exon            complement(130623..131709)
                     /number=2
     exon            complement(131761..131802)
                     /number=3
     exon            complement(131857..132203)
                     /number=4
     CDS             complement(133149..133643)
                     /codon_start=1
                     /locus_tag="AO090102000054"
                     /note="cytosine/adenosine deaminases"
                     /old_locus_tag="AO070290000044"
                     /protein_id="BAE61165.1"
                     /transl_table=1
                     /translation="MSPLTGEQLSAAAGACLELQKTGQDIHSKRPFAALLLAPDSTTV
                     LMSSLSLSHVRHAEAELARNAADNYARDYLAETTFISTWEPCAMCAGTIYWANIGRLV
                     YLASEKALQGVIGEGNIENLTLDLPCRTVFASGQTEVEVIGPVSGWEEKVVEDSKRYW
                     GKGK"
     exon            complement(133149..133643)
                     /number=1
     CDS             134541..135116
                     /codon_start=1
                     /locus_tag="AO090102000055"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000043"
                     /protein_id="BAE61166.1"
                     /transl_table=1
                     /translation="MYQATYIIHRAGSFHEIDKFITYANHINPNRISDISSTDRTKRN
                     CKMYLLQPLLTFLLLTLTTSTPTPTLTHDATAVINDLTKITTDLSALTKSIVAYNGGI
                     PAALDIQVKEMAVERDLDQATRDTTAATPFTVSESATTTSALLGLEPDIRTALVTLVQ
                     KVFSFLRFLVSMLLWVKGGGSVNMALETPRR"
     exon            134541..135116
                     /number=1
     CDS             complement(join(135557..136080,136143..136620,
                     136671..136715,136761..136953,137010..137314))
                     /codon_start=1
                     /locus_tag="AO090102000056"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070290000042"
                     /protein_id="BAE61167.1"
                     /transl_table=1
                     /translation="MDAKHSSPETPDTEKDRPVVDLEEIGEREGYMLYTPRNKNQNLK
                     TTDDGQTVLIPQPTNFPHDPLNWSPFRKNLILFVISATAFLPDYGSATGAVTLLQQAK
                     QWNMTEDHVNHSQAGNIFMLGVGGPVVVALSAYFGRLPVLFYFVLMALATAIWCTAAQ
                     SFESFMAARILNGFFSTVAQGGGLMFIKDMFFLHEQARKINIWSGSIILSPYLGPMFA
                     AFITNTQVWQWAFGLYSIETGLCLIAIILFVEETYYDRKNIQPDLIPNAPRWKRMLGI
                     QQRRSGYMVNTPKDAIMRPITVIMKPVVFLSTIYYMLTFAWVVGVNTTLSIFVGPLYG
                     FGPKQIGFFYFTPVVAAILGELTGHWLHDYLAKLSTNRNQGRLEPEARLLAIWFATPF
                     ILAGIILLGFALEGAYHYMLTALGWGFYVFGVMIVTVAINAYVLDSYPEASGEVAAWV
                     CFGRTTGGFIVSYFMVEWAGKQGARRQFGTMAGIVAGAVLIVLVLQVRGKELRGWAGP
                     VRFKTG"
     exon            complement(135557..136080)
                     /number=1
     exon            complement(136143..136620)
                     /number=2
     exon            complement(136671..136715)
                     /number=3
     exon            complement(136761..136953)
                     /number=4
     exon            complement(137010..137314)
                     /number=5
     CDS             complement(138105..138539)
                     /codon_start=1
                     /locus_tag="AO090102000057"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000041"
                     /protein_id="BAE61168.1"
                     /transl_table=1
                     /translation="MAAAIVKTINLSSLTERADLTWDTVDLSIWTSIEQYLIILAACI
                     PTMTPLVNILLHKRPSKRNTARARTHPGNPYGRGQGYAQFGGRSLDYALGTYGDAWAT
                     ARRDKGDGDSEDPIMNEETSQGIMKTTEIHIQSDVDVDQRGS"
     exon            complement(138105..138539)
                     /number=1
     CDS             complement(join(140359..140552,140599..140641,
                     140690..140919,140972..141063,141110..141158,
                     141205..141298,141353..141474,141526..142018,
                     142068..142892,142955..143133,143191..143239))
                     /codon_start=1
                     /locus_tag="AO090102000058"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000040"
                     /protein_id="BAE61169.1"
                     /transl_table=1
                     /translation="MKLVNRLLASFLSVSTVLQSCWAQSGTPVAYTDTETGITFDTWS
                     VPAGTGTGGLVFGVALPGSALTTDATEFIGYLQCASQNASSAGWCGISLGGGMNNNLL
                     FLAYPYEDTVLTSLRFGSGYSMPGVYTGNANVTQISSSINATHFTLLFRCENCLTWDQ
                     NGQTGNATTSKGRLVLGWAQSTESPSNPSCPDNISLVQHDNQGIISATLDENAASASY
                     EDWVKLANKTVPGDCSGDGGGGNEPTPVPVPDGATYDYIVVGGGAGGIPVADRLSEAG
                     HSVLLIEKGPPSSGRWGGTMKPSWLDDTNLTRFDVPGLCNQIWVDSNGIACSDTDQMA
                     GCVLGGGTAVNAGLWWRPNPVDWDYNFPEGWQSSDMQAPADRVFSRIPGTTTPSTDGK
                     LYYQQGADILFNGLQSAGWSSVTLNDVPAQKTKTFGHAPFMFSGGERGGPMGTYLVSA
                     SERDNFARWSNTTVKRVVREGGRITGVEVEATLNGGYAGTVNVTANTGRVILSAGTFG
                     TPKVLMRSGIGPKDQLSIVKNSTDGETMIAESEWIELPVGENLVDHVNTDVVVTHPDV
                     VFYDFKAAYKTPIESDATSYLNDRTGIFAQAAPNIGPIIFDEVTGSDGIKRQIQWTAR
                     VEGGHDTPDGHAMTISQYLGRGSTSRGRMAITAGLDTVVSTLPFLRDESDVNAVIQGI
                     QNLKMALNGTGFTWNYPSRNTSIAEFVKTMPITAGTRRANHWMGTCKIGTDDGRTGGS
                     AVVDLNTKVYGTDNLFVVDASIFPGMITTNPSAYIVTVAEHAAEKILAL"
     exon            complement(140359..140552)
                     /number=1
     exon            complement(140599..140641)
                     /number=2
     exon            complement(140690..140919)
                     /number=3
     exon            complement(140972..141063)
                     /number=4
     exon            complement(141110..141158)
                     /number=5
     exon            complement(141205..141298)
                     /number=6
     exon            complement(141353..141474)
                     /number=7
     exon            complement(141526..142018)
                     /number=8
     exon            complement(142068..142892)
                     /number=9
     exon            complement(142955..143133)
                     /number=10
     exon            complement(143191..143239)
                     /number=11
     CDS             complement(144320..146779)
                     /codon_start=1
                     /locus_tag="AO090102000059"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000039"
                     /protein_id="BAE61170.1"
                     /transl_table=1
                     /translation="MGSYDCSDPKLTIFFAVNSLMMSGMMASNTSFYVVTGAEIHWRQ
                     ATSFHADAAAMRTLLTGLAGFLIVEGILLTVNWFVAGFIHRVTGGILHVLAWPIRALV
                     ERLRPCFHRVYGSVRRQPLPDPETYEQIAVDDYLDDKSDDGESDHLLHTGTATGSTAP
                     TERRRTDTPMRRFVVLGLFALFLLLRFLRPWAPAYLYLSGTLPLTPFFEGGHRKSPVD
                     TTALPGDYGWLEERSSLHPAPGWDWMPQKGLPGFSDWDKTDRFALHYTPSMDPLHISN
                     RDNPVLDSIRPVLEDNSVKIKHVIMLKLESTRGDVFPLKKDSFMWNRIAESHKDKQIP
                     PEIQDRLSNLTRTAEWLTGFDAGFEHTDSLHADRKAYGGISARNAHTTGTYTLKSLVG
                     TLCGVTPLVTDFNREYKHHIYQPCLPHVFNALSQQHDITNQTDDFTAWPWHSVWMQSV
                     TETYDNQDKLTPALGYHDKITKETLEEPSSKHFPVKSEEINYYGYADTELRDYIRDAI
                     DDAEASHTRLFLTHLTGTTHHPWGMPHDEYEEFMGSSWTGHNNDVNRYLNTIGFGDNW
                     IAEIISILEEKGIADETLIVMAGDHGLSLPNDGGVTPYDNPHVGSFHVPIVLAHPKLP
                     PVEVSTPVNSNQIVPTILDLLIESRSLSEGSGRAARDILSLYEGQSMLRPLVQEEDGK
                     QNWQFTVMNTGGTWLAVRSAARPAFRLVIPLVDDLEWRFTDLEKDPIELKPIKHFSLM
                     DMANELDQKYGQDVVDWLRDAAHVTEWWVLDNWHRYRYIPQIKISKDGKISKGKDSGD
                     KGSDDKDSDDTDSDDSEDSKR"
     exon            complement(144320..146779)
                     /number=1
     CDS             complement(join(146879..146887,146931..147116,
                     147596..147643,147760..148059))
                     /codon_start=1
                     /locus_tag="AO090102000060"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000038"
                     /protein_id="BAE61171.1"
                     /transl_table=1
                     /translation="MEERFLSNVGLMNSKPVHWIPSPVSQQTARKCTARVFSLGATVD
                     WSPFPSPVGRGLKPAVSANDMTEGEWAQGIKKGLVRKGVWWASEKRQFHETQEDNSSQ
                     GRQGCAALLLVKEPLANTLHALRQRWVPVFHKLRSSPGEAFDLFWEFARRYFFSLAFI
                     SLFGAKFLHLFAHLHSLPMS"
     exon            complement(146879..146887)
                     /number=1
     exon            complement(146931..147116)
                     /number=2
     exon            complement(147596..147643)
                     /number=3
     exon            complement(147760..148059)
                     /number=4
     CDS             complement(join(149881..149927,151525..151737,
                     151791..152429,152494..152812,152863..152942,
                     153007..153129,153190..153274))
                     /codon_start=1
                     /locus_tag="AO090102000061"
                     /note="predicted flavoprotein involved in K+ transport"
                     /old_locus_tag="AO070290000037"
                     /protein_id="BAE61172.1"
                     /transl_table=1
                     /translation="MAGFQAGRPVGNHDYTSATVVIIGAGISGLCMAIDVIKRSQCRN
                     IVILEKGNQVGGTWTDNRYPGCACDIWSTLYSFSFEQKTDWTREHPGQEEIRDYLIHV
                     AEKHGLYKFIRFNTTVQEARWDDKQLKWKVSVATSGAKEPQFHDSYDITTDFLVSAVG
                     QLNVPSWPSIPGLDDFTGKLMHSARWDWTYDFTGKRVAIIGNGATCAQIVPELAKSVS
                     QVTVYQRTPNWVIPRYDTSVSSLQRFLLSYVPPIRWCKRALMMQAREFSHDAIAKSNS
                     ALAGYIRKISIATMKSQLCDKPELWDKLIPDYSPGCKRLIPSDDYFPALNKKNVHLET
                     RPIQRVTESGIETVDGALQEYDLIVAATGFRSVEFMHPIQVYGRNGRPVSDVWKDGAA
                     AYYGVTVEDLPNFGMLYGPNTNLGHNSIILMAEAQSRYLSTLIGEVVRAKARSDSLVF
                     QPRSDVVAAFNERLQEELERSTFADPQCHSWYKLENVCASLSLRKSIALSG"
     exon            complement(149881..149927)
                     /number=1
     exon            complement(151525..151737)
                     /number=2
     exon            complement(151791..152429)
                     /number=3
     exon            complement(152494..152812)
                     /number=4
     exon            complement(152863..152942)
                     /number=5
     exon            complement(153007..153129)
                     /number=6
     exon            complement(153190..153274)
                     /number=7
     CDS             complement(join(153697..154281,154336..154596))
                     /codon_start=1
                     /locus_tag="AO090102000062"
                     /note="acyl-CoA synthetase"
                     /old_locus_tag="AO070290000036"
                     /protein_id="BAE61173.1"
                     /transl_table=1
                     /translation="MPRFQFDTFCATIQKHRITYAYVVPPIILELVSNPRITEYDLSS
                     LRMMLSAAAPLAVELIQTLHQKLKLSVRQAYGMSECAPCTHMQTWNETHTHLGSVGRL
                     LPNMTAKYALVEGETGRSKELWVKGPNVFLGYLNNPKANSESFSEDGYYKTGDVGHKD
                     ENGHFYITDRVKELIKYNGFQVAPAELEAIALGHPAITDVAVTGIKDGQSGTELPRAY
                     VVVAPGYEGNQSTADAISQYVSDQVINYKRLRGGVRFVQAIPRNPSGKILRRELKKLD
                     RVAKL"
     exon            complement(153697..154281)
                     /number=1
     exon            complement(154336..154596)
                     /number=2
     CDS             complement(join(156034..156120,156198..156341,
                     156425..156955))
                     /codon_start=1
                     /locus_tag="AO090102000063"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000035"
                     /protein_id="BAE61174.1"
                     /transl_table=1
                     /translation="MITMIGVGVQYKGGTSIYATQHTNIYHGFTAVTNIVFAYCAHVA
                     FFGLIAEMEEPKDFTKALCLLQGFEIVLYVTAATVIYYYVGTGVASPALGSAGPVLKK
                     VAYGVAIPTIIGAGVVNGHVGLKYIYVRIFRKSGRMAKRDFVSVGSWVAIGVTCWIIA
                     WIIGEGIPSFTNIVSLISSLFASWFTYGLSGVYWLHMNWGYWFSSPRKIALTILNFLI
                     VGIGGTICGLGLYASGKAIHDDSSRASFTCANNAD"
     exon            complement(156034..156120)
                     /number=1
     exon            complement(156198..156341)
                     /number=2
     exon            complement(156425..156955)
                     /number=3
     CDS             join(160564..160844,160907..161136,161198..161299,
                     161373..161569)
                     /codon_start=1
                     /locus_tag="AO090102000064"
                     /note="dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /old_locus_tag="AO070290000034"
                     /protein_id="BAE61175.1"
                     /transl_table=1
                     /translation="MARLLNKVALITGSSSGMGRAIALRYAKEGAHIVCADLSLTARS
                     LVPEEAEITTHDAIIQAGGRAIYVQTDVSEAQQFERAVQTAVSEFGRLDILVNNAGIA
                     TDTRNPTRVHETDEHAWDTMLRVNTTSVFLGCKYGIAQMLKQEPHSSGDRGWVINLAS
                     IWGLVGGLGSPAYCASKGAVVNLTRQMALDYGPDRIHVNAICPGFIWTAMTRDLEEAS
                     PHAIESLHQKHPLKGFGYPDDVARMAVVLASDDASLVTGVALPVDGGYTAQ"
     exon            160564..160844
                     /number=1
     exon            160907..161136
                     /number=2
     exon            161198..161299
                     /number=3
     exon            161373..161569
                     /number=4
     CDS             complement(join(161796..162402,162452..162725,
                     162783..162912,163032..163463))
                     /codon_start=1
                     /locus_tag="AO090102000065"
                     /note="aldehyde dehydrogenase"
                     /old_locus_tag="AO070290000033"
                     /protein_id="BAE61176.1"
                     /transl_table=1
                     /translation="MSPHLWELDTLEDAEGHLQRLDFQPFKLQNLVNGNLVPHPHNWI
                     DSMNPKTGLHFACIPNSTPEQIDQAVKAADAAFPAWSATPPSQRSQYLQRIASRIEEQ
                     RELFAVWESIDQGKTLTRARVEIDRAVSNFRWDNSGIAFHTCGVFALISPWNMPLYLL
                     TWKIAPCLAFGCTAVAKPSELTSVTAYLLSAVFQDVGLPPGVINLVYGAGNPTGSALV
                     RHPLIKGISFTGGTATGRQIRRDTVDDIGKHLSLELGGKNPTLVFDDVDMDKAVATAA
                     AAAKSRTNNIQICLCGSRIYIQRRIWSEFVSRFVSYVKEHYELGNTVGAVVSLPHYNK
                     IRSYLSLAAEDPVSVFHLGSIPPENPEGGFWIEPAVLTVSESSPLLTDEIFGPVVTLT
                     PFDTEEEAIQKANNSQYGLASILLTKDGARMRRVGERLEAGLVWVNCWLVRELGTPFG
                     GMKASGIGREGGQYSREVFTSVRTLHIPQV"
     exon            complement(161796..162402)
                     /number=1
     exon            complement(162452..162725)
                     /number=2
     exon            complement(162783..162912)
                     /number=3
     exon            complement(163032..163463)
                     /number=4
     CDS             complement(join(163879..164135,164185..164322,
                     164367..164511))
                     /codon_start=1
                     /locus_tag="AO090102000066"
                     /note="3-hydroxyanthranilate oxygenase HAAO"
                     /old_locus_tag="AO070290000032"
                     /protein_id="BAE61177.1"
                     /transl_table=1
                     /translation="MIPPFSFASWVAENEDKLHPPVNNYCLYSGEDFTLMVVGGPNSR
                     NDYHGVFIMVVNQTEEWFYQVKGDMLLRIVENNTTFRDISIKEGEMFLLPGNTPHNPV
                     RFRDTIGLVMERKRPEDSLDRLRWYCSKGKHKKPTIIREEIFHCADLGTQLKPLIERW
                     QIDEESRRCGACGAIADPK"
     exon            complement(163879..164135)
                     /number=1
     exon            complement(164185..164322)
                     /number=2
     exon            complement(164367..164511)
                     /number=3
     CDS             complement(165428..166585)
                     /codon_start=1
                     /locus_tag="AO090102000067"
                     /note="predicted metal-dependent hydrolase of the
                     TIM-barrel fold"
                     /old_locus_tag="AO070290000031"
                     /protein_id="BAE61178.1"
                     /transl_table=1
                     /translation="MYCDDYHHLLRIDLHTHIMPPSLPDLSSYPSNSTDSPWLSLRPN
                     TKNPEDTDMYVGDHFFRTVNRNCYDVNTRLAEMDAAGTDIQVLSTIPILFFYDQPAEP
                     VTILARHLNNHIAALCAQHPARFLGLATVPLQDVPAAIAELHRAKNELHLHGVEIGTT
                     IDGMTLDDPQLDPFWQACEELEMPIFIHPLGYTWPKENPKLWSKYWSSWLVGMPSETA
                     LALHLLICSGTLLRFPRLRLCFAHAGGSFPALLGRIQHGYDCRPDLVATDAGGVTPME
                     HATVRDNIWIDSLTHDVDLLEFLVKKVGAHRIVMGSDYPFPLGEVPEAGRMIARDKRL
                     EKFLSWKQRADMLAGNALRFLNLDPDEKWRDLVEMRLRASEKGHGSKHYLS"
     exon            complement(165428..166585)
                     /number=1
     tRNA            complement(167209..167280)
                     /locus_tag="AO090102t00001"
                     /note="tRNAscan-SE"
                     /product="tRNA-Glu"
     CDS             complement(join(167996..169469,169722..169831,
                     169885..170025))
                     /codon_start=1
                     /locus_tag="AO090102000068"
                     /note="gamma-glutamylcysteine synthetase"
                     /old_locus_tag="AO070290000030"
                     /protein_id="BAE61179.1"
                     /transl_table=1
                     /translation="MGCRGTTTLHFYYSRSIDANTYCSKQILNVWRRGKDINDPRALW
                     GDELEYVMVQFDPSQSRATAVLDQENVLSRWNDQVSSKLGRALIKDLLGPTQYPLTIA
                     HFPRLGTKGQFTTPHYHTSQRDIHHRMIPPQVEAPGLRYVYTNQQVLSRRQRPFRLHA
                     PIYRDRNTPRPFIDEDCLAEGALLRKDNVYLEGQAFGVACCALQITVQAANEPDVRWL
                     HDQLVVLGPIMLALTAASPIYKGYLANTDSRWDYLAASFDIRTQEEECKFLGTPKQCC
                     SSPLMRWSSNRVYLSHERPAGIANACGQVQVDESARRQLLDGGMDETIASYFSNLLWH
                     DPLWLNQDAIELSSPDTTHIFEKFQHGVWRHVHLKMPEASTGSGWRVEFRPMEVQPKD
                     SENAAFAVFMLLLSRAILAYRLNFYIPIDLVTESMQRAQKLDAVTKERIWFRGRDWAP
                     DGLDSIQCNPQHGCAQSQKEDVYALMTIDEIINGEHSMSPARFPGLVPIVRSYLLERD
                     LLPNEEAKLMQYLNLISCRASGSLPTPARWMRDFVAKHEDYQHDSVVSERICYDMLRE
                     VVNMNEAD"
     exon            complement(167996..169469)
                     /number=1
     exon            complement(169722..169831)
                     /number=2
     exon            complement(169885..170025)
                     /number=3
     CDS             complement(join(171974..172467,172544..173337,
                     173384..173694,173717..174319))
                     /codon_start=1
                     /locus_tag="AO090102000069"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000029"
                     /protein_id="BAE61180.1"
                     /transl_table=1
                     /translation="MGQAESYEGNINCPVNRYRYSPLPQGCIRLLRLLPSEKSDSRLQ
                     GHLFNYPLGLLAAKTHLYEALSYVWGDLNNSRLISLGNYDFPVTKNLHTALLYFRDQY
                     IERIIWVDAVCINQEDLNEKGEQVRRMAEIYSKASRVIVWLGHMENHSNEALEAIRIA
                     AQRPHGVDDKLTREAVFCLLRRPWFERIWVFYDPPTKLEFPVLQEVASARQILIKGGD
                     TEMDGHVFCTGLTSKSFEYLYKDFPDLHTVVRPVIFLMSESLFRPKVVERTSNEFSLN
                     IRPLGELLDMYHTRKATKQHDKLFALIGITPWARLFERLIRYLLWGDVAIRTCDASER
                     VLISGSGYILGKVLSVTSSQHEDGQDVGLATRDIDGSFGPETQWRLPAIAKPVQVGDL
                     ICQLRGAAKPTIIRLCHDHFSIILIAPSLELKQPVSDTSLVFFLSWDWQDAHGKLSNL
                     DDAQRPVDYSLPWHWGNQCAACSSELHELWCTGLILDEAEEYRLAENKLQQVLSGYEE
                     TIGAEDPRTLVCMDKLALIHKKLGLLNDEEPNMVPEELRGLRLSELSSLNDWTLRLKF
                     KQKGVIRYGTAFRINIPGVERAVLLTARRNLADEQGRLSQDLEIYNEHGRNKLRDIGH
                     KEVFLSAFDPRSASDTGVYSGYGAILFDKEAESYLGGYGFSLELGQANLEGDGLGVCG
                     YLKQDTLSRSTGLCLSCQDDRMTYNAITMPGMSGSPVFLSRNGDATAVGIQ"
     exon            complement(171974..172467)
                     /number=1
     exon            complement(172544..173337)
                     /number=2
     exon            complement(173384..173694)
                     /number=3
     exon            complement(173717..174319)
                     /number=4
     CDS             complement(join(177218..177627,177680..178637))
                     /codon_start=1
                     /locus_tag="AO090102000071"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000027"
                     /protein_id="BAE61181.1"
                     /transl_table=1
                     /translation="MTRPNQSRYLFRFGIPSIVGGILGLLIWSLWFGVNSDRDNVSSL
                     INHLIPAGHCACQTAVSFECGSCLRCASGLPEDPTPQARAYNPVYDAHNLSLNAAQCQ
                     GFFPGLFEDVHRAQAFWTAKHGISMHDLNDIHLVDGMARAAVVNGQLYVISTHARGDD
                     HRRKILGILGSIHRALASSPNTSALPNTEFIFSVEDKVDDVASPHHPLWVLARKPDEK
                     AVWLMPDFGFWAWEHGKVDGKIGPYTQVVDRIRQKDVPWEEKEAKLVWRGKLSFAAKM
                     RRALLEAARNQPWADVKEIVWKDKTNFISMEEHCRYRFIAHVEGRSYSASLKYRQACG
                     SVVVAHKLQYIQHHHYLLVSSGPDQNFVEVERDFSDLPAKMQTLLDDPASAERIANNS
                     VTTFRDRYLTPAAESCYWRELLDQWTAASRHITDAISPSEFVLRGIRYESFILLDSQK
                     MMQFP"
     exon            complement(177218..177627)
                     /number=1
     exon            complement(177680..178637)
                     /number=2
     CDS             complement(join(180169..180458,180513..180770,
                     180830..181182,181260..181618))
                     /codon_start=1
                     /locus_tag="AO090102000072"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000026"
                     /protein_id="BAE61182.1"
                     /transl_table=1
                     /translation="MRLTPSLISCLSLLHFTSALVAFPGAEGFGANAVGGRQGVVYVV
                     SNLNDSGEGSLRDAVSQPGRIVVFSVGGVIEITDRIVVSKQVTILGQTAPGDGITVYG
                     NGWSFSNADDAIVRYIRIRMGKGGSSGKDAMGIADGKNMIFDHVSVSWGRDETFSING
                     DVSNVTIQNSIIAQGLETHSCGGLMQTDGGVSLFRNLYIDNKTRNPKVKGVNEFTNNV
                     IYNWGGGGGYIAGGSDGESNVNVIGNYFISGLDTSVTAFTRGNENFHAYVETNYYDSD
                     KDGTLNGSELGVDSTNYGGMDLVTEKYDYPAVASVLSPDDALTYVTKYAGASKVRDSV
                     DTQLVAQVESYGKDGALISDEADMGGAGDLDQGTTPTDTDGDGIPDDAEAELGTDPNT
                     ADSMDLDTSGYTFLEVWANSLVPSSYA"
     exon            complement(180169..180458)
                     /number=1
     exon            complement(180513..180770)
                     /number=2
     exon            complement(180830..181182)
                     /number=3
     exon            complement(181260..181618)
                     /number=4
     CDS             join(184289..184419,186338..186549,186606..187726)
                     /codon_start=1
                     /locus_tag="AO090102000073"
                     /note="monocarboxylate transporter"
                     /old_locus_tag="AO070290000025"
                     /protein_id="BAE61183.1"
                     /transl_table=1
                     /translation="MAPSASATSAASQQSGGHLAGGTDIIIPYYVYPADGAWTPLEQL
                     CTMRRFPQYDNFELASDLDLDVRSAVSEPLADNLDESRAVSAFPDGGREAWTCLLGSF
                     LMMFPSFGFQTAVGSVQDYISTHQLSEYSVSDVGWITAVLVFLTLFLGVQVGPLFDRY
                     GPRILLICGSLGSFTSYILLAECCEYWHFMLCLGVLGGVSAAVITTVSIAVLSHWFYR
                     RRALASGICMGGSSAGGAVIPLLLRTLFAKYGWIWAIRVIAFIALGCYTLGFALVKGR
                     LPVSTQSRTTIDIRAFKSPRLCFLAVGVFSFEFIIFGCAALLPTYVRYAGLSLDVQFY
                     SLTVLNAMSFLGRVLPGFAADLVGRFNILLTLVIMTLIVMAAVWLPFGSRDDATLYAV
                     VAIFGFGSGGWLSLAPVCAGQLCKTEEYGRFYGTIYCVAAFGVLLTVPVGGELLQSTT
                     PQVLVGFYSAVLLAGLVSIALSRWALLDWKWRWKVKV"
     exon            184289..184419
                     /number=1
     exon            186338..186549
                     /number=2
     exon            186606..187726
                     /number=3
     CDS             complement(join(187902..187912,187985..188077,
                     188177..188525))
                     /codon_start=1
                     /locus_tag="AO090102000074"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000024"
                     /protein_id="BAE61184.1"
                     /transl_table=1
                     /translation="MNQRKVINDHATDVASAHRVCTAKYHERFIALVAAVEDLRDIQA
                     KDPCFLEYEYEFDMPPSSGYYSDSSDAEESGEDGDEPANFYGSDLDFQEKWRIYHLKR
                     NKIMGLCQSLHFARDHAQEVAICRPILDPSYFLSTSSPNPPDSHVVTA"
     exon            complement(187902..187912)
                     /number=1
     exon            complement(187985..188077)
                     /number=2
     exon            complement(188177..188525)
                     /number=3
     CDS             join(189696..190209,190374..190495)
                     /codon_start=1
                     /locus_tag="AO090102000075"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000023"
                     /protein_id="BAE61185.1"
                     /transl_table=1
                     /translation="MPSQAGRQPILPPKGPKHSFPTSHEPEKKLRAIIDLEIPWNTET
                     NDNPNDLKEPLRTRIDQENLEIERVEGVGTLGNNTGLSLAKEARRRATFVTIARKRFL
                     HLQYKRRNKKKKWVRFTEKDQDDIEAGNNTIHSADIVEDAHFYKGENARQDTYLFQMI
                     YAIPPSAFDKVGHLRKVEYASDYIDTLEKSYEEFRKRDMTDNTTQAFVRTT"
     exon            189696..190209
                     /number=1
     exon            190374..190495
                     /number=2
     CDS             complement(join(193361..193449,193519..193614,
                     193705..194575,194658..194717))
                     /codon_start=1
                     /locus_tag="AO090102000076"
                     /note="threonine dehydrogenase and related Zn-dependent
                     dehydrogenases"
                     /old_locus_tag="AO070290000022"
                     /protein_id="BAE61186.1"
                     /transl_table=1
                     /translation="MVPDVAPQTANPNTGSSETERDNRPMMKALVYTGPNKLEVLDRP
                     MPVIQSPTDAILKMLHSTICGTDLHILKGDVPAIPYDRVLGHEGVGTVVSVGPAIDGL
                     SVGDNVVIAAITACKVCASCRKGLEAHCITGGWQLGNKVDGTQAEYVRIPHATSSLYK
                     IPEGLDLRACAAISDALPTGLECGTISAHVQPGSTVAIIGAGPVGLAVMLTARLYTPS
                     QIVMIDLDDTRLEHAKRLGADHAVNPGKLDAMETLNTFTEGQGFDCVIEAVGIPKTFE
                     MCQKLVAPGGSIANVGVHGHPVNLDLHKLWDRNISIKMQLLNAVSIPTLLRLYQSGHI
                     KPSNLFTHHYPFSEVHKAYHSFQMAAQEGALKVAIDF"
     exon            complement(193361..193449)
                     /number=1
     exon            complement(193519..193614)
                     /number=2
     exon            complement(193705..194575)
                     /number=3
     exon            complement(194658..194717)
                     /number=4
     CDS             join(199301..199675,199998..200273)
                     /codon_start=1
                     /locus_tag="AO090102000077"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000021"
                     /protein_id="BAE61187.1"
                     /transl_table=1
                     /translation="MGGRWTESEGDTITLEEDTVRSIEIWLRHFHGTLDVVTLDDISV
                     ADIWHIILASDKYQFNRNDLLQWFIRWYRNATAAGIHRDNLAKKLMLPCYAFDYAHGF
                     QDLTKRLAYEEKGHIMEINPIDNERMLRGMSRQPCSSCGIEWKRRVGKAIEVTRDYFD
                     GLCLDCMKTTVKADEEYWYHASYRSRHDENCRITHGEPTHYFSLMARRDKRGLVAD"
     exon            199301..199675
                     /number=1
     exon            199998..200273
                     /number=2
     CDS             complement(join(203972..204001,204032..204471,
                     204551..204632))
                     /codon_start=1
                     /locus_tag="AO090102000078"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000020"
                     /protein_id="BAE61188.1"
                     /transl_table=1
                     /translation="MSREDFNKSQIADQPRLPWNWSNLGKNSATTLGISFVSWKQNLG
                     SSDSVMPAVRVAKLTIKNVGSTRRRAQRKCLARAMPAPVAESFLKWVGAACRNDASHI
                     EIGHGQPAGQKRQCGGCFHCPIRLVHHGPIRRDMESDSLSAGMHAAYRKVFVSAISLS
                     LPSCIQLDGTVSSMACSGSRKEQ"
     exon            complement(203972..204001)
                     /number=1
     exon            complement(204032..204471)
                     /number=2
     exon            complement(204551..204632)
                     /number=3
     CDS             205887..207608
                     /codon_start=1
                     /locus_tag="AO090102000079"
                     /note="hydrolytic enzymes of the alpha/beta hydrolase
                     fold"
                     /old_locus_tag="AO070290000019"
                     /protein_id="BAE61189.1"
                     /transl_table=1
                     /translation="MHSSLKLLLSAASLLPLAQAFQYTPLQLAYPELRAKQQLTPESA
                     VKQQSTTAEYPEYYLSVPVDHFHNDSRYAPHSDDHFDLRYWFDAQYYKEGGPVFVIAA
                     GETDATDRFPFLSQGIVTELASAYNGIGVILEHRYYGKSYPVANLTTENIRFLSTDQA
                     LADYAYFASNVVFPGLEHVNLTSKTTPWIAYGGSYAGAFVAFLRKLYPDVYWGAVSSS
                     GVTEAIIDFWQYYEPIRKFGPSDCIWSTQTFIDVVDRILIDHADNKTLGQQLKTSLGV
                     SPDKDDVSFVSLLSSGLDSFQSRNWDSNIGSYSFRSYCDNITSSDLLYPDTEAVKPTI
                     QELIEVAGYDATNSSFVNGFLNHVGLFKKSISSDEDSAETEQSDSSDPKSLPKDDGTS
                     WEYQVCTEWGYFMSGASVPKDIMPLISRVLDVASVSTFCETTYGITSPPNVTNINKHG
                     GFNFSYPRVAIIDGLADPWRDATPHADGTKERESTDDEPFILIDVPAEDVWDGIRGAV
                     HHWDQNGLSKTDEGKGQEPPAAIVEVQKEVLRFIGVWLDQWKKRSRDSSRPLGGIRGP
                     GRSQVPL"
     exon            205887..207608
                     /number=1
     CDS             complement(join(208685..209225,209311..209735,
                     209795..210232,210284..210421,210474..210572))
                     /codon_start=1
                     /locus_tag="AO090102000080"
                     /note="acyl-CoA synthetase"
                     /old_locus_tag="AO070290000018"
                     /protein_id="BAE61190.1"
                     /transl_table=1
                     /translation="MARILEPEKRLPLSNQDLLSYVFDRPAYDRTQSIYIDAHNPSRS
                     ISWNQARTIIRQLIKGLRNAGLQNGDCVAVHSLNNIFYSVVVLAIVGSGGIFTGTNPS
                     YTAGELQHHLKTSQSKFVFCESEFVSPLLESAKQASIHNGNIWVFDTTGDSILPPGLQ
                     SWTHLLKQGESDWVHFDDLVIAKKTTAARFFSSGTTGLPKAVEITHHNLLAQHSLVFE
                     AHPRPYSMSHLIVLPAFHAAIAPLMHIGALRSGYVMYIMRRFELNSYLEFVDKYNITD
                     LIVVPPILTAVLKSEHPEKERRLKKVKNIVCGAAPLDKAIQSQARDLLPKDTPLTQAW
                     GMTETCCASMIFPYPEKDETGSVGRLVPNVEAKLIDDQGRNITAYNVPGELCIRGPTV
                     TPGYFDNVSANSSAFDDDGWLKTGDIASCDEASRKWYIVDRKKELIKVSGFQVAPSEV
                     EAVLLSHPGVADAAVVGARNPGDGTERPCAFVVPKSGMKVTSVELKLYAARRLAKYKE
                     LSGGVKFVDAIPRNVSGKILRRVLRDLCEDDGGLKSKL"
     exon            complement(208685..209225)
                     /number=1
     exon            complement(209311..209735)
                     /number=2
     exon            complement(209795..210232)
                     /number=3
     exon            complement(210284..210421)
                     /number=4
     exon            complement(210474..210572)
                     /number=5
     CDS             join(211222..211548,211610..212185)
                     /codon_start=1
                     /locus_tag="AO090102000081"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000017"
                     /protein_id="BAE61191.1"
                     /transl_table=1
                     /translation="MTEASYIIVGVTAVISCLAIFWAKFRNQGSGTRPFLAEDKVVLV
                     TGGLSGLGREIAELYRVQGAKVAILDIKDEASLPWVPNTMASKYYKCDVSDGSEVEAT
                     LKKIGVALGNPDILINCAAMPINRLPFCELQSESFARTIRTNLLGPVNLTRAVLPLLM
                     QSTKRGSIVNISSVVAHLYPAGLSDYVSSKAALSALHHCLEAEARWFGYDKQVDFFLV
                     EVGQMDTPLFSWIKPPNSLLAPVLEPRYVAEKVFAAVSSGGGRIIRLPKYAAWVCGYD
                     MLPVPVQRFARYVMGVDEALENYK"
     exon            211222..211548
                     /number=1
     exon            211610..212185
                     /number=2
     CDS             complement(join(212490..213429,213489..213535))
                     /codon_start=1
                     /locus_tag="AO090102000082"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000016"
                     /protein_id="BAE61192.1"
                     /transl_table=1
                     /translation="MEKHLEMRSDISTYAVRIAISALLEEVALTRALLDDNFTAHIGN
                     AIVCLSTRLIGSDLTFEQLKNMFPGMLFTVFAFSYSFDIANQAFSVEEDSTNKPDRPI
                     PSGRLTRDGAYRRWLLSWIISLALVGLEVGFQAALVLLEWEVWVALFYVWPKFHNWVA
                     RNLFTAVGATIQLRLLDAVLVKTLPSFRTDSSLAWLLFTWLVWTIHVQEFHDMEGDER
                     VGRQTLPLIVGHRGQFPLRVVTAMIVGGTGISSILLVQLWRTSNPVLLCLGLGHLLFM
                     LTVAVRLVVLPFKEADKITYKYYYTLATYSLLLFRQHTGRLGSFGGNTTELW"
     exon            complement(212490..213429)
                     /number=1
     exon            complement(213489..213535)
                     /number=2
     CDS             join(214456..214877,214916..214919)
                     /codon_start=1
                     /locus_tag="AO090102000083"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000015"
                     /protein_id="BAE61193.1"
                     /transl_table=1
                     /translation="MAPYNDGLLAFLFRQLFYTIPEVPPVELHGKSVLVTGANSGVGF
                     CLALELASHGAKVLAAVRSVPKGEAAKQRILERVPTAQVDVQECDLASFDSVKAFANQ
                     MKQESKTFDLVILNAGVWCSQWMASTDGFDISLQVSVAR"
     exon            214456..214877
                     /number=1
     exon            214916..214919
                     /number=2
     CDS             join(215021..215370,215417..215540)
                     /codon_start=1
                     /locus_tag="AO090102000084"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000014"
                     /protein_id="BAE61194.1"
                     /transl_table=1
                     /translation="MVPTHFMQHNSILDTFKQSPESFDHYTHYYTSKLFGLLWALALS
                     RRIDREKFSVVLASPGLCKSELFRHVRSAPTDILANCFARSCDEGARMIMIASVQELA
                     ENSEPSYYSQGSLVPVSRFSSSAEGLLCQDRLWQEVASTLVQVDPDFEAYLQLAC"
     exon            215021..215370
                     /number=1
     exon            215417..215540
                     /number=2
     CDS             215963..217393
                     /codon_start=1
                     /locus_tag="AO090102000085"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000013"
                     /protein_id="BAE61195.1"
                     /transl_table=1
                     /translation="MAFQFTPMVLTPLDHTMPICYIAFFYALVLDDPHRGVSILKEGL
                     HRLLGECPLLAGNMMRSSSKRSKANVREVRPPTVDSLREFPILRVAHHLNQYIIKKVL
                     DSGERVSSDSLFDERYLPLPLSVATREICPIIRWQANILQDGIYVAVCFHHSVFDAAG
                     FYFIQDALARCCREPNSPALTIPLGSDLLEGRRRMVSSPVVSSDVRGDAPTEDPHTIR
                     VADFNAVEGLVSRRLVLQPAHMECLKDVCNSILRDQSQEEYLTSNDMISALLWLAIIR
                     ARYGPSPDGGGGQETRPVQSSLILITEVRRTLTPPLPISYVGNGIVQSVATSPVQRAL
                     ISDASNAVHPHLPSVTKGDLQLLTDLALKVHSTQSSADNTYVKGIIQEKQRSPDWSPT
                     FKQGDVTSTSIRRMGIYGLDFGETLGRVVEFESPDNRIDGTVCILPARSTSILELRVT
                     LQADTMHRLLQGPLLQWAMRRTLGKL"
     exon            215963..217393
                     /number=1
     CDS             217792..219243
                     /codon_start=1
                     /locus_tag="AO090102000086"
                     /note="predicted flavoprotein involved in K+ transport"
                     /old_locus_tag="AO070290000012"
                     /protein_id="BAE61196.1"
                     /transl_table=1
                     /translation="MSTKEYDIVIIGAGIAGINAAYRIQALLPQHRYVILEARETAGG
                     TWDLFRYPGVRLDSDIHTFGFSWHPYDGDTNMMDGDSVFNYLNETAKQYGIDNHILFN
                     HRVRRAAWSSADNLWNVTSTHLDKEVCIRATYVFFATGYFDHQEPLRAQIPGLDDFGG
                     VIVHPQFWPANLDYLGKRIAVIGSGATAISLVPKLAETAFTVTMVQRSANYILPIPSP
                     GGNRWARFLSSTLPHKVKRFAWLAVTLVGYYACRKFPGAAKDYLLGLVQKQLPKHIQA
                     DPHFTPGYNVWDQRLLACPDGDFFESLHRGNVRIETANIQTCTPNSIVLDNGKSIEVD
                     LVITATGHKLQFGGGSTLEIDGKVCDISKRCLWNGMMLQGVPNAFFALGYLTNASWTM
                     GVDVTALSACRLINYMAKRDILAAMPHAKGPLDPTVRPIWNLNSTYMAVGGDSLPKSG
                     IVSPWQPRTNYIADYLQAKYWSFSDGLEFTRAA"
     exon            217792..219243
                     /number=1
     CDS             join(221972..222594,222653..223335,223401..223471,
                     223579..223614)
                     /codon_start=1
                     /locus_tag="AO090102000087"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000011"
                     /protein_id="BAE61197.1"
                     /transl_table=1
                     /translation="MKIVIIGGGISGCTAYLQLKKHLPKPPSPDEDHEITIYEAYDTN
                     KDTTCDERDGPTHSSTLIVGGGLGIGPNGLNVLKRLDEDLLRDIVRGGYVVPTSNMKN
                     KNGRLLIRMDASDEPTSPNELPMHMLGCSRHWFWRCLRMRIPDRDIVTKRVAEVVASP
                     DGRNVVHFADDSPPVEADLVIGADGLKGIVKRALFPETEGDPFPPHYEGLSGVGGFIS
                     ADKVKDDVEKGSMNFIIGGNGFFGYFYSDSARSAPHRDSPYHVSEPGESLGWWSTYQV
                     DECPNPKTIDKEDVARQLRERYSSWKDPVIQKVLHSLEVSNMYPTWTMPPLPTWERNG
                     VVLVGDAAHALPPTSGQGSSQALEDVEAFVLFLSHYLRKEYETRGPDIDVKAVISTAA
                     KPYMELRIPRVRAILEDAKHRQNIKRDMSIVEEYLMYSFLWILELGWFPSFFAKEMKA
                     VFNYNVADETDHSRTQTYFS"
     exon            221972..222594
                     /number=1
     exon            222653..223335
                     /number=2
     exon            223401..223471
                     /number=3
     exon            223579..223614
                     /number=4
     CDS             join(225673..226262,226376..226428,226523..226548)
                     /codon_start=1
                     /locus_tag="AO090102000089"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000009"
                     /protein_id="BAE61198.1"
                     /transl_table=1
                     /translation="MNLLLLALTLLTTLTSATPTPRQMNILYPYETYRYWVQSGNWKL
                     DPQDQLLVVKNGNAADETTSIVTFNIPPAADGHKCKLLFDLWDRDVSSGSKQADVFTA
                     TKPTGASASDANTDSASLQSVSKEVADVIVQSRDEHVGRISVSAPGTADWVLAYQGYP
                     EFDCPAGQIVGFEFVGVGDEVAIRWDIGVTGPRVQILNNFFYFVHGTEGKVLAEMGII
                     CCKL"
     exon            225673..226262
                     /number=1
     exon            226376..226428
                     /number=2
     exon            226523..226548
                     /number=3
     CDS             complement(226764..228014)
                     /codon_start=1
                     /locus_tag="AO090102000090"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000008"
                     /protein_id="BAE61199.1"
                     /transl_table=1
                     /translation="MPQTAKTGNENINIDLASPPGWTYVGGDTVIGNVVRRSHVVTPD
                     ASVTLTLVGRVKTKITVKRNNGQLTSTSHYRGRWQLFSTSRETLFRGPLHLPEGSVNN
                     PLTWPFSVEIPTRPSDRVLEGHCKEESYLPLDKEILAKNTLPASFFSSNRGWRTSSEG
                     FVEYYLEAQLRYSRSGSFEVETATFPITIRHVPQAGTFIYELQSRLLAGRAKSQRLLP
                     GMEHAELSLKQKTQKLFGSSKVPEFHYTVEVSWPYAIQLDNPMPVPIIISIKPASTSP
                     EISDVVQKVQLNWVNMVIKSQTMVRAPGNLTPTYTHNHSHSSSHPIGLKKAFLRLESP
                     VVFTTGKGNEPVDIGSMFGLLFHSNGSTVGGLRNTTYSGPSPDFITYNILHRNELELE
                     VSLTVAEETKEFKISSGLKILAAE"
     exon            complement(226764..228014)
                     /number=1
     CDS             complement(join(228484..228608,228707..228761,
                     228809..228881,228933..229125,229172..229746,
                     229796..229974))
                     /codon_start=1
                     /locus_tag="AO090102000091"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000007"
                     /protein_id="BAE61200.1"
                     /transl_table=1
                     /translation="MESLQVDNPQPEPQTPRLLLKLISAGFAFFVAGVNDGSLGSLIP
                     YIREAYHIDTNMVAIVYGTTFCGWFFAALSNSHLSQYLDLGVFLVMGATLQVLAHALR
                     TWLPPFPLFAVTFFFASLGQAYQDTYANTFVASVKAAHRWLGFIHAMYMAGCLAGPFI
                     STGVASAGARSRWELFYTAPLGLGVINFALVVFAFRESLAFKRPTQGEMESPQEARQK
                     GAMQEIQKTLAQPSVWILSLYFFFFLGAVITAGGWIVEYLVHVRNGDLNDMGYVPAGF
                     YGGGFLGRLILAEPTYRWGERRMVFIYVLLCVGLELVFWLVPNIITEAVAISLLGFFS
                     GPFFATGISVASKLFTVDIRSSALAVTGIMAAKVGVSVLQPMLVGLLGATGVSWLMLP
                     KSRLHHD"
     exon            complement(228484..228608)
                     /number=1
     exon            complement(228707..228761)
                     /number=2
     exon            complement(228809..228881)
                     /number=3
     exon            complement(228933..229125)
                     /number=4
     exon            complement(229172..229746)
                     /number=5
     exon            complement(229796..229974)
                     /number=6
     CDS             complement(230226..231008)
                     /codon_start=1
                     /locus_tag="AO090102000092"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000006"
                     /protein_id="BAE61201.1"
                     /transl_table=1
                     /translation="MKLYLLFFFFLTLHALPGLPRSTADKPPFFLLAGDSTTAVQSTN
                     GGGWGNGFIQTTLAKGAKGQNYGHNGATTVSFRAGGDWDTLLKKVEEVKANYQPYVTI
                     QFGNNDQKPTANITIAQYTSNLETFVGDVRNAGGVPVLVTPLSRRQYDNSTGVPTIIR
                     SLENERVATIKAAKKTGASYIDLNRASTVYLNSIGPVSAHMYDLKTGDSTHLNAAGSQ
                     VFGGMVAGLIIQDFPQLGDAGFVHVDPKLQTALDKGQYYWPQ"
     exon            complement(230226..231008)
                     /number=1
     CDS             join(234568..234908,234957..236262)
                     /codon_start=1
                     /locus_tag="AO090102000094"
                     /note="amino acid transporters"
                     /old_locus_tag="AO070290000004"
                     /protein_id="BAE61202.1"
                     /transl_table=1
                     /translation="MDKKSVIDDHQVSKEDTGNGTIIQPRETQRGLSSRQVQLMAIGG
                     SIGTGLFVGIGSYLRDTGPLSVFLGYMFYGLLFVWPVNLCVGEMCAYLPIRGSIFELA
                     ARYIDPAFGFAMGWVYFYGGLMLVCTEYSAVATVMQYWTTSVNPTAWVAMALVVCFLL
                     NIVAVKWYGESEFIMASTKILLLIGLVMLTFITMVGGNPKHDVYGFRNWTHGVMYEYY
                     TDGATGRFLGLFSVMVYAAFSVAGPDLPALAAGEIQNPRWTIPRVVKMTFYRIVGFYV
                     VGVLAVGIICSPQDPRLLSAIDSGAAGANASPWVIGIQNLDIHGLPDLINVLILFSGW
                     SCGNAYVYSSSRTLYSLARDGQAPKFLLKCNSAGVPIYCVITVSLLSCISFLVADTSA
                     VTVLYWFIDLTTCALIITYTSMACIFLGWYRALKAQGVDRKTALPWVAPFQPYFAIGA
                     VTIGSLITLFNGFSVFSPFSVQGFITSYFGLAFFVVMFLFWKLYHKTEFVDPATADIY
                     SGKAEIDVECRIWEDGRFEERRKAELAQMHWARRMWEKMW"
     exon            234568..234908
                     /number=1
     exon            234957..236262
                     /number=2
     CDS             complement(236389..237111)
                     /codon_start=1
                     /locus_tag="AO090102000095"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000003"
                     /protein_id="BAE61203.1"
                     /transl_table=1
                     /translation="MTTETIQIRRMTRPDIPYMAHLASTTYFNSPLSQFLSPYRHAYP
                     EDFTRRFVQMIRARYFNPRCIGFVAVSVSNPDIPVAYAQFIRLGNDKAARDLIAAQTS
                     IWNTLRRWFVTVQTWIENLLWPDRSGDADAVRRFEKSAEVDGLRFWDSEEMKRLYGER
                     WHAQSVVVSGDWRRMGIGRRLMGEVLRRAQEDGVFVGLEASEDGEKLYRSLGFELRGR
                     FSLLLDGQDGGGIMMWRPKGGL"
     exon            complement(236389..237111)
                     /number=1
     tRNA            239929..240000
                     /locus_tag="AO090102t00002"
                     /note="tRNAscan-SE"
                     /product="tRNA-Met"
     CDS             241031..241453
                     /codon_start=1
                     /locus_tag="AO090102000096"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000002"
                     /protein_id="BAE61204.1"
                     /transl_table=1
                     /translation="MEFKTMRLQRDTLAVAEQGKQYKQLLNQERAARKAVEDIRKEKT
                     TMVYDQTENCDDSEKKKQHEKERLQREIETRAKEAELERLRKLREEAEKQRCKEQEAQ
                     KKLRTMGVCCMGFRWIKQAQGYRCAGGSYYVSNAKLGL"
     exon            241031..241453
                     /number=1
     CDS             join(243216..244093,244216..244485,244584..244623)
                     /codon_start=1
                     /locus_tag="AO090102000097"
                     /note="predicted protein"
                     /old_locus_tag="AO070290000001"
                     /protein_id="BAE61205.1"
                     /transl_table=1
                     /translation="MRPSTLAAGTIASLATLIQAFTHPGLLHTNTDFERIKTKVHSNT
                     EPQLTGWYKLTNSSFANPSYTPRPQETIYRGKDGTHAENYPNLYKDIAAAYALAIEWK
                     VTDDKTYADAAVSVLDAWATTLKSISGNSDKFLASGIYGYEFANAAEIMRDYDGWEES
                     KFAAFKDMMVSVFYPMNHDFFVRHNDAKIDHYWANWDLCNLASMLSIGVLADNETMFQ
                     EAVDYFKNGTGNGAIEKMVWKLYDVDGQVLGQGQEAGRDQGHAMLDFGLLGAIAQAAF
                     NQGEDLFAYGDNRILAGAEYAAKYNLGKDVPYTTYQNSDVTQTVISENSRGDVRPIWE
                     LLYNHYGVLKKLNATWTKQYRDMVVEKGEGAEGGGGYYGSTSGGFDQLGKVFIVDGGS
                     HLP"
     exon            243216..244093
                     /number=1
     exon            244216..244485
                     /number=2
     exon            244584..244623
                     /number=3
     CDS             join(254910..257097,257158..257243)
                     /codon_start=1
                     /locus_tag="AO090102000098"
                     /note="predicted protein"
                     /old_locus_tag="AO070297000001"
                     /protein_id="BAE61206.1"
                     /transl_table=1
                     /translation="MATNGDSPNPFNLPFANSALRTHHSSSSTDTFTDSTRQALLASM
                     AQPTGFNHRKYSQPASGMLHCRDLFLRSSSFNSSSPLPSTSDMQRYISAYITYFHPHM
                     PFLHIPTLDFQAPEYTNNLRTPSGHLNLSSTGVAGGGGCLILSMAAIGALYEYDTAAS
                     KDLFEAAKKMIQLYLEERRKADMSAAFSRANSARDNSVHNTPLWLVQAMLLNVIYGHT
                     CGDKTSADIASTHCAALVSLARAAELTHHLDARDLPQDYLKAGLGSRDSSQDASPDPE
                     TWASSMGPPRERKDWLDWKIVEERKRTLYAIFTLSCFLVSAYNHAPALTNSEIRLDLP
                     CEEDLWAAESPQAWRKKGGPLASQKGLSFPSALTTLLTASQREQSQSQTPTSNNTTSE
                     DSSNNDLKPSTFGCLVLIYALHNYIWETRQRHMGRQWTARETDAMQAHIEPALRAWQA
                     AWASNPVHSLERPNPFGAGPLSADSIPLLDLAYVRLFVNLGRCKEAFWQRDWNAMSDE
                     LARGTDIVNHVEEIPPDVLDPSITESVFHMDNRRDSVADLGVADLAISKTPTQEHPMQ
                     TLMGVHRPGQSKRERHLRKAAFYAADSISMSDRLGNTFAEFTCRDLPIQCAMCTFDCA
                     QVLAEWITTVQERVGPYLGLLGRDEVDLVQASRVMLLEEEDCKLLEKIKEILASVETK
                     MQAEVQTSATVSTLSVLQRLPSVVEGGYGCKILIATASLLDRAAVWPVTKLMARSLEA
                     QAMRLKERAENSAMRTD"
     exon            254910..257097
                     /number=1
     exon            257158..257243
                     /number=2
     CDS             complement(join(259350..259594,259674..259831,
                     259906..260073,260128..260268,260339..261492,
                     261567..261731))
                     /codon_start=1
                     /locus_tag="AO090102000099"
                     /note="predicted protein"
                     /old_locus_tag="AO070297000002"
                     /protein_id="BAE61207.1"
                     /transl_table=1
                     /translation="MDLQPPSVLAQLPRPLHASKGKTHIGEVYSLSDSKKRKRYEVAV
                     AVDGEAVNIYNLVTSYAVPPQSSFSCEPCSVRRKLSDKSVVKRQTYVAVNPQNEIKCF
                     VEESGGNGSSAPVISSASFSVKDSSTPTVFIGIVPTGSSQVDERNPFDILTVHQDGRV
                     RRLAADLDNQHWSLQHSELAKISSSHAVQACFLVEFEDAKKALFKRRQDLAALALGDL
                     VNSNVDEPSVLLLVSHPTGSKEIKLSDVKVHMFSVPAKTPSQERTLDESQKLKHLLTL
                     SIPDIKGQELFESSGLEWDFHTGSAGLNLSFAKGFVNFDLSQYKPTVTSQFILENEDF
                     SSLMRISPQSVIGAGNSIVALFDTQYKSIQRSISLNDIHESNSSKARTKFISYYAKLG
                     IAVATKGNTLFAFDLSSSNSLLGSSLKRSRDSLLIDAIGRGIGSSASQSVGGTDWSLT
                     CGQPRSQKTAPPSTVPCRRTSRLVALMLCQNSMSIRKTNCPSLPRHSSTLTSGPSTPA
                     NGLLNWAIYLSTTSRLPFADHSSPVSCPHCQPDHSSDELAYTLQFFLNMARSRSAALE
                     ETTQAITSGEENSTEAIQNPEATLQDIFREPRSSPWSTTSASPSQQAATHPASPKTPQ
                     PQSVPTKPPPPSPSTQSQTSSTSPSTPSAHPAGSPPPPSTTLPPAKWTSSQT"
     exon            complement(259350..259594)
                     /number=1
     exon            complement(259674..259831)
                     /number=2
     exon            complement(259906..260073)
                     /number=3
     exon            complement(260128..260268)
                     /number=4
     exon            complement(260339..261492)
                     /number=5
     exon            complement(261567..261731)
                     /number=6
     CDS             join(262470..265061,265114..265812)
                     /codon_start=1
                     /locus_tag="AO090102000100"
                     /note="predicted protein"
                     /old_locus_tag="AO070297000003"
                     /protein_id="BAE61208.1"
                     /transl_table=1
                     /translation="MLEHDPNASRRKRRKTDKSNDVNHSEGSIVQYITAKGSPSTPNG
                     ESTTPAENDTPKVTETGASALPSTPSPDVVAQDKFHVADDSALDKATPRRSPRQKTIK
                     LNPNGKLLSSPVADKSEKSTKKKDRGRGKSGPQRDVGSKHKVVIIKYSNTNDAAESLG
                     KRIDDIINDRTKYAPPVKRQPTVRPTAKDEPGKPTHPFFLKKATRKSDALQHQITNQD
                     STAADKGEEGVIKAPSPSQKPPAPSLGVNKTTICTPFAQRASKFPEPMQPVWPPRDFV
                     HVRGSQSGQPNLQYSPYVDRKKSKMATINIQDKESVLSPKMQGLCQEPAKILRIPDRH
                     VASGNILKKAIADQLSQSTLSNPDSYTLSDTCHPAIAKLYTSIPYSMTAFDRGEYDSC
                     LWTQKYAPTSAGQVLQTTREASMLRDWLRFLMVSAVDTGKASKDGEAKRSLDTKKRKK
                     RKKTENLDGFIVSSADEASELGEVDESEEDELAGGVTVSSRRTLIRSGDLTLEKGRVS
                     NAILLSGPSGSGKTASIYAAAKELDFEVFEINPGNRRSARDILERVGDMTRNHLVHNV
                     NGNDEKSSRESSDIDSLKDEACDPKQNKLMGFFKSTSAGANKDKEIKRQNLEKQTDLK
                     RSRSQKQSFILLEEADLLFEEDKQFWSGVLALINQSKRPIIITCNDESRIPLEDISFH
                     AILRYRPPPQHLAVDYCLLLAANEGHMLKREAIEDLFKSTGRDLRRTITELNFWCQMA
                     IGSEKSGLDWMIDRWPRGCDVDEDGCPLRVISVNSYEPFMGWFSRDMLLLKGLDSEVE
                     SQQEAFSWWALSLQDAERMSDMDAAHATPVASNKERLDRLQYQSNLMDMRSALDVLSL
                     DCSLDLKLDAVDTSIPPMPEKQKANYVDGYPLLHADVVSDHSSLSTSIASTFEVLLGR
                     VFRPCQEANIESLQAEKVLDNVTKPKSTNSPQAEFTRAFETVMRANYVFPLPTGRLSP
                     SFENGLRPISEDLGPYVRAIIAFDLRLEQYRMQLSGLLSQNGQGSKRARTTRASRAAL
                     EGGSKAETRKERWFPPDANPTLILATGGQDWQDLLVQNGYFVVTGSEPSRECNDHAAT
                     ESSSEGGI"
     exon            262470..265061
                     /number=1
     exon            265114..265812
                     /number=2
     CDS             join(266404..266914,266970..267707,267788..267909,
                     267973..268566,268632..268841)
                     /codon_start=1
                     /locus_tag="AO090102000101"
                     /note="membrane coat complex Retromer, subunit VPS5/SNX1,
                     Sorting nexins, and related PX domain-containing proteins"
                     /old_locus_tag="AO070297000004"
                     /protein_id="BAE61209.1"
                     /transl_table=1
                     /translation="MSLFGTSPEDSSAGNSAHRSKSSLFADEPSLGTGSNANLGSSSL
                     FADDDDLSSGSPWNSNVNKRTARHKLVKTLLSDSDAPESYIDAYDLVLSAGDRVGAGI
                     GLTSVREILSGSGISASDQEKILNIVVSGDIDSANGLGRGEFNVLLALVGLAQEGEDL
                     TLDAVDDRRKKLPAPKSLYLDALRANQESGTPAPSQERPITPPRPASPQQAPNSAHSR
                     RESMTGLESDPWGSPELHRGHAHAQLESDHPVLNGYGSVRSATNAWSSRVGEDNNPNE
                     ISNSNRANSQTDSAPSHGSGFGWGESLGNTPSDGGLGGTARAGLGGFGPPSSVHSDSN
                     PRRRSLGIGRVASPPVEEHVTVTLLPEKEGMFMFQHRNYEVKSARRGSTVVRRYSDFV
                     WLLDCLQKRYPFRQLPLLPPKRLSADSNAFLEKRRRGLVRFTNALVRHPVLSQEQLVI
                     MFLTVPTELSVWRKQATISVQDEFTGRDLPPDLEDSLPSTLPDTFETVRGGVKRSAEI
                     YINLCTLLERLAKRNEGLAADHLRFSLALQSLTEVTRDTYAIDTNDVPLLNEGIRATA
                     NHLSVSQSLLEDEARAWEEGVLEDLKRQRDCLVSVREMFDRRDRYARNNIPQLERRIE
                     NNERKLQDLRSRPQGTVKPGEIEKVEDAIIKDKESIVQQHARGVFIKECIRDEIVYFQ
                     QSQYHISRLHQEWSQERVKYAELQADNWRSLSDQVESMPLSG"
     exon            266404..266914
                     /number=1
     exon            266970..267707
                     /number=2
     exon            267788..267909
                     /number=3
     exon            267973..268566
                     /number=4
     exon            268632..268841
                     /number=5
     CDS             271120..274263
                     /codon_start=1
                     /locus_tag="AO090102000102"
                     /note="Na+/H+ antiporter"
                     /old_locus_tag="AO070297000005"
                     /protein_id="BAE61210.1"
                     /transl_table=1
                     /translation="MAWDHLDIDKPHLAYMILGGFTGLFMLCSLFVKEKLYIGEATVA
                     TLCGIIFGPHAANLFNPHEWGNVDKITLECSRIVLVVQCFAVGVELPKSYMNRHWKSV
                     FLLLVPVMTWGWLITSLFIWWMVPPLSWLESLVCAACVTATDPVLASSVVGKGKFAKR
                     VPKHLRDLLSAESGCNDGMAFPFIYLSFYILRYRPDAGKVTLNWICVTILYECIFGAV
                     YGFLIGYFARHSIKYAERKQLIDRESFLVFYFVLAVFCAGSGSLLGMDDLLIGFAAGV
                     GFSNDGWFTEKTEESHVSNVIDLLLNLAYFVYFGSIVPWEMYNAPELGLVPWRLVVIA
                     ILVIFFRRIPIMLILKPIIPDVKTWREALFAGHFGPIGVGAIFAAILARAELETDSTQ
                     PLTEAELPKAGTADYYIVQLIWPITTFMVISSILVHGSSIAVFTLGKRINTLTITLSY
                     TTANEEGPSWMNRLPRVQSIAKGSMSFRKPDDTDASSNEQEYPPGTLPPIGVPGNFLR
                     RVRDEDTESPTGRTSSRRPRRRRRHASGAGGPISQSAIAPQRTVESEDAEEEDERDKI
                     EREGSPPSKERDQFGREPIVEAYLEGHHMIIEDEEGNVLKTEDVSHVSPEERQRHIEA
                     QRDRLLQEKSGEFAKSKSQPHARSEGEEVEEALEEKAGHPLEKARKRFGQWIGLGKGR
                     AQEVEDQEVEKAPTTKQQPTATDKKPKGKSRSAHAYQFGNTIIVEDEDGEVIKKYSIP
                     STDKPETGAPVRRGLTRMGTWFGMDGEGEPSQAEKKSANDDWLADDGLRFTVADDDNI
                     SKKGVSHKGRRMNKHEFVQQLRNLGPRARRELVEETDVPQHVKEVARDEARDAERKES
                     LAGGSAQDTQHGTTPARPASISSSESSNGSDIGVPGDNIAASLARFTRGTAAEERRST
                     LNPSTRPRSRRDSEDDGTERVPPAQLREAAGLSPPPQQDDDDTGETPAERRRRLAALG
                     ELNLDDSDESDAAVESDSEDNTGFRRVGSKVQFVEGTKPSDSGNGSNSNQGNGSSSSS
                     SAHQRSISWGGEKGREA"
     exon            271120..274263
                     /number=1
     CDS             complement(join(275537..276564,276646..276807,
                     276867..277134))
                     /codon_start=1
                     /locus_tag="AO090102000104"
                     /note="predicted protein"
                     /old_locus_tag="AO070297000007"
                     /protein_id="BAE61211.1"
                     /transl_table=1
                     /translation="MSLHTSYHADSDADDEYERSVITSPHLATDSEASPSESDFPSSE
                     QTPTTFANADEHPKSPKTIITEWTVEECAHFLASLGLRQYCPAFLENEIVGEALIALK
                     HDELKEMGIASVGHRLTILKSVYETKVKQDIPLDADHYIPLSADQSMNETASQEDVAR
                     LIQSIRLRDERIVTVESELRRMAEDYRRLREELLPVFKMAKDRSQPLPPPTSMGISGP
                     DGYHDSQQTLVSPSGITLLDRSGTLSRQISKRLNTGGTTPKNNSPTHIPPSIHEGRMY
                     QDSGVLDPSSALYTNGKSQLSPGIPSPTSPGVQYTAAQTLGSRSYQPAPNTSRSPHDH
                     HDEPSTSQNRERLNPTPTQPNRPDIPTRSDSRAGNGNDPPSVEIFKSFRVSMEDPCYK
                     VLPAALKKYNINADWRQYALYIVYGDQERCLGLDERPLILFKQLEKEGRKPMFMLRKQ
                     LQHPVESNYPPVNPVPNSAGFESRQAQINLPGGVL"
     exon            complement(275537..276564)
                     /number=1
     exon            complement(276646..276807)
                     /number=2
     exon            complement(276867..277134)
                     /number=3
     CDS             join(280774..281367,281459..281527)
                     /codon_start=1
                     /locus_tag="AO090102000106"
                     /note="predicted protein"
                     /old_locus_tag="AO070297000009"
                     /protein_id="BAE61212.1"
                     /transl_table=1
                     /translation="MATSQSTGITPASSESLESDLLAHLASTTALDDLHATLLCSLQR
                     MGWTEKVRKLSQELLRGGRCERFDDVVEAVVASAEGRKHPSLAGLDNVNEEDKNSNGD
                     ADGYFEKVDVRIPEAVVEQGVRAIKEVLREVVVLDDDSDLLDHHDSHHHAGDGKQEGG
                     GETKTKPSKSSKTGDQSLKNGDTSPVKKTDKKPKPGKQGTSGFGILVWITCHGSSGEI
                     GV"
     exon            280774..281367
                     /number=1
     exon            281459..281527
                     /number=2
     CDS             complement(join(281909..282498,282557..284048,
                     284111..284360,284434..284489,284550..284577,
                     284632..284681))
                     /codon_start=1
                     /locus_tag="AO090102000107"
                     /note="AAA+-type ATPase"
                     /old_locus_tag="AO070297000010"
                     /protein_id="BAE61213.1"
                     /transl_table=1
                     /translation="MSAEPDHTHDKKRVHLQDASGAEKKEELDTATAILKKKKKPNSL
                     IVTDAVNDDNSVIALSNNTMETLQLFRGDTVLVKGKKRKDTVLIVLADDDLDDGSARI
                     NRVVRHNLRVKHGDVITVHPCPDIKYAKRIAVLPIADTVEGLTGSLFDVFLAPYFREA
                     YRPVRQGDLFTVRGGMRQVEFKVVEVDPPEYGIVAQDTVIHCEGEPIQREDEEGNLNE
                     VGYDDIGGCRKQMAQIRELVELPLRHPQLFKSIGIKPPRGILMYGPPGTGKTLMARAV
                     ANETGAFFFLINGPEIMSKMAGESESNLRKAFEEAEKNSPAIIFIDEIDSIAPKREKT
                     NGEVERRVVSQLLTLMDGMKARSNVVVMAATNRPNSIDPALRRFGRFDREVDIGIPDP
                     TGRLEIMQIHTKNMKLGEDVDLETIAAETHGYVGSDLASLCSEAAMQQIREKMDLIDL
                     DEDTIDAEVLDSLGVTMENFRYALGVSNPSALREVAVVEVPNVRWEDIGGLEEVKREL
                     IESVQYPVDHPEKYQKFGLSPSRGVLFYGPPGTGKTMLAKAVANECAANFISVKGPEL
                     LSMWFGESESNIRDIFDKARAAAPCVVFLDELDSIAKSRGGSVGDAGGASDRVVNQLL
                     TEMDGMTSKKNVFVIGATNRPEQLDAALVRPGRLDTLVYVPLPDQASREGILKAQLRK
                     TPVAPDVDLPFIASKTHGFSGADLGFVTQRAVKLAIKQSITADIERQKQREANGEDIK
                     MDEDEEVDEEDPVPELTRAHFEEAMKTARRSVSDVEIRRYEAFAQSLKNSGGSSFFRF
                     PSAGEVQDNNTFGEAGNDDSLYD"
     exon            complement(281909..282498)
                     /number=1
     exon            complement(282557..284048)
                     /number=2
     exon            complement(284111..284360)
                     /number=3
     exon            complement(284434..284489)
                     /number=4
     exon            complement(284550..284577)
                     /number=5
     exon            complement(284632..284681)
                     /number=6
     CDS             285886..286482
                     /codon_start=1
                     /locus_tag="AO090102000108"
                     /note="predicted protein"
                     /old_locus_tag="AO070297000011"
                     /protein_id="BAE61214.1"
                     /transl_table=1
                     /translation="MECKPWYPADFNQALLNTFTEETLKELLERPDCAPRFVYGVLML
                     PTVLKYFIGEDPATDITKRMTRACISGYMLYQISPKSPPVVVETSNPHDTVHGMLVLG
                     LDVNQRNLIYELEGGLMNLVDVRAQIRLKDGSLPCHDICSGRMVDAGMFVWHGSKEGL
                     IPVESTAWPLDWFLKEKFYENIVNSQHRNLLDGSGLFL"
     exon            285886..286482
                     /number=1
     CDS             complement(join(286819..287560,287679..287860))
                     /codon_start=1
                     /locus_tag="AO090102000109"
                     /note="predicted protein"
                     /old_locus_tag="AO070297000012"
                     /protein_id="BAE61215.1"
                     /transl_table=1
                     /translation="MADTENPPDSSAPAVAEPPNVGKSASPAGGSPPQPSSLSVAQRQ
                     LLGALRATDVTIGRLDKLMSSAYGQERVFAVTGYLTHALHHLLASAPWIALQTRLGLL
                     ARLRSKTKPVASNSTPSQSRLLALSALMSETRYSLRLLGLFPLWTWGSATLKSPPSDR
                     ILYALTLLQVAVNMIYQALENAGFLASKGVISKKFIDRWGGIDKWYIWSTRAWFGHIF
                     FQFFVLWREHVLRKKRMSGEVSDEKKEEALRAEVRAWKKSLVNNTCWAPLCLHWCFEK
                     GIGFPDSLSGVVSFMAGGWGVYDLWTATAKS"
     exon            complement(286819..287560)
                     /number=1
     exon            complement(287679..287860)
                     /number=2
     CDS             complement(288548..289753)
                     /codon_start=1
                     /locus_tag="AO090102000110"
                     /note="predicted protein"
                     /old_locus_tag="AO070297000013"
                     /protein_id="BAE61216.1"
                     /transl_table=1
                     /translation="MADSEQGDSGGNTGIHQTGSLPILQVPPLTSNYRLVRQYQVSTQ
                     EDYVWPAPELQLPLDYQNYYTGHPLMAPPTTQSAVRQRRCHHSVVERQFCVDRMETCN
                     SCGRRPFLGWLYLCVEDTSGFSDPLDPINGPFLSPWILKAMEDGHYTTEQKEIVIHQK
                     LNVVRTAERERGPVPPPLSMLYAERSAQNGHNLDDPWVELVEDVSQRDESAPRTSEST
                     VRLDHPEQTSQLLQRSHPSLPCTFQACRHCERRHGNLEERTWISLNEICNDPSIPPPD
                     SWELLERPVSDANILRNLELPSGHFWPGSPNASSSDYSITESCEDISARLYSQENTTS
                     TNLHELLHQSLNISVRSVESEQAVASYTSRLSESIVVGMAISAFDDHLASLPWPDSLE
                     HGHDDGNTE"
     exon            complement(288548..289753)
                     /number=1
     CDS             join(291297..291485,291586..291861,291939..292256)
                     /codon_start=1
                     /locus_tag="AO090102000111"
                     /note="predicted protein"
                     /old_locus_tag="AO070297000014"
                     /protein_id="BAE61217.1"
                     /transl_table=1
                     /translation="MSVKFQDKFQDQVTQQVTEQIKGQIQGQFQEEAAKSIRQDTKEL
                     VHKVGERLTGGNPQNGYMAMYLRQLQKNPLRTKMLTSGVLSASQEYLASWIANDVSRN
                     GHYFSARVPKMLLYGMFVAAPLGHFLVGILQKLFAGRTSLKAKILQILFSNLIISPIQ
                     NAVYLSSMAVITGARTFHQVRATVRAGFMPVMKVSWITSPLALAFAQKFLPEHTWVPF
                     FNIIGFFIGTYVNTHTKRKRLEALRKVNALFNLFIPETNSQS"
     exon            291297..291485
                     /number=1
     exon            291586..291861
                     /number=2
     exon            291939..292256
                     /number=3
     CDS             complement(292903..293310)
                     /codon_start=1
                     /locus_tag="AO090102000112"
                     /note="predicted protein"
                     /old_locus_tag="AO070297000015"
                     /protein_id="BAE61218.1"
                     /transl_table=1
                     /translation="MVAHADNLRSRIPTQPDLFRRVYRYTFPLCRMQGQRNLQFEIAA
                     EQWKLFFTPDKGGVQWETETTPWLDWWIEFMEERGKKPVNKDLWEQVEVFMRKTLDDE
                     RFGWWSADGAWPGALDDFVVWVQKKRGDNMEVE"
     exon            complement(292903..293310)
                     /number=1
     CDS             complement(join(293392..293570,293619..293689,
                     293733..293812))
                     /codon_start=1
                     /locus_tag="AO090102000113"
                     /note="predicted protein"
                     /old_locus_tag="AO070297000016"
                     /protein_id="BAE61219.1"
                     /transl_table=1
                     /translation="MRTRSSGKSEYLCLPLAKPTRASKRRKFFQSPQGAGGATSSINK
                     IFDSYRDSPDDNPDGIGIEGAMKFLGDIQVQLDEVTCLGIAELLKSPSMGEFTREGFL
                     NGWRAVG"
     exon            complement(293392..293570)
                     /number=1
     exon            complement(293619..293689)
                     /number=2
     exon            complement(293733..293812)
                     /number=3
     CDS             complement(join(295464..295487,295543..295644,
                     295702..295871,295923..296184))
                     /codon_start=1
                     /locus_tag="AO090102000114"
                     /note="ribosome biogenesis protein NIP7"
                     /old_locus_tag="AO070297000017"
                     /protein_id="BAE61220.1"
                     /transl_table=1
                     /translation="MRQLTEQETKTLFEKLANYTGRSLNNLITTSDDPNDRYVFRLHG
                     NRVYYMKLSLANLSTAIPRANLLSLGTCIGKFTKSGQFRLHITALDVIAPHARYKVWI
                     KQNGEMPFLYGGNVVKAHVNRWSDDCPEHAGVVVFNSNDTPLGFGVTARSSAEARKLE
                     PTAITVFRQGDIGEYLREEDTLFTT"
     exon            complement(295464..295487)
                     /number=1
     exon            complement(295543..295644)
                     /number=2
     exon            complement(295702..295871)
                     /number=3
     exon            complement(295923..296184)
                     /number=4
     CDS             296380..298434
                     /codon_start=1
                     /locus_tag="AO090102000115"
                     /note="protein involved in the nuclear export of
                     pre-ribosomes"
                     /old_locus_tag="AO070297000018"
                     /protein_id="BAE61221.1"
                     /transl_table=1
                     /translation="MAPGRTNKRRRLSPPGDEGNGTSKTSKASALNNFYSNASEWDLE
                     QDYERRPRKLGKKDKERTRLPIKTAEGLQNLEEPELEESDSFLGTDGDEEDAASDAED
                     DMDEDEETPAEEEKPKIPLKLQILQAKEELAKLATLINEDPEEHLGSFKTMAEMVNNG
                     AHVAIKKLALASQAAIFKDVIPGYRIRPLSEGEMTTKLSKEVRKLQNYEQSLLSHYKH
                     YVQKLTELTKSSKASQEEVDPSLKSIAINCACNMLLSVPHFNFRSELLKILVNRLAKR
                     QVDADFIKCRETLEEVFSRDEDGVVSLEAVRLLSKMMKAKEFRINESVLDTFLHLRLL
                     SEFSSKASRDRVDREPEENTFRGKKKQKKEFRTKRERKIEKERKAVEKDMKEADALVS
                     HEERDKNQAETLKLVFGVYFRILKLRIPAFMGPVLEGLAKYAHLINQDFFGDLLEALK
                     DLIGHADRDELEDDVEDEDSESATTSRDSQREALLCTVTAFALLQGQDASKAASTLHL
                     DLSFFIKHLYHSLYSHSINPDIEFNPNKSLRLPDPDDNSSPQQLKRNKVNFQTPTVLL
                     LHCLQSTLLSRAQGIPPPVRVGSFTKRLLTTSLQVPEKSAIATLSLLNQVAKHHANRI
                     SSLWHSEERKGDGVYNPYATDIEATNVFAGTVWEGELLRLHYCPQVRDAAVDMEKMIS
                     RK"
     exon            296380..298434
                     /number=1
     CDS             complement(join(298913..300320,300337..301573,
                     301691..301901))
                     /codon_start=1
                     /locus_tag="AO090102000116"
                     /note="predicted protein"
                     /old_locus_tag="AO070297000019"
                     /protein_id="BAE61222.1"
                     /transl_table=1
                     /translation="MADCDKDQEAQTRSESEDKELREKPKVKLPLVPTVPGNAWSQMR
                     AREQEHIRERELHKLEFGELGYDPNTGLDYDEALALPMPKPRLMAVSSSVPVLEPTVS
                     KPNVLTKLSGLKTQGDKEAHPGDKGAGTKVEGEKKKSMMATLRSKLSFKELGKEFRKA
                     QDPPLSAMPRLPSNAGTPQVGKTKQSPPESVDFDEERLYVPKPRDPGVHPASAPVQTT
                     RFSDSGSFVSSKQSASSCPAQQAKGNDRLDAKALRDTQEQHRPHKKVGNVEPMTRLDT
                     VLIDGSSPLASTGDTSRGHPAVVDAERRYISLKVENETSVPSKPKTDATSTESPASYK
                     LSTSNAPKGIAPVSSSCERKQSTVEKNRPLVVSSDQQRPPSVRTQDQTEVTTPSGQYS
                     RRSSSRSQEHMASSSGQADPAFDPTHMRMPFDSQLPIDDPRFYSGVTTHGGYAPPPPH
                     PGYQNTVTLEQQISTYMDSLHIHVDGTANKLARNNWSTDQILRGTGHLSELMRKLNNR
                     VMSDTEVMRELQRVMMDVKIQVGAIQREQRQMEDRMTQVFQSEYNKLKGEISALASTV
                     KSNLPYNPVEDARSMNTRLQGSRDVIRWSKDNERPQQFMKMKSRQMRKEEVVTKNTES
                     RGEEHNCESVALDNKHAEEHTLTDDVPTPMAAFPTPGLHSDDRKDHFTDPHPRRLILK
                     DPSKISTGSPEPLHSSSEKGKERTASSQTLVHKASAEIMKFPAKMGLFYPFRRGRDRR
                     SSESKAASRSLPPAKRGKDDKTPEEQDSIKQEPLPFTPPLQTRAIATIGAEHHQVEVS
                     PSRVHPALRNLAQQQIMAERERLNNQETMTSRQLLRSSRSFQDLNSRSRNAASFDWID
                     SSIESPSESTSRSQNQQDLAMGFPALTTASLRSSSRARSPLTAFAEARMSQASDVSFY
                     YRGPTPPPRGSEASESSLPTWYQAAYAYKSIEKPDDD"
     exon            complement(298913..300320)
                     /number=1
     exon            complement(300337..301573)
                     /number=2
     exon            complement(301691..301901)
                     /number=3
     CDS             complement(join(303136..307151,307235..307508))
                     /codon_start=1
                     /locus_tag="AO090102000117"
                     /note="predicted protein"
                     /old_locus_tag="AO070297000020"
                     /protein_id="BAE61223.1"
                     /transl_table=1
                     /translation="MVESITETVTISVRRPTDTPTIFVAGTFSEPQWEPLELNVKTIE
                     VESELDPGLYSTEYLFFRDFKLAPGQYQYRFREGATGSWFHDESVKNASGTEGLVNNY
                     LTVKSAAEQETPAQNGASEKAEEATKEPETDASTEGGPVTNGVHKSNGVNGVAEHEAP
                     VADESPADDQKTEQVPEKPVETDAKAETEAEPKEALSNGTKEPEVNGTEPAAQTSESK
                     DEPVAEEKSDPVVERPEEKVAESQPVAEKEGTEKKAEEVPATSTQEEAPVVNGEAKVE
                     AEKQPEESQPQKATEKVAVKPEEPAVEMSTPEVTAEETPAQESNTEKPTATETPAAET
                     TTEQPATEAQPTAEEETTKEPATEPAETKQAEVVSEEPAKEEPTPEEPKEAPATEELV
                     KESVKEEAAPEQSKETVSEKPAAEEPVKEETTEAVKETSATEKLDESDKAPVQEETAA
                     EESQETTKEPVKEEIAPGKSEETPAIKAPVAEEPAVEEPVEEKAAPEEPKDISAADPA
                     VVEAPVKETVKEEGVSEAPKETSAEEPVKEAVKEEPVPEKTEQPAAPEPAVAEEPAKE
                     PVKEEPVPEKTEEPAAPKESVKEIVKEEAVSEAPKETSAEEPATNDTAAQDKPSTEET
                     VVEAVKEVPVVEETKETLSTAAPDAQESVAQEPVIKSSATEDAPSEPTKESGAEKAVE
                     EQTTEQPTYADVVAEEPAKETTTEETEAPVETTSEEPVESVPESTTAEAPAATEESKQ
                     PAEKTSEPAAEDEKAPIEKPVEETKAEPASEEATTKEEVVQPSVEEAPTEEAAKVSPA
                     EEGEKIVEAAKEEVPEEASAKTLVEVEATTTEPVVEEPTSEKPVAEETTAEEPAKDLT
                     KEEPATQEPVSEVPATEDSTTKEATEEPTKASGPEVAAEEPTTDEKPADVTEHEIKEP
                     VTEESKETKHATEETTLEEPVKETPVVEQPVESEPAKEAEPVKSTAEESVKELAAEEA
                     AVQEPTPVEQPSEEPAVKESPVEEPPTVEGSVAAEPSTEEPAAEQPAKEAELVSEVLT
                     TEEPATKQAAEPEPAEQPAAEEKPVDDSTEKPASEETVAEDSVPEPTEKAVVAETPAT
                     EEVVEKATTEEPAKEPVSEEPVADKSAEQPASSDVVEETAESSKAVVPEEVTLNEVEP
                     AVTQSHEEKPEEVTELPKEETVAAEPVAVETPAEQKAPETEPEVVPKAEAEEAVIAQK
                     EEPASEPVAAAPAEAEKEEPVSVSSGEPPVEKESTDTAEVVPEATKEDAPEQDGKNNA
                     SAELIGVGAAAAVAASAAAAAAGVAALSHTDKEPETASAEESQPTKGEDKAASLAPES
                     QPSASKHAPLPPSENPEADINEPRSGSEEPAASTNEPSTTAEPATATETTADKAVAQK
                     GDASRSPSQTRAVTLSNTKNDSWLKVILRAVFVNFFGTIFSPFRRRPRNDQ"
     exon            complement(303136..307151)
                     /number=1
     exon            complement(307235..307508)
                     /number=2
     CDS             complement(join(309814..310020,310139..310870))
                     /codon_start=1
                     /locus_tag="AO090102000119"
                     /note="predicted protein"
                     /old_locus_tag="AO070297000022"
                     /protein_id="BAE61224.1"
                     /transl_table=1
                     /translation="MPPASSSFTALNLPETFSLPQCMEYFTLTAGPNTDLWRKPPNGD
                     TSTAPIIFTSLRNPFILAEVTVSADWEMEWDQGGLVIFAGAAPQSCSSESVPLDSGTR
                     SSRSGYPQIARPCKWVKAGMEFSSGTVNASSVSATADGADWCLSPLSLPDSGPSTVQS
                     LRIKLERIGNSLWIWYQIPSAVPYALTPSAVSSTWKKLREVTWFFYGVEDKFIHVGVY
                     ASRPNNISRNSTMWEMMNGPVLSESTRSHDPRMAYEPTTPCFAPLVGPNMLSLFLFLP
                     LVYHNCFEDTVSSIQGDMMSVPVFFYHSVLLLLRDT"
     exon            complement(309814..310020)
                     /number=1
     exon            complement(310139..310870)
                     /number=2
     CDS             complement(join(315825..316127,316213..316880,
                     316938..316983))
                     /codon_start=1
                     /locus_tag="AO090102000121"
                     /note="mitochondrial ribosomal protein L17"
                     /old_locus_tag="AO070297000024"
                     /protein_id="BAE61225.1"
                     /transl_table=1
                     /translation="MSSGSNGARRIASVLRPSIADPKVCRSCQETLVRRNYSSAAAQP
                     SSESTSTATTTFPVVKPVYTINAGVALSRPPQITRDLSQFEKAYYFYQKRLNERLALP
                     FTKYFYFKRGTPADEDWKRKIRERQTAARDIGKYNAYSKDAWNDELLVGAVEAEPEHQ
                     VEMLVQDAEATVNATSQDTSKKEEIPRPFPRVTEADQKNDQRSLNRALQRTLYLLVQT
                     KEGYWRLPSSPVEQDETLRLAAERTLAQTAGVNMNTWMVGFHPVGHHVYNFRYPRVDK
                     ANGTEHLGEKTFFMKARIMAGQADLAANTQNLQDFKWLTKEEIAPYVLPQYYSNIKNM
                     LAER"
     exon            complement(315825..316127)
                     /number=1
     exon            complement(316213..316880)
                     /number=2
     exon            complement(316938..316983)
                     /number=3
     CDS             complement(318028..318645)
                     /codon_start=1
                     /locus_tag="AO090102000122"
                     /note="predicted protein"
                     /old_locus_tag="AO070297000025"
                     /protein_id="BAE61226.1"
                     /transl_table=1
                     /translation="MPSVLNNFQKRLVHQLIEVEYPSLVTISRPAFIQVIDYDEDREK
                     AIQEQRMARARERVWKQIGFRWIVEALSGGDLSHLDPFCFGSIMNSSTVVEPQVSLHG
                     FSEKLQQRLRTHRPVLVGHNLFTDVVYLYRCFFGPLPDKLEEFQAIVHHMFPILMDTK
                     YMATHDCGSITPKSSLSEINDNLLHIKTPKISAENASPYIVVASS"
     exon            complement(318028..318645)
                     /number=1
     CDS             join(320033..320472,320529..321402)
                     /codon_start=1
                     /locus_tag="AO090102000124"
                     /note="predicted protein"
                     /old_locus_tag="AO070297000027"
                     /protein_id="BAE61227.1"
                     /transl_table=1
                     /translation="MAADDSVSQSQLSTSASSLSPSKICSKTYKKASQLYLTRRLQET
                     LTTLEPILTTSQTNDDQYANGNESLPPIAMAQASVRIKVWNLYITLLSAILDLGPEEG
                     KATFGQKEWKAISTKVREGEIWETVVQTGYKGREGSVDAEVVYNLATLLLNHSPSQKL
                     NQQRLEHYLSSYGQPNLDIAEHMQNSPSQQSKARVNGGTDTPRDLTSRVRIIELFTLH
                     VLPRNEEWDYASEFINFSEVLDEERKEMFLQTLDGLKEEREQGELRAAALQREKDAQL
                     EREMQEAERQRAEEEAAAAQHSQKGHTRDNSEVDYGIEKTNPNGSVKSRGKGEKQSGS
                     KANSSSNRTNTLSPTGSKKRPEKPVSRPGQTRALANVLRNLLRYISKTVAGNPMSFAR
                     TLLFLLGLLVALSRQGVRERLRRITGAGWQKVKGTVGMGVKVSYI"
     exon            320033..320472
                     /number=1
     exon            320529..321402
                     /number=2
     CDS             join(324800..324881,324935..324982,325041..325090,
                     325151..325349,325415..326028)
                     /codon_start=1
                     /locus_tag="AO090102000125"
                     /note="mitochondrial tricarboxylate/dicarboxylate carrier
                     proteins"
                     /old_locus_tag="AO070297000028"
                     /protein_id="BAE61228.1"
                     /transl_table=1
                     /translation="MSTKSAQGNGNGNGNGKKPASAAVNLIAGGGAGMMEALVCHPLD
                     TVKVRMQLSRRARAPGVKPRGFVATGVEIVKKETALGLYKGLGAVLGGIIPKMAIRFT
                     SYEWYKQMLADKETGHVTSKATFLAGLSAGVTEAVAVVNPMEVVKIRLQAQYHSLADP
                     LDAPKYRSAPHALFTVIKEEGFIALYRGVSLTALRQGTNQAANFTAYSELKAALQRWQ
                     PEYADTQLPSYQTTVIGLISGAVGPFSNAPIDTIKTRLQKTRAEPGQSAVSRIMAIAN
                     DMFKQEGARAFYKGITPRVMRVAPGQAVTFTVYEFLRGKLERSNWAFVGGKFEE"
     exon            324800..324881
                     /number=1
     exon            324935..324982
                     /number=2
     exon            325041..325090
                     /number=3
     exon            325151..325349
                     /number=4
     exon            325415..326028
                     /number=5
     CDS             join(327247..327312,327395..327646,327707..327823)
                     /codon_start=1
                     /locus_tag="AO090102000126"
                     /note="predicted protein"
                     /old_locus_tag="AO070297000029"
                     /protein_id="BAE61229.1"
                     /transl_table=1
                     /translation="MPVDDEAKNALASLQPGDLVQLAIDIPKETFVLAGVENGTVPSS
                     VESHISSSSPRYTFYHYPDTDVVIFVYTCPSGSSIKERMLYASSRMYALQLAEDQGLK
                     ISKKIEASSPDEITGDRLQEEVSPPQNDGLNRGFARPRRPGR"
     exon            327247..327312
                     /number=1
     exon            327395..327646
                     /number=2
     exon            327707..327823
                     /number=3
     CDS             complement(328036..328362)
                     /codon_start=1
                     /locus_tag="AO090102000127"
                     /note="uncharacterized conserved protein, contains CXXC
                     motifs"
                     /old_locus_tag="AO070297000030"
                     /protein_id="BAE61230.1"
                     /transl_table=1
                     /translation="MSRHHPDLVMCRKQPGISIGRLCDKCDGKCPVCDSYVRPTTLVR
                     ICDECSFGNYQNKCIVCGGEGISDAFYCFECTRLEKDRDGCPKIINLGSSRTDLFYQK
                     KSFRNH"
     exon            complement(328036..328362)
                     /number=1
     CDS             join(328879..329337,329382..329387)
                     /codon_start=1
                     /locus_tag="AO090102000128"
                     /note="predicted protein"
                     /old_locus_tag="AO070297000031"
                     /protein_id="BAE61231.1"
                     /transl_table=1
                     /translation="MSRTLASAVVLPEQDNLPPSPDAGLKRRNSVAEADSESKRRRLS
                     SQQDHTGDRSPAERKQSSPDGAERKPERRPGRGGREEERKRGQRLFGALLGTLSQSST
                     SAAQKRRADIERRQQDKLKLQDEEYGELKKKRREERIAIRKKEQRLYEEESG"
     exon            328879..329337
                     /number=1
     exon            329382..329387
                     /number=2
     CDS             join(329439..329477,329533..329937)
                     /codon_start=1
                     /locus_tag="AO090102000129"
                     /note="predicted protein"
                     /old_locus_tag="AO070297000032"
                     /protein_id="BAE61232.1"
                     /transl_table=1
                     /translation="MSHFLKTRTEPVLYYKPWQLRSGDEAIIREQVEEAEATVAREVA
                     EFEARYPAHEEDTSKKQDEVTQEDRDQAPEPEAEFKENKDTTHETGAVGAETNHNRDS
                     EAAPSDATAINNNNIPINNDHADVHRGAEDDGGEVVEDKEDTVIY"
     exon            329439..329477
                     /number=1
     exon            329533..329937
                     /number=2
     CDS             join(330445..330523,330664..330692,330805..330912,
                     330993..331102,331182..331512,331579..331630,
                     331695..331972)
                     /codon_start=1
                     /locus_tag="AO090102000130"
                     /note="soluble epoxide hydrolase"
                     /old_locus_tag="AO070297000033"
                     /protein_id="BAE61233.1"
                     /transl_table=1
                     /translation="MIVDKIHVTGDLRVERRFAAINGKTYGYLYSAPDTGLHGFPDLS
                     MGWRYQIPMLTDMGLRVIAPDCLGYGRTDAPEDPHHYSHKSCANDIKELAFQLGIPKI
                     IVAGHDWGAALAYRVALWHPELVTHIITVCVPYAAPTRRYFPLKDMVEKITPHFYYQL
                     QFISGELNKYVETKEDIKRFLSAMYGGRTPENEMAFDAELGILPDKLARVLPSELLSE
                     EELEYYAEEFSRNGFHGPFNWYRTREINYKEEVAILNKRITAPVLFIQALRDTALPAH
                     LGRGMTKTIPHMTFKQINTSHWALWEKPEEVNEIIAWWLDEVVFRDPRMFKL"
     exon            330445..330523
                     /number=1
     exon            330664..330692
                     /number=2
     exon            330805..330912
                     /number=3
     exon            330993..331102
                     /number=4
     exon            331182..331512
                     /number=5
     exon            331579..331630
                     /number=6
     exon            331695..331972
                     /number=7
     CDS             complement(join(332343..333051,333109..333233,
                     333290..333395,333414..333585,333619..333808))
                     /codon_start=1
                     /locus_tag="AO090102000131"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070297000034"
                     /protein_id="BAE61234.1"
                     /transl_table=1
                     /translation="MESKREFDLILLGPTGYTGRLCAEHIVKNFPTGLKWALAGRSLQ
                     KVGDVAKELKNLNPDRVEPANIVDLLLEILAVQLNREELHSLAQKCRVLLNCVGPYHL
                     YSTPVVEACASNGTHYLDVQALDAMANLCSTGETPWIKSIIEKYHETAKSNGAIIIPS
                     VGVESAPADMLSWALVKRIREELSCDTKEVTCAIDELKSSGASGGTLATIMTMFDTLS
                     LFDILKAADPFALAASSPPKSIPSEPLAEKVLGVRSVRDMGTLTTAPTAIADITIVHR
                     SSTLMPEFYGRRFHFRQFLRVRNVLIGVALHFAFVTGLLLLLLPPVRWLLKKYIYAPG
                     SGPRMEDSVNDRLVYRAVATADQDTPHPKRALGKLKYDGTMYVFTGLLLAEAAMTILE
                     NEEKVKKVSRCGLVTPATLGQEFIDRLEKVGCQIETEVFNY"
     exon            complement(332343..333051)
                     /number=1
     exon            complement(333109..333233)
                     /number=2
     exon            complement(333290..333395)
                     /number=3
     exon            complement(333414..333585)
                     /number=4
     exon            complement(333619..333808)
                     /number=5
     CDS             join(336327..336624,336738..338308)
                     /codon_start=1
                     /locus_tag="AO090102000133"
                     /note="PHD Zn-finger protein"
                     /old_locus_tag="AO070297000036"
                     /protein_id="BAE61235.1"
                     /transl_table=1
                     /translation="MSDTCIVCLGDLGESASDPLAVSAEAAPRLDVQVNGRSTDTSVK
                     ADGVDGSEDSGQIAQLLPCGHILHNNCLKPWVERANSCPICRRSFNVVELSDRIGGPV
                     LSSYAVQDRVQVADVDPSMVIEYIEEDDLAGFSPCLICGDSDNEEFLLLCDGCDAPSH
                     TYCLGLDTVPSGPWYCSRCETQRARALSPDSADRSSRAQDRRGRRTRAQQRQLQSRSQ
                     MNSLHWARVWQSVWDHLNLDLDFPFDDDRAAERARQQQRREEANQREFRAWQRRFEVA
                     ERQGGSNRFRDTAALLDIEAPRPSRPRVPREPTPEPESLEEMRAWNAFERAREIENDP
                     SAARKRKEPTMSPSPEPTEPERKLKRPRTRRAEDLAALATQNGESSRAAGVQASARIN
                     AETSSEPSFLQSLLKEVEDASNDTTSHGNSAQVSVAATDHATPGPSSPSISPVPSNHS
                     SPRLSSTTPPPHPRSRPISPLQLVTPTHPSSPPFSPDVSPTLSTEITPSQGFSDNTRR
                     RIPRAAYRSNLLRANDKSPSRPNLSLAVKTDIQKLVSTALKPYYRSKTVSKDEYTEIN
                     RNISRMLYEQVGDVETIGADAKTDLETTAKEQVTKAIDALKQRHKMEDNDPVDDSS"
     exon            336327..336624
                     /number=1
     exon            336738..338308
                     /number=2
     CDS             join(341160..341901,341973..342880)
                     /codon_start=1
                     /locus_tag="AO090102000135"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070297000038"
                     /protein_id="BAE61236.1"
                     /transl_table=1
                     /translation="MSATNRDGATQHDLQSSARLDKENEGPMQSSDITLRSESSSSIG
                     EDPEKDAGGTRNTDLDMLERSMSTPHSRKGHEEKAPEKDPNLVEWDGPDDPENPQNMP
                     KWRKWVLTMTLSSLTMWITFASSVFSTATLVTAKEYNVSTEVMTLATSLVVFGFAVGP
                     LMWSPLSELYGRRIPLFSGYAIFAIFQIPVAVAQNVETIMLCRFLMGVFGCSPLAVVG
                     GAMADFWDPVDRAVAIACFSAATFVGPVIGPIVGGFITESHLGWRWTAWITLIASASF
                     GTFALLTVPETYGPVILQKRAARLRRETGNWALHSFLDEHRPTASEIVTKYLLRPLQM
                     LFLEPILLAMTIYLAFIYGILYLFFEAYPVSFQEVRGWTNGGVAGLPFLGIMIGVLCG
                     VALIIWQTKTRFARKLEKHGRVVPEERLVPMMIASVLLPAGLFWFGWTSDPSISWVPQ
                     VIAGVPIGMGILVIFMQGLNYIIDVYMMFANSAIAANTLVRSGLGGAFPLFAVQMYHR
                     LGVDWASSLLGFLTVAMIPIPVVFFFYGAKIRAMSKFSPKF"
     exon            341160..341901
                     /number=1
     exon            341973..342880
                     /number=2
     CDS             join(343729..344085,344175..345848,345904..348318)
                     /codon_start=1
                     /locus_tag="AO090102000136"
                     /note="sister chromatid cohesion complex Cohesin, subunit
                     PDS5"
                     /old_locus_tag="AO070297000039"
                     /protein_id="BAE61237.1"
                     /transl_table=1
                     /translation="MPARTRQGPSAAAEVVESEETPGGLRRLRFNEPLSWRVGRSAIP
                     IVDLLQRLQTLAQELRKLEQEEVEKDSLQKVSQELATAQLLAHKDKGVRAWTACCIVD
                     VLRLCAPDAPFTGNQLKDIFTCIVTSIIPALGDPSNTYNAQHIYVLNSLAEVKSIVLM
                     TDLDHPDALIIPLFTTCFDIVSGSSKGSTGEDIAKNVEFDMTRLLVTVIDETPVLAAD
                     VVDVIVAQFLRIDPRALENPSRRGKKADAPLDAKQGTLLLKDYPPAYNMAKAICQACP
                     ERMTSHISQYFNNVIIDASATGANGPSKNSHRRPNLDDSDEEGEDIKELSKAHRLIRE
                     LWRACPEVLQNVVPQLEAELSAESVSLRLLATQTIGDLTAGIGVAGPPPPPPMDPAAY
                     PPVTLSDYSQIVPQPNVLIQPFSPKPFSQAHSSTYEGFLSRRLDKSASVRAAWATVVG
                     RILLTSAGGSGLAESEEQMLIKNLASMLRDADEKVRVAAVDAVGTFGLSHIVHKLGAS
                     GGFSSHDSILFILAERVKDRKPQVREHAMKTLGRMWAVAAGEIEQDNEQVVSLLKDGP
                     SKIFDAFYTNDMDIHVLIDRVLFDILLPLSYPPIKPKLSRSSSTQSQKLKDSQTSEGE
                     NETDVDKIRVRRILTLIRGLDDKAKKVFFAMQARQIQMRTAVTVYLQACEEYNGGVME
                     KDDERITAQINRVIDTLSKLFPDASRASADLWKFAKVHDRRSYQLIRFAMAAVSDYRT
                     VIKAIRELARRLQSSNNSPLLETLTPLLYRCSSLVFNRSHIPAIISLSRTDENGLASP
                     AHEMLREISSRNPEVLEAQVQEMCKDLESQAPSAKTSKDTGTEEILKACSGFAKKLPA
                     KLPKERKFFQALVNYALYSPSPRAAKHAVSILMATADRKEMYAKDLVQKCVSKWEYGT
                     DRFLTKLATLSQLNLLAPREADEESDAIVSIAVNKVLLTNRSPKPEAGYIWSDAVDDE
                     TAAKEWALRIIVNRLRAKEGSDDENDFRAHAEPVYSTLNKLVVGEGELSKKKDTPAGQ
                     KSRLRLLAAKSILKLCASHSICDHLLAPQDFNALALVAQDRLAPVRIGFINELKKKLV
                     PNSRLSHRWYIITFLLAFEPNASLKDSTLTWLRSRATFFSQSGGKKKDPVMESIFSRL
                     LSLLAYHPDYPPQDLDEEVKARDLTDFGRYILFYLLAIANEHNLSLIFHIAQRVKQTR
                     DGITKSDEITTRLHTLSDLAQSTIRRFADIYSQQRRFGGGAGGTNILQTYPGKMGLPS
                     SIFAPMSSHREAQEVAEKNFLSEDVDDLLDRLVRSVMRSKGGSQGQAAKKRKPEPTDT
                     TGEAGTTTKKVKKVREKVTRPRKSSGATSRTPKRKNKDEDGWSSDEGAAKTSTATARR
                     RSSRGTSRRVSYADHDSDEDDVEMDDWDQDKDEAEAEEEEEDDNEENENNHANNNHVQ
                     DSEDDGSDLSSPPPSLPPSSPPPSAKKARAEKATTLPSRRSSRRG"
     exon            343729..344085
                     /number=1
     exon            344175..345848
                     /number=2
     exon            345904..348318
                     /number=3
     CDS             complement(join(351453..351532,353432..354131))
                     /codon_start=1
                     /locus_tag="AO090102000137"
                     /note="predicted protein"
                     /old_locus_tag="AO070297000040"
                     /protein_id="BAE61238.1"
                     /transl_table=1
                     /translation="MRSSTDLPLRILTNNIRYATKSPFKGEKPWEERRQPLLNQLLYN
                     TRNQDAFICLQEVLHDQLIDIHSGLNREHSAASAEAGEDAWAYIGVGRDDGHEAGEYS
                     PIFYRPSVWQLRHWETVWLSETPHVPSKSWDAASIRIVTIGVFTHHTSRQTILAMNTH
                     LDDQGSRSRFEAAHIILRKIDEYESGEHKDVISAVFLTGDLNSEETQEAYSVLTGNES
                     TLIDAAKAVDPVEHYVKQCQWLSSKQKTITWRLRHSSFLVS"
     exon            complement(351453..351532)
                     /number=1
     exon            complement(353432..354131)
                     /number=2
     CDS             join(356972..357026,357078..357143,357702..357817,
                     358059..358142,358229..358348)
                     /codon_start=1
                     /locus_tag="AO090102000138"
                     /note="predicted protein"
                     /old_locus_tag="AO070297000041"
                     /protein_id="BAE61239.1"
                     /transl_table=1
                     /translation="MCPALIPTSCCTQKGQCITLSLACHDQYPPVVKLTVTQLTFFDR
                     RDFTILPNYWQKIITFSREEHGPVATGGRERSFIQYPRSSAGLTPLGVQSGASSHLAK
                     EPTCKLCPQSFVDLTSYHERGVNHVRDSFLGKPDLLSLSPNFQG"
     exon            356972..357026
                     /number=1
     exon            357078..357143
                     /number=2
     exon            357702..357817
                     /number=3
     exon            358059..358142
                     /number=4
     exon            358229..358348
                     /number=5
     CDS             join(359645..359890,359952..360217,360291..360349,
                     360403..360644,360707..360776,360855..361216)
                     /codon_start=1
                     /locus_tag="AO090102000139"
                     /note="predicted protein"
                     /old_locus_tag="AO070297000042"
                     /protein_id="BAE61240.1"
                     /transl_table=1
                     /translation="MFLSRVFCVLAALACVSAARETCVVPAGGSNATDDAPAIVHAFK
                     KCGRGGKVVFKPTTYHIGSVMNITWLEDVDIDLGGTLLWGTNIQYWLNHSLPVGYQNQ
                     STAFILGGNNVRIDGHGIGTLDGNGDTWYQWIKEQPNTSNYPGRPHAITFNGLTNSVV
                     RGLRFLRSQMCHHVEFDSILVNNTGNVVSSSNTDGADTIRSSHITFNNWTVYNGDDSI
                     SLKGNSTDITITNSNLYNGLGIALGSIGQYKDQFETIERLKVSNVNFHSTLHAIYVKT
                     WTADQNGYPPNGGGGGLGYISDVTAKDLKATSLRGAAFAISQCTRFSGAPGEGNCTNS
                     EFQVRDISVLNLSGTTESNRVANLQCSAVAPCTDIALSGINLELKNGTAASEYLCGNV
                     ENQKGFECTGAVCEGGSATGEC"
     exon            359645..359890
                     /number=1
     exon            359952..360217
                     /number=2
     exon            360291..360349
                     /number=3
     exon            360403..360644
                     /number=4
     exon            360707..360776
                     /number=5
     exon            360855..361216
                     /number=6
     CDS             join(362618..362775,362917..363272,363348..363504,
                     363561..363654)
                     /codon_start=1
                     /locus_tag="AO090102000141"
                     /note="predicted protein"
                     /old_locus_tag="AO070297000044"
                     /protein_id="BAE61241.1"
                     /transl_table=1
                     /translation="METHINTHSQLIKRLRAQPVSVPNLLPIFSSWPGAVNPHWRALV
                     PVMNARIDSLFPEPAKATKLKRCDFAHLASTRWPLAGFNELYILAFLSLWLVTWDDQI
                     DDTKRSLSNDFEAAEQYRRETLYFVAQCLDLDITEGLPRSYNDSIFVPDDPIVQSFDV
                     IGEALRDAYTYEQRHRFLREMSLFMVTSHMEQKAKLEGHIPSLEEYWRVRMGTSAVGV
                     ICAVNEYSLRSVIPCAIMEDHDMRTMWNEVNVIASM"
     exon            362618..362775
                     /number=1
     exon            362917..363272
                     /number=2
     exon            363348..363504
                     /number=3
     exon            363561..363654
                     /number=4
     tRNA            complement(364382..364496)
                     /locus_tag="AO090102t00003"
                     /note="tRNAscan-SE"
                     /product="tRNA-Gln"
     CDS             join(365269..365305,365566..365649,365731..365835,
                     365915..366712,366800..366999)
                     /codon_start=1
                     /locus_tag="AO090102000142"
                     /note="metallopeptidase"
                     /old_locus_tag="AO070297000045"
                     /protein_id="BAE61242.1"
                     /transl_table=1
                     /translation="MADTQAQQPAEVDYTLNNPDTLTKYKTAATISHKVLDAVAALCV
                     EGAKIVEICQKGDELLEEEIAKVYKGKKITKGVGHPTTVSPSSHVTPYTPLVSDAQEA
                     ETTLKAGEIAKIQLGAQIDGFGTIVCDQVVVGQDEVTGREADLITATHYANELLLRLM
                     VPPGLLATGTEEEKKKAAAERAPTQAQISQLIEKVAKAYDCNVVENTTSWLFERNEIE
                     AEKKIILSPGTGVKGEGVPDVGEVWGVEIGLSLGSGKVKTLPLRSTLHRRTTTTYGLK
                     RPSSRQTLSEIVKKFGQFPFSLRQLDDEKAAKVGVVECVRGGVLRQYEPAGDADNAPV
                     SRLLTTIAITKNGITKLTAPAAPDFTKVKSDKKIEDEEILKILERPLSKSTGSKKNKN
                     NKKKAAKKADSGDKE"
     exon            365269..365305
                     /number=1
     exon            365566..365649
                     /number=2
     exon            365731..365835
                     /number=3
     exon            365915..366712
                     /number=4
     exon            366800..366999
                     /number=5
     CDS             join(370108..371894,371951..372255,372310..372410)
                     /codon_start=1
                     /locus_tag="AO090102000143"
                     /note="PHD Zn-finger protein"
                     /old_locus_tag="AO070297000046"
                     /protein_id="BAE61243.1"
                     /transl_table=1
                     /translation="MPSAADMRKAGLGPLRPSTQNTTAKKDQRSVQNGDKEISKPQTP
                     LTPAEESIPEPVIPKDNTAQDVTAFTTLPVPDSTDVDVVKLRSAVENALHMASETGNR
                     PVIRGLLRLWETCGKDSFALSVLEGVCGASPGAREQSVFQTVMRTAWKEVQSEENTEV
                     LPAATPAMGRTRSASSVSSLSSAKSLDAETFAPGMGPGPANARSRGRGKHSKTTQKAM
                     DSEASEPPSRRSAFPSSDSTLQRRRALEENPEFSAEAVKAKRTRLQRSFPKITATESR
                     LRSSLASEPPSSITTPAATTASRSQTAAEGAVDDQRERSESPASSDAGDNRRLTPTMA
                     TNKENGEENNDFCRECNGSGQLLCCDGCVNSFHFSCLNPPLDPANPPEGDWFCPRCSI
                     LKPMGTLLVAVDKVSHKDFALPSRLRSYFAGVQTGDKGQYDEVLPFPRINPRSGRNRS
                     GRYDDPFLLRTVDAKGKLILCHGCGRTTNGRRPIIQCDFCPLAFHMDCIDPPLAIPPA
                     QKPGSDRTYHSWMCPDHSWHDKFFIVQDEEGYDLVKRIRRPKNPRLIDVEILPDEEED
                     EKIEEQEEEGIMYRVSEKGVKLDFIQRVKRENEELAMKKAVADKYYEYVRQRHDELTS
                     KAHAFYAAQNPEVIEEDTTTAILNSRTAAEREAAANLITFARGNSAEVEDSKISLLID
                     QLKANVPPDFMPSAENLRTQSAPTESPAANSPDVELMDAQPTNPSAST"
     exon            370108..371894
                     /number=1
     exon            371951..372255
                     /number=2
     exon            372310..372410
                     /number=3
     CDS             complement(join(373195..373322,373380..374106,
                     374155..374335,374392..374462,374523..374589,
                     374648..374736))
                     /codon_start=1
                     /locus_tag="AO090102000145"
                     /note="predicted protein"
                     /old_locus_tag="AO070297000048"
                     /protein_id="BAE61244.1"
                     /transl_table=1
                     /translation="MKFSASLPLFATLAAAQTVIEGSSFGHGQTLSPTRDTIPGWTIG
                     GEGHSPQVLSNKLILTPPYPGNTRGFAWSQAPVSQSEWSAEFQFRASGVERGGGNLQL
                     WYAKDGQSKIGTSSIYTVGQWDGFALVVDMHAGRGGSIRGFLNDGTTDYKSHRSVDSL
                     AFGHCDYSYRNLGRASVVRIKHTNANLEVTVDDKLCFATDKVSLPAGNTFGVTAATPE
                     NPDSFEVFKFVLQTAQSGTAPPAQQQNNQQQQQPPQQQQQQQQQPVAAQAQTQQQPRT
                     DQFVDLAARIELVNKATGNIIREIGNQGKQNENRHLELQQKLATKEQVAGLDARLQKI
                     EQMLQTIQRDLEGKDYHSRFNQLQDTLRSSHQTLTEHLQGSVLSAITASTPRMGFFIF
                     LIIAFQVFLAVSYIIYKRRRANMPKKFL"
     exon            complement(373195..373322)
                     /number=1
     exon            complement(373380..374106)
                     /number=2
     exon            complement(374155..374335)
                     /number=3
     exon            complement(374392..374462)
                     /number=4
     exon            complement(374523..374589)
                     /number=5
     exon            complement(374648..374736)
                     /number=6
     CDS             join(375309..375385,375470..375548,375609..375802,
                     375865..376358,376408..376547,376605..377135)
                     /codon_start=1
                     /locus_tag="AO090102000146"
                     /note="glucosyltransferase - Alg8p"
                     /old_locus_tag="AO070297000049"
                     /protein_id="BAE61245.1"
                     /transl_table=1
                     /translation="MADLYPSLAQCAIVATAFKILLFPAYKSTDFEVHRNWLAITHSL
                     PVKEWYYEKTSEWTLDYPPFFAAFEWLLSQVAQYADPAMLTVKNLNYDSWQTIYFQRA
                     TVIISELVLVFALNRFIKSAPQSNKHLAHISSLSILLSPGLLIIDHIHFQYNGFMYGV
                     LILSIVLARKQSTLLYSGITFAILLCMKHIHLYLSLAYFVYLLRTYCLDPKSVFRPRF
                     GNIFKLGLGVISVFAVAFGPFIYWNQLLQLKDRLFPFSRGLCHAYWAPNIWAMYSFVD
                     RALILLAPRLGLSINEEALTSVTRGLVGDTSFAVLPEVTKEHTFALTFLFQLLPLIKL
                     WRSPGDWDVFVGAITLCGYASFLFGWHVHEKAVLLIIIPFSLIALRDRRYFSAFRSLA
                     IAGHVSLFPLLFTAAEFPIKTVYTVFWLVLFLFVFEQVAPVPERPRIFPIVDRFSLLY
                     LAVAIPLIIYCSLLHQLIFGLERYEFLPLMFMSSYSALGVVGSWIGFMVVYFTA"
     exon            375309..375385
                     /number=1
     exon            375470..375548
                     /number=2
     exon            375609..375802
                     /number=3
     exon            375865..376358
                     /number=4
     exon            376408..376547
                     /number=5
     exon            376605..377135
                     /number=6
     CDS             join(379069..379158,380072..380215,380272..380374,
                     380436..380452,380515..382112,382168..383239)
                     /codon_start=1
                     /locus_tag="AO090102000147"
                     /note="chromatin remodeling complex WSTF-ISWI, large
                     subunit (contains heterochromatin localization, PHD and
                     BROMO domains)"
                     /old_locus_tag="AO070297000050"
                     /protein_id="BAE61246.1"
                     /transl_table=1
                     /translation="MGGESVLAPSHAPSALLPIGYSRPLSARHLVWVIPETNEVFTQY
                     EPYLQRMDFYKQRRFICEITGHSGLTFFEALRSELEESREVNNTFPDALKEPILRRIQ
                     FSTVSRVDNLVDEIYEEFKQDFYPGEPVLILLDDNTRLHGMIRDKANFAEQLHPDGTV
                     KSPAYATYLVKVLDRPNEEALLDQEHITRDRKTFTKQMLRAFIKNNVTRESWNGAPWL
                     VKPSIAEEYRIPTEVPKHLQYGAKVAEKKAMKKADQEGFFGFFASQQLPELKPAVKGQ
                     KSKLSQQDLARSKEAQFLEYQRSLNGNPSFVVSSKTTGAARSSKSQDTEKKSQTATAV
                     IVKTETPRPPSPPPIKYPIEDLDIAPDREKKKQRPTLTFLKVDETDSPDDEDLLHDDI
                     DMKSVGLLLETWNTLNVYCEVFQLDSFTFDDFLQAMRFSSEDVDCELFVEVHCAVLKK
                     LVNSEKDENGAVQISLPDLPADDSESDEEDQEEEVEETPEPEPVVTRMTTRSSLAKAE
                     AENLKAQANRSRSNSVEVKIHRAAEMFGDYGWIDRLRKRDFRNGGWELVMVGLLHQLS
                     ARPRMEKVCNDILKHLAPLDAEPTQDTAQRQYATLDINLRVKALQIICMLSLDTKAIR
                     NYLEECSNQMTEFRKEKIEYQKARKAGLEELRRLHQERKALQPEPEKSPSPAPELEAL
                     EDSKMTGVDVESDQVADTEEEEEVPQRSLRGGLDRVLERKRKHEEEQKRKEQLAKQPK
                     GTKQYQRVLKKIDEQKANIEKLEEKIDVVDNDLREADCPRTRCLGKDRFCNRYWWFER
                     NAMPYGGMPNSSTAEAQFANGRLWVQGPDEMERVGFIDVPEDQKKQYQKEFHTTPADR
                     KKAEEGPTRLSNADEWGYYDDPDAVDKLIDWLDPRGNRELRLRKELLLHRDNIVKYMR
                     FRAEYLAQTAERADSEEMPTKRMTTRNKTYVDDHKHRCLSWHNTTAMSENGHLHIDAS
                     RPTKRAKRATDDPKEIKAVNRQGKPLTRQGSRYHF"
     exon            379069..379158
                     /number=1
     exon            380072..380215
                     /number=2
     exon            380272..380374
                     /number=3
     exon            380436..380452
                     /number=4
     exon            380515..382112
                     /number=5
     exon            382168..383239
                     /number=6
     CDS             join(384188..384391,384458..385438)
                     /codon_start=1
                     /locus_tag="AO090102000148"
                     /note="mitochondrial solute carrier protein"
                     /old_locus_tag="AO070297000051"
                     /protein_id="BAE61247.1"
                     /transl_table=1
                     /translation="MEQVADSRPARGDVSRNAAVATTQTTAVDDASSPGYKKNDHGGP
                     QQMNKRSLDYVLRSGLAGGVAGCAAKTMVAPLDRVKILFQASNPQFAKYTGSWSGLLY
                     AVRDINRHEGRRGLFKGHSATLLRIFPYAAIKFLAYEQIRAVIIPSRDKETPFRRLIS
                     GSLAGMTSVFFTYPLELIRVRLAFETKRSSRSSFTDIFRQIYRERVSPPSVPSGLSSS
                     SSASAAATATAEVSSAVNKVVPSSGLANFYRGFTPTLMGMLPYAGVSFLTHDTVGDWL
                     RSPALSQYTTIPGSESQSKKGSHRTQLTAAAELFSGAVAGLVSQTSSYPLEVIRRRMQ
                     VGGVVGDGHRLGIAETARTIWLERGFRGFWIGLSIGYLKIIPMTATSFFVYERMKWSL
                     GI"
     exon            384188..384391
                     /number=1
     exon            384458..385438
                     /number=2
     CDS             386082..387089
                     /codon_start=1
                     /locus_tag="AO090102000149"
                     /note="TBP-binding protein, activator of basal
                     transcription (contains rrm motif)"
                     /old_locus_tag="AO070297000052"
                     /protein_id="BAE61248.1"
                     /transl_table=1
                     /translation="MTTRKRNEFLDLAPSDDEDNDRGYDSEAAEESKARISKRRRTQT
                     QDDESDQSDNDSVASDEDLKLSKSKGKAKKPQQRSEEDVISDNDDEQQETSGTQYLDV
                     TEQETKSSKRKPLDKGKPPKKNKTGVVYLSSLPPYLKPFALKSMLEARSFGPITKVFL
                     SPSVRPASAPRRRSNKRKTYTDGWVEFASKKTAKLCAETLNASIVGGRKGGWYHDDVW
                     NMKYLKGFKWGDLMEQVQRERQEREAKQRIEDARARKEDKVFLQGVETGKVLDGMQRK
                     NEEKKKRKMESGDAGGQQTEELKVRRTFKQNEVKKGRHTIKDGEAALEDDTKRVLGKI
                     F"
     exon            386082..387089
                     /number=1
     CDS             complement(join(387269..388339,388398..388688,
                     388738..388879,388938..388996))
                     /codon_start=1
                     /locus_tag="AO090102000150"
                     /note="NMD protein affecting ribosome stability and mRNA
                     decay"
                     /old_locus_tag="AO070297000053"
                     /protein_id="BAE61249.1"
                     /transl_table=1
                     /translation="MSMDLDAPVPIAAQDHIAATILCCNCGAPIDGTTAAGALCQDCV
                     RSTVDISEGIQREAVVHTCRDCERWLLPPNSWVSAALESKELLALCLRKLRGLTKVRI
                     IDASFIWTEPHSRRIKVKITIQQEVAAGTILQQAFVVEYVVHYQQCSDCLRSFSPHTW
                     VASVQVRQKVPHKRTFLYLEQLILRHRAHQETNNIKEAKDGLDFYFSQRSHAEKMVEF
                     LSSVVPVKVKKASELISMDIHTSTKSYKFSYSVEIVPICKDDLVAIPIKLARSIGNIS
                     PLTLCYRIGTTIQLLDPNTLQTAEVPGATYWRSPFKNLADVTELVEFIVMDIEPVGRS
                     NGRFHLAEATVARASDLGSNDQTYFTRTHLGGILHVGDSVLGYHLTGSMFNDPNYDAI
                     EASSQYSSTIPDVVLVKKHYTRKKNKSRNWRVKRMAREHEEEALQASTGGSRKQEQER
                     ERLEADFEMFLRDVEEDQELRGTIELYKARKNQNAGGMEMDEDSDDEDVPKINMDELL
                     DDFDELNMNDDE"
     exon            complement(387269..388339)
                     /number=1
     exon            complement(388398..388688)
                     /number=2
     exon            complement(388738..388879)
                     /number=3
     exon            complement(388938..388996)
                     /number=4
     CDS             join(390120..390136,391561..391601,391654..393062)
                     /codon_start=1
                     /locus_tag="AO090102000151"
                     /note="predicted E3 ubiquitin ligase involved in
                     peroxisome organization"
                     /old_locus_tag="AO070297000054"
                     /protein_id="BAE61250.1"
                     /transl_table=1
                     /translation="MHLLKSLQQEFDELKPSLFELLAEQQLSDLLPPSIRYILAVATH
                     RHPRYLLRILNSYDEIYALLSLLVERYYLRNFGGSFTENFYSLKRERVLLTKNGEIPR
                     AQLGAPGPVRETLKLRSSDVWKNLLIMVGIPYLKRKLDEGYDIHAAPQASLIMSGGPR
                     YDPNDDLPPNPTIRQRLVHYYKWFLRNVYPSVNAAYYFSILAFNLAYLFDNTKYSSPF
                     LWLIGTRIRRLGGADHKAIADMLEAKPAAGPGGRGRSRPGSGLLGLLSPQNLYPQLLT
                     SLRYFLPASIFALKFLEWWHASDFSRQLARKATEVLDLPAPVTNGMVLPSERKKLAEE
                     KEKKKQEPDSPTRKSALKSSRKRIQPPISATSYLPIFTVPLPPPDSDAASTCPICLNQ
                     LANPTACQTGYVFCYVCVFHWLNGEHQRQIDFMNGEGAGAAGEDESEDDEAKGSDEKK
                     GDGQGQSREGKWESGKGRCPVTGRRVLGGTEGLRRVLI"
     exon            390120..390136
                     /number=1
     exon            391561..391601
                     /number=2
     exon            391654..393062
                     /number=3
     CDS             complement(join(393332..393603,393666..394870,
                     394937..395073))
                     /codon_start=1
                     /locus_tag="AO090102000152"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070297000055"
                     /protein_id="BAE61251.1"
                     /transl_table=1
                     /translation="MTRSSAALIVALAACWNAQGSAGLRDDPAILRRACPDYLTYSTA
                     PHPPYSGGPLNLPFQRPAQECRTFSSPAVEQVIEDITSRIEDKDLAQLFKNAFPNTLD
                     TTIRWHTDGTSAQPSRRAKRAGSQWNGPQTFVVTGDINAEWLRDSTNQLSGYQALAMK
                     DKNLHNLILGAINTQAEFVIQSPYCNAFQPPPPSGIQATDNGQDDKVHPAYEPSVVFE
                     CKYELDSLANFLALGTEFYENTGSTEFLTDRWYLALDTLLKVLDAQSQPTFNNDQFVT
                     NQYTFQRTTTLGTETLNLAGVGNPLNHGTGLIRSAFRPSDDATILGFFIPPNAMMAVQ
                     LKKTAEVLRKAGGKADLAQQLQDRGENLDKAVREHGIVNHPTFGDVFAFEVDGYGSRI
                     LMDDANVPSLLSLPVLGYVDKDDKVYQNTRKMVLSQDGNPYYLTGSAFHGIGGPHIGL
                     QNAWPMSLLIQAQTSDSDAEIIECINLVRNSSLLGLVHESINVNNIEKYTRPWFAWAN
                     SVFAQTILKVAKERPHLIFGEGAKPYVIE"
     exon            complement(393332..393603)
                     /number=1
     exon            complement(393666..394870)
                     /number=2
     exon            complement(394937..395073)
                     /number=3
     CDS             complement(join(395801..395946,395998..396180,
                     396231..396371,396431..396455,396506..396796,
                     396855..396987,397062..397343,397394..397449,
                     397519..397578))
                     /codon_start=1
                     /locus_tag="AO090102000153"
                     /note="predicted protein"
                     /old_locus_tag="AO070297000056"
                     /protein_id="BAE61252.1"
                     /transl_table=1
                     /translation="MAVADYKRYLAENVLNERRTVTFRSLSRALRVHSTLAKQMLYDF
                     HHNENNKKPQSVNATYIITGVQKAPAPATNGHTNGEDNRDDVFPSSPYLSSSMPNQDS
                     APDTVATASVLLVREEDLEGRAPLVSHAGLDLQQTVLQDLNVLTDVSRETVSNHSQED
                     PLEYGGQWSMIQNKNVKRRTGSRPPPAPAATKSKPTIPSKRPSEATSSQIKPEPKKEE
                     TAASEQASTRESTPSTASKPTEKAAPLKREKSNLFSSFAKAKPKQKKEESATPAESAE
                     PSGAEDVFGDDDDADEEPEELFPDSGKSASSAAATRESRKEREEKLKQMMEDDDEDED
                     EEMPDATEPPEESKPIDQPPPKKPELKEEITVQGGRRRGRRQVMKKQVRKDDEGYLVT
                     VEEPSWESFSEDEPAPPPKKKPAVSALKGKPAGKGQGNIMSFFGKK"
     exon            complement(395801..395946)
                     /number=1
     exon            complement(395998..396180)
                     /number=2
     exon            complement(396231..396371)
                     /number=3
     exon            complement(396431..396455)
                     /number=4
     exon            complement(396506..396796)
                     /number=5
     exon            complement(396855..396987)
                     /number=6
     exon            complement(397062..397343)
                     /number=7
     exon            complement(397394..397449)
                     /number=8
     exon            complement(397519..397578)
                     /number=9
     CDS             join(397813..398323,398381..398495,398548..399148)
                     /codon_start=1
                     /locus_tag="AO090102000154"
                     /note="postreplication repair protein RAD18"
                     /old_locus_tag="AO070297000057"
                     /protein_id="BAE61253.1"
                     /transl_table=1
                     /translation="MEQTFDLPDSTDWLGTPLSLLTPLESALRCQVCKDFFDNPVITS
                     CCHTFCSLCIRRCLSTEGKCPACRSSDQELKLRRNWAVQELVEAFQNARPSVLDLAKR
                     AATEDREDAEVGTAQPASKKRKVDERDGSNSEVSEGRQTRSRTKGVERQTEPATMDVV
                     EDSQDEEYVPEDGLVACPICNRRMKNEAVFQHLDNCTGDPVPPKKISFGSLQPMSPAS
                     RTLNKAPERLPTINYSLLKDNVLRKKLKDLGIPNWGPRPLLQRRHTEWMNLWNANCDS
                     KTPKSKRELLHELGVWERTQGGSAHPSAESAGSVMRKDFDATAWSTTHESDFKQLIAN
                     ARKRSDALVRTTIPSAAPAQSQESPTVEQPVEATIPTNMQKPEQPLVDLTSAAYPKIQ
                     HAQEPGESEEPYTLPG"
     exon            397813..398323
                     /number=1
     exon            398381..398495
                     /number=2
     exon            398548..399148
                     /number=3
     CDS             complement(join(399234..399926,399977..400171,
                     400225..400446,400534..400801,400870..400916))
                     /codon_start=1
                     /locus_tag="AO090102000155"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070297000058"
                     /protein_id="BAE61254.1"
                     /transl_table=1
                     /translation="MNDLLNFILSQDAFRKNRLPSLYSDFAIHRKTNPDGYAVNVAAW
                     EQALTKAAKHGYISSSHGQLSTPSKGAMRKSDHLILRADKSLLRDLEIPEWGQPVALG
                     AVLEEAMQNRTIVPLQVYRVNPAILQKPQWRLIDPGVLNPWNVMSWGLKQLKGVVVGT
                     DDSSPVLQGQEWVLVENLKEAAGGIVKKVMGRSPSNTDLVYSKESFVSEFGTTLNQDS
                     ELSEADFDVLLLYLSRDSGAIAYDGKTIKFRPSNDAPREITQQDSTIASIKALMATMT
                     KQVEGLENKISELNSAAKAALHNKNRISALSAVRSKKLAERNLQQRLDTLAQLEEVYS
                     KIEQATSQIEYVQVMEASTGVLRGLNTQIGGAERVEDVVDELREEMSKVDEIGNIMNE
                     AGPQVDEAEIDEELEELENKERQAVEEEEAEKTRQKLAELDNLEQKAKEAARIAGSEQ
                     NLDSELEERLSRMSVEENPSTAAQ"
     exon            complement(399234..399926)
                     /number=1
     exon            complement(399977..400171)
                     /number=2
     exon            complement(400225..400446)
                     /number=3
     exon            complement(400534..400801)
                     /number=4
     exon            complement(400870..400916)
                     /number=5
     CDS             complement(join(401551..402716,402773..403841))
                     /codon_start=1
                     /locus_tag="AO090102000156"
                     /note="protein with predicted involvement in meiosis
                     (GSG1)"
                     /old_locus_tag="AO070297000059"
                     /protein_id="BAE61255.1"
                     /transl_table=1
                     /translation="MTSPGDAAPVRPPPSFSPGVPRVASKTRYPDQRRDSSPNLDSDL
                     VDSRIATSPPQPPLSATAAELPIRSASPHARSIRSSTPQLTRSSLGSPTEGRLDGSED
                     IRSLIIRSFSPVVGVYSSVDTDELVRQKGFAGGFWELIRPFGETVPGKIVVRDSVGAS
                     RGWEDYGVRFVDLGGNPQVSSEPRAPPLTQLEEALERQLESPDDPLGGILRPKDFLSF
                     PTTSPLYKSFLRQLLSVSSPTPHETFRHPVASVIAISSRNTSPLETLRRLYADTSNGD
                     RKLPEWVHPEYLRYYVLVHDEDRDDIAESTKLYDQMKRHFGLHCHLLRLRSNQCVVTD
                     DDSCQVPEAEWLSPTERLSGRSEPLVDLDTDGQPYLFESDVTAIKAFVRELVAQSVIP
                     YMENRVTVWNDQVASRRRGISGRFMSMSRRWAGFGSGSRSSLIGSGGGTSGNYDLAHG
                     FYKPDVPEAILRKMADFAFMLRDWKLSASTYELLRSDYANDKAWKYHAGVHEMCAVSM
                     LLNPLSMPGKSKINDIDQMIETACYSYLTRCSDAPNALRCLSLSMELLKSRGGSGIES
                     AARWAMRAMDLSLVGSIGQALLSERISACYASRNAINGVRFGSRHRKAGMWSVLAADR
                     WLRLGKPSLASASLEEAERLYADVLDSNGAFPIPEMQAFVDNLRHAVKVEYLESRGLD
                     TGDEAATADPLDVFEPEETSEKLDKRKNRKSLIANPMDSGGLSSTQGARDDDNPANDD
                     FERA"
     exon            complement(401551..402716)
                     /number=1
     exon            complement(402773..403841)
                     /number=2
     CDS             join(404616..405519,405571..406119,406180..406430)
                     /codon_start=1
                     /locus_tag="AO090102000157"
                     /note="tRNA nucleotidyltransferase/poly(A) polymerase"
                     /old_locus_tag="AO070297000060"
                     /protein_id="BAE61256.1"
                     /transl_table=1
                     /translation="MNHKKPRNSSPERATKRRRISSPISRKNPSDEMTATPDQTHPII
                     QLTPIENTLKSLLLDVADYIRERSIAEGGNAVDTPRTVLRFTGGWVRDKLLGIDSHDI
                     DVGINNMTGYQFGLLLKDYLDIPENLQKYKKNHNNGQLKDAIVSLHKIEANPEKSKHL
                     ETVTTKIFGLDIDLVNLRKETYSDDSRNPQMEFGTAEEDAMRRDATINALFYNLNESK
                     VEDFTRRGFQDMRDQVIRTPMEPYQTFKDDPLRVLRLIRFASRLGYRIDEDTENAMKN
                     KDISEALKLKISRERVGTEMMKMLKGPDPRGALQFIDRLELYPTIFANHQDDVGVDTS
                     SWAPAYNALQKLLHPNNNSIPIARVRDLLIRDAQEAYYAWVIAAFAPWSTVPDRVAQG
                     PKPRPPPARAAEVARDSLRSDNKTINLLRDAARHWRSIVDVKSSLLQGRMSGTAAEIR
                     QQIGLHIRTWSKDWRLCCTLAILQEVAQGGEFNKVIQEYNQFLSYLVEHDLENVYDMK
                     PIVNGVEIAQNLASPKGPWMSKALDMVIKWQLLHPEITDKAKALEEVSSRKEELDIRS
                     K"
     exon            404616..405519
                     /number=1
     exon            405571..406119
                     /number=2
     exon            406180..406430
                     /number=3
     CDS             join(406811..406879,406929..407038,407109..407394,
                     407459..407561,407637..408013)
                     /codon_start=1
                     /locus_tag="AO090102000158"
                     /note="predicted protein"
                     /old_locus_tag="AO070297000061"
                     /protein_id="BAE61257.1"
                     /transl_table=1
                     /translation="MSTTTTTTTSPSTIMIEGAGAASTIGSRPTQQDQYTFLLPENFL
                     TKSGDKIAFFAVYDGHKVSKHANENILRFLQESPELESGRYEEAIKEAIKKEEAELLK
                     DFRDGEEQFATSGSTAALALVNLTQGFLVIGNLGDSHILMADYTSSSEGATNIRRITR
                     SHKPGDSDEKNRIMDAGGMVNTDSGTERLGSLNMSRALGDLQYKDPLINSGTGPLNEA
                     QIRADVSSSIDQWNLLSNEPYLSRVDLNDGSQHVLILTSDGVTNSLEDEIMVHGLLTC
                     YRSGLNATESAKYIVDEAADVPGSDNATCIAVFIGGAS"
     exon            406811..406879
                     /number=1
     exon            406929..407038
                     /number=2
     exon            407109..407394
                     /number=3
     exon            407459..407561
                     /number=4
     exon            407637..408013
                     /number=5
     CDS             complement(join(408520..408905,408953..409326,
                     409391..409760,409813..410104))
                     /codon_start=1
                     /locus_tag="AO090102000159"
                     /note="trehalose-6-phosphate synthase component TPS1 and
                     related subunits"
                     /old_locus_tag="AO070297000062"
                     /protein_id="BAE61258.1"
                     /transl_table=1
                     /translation="MVTENKKKRGLIIVSNRLPLSVKEENGTYKSSLSSGGLVTALSG
                     LTKSTNFRWFGWPGKAIEDPEEQKKVSDALAENSAVGIFLSEQLAQDHYNKFSNSVLW
                     PILHYQSGVAFNEDAWEAYQRVNEIFADTVAKEAANGDLIWVHDYHLLLLPSLLRERL
                     KKQGKNCPIGFTLHTPFPAEDFWRAIPVQKDLLKGLLACDVIGFHTDEYRRNFTESCE
                     RSLGANAEKEGQLEYEGHTACVGTFVVGIDPQKFNDSMQDPDVQKRIKELERRYEGKT
                     VIIGVDRLDYTKGLVQKLEGWDHFLKTYPELEGKVTLIQVAIPSREDVKEYQELEEEI
                     STLVGKINGEHATPDGTPLIYMHRSVSFTELTALYCISDICLLTSRRDGMNLVASEYV
                     ACQENKHGVLVLSELAGAASFMSGGSVTFHPSSVQELSDAVHQAISMDDKERKERYEN
                     LREFITTHTRQVPDLILFILILS"
     exon            complement(408520..408905)
                     /number=1
     exon            complement(408953..409326)
                     /number=2
     exon            complement(409391..409760)
                     /number=3
     exon            complement(409813..410104)
                     /number=4
     tRNA            410930..411066
                     /locus_tag="AO090102t00004"
                     /note="tRNAscan-SE"
                     /product="tRNA-Ser"
     CDS             complement(join(412322..412526,413007..413086,
                     413151..413243,413308..413469,413530..413754,
                     413826..414062))
                     /codon_start=1
                     /locus_tag="AO090102000160"
                     /note="predicted protein"
                     /old_locus_tag="AO070297000063"
                     /protein_id="BAE61259.1"
                     /transl_table=1
                     /translation="MPSKVNIDTSLKDEKNDMLNGDGPNITVVAKEAPITVKRIPATH
                     INEAIDNPGVARADVAVSIEKPSGDQEWANKVRGYTPLQQHVLFWDRDGDGMIFPWDT
                     YIGFRELGFNILFSFLAVLIININFSYPTRLAYSWLPDPWFRVYVRSVHKAKHGSDSG
                     TYDPEGRFIPQLFENLFAKWDSDNDGALTLRELFQLMHGHRCAADPFGWGAALFEWGT
                     TWLLIQKDGKVYKEDLRAVYDGSIFWKIREARKSSPGWTQGFGLGGDGWVRHGRSIRP
                     FAEKIRQVVNGSCKKAHSSLIWWLTRSTRVRTRRHKHLGSTKGLGKLFTFFRRQCLL"
     exon            complement(412322..412526)
                     /number=1
     exon            complement(413007..413086)
                     /number=2
     exon            complement(413151..413243)
                     /number=3
     exon            complement(413308..413469)
                     /number=4
     exon            complement(413530..413754)
                     /number=5
     exon            complement(413826..414062)
                     /number=6
     CDS             join(414447..414579,414633..414946,415052..415093)
                     /codon_start=1
                     /locus_tag="AO090102000161"
                     /note="predicted protein"
                     /old_locus_tag="AO070297000064"
                     /protein_id="BAE61260.1"
                     /transl_table=1
                     /translation="MALVAQSATFIHQYISSFLHSKPRKSPEALKLGILSSAQINAAA
                     VIHPAETHPDVILYAIASRDASTAAQAAKQYNITKSYGSYQELLDDPAVDIVYVSTPN
                     GQHYEWTSKALQAGKHVLCEKPFTSNADEAKGLVSLAKEKGLTLEEASPASTAGSCGQ
                     RP"
     exon            414447..414579
                     /number=1
     exon            414633..414946
                     /number=2
     exon            415052..415093
                     /number=3
     CDS             join(415223..415771,415888..415914)
                     /codon_start=1
                     /locus_tag="AO090102000162"
                     /note="predicted protein"
                     /old_locus_tag="AO070297000065"
                     /protein_id="BAE61261.1"
                     /transl_table=1
                     /translation="MTYALSFTRYALRARHPKAINSVTARVSSDDPRVDAAMYAYLTF
                     VGPQDTEVHSQIYTDMERQWVVGVVPRFWELPSIEVETERAIIFFYNAMMPHLYHYIS
                     VTDKTTGQTRYHKQYKGGPLWGNVTTTGGKGGSSHWSTYRWQLEAFVDAVRGKTPTYW
                     IPGEDSICQMECIDALYQAAGLPHLGCVESA"
     exon            415223..415771
                     /number=1
     exon            415888..415914
                     /number=2
     CDS             join(416248..416406,416504..416624,416678..417135,
                     417207..418220)
                     /codon_start=1
                     /locus_tag="AO090102000163"
                     /note="predicted protein"
                     /old_locus_tag="AO070297000066"
                     /protein_id="BAE61262.1"
                     /transl_table=1
                     /translation="MEELRRACREALSQRDSTSSTFPEAQVVNIALPEELDLLWQDVS
                     SQGNSSNLEARGPKDLCRADEHAANSIYSWASDAALPSPVYAQIEETSDEKNDVILED
                     QLRSRIALSVLATLSESLPVSKAENVADIVIALASFSSTEDPWTTQEAFTYATTLLNA
                     FASTTATNKESNTTFWSVIEKILKDRIRPLFAKTRNPAITSAGRKNFHPVPLPRFDAG
                     ILDPETKPWKIQDIYATAVLSWIIQQYKPTNQTNLETHFPLLVPPILALIDDDTSAIK
                     TKGCTLLRNLLTPIQQTKSPILHRTNLTSVFEDALKPCLLSLPTITPEPDSIDLLKEA
                     YPALLTLQKTTYTNTPSPSPQSQSKTQPNKLETYISRLTTTLRENLIPSFHHISSSNT
                     TSLSSDFASFPYPRLSTLLLEQMVPVLGELGIHTTKFLQDIVPILHNTLANPFGPAYP
                     PMLLRAVEVARGVVLNAHPRVWRWRGELLDALCSCWIHVVEEEGEIVERGKRGGESES
                     EGAVMERLKKELRGVVYLLKFALQNSIQVDGGEGQLEAKENLDKELRELVDADESLKG
                     LLLEDIDANDGGFFGEA"
     exon            416248..416406
                     /number=1
     exon            416504..416624
                     /number=2
     exon            416678..417135
                     /number=3
     exon            417207..418220
                     /number=4
     CDS             complement(418394..421414)
                     /codon_start=1
                     /locus_tag="AO090102000164"
                     /note="putative phosphoinositide phosphatase"
                     /old_locus_tag="AO070297000067"
                     /protein_id="BAE61263.1"
                     /transl_table=1
                     /translation="MESLEEITRPRDPAEGTVDDGSSRTTSVADQSLANSLASLNIGS
                     ADASFKSISSNKVPDEQVDRKFTEQEDSSIPPTRVLSPYAPVPYNPPSAAAISDDGAD
                     EDEEPRIATSFERDSTPTSLQKHRSMFFDTGEEGINRMHKFSLYETATRFYMVGMDLS
                     DTRFRILKIDRTTETGDLNVAEDDIVYSKREMSQLLDAIDDGNKISGGLKLRCSAWAM
                     LGFIKFTDTYYMLLVTKRSQVAMLGGHYVYQIDGTELISLTNSSSSKLRPDKNPEEAR
                     YIAILNNLDLTRSFYFSYSYDITHTLQRNICRERKAHRDGYPKPSQQDYNTMFIWNHH
                     LLSPALENLKNPYEWCLPIIHGYVEQAKMSVYGRLVYITIIARRSRFFAGARFLKRGA
                     NDLGYVANDVETEQIVSEMTTTSFHAAGPDLYANPLYTSYVQHRGSIPLYWTQENSGV
                     SPKPDIELNLVDPFYSAAALHFDNLFERYGAPVYILNLIKSRERTPRESKLLKEYTNA
                     INYLNQFLPEDKKLIYKPWDMSRAAKSRDQDVIGTLEEIAGEIIPKTGFFKNGHDAES
                     GLRLQNGIARTNCIDCLDRTNAAQFVIGKRALGHQLHALGIIEGTTVEYDTDAVNLFT
                     DMWHDHGDTIAIQYGGSHLVNTMATYRKINQWSSHSRDMVESFKRYYNNSFLDAQRQE
                     AYNLFLGNYIFSQGQPMLWDLSTDYYLHHANPRSWSNKPRPNYIRWYTPDNLKEKEMP
                     PPPSPPKEPLSRYDDHWLEYYRPLAISSFSKIFSYKMNSTLRYLPFRPSSGALYDLSP
                     FVARIPNEQVNRERQHQQRSVRIQEPDFVRDRPERTQFGAVTPAPNWHLSTNQGSGLM
                     RDSSFGASETSNSTQRSTPSKAQIAQWTLGQLVSDSLNPSVTSAEAEEYERYINHPLK
                     VPLVVTSRDDLTATSARERESNLDLIEYVNKCNVEDSALKANADQNMADYAEFLNISD
                     EGLTVTAEDHEMKRYKRYRQWLRGKSLFKQRVDI"
     exon            complement(418394..421414)
                     /number=1
     CDS             complement(join(422554..422875,422983..424346))
                     /codon_start=1
                     /locus_tag="AO090102000165"
                     /note="acyl-CoA synthetase"
                     /old_locus_tag="AO080538000066"
                     /protein_id="BAE61264.1"
                     /transl_table=1
                     /translation="MNSNTPTDIVSFCFETQADHNATGPILIDGLTPTRSLTLHQFRQ
                     LVCQLIAGLHEQKIQQGQCILVHLENSILYPALFLAIVGVGAVYMGAHPASSATELEH
                     LLSLANPSLIITGRDTLSTVLQCTMSPSGGKKEKIPSDRVWVLNDIDQVLCEAFSSTP
                     DASMGDAAYHHRRDITKLLHSGQRPWRTFDDDGQKSKITPAAMFATSGTSGLPKAAIL
                     SHHALIQQHISIHHPVPYPVTRLLTLPLFHRYGALVALFFPTRYAQPLILLPGFQLRP
                     FLSAIHVHGVTETYLSPAMVHILIQSTPQSSSIRESLRSLRYVCVGGAPIDSRPLQSL
                     QDMLHPEACVAQAWGMTETATVFQDRYCLPSRQFDKGSVGVVLPGYQVRLVDVSGSGR
                     VLDNATEIPGELQVRGSGLFTSYKGHPDHTDGDGWFSTGDVMYQKNGHYFLVGRMKEM
                     IKVRGYQVSPVELEAELAQHPLVKDAAVIGVLATDGSSELPRAYVVPLSWAERPSPED
                     IYDFMRQRLAGYKFLEGGVVFVDSIPRNSGGKIRRTKLSELDDQRDKLIALLT"
     exon            complement(422554..422875)
                     /number=1
     exon            complement(422983..424346)
                     /number=2
     CDS             complement(424799..432088)
                     /codon_start=1
                     /locus_tag="AO090102000166"
                     /note="polyketide synthase modules and related proteins"
                     /old_locus_tag="AO080538000067"
                     /protein_id="BAE61265.1"
                     /transl_table=1
                     /translation="MKVDERVAIIGTGCRFPGGSNSPHELWELLVNPRDVARKVPPDR
                     FNIAAFHHPQMGHHGTTAAWESYFLDENIQRFDASFFNISPTEAAAMDPQQRLLLETV
                     YESLDRAGLRLEELQGTQTGVFCGLMRHDYHRLLTADMETNPPYALAGTAGSVLANRV
                     SYFFDWHGPSITIDTACSSSLVAVHLACESLRKGECSLAIVGGSNLLLSPDPYIWESK
                     MQLLSPTNRCHMWDASADGFACGEGVASVVLKRLTDALADGDHIECVIRATGVNSDGR
                     SPGLTMPNSNAQSALIMDTYARAGLHPKQNPHDRCQFFEAHGTGTKAGDPQEAAAIQD
                     ALFGCNMEENQPNNETVYVGSIKTIIGHTAGAAGLAGVIRASLALQNGVVPPNLHFNR
                     VSDTVAPHTTHLEVPTRAVRWPELPSGVPRRVSVNSFGFGGTNAHAILESFDQASRHP
                     STQVERVHQSQQALLPIVFSAASQSSLADLLEGYVQWLFDNPNVDLLGLASSLLLRRS
                     TLRYRKAFIAASPDELRIKIQHELKRNTTDAQWAIMSPPKREGGNCILGVFTGQGAQW
                     PQMGLELIQNCPQARMRLRELQQSLDDLPIEYRPGFTLLDELSAPESQSRLGETALSL
                     PLRTALQIIQIDLLRALGITFNAVVGHSSGEIAAVYAAGILNATDAIRVAYLRGFAVK
                     HAASRGKMIAVNLTEHQANAICSQPMWKGQVAVAAYNSPSNVTLSGDPETMDELVWLL
                     RSLERHTHPLNTDAAYHSHHMQPCAGPYLQALKSCNVGVSSPSSVQMFSSVYKGLVVN
                     STDCALDSTYWCDNMLRPVLFSQAISTCLDQIPDINLIIEVGPHTALQGSIKHILHDT
                     LSEGSVVPYIGLAHRGEDSIQSMAAAIGRLWAYLGMRDLKLQQYIQLFGPFRESCCVQ
                     SLPTYPFDHRTSYWAEPRLSQARLHCPIPPHPLLGVLSSECGRDEWRWRNYLHLEEIP
                     WLTGHRILSDISYPPMGYIAMAVEAAQAASRSKPLQLVEIHSLIIERTISIPVEGPGI
                     ETLFKMDIESADNDTMTGTFQCQISCGNEFQKCASGRVILALGEANPTVLPSKSKGMS
                     ISYPMNVDKFYNQLQIVGGNVSDIFRGITELTRQEGGMQGVANVPSHDQPTFHPVVMT
                     TALQVLWGAMMSDEGRLSALPLPVRIDSVTINPSCSHSGHVCLEASITRTGSGRNGCG
                     DVLVFNGQGDGIAQLEGIHLTLSKPKNSSDDQALAFGTTVWGPLNPDPSIGYPKNLPY
                     NLSIQNLQARLAVLYLRDAQAGLTAQDRERLVSHRRHYVAWMDSTLSKIRDGVHPHYP
                     RDWLLGTIGELDSQTTSHETLIHVTHIVGQNLLQFLSGGEETILLKLRDNNIDLLTRY
                     YQDDEAMRIMSDSLGKVVSQIVFRNPQLHVLEVGAGTGSATRAILSSIGRNYHSYTYT
                     DISPAFFEGASAAFHTHEDRFIYKVLDVECDVTDQGFSMHSYDVVIASNVLHATRSLR
                     RTLMNIRKLIKPSGYLVLLEGTDPDRVPTPFIFGAFEGWWLGEDDGRSGGPLIRREEW
                     DVLLQCTGFGRCTSYTPTNQANLYGMSVIVSQPTDMPAIPVIEMDLLLVGGSTETTRQ
                     IILDLKTILRDSFVQISSCLSVDDFTPGPGISQLAILCLAELDHHSEETRWQWQDMRL
                     MMTAASCLLWVSPADDPHSGVSKGLLRSLALDSSSGLLQHLTVIDSTPIGAEMLATTL
                     MNLVRTKQEGMGRPEIELGWGEGILNIPRIVRDPTITQRLLASRSPCVFNLVDVREQA
                     VCRLVSTEGSQKEKVDVYLTDPKNATTSAAKLFSNESIVQYQVHYCTQAALTITEKCS
                     LFLIVGQNVFNGARQLALSISHGSIISTPLSWAWDVPASVSTDNEPKLLAAVAATILA
                     FAIADLAGPSSTLWVHEAQAMGPTFMDALVSAVSDRQDIKNLTLTTSQCGLSDTRVHF
                     VHPHSSTKTLSSVLPRNVSSAVLFDDGRLSRRSRLVLPRCANFRSFSDFFRPSSIIEE
                     IDIQSVATILNSACAFVTRKGYEKGSSPRIISPREQSSVDSLEVVNWRQPTWIEAQIL
                     PASSLVSLSPTMAYVVVNMNHKLRRLVLDFLVRQGARHIVWVGEWSDEDFAWIAQLSR
                     DEVHVAVVQMWAFLSSISDLYDQLTSTRKAEIPISSLQTYMPIGGIIYDGLKDSPQQA
                     AENTLLLDELCGNDATFFILVGSLLGHIGFTDSNSFIGSTTGVLSGVISRRRQRGYVG
                     SVLYLGEQNAVEDITLSAGDIREAFSEAILLGPPESTSNGEILAGLRNSEKWELVPKL
                     SAWNESKTLLESDDKSQSAGQGQAHDTDAVTQLKLATSVAEAREIILQLFKEKLRRKL
                     GLSSDVPLRRETLLHELGIDSLVAVDIHIWFARELGAKIPVVQIMGAGSIGSMVDEVV
                     KRRNGFT"
     exon            complement(424799..432088)
                     /number=1
     CDS             join(432880..433161,433233..433286)
                     /codon_start=1
                     /locus_tag="AO090102000167"
                     /note="predicted protein"
                     /old_locus_tag="AO070297000070"
                     /protein_id="BAE61266.1"
                     /transl_table=1
                     /translation="MSAQVMRPGTPQHEGQEFLSGTDEELAVAMRHYLAYSGRFTVPD
                     MASTENSTRRVIHEVEMSSYPNWIGTTQERVVHIKGDILELSTVHPLVISGIEQRSFL
                     TWRKLPRLT"
     exon            432880..433161
                     /number=1
     exon            433233..433286
                     /number=2
     CDS             join(434114..434306,434377..434506,434571..434762,
                     434826..434977,435030..435274,435334..435605,
                     435671..436073)
                     /codon_start=1
                     /locus_tag="AO090102000168"
                     /note="cytochrome P450 CYP2 subfamily"
                     /old_locus_tag="AO070297000071"
                     /protein_id="BAE61267.1"
                     /transl_table=1
                     /translation="MLVLVSLVLCLTGFCLLQWALKERKIVKGLPPGPRPKPIIGNLL
                     DLPPPGALDWLHWLKHKELYGPISSVTIFGQTIIIINGHRVANELMEKRSGVHSSRPH
                     VPIAELAGWQYTLGFIPYDSRLRAYRRALHQEMGNATSISKYHNILDMETHRLLFRIL
                     KTPDCLMQHLRKEAGSIILRITYGYITEPEAYDPLIDLVDKAMEDFAQVILPGGWLVN
                     FIPMLKYLPSWFPGCDWQRRAKAFKQRAKAMTDIPYAFVKQQHEQQKHIPSYVSRLLE
                     QNNIKLGSEEELVVKWSAQSIYGGGAETSVSVFACFFQVMALHLNVQKKAQEEIDRVV
                     GASRLPDLSDCKNLPYINAVVKEVLRWHPVAPMGVAHASSKEDIYHRYVIPKGAILVP
                     NIWAMAHDPDFYHNAMDFEPERFLKSGRNEQNPEYDPHQFIFGFGRRTCPGQHLVSAN
                     LSLGVARVLAVFNITNAVRDGKKVPISPEFSPGVISRPAPFELSIQVRNAECKRLIEA
                     VGMKFPWEESHAEALAQLRI"
     exon            434114..434306
                     /number=1
     exon            434377..434506
                     /number=2
     exon            434571..434762
                     /number=3
     exon            434826..434977
                     /number=4
     exon            435030..435274
                     /number=5
     exon            435334..435605
                     /number=6
     exon            435671..436073
                     /number=7
     CDS             join(436167..436251,437290..437726,437831..437891,
                     437951..438168,438216..438660,438726..438857,
                     438923..439017)
                     /codon_start=1
                     /locus_tag="AO090102000169"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070297000072"
                     /protein_id="BAE61268.1"
                     /transl_table=1
                     /translation="MAENRCLIRLNRHTLAVTIIFKKQCADYGPRLTMQGSKHGSDGA
                     QYAFPTWRKCLILTDACFVVFTSSSALCSMFPATAQIAAELSTTVETLHIANACVQIA
                     MGISLFVWQPIRSFIGRRNAYLLAILTLFCFSIGAALAINASMFIAMRIIVGITGTFL
                     LVAGQELLAETFDPVARGAAFGYMQIGNTTGLTIGPCIGGIIVSFTRWRIIYWLQVGL
                     AGLGLILSSLFIPNEKGKSETVHGSISRLAALNPVNLLKPLVYPNIVITGSERCPEIQ
                     HILTSKQDIACGFLVFFQFIVLTSIPHIINPRFHFTTPLVSGLFYLAPGGGFVLGSLV
                     GGIVSDRTTKRYIAKRNGIRLPQDRLNGSLPMWLGFMPVSMVIYGWTLDLEVGGMAVP
                     IISVFFAAGGIVVAFNGLNTYTAEALPEHRFAAISGKYIIQYGFGAVSTAAVVPLIDA
                     IGVGLVFTICAIISVIGGVGVFLVAKYGLQMQNHRFSSRV"
     exon            436167..436251
                     /number=1
     exon            437290..437726
                     /number=2
     exon            437831..437891
                     /number=3
     exon            437951..438168
                     /number=4
     exon            438216..438660
                     /number=5
     exon            438726..438857
                     /number=6
     exon            438923..439017
                     /number=7
     CDS             join(439934..440225,440231..440298,440358..440741)
                     /codon_start=1
                     /locus_tag="AO090102000170"
                     /note="predicted protein"
                     /old_locus_tag="AO070297000073"
                     /protein_id="BAE61269.1"
                     /transl_table=1
                     /translation="MNPHSDVFRNNVIAVDVLAVVSIVLRFVARRIRKVTLGADDCLI
                     VASLVNPLLVTLANRNTNEISVCRLCSSRFPALLWEVRWDPCQVSLEITANESLIHYG
                     MGYDKEDLSAESSLMVAKLLYVFEILYVVNLLTIKLSILMMYRRIFTNISRLFRVGAM
                     ICGAVVTLWATAFVPTAIFQCTPVARAWDIDIPGHCINLQLGFYCVALPNILTDIAIL
                     SLPIRSCWQLHRSVLYRLSLIGVFMLGIL"
     exon            439934..440225
                     /number=1
     exon            440231..440298
                     /number=2
     exon            440358..440741
                     /number=3
     CDS             complement(join(442361..442930,442984..443433,
                     443495..443742,445564..445657))
                     /codon_start=1
                     /locus_tag="AO090102000171"
                     /note="predicted protein"
                     /old_locus_tag="AO070297000074"
                     /protein_id="BAE61270.1"
                     /transl_table=1
                     /translation="MFWKSLRAFLGRLPLLVGVEVTRCGVNFVGDDSLKQAGKAVAAP
                     MMDFYKKNETEGIPGKLTDTWYVAGSMFMTLIQYWQASGDDTYNAVVSNDLMFQAGEN
                     YDYYSKNVSDWLGNDDQMFWGLATITASEAGFPEISGKPSWTSLARVVFNMEVERWDK
                     SACNGGMRWQLWPYQEGYTMKNAISNGGLFELAARLARFTKNETYSEWADRIWDWSAS
                     TPLLQTDRWYIADSTSNLNNCSDAGDQQWSYNYGTYLAGAAFMYNHTNGSDKWLKRVD
                     GLLNSVLTTFFPKEGNGVVLSEVACEPILTCDRNQLCFKGYVAMWLAFTAILVPSTRE
                     LITPKLQGSAAAISKQCSGGDQNLCGERWYSTEPVGPTGLEVQMAALGGITSNLMLFE
                     AQSPKTIESNPNATETEIDHHSDEEPNKPKPITTGDRAGAGIITVVVAIAVAGTVVWM
                     IVP"
     exon            complement(442361..442930)
                     /number=1
     exon            complement(442984..443433)
                     /number=2
     exon            complement(443495..443742)
                     /number=3
     exon            complement(445564..445657)
                     /number=4
     CDS             complement(join(446866..447368,447426..447515,
                     447577..447804,447860..448283,450036..450470))
                     /codon_start=1
                     /locus_tag="AO090102000172"
                     /note="acyl-CoA dehydrogenases"
                     /old_locus_tag="AO070297000075"
                     /protein_id="BAE61271.1"
                     /transl_table=1
                     /translation="MSALEDLSIDDAQRRVPSRTTTGDIVLASKASNIVQHNPDQAYA
                     GPAKRGLYRPSLADIGKRLPSTENIRALENVHLDVGSLPSQSLHLAGSSPASFPLFET
                     NLPTPHNHLSRYATEFAEVKVLGRGSFGEVYHVKNHIDGQPYANPYYTDLHHNLRAYV
                     RNYVESSIAPYAQEWEAAGQVPEPVRRRHCELGFGIIHPLTTIEDAAGLFLPNNIPRE
                     KWDTWCSLIVADELIRTGYVGVIWGLGGGNNIGCPPIARFGTKEQRQRWLPKVAKGDI
                     RCCLGITEPDAGSDVANISTTARREGDVYVVNGAKKWITNGIWADYCTAAVRTGGPGK
                     GGISLLVIPLAAPGVTRRRMYNSGVHASGSTFIELDDVRVPVDHLIGEENKGFPLIMS
                     NFNPERLSLACASLRLARVCAEDAFHYATQRETFGAPLITRQAIQSKIFKFGLMIEPA
                     YAFMEQLVNIIELTKDRPTDDVRIGGMTALLKVMSTRALEKSVREAQQILGGAGYNKA
                     GKGARIEQISRDARVHVVGGGSEEIMMGLALQEETKALRTRRKALEKKARL"
     exon            complement(446866..447368)
                     /number=1
     exon            complement(447426..447515)
                     /number=2
     exon            complement(447577..447804)
                     /number=3
     exon            complement(447860..448283)
                     /number=4
     exon            complement(450036..450470)
                     /number=5
     CDS             join(451895..452879,453229..453284)
                     /codon_start=1
                     /locus_tag="AO090102000173"
                     /note="glycine/D-amino acid oxidases (deaminating)"
                     /old_locus_tag="AO070297000076"
                     /protein_id="BAE61272.1"
                     /transl_table=1
                     /translation="MHDLQNTFSLCFRGQNPQYLQQDTMESSKTTADIAIVGAGIVGS
                     ALAYFLSQTDKKVVLIDRSFSELKGSTGHAPGFVGQFNESEVLTRLAIETVGEYTKVP
                     GGFDVVGGLEIATSCEGVARLRSRCEMAKRAGLSAELISSGQATSLAPELVNDDNQIA
                     LYFPGDGAANAIRITTFYHENARARGVELIEAEVTEVQQANGCVNGVMTTSGLIPAKK
                     VIIATGIWATNLCKFDIPIPIVPVAHPYMYGEHHAPKLRKAPWVRWPQHHVYARDHGT
                     FFGLGSYDHAPVFNEPRDTAIGDWIGQFDETLSQAMRFIPEETQLVPRERFNEHLHNY
                     RGPPSRSCLRMK"
     exon            451895..452879
                     /number=1
     exon            453229..453284
                     /number=2
     CDS             join(453945..454340,454394..456573,456643..457381)
                     /codon_start=1
                     /locus_tag="AO090102000174"
                     /note="DNA polymerase delta, catalytic subunit"
                     /old_locus_tag="AO070297000077"
                     /protein_id="BAE61273.1"
                     /transl_table=1
                     /translation="MPEAVATPQKRVLGDASNNPRGILKSPDASKKRKIDNRLSARVN
                     PPSQNGQRKVPGSSQLQKSQFEEEVLEKLTQDINDLKDSNAEKDQQWERPPLGEFDPT
                     KENVCFQQIDAEEGTLLGGKPAVRLFGVTEAGQSVLLHVTGFQHYLYIAAPVNFTKED
                     CDPYRAFLESRIGNFQTMIQSVQVTLRENIYGYQGNQKSWYLKITVTEPKFISKLRGA
                     LENGGQSMNYKGLWTGIEKIATFDNIQYLLRFMIDTNISGMSWVEAKAGKYRLIHEKE
                     KHSNCQIEAVVDYHDLIAHPPNGEWAKMAPLRILSFDIECAGRKGIFPEPNQDPVIQI
                     ANVVTRYGESKPFIRNVFVLDTCSLIVNTQILEFEKEEKMLMAWRDFVQKVDPDVIIG
                     YNIANFDFPYLLDRAKHLKCTGFPYWTRLNGVMSQAKETNFSSKQMGNRDTKATNTNG
                     RIQLDLLQLVQRDYHLRSYTLNSVSYEFLGEQKEDVHHTMITELHNGTPDSRRRLAVY
                     CLKDAYLPQRLMDKLMCLINYTEMARVTGVPFNFLLSRGQQVKFMSQLFRKALEQQLV
                     IPNNTPESEQEYEGATVIEPVRGYYNVPIATLDFASLYPSIIQAHNLCYTTLLNKKAV
                     ERYNLKKDEDYIVTPNGDLFCTTKVRKGLLSQILEELLAARKRAKKELAVETDPFKKA
                     VLNGRQLALKISANSVYGLTGATVGKLPCLPIASSTTSYGRQMIEKTKQEVEARYTIA
                     NGYSHDAKVIYGDTDSVMVKFGVTELADAMKLGQEASEYVSSKFLKPIKLEFEKVYFP
                     YLLINKKRYAGLYWTKTEKYDKMDTKGIETVRRDNCLLVQNVIETVLHKILIDRDVDS
                     AQEYVKETISDLLQNKVDMSKLVITKALSKSDYAAKQAHVELAERMKKRDAGSAPTLG
                     DRVAYVIVKGAGGSKNYEKSEDPIYVLENNIPIDTKYYLDNQLANPLGRIFEPILGEK
                     KAGQLLTGEHTRSISVAAPTMGGLMKFAKKTATCMGCKKPLSGKAEMAGAVCEHCQPR
                     LGELYTRSLTKVSDLEVRFGRLWTQCQRCQGSLHCEVICSSRDCPIFYMRMKAKKDVE
                     DAQKELSRFDFDAGAW"
     exon            453945..454340
                     /number=1
     exon            454394..456573
                     /number=2
     exon            456643..457381
                     /number=3
     CDS             complement(join(457911..457917,457965..458318,
                     458364..458696,458803..458807))
                     /codon_start=1
                     /locus_tag="AO090102000175"
                     /note="predicted protein"
                     /old_locus_tag="AO070297000078"
                     /protein_id="BAE61274.1"
                     /transl_table=1
                     /translation="MMLPSAVANPQGLWDYESNVKGTGAFVLGTVSEMQGVVTANSVQ
                     LLVTVGYYFYNSVLTSMLASAEYSSYGTDRKPLRVTWPVKGSQQRSTYWLSVPYKYGI
                     PVMILFMVIHCPDDQPLYGEKFSSLGASVLPMFIAGLVGLVLFILLLCLAFRRLKSTI
                     LLAGSCSAAISAACHPPEDVCNATAAHGELLWGETSLPRDCVDDQSDGCDLPRGHCSF
                     TPLDARQPSLNKFG"
     exon            complement(457911..457917)
                     /number=1
     exon            complement(457965..458318)
                     /number=2
     exon            complement(458364..458696)
                     /number=3
     exon            complement(458803..458807)
                     /number=4
     tRNA            complement(460859..460931)
                     /locus_tag="AO090102t00005"
                     /note="tRNAscan-SE"
                     /product="tRNA-Arg"
     CDS             464754..465833
                     /codon_start=1
                     /locus_tag="AO090102000176"
                     /note="predicted protein"
                     /old_locus_tag="AO070297000079"
                     /protein_id="BAE61275.1"
                     /transl_table=1
                     /translation="MTTHLAAISPAKGRPFELEPRPTPKPGPDELLIAVKSVALNPAD
                     AIMRDQGLFISTYPTVIGFDMSGSVLEVGDNVPPSYQPGTRVAAYAASVWKSCDPDYG
                     PFQERCLVPWQHAVPLPEGMSWNHAATLPVAVQVPLSAWDAMGIPRMGEDTAKITMGK
                     REALLIWGASSSVGTMGVQTARLLRDNPNSSFAAVYATAGSANRSYVGSLGADRVFDY
                     KDPQVVNAIISAAKGDGLVIRHCFLATGQLASCQAVLEAFLGEDHKGETAKIASAPVV
                     PPDAMVMDGVETIFVMPSMLEEERLEQFRYWIGTWLKENLTKGTIRPSPELSVVGKGL
                     GAINAGLDKLLRGVSCTKLVVEIAE"
     exon            464754..465833
                     /number=1
     CDS             complement(join(466470..466924,466954..467118,
                     467167..467275))
                     /codon_start=1
                     /locus_tag="AO090102000177"
                     /note="predicted protein"
                     /old_locus_tag="AO070297000080"
                     /protein_id="BAE61276.1"
                     /transl_table=1
                     /translation="MAPNLAASQHQLIRDMIISRSLTAAQMADVANCSERSPPIKGGH
                     PRSITPLMAEALCEHLLEKPDLYLDEMALFLWDELEILTTPSTISRTPRRIAKERNAD
                     LRDFYLHNLSDFRSYHLVYVDESGCDRRVDSRRTGWSPLGVTPVQVARFHREQRYQIL
                     PAYSQDRILLSRVFQGSTDSTIFKDFIKQLLHHCGKWPDPKSVLVMDNASFHHTERIK
                     QMCSNAGVKQLFTRTRSVQEDKEG"
     exon            complement(466470..466924)
                     /number=1
     exon            complement(466954..467118)
                     /number=2
     exon            complement(467167..467275)
                     /number=3
     CDS             join(474349..474597,474824..474886)
                     /codon_start=1
                     /locus_tag="AO090102000180"
                     /note="predicted protein"
                     /old_locus_tag="AO070297000083"
                     /protein_id="BAE61277.1"
                     /transl_table=1
                     /translation="MRISRLLTLGSFWHLLAVVLAGFPAANLSSGLSSPLLVLSPATG
                     IFYPSNGDWTNEIQRLTLHDSLTYLAAVKPATERDVQKLEREDDTQMGGIYRKLVPIN
                     S"
     exon            474349..474597
                     /number=1
     exon            474824..474886
                     /number=2
     CDS             475741..476448
                     /codon_start=1
                     /locus_tag="AO090102000181"
                     /note="predicted protein"
                     /old_locus_tag="AO070297000084"
                     /protein_id="BAE61278.1"
                     /transl_table=1
                     /translation="MIRYDANGCIIDFEYVLYFEESLLPLQQGNPVTETENFEKSSEK
                     PTATANEYRTTSTSSSRDSSKRRRSSSKERRKRYRVETDSMDVESESIDTMPVGAVQY
                     QKRKRLDMMMAGGDEDVRNVTPVALETEDISEEVQRRLEIKEEQRRKRSSKPEKRKRD
                     SMASTGSTSSPGIAKPKKKTKTESSQDGNIDVPWDTGRKKKIMKPFDSEQGSDVGSFE
                     EKRRTKRQKRNSGTPVF"
     exon            475741..476448
                     /number=1
     CDS             join(477332..477481,477541..478014,478071..478154)
                     /codon_start=1
                     /locus_tag="AO090102000182"
                     /note="predicted protein"
                     /old_locus_tag="AO070297000085"
                     /protein_id="BAE61279.1"
                     /transl_table=1
                     /translation="MASFGEGPVVSHPGQGFVQTAGANNRTGRRPQDTSSGNRRRGRR
                     NNEVSEINQRSRPSPPSGPRGYRGGNNHPANGNNRVQKQAPRQPQGPGGKTKFTPRRS
                     RRGPGPQGAGPQHGGANNAPRNPGQHRGPYPRVSRDGDTIMRDAPALNKQPVRRPGIS
                     VPHPPPQRDVVMVDVFATPPPSEVEDVVMLDVFTTSHPVEQQFAALAIAAPQFATSTG
                     EEPQDIEMMDAPPLYFY"
     exon            477332..477481
                     /number=1
     exon            477541..478014
                     /number=2
     exon            478071..478154
                     /number=3
     CDS             complement(join(480613..480630,480698..480761,
                     480812..481368))
                     /codon_start=1
                     /locus_tag="AO090102000183"
                     /note="predicted protein"
                     /old_locus_tag="AO070297000086"
                     /protein_id="BAE61280.1"
                     /transl_table=1
                     /translation="MSTTTPEDIQTRREEDYARFKNYAAYTFLVASPILIALPPRKLD
                     HLTVLLGTAFAFSANHITYDRTGRSIVDRVHSKISSGRTIVPSGLPSERALEIQARLR
                     ASREKQLREGGLTTEEIEKLRAREMQDKGVMERVWMGGEKEGWKERRLREEREALDAG
                     KGYGDLIKEHVWDVWTWGKKDGEKKDILDGRLGVLCSAWGALDKACFIRTLL"
     exon            complement(480613..480630)
                     /number=1
     exon            complement(480698..480761)
                     /number=2
     exon            complement(480812..481368)
                     /number=3
     CDS             complement(join(482230..482504,482558..482949,
                     483012..483277))
                     /codon_start=1
                     /locus_tag="AO090102000184"
                     /note="predicted protein"
                     /old_locus_tag="AO070297000087"
                     /protein_id="BAE61281.1"
                     /transl_table=1
                     /translation="MSGMNMDDCTLATCPIDLAYINYQPNIPANVLFLVIFGLLLAAQ
                     ITLGTWFRTWTYMGAMTAGLILEILGYIGRLMMHSNPFDFNAFLLYLICLTIAPAFFT
                     AAIYICLGRIVIVYGEDISRIRPRTYTILFVTCDIIALVLQAAGGAITSIADSDQKSL
                     GDTGVNIMIAGLAFQVASLTLFIVLASEFALRVRRSSEVMKNTSTASVRSGLKWKMFL
                     LGLAIAVLTIFTRSIFRVAELKGGFNSHLANDEIALMILESTMIAIACICMTAAHPAV
                     AMGRRWGELSAKSRRGVVSSKMSHASSEIEMMNA"
     exon            complement(482230..482504)
                     /number=1
     exon            complement(482558..482949)
                     /number=2
     exon            complement(483012..483277)
                     /number=3
     CDS             join(484705..484987,485043..485701)
                     /codon_start=1
                     /locus_tag="AO090102000185"
                     /note="predicted protein"
                     /old_locus_tag="AO070297000088"
                     /protein_id="BAE61282.1"
                     /transl_table=1
                     /translation="MTSHSIVLQRTGTMPWSPFIESCAAKLSQECEFSTDRYLLGQVQ
                     VQHMLVRIDSLVARRFGENQAPADIEVMIRSLQSDFEDCKARLPVPIDHDAFQGISSH
                     AFDIHLYQTIFFDVYPSSAASIDHSMALLRIDALCHGLAAAKQFMSFYFSLPPGIEKG
                     YSYTQWTMTGFSIAASCKLVLASLEPSVRDHDQVRGLRETLDMRHEIQKSVKRMNTLD
                     QECKGGKWDQHEMFFYQDWLRFLSEWFEEKYRLAESDSAGENNGALGVFTTGISEKNI
                     DEEPQPDPGFPWVGLQDVTIEEMLNVWLEPMNMPHYF"
     exon            484705..484987
                     /number=1
     exon            485043..485701
                     /number=2
     CDS             complement(join(485942..487549,487611..487910))
                     /codon_start=1
                     /locus_tag="AO090102000186"
                     /note="predicted protein"
                     /old_locus_tag="AO070297000089"
                     /protein_id="BAE61283.1"
                     /transl_table=1
                     /translation="MRNDRDNLLRPVHSQDERPKSSTLSGSQGQRLIDKPAAPCSPKR
                     PLEPRQLRYNKWQLMFDLLSAISALPFVALALVAMIFNSRSVDEHDWDDLQIAMKTSV
                     TIFPLIYSAVIGRAIRQIAKQNLERGSTLGRLEQLNKSTTVFGAISTPLILKSWNILG
                     LVLVLIWLISPLGGQASLYLIRPQTLEHVERQEVQYLDINGLSKAPNLSSFPRLTNAL
                     EAMFLACLIAPVSVKEADSDAWGNAKIPLLRSLVRNNTAQSEGWFKPAGNSITYSSLV
                     GVPMFGISSRGNSTFQLQTSYIDTDCFELGEPPDELVYEYKGQSGKFRIYPAAPWNAT
                     RSVNASVAPDIHVLSGYGREATNGAMITCHLTNVYVELKVLCSGSNTTAQSQRSCRVT
                     AIRESVETHQSSSLPPLMYPDFNVRDTFAQGLVNASLSVNRKLSTYTEAYLQNIDAAE
                     TIPLPKYLLKTPLHDISDHLTQIMNTFYLGSIALPFVTLGPNLPSEGNYSKYSEAYEA
                     FDRSSLASLVAERAYRDTTATYVVNWGWAAVLLLASLVLIGASVVSFLVARQSLNPDI
                     IGYASTLTREAPYLPLPSAASALSGYERARWLKDVRIRFGDVQPESTVGRLAISTPDL
                     ADRSRKGRLYF"
     exon            complement(485942..487549)
                     /number=1
     exon            complement(487611..487910)
                     /number=2
     CDS             join(488455..488793,488861..490157,490242..490309)
                     /codon_start=1
                     /locus_tag="AO090102000187"
                     /note="predicted protein"
                     /old_locus_tag="AO070297000090"
                     /protein_id="BAE61284.1"
                     /transl_table=1
                     /translation="MELEVYHRPSSSHAASFPETGSSHNSDTQLYPKNASVFAVESDN
                     QRDQASFAIVGWPIGSRKLSRLDIGSLLLNLLGVSTAVLYLVLIAIVIKRNGNPVDKA
                     DWNRIQTAMNLAATLFPLAFAAVIGRMNQQLATWKLERGVSVGVLEQLFGSSTFFNTV
                     ITQVSVRSIKPLPFILIILWCISPLGSQSILRMLHTKPTTITRPIDITYGNDTELSTH
                     TFIPSTTFTKAEAMYQESLLSPDVVKHSPLDIFGRLKIPLVNLRDSSDWIELDTENTD
                     YSSLTGIVIDGVKDANGETEFTMEAPYYNLHMSSVEGEPTFNSKGFDFEDDGMYTIDK
                     SQTRYGLTEVYFNFTIPDTNFKASFNLTEQYVDMRVKCIDGIANCATTAIRPISRTSP
                     HANGTYWADMRAIHTLFSYLRSAGSERSLTEAYFRNPDTPLAADIYTGSNFTIPVDIF
                     LLRLTQAINTYALLLSASSGGEVYNGTGTFTDSSPPPVYEISWPWLAISIVATSTIIV
                     GAFVPALLGFFTRNPDILGYVSTMTRDAPNLKIPPGGVSRIGIGTLDQASPSNKGRLY
                     E"
     exon            488455..488793
                     /number=1
     exon            488861..490157
                     /number=2
     exon            490242..490309
                     /number=3
     CDS             complement(join(492494..492764,492823..493544,
                     493600..493854))
                     /codon_start=1
                     /locus_tag="AO090102000189"
                     /note="predicted protein"
                     /old_locus_tag="AO070297000092"
                     /protein_id="BAE61285.1"
                     /transl_table=1
                     /translation="MAEEAVANKVKCTYIGCKLVFKSEKEMKHHKKFDSEHAYCDECE
                     EDFEDEERLLIHKIKSVKHIVCPVCGIDFGSDGGRNSHIRQNHHSLQVIPCHGCKTTF
                     KSASGLMSHIEKDECPTIRSVHLLQEQSKKMMIREALGAGEGVNMPIIPPQGTLEDTE
                     FDDADGGVMLVTDEAASRVLSNREALSNQPKPGQDDPTASVSAMLALKHWPTLDGKAS
                     KGKSLAPSELLAFSDLSISAATGKENNSWKGKEPVRSIPDGVSTQRPFGIGPVRPGDT
                     LRMLDRAWDATKFFDSFTGQFVCPCKKGFSTMTEFENHVLMKSRMMEDRQCPGCLRFF
                     KTTAALVAHLESPSTRCNLSDGERYGQIFEEITGGLIQTAGYTEDGRIKYEAGKLEIT
                     DGLGPATTTVGTDLRLRPQRRKF"
     exon            complement(492494..492764)
                     /number=1
     exon            complement(492823..493544)
                     /number=2
     exon            complement(493600..493854)
                     /number=3
     CDS             complement(join(494673..494694,494749..495188,
                     495250..495270))
                     /codon_start=1
                     /locus_tag="AO090102000190"
                     /note="cyanate lyase"
                     /old_locus_tag="AO070297000093"
                     /protein_id="BAE61286.1"
                     /transl_table=1
                     /translation="MSLATLDTSQHPNLPSASATLFKAKAAKKFSFEQIAQHIGRNEV
                     ATAAIFYGQAKASPEDITNLASLLGIPQEVLEDQLNGFPDRGKSVEMPPKEPLIYRLY
                     EIVQNYGYAYKAVLNEKFGDGIMSAISFSTKVEKETDADGNNWAVITLRGKWLPFSRF
                     "
     exon            complement(494673..494694)
                     /number=1
     exon            complement(494749..495188)
                     /number=2
     exon            complement(495250..495270)
                     /number=3
     CDS             complement(join(495657..496364,496429..496534,
                     496589..496659,496731..496841))
                     /codon_start=1
                     /locus_tag="AO090102000191"
                     /note="predicted protein"
                     /old_locus_tag="AO070297000094"
                     /protein_id="BAE61287.1"
                     /transl_table=1
                     /translation="MSSTKSRPTLAELPLNPNDPPYSAWGLWGVDDEVGTLNLLDEST
                     VTKAASEIQVGQRFSLNWSLASPRTPMFGRDTCEFSHKVYQHSPELIALDDELHFNTQ
                     KSSQVDGLRHAAYQKSGLFYNGRSKEDILKAGSLTLGIHHWHDNGLFAGRGILIDYWA
                     YAKRHGKAYDATGGASITYDELMACLAEQSQLSKQTIEFRKGDMLLIRSGFTHNYVKL
                     SEDQERKSAHTTPPKSCGVAQDERMLQFLWEKQVAMVGGDSPAWECLPPVPSANFLYH
                     EVLLAGWGCPIGELLWLEDLARACDEHKKWTFFLTSAPLNVPGGVASPANMIAIL"
     exon            complement(495657..496364)
                     /number=1
     exon            complement(496429..496534)
                     /number=2
     exon            complement(496589..496659)
                     /number=3
     exon            complement(496731..496841)
                     /number=4
     CDS             join(497438..497589,497675..498060,498116..498392,
                     498466..499099)
                     /codon_start=1
                     /locus_tag="AO090102000192"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070297000095"
                     /protein_id="BAE61288.1"
                     /transl_table=1
                     /translation="MGHLTENSDSTPRDPTFEIDWEQNDKENPTNWPLWYKCFTVWSV
                     SLTTTCVILYTTSYTSGSPGIQESFGVTSRIVVLIGLTTYMIGLGLGCLVLAPLSEVY
                     GRRIIYISTSVLFTILVLPVALAPNFPAVVISRFFGGFFGSASVVAGPGTINDIIQPK
                     YRALAFSLWSLGAMNGPVLGPIIGGFVYQYLGWRWINWIVLICGGASTACLCLVKETY
                     APVLLKRRRKAKQIETGDTRWWTKYDSQAEESIWKRLQTSLSRPLIMAVFEPICLFWN
                     VYVGVVYAVLFLCFVGYPIVFQQLREWSPGLAGLGYLGIGTGIALAVFSEPLVRNFLI
                     AKHPPDPVTGKIPPEALVRPICIGGILIPIGEFWFSWTARPPVHWISCVLAGVPFGLG
                     NGLVFIYATSYLAASYGMYAASAIAGNSVVRYVFGGVLPLAGSKMYRAMGVNWAGTML
                     ALVEVFLTFIPFVFYRYGARIRQRSQMASKMI"
     exon            497438..497589
                     /number=1
     exon            497675..498060
                     /number=2
     exon            498116..498392
                     /number=3
     exon            498466..499099
                     /number=4
     CDS             join(500278..500378,500443..500725,500801..500984,
                     501046..501305,501363..501683)
                     /codon_start=1
                     /locus_tag="AO090102000193"
                     /note="predicted protein"
                     /old_locus_tag="AO070297000096"
                     /protein_id="BAE61289.1"
                     /transl_table=1
                     /translation="MSPLSGKVAFVAGANGISGFAIIEHLVRQPKTEWSKIIVTSRRP
                     LAYFWPDPRVEFVAVDFLEPVEKIVAKLRNICAPVTHTYFTSYVHHDDFRVLKEKNVP
                     LFKNFMDAVDEVCPNLERVCLQTGGKYYGVHLGPVKFPLSEDMPRYDDKGYNFYYVQE
                     DYLKEAQKKRNTWSWNVIRPNAINGFAPHANGMSEALTVAIYMLICRELGQPAQFPGN
                     EYFWNSIDDNSYAPSLADLTIHATTKDHCKNEDFLHCNGDVFVWKYLWQDVAKYFGVE
                     APEPQFNKATGQADTLNNEIDMVEWAKDKRPIWEAVVKKYGGKVEAFDWGTWGFFNWA
                     TGKSWCTISSVNKARKYGWQRTDDTYETWIETYRSFENAGVLPSHTAL"
     exon            500278..500378
                     /number=1
     exon            500443..500725
                     /number=2
     exon            500801..500984
                     /number=3
     exon            501046..501305
                     /number=4
     exon            501363..501683
                     /number=5
     CDS             complement(502094..502645)
                     /codon_start=1
                     /locus_tag="AO090102000194"
                     /note="predicted protein"
                     /old_locus_tag="AO070297000097"
                     /protein_id="BAE61290.1"
                     /transl_table=1
                     /translation="MIRTIRRLNQITSSVLSSSRTRASSRSALQSSSRNYSGDTQTVP
                     QTTSTRTWPSSTTLPLENPTSHTSAVQGSYIPISALTNQNTTSLTTSPMHASHSMTPS
                     TQLQHTSEGWAVAPTNLVTADFDFEQSLTSDLIPGGHIYGWMAGTQPSEMQHDGTAYM
                     EMGWLESLFGTDLGSNVMLPPED"
     exon            complement(502094..502645)
                     /number=1
     CDS             complement(join(502777..503022,503031..503627,
                     503752..504353,504525..504534))
                     /codon_start=1
                     /locus_tag="AO090102000195"
                     /note="predicted protein"
                     /old_locus_tag="AO070297000098"
                     /protein_id="BAE61291.1"
                     /transl_table=1
                     /translation="MMIRIHGSTSPQGATARRPVDSDISDVVRSQVPAFSGESSITHT
                     LDQIEGHLERTDVTYGNAERPMSCQVSGTSLTAPSSPLGGFRETREAVDIRKVLNAYG
                     IDPRKEEWDGYMHTFCDEVHILYPFLHIPSLWANYANMWNSGFSSTEHEFQRSKDYRM
                     MVAQVWVCIALGRCTESPRVSSEEGKHSAGWSIFEAATDLIGDLVVYLFRLDANERAE
                     KFLALAISHAHHLGFHRSKVIRRMPVFNDEMIRRLWWSLYALDRRLAIETGHPFLIQD
                     VNVDAPHPQNLDDEWLTRYKEDSKTSNELESDIKTALSKDPITPIPYLSATTRYSRVL
                     GKIWEAIYGANMTDVIPSSSLLEYLDQLISRAQVEVRPEFSDSYQAEPPNLEQTNPLR
                     WLAKQQMLMRIPLHLTSFPVFHSFVTNHIPSDGCPSACSSENQSSNNGLHPRNPSPTS
                     SKQKSPASELPATLFKNSNKSPNIQHLHFPSSTH"
     exon            complement(502777..503022)
                     /number=1
     exon            complement(503031..503627)
                     /number=2
     exon            complement(503752..504353)
                     /number=3
     exon            complement(504525..504534)
                     /number=4
     CDS             complement(join(504592..504688,504746..504993))
                     /codon_start=1
                     /locus_tag="AO090102000196"
                     /note="predicted protein"
                     /old_locus_tag="AO070297000099"
                     /protein_id="BAE61292.1"
                     /transl_table=1
                     /translation="MVRQQRDRETADQQQQPRDYRENDDGASDSHEGLPTEPAPKRHK
                     RGKYVSKAWYGTRKYSVTATSLTPHVYSPVDNAREEKSNVMDASPVDHVSSMAEIASC
                     KQWTCGAEDQPG"
     exon            complement(504592..504688)
                     /number=1
     exon            complement(504746..504993)
                     /number=2
     CDS             join(506516..506798,506948..507141)
                     /codon_start=1
                     /locus_tag="AO090102000197"
                     /note="predicted protein"
                     /old_locus_tag="AO070297000100"
                     /protein_id="BAE61293.1"
                     /transl_table=1
                     /translation="MGSGHLSEFDASMHYSGSDTPFAVLPFPRIDFRNDASLDIDQDL
                     DLSCVSCFSKLAEDAVRSEEISVLITGKPTLKVQALPTAHLDIHKTVTLPEFMKRDDA
                     FNVTKLDLINPRTNDGYNVNATIVFNTPAAISVEMVSCDSTPTSKLLTDETFLFTD"
     exon            506516..506798
                     /number=1
     exon            506948..507141
                     /number=2
     CDS             join(508088..508468,508525..508791,508846..508865,
                     508920..509251,509302..509343,509393..509588,
                     509643..509913,509969..510010)
                     /codon_start=1
                     /locus_tag="AO090102000198"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070297000101"
                     /protein_id="BAE61294.1"
                     /transl_table=1
                     /translation="MDILLRESSFGRLLNFASNGQIFPHRDLNIPKHEETTSSSSSCP
                     EAPRHVLIDFSGPNDPDMPRNWPTLAKTVVMVDVMLLNFSFYAASAIFTPSIPRIEEV
                     FGATTAEGTLGLSLFVIAYGIGPLILSPLSNLPSIGRTPVYVLGSLAFCLFNIGTALA
                     KNLHTILILRFFGGFIGSAPISVGGATLMEVYGPTEIPYAIALYAVSGVCGPILGPIL
                     GTLVIERWKTWTATLWLLSGVTAFTTVFIFFLLPETLYSNILLRRAQRLRDQTGNPAY
                     QSQADIDTPQSNLAIRIVKQTMDDFKLSCMDPVILFVNMHTMLIYGVLYLWFEFFPFV
                     FDGIYHFTAIQQGLAFFGILVGAVVSVITYVLWLYFSYQPRVAKPEAIVEPEARLVPG
                     QVGAICIPVCLFMFAWTSRESVHWIVPIVGTAFFAPGFYLTFQSILNYLGESYPRYVA
                     SVFAGNTFFRSSFGGALPLAAPRMLQSLGIGWASSTLGFISIAMVPLPFILERYGKRL
                     RSWSKYAN"
     exon            508088..508468
                     /number=1
     exon            508525..508791
                     /number=2
     exon            508846..508865
                     /number=3
     exon            508920..509251
                     /number=4
     exon            509302..509343
                     /number=5
     exon            509393..509588
                     /number=6
     exon            509643..509913
                     /number=7
     exon            509969..510010
                     /number=8
     CDS             510353..511111
                     /codon_start=1
                     /locus_tag="AO090102000199"
                     /note="predicted protein"
                     /old_locus_tag="AO070297000102"
                     /protein_id="BAE61295.1"
                     /transl_table=1
                     /translation="MGYCSKNASTTTLDEFRSRDPVIESFSVRATPKMIRHTNLPEIN
                     PVLDLSPITFYLYSISTPLLQHNTPSQVPQESQIWPRDASTHAPPSTTRIVHKTKKGK
                     GKQPEAKKEDLGKYCYAKVTANVARKDGYMMFYQACGRLIIQRKWEIIHRTTLYSEDE
                     IKAEDGHTMSVLVNSSGSEPTENEILESFWKALEPARKNIMELNQKQWDVIEKVFKTA
                     VEAGLEGVQVTLLKAIDDLFKIDLPEEASSSKGA"
     exon            510353..511111
                     /number=1
     CDS             complement(join(516353..516705,516819..516873))
                     /codon_start=1
                     /locus_tag="AO090102000201"
                     /note="predicted protein"
                     /old_locus_tag="AO070297000104"
                     /protein_id="BAE61296.1"
                     /transl_table=1
                     /translation="MPQYLGCFVMLATILSIKGSGPGPGSGSCACSGSGSSSGSGSGS
                     WTGSGSGSSTGSGSASGSGSISCADSGSDSGTGSGSGAASRTSTGPSAISSGAGGGHT
                     KSFPGAGNPLLTSSLVRFFFILGLSFFHPLYSG"
     exon            complement(516353..516705)
                     /number=1
     exon            complement(516819..516873)
                     /number=2
     CDS             517020..517439
                     /codon_start=1
                     /locus_tag="AO090102000202"
                     /note="predicted protein"
                     /old_locus_tag="AO070297000105"
                     /protein_id="BAE61297.1"
                     /transl_table=1
                     /translation="MLDYLYRGDYDEHELATEAQRYQDQGPALPKYANAMMHVTANKY
                     AIRGLKDLTEKRLVSNLIHEWNDTNFIQLIQYVYGPRTPANSTLQTIVAQFAARHVST
                     LREFQSFHEVLKRFPDFMYVFSSEMMERVIQLEKEAL"
     exon            517020..517439
                     /number=1
     CDS             join(518328..518335,518381..518822)
                     /codon_start=1
                     /locus_tag="AO090102000203"
                     /note="predicted protein"
                     /old_locus_tag="AO070297000106"
                     /protein_id="BAE61298.1"
                     /transl_table=1
                     /translation="MPWGKDIIEIQADRTEAVRRAFERAERRNYTFKFKDRRGLGGLG
                     GSGNLDEFLVELRQNDPKVEPTVKDMMDIVIPIVERQFRIEDVYLERLCIMGDAGALT
                     WLEELNPMHQLAWSRLIKELEGNEWPGLFGYLKRLVEYLSLASGTSH"
     exon            518328..518335
                     /number=1
     exon            518381..518822
                     /number=2
     CDS             join(523376..523402,523686..523980,524040..524183,
                     524256..524900,525879..526756,526806..527492)
                     /codon_start=1
                     /locus_tag="AO090102000204"
                     /note="phospholipase D1"
                     /old_locus_tag="AO070297000107"
                     /protein_id="BAE61299.1"
                     /transl_table=1
                     /translation="MGLVAVKVKGKPQGKPPKEDKLSGLFGKIQGAVAEIGTDLGQRI
                     GTALDPQAYAEYGQVKPQTQHRFGSFAPDRQGNDVKWYVDGCTYFYAVSKALESARES
                     IWILDWWLSPELYLRRPPTKNEQYRLDRMLQSAAQRGVKVNIIVYKEVTQALTLSSHH
                     TKHCLEDLHPNIAVFRHPDHLPDRQNLADDISTSLHNLALDAKSLVQMSGDAIKNIYG
                     MHDDVVLYWAHHEKLCVIDGRIAFMGGLDMCFGRWDTNQHALADVHPEDVNESVFPGQ
                     DYNNARVLDFQDVAHWEKNQLDRKTSSRMGWSDISVSLHGHVVEDLRRHFIERWNFIY
                     DTKYDSRKDARYSRLALYGRPSSSNRPQQPGAQQQQNEFTQYSNVLRGQLAGQVHQYQ
                     DRLSSFGHPSQPRGNMCCQIVRSCSKWSNGTPTEHSIADAYAAIIRNSQHFVYIENQF
                     FITATGDAQKPVKNQIGAAIVERILRAARAGEKWKMIVVIPSVPCFAGDLADDSSLGT
                     RAIMEFQYNCINRGGSSILELVSDAGYNPMEYIRFYNLRNYDRINVSGPLVQAEQRSG
                     VDYEDARKQHDVNVVGQGGYGPGAPAPRSAFDTTAPFQQYQQGARQVPGAKTASGRWN
                     SVSSCYMLNGEDIRNVPWDGPPEAEIDAFVTEELYVHSKVMIADDRVVVCGSANLNDR
                     SQLGDHDSEIAIIIEDYTPLESTMNGKPWTASRFASSLRRYLFRKHLGLLPPQDYERP
                     DANFEPVGVPNEFNFDAPESRLVADPLADTLHNLWNSRAHTNTEVFRKVFHSVPDDCV
                     RNWSTYKEFYGYFFDKADKQAYGEEKDSPPSRYRYGHVVRDDFPGGPEGVRQVKELLS
                     KVKGTLVEMPLMFLIEEDVAKSGLALNDITEPIYT"
     exon            523376..523402
                     /number=1
     exon            523686..523980
                     /number=2
     exon            524040..524183
                     /number=3
     exon            524256..524900
                     /number=4
     exon            525879..526756
                     /number=5
     exon            526806..527492
                     /number=6
     CDS             complement(join(529732..530832,530879..531832))
                     /codon_start=1
                     /locus_tag="AO090102000205"
                     /note="predicted protein"
                     /old_locus_tag="AO070297000108"
                     /protein_id="BAE61300.1"
                     /transl_table=1
                     /translation="MAEEEDPIVQALPPATDYLTYLTLLEYQLTPARLPTLHKLLQDE
                     VLTTNIGWDLVQLLLPMLPQSLECLQDIARLGNPREVILRVSEALMQLQPEDEDDDDD
                     DDDEENETAEPAAAHDTEPVDTELKAATDRDAEKSNIQNNLPRHVLKFNALVAMLSIL
                     HSRIQTKSPSRFFATSLQAVLEAYTLMPTNETTLALLEFFRDVSPSKRPAPPPRAASE
                     SSVLRVSEASAPDPEAEVQSPNPSNNEPALIKRFLQFGLIELIKSYILSFSGPMDPGM
                     SWTIRLQEKLQTRHLTGQVSETEVFANNKELSERDMILGKITALSRDFGLDDKQLLAV
                     VSQPADKHPQPLDFDEPPRNVEEIPLERHGALLLLAARAAMAELFSSGQVTPIAVFPE
                     LAQIFDNFVGAHDKPDEIAFGQPQALLDSLLTLTVFSMQRSIGEPSTEIEFRRFILSL
                     TACTTRQSYNSIRRIPGTILHSHPSHIVRFKTIRLVLEDDRFQLIRDSAIGWLKDEIL
                     DANKKPSGSPESDIFINPHYFSILFPLLFNSSELLLNVSSDIVASWIKFSQTLTPSIH
                     AALSLYYILLSSSTLRAQLQLEKTYIYFRNRFLEPLKSLLHAFESDLTQNGGDGKIES
                     AVGENMCQVGMARSVGLVSHAVEQVEDAVGDAFVGADDELQEPSMDDVARVDKIRKET
                     AL"
     exon            complement(529732..530832)
                     /number=1
     exon            complement(530879..531832)
                     /number=2
     CDS             join(537169..537634,537693..538708,538760..538834)
                     /codon_start=1
                     /locus_tag="AO090102000207"
                     /note="Rhomboid family proteins"
                     /old_locus_tag="AO070278000065"
                     /protein_id="BAE61301.1"
                     /transl_table=1
                     /translation="MAANSYYNTGYSNNPPTYEQANSHTDSFHRQSPAPTYTGPSGHP
                     YADSEPPHIRDSQHSLGSDQGAYVAGGRLNEGDHYAENIPLKENTQYSNGPPPANWMQ
                     QPTHYPPDPAMLESAPNRSRGKKKGFFKKKIPFVTYILTVVQIAVFIAELVKSGQLTG
                     SPIQTKPQFNPMIGPSAYIQINMGARYAPCMKNVDKVQNSPVDFLMPCPNSTTNALEC
                     TLSELCGFGGVPNPHLGGSLDDQPEPNQWYRFIVPIFLHGGFIHIGFNLLCQMTMGVD
                     MERMVGWWRYGLVYFASGIWGFVLGGNYAAPFQPSSGCSGALFGILALFILDLFYTWK
                     ERPSPFVELIIMVLGVGISFVLGLLPGLDNFSHIGGFIMGLALGLCIMRSPNALRERI
                     GLARNPYVAMSGGAGPTSDDENKTTTGPSFVNLFKGRTGPNSSSETAGPLGFFKGRKP
                     LWWAWWLVRAGALVAVIVGFILLIVNFYKYPKSNCSWCYRLSCLPVHDWCEQGMEPFT
                     ITNTTTTTGN"
     exon            537169..537634
                     /number=1
     exon            537693..538708
                     /number=2
     exon            538760..538834
                     /number=3
     CDS             join(539669..539867,539934..541327)
                     /codon_start=1
                     /locus_tag="AO090102000208"
                     /note="predicted DHHC-type Zn-finger protein"
                     /old_locus_tag="AO070278000064"
                     /protein_id="BAE61302.1"
                     /transl_table=1
                     /translation="MATLAASPPSSPSWPKRRPRAWALRCERYCCAAASFFPLAFVYG
                     LTTWAVYVEASIGIRPSRNSWIGLPTSIIGIALYICLNASYSVAVFTDPGSPLSSNRR
                     HEYSALPVTELPEFTSYTVNSMGGSRFCKKCQCPKPDRAHHCSTCKRCVLKMDHHCPW
                     LATCVGLHNYKAFLLFLIYTSIFCWVDFAVASSWIWTEVLNDTRYMDTILPVNVVLLA
                     ILGGIIGLVLSGFTIWHISLAVRNLTTIECLEKTRYVSPLRKALDRRRYENILGNGHN
                     GHENDDPESLGHRLQDYGNQILDAHANAIPGVTRPEEGEEPLPAYSQSGPGGTPAQQA
                     LSRSYADLERQREHDRYHSYLDEEDNEKMPNAFDHGWRRNLLHLFGDRPLLWPIPVHT
                     TTGDGWHWEPSSKFIEAQDRVRQRREREASEEQQYYRDLYQRNMNNSRSWLGTDATPS
                     MYMPHQPSNVYQETERPATGVSMKTLAPMSPRPRPGDSDFEDVEESHDFLQSRNDHLS
                     APRKPGLPAKQHGQSDEWRDWD"
     exon            539669..539867
                     /number=1
     exon            539934..541327
                     /number=2
     CDS             541881..542801
                     /codon_start=1
                     /locus_tag="AO090102000209"
                     /note="non-canonical ubiquitin conjugating enzyme 1"
                     /old_locus_tag="AO070278000063"
                     /protein_id="BAE61303.1"
                     /transl_table=1
                     /translation="MSPSLRRLMKEAAELSASPSPHFHAQPVSDSNLYDWHFTIAGPP
                     APSPYASGIYHGRIVLPPTYPLRPPSFRFLTPSGRFEVNREICLSISGHHEETWQPAW
                     GIRTALLAIRSFMDGDAKGQVGGLDVSEEVRKDYARRSGDWCCEVCGKSNEAILGQWR
                     DYCKENGVEVGDMGDEKVVSPAAKEEGEKGDTDATRQEEQPEKIVQDEPVAVSQKSVP
                     QQPAPEVVQAAFSPPPPPSTSVTTSTLVPGSSVQTDFAAPAPRRPVTSYPAQAVASPQ
                     SEDPWLDRAIIGVLVALVFMILRRMACSED"
     exon            541881..542801
                     /number=1
     CDS             join(543522..543588,543704..543843,543912..543986,
                     544059..544247,544323..544575,544658..544890)
                     /codon_start=1
                     /locus_tag="AO090102000210"
                     /note="predicted protein"
                     /old_locus_tag="AO070278000062"
                     /protein_id="BAE61304.1"
                     /transl_table=1
                     /translation="MSIDDTPKPLQIVIIGAGIAGLNATQQVLEKSKFARETGAAIHV
                     PPNCTAMLQWMDVDPKDFGGTLIEQIHRYDSNGELKYCKELSGIRDQWQAEWYLVHRV
                     DLHNYLKERLARTQGTLHLGCKITHMDIESEQPTVTLDDDREFTCDLLLGADGLHSIL
                     RTHIVPNFPSPYPEGKSTFRWLLKTDDMKNDEATKDVVGDPGVFVEWAGNDRRLVAYP
                     CSNNKIYNLCGFMPTAESGKYAEGWQAVGDKSALAKGFSGFAPSVQRLIDMAGDDLKV
                     WELADMERMPTWVRGRAALVGDSAHPFQPCMFVFFYPSLISS"
     exon            543522..543588
                     /number=1
     exon            543704..543843
                     /number=2
     exon            543912..543986
                     /number=3
     exon            544059..544247
                     /number=4
     exon            544323..544575
                     /number=5
     exon            544658..544890
                     /number=6
     CDS             554785..556389
                     /codon_start=1
                     /locus_tag="AO090102000213"
                     /note="predicted protein"
                     /old_locus_tag="AO070278000059"
                     /protein_id="BAE61305.1"
                     /transl_table=1
                     /translation="MNLVSIQDFPEHRNLHLRTYSGSSTIIVWCYYVLGIGVNVQING
                     VGMQFGDNPRIFLENCQPFEASATLLDAAGENEPLFKLSQVEEDPPIQGEDRTTARGF
                     IRRILMLSGVSEKNVEAQAHSIAAHCIRLLSSTAQPSVLASLKVTSMASQVERNLLGA
                     VAFLFDIAELDRCLVSKLLGKIQQKKEKLKSGDRQKWSQMILIIISFARVHNLEKCDN
                     LPLSLKAYWGLCEEDFEISCQEEGFVGTAPDTFVCFDIISRMLLGHQYSKEYVASSAL
                     VSSWGWSVFFDSFDALDPADINPGVIHIRLGVPTRNGERKMRIVDGPTDVPIAWGEVL
                     HESEIPITFWPGVFTGRLTATLIGYHGTDAFSAVQVYEWETGPQKSKKWRMGFRDKQE
                     MCLTFNIIDICPCPEFLKDEESKAWINQLITTGHLQKRGVLDSARLAEVVEVTRKYPS
                     SAEKLASSPERVFCETLRRLDTTDSLSSAWYFFVTANTAARWLALDGLEQLKGEAAGF
                     LNILRGKGCCVKCACSAVATKSFVLL"
     exon            554785..556389
                     /number=1
     CDS             557327..558313
                     /codon_start=1
                     /locus_tag="AO090102000214"
                     /note="predicted protein"
                     /old_locus_tag="AO070278000058"
                     /protein_id="BAE61306.1"
                     /transl_table=1
                     /translation="MRRRRDFESRNYQPQHNRNGYDTRATEATHHRDVLRRIAKETLK
                     VIPDITKQLSPSINVYHSTKLSCEDLPRLQPRYCPAFPERASIRVLNEDTLNAAIQIS
                     QFMRTGGTNPHLHDPRPLIINFASYKKPGGGWLNGAVAQKEAICHRSSLAVSLDESDY
                     PLALDEAIYTPYIVVLRSDMASGYRLLFPHTPAKDLPLFSTITLAAIYRPRVQTFDVK
                     DNHGGDSRSRPQWRKKQVFALDRHRNTTKDKMRLALRIVAIHRHRLLVLGALGCGVYG
                     NPPEDVAHCWLEVLKEDEFSGHWWKGAWFAVYDSRNEGNYATFNRVLSGRQV"
     exon            557327..558313
                     /number=1
     CDS             join(559170..559826,559882..560391)
                     /codon_start=1
                     /locus_tag="AO090102000216"
                     /note="predicted protein"
                     /old_locus_tag="AO070278000056"
                     /protein_id="BAE61307.1"
                     /transl_table=1
                     /translation="MISKDPDTTHTSGKSQLDNSANSWTNSLPTQKRKFDDDAGSAII
                     EYVERLSNIAPSPSIVPSLYRRETPSDPKYINELLDAVRRGTVVTVEMILNHVDIDAR
                     DPCTGRTALSIAAELGDRDMTKLLLIQGASVNIRQYSLSSYCFGRPAMASGRFPLHWA
                     IAGNHIVVAELLLQYGANPNARNSPGRSALQEACMRSDLKMVRLLLQYGADVNARSYN
                     HGWAPIHEAANDKPIEILQLLLEYEPVLDVPAVFEPHAPGAAPLHLAVRSHSLDSLRL
                     LLSSGADPDALMVEDMTALHLAAAMGWVEGITVLLDAGASINARDACTRETPIHKAAR
                     NIKMDAIGILGARGADTEIKNIDGQNYQTLLECARRSPDDWRVDPLLGSYCTFY"
     exon            559170..559826
                     /number=1
     exon            559882..560391
                     /number=2
     CDS             564960..565712
                     /codon_start=1
                     /locus_tag="AO090102000217"
                     /note="predicted protein"
                     /old_locus_tag="AO070278000055"
                     /protein_id="BAE61308.1"
                     /transl_table=1
                     /translation="MPPITTPGHESHGGCASADSSTLSRHRSTSAEFPPSQSPTPVSY
                     PRTTVPLCPPPNMAFPCPRTHTPRSYAQQCLLLESRMASEDLTNMLSVPIWRARDTPI
                     RSMYRLYEAMAAGEYYAIRPEVEYFWYQRSWILSRVPDPRDYDPVRYAILASIAEELA
                     KAINWRLSLGMRRDKRKHIYRKTLEDVLPPYTPETAPSWTKRVPPIDVELITDLPDAL
                     DSSGRLVLEAGGKSPAFAERNIVTDSGHFYTV"
     exon            564960..565712
                     /number=1
     CDS             complement(join(566719..570818,570877..571321,
                     571403..572496,572696..572762))
                     /codon_start=1
                     /locus_tag="AO090102000218"
                     /note="predicted protein"
                     /old_locus_tag="AO070278000054"
                     /protein_id="BAE61309.1"
                     /transl_table=1
                     /translation="MAPSLRELIDFLLAEIALCGDQGASPSDILTFINTFYAKAAQDA
                     STRNHVVDRRFQEKVWSWLAKNPEVSIGENGECNALSLSDVERRVNDAPDSEHTAQNQ
                     IRVFVSKERTWLAITGHEPDENKLLATEFALLSIIASRKADGIAQTELVKLSGQDKRS
                     VPKRTDQLQQKGYIEKRAVQIKSTRTSLCTLRKFMQAEQSSTETTKDQSSGQPQVIDY
                     KEFSKQLFSILREHEIISRVDLKKILGFADRWRWRILSRALRKFERIGVLKRVKAMSQ
                     FSENDKHYFACVKLIREPTEKDLELFHEFSRGISTNLEQDDNAELDEDVEPTDATRES
                     PLLNNGETLNVMKREEETDEAGRILPLWTPDQTIHNLILDVVENAGTEGIMNQQIIRK
                     CFGGFYRRPLENTMSRLVECWQLSQPLHLRHMAIVRDTVLNRTITQYNHFTATNFAKL
                     VEAGESAWEAVEFTPKNPKVDKIRAPPVDAQPELDEYGLPVAVPAKELVKNGDVSLLE
                     CIVAVDPSSYNATNTDAAAIRLKDGTYALHCGQTKAPAGSRKLATRSDIVTPSRPKRA
                     RLDVSDSEMGDRTPGGPISTIKRRKVPRDESEKFQGMSEIEKLKALGLDETWTEYNAL
                     LIERPNSGVYVTPRGRRRPTGKRQGRPRISRIAIFKCPKLSSFPWFTEEAETGDQDGG
                     SQQPSREQTVEETVEETPAPTPVPTPATTGKALDAPEDINATPSRGTKRHPRPSTSKI
                     GPSPATMRTAKQRRITDFTTKSNNVPITESGNPEGNPAGDPRQDKPDVGNDNKTEGKP
                     LKRKRAESPNQNSQEVVTENGLRESNVQATQILETPSKKPREAVRNEGNKDAIGAKDK
                     PPTDQAPVNDLSDSTPMETEACTTAETDGVAMSTTPASQAVLESNNGEELKANPLERA
                     KDANGSSGAPTNTKTLAESSRARENVKEKKGSVGFIRRKIILDIVEKAGGAFPMGTEI
                     WYPFATAWRKTKYKETPDLRTIKATVKHIIDAGKLRQLTFSGKDNKGVMVTKNIITKP
                     DMRPDDPLVLDMQKKMLAAGSRHYIPDNVDYDPEMTKTGARRVTFGKDGRDPNTYAKL
                     PVESALTVQLQYKPGFVVAQEKRKGLSVQRRLLQRIGEGKENHSKVVRLLSLQRPLAQ
                     DSATPGITAATRPDQIANQGRRRIKAGRRSSVLNAQDSSTAEGGRRMRRLWIPISSMA
                     PYAMLMSPRQTFNATTGTFSTDAGLAALRAARNDQKKKVRESPRALETIGDKTPELPH
                     SLDDLFSQTRRRTVDYSESADPRSNRFFYDTNVIMRWELQNEGLLDKKSADLWYINQT
                     VQDSFDSVPLEGNIRFDIDEPELPTRPPLEPRVTRQRGRQSDLLAEPGSFGAMTPLGH
                     NRTLASRALAPGTAQNRRLEKLTASMAAGDESDTTLQPTGSRAPARRNRTGYQLPHLL
                     TQRLMIAIVVVRALAGGYEGKVVDWTLFSSSFPGYDPLFIQAKGKYVLSKNRLQLAKM
                     QSDFQERYLEAYANGQVPPINYDDLEGYDWEWIVDWANAQLDVPKSEKLLPDLPATRE
                     QFDSVFEIREEPPSTLDDIYQTTQPLTINRKRNLLASAPFALPLIDKHKPPAPRKQDL
                     SRLEVVKSWIRANVVTPEDAYRPAEARQALSYMGSFIDSAIDSLVTERVISMGNRGRI
                     TPGRNYDITDHFLQALGRKRLIESTQLRRAARFKTQILDPALQSEGKFEIKYNAEDGD
                     ILAMINLVAARRVILRPRDPPRDKYGLTEGGYLTRQIDKDKLRFRVELYPVEENYVYG
                     NPIEKELNDVPAPCPPRATNNGVAWVPEKIPVWCDIHGGFIKLLWDLAVATVAGCVAN
                     RPGLSAASIASMIKPTMGAWEIELLLKWMTEIGVMKKEGPDSEKEGGWILQEWWWMIL
                     R"
     exon            complement(566719..570818)
                     /number=1
     exon            complement(570877..571321)
                     /number=2
     exon            complement(571403..572496)
                     /number=3
     exon            complement(572696..572762)
                     /number=4
     CDS             join(574065..574242,574313..574431,574493..574554,
                     574617..574642,574693..575042,575108..575383)
                     /codon_start=1
                     /locus_tag="AO090102000219"
                     /note="predicted protein"
                     /old_locus_tag="AO070278000053"
                     /protein_id="BAE61310.1"
                     /transl_table=1
                     /translation="MEEGTANTNPLEPPPLPYSLRTRKKSIAFFWILFVFDTLAQPVA
                     LYFGLWYGTNLSHNLVFTIVTAALGGISVFEYFYRLYNLFRKDSRTRPLNARKSWLDF
                     FHINFTIVWLILAVELIVGTVQEEPYVRLVAMVLPSVMFYFGGVYLALDILRVLGFKA
                     PFRISSTPKGSTMPTALYVMIEDVVAVDGGGGQTYRYALRVRYLSSPYFRRMLFQMNC
                     FWAGGSIIFAAVITAIVFTTPKPVAYTLGWSLPFVWAGVWTLITIPWVQSDLRREKKA
                     WAENRGQGGIPYTDDISAPADRTRLESIHEHMPNLWPWGREKNKEKPSTQSTPSDGHS
                     NV"
     exon            574065..574242
                     /number=1
     exon            574313..574431
                     /number=2
     exon            574493..574554
                     /number=3
     exon            574617..574642
                     /number=4
     exon            574693..575042
                     /number=5
     exon            575108..575383
                     /number=6
     CDS             complement(576006..576707)
                     /codon_start=1
                     /locus_tag="AO090102000220"
                     /note="hydroxyindole-O-methyltransferase and related
                     SAM-dependent methyltransferases"
                     /old_locus_tag="AO070278000052"
                     /protein_id="BAE61311.1"
                     /transl_table=1
                     /translation="MATPDSKIDHAASIRYWNSVAANSNTMLGMLGSYPWYTRIDLRG
                     SKSFLSKVRRLVPGCTTEGKLKLGADCGAGVGRVTEGFLKDVCETVDAVEPVEKFTQV
                     IRDSALKGSGIVGDIYTVGLEGWYPEKKYDLIWTQFCVGHLTDVQLVEYFVRCRESLT
                     ETGIVVVKENQSTDPNGNDMYDDEDSSVTRTDEKFKEIFKQAGLIVVTSELQLGFPKN
                     FKLLPVRFYALRPKS"
     exon            complement(576006..576707)
                     /number=1
     CDS             complement(join(578189..578510,579443..579540,
                     579594..588125))
                     /codon_start=1
                     /locus_tag="AO090102000221"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070278000051"
                     /protein_id="BAE61312.1"
                     /transl_table=1
                     /translation="MTLFSPTTVLVGFLLLYLSSFLIFAIVRIATGVSIQRIGYFSLR
                     RIAYVPKQGVQIELRGLGLSLHPPSFAQPTWLSLRLTELKVTVDPAALAKSKRNENHP
                     DVSEPTSPGDFSPPEDEDSATLQGRSKTWRTLTKLKEQVKRLHRKIHWLKLVDVIAVN
                     TTVNFLEAGQIQVGSLSLAVDTRRKMVDRGKLFRRKKYDSGEQRPAEWIMTVQNVLLT
                     VDGREPTELLDNIGVNVHGMLHKDLEGLRDASIALKIGRMHIPYDDLMTLVQRIKKFR
                     QTFSEASKSEADDEVSFADFVEELDKPGSQDDALVQTVADSKEFASSLLRGIHEIQIA
                     LSFFRLSRAIQPPSPKQSSVYLNIISHEIGIDLHRMDQNSPAHRMYFQRNDVAHQALL
                     AAISLSVSLDDSSGETDNILYIPMATTTIKTTLPSKTISSFSEWNPEERNTNILFANL
                     VVTSPSIDLEPRHVSRLLGLVQDRTSSPRGKKRNNHQLISRLLPKASIKLSVHEPVLR
                     FVLPISEASDVSTEDYNLLICSISSISLDIESSHSSEGGVHYSLSSIYRVASHQLYYQ
                     TPLGVKHNLLTTDNMELKVLLSSSPQVCVIASGSLNTCSAHMVNGEVNRGIQQVIEQF
                     RAQVKPKRKVSMSLEERKPSLLRRLPPWLLRFQFEATGLSLEIAGVDEAVSELSRGVS
                     LQLHSWTADYRAQKTEQPSVSIVRRRTPSHSTIGDESPFRFPPTSPPRQTQRGAADGR
                     RLALHVRGFEGFVIESEDYLEAEPFFSLPRFEVALSTLSDRLGPIFHINSVIKGVYLQ
                     YSLYRYYCVGVAASVIQSAFLQRSPATTPQTPSPWNSPPSSPRPFSQRNELITADVRV
                     TVVQVKTFLPSDPPMMLQIYGLAAGSHRLSVPFVRAHLVRLHAEAPKLKGVWARIIGM
                     TNVRVDFRNAKLKQGANLTEEKSIDVWADFIRLGVPHHMVMHRIFDNVINTSKAIKQL
                     HHRFKNHTAEFDTSRDPEEPKKVPRISLRSKALLFEMEDDAFEWKLGCIYRAGLLEQR
                     QRLAREEAYDLKIQKIKECDQRRASSRLRAKSSHRTLRSERVSGESKRSKSADAKPRS
                     SDADDSKRGRGRKFRYDTEGAACLSGESKISAEVAWYRLQEYNARSWKKKIDGALKFQ
                     GTSIKEVRNLFSGADEPPEDVEETETVLSIPNRPALMAALISDINLVIDKPSFPLEDY
                     PTFLHRIGKGIPMSTQYALLIPMSFQLDMGEARVNLRDYPLDLLHIPALRPGQSPRLP
                     SWSLRTNFVIAEEYRDYKSARQVQVELVPPMELPDGSKSPSFEISVWRSVSPVKTYSD
                     PTIEISTSLPTSISWGMSYQPVIQDMMKIIEGFTKPEIDPSDRVGFWDKIRLSFHSRL
                     RILWKEDGDVHLRLKGSRDPYVVTGFGSGFVMCWRKDVKWEVHTSDDPKEFMGITSGE
                     YVLAIPDYSHEARFMAEATAQDLESTSTSSELKNAAHFKKVVMKLSGEVKWVVGLVFE
                     RNVDENRRSFQFMPHYEVVLQNPKYVDSSERAVYDAYRGFRSNHIHLSISVLAPESRD
                     WSVDHVESSTSYNTVHLTPRFFTHFYNWWSLFSGVMSLPVRQGPLWPGITKTSKKFNR
                     HLATVKYQLLFAPLFVAHIYKHKDREDYGEDVVTATGIKVRLDSLKLDVHQRREQVKT
                     LAKGRLKQTQASAMRINQAELDLQAADFRAVSASIEGTNLDDIEQSKNDIISSFQQPV
                     PSVDLSRFTIPDHNLDWIDMDDFVELDWTLPQESNPRTQILPLAFTPRFTYFRQTDHG
                     DIGPDDTGYSSFGNEPTHACVMSESNEPRRVQMQLIRERLAHVETQVQDWERTIGEQE
                     LRMAKDVNQDPSLRTDHENYVKQAQSLARRRAFLASALQRLERQLAREEMSSMKTSPE
                     TVAADVTNRVGTDADSNNDGKDADMDGLYSSPHDEFATNFNNRFIIHNTQLKWNNSLR
                     NIILRYSHQVSQRRGFVYYMSRRAVKFILDIVDEQSKNQRRHSKLFKSASRRPSDIRG
                     LVDNEEDGTVEDRIEQLLNDAKRFVNADEQEDSDHKKQDSSKSDNSSENISPEFTPQN
                     SYHLRLIAPQIQLQSEKNQKSVVLVAAKGMQLKVVSIMDKERVSDDVSGLVQRRFSLE
                     MDGAQFFVATQKNLMKHLQFYAGNKYGNSPGSAWPPWLTIEAMFDFELNPFGFSRIVQ
                     KTSASLRYDKYNNLRLKYNEEVGKGQPDHEHGLSSEESRIDQISVEFPHLRAICDSAE
                     YYSMYIIVLDLLLYSEPLEKVRSERLERIMLSSDFSDLRGAPEMVFKLQSRIRHLEEI
                     KEHFQIHAKYLDKQGWEDRLELEKDLAQCEDELFFLMKAITTSQRRIDPTMSGAHGLM
                     RWNISAHEVVWHLMKDETEPLVEFQLRNAEYERTDNSDGSNHNLVAVERLYGLNLLPD
                     AIYPQIIVPYLDQAKPLDSPDDYMIKVKWHMLEAVAGIPVLDNFEVSLFPLKIQLERE
                     LGQKVFEYIFPNVGASAFENGGFSPLMIKNMKPLEDSDEDDEAESPVPPRSAHSNTDV
                     STEDLQKGPGAIELRLQPTFTSSDDTRPRSARSNHLKGLAMTPLHKDSNRLGPSEPSR
                     QTARPSTSGGLSTKRSADSLRLLSRQGTDKTLAHGSGTSVVEDKGKKFGLAKLPNRSK
                     SKAATDDLSQMMSRASNYMTLAHVKVQDVVLCLSYKGKGDHNLEDIHDFVFRLPILEY
                     RNKTWSNLDLALRLKKDVIKALISHAPAILGNKFSHHRPTKQQQKKYRDIANSAQLLH
                     NPDSAAVTISDKSQTSQDSNSEYSESQSQRSVHSGSSRLVRSNSLGSSMLSIDQSGLM
                     SDARSGSEVDVDARWEQSRRIVNPPSRPMTSGTAIARSETKRWDGADEGPTQLLQHRP
                     NNLHRPLTLPKINPNPTSNHLRRLSRIKGSFRPALDIDAEVPLRHVFETGGCFGAGVY
                     AGFCDFEVASGVLVSIDGMAGLGNDEGVGFDVPETVLVD"
     exon            complement(578189..578510)
                     /number=1
     exon            complement(579443..579540)
                     /number=2
     exon            complement(579594..588125)
                     /number=3
     CDS             join(591529..591592,591643..591687,591825..591902,
                     591956..592237,592288..593306)
                     /codon_start=1
                     /locus_tag="AO090102000222"
                     /note="RRM domain"
                     /old_locus_tag="AO070278000050"
                     /protein_id="BAE61313.1"
                     /transl_table=1
                     /translation="MSPAPKQKAQKMSISTFLADENFGSWADEMDDMPLPAPPQPRFD
                     SDRRAGGPPSAGFGSGFGDRGYAVREPLPLPTQPPYTAHVGNLAFDATSADISDLFVD
                     CAVTNVRIVEDKLTKAPKGFGYVEFETVDGLKKALDLSGATLQGRTIRVSIAEPPKER
                     DVKEFDWTRKGPLPAPEAPRRVPDRSSFGRNMDNFSDAGSERTGGRRNFESDGKFRDF
                     GNWERKGPLSPTGPVREGGRPRTNEGSSFRKSSPAWGEGRSQDGSRPPRREFQERAPT
                     AAEMDNAWRSKMRPDQPKESSNPPSPAAAPASPAAPTRPRLNLQKRTVTEAVSSPAAT
                     TGTGASPFGGARPIDTAAREKEVEERRQLALRQKKEADERAKAEKSEKQRAAKDQAKG
                     DKASTPADPNGRDTADTPQGAKNFEILRRAGEDESGMAADQDQSEETKPAAKAEAPND
                     AAAKKENGSWRRAPAQPADAADEEGWSTVSSRQRNNRRGAGRSFA"
     exon            591529..591592
                     /number=1
     exon            591643..591687
                     /number=2
     exon            591825..591902
                     /number=3
     exon            591956..592237
                     /number=4
     exon            592288..593306
                     /number=5
     CDS             join(594577..594696,594751..594771,594835..594892,
                     594962..595021,595077..595362,595412..595793,
                     595849..595951,596006..596451)
                     /codon_start=1
                     /locus_tag="AO090102000223"
                     /note="vesicular amine transporter"
                     /old_locus_tag="AO070278000049"
                     /protein_id="BAE61314.1"
                     /transl_table=1
                     /translation="MHRNDIQENYVPVASSPPWKLGFRSSRRFVISVVAMAVFTDVFI
                     YGMIVPILPVVLKTRVIVPDDQLQQWMAIMLAAFGGAIFVGSPIFGYFADKGTSRQVP
                     FIFGLLALGGSTIMFWIARTLSSLIVARVLQGLSAAVVWTVGMALVVDTVGKDQVGAA
                     MGYVSMSMTVGTVFGPFIGGVVLSRISYDAVFTIAVGLVVLDILLRLVMIEQKTALTW
                     TQPQIANETEGLLSSASETGNGVYQGTREECSEISVNPRHSVCWPEVSGELDASGRTS
                     SMPPIVRLMCSSSVLLFCGATVVDAILWSSFDTVLPLHVMDTFQWDSFWVGICFLPLF
                     APSFFSPLVGDAVDRYGSRTIAFLGFLLDFPTFFLLRLITHDTKQDQILLYMFLFIAG
                     IASTLQMVSLMTEVSLVVERYEKESPGIFGSQGGMGQAYGLFNVAWSGGQVLGPLIAG
                     LLSDRGGWVTMVSVFGTMSGVTALVIGFSDKKVLRCFRKQT"
     exon            594577..594696
                     /number=1
     exon            594751..594771
                     /number=2
     exon            594835..594892
                     /number=3
     exon            594962..595021
                     /number=4
     exon            595077..595362
                     /number=5
     exon            595412..595793
                     /number=6
     exon            595849..595951
                     /number=7
     exon            596006..596451
                     /number=8
     CDS             join(597625..597835,597928..598463)
                     /codon_start=1
                     /locus_tag="AO090102000224"
                     /note="predicted protein"
                     /old_locus_tag="AO070278000048"
                     /protein_id="BAE61315.1"
                     /transl_table=1
                     /translation="MSTTTTTAALTSTTLVGMLPTINATGLIPGKNCPTCGQETTLVQ
                     EHAADQRRIKELEGQISFLSVQAAQRAEKLAEYEHEVRRLRTQASYTSRNGSSISSTS
                     SNEMNRPLSPPSNSQGRLSTLTSFLHSHGPSNTSPTQTPAQPISQPPSRQPSPDHTAE
                     LQSALDREQSLRRAAESQLSQASSELEELTAQLFSQANEMVAQERKARARLEERVAVL
                     ERRDVEKRTRLERLEKAMERVERIRALVGQ"
     exon            597625..597835
                     /number=1
     exon            597928..598463
                     /number=2
     CDS             join(599160..599190,599247..599272,599335..599513,
                     599580..599863,599940..600445)
                     /codon_start=1
                     /locus_tag="AO090102000225"
                     /note="predicted dehydrogenases and related proteins"
                     /old_locus_tag="AO070278000047"
                     /protein_id="BAE61316.1"
                     /transl_table=1
                     /translation="MAIGVAIIGSGNFAREEHLPGVQASDAFDLKAIYSRSLTSAQIL
                     ATGVSGIDLYSEDAGPGKTYDDLLSRSDITAVIIALPILAQPEFIRKALTAGKHVLSE
                     KPIAKDLSAAQDLINLHNSRIVSSKTVWAVAENWRYMSKFVRAAEEVRRLGGVKNFRV
                     VMRSMIKPGSKYHKTEWRRKPEYQGGFVLDGGVHVVAALRLILGQSDGLAMVAAHSSL
                     RQEHLAPVDTVDALVKTRSGATGVLSVSYGSEINDSLFEFTCADGVVTLDFDRLTVNG
                     EGYDVPFEGRGVNKELVEFAESITTGDGIATRLRPEEALADLEVMEGIFTSSEKAGEN
                     RNLHLQI"
     exon            599160..599190
                     /number=1
     exon            599247..599272
                     /number=2
     exon            599335..599513
                     /number=3
     exon            599580..599863
                     /number=4
     exon            599940..600445
                     /number=5
     CDS             join(600844..600883,601188..601312,601433..601554,
                     601626..601734)
                     /codon_start=1
                     /locus_tag="AO090102000226"
                     /note="60S ribosomal protein L32"
                     /old_locus_tag="AO070278000046"
                     /protein_id="BAE61317.1"
                     /transl_table=1
                     /translation="MVLAKKHVPIVKKRTKTFKRHQSDRFKCVPESWRKPKGIDSRVR
                     RRFKSNIPMPSIGYGSNKKTKHMMPSGHKAFLVQNPKDVELLLMHNRTYAAEIGHAVS
                     SRKRVEIIAKAKALGVKVTNPKGRVTTEA"
     exon            600844..600883
                     /number=1
     exon            601188..601312
                     /number=2
     exon            601433..601554
                     /number=3
     exon            601626..601734
                     /number=4
     CDS             complement(join(602333..603658,603720..603962))
                     /codon_start=1
                     /locus_tag="AO090102000227"
                     /note="RNA pseudouridylate synthases"
                     /old_locus_tag="AO070278000045"
                     /protein_id="BAE61318.1"
                     /transl_table=1
                     /translation="MALTPVDTTLKVPPPDPVEEPPKVAVTPCEPPTGPYYFEGGFRR
                     VSPYHYTYNTFCKERWRGRELVDIFISEFRDRPPEYYREALEAGRVCVNGKPAGPDTK
                     VKNGDVISHTLHRHEPPVTSQEIGIIHEDDGLIVIDKPAGVPVHSAGRYHYNSVIEIL
                     RSERGGGWVPRPCNRLDRLTSGVMFIAKEPKAAEMVARRLKERTVHKEYVTRVKGKFP
                     DGVVVCDQPIMQVSPKLGLNRVRATGKTAKTKFRRLAYYPPHDPEPVAANKDRAATPP
                     PAYANEEEGYSIVHCLPLTGRTHQIRVHLQFLGHPITNDPIYSNRRVFGPGLGKSEDN
                     GDRDKEIMERLNNMGKTEVADTVSYRTHLTAAPLVPPGTDSSVIEGIMSREHEAALVE
                     YHKRKGERLSGEQCDVCGTELYTDPGVHELGIFLHAVAYSSDDGDWKYRSKMPSWALP
                     PSGMEGPRAVPDWEPVPEEEEIVIGNGTVPEGMEDEDKPKRRQGDVLVRGVGVVDSEK
                     LQSNSDLLELSLST"
     exon            complement(602333..603658)
                     /number=1
     exon            complement(603720..603962)
                     /number=2
     CDS             join(606117..606196,606269..606719)
                     /codon_start=1
                     /locus_tag="AO090102000229"
                     /note="predicted thioesterase"
                     /old_locus_tag="AO070278000043"
                     /protein_id="BAE61319.1"
                     /transl_table=1
                     /translation="MAPKEIEAKKRRTRSDYVFHQVYRTRWFDNDMYAHLNNTVYAML
                     FDSIVNSWLIAECGMDPFSINNKGSDSSAKAETNSASQVGIMVNSYCDYFASVAFPDV
                     LDLGLRVAKLGSSSVTYEVGVFKQGEEEVKVVGGYTHVFVARETMRPTKAGMEERVRK
                     GLEKLVKGGGKEGAKL"
     exon            606117..606196
                     /number=1
     exon            606269..606719
                     /number=2
     CDS             complement(join(610500..611715,611765..611919,
                     611976..612332))
                     /codon_start=1
                     /locus_tag="AO090102000231"
                     /note="dihydroxyacid dehydratase/phosphogluconate
                     dehydratase"
                     /old_locus_tag="AO070278000041"
                     /protein_id="BAE61320.1"
                     /transl_table=1
                     /translation="MALYIERYLNYGITREELMSGKPIIGIAQSGSDLSPCNRHHLEL
                     AKRVREGIRSAGGIAFEFPTHPIQETSRRPTACIDRNLSYLGLVEILFGYPLDGVVLL
                     TGCDKTTPAALMAAATVNIPAICLNVGPMLNGYVKKDLAGSGMVLWTGREMYAAGEIN
                     KEEFIDYVSKGTPSVGHCNTMGTASTMNALAEALGMALPGSAAIPAPYRERGQCAYET
                     GLRIVEMVHSDRKPSDIMTREAFENVIVVNTAIGGSTNAPIHINAIAKHIGVEVSLDD
                     WDRLGFHIPLLLNMQPAGELLGEEYYRAGGLPAIMAELLDARKLNPDALTCNGYTVAE
                     NVRDKHTWDRRMIKPYNEPLLEDAGFLHLQGSLFRSAIMKTCVISEPFRQKFLENPKD
                     PNAFEGTVVVFDGPEDYHHRLEDPSTPIDDRSILVMRGAGPLGYPGAAEVVNMHPPGR
                     LLRQGVKSLPCIGDGRQSGTSGSPSILNASPEAAAGGNLALLQDGDRLRVDLNKRRVD
                     ILVSTEELEKRRKTLEAQGGYDVPESQTPWQELFRRETTQLSDGMVLRDAVKYQRLAQ
                     RYENPRHNH"
     exon            complement(610500..611715)
                     /number=1
     exon            complement(611765..611919)
                     /number=2
     exon            complement(611976..612332)
                     /number=3
     CDS             complement(join(614451..615006,615060..615237,
                     615299..615734,615794..615852,616331..616421))
                     /codon_start=1
                     /locus_tag="AO090102000233"
                     /note="molecular chaperone (DnaJ superfamily)"
                     /old_locus_tag="AO070278000039"
                     /protein_id="BAE61321.1"
                     /transl_table=1
                     /translation="MDDGQEAGDGDASWSRKRAQLCRIIQGKSDEVLGIASSASKDEI
                     RKAYRKSALANHPDKVPEAEREEAEIRFKAVQEAYDILYDEDKRHLYDTHGMSAFNGS
                     GEPGMGAGPDLDDILAQMFGGMGGMGGMPGGPRANKPRRSPNEEQKYEVKLEDLYKGK
                     TVKFASTKNVICSLCQGKGGKEKAQAKKCATCGGQGVKQVLNQMGQFITTSTVPCSTC
                     NGEGEFFSPKDKCKKCKGKKTTEERKILEIYIPRGAREGDKIILEGEADQVPGQEPGD
                     IVFHIVEEDHAVFRRAGSDLTATIDVTVAEALTGFSRVVVKHLDGRGIELQHPKKPGD
                     VLSPGQVLKVPGEGMPMKRGDERGDLYLVVNIKFPDQSWKPNPEVLEKLKELLPKPDA
                     PIQADTVDEVDYDPKGDLDEFGAKDAHGGSAWEDDDDEGEPAQCAAQ"
     exon            complement(614451..615006)
                     /number=1
     exon            complement(615060..615237)
                     /number=2
     exon            complement(615299..615734)
                     /number=3
     exon            complement(615794..615852)
                     /number=4
     exon            complement(616331..616421)
                     /number=5
     CDS             join(616478..616651,616711..616783,616839..616928,
                     616957..617357,617413..617670,617734..617900,
                     617956..618574)
                     /codon_start=1
                     /locus_tag="AO090102000234"
                     /note="Glutamyl-tRNA synthetase (mitochondrial)"
                     /old_locus_tag="AO070278000038"
                     /protein_id="BAE61322.1"
                     /transl_table=1
                     /translation="MRAGNKKTNLPDFPARTRFAPSPTGYLHLGSLRTALFNYLLAKR
                     TGGQFLLRIEDTDQKRTIPDAEQRLYEDLQWAGLQWDEGPNVGGSYGPYRQVRLSNAL
                     INPTPKNAILTIYRTHARDLINNGHAYRCFCSADRLDAFARHRSQAGLPPGYDRKCAE
                     VSAEESEDRAAKGEAHVVRLKVEGYPMFEDIVYGKTGQNRSPNKLDLIDRVYDDPILI
                     KSDGHPTYHLANVVDDHLMKITHVIRGTEWMPSTPLHVALYNAFKWTPPRFGHVPLLV
                     DKSGQKLSKRNADIDLTFFKDTQGVFAATLVNFAALLGWSHTQKSDIFSLEELEQIFN
                     LKITKGNTVVAFEKLWFLQKAHAQRFATNGGPEFEEMVSRVSRAVEETCPSQQLAPIL
                     QSRSLAEYLPLLLRADAKSYTNASEFIQRNSTFFTTTLNRPPYAPAASASKSPSQTVP
                     MAALHTAAAALSLVPEAHWTIESHKFNITSYDGASSILPEESDAGIHGSPEEVEKARV
                     AADKTFKKELYHYLRWALSASAPGPGIPETMVILGRAESLRRLQEAQQMTVSLVNKSA
                     GPTRVAKGAQSSENQDKTWMGSLAPKS"
     exon            616478..616651
                     /number=1
     exon            616711..616783
                     /number=2
     exon            616839..616928
                     /number=3
     exon            616957..617357
                     /number=4
     exon            617413..617670
                     /number=5
     exon            617734..617900
                     /number=6
     exon            617956..618574
                     /number=7
     CDS             join(628881..628884,630186..631162)
                     /codon_start=1
                     /locus_tag="AO090102000238"
                     /note="COP9 signalosome, subunit CSN5"
                     /old_locus_tag="AO070278000034"
                     /protein_id="BAE61323.1"
                     /transl_table=1
                     /translation="MKLENAISLIDPQRDALYQYDQETHKALSAERPWAKDPHYFKSI
                     RISAVALLKMVMHARSGGSLEVMGLMQGYILPETFVVTDAFRLPVEGTETRVNAQDEA
                     NEYMVSYLQACRDAGRMENAVGWYHSHPGYGCWLSGIDVTTQDMQQLGGPFVAVVIDP
                     ERTISAGKVDIGAFRTFPKDYTPPKEEQEDDEYQTVPLNKAEDFGAHASHYYSLEVSL
                     FKSVLDTEILSLLWNKYWVATLSQSPLFTTRDYGSKQMMDLSQKVRRAARSIESNPSR
                     GGTTTVKDQQLEKVVRDGQRIVSEEVKGLLAAEVKMKLFQGIGENNKAET"
     exon            628881..628884
                     /number=1
     exon            630186..631162
                     /number=2
     CDS             complement(join(632716..633080,633134..633350,
                     633399..636596))
                     /codon_start=1
                     /locus_tag="AO090102000239"
                     /note="Ras1 guanine nucleotide exchange factor"
                     /old_locus_tag="AO070278000033"
                     /protein_id="BAE61324.1"
                     /transl_table=1
                     /translation="MYDTRLAEPLVIDTKSALATKTGTTITTTFAFTEEQAYTPTTAP
                     GSRSRGSSLSFHYRDKSVDQSPQAHQSPVKMTATGRFTPSPEPAPALFVRAMYDYDAD
                     DHTSLSFQRGDIIQVLNQLETGWWDGVINNSVRGWFPSNYCTIITDLSELEEHVSNGR
                     EDGDVSAESGLGEEYEEDREEDEVDSAGNPRDSQPILPIEGTGPPNEQEEAAFWIPQA
                     TPDGRLFYFNTLTGYSTMELPFENPSTNETGPYDRNNFFVPNQTRPPPELMARGFERD
                     EDDYDGSASEAEGESLMLASQDSMSRRRQSYIDGVSPATSMDSLHLPSTTKSINEGKS
                     SFRSLSKAYSLGTAASSTTSLSDNFYRPSISSEAPSHFVDDGASAPLTWALLVDNMRN
                     AVETYRQTLLNGDRSEYVRKAEDISDHLRMLLAAGSDTTDNHSGNPSIISTNKALYPH
                     FRDMMSKFSKLVLSSHIAAADWPSPDSVNKCLQEADGVMQGVYGYVDIARQQRGDFIR
                     RIIPGFVVGSCSGGGWQNNGVTLNDSGPTSFLDQDGADTRVEPAVPLDAALLDHIDIL
                     RRSFVGSIRRLEERLSLSQKKIVTIAEHHEIGDSVSAAAIKVIEQFRPWISSVESINL
                     APLGTSFQNPQLVDFSLQKQRVYDAIADFVLGCQAVTSPLGDEWAELRGDSLEDRLNA
                     VRGVARQLENYVSQIGFSLSLLLEQIPESTAAFRSESRLGQDNEGLKALHSRAESQAK
                     IADESIGIPSSYSVNPPHDKVRRNMDKAQRFFGQAPPSAITREPIREPVREPEETPWF
                     LKMDHEGEVFYDTKNDVPTLKCGTLAGLVEHLTRHDKLDASFNNTFLLTYRSFTTAVE
                     LFELLTQRFNIQPPFGLNQEEMQMWIDRKQKPIRFRIVNILKSWFENFWMEPNDEAHM
                     KLLERVHAFTKDSIATTKTPGTPPLLTVIEQRLRGQDTTVKRLVPTQAVPAPSPIIPK
                     NMKKLKFLDIDPIEFARQLTIIESRLYSKIRPIECLNKTWQKKVGPDEPEPATNVKAL
                     ILHSNQLTNWVAEMILSQSDVKKRVVVIKHFVNVADKCRALNNYSTLTSIISALGTAP
                     IHRLGRTWGQVSGRTSTILEQMRKLMASTKNFGEYRETLHLANPPCIPFFAAETNLDF
                     LGVYLTDLTFIEDGIPSLTPSELINFNKRAKTAEVIRDIQQYQNVPYLLQPVPELQDY
                     ILSNLQAAGDVHDMYDRSLEVEPREREDEKIARYATTAGRDMSTLAIATLAMSMR"
     exon            complement(632716..633080)
                     /number=1
     exon            complement(633134..633350)
                     /number=2
     exon            complement(633399..636596)
                     /number=3
     CDS             complement(join(647999..648179,648369..648522,
                     648672..648708))
                     /codon_start=1
                     /locus_tag="AO090102000243"
                     /note="predicted protein"
                     /old_locus_tag="AO070278000029"
                     /protein_id="BAE61325.1"
                     /transl_table=1
                     /translation="MVCNSVRWVPSAAQNHNSGTQNRCGAMNIKWLSFMIYLTYTKKH
                     GTYGVAIDDNSNLAAYISTGPSSAAPPLAPPTRIEQLQMPRNCALADLICVFPPFIST
                     SEILCTQTLFEYLFYYYFILV"
     exon            complement(647999..648179)
                     /number=1
     exon            complement(648369..648522)
                     /number=2
     exon            complement(648672..648708)
                     /number=3
     CDS             join(650440..650575,650748..652884,652943..653084)
                     /codon_start=1
                     /locus_tag="AO090102000244"
                     /note="predicted protein"
                     /old_locus_tag="AO070278000028"
                     /protein_id="BAE61326.1"
                     /transl_table=1
                     /translation="MAPSASNTASNSPAKKTSAPEKKYKCQFCNRAFSRSEHRSRHER
                     SHTKERPFKCLKCRSTFVRRDLLLRHDRTVHAKDGGIPLVSEGRRRGGAGVQKSSPAP
                     APPKPSITIDPATLEQIEASSDGMVDLETAAMLMTDFQHKAAAAATSQVNDRAESDRS
                     FSPGRGPLLEPSVSYLSGNATLPQMPWDTLVSPVDTKHFMSQDSGSDSRTLSSSMDRH
                     GPVGDALAPSLHSLVNSLPVSGNSTPNALSPYPSMTGPVSPVNYRKSPGPSQALTLPK
                     APQISNEIERNMIVERIRNADALGSLPDSFQLPSTAALNKYLSTYFNLYHHHLPFLHQ
                     ESFKPTNTSPPLLLAVLSIGALYTFERQHAFMLHVGSKMLVTQFLQHKDNFDSRKCPL
                     WAMQSSLLNMIFESWSGDPKGLEWTCSIKSLLANMVAGNRYQLKLRTEAREGAKPTRE
                     EWIEDESCRRTYYAVYIFFGMLTLTFNHTPAMSFDEFDNLELPSSESLWNLDVTDDEA
                     WRRSLASTTTLTVREAHDCLFQGEQVRYSAFATRVLINALFLQVWNHKRSFEALQDVV
                     TEYKLRLALETWENSLEVCEPETIVVPISTPQKGHPLIFNSMAVYRNTRARLEVDLKS
                     IQEALRYHSSYEVAAAMTVAREKVKRSQEMNKVIQSCFECIEIAAIQGINWVAKTSAT
                     NWSVEHPLCGLDLMVILSLWLYRLEHDEEPATEAEMAIYNKVRNLFDDDAVDAFGKLS
                     STVARVWGNILDGVVVWGITKLMGESFKLHSQALVGYEDSLRVGKDQPIHPMPTKTLA
                     SVGTAY"
     exon            650440..650575
                     /number=1
     exon            650748..652884
                     /number=2
     exon            652943..653084
                     /number=3
     CDS             complement(654258..655541)
                     /codon_start=1
                     /locus_tag="AO090102000245"
                     /note="predicted protein"
                     /old_locus_tag="AO070278000027"
                     /protein_id="BAE61327.1"
                     /transl_table=1
                     /translation="MQSTSPIPANDTEQLPETQAPPPTTEEASQRQAWSSEGYGLPPT
                     SDKPPYGPVEPTPSRREPVARPLSKHATHLFTLSYLIFFAIFGTLARLGLQALTIYPG
                     APVVTGVLWANVGGSLLMGFFLEDKNLFREEWGDVNQNNSNGTGTDPSAESKRHKSVK
                     KTIPLYIGLTTGFCGCFTSFSSFIRDIFLALSNDLSDPSTPNGGYSFMALVAVILTTV
                     ALSLGALIFGAHLALALDPLIPSFPFRFTRRFIDPLFIILGWGCWLGAVFLAIWPPDR
                     HDNGPEFWRGRAVFAVVFAPLGCFLRYYVSLVLNTRLPAFPLGTFAVNIFGTIILAMC
                     YDLQHVDGIGASSLGSGASSSILTSCQVLAGVMDGFCGSATTISTWVAELNGLSRRRH
                     AYFYGIVNIGVALGFFVIITGSLRWTKGFVEPVCE"
     exon            complement(654258..655541)
                     /number=1
     CDS             join(656066..656242,656299..656398,656458..656867)
                     /codon_start=1
                     /locus_tag="AO090102000246"
                     /note="armadillo/beta-Catenin/plakoglobin"
                     /old_locus_tag="AO070278000026"
                     /protein_id="BAE61328.1"
                     /transl_table=1
                     /translation="MSLPPNVHISSHPCLQAKISQLRSHKTSTRETRSLVHEITTILG
                     VEAFSTVLKATKRGTDQTPLGIEYDTQDIEPANVAMVPILRSGLGMTEAINNLLPGPV
                     PIYHLGLFREKFTLQPVEYYNNLPYQRQDGSDSNTAAADTAILLDPIVATGATAEAAI
                     HLLREWGVKRVVMLSVLGSETGIRRAVDSWPEGVEFWTGAVDEKCNERGMIVPGLGDI
                     GDRLFVAIGK"
     exon            656066..656242
                     /number=1
     exon            656299..656398
                     /number=2
     exon            656458..656867
                     /number=3
     tRNA            complement(657157..657272)
                     /locus_tag="AO090102t00006"
                     /note="tRNAscan-SE"
                     /product="tRNA-Thr"
     tRNA            complement(657863..657966)
                     /locus_tag="AO090102t00007"
                     /note="tRNAscan-SE"
                     /product="tRNA-Phe"
     CDS             659395..660954
                     /codon_start=1
                     /locus_tag="AO090102000247"
                     /note="predicted protein"
                     /old_locus_tag="AO070278000025"
                     /protein_id="BAE61329.1"
                     /transl_table=1
                     /translation="MIGIALGSPRLVDPQNTFAQMQEKAMESARGRPKAAPQIQRKPS
                     KWRKIGGLFKAKNAVASGASQPFYQVQVQGSQAPLAQGSSHSIDYQSREAKSNHVMDT
                     EVWPCLEPEVKAEEKHQNASVAQVSAQDRQQCAVSKSGPLLQVDIPSVEMERYSVMFS
                     ALLNKNEPSPLNRRSKTLENISVTSTEVNHSTSPPIYITYKILNPHQTSPPPPDLLPP
                     RRRATSPTRSNSPRLSLFPATQKSKASKMLGTQNLPRGPSPLPRNQVSRAESRQEDLS
                     NEQDHILLMVRSDTISSHKPQDSVSSFISSTTINSDDEKFILQKLKPVQTYVDPKGEP
                     EWEMISKRKPSADETKPQKLTPALSLNTQELSPEPKNSESTASSPILSPLAAVQQRFS
                     PLSPSDSSKSTVSPAETIRMPLTNETKVEEDDKTTHEHEPTDPTPDEEPESETEQDHE
                     EQEREPADPLPTIEISIARSVSVSKRKQVLVPVGRRPDRLTPRARTPQMVNGQYGHRH
                     GNSQDARIESV"
     exon            659395..660954
                     /number=1
     CDS             complement(661525..667521)
                     /codon_start=1
                     /locus_tag="AO090102000248"
                     /note="DNA/RNA helicase MER3/SLH1, DEAD-box superfamily"
                     /old_locus_tag="AO070278000024"
                     /protein_id="BAE61330.1"
                     /transl_table=1
                     /translation="MNGPGSVESQWLTQLAAMRQAIAELKLPKDPAKDQVGYGSDLDL
                     DLDDDYSSPGTVDDIWDVISSDDESIADFDESDGFASPSASSYDQFWLEQKCQSLTSQ
                     KPGLSANELAQQITAALATDSGDDELQMSLAEIVGFDDLDFVIELIAHRTEILRSGHS
                     GPEAQTDGLFSGRLQTRAEREQALRRQDFEHKNAPLMPAQTRQEPQYPHVFKSHDNRN
                     VLSFSGKKYGLPLGSKQTDEQKYTEVEVPASRVGTLGTTQKLVQISSLDGLCQGTFRG
                     YKTLNRMQSLLYEVAYKTSENMLICAPTGAGKTDAAMLTILNAVGKNTIPNPVEQPEA
                     TEFAVQVDDFKIVYVAPMKALAAEVTEKLGKRLAWLGIQVRELTGDMQLTKREIVETQ
                     IIVTTPEKWDVVTRKSTGDTELVQKVRLLIIDEVHMLHDERGAVIESLVARTQRQVES
                     TQSLIRIVGLSATLPNYLDVADFLKVNKMAGLFYFDSSFRPVPLEQHFIGVKGKPGSK
                     ESRENIDVVSYEKVRDMLERGHQVMVFVHSRKDTVLTARMLKQMAADEGCENLFSCQD
                     HENYSNGLKDMKHARARELRDLFASGFGTHHAGMSRSDRNLMERMFSEGLIKVLCCTA
                     TLAWGVNLPAAAVIIKGTQLYNPQEGKFVDLGILDVLQIFGRAGRPQFQDTGIGFICT
                     TYNKLHHYLSAVTSQQPIESRFSSRLVDNLNAEISLGTVTSVPEAVQWLGYSYLFVRM
                     KREPRNYGIEWAEIRDDPMLVQRRRQLIIQAALVLQKSQMIIFNERTEELRAKDVGRI
                     ASQYYVLQTSIEIFNELMRAEAGEADVLKMISMSGEFDNIQSRENESKELNRLREEAV
                     QTEIEGGNDSPHAKTNILLQSYISRAKVEDFALVSDTGYVAQNAARICRALFMIALNR
                     RWGYQCQVLLSMCKSIEKQIWPFDHPFHQFDLPQPILRNLDERLPSSSIESMRDMDVS
                     EIGQLVHNQKMGKTLAKLLDNFPTLSVEAEIAPLNRDVLRIRLPLYPEYTWNDRHHGA
                     SESYWIWVENSETSEIYHHEYFILSRKKLHDEHELNFTIPLSDPLPSQIYVRAISDRW
                     LGAETVTPVSFQHLIRPDTESVYTDLLNLQPLPISALKNPILEELYGQRFQFFNPMQT
                     QIFHLLYHTPANVLLGSPTGSGKTVAAELAMWWAFREKPGSKVVYIAPMKALVRERVH
                     DWKKRLTGPMGLKLVELTGDNTPDTRTIRDADIIITTPEKWDGISRSWQTRDYVRKVS
                     LVIIDEIHLLGGDRGPILEIIVSRMNYIASQSKGSVRLMGMSTACANATDLANWLGVK
                     EGLYNFRHSVRPVPLEIYIDGFPEQRGFCPLMQSMNRPTFLAIKNHSPEKPVIVFVAS
                     RRQTRLTAKDLINYCGMEDNPRRFVRMSEDDLELNLARVKDDALREALSFGIGLHHAG
                     LVESDRQLAEELFANNKIQILVATSTLAWGVNLPAHLVVVKGTQFFDAKIEGYRDMDL
                     TDVLQMLGRAGRPQFDSSGIARIFTQDSKKAFYKHFLHTGFPVESTLHKVLDNHLGAE
                     VSAGTITTKQDALDYLTWTFFFRRLHKNPSYYGLEISAEEHNTIAAQTIAQDFMIDLV
                     DKSLGELAASSCIVLDSATGEVDPTPFGKVMSYYYLSHKTIRYLMAHAKPNPTFHDVL
                     SWMCSATEFDELPVRHNEDFINAELAQNLPLSVESMGDLPMWDPHVKAFLLLQAYMSR
                     IDLPISDYVGDQTSVLDQGIRILQASIDVMAELGYLHACQMLMSLLQCIKSARWPEDI
                     PLSILPGVGVNAKAPFLPASLAAFSSLPTAAVSTLPKKLQLSPPQAAQFTKAASYLPN
                     LSVSVSKVSATGISVSLTRRNPAMDSEYRIYAPRFPKPQTEGFFLIVCSAASDGKDGE
                     LLALKRISWPPVEKQRNNRGKNNAGSSKPGEKNNHRGGPPLTIRSSVKFPDTAAKNGI
                     KVKVISDSYPGMEWTMPTVEVDMAPEKQVVPESANYPEKS"
     exon            complement(661525..667521)
                     /number=1
     CDS             complement(join(668401..668528,668659..668884))
                     /codon_start=1
                     /locus_tag="AO090102000249"
                     /note="predicted protein"
                     /old_locus_tag="AO070278000023"
                     /protein_id="BAE61331.1"
                     /transl_table=1
                     /translation="MSSSEQEQTAQPVDSEPRVDILCSAPGFSVPNPETVREKVNKSN
                     TIFHWGGVRIAKISPEIVVKLGSHITLNEAKTLWRAIVWTKLGRHIMRRRKIVLPTSS
                     KGISVNFVKSPPATM"
     exon            complement(668401..668528)
                     /number=1
     exon            complement(668659..668884)
                     /number=2
     CDS             669620..670696
                     /codon_start=1
                     /locus_tag="AO090102000251"
                     /note="phosphoesterases"
                     /old_locus_tag="AO070278000021"
                     /protein_id="BAE61332.1"
                     /transl_table=1
                     /translation="MTSPYHRRPIPDYFLASPLATFLYPLHHILLRLRGPPRLPPPDA
                     HPIRVVCISDTHTLEWDDVPDGDLLIHAGDLCNDGSVREIQAAVDWLQGLPHPHKVVI
                     CGNHDSYFDVRSRLEEDRDKSFATVSSSTASLRSIDDLESPHRIDWGDIHYLQHSAVT
                     ISFPPPSSTGSRARSLTIYGAPQIPALVPFGPEHAFTYPPHYDAWSGTVPPNTDILVT
                     HTPPQSHLDLSPVYSTGCPFLLTEAWRVQPALHVFGHIHAAYGMEPVYWDEAQKAWER
                     LCASRRRRARNGRFSSLFGFLRDLFDISGWVDSARVVVYGVLGVVWAKVWGGENRGCG
                     WMVNAACMSRDSKGLSNKPQVVVL"
     exon            669620..670696
                     /number=1
     CDS             complement(join(671131..672210,672264..672737))
                     /codon_start=1
                     /locus_tag="AO090102000252"
                     /note="glycolate oxidase"
                     /old_locus_tag="AO070278000020"
                     /protein_id="BAE61333.1"
                     /transl_table=1
                     /translation="MSKGKLTGADVAEHNSRDSCWVIIHGKAYDITEFLPGIVYRGPF
                     RLSLLTVATEHPGGQKIILKYAGKDATEEFDPIHPPDTLEKYLDPSKHLGEVDMSTVE
                     QEEKVADPEETERQERIKRMPPLQACYNLMDFEAVARDVMKKTAWAYYSSGADDEITM
                     RENHSAFHKIWFRPQILVDVENVDFSTTMLGAKTSIPFYVTATALGKLGNPEGEVVLT
                     RAAHDHDVIQMIPTLASCSFDEIVDAKKGDQVQWLQLYVNKDRAITKRIVQHAEARGC
                     KGLFITVDAPQLGRREKDMRSKFSDEGSNVQASGGDAVDRSQGAARAISSFIDPSLSW
                     KDIPWFQSITKMPIVLKGVQRVEDVLRAAEMGLDGVVLSNHGGRQLDTAPSGIEVLAE
                     VMPILRERGWENKIEIFIDGGVRRSTDILKALCLGARGVGIGRPFLYAMSTYGQAGVD
                     RAMQLLKDEMEMNMRLIGATKISDLNPSLIDVRGLTSGHHASVPSDTLTLRAYDPLQA
                     PRFSEKAKL"
     exon            complement(671131..672210)
                     /number=1
     exon            complement(672264..672737)
                     /number=2
     CDS             join(678235..678328,678403..679051,679109..679937)
                     /codon_start=1
                     /locus_tag="AO090102000255"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070278000017"
                     /protein_id="BAE61334.1"
                     /transl_table=1
                     /translation="MAPTFAGLSGRPLSLAVSTVATMGFLLFGYDQGVMSGIISDKAF
                     NNVFTATKDNDTMQALVTAVYELGCLAGAIFALVFGDRTGRRWMIFSGAIVMIIGVII
                     QVTSFVGHIPLLQFFIGRVITGIGNGMNTSTIPTYQAECSKTSNRGLLICIEGGVIAI
                     GTAIAYWIDFGAHYGPDDLVWRFPIAFQIVFGVIIIVGMFFLPDSPRYLISKDRIQEG
                     EYVLAALGGYEVHDQETQIQKNLVIDSIRASGAGATTRYRDLLTGGRSQHLRRMLIGS
                     SSQIFQQLSGCNAVIYYLPVLLKQSLHQSNDEALLIGGINMIVYAIFATFSWFFIEKI
                     GRRKLFLGGSIIQTIAMVITFACLIPDDTQVSKGAVFGLFLYMAAFGAAWLPLPWLYP
                     AELSPIKTRAKANAVSTCSNWLFNFTVVMITPVMIAHIGWGTYLFFAALNALFIPIIW
                     LFYPETANRSLEEIDIIFAKGYTENISYVKASKDLPKLNDEEIEQKANEYGFGNSTED
                     PEKATAAEYSPSTSE"
     exon            678235..678328
                     /number=1
     exon            678403..679051
                     /number=2
     exon            679109..679937
                     /number=3
     CDS             join(680569..680741,681023..681167)
                     /codon_start=1
                     /locus_tag="AO090102000256"
                     /note="predicted protein"
                     /old_locus_tag="AO070278000016"
                     /protein_id="BAE61335.1"
                     /transl_table=1
                     /translation="MFKPKFSQSPRLCGEAVKGIFLSVIFENTVWGWLWALWQIENKT
                     FVGTNRTTVALHYTYEVVIPYIRLNPDPHRCPHEGSPRIQNIVALAAGYMAITIFPYQ
                     LQN"
     exon            680569..680741
                     /number=1
     exon            681023..681167
                     /number=2
     CDS             join(683933..683978,684042..684871)
                     /codon_start=1
                     /locus_tag="AO090102000257"
                     /note="GTPase Rab5/YPT51 and related small G protein
                     superfamily GTPases"
                     /old_locus_tag="AO070278000015"
                     /protein_id="BAE61336.1"
                     /transl_table=1
                     /translation="MSSSLEAKIVILGSQGVGKTSLVQRYVKNAFNPVGTASTVGASF
                     VTKRVLDSSSDTIVRLQIWDTAGQERFRSISKLYYRGANACLLCYDITDEQSFLEMTG
                     WLLELKKNLGDEDPVVIHVVGTKSDIVALDPLRRAVPFERTIAYVAEQLYPSQASTPP
                     PTAGVSHSSSTTLQGLDSKRSSGFWGQDIGWDCCHEISAKDGEGIEEVFQVITRKLVE
                     QRNKQLGITSSHGSTSGLDGVASPVGPRTLEGNGSFRLGHGDNRRSWLGFPPSSVGDE
                     LDERIEFTKKKGKCC"
     exon            683933..683978
                     /number=1
     exon            684042..684871
                     /number=2
     CDS             join(688176..688303,688351..688920,688978..689022,
                     690540..690678)
                     /codon_start=1
                     /locus_tag="AO090102000258"
                     /note="predicted protein"
                     /old_locus_tag="AO070278000014"
                     /protein_id="BAE61337.1"
                     /transl_table=1
                     /translation="MESDVISPQNYETTPIIVPNDRALVMAKLASEDTSWVANDLNEW
                     RNVIYTVDDLSATRHTPINKGRESLAYLQYIIEHYHDLPSLIVFIHSHKDGWPAAWHT
                     DNMEYSNVVAIRNLQADFVQQNGYANLRCQETPGCPEELRPLRNPPRPGQTTEAAYAQ
                     AWKELFNNTEVPEVIGAPCCSQFAVSRDQVLKRSFEEYMQYYNWVLTNDLPDDVTSRV
                     MEYSWHIIFGKDPVYCPDSLQCYADVYGNPSLLPEHLRTGRCVLPVRGGAPWFLRGFG
                     GSLGGHICRSGYYRHWR"
     exon            688176..688303
                     /number=1
     exon            688351..688920
                     /number=2
     exon            688978..689022
                     /number=3
     exon            690540..690678
                     /number=4
     CDS             join(692936..693286,693346..698364,698388..698549)
                     /codon_start=1
                     /locus_tag="AO090102000259"
                     /note="predicted protein"
                     /old_locus_tag="AO070278000013"
                     /protein_id="BAE61338.1"
                     /transl_table=1
                     /translation="MSSSYVTENTAANGDSSPQPLLREALENVSKECPTRLGMSPNEI
                     LTKSPTVDVFFDAIAAERLRRMPPDGSRLDGALHRASRLAFAVGSLRDSVAGFMDGAD
                     EAAMMIWGAILLQLELGIEHVDVIDSLFGQYGRVTLGISLLLQQESYFQTYRALQHEV
                     TEIYAHVLQLVLHVTMEYREAERSQHWQSMSEAVNRSFFCYFNRFTTHWRRMSQVALA
                     TGAPKQQTPLDLAAIYQFLELQDRPLHMLLEGHNHSLADGSFAWFDPHLTTFTINRRN
                     MLLVTGNPGSGKSALAQWTMEKLQVSSEFDIWNVIPVSIRSDVPITTLPLSILKGLLT
                     QILDLCVASRKTYESILSGVMNALELAVTGAPDPQVEEQLWTAIRIALQSNMHFMLVV
                     DGVDQIKHSEVTVGPFLQRLQDAVSERNTPSKLIVFSRPLAAAQMPMREATTTQQISM
                     NVSLTQQDLHATLVDMMTSDAAIFGLDTSQRDSLAAAIVPRAQGCFVWAQLTLEAIRN
                     LSTFNEMQSAVKASPHTLGDLIDRHIRSIDLNRVGTQSLLAWLLAAERPLRIQEIEQL
                     LAVDLKTLNITSRTSNTEREVFQPLARLISVHDGFVTFKHHLVRDHIQARALMGQEVP
                     FSLSEAHYDLLIRSLAWVRKSITDEVAVAWDKLRVTARDRYLDAYTLLEYTARYWLSH
                     MLASPIASSKREELNFPKPFRQAMPDSVLFAQLELTNRESQFSRSSIVELYRLAVTVR
                     RSVLGGDSPALLQSLILSARAADMAKASWANDHLYEAWIRSRSQLGPSDPTTRELEQL
                     LVATPEGRGKADQVAGFKTDALRDMALSGWDSSDISFAQRLQYLDRLVKSYKDNNQED
                     AAYDVSKQFYRQTVMTYGSHSSEAIQAADFLTQHFNIAPPDEMALEIARNKYETMMRS
                     MDATDPRRVAYSLQLAQMYEDSRQPAKAEAVLTRLWSGLSARNLDTSPAWDQKTKVAF
                     YYSQFLRRQGRPDEASAILRQLSADLEAEGGVRSPEMASRAEELRVEAREMGLDDMDR
                     ALSLQIWKYYQASGQQYSPEAVTLAESLARVSLPTQGNVENMGALSPEESKLLPGWID
                     SIASAGAEKRTLPLLTLCHQLATQHIRDEEWRKGSDTAWAVLKHAWPTVEDPQSKAKF
                     ASSEAPILANLALDHAYCLFRRLDINTASVVYGNAFRASITADQVAVPSVTAVVKTVV
                     EFYETTFQFEKALVLLHQVSEFFGSRLGDHDKHTIDTRYYEGDLALRLDKRAEAENSY
                     RHIYDACVRDGKVSSSGVKAAVALVNIYVQNKQWDSALEVYRHLWPTLVRFDEKDGYD
                     RALLEGLLPKTYTGYMELLNNKAAQGSHAERYQVASQHQQLCRKLYGPTDARTRDATL
                     TLAALCADSDQHVGEAINNYHQVLNTHDWVSPTESSRALPDMSEPLPISIKHQMAQLY
                     LRQKDNSEPARSLYAEELALAKQQQGLSAPTTLLWLREIARMHAIQKSPESRRQGAAL
                     LDDHVDEVVHVTANHEALVDRAHRLAEIYLELGYIDEGNRLIDDLHQRVINETPAAQR
                     QSLNEYRPAVFVAAFEEVFGKQRSSKQVLDELSREGQVYNAFQRSLSSHDLMPTLAAG
                     EKLYTLQTNQKRYSSAQDTQSRLYDYFCNTLSVAQPLRKKDAVQQFYALCRRESLQDD
                     SNINIVTSTMRMVKDLCDRAQFQDAADVTGVFHSFVHLTDGLRSPESIFTAIKLCMYL
                     NGYQTKKCTEEATAKNMSLESQMLLQEIMTKTKELPLEFTELPFAELNDLVTVLGEHE
                     MFEDLENKGYTNKPGHSYRTLDLAYCSKDLVTPSHCLDRTPTSRNTFLPRSRLIRHSA
                     W"
     exon            692936..693286
                     /number=1
     exon            693346..698364
                     /number=2
     exon            698388..698549
                     /number=3
     CDS             join(698608..699044,699127..699130)
                     /codon_start=1
                     /locus_tag="AO090102000260"
                     /note="predicted protein"
                     /old_locus_tag="AO070278000012"
                     /protein_id="BAE61339.1"
                     /transl_table=1
                     /translation="MTKLLSGLYTASGNHLAAAALHESALAELLNSQTDRQEGAIEAV
                     TQHLELLQHAHARLAKEGQTGTIDAAAAQERVQQIATKFGLSSEQLEAVTGADENVGV
                     WERPRRFSLDVEDLETHHNNLRQTSGSALLNGNAGAKRISISAF"
     exon            698608..699044
                     /number=1
     exon            699127..699130
                     /number=2
     CDS             complement(join(701342..701408,702199..702764,
                     704505..704540))
                     /codon_start=1
                     /locus_tag="AO090102000261"
                     /note="predicted protein"
                     /old_locus_tag="AO070278000011"
                     /protein_id="BAE61340.1"
                     /transl_table=1
                     /translation="MDKLKALGKEGGAEVIQLLLEAGADVNLVESDGNNALHLAAYCG
                     TIEIVESLLAHGAAVDVLGPDDRTVLHVAAAGDNPDVVPSLCRAGVAINALDASGNTA
                     LHLAALHGRTALTRLLLEMGADVSVSPEDGRTALHYAASVDQADLLQLLVDAGAEVGA
                     LHSDEGHTALHYAAVNGSADAFRVLLRAADAQKFDLLSPCCQESVAITTLSQWLNSMK
                     CILS"
     exon            complement(701342..701408)
                     /number=1
     exon            complement(702199..702764)
                     /number=2
     exon            complement(704505..704540)
                     /number=3
     CDS             complement(join(705478..705578,705629..705756,
                     705808..705934,705993..706017))
                     /codon_start=1
                     /locus_tag="AO090102000262"
                     /note="predicted protein"
                     /old_locus_tag="AO070278000010"
                     /protein_id="BAE61341.1"
                     /transl_table=1
                     /translation="MDPSTYPYGDGKTGDATNFGIFKQNWMMLRTSATEFLGQKTEDV
                     KNGEVLNTNLEKDIKARHDGEKKYGFDVWYAGHRNGASGLENPNTQDINNYKSAVKWI
                     KSQIESDKKYQSDDTRFWVDVVAI"
     exon            complement(705478..705578)
                     /number=1
     exon            complement(705629..705756)
                     /number=2
     exon            complement(705808..705934)
                     /number=3
     exon            complement(705993..706017)
                     /number=4
     CDS             complement(join(711065..711467,711524..711694,
                     711749..712030,712084..712544))
                     /codon_start=1
                     /locus_tag="AO090102000263"
                     /note="predicted protein"
                     /old_locus_tag="AO070278000009"
                     /protein_id="BAE61342.1"
                     /transl_table=1
                     /translation="MRSIAYLASGLPVALAATSGQFDVLSFNVAGLPAILNGNEVPGD
                     KTNNSKAIGAKFAEYDYDVIHVQEDFNYHAYIYETDDHPYRTATSGGAGIGSGLNTLA
                     NYPWVDFERVKWETCSDASGSDCLTPKGFTTMRVRFDEGVYVDFYNLHTDAGSETDDV
                     TARSANLQQVADYIGNNSAGNAVLVFGDTNARYTSSGENIRVFGTEQNMTNPWVELIL
                     NGVEPTEGTDPWMCDNPTTNNTCETVDKIFYRGSRSIELSATFWSYVGTKFELDGHIL
                     SDHNPVTSNFTWTLSDSVRQSDLFGGPHGTWFNDLSSVPSSSTGQNKPSKITLRGENR
                     VDRVGLALTSGQNYTHGGTGGTASELTLAEDEYWTQAKLCQDKYDDHTRIFYLLATTS
                     AGNTVSTGKTTSDCKEFTAPDSWQIVGFYGRDGDEVDELGFIYAPQ"
     exon            complement(711065..711467)
                     /number=1
     exon            complement(711524..711694)
                     /number=2
     exon            complement(711749..712030)
                     /number=3
     exon            complement(712084..712544)
                     /number=4
     CDS             complement(join(713613..713783,714027..714122,
                     714240..714392,714517..714864))
                     /codon_start=1
                     /locus_tag="AO090102000264"
                     /note="predicted protein"
                     /old_locus_tag="AO070278000008"
                     /protein_id="BAE61343.1"
                     /transl_table=1
                     /translation="MGNWKIQLPESTSKDHVLGTISSGLPKYYAGEPRVNLGHFSPSL
                     QNSLKRVIEQSYQAEADEKPSADDISRAYDILSKYLAAYLMGQSSDDSVTHWVVSQFP
                     RHQTQPLQSIFHNKSQTPEARYHAESLNRARGLFASLLEITTVDNINIFGNALRQSNW
                     GLLEMTHYWGRVDMVKFSQEYKKPDLALNIIKAMGDAGVWPVDVRHPPSIVLRSWAQN
                     GPMLYLHKFEAITIALGFAVAEYVLRLMLLFHPILQN"
     exon            complement(713613..713783)
                     /number=1
     exon            complement(714027..714122)
                     /number=2
     exon            complement(714240..714392)
                     /number=3
     exon            complement(714517..714864)
                     /number=4
     CDS             join(717907..718104,718159..719586)
                     /codon_start=1
                     /locus_tag="AO090102000265"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070278000007"
                     /protein_id="BAE61344.1"
                     /transl_table=1
                     /translation="MTTTSYSRPIDHEKTPSPVGLDANMQEDQLDENKSHPQQDLHEY
                     PPLPRVIMITIALYLAIFLVALDRTIISTAIPRITDTFHSLNDIGWYGSAYLLTCCSF
                     QLVFGRIYTFYSPKWVFLGAILLFEVGSVICGAAPSSTAFIVGRAIAGIGASGLMSGS
                     VVIIVYIAPLHKRPMYTGIIGAVFGIASVIAPLMGGAFTENVSWRWCFYINLPIGAAT
                     VAIIALVLKLPEPPHSNISTRERLAKLDPLGTAIFLPGMICLLLALQWGGTTYAWHNS
                     RVIVLLIIAGILLLSFIGIQTWKQDNGTVPPRIILQRSIFSGFWYMFTLNGAMMVILY
                     YLPIWFQVIKDASAIKSGIMTLPMIIGLVVGSIVAGAGVTRSGYYNPFMIIASILMAV
                     GSGLMTTFTTTTGHSKWIGYQVCFGLGLGFGMQQPAAAAQTVLSPEDVSTGISLIFFA
                     QYFGGALWISAANNVFANCLARNVASIAGVDAGDVVKVGATALREVVGDEQLALILPG
                     YNSAVIDAFYVGVACACATGIGALTMEWKSMRT"
     exon            717907..718104
                     /number=1
     exon            718159..719586
                     /number=2
     CDS             complement(join(720624..721030,721091..721294,
                     721399..721405))
                     /codon_start=1
                     /locus_tag="AO090102000266"
                     /note="predicted protein"
                     /old_locus_tag="AO070278000006"
                     /protein_id="BAE61345.1"
                     /transl_table=1
                     /translation="MTAVISPLVSSAPPLPAAPVLKRAEWIPLDAPMLQGNGSYEKGL
                     LPSSKGGKCGYWDVDGYIAQCDCIMTGSKMADSYIEQYASIACDAFLSSLPGANVVNS
                     KWLRFAVKNLVGTNGKPNVLNFRWKKVSKGELTLTKELCNDAYKMLANTICDKKDAKA
                     TRGGTIKFAGDQGIEIGVDPDEMKNFKEKDKRYTNVGKFIDAVIG"
     exon            complement(720624..721030)
                     /number=1
     exon            complement(721091..721294)
                     /number=2
     exon            complement(721399..721405)
                     /number=3
     CDS             complement(join(723546..723796,723875..725942))
                     /codon_start=1
                     /locus_tag="AO090102000268"
                     /note="predicted protein"
                     /old_locus_tag="AO070278000004"
                     /protein_id="BAE61346.1"
                     /transl_table=1
                     /translation="MPKSNRPPYRLDKLAAFGQEHQQPCGSRKRSKDDDNLSGTTMND
                     HPNCTAESSVICLHSPSVEASSTGSSPIPAGLGISWGSNTAASSSAPDIQLSETAKDY
                     PAPLVPSSLRRAVSPCKSKTSAGALAYNEIPPRQDINKPLPPAPPLAPSRARGGKQRA
                     LPLKPLPYHLAVLDKAFERAGLMHNMSPPAPEHPDDPQRHTAVPGAIGQDRLSLKAGD
                     RAARPHQPWRAIGWLARQKTDTAQSTSRADTERTRVSKPNRSTNELVSRPRTLGRLLQ
                     RLHLPWQSHRESSRPDSDSTQSNSPSRKSIEEISTCQSLSQPAPNTSTLPGARPSRTH
                     CRPVDRMRRVLSALMEERISVHLTSSAEVDQERHIHSLLQDAQRLLLDGLHQVSRQDG
                     AGTVPPTPATYIQPPPNINASIPSAPVFPPPRRSIHELDGRSLIPRVSSAPDQSIMLR
                     ILWEVNCLEDLFSMALVNREAYQVFKENELQLMQATLWKVSPPAWELLQVSEPHWDRG
                     LLASSRSAAASFYLRHYARNLYNLTRIKFLILDHCQTVLRPDTISELRDPYSRLGTVD
                     AAVYRVWTFCQLFGCQKGREWDIDGQIRWLRGDTVGADLPSICNTSPDANDVNNVLFI
                     PPEGFAQGNQGPLSQSQLRDMMEIWTAMAALLDFLRDETSRARSVGVFDNAPVTAGDI
                     QQERLMLRTWLRFIITLGPIAVLELAPSGPYSDPETAFRRASSQGWTDWVPPTPGSHS
                     SGFLTGAIQTLLETSTCPPEIEADTATATAAD"
     exon            complement(723546..723796)
                     /number=1
     exon            complement(723875..725942)
                     /number=2
     CDS             complement(join(732205..732224,733011..733670,
                     733780..733855))
                     /codon_start=1
                     /locus_tag="AO090102000269"
                     /note="predicted protein"
                     /old_locus_tag="AO070278000003"
                     /protein_id="BAE61347.1"
                     /transl_table=1
                     /translation="MHFHVKHAILLAAFFGLHLGTSVGAESPNQSASETALPQFVSSA
                     VTTNEASPDIIPSLDHTPRLNSKHKVPTAGVASSQPLHVNNTALPGKVVRPLYERAPR
                     VTVQRWNGLDDGTITDPTFVRDVRPSMFGTAYQHSEVDTFARQGYESMKGQDRPKILV
                     GALYIPGSGAYLCSVPGEPARKRFRATAHEVAPAWWHVVKDRRPRDIYHAEDCTAYRY
                     ELSRTNKLSPGMTYPEGSYFAVFGERDGKQSAE"
     exon            complement(732205..732224)
                     /number=1
     exon            complement(733011..733670)
                     /number=2
     exon            complement(733780..733855)
                     /number=3
     CDS             complement(join(748896..748908,750390..751057,
                     751112..751371,751428..751637,751688..754058,
                     754125..754172))
                     /codon_start=1
                     /locus_tag="AO090102000272"
                     /note="inositol polyphosphate 5-phosphatase and related
                     proteins"
                     /old_locus_tag="AO070322000147"
                     /protein_id="BAE61348.1"
                     /transl_table=1
                     /translation="MEGNGRSRDGTDSAPLRPVSSLLSHFENLSHRRAPSASPSGPRD
                     PTSYLKSPEPVDDFRSARASLDLSRPRSPWVPSADFQNGQGTEYTNGAPRQRGVSSGR
                     SPGRRQSRPMSMNLHSSPQLAPTLTVDSPRSPPRGFGTHPDHNEDIRTARTPPNAPRE
                     SLPPRPIAQANSLTRPTTPTYASSVPTEHRIAHLSPGHPDSAVSTRDSPPERRLKSAS
                     LPPPANRAEKPKIPAKPAGLSFHDGNGLAPRQERPHVEDGVSPFNTPPGSPDKSPPKV
                     PSATKPQPPASPRPVPPPVRRSFDERRPHPNALGLPERPQPRRPSPRPTRDTKPLMVQ
                     IPSRQTSQQETMSAIPHTAHRFQSFDSPREPPGLPPRQPSIARRGARSPGAQLDRLRS
                     PVQPECPPRPELRPHPTGEVHTPRQLQRQPSFSRETKPGPPPAIPERPVVDRPVVERQ
                     PVRPVPAPSEDEQPLDEAPAPRTDYPDASLANRRPPLLKKGPQEIPTRYDTRLMDVCG
                     KYVCTTGYLTRVWDLTTGEQIMTLSHGETVKCLSLAFKPGKGLEDEGQRLWLGTSAGD
                     LHEVDISTQSIVASRSYPSRREVIKIHRHKKEMWTLDDEGRLLVWPPDESGTPNLQYS
                     YHNPYDRVARGHTFSVVVGDTLWLATGREVQIYRPNARDDVSFKVLKRPLGSQHSGEV
                     TSGAYTTKDGGRVYLGHADGKVTIYSAHDYTCLGVVNVSVYKINCLGIVGDYLWAGYK
                     TGMIYVYDTSTNPWMVRKDWRAHDSPVSAFLLDTSSVWTMNRLQVTSLGTDNCIRLWD
                     GMLEDDWMESRMQAKDVEYCTFREIRASILTWNAGASTPGSARTSTFIQDAIHPEDPP
                     EILVFGFQELVDLENKKITAKSLLMGSKKKESSEKEHISRQYRVWMEHLTRVINECMP
                     LEESYVLLHSANMIGLFTCIFVKHKERQRIKDLSAAEVKRGMGGLHGNKGALILRFIL
                     DDSSLCFVNCHLAAGQSHTTHRNNDIAAILESEALPAETSLMTRADRFVSGGDGSMIM
                     DHEICILNGDLNYRIDSIPRNVIIEDIRNNRFTKLLERDQLLASRRKNPGFRLRSFIE
                     APITFAPTYKYDVGTDDYDTSDKKRSPAWCDRVLYRGIGRVKQLEYRRHEARASDHRP
                     VSASFKLRVKTVQPNERAAVWESCQQEFQKEKRRLASEARPLF"
     exon            complement(748896..748908)
                     /number=1
     exon            complement(750390..751057)
                     /number=2
     exon            complement(751112..751371)
                     /number=3
     exon            complement(751428..751637)
                     /number=4
     exon            complement(751688..754058)
                     /number=5
     exon            complement(754125..754172)
                     /number=6
     CDS             complement(join(756024..756351,756418..756805,
                     756871..756923,757460..757485))
                     /codon_start=1
                     /locus_tag="AO090102000273"
                     /note="20S proteasome, regulatory subunit alpha type
                     PSMA7/PRE6"
                     /old_locus_tag="AO070322000146"
                     /protein_id="BAE61349.1"
                     /transl_table=1
                     /translation="MHSTFTTYDPDGHVFQVEYAMEAVKRGTCAVGVKGKDVVVLGCE
                     KRSALKLQDTRITPSKIAVLDNHAVLAFAGLNADARILIDKARLEAQSHRLTVEDPVT
                     IEYITKYIAGVQQRYTQSGGVRPFGISTLVVGFDPNDKVPRLYQTEPSGIYSAWKANA
                     IGRSSKTVREFLERNHEDDMDREQTIQLTIKSLLEVVQTGAKNIEVAIMSPGQTIEML
                     PEDQIEAYVKSIETEKQEEAAKKKTARTSTTTAAILTRGGGESGDA"
     exon            complement(756024..756351)
                     /number=1
     exon            complement(756418..756805)
                     /number=2
     exon            complement(756871..756923)
                     /number=3
     exon            complement(757460..757485)
                     /number=4
     CDS             complement(join(758701..759621,759684..760390,
                     760521..760578,760751..760906))
                     /codon_start=1
                     /locus_tag="AO090102000274"
                     /note="RNA-binding Ran Zn-finger protein and related
                     proteins"
                     /old_locus_tag="AO070322000145"
                     /protein_id="BAE61350.1"
                     /transl_table=1
                     /translation="MATVSAPTPKLDRYIVIHVATTCDEHGVYVTKDSAEVIELGWIL
                     LDAKTCEELHRESVLVKPVNTPITPLCTSLTTLTWEHVRSAGTFRDAIARFDEFAKEH
                     LISKNLEFAFVTLDSWDLRVQLPREARDKAVVLPAYLQHSRTFDLRTEYQRWQTHHPE
                     SLPFGPSSLSNICAALEVEPVQTSAPIKHNLPFHLQALAPASPRRAMEEAITLARVLR
                     GLIRKSQPPHEHPEILTRPMDARADVRAFLAERSKVLHLSGLPHDTTQSELESWFTQF
                     GGRPIAFWTLRTPDQHKPTGTGFAVFSSHEEAAESLCMNGRALNEKAIEVSPSSSRVL
                     DRAAEILTPFPPSKNRPRPGDWTCPSCGFSNFQRRTACFRCSFPAMAAAPDPMGYGAF
                     GYGPPSMMPPHMGHGHGMGHSRGMGGNGGVVPFRAGDWKCGSEGCGYHNFAKNINCLR
                     CGAPRSGAAVVADSAFPSPMDPPSNFGMGPNSMASTPAPGPFTSTAGGFGGFSQQFGA
                     PPNNYALPSALGSGPGGYPPMGQMNAGYGSSNTSHSAASFANPATQAAFTGADHATST
                     SASNGAFYGADGSNDPFAFLSTGLGGLSVGDDGHSRRNGTGASKSPA"
     exon            complement(758701..759621)
                     /number=1
     exon            complement(759684..760390)
                     /number=2
     exon            complement(760521..760578)
                     /number=3
     exon            complement(760751..760906)
                     /number=4
     CDS             complement(join(763281..764558,764615..766654))
                     /codon_start=1
                     /locus_tag="AO090102000275"
                     /note="chromosome condensation complex Condensin, subunit
                     G"
                     /old_locus_tag="AO070322000144"
                     /protein_id="BAE61351.1"
                     /transl_table=1
                     /translation="MPGRSSARSTSATTSRRPSAQPSLSGGRAGSVTPSVAIPEEPPL
                     PEAFPNLRRDVCSLFADAQRSTTGHRKLVVRLRKLQEACCGISQKSSKKNGKEVQEET
                     LIPGEETLPETEFNVEIGRCMLRILPVKKSEPVGDRILRFIGTFLTHASEKDAEIFAS
                     DDDEVSAETPTSRLAASLVALVMPLLATKDRTVRFRATQITAHIVNSLETIDDDLYHT
                     IRQGLLKRIRDKEPSVRVQAVMGLGRLAGNEDEEDEDSAVLVEKLVDIMQNDTSAEVR
                     KTLLLNLPLLRKTLPYLLERARDLDAATRRALYARLLPTLGDFRHLSLSMREKLLRWG
                     LRDRDESVRKATGKLFYDRWIEDVASTDNDEEGPANQRSPPNIPALLELLERIDVLNS
                     GIETGIAHEAMRSFWEGRPDYREAVVFDEEFWESLTAESAFLIRSFNDFCRVEHDGKF
                     DNLADEKMPEVTALAYFLNKYMTDLLQRKKTAKEAGTATDDDSVEHEFVVEQLLHIAM
                     TLDYSDEVGRRKMFSLLRESLAVPELPEECTKLAIETLRFVCGPNAAAENEFCSVVLE
                     AIAEVHDTIATEDSFVSARSEISESSSRQRSETPEAKPFNKEEAKAKVLKEIMVNMKC
                     LHIALCMLQNVEGNLQANMNLVTMLNNLVVPAVRSHEAPIRERGLECLGLCCLLDKTL
                     AEENMTLFIHCYSKGHEALQTTALHILCDMLTTHPSLLAPVTQPDGETVTPPVFQKPL
                     LKVFARALKSNSPNSVQATAATALSKLLLTNTFTPSGANVPPAIQEYNQTSVETLLQS
                     LVVTFFHPRTRENPALRQTLAYFFPVYCHSKLSNTEHMRRVSVPIVRAVLNAAEEHFS
                     LEAEEDSDGDIDESVGQRELKALMSGVLGMLAEWTDERRVVGLGGEKILAGGAASSNV
                     CGWVHLALVKDILERVLGISEGPNRCSKEEKKLLFSLLSKLYIAPPAVPSRAGSRNLE
                     GEDPIAPSARSNQSEVSPENAALAQEVKELLDETIEEGLASEAASRNALVKVKNSVLK
                     LLAAAQGRPSSSRIREGTEEGDSDMLSLRSGRSGSVRPSIEPGAYRRGVSIEPSIMEE
                     DENEDSRTTIKSEAHDY"
     exon            complement(763281..764558)
                     /number=1
     exon            complement(764615..766654)
                     /number=2
     CDS             join(767292..767409,767477..768474)
                     /codon_start=1
                     /locus_tag="AO090102000276"
                     /note="cysteine synthase"
                     /old_locus_tag="AO070322000143"
                     /protein_id="BAE61352.1"
                     /transl_table=1
                     /translation="MFRQSIRRFGTTALRAAEGSTAYSVRVSQAQGYVNGLTEAIGNT
                     PLIRLKRLSEETGCNILGKAEFQNPGGSVKDRAALFVVKDAEEKGLLKPGGTVVEGTA
                     GNTGIGLAHVCRSKGYKLVIYMPNTQSQGKIDLLRLLGAEVYPVPAVAFDNPQNYNHQ
                     ARRHAESLDNAVWTNQFDNTANRQAHIEMTGPEIWAQTGGQVDAFTCATGTGGTLAGI
                     TRYLKTASDGRVKCFLADPPGSVLHSYIQSGGNLIERSGSSITEGIGQGRVTDNLQPD
                     IDLLDGSLNISDEKSIEMVYRCLDEEGLYLGASSALNVVAAKEVAEKLGKGKTVVTIL
                     CDGAYRYADRLFSNNWLQSKGLRTAIPKHLEKYIVLP"
     exon            767292..767409
                     /number=1
     exon            767477..768474
                     /number=2
     CDS             complement(join(768553..769143,769202..769450))
                     /codon_start=1
                     /locus_tag="AO090102000277"
                     /note="sulfite oxidase, molybdopterin-binding component"
                     /old_locus_tag="AO070322000142"
                     /protein_id="BAE61353.1"
                     /transl_table=1
                     /translation="MRTLLKEVQGIDWGDAAIMNCKWKGPRLRDVLLRAGVTSSLDRD
                     LYVAFSCYQVQCQEDDWFGSSVELKRCLDEDMDAILALEMNGSPLTPNHGYPVRVVLP
                     GIAGARWVKWLDRITVQDHESSNFYQQRDYKVLPPDAVDSASAEPYWDRTPAMCDMPI
                     NSVVAVPGDGETVHLSESSTLEVKGYAVPHGADGPVTGVQVSADGGQTWVDAEIEGSS
                     LERKWCWVLWRAKVRVEKGTGKQVLSRAFDRGGNVQQEHSQWNLRGVGYNGYGRASDL
                     IVV"
     exon            complement(768553..769143)
                     /number=1
     exon            complement(769202..769450)
                     /number=2
     CDS             join(778670..778895,778964..779151)
                     /codon_start=1
                     /locus_tag="AO090102000280"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000139"
                     /protein_id="BAE61354.1"
                     /transl_table=1
                     /translation="MSSHGHPGRRLVPELLDEFEVRGPNGTHTCYTVTLAACNLRDVS
                     FSLFPLDVARALSYSLAQAVACVHSQGYVHGDLHLNNVLLALPSNFDDLSVEQLYEKY
                     GKPETVPITQIMEMESRSLRISQLKRLGHCFLGDL"
     exon            778670..778895
                     /number=1
     exon            778964..779151
                     /number=2
     CDS             complement(join(779811..780168,780290..780438))
                     /codon_start=1
                     /locus_tag="AO090102000281"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000138"
                     /protein_id="BAE61355.1"
                     /transl_table=1
                     /translation="MAAVQEGVNFVRIFFYAKNTISAKRKKALVGLAYQTARDQLLAP
                     KEILIRSDLHGTTNIKGDVSKIPRVGMAPLLSKARTSSCANTTLRHTGTPAVKRNISS
                     KKRRTLQRRQTILHEAGQKRKKLFGHPWINLKNMRTALLVTRTSPVRTRSRTGLTIVE
                     PGRTSAHT"
     exon            complement(779811..780168)
                     /number=1
     exon            complement(780290..780438)
                     /number=2
     CDS             join(782428..782523,782579..782623,782673..782820,
                     782887..782954,783000..783884)
                     /codon_start=1
                     /locus_tag="AO090102000282"
                     /note="Zn2+ transporter ZNT1 and related Cd2+/Zn2+
                     transporters (cation diffusion facilitator superfamily)"
                     /old_locus_tag="AO070322000137"
                     /protein_id="BAE61356.1"
                     /transl_table=1
                     /translation="MSLPELEIYSHLLSPVGFYTKSLALVADAFHYLNDIIGFIVAFA
                     AVKISSKKESPKDLSFGWQRARLLGAFFNGVFLLALGVSIFLQSIERFISPQAGSYYW
                     LCWAGAEYTKRVIPSRFFLDSEHDHSHDNLPGGNLDASAESGINEVTELANREDRKSA
                     EHPRQAYAFHTGHRHNNLQAQKKGYDLGLLGVFIHVLGDAFNNVGVIISALIIWLTHS
                     ASRYYADPAISMAIALMIMGTSIPLGLCSLSLGKTLFSRLNFHPVRNSGLILLNSVPK
                     GIDLSDVKHDLELVCSHPDIPHHPPISRLFHARNFYPCINMAQLPEVSSIHELHAWRL
                     NQEKALASVHVGLPDIRISEFVKLAKTMNECFHSYGIHSAIVQPELVQTVEDTTEGTE
                     TKSDSCQITCGSSCELLTCCG"
     exon            782428..782523
                     /number=1
     exon            782579..782623
                     /number=2
     exon            782673..782820
                     /number=3
     exon            782887..782954
                     /number=4
     exon            783000..783884
                     /number=5
     CDS             complement(join(784906..785235,785291..785596,
                     785651..785923))
                     /codon_start=1
                     /locus_tag="AO090102000283"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000136"
                     /protein_id="BAE61357.1"
                     /transl_table=1
                     /translation="MLSISKVSVDDLASEHREAFIQALHNVISRQPTQRALAQVVDGI
                     PTRTDSNGWEFVKAGLKRKDDPFEESIETVKAFQDKFEVDTLEISSDVAQAYQDTSIG
                     SRDFKLRLLEMVAISFHNMVAHLFKSFEADPDAWLSRNSVPHPREATWFYHSDYLDHD
                     QYPLGVPDVVGYWAEKQVFGGVVLFDRGENDNKCHDAFIHPDDGYRIFKLSDDQLDQF
                     ASLGAKPGLNDQNNDSVSPIPFQAERYTRRIEPEEAMERHIYRHLYERRPKAEDNGRT
                     QHKRRRLEDYPEFGDLLHRLGKGEQR"
     exon            complement(784906..785235)
                     /number=1
     exon            complement(785291..785596)
                     /number=2
     exon            complement(785651..785923)
                     /number=3
     CDS             join(786727..787131,787496..787522)
                     /codon_start=1
                     /locus_tag="AO090102000284"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000135"
                     /protein_id="BAE61358.1"
                     /transl_table=1
                     /translation="MASIANFVVFTRRSSDPSLGWEDNPPNTPVYTYVASAINIALSI
                     LESPHGRHYLTQLALIIDHEMDENSHFQGNKDIAKHWVDVFLAKVRAQFPVVIVDFTM
                     NNPNELGCHPRGGWMGHLKDFDPRSHMICINGQTDRDTIPN"
     exon            786727..787131
                     /number=1
     exon            787496..787522
                     /number=2
     CDS             complement(join(789103..789118,789211..789419,
                     789484..789858))
                     /codon_start=1
                     /locus_tag="AO090102000285"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000134"
                     /protein_id="BAE61359.1"
                     /transl_table=1
                     /translation="MAYTFADLHGVQRILFSKGDDGRPRGSNEISGLWIEYYGSRRPV
                     IIGQWIAEGSSLTFEQGERITGITLLVTKDTMTYRDRYHLGRVVQVSIFTSTRTEMYP
                     NDSSLSMDEHNILRFQESRLEELSSLAWIFNDVWDYPRVIYSPKASGSQLLTWDPFKI
                     SVYRPWIAPQKALFKETNQDDILSSATGFYGVKHPARPE"
     exon            complement(789103..789118)
                     /number=1
     exon            complement(789211..789419)
                     /number=2
     exon            complement(789484..789858)
                     /number=3
     CDS             complement(join(789983..790018,790078..790275,
                     790337..792177,792234..792339))
                     /codon_start=1
                     /locus_tag="AO090102000286"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000133"
                     /protein_id="BAE61360.1"
                     /transl_table=1
                     /translation="MLHFCVICGVLIRRTSFAPGVLPDDDLQWYQQLHIVWRREISDT
                     ATLSGVGYIDSDDRVIAPLGPESSYRDASVTFEEYIPYYEGSQLPWSFFFHATCWDIL
                     LQRVPEGLSDLSRFSSIFHNVLYCTTWSRHRYVRPGHDFGGSIQFQKPAGDPIRKIIA
                     EGYSYLLAEPLQPQNMAEILRICGGHKVFTVPTRAPIIRSSQGSRDIFSRLPLEVLYM
                     IIELLPSSDIGRLRLASTSTAHVTRPTSLPQRFWRSRFRPDFEMGFAMPIEATIDEDW
                     RKAYFAIRHALSSPLDFAYLKNRQRMWNIVTVNASLLAEHMKGSGLSGDLHNDNNDSC
                     PKLQNGLSELGRGQIITTQFSTSCHEYLHVGSRKLSDTSIVLPVNEGEVRIIWLSMIC
                     FNSQKFIAGVRFQALDSPTQGYRNYSLGYISRGSEVKVDIPLSHRIAGFELATRVNGV
                     VGMRVVLQKGSDKSWTSWVGDVGDGDPNIAFGMLSLTKGLQRALIVAGFDVSLIVYEG
                     LQWLTALKAFKMLDLAILREAPARLEDVPLQPLWTPVCPRGPLTPALQYSSRGSFNAM
                     LVMDFGGNHGQNLAHLTRIVAHIQEYSAPIVGLTFYFDNQKNIHFGRQGRMEVSSFFD
                     GPAGERVVSVTYERASTSCGIVTLQIHTNYGNTAVFMPNELRKWPSTKLSVPAPPNTP
                     SDLSLQRPSTEYSTETLRAPEDQQITGFAANLEQSLLPELSFAT"
     exon            complement(789983..790018)
                     /number=1
     exon            complement(790078..790275)
                     /number=2
     exon            complement(790337..792177)
                     /number=3
     exon            complement(792234..792339)
                     /number=4
     CDS             join(793624..794046,794134..794481)
                     /codon_start=1
                     /locus_tag="AO090102000287"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000132"
                     /protein_id="BAE61361.1"
                     /transl_table=1
                     /translation="MSQSTHPPTLLLTPGSWHTPTSLIHLQTALQKAGYPTQTIAHPT
                     NGAEPPTKTLTDDTTNLRHTLSQLIDQEGKDVVLIAHSYGGLVISNAAEGFGKKDRGK
                     RGLQGGVVLMVYMTAFLVPRGKSLFGVLGEFRPANMVLEGSYCRATSARESFYHDLSP
                     EMLAEAEAQLTHSCIGAYTESVNYEPWRDISCAYIFCEEDRALGLPVQEMLVEMMRES
                     APFPVLTGRLKASHSPFYSMPGETAEVIRGFISEVEGV"
     exon            793624..794046
                     /number=1
     exon            794134..794481
                     /number=2
     CDS             complement(794882..797398)
                     /codon_start=1
                     /locus_tag="AO090102000288"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000131"
                     /protein_id="BAE61362.1"
                     /transl_table=1
                     /translation="MTAMAMEKPENIVAAGQGPAPMKFSRYRSVRKAASQKPHPMHPP
                     PVSTLPSLPSASRPGLQDGAAAVDGTNPAIKRSMSRYRRQRAATESSPNAPPLPVPGD
                     RVLAHRAKPHVDVNGAAVQKTSRGSPDDAKPVDASYNAVSARAENRRRAFNVEETTVN
                     PFLTDSEEDEDVRQKHRQDAMNRLTGEDRKPSVPAPHRRHTTRERDVKRPAERPPRRD
                     VEGPTSRRASHDSKRLSNKEMPMPARSIDTANKEVTAIDTSVGNRFPGIDAPVSAVNA
                     GERRVVVQYRKTSLNLRVTPSTTAQDLLFLAADCLAGQIDPPKFIMMESFGELGLERP
                     LRTYECVREVMNSWAHDQENSLIIVPAASLDALSLLDSRHAPSEQPTDVTLHMYYSQR
                     PRKWDKRYITLRADGQVTLSKKEHGQDSVNVCHLSDFDIYSPTSRYLSNNVKPPKKIC
                     QAIKSQQKSSMFLTTENFVHFFSTNDKAVSDTWYRAVQSWRSWYLVTKLGAGSPADQA
                     DVPADAGDALPSHKKPFKPLLNLDSPLNSGAENSDSATDRPKASKTKELFSRKKSTRE
                     HVPPPSSFPKMLSDESDLSAAQSSDESPFASGGLLGRTYTQRQRAMKEREEKEKKATE
                     EPFTNGLVGAVDTRRQFAGPGSRANSRPNSRSNTMTSTHAPDPSGMVKRSQSVKNKPL
                     VDLTPVYQEPPQHTRKGRGFTVEAGKPLVDAATGPEVPGGIVIPSATTWRRPEVPSPT
                     ADARTRKRSNTNRSASSQQRHQYSRTAPTSPTTPVDPLPSREEPFIPNSLLARSAPGA
                     AVPGQPKGHGVATGDRNASKPMLDMSPENPFAEGSLLRDL"
     exon            complement(794882..797398)
                     /number=1
     CDS             complement(join(798840..798870,798924..799632,
                     799693..799712,799818..800029))
                     /codon_start=1
                     /locus_tag="AO090102000290"
                     /note="C-3 sterol dehydrogenase/3-beta-hydroxysteroid
                     dehydrogenase and related dehydrogenases"
                     /old_locus_tag="AO070322000129"
                     /protein_id="BAE61363.1"
                     /transl_table=1
                     /translation="MTSIEPTSEKMSSVVLVTGATGLLGRQVFNTFKHSGCFVVGQGY
                     SRANPPTILKADLENKDDIQRILDEAKPQIIIHCAANRSPDLCEQDPEKARRVNVEAT
                     RTLAEEASSRGAFLIYISTDYVFPGKEGEAPYETDAETNPPNLYGQLKRDGEVAVLEA
                     TKETGLGLVLRVPVLYGPSDNNSESAVNCLIDAVWKSQTPESSVKMDDWAQRYPTNTE
                     DVARVCRDIVIKYIKERTRLPQQPHILQFSSEDRMTKYEICEKFAEVLGLPLDRMIRN
                     KQGNEPGGVQRPYDTHLSTKGLKDLGIDVRTTDFVAWWRKHLGAYKK"
     exon            complement(798840..798870)
                     /number=1
     exon            complement(798924..799632)
                     /number=2
     exon            complement(799693..799712)
                     /number=3
     exon            complement(799818..800029)
                     /number=4
     CDS             join(801161..802759,802812..802844)
                     /codon_start=1
                     /locus_tag="AO090102000291"
                     /note="proteins containing the FAD binding domain"
                     /old_locus_tag="AO070322000128"
                     /protein_id="BAE61364.1"
                     /transl_table=1
                     /translation="MSSARNISVALRRARLPRPRCFVQPIVSRAPSRIATRSFSLTSA
                     VNATKEIKYTSNAYPNLKRDPKFAEITAEDVTFFKELLGSQSAVIDGVTTDAADDIEP
                     FNSDWMRKYRGHTRLVLKPQNKEEVSQVLKYCNDKKLAVVPQGGNTGLVGGSVPVFDE
                     IVINTSRMNKIRSFDEGSGVLVADAGVILEVADQYLAERNHLFPLDLGAKGSCHIGGN
                     AATNAGGLRLLRYGSLHGNILGVEAVLADGTIVNSLSTLRKNNTGYDLKQLFIGAEGT
                     IGVITGLSILCPPRPKAVNVAYFGVESYEQVRQAHQEAKSHLSEILSAFELMDGRSQK
                     LVHESTGNKNPLDSEYPFYCVVETSGSNGEHDMAKLEGFLEHIMGEGIVADGVLAQDE
                     TQFQGIWRWREGITEALSHLGGTYKYDVSIPLPELYQLVDDCRERLTKLGFVGDDDSF
                     PVRAVVGYGHMGDSNLHLNISVREYNKEVEKAIEPWVYEWIQKRNGSISAEHGLGLAK
                     KEFIGYSQDETMVKLMKQLKDLYDPNGIMNPYKYI"
     exon            801161..802759
                     /number=1
     exon            802812..802844
                     /number=2
     CDS             join(804098..804146,804209..804276,804340..804507,
                     804563..805164,805219..805884,805954..806224)
                     /codon_start=1
                     /locus_tag="AO090102000293"
                     /note="serine/threonine protein kinase"
                     /old_locus_tag="AO070322000126"
                     /protein_id="BAE61365.1"
                     /transl_table=1
                     /translation="MADDMANQYQMMEELGSGSFGTVYKAIEKSTGEIVAVKHIDLES
                     SEDDIQEIQQEISVLATCASPFVTQYKASFLRGHKLWIVMEYLGGGSCLDLLKPGVFN
                     EAHVAIICQQLLLGMDYLHSEGKIHRDIKAANVLLSHTGKVKLADFGVAAQLINIKSQ
                     RNTFVGTPFWMAPEVIQQSGYDYKADIWSLGITAIEMINGEPPHASTHPMKVLFLIPK
                     EPAPRLEGDQYSNTFKDFIAQCLTKDPDRRPSAKELLRHKFIRNAGKTEALQELIHRK
                     QDWDAGRGVTRNVKYYAESLNTITHLKDDDGWVFDTVKAPTMKIQEDPYVDENELDSQ
                     DFLYDETSEMMNDMHISSPPPPPKHAPNSATNSAVNTAVRRAPAPERSPSTRRSYRKR
                     RSSGVKQPLGVNLTFGNSPSTVRQFRRVSDKIPSENSYSSQYSFGPDENNSPKTLFSE
                     PNSKEAQLGRRAYSKAVGLSCQEVLGTTGDQEKREAISRLAEAWSDLEMVDPEGLYHI
                     LKIMNEKLQGDPKLSGLVPQAAPPPESPQRPRLVLAQNNPHLKSHRRRQSAVVAEPSL
                     QPAQLVNLPGQQVPGMEHTKQLSDVLYQRWSEGLRNRWPGI"
     exon            804098..804146
                     /number=1
     exon            804209..804276
                     /number=2
     exon            804340..804507
                     /number=3
     exon            804563..805164
                     /number=4
     exon            805219..805884
                     /number=5
     exon            805954..806224
                     /number=6
     CDS             join(807737..809190,809280..809466)
                     /codon_start=1
                     /locus_tag="AO090102000294"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000125"
                     /protein_id="BAE61366.1"
                     /transl_table=1
                     /translation="MGDITGTESPAPEAAQPLLRSSLDHNLMSATDITEEQLEQQRQL
                     RQQKRASLPARPHGAARHKKRLTLNFPINVPPLTTALDSAVTEPSSMTPVTRPSTRHS
                     HVPAVGTPLTFDDQDEGSSLLTAIASQERKVLELREELQRAETELDSLKRQWEASEKT
                     KKRIDISHRAEPLIPLRSPDRPGADERILHSREHSVASSESPSVAQPRFSRELERRHS
                     VRAAAAKGTKISANGRRVFQGSHTRTLSLLSPTVGPVPNLPGSELGNDQRDQDRMGRA
                     PRAATLPSAERSPMILGSNEDMVAQWRKTMPPPSREALMRTGKQMASDLREGLWTFLE
                     DIRQATVGEEGINATESRAVPSRSSTSRSRDRLSTQGGMSSRSASSSRSKGAGAKLSG
                     KDSKSADIDSSFWSEFGIDTSGQKSPNAQRASTTPSGPNAQNESNRLDIEDNWDDWDT
                     PQPKKMHTPSSSQSTWESKQDQSPMTPSSPRTSTSFGDWRPLHDSSVPDPSVSDGIPW
                     PAMADMPSPKLPRTATNLMAEWERSLSPALDSPTFKKD"
     exon            807737..809190
                     /number=1
     exon            809280..809466
                     /number=2
     CDS             join(810151..810273,810359..810454,810521..810856)
                     /codon_start=1
                     /locus_tag="AO090102000295"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000124"
                     /protein_id="BAE61367.1"
                     /transl_table=1
                     /translation="MNIPGMTTGMAPAGATAGAGFPGAGAGMQGMSEQEQAMVKAMHA
                     AMESCPVKTVISGTMGFGLGGVFGLFMASMSYDSTFTPQGKAIMDLPWREQVRRGFKD
                     MGSRSWSSAKNFGIVGALYSGTECCVEGLRAKNDLSNSVISGCITGGILGAKAGPQAA
                     AAGCAGFAAFSAAIDAYMRMPSEE"
     exon            810151..810273
                     /number=1
     exon            810359..810454
                     /number=2
     exon            810521..810856
                     /number=3
     CDS             812087..813436
                     /codon_start=1
                     /locus_tag="AO090102000296"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000123"
                     /protein_id="BAE61368.1"
                     /transl_table=1
                     /translation="MRLFPVSQGLVSVAVAVTSTAWGVRAASEATTGNPLATFDQQEL
                     DALAIQIYQDYPFTVLKAEAKVAYQTAHGLPISDEAASSLNASIEELVFSAVQKAVNN
                     DPYHPKVYWVDSGPRSWFGLNVPGGRYSYDNPDCIYRTIPIDNDVDYVVTGYRHSPGP
                     TDVSFSLISDPNSQNTVAYLAGSDLIVDSDGSYTITINSSAADGQTNHIQSTSSAVQL
                     LIRNNLGDWNTETPDNITVQAVSNTTGHDAITSAKIISDAIWNLQESIVDYGVGALGL
                     KTTINAVNTLSAPSQSSSLGTLTSQASSFGHFNLTAEEALVATLTPGPADYFVFPVTN
                     PWMITVDPGSSLVSLNSKQAVANTNGTYTFVVSLDDPGVYNWVNTTGLHEGTIMARWQ
                     GLNTSSSSADSLAIDVQVVAVSDLALVLPEETRYVTAEERAAQLNQRATAYSRRLEY"
     exon            812087..813436
                     /number=1
     CDS             join(813938..813960,814015..814315)
                     /codon_start=1
                     /locus_tag="AO090102000297"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000122"
                     /protein_id="BAE61369.1"
                     /transl_table=1
                     /translation="MPVTAITSASQYKEVTGGVTPVAIFFSSDRVASCKSIAQLLEEK
                     TKGFPSQFYKVDIDAQDKIAKDAGIGFRDVPTIAIYRYNQKLGDCTGSDPQIVDRAIG
                     SVTSF"
     exon            813938..813960
                     /number=1
     exon            814015..814315
                     /number=2
     CDS             join(816153..816237,816288..816561,816635..817514)
                     /codon_start=1
                     /locus_tag="AO090102000298"
                     /note="beta-lactamase class C and other penicillin
                     binding proteins"
                     /old_locus_tag="AO070322000121"
                     /protein_id="BAE61370.1"
                     /transl_table=1
                     /translation="MTAKEQQIEAAVAAGEIPGLILLATDTADKFHYERTIGSASLKP
                     GAERPLTLDTTLTIASCTKIITTVAVLQCVERGQFGLDDDVSTVLDELQDLKILKGFE
                     EGTENPILVPAKNKITLRHLLTHSSGIAYDFLDPNIIRWRMSTGRTPDIGESTPLLQR
                     TNLPLLFEPGEGFVYGYSLDWAGILVARLNNISLEDYIQKNICEPLAITDLTFHLEKN
                     DEVRSKLADFNFRSGGITQFGTPADPNGSISWTPGRVWPDPVVEEYGGWGVFTSGPSF
                     LKVLASILRNDEKILRPDTVDEMFKDQLSAASKEMLNATLSIPEINNFLGGTPLGLQK
                     TWGLGGLLVLEDHTTGQKAGSLRWAGLPNLFWWIDRKVGLCGFYASQLVPTGDPKSVE
                     WSTVFIQDMYERVEGFGAQV"
     exon            816153..816237
                     /number=1
     exon            816288..816561
                     /number=2
     exon            816635..817514
                     /number=3
     CDS             complement(823954..824688)
                     /codon_start=1
                     /locus_tag="AO090102000303"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000116"
                     /protein_id="BAE61371.1"
                     /transl_table=1
                     /translation="MDTKHESKEYATSIHSVASTTTTLLDTSKGSFLEGKRFRVEAKG
                     IRALRPPMPMRQNEIPIYTADGSLAYTATKAKAMSSHTILASPKHGDLFSIDFKPGCC
                     PWIRFLNPIEGDVIPEIALEGKLTTRAMSFTPPEGGCKWEWKYSIIDSPSGGKLKALC
                     LEKIDGSECGKATRIAYLLRSPDTRATGSSCCSAGNGGQLVISPDVDLSMVEEALVIA
                     TCLVMLRRERDRRRFIQAMVIGGMGS"
     exon            complement(823954..824688)
                     /number=1
     CDS             complement(join(825919..825936,825996..826056,
                     826120..826352))
                     /codon_start=1
                     /locus_tag="AO090102000304"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000115"
                     /protein_id="BAE61372.1"
                     /transl_table=1
                     /translation="MTHESGMNLTTRFCENCGSLLYKTGDREGFEGAVIVLAGTLDNT
                     EDFEKAKPEAEFFVKHRVGWWPGLGFATQLKEFDSNMGLANVCGGGVAVLLALGYYHI
                     F"
     exon            complement(825919..825936)
                     /number=1
     exon            complement(825996..826056)
                     /number=2
     exon            complement(826120..826352)
                     /number=3
     CDS             complement(join(827692..827710,827827..828683))
                     /codon_start=1
                     /locus_tag="AO090102000305"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000114"
                     /protein_id="BAE61373.1"
                     /transl_table=1
                     /translation="MAWLGLDHPLQEWWEDEHIDLLLENNRGETLIAIAVRVRCKPLC
                     KKLVSRLPKDQRTRGCGCALIIAAKQGDENLVRFLVQEGNANVNLVARGFTTALCEAC
                     VIGALNIVKYLVEEAQASVDVRTECDNYISALAAACHSDSASRLELVKYLLEEAGAVV
                     DPPLVSGLANSTLGIASSIGPLDLVKYLVEKGNADVNLQLEGWRCSHGTALAAVIRRR
                     LEIIKYLVTEVHADVNQQLRFGHTNTALTTAVETGSRDIVQLLVEEGNANINLQSTCG
                     GDRNFGSTLESCNLP"
     exon            complement(827692..827710)
                     /number=1
     exon            complement(827827..828683)
                     /number=2
     CDS             complement(828780..829226)
                     /codon_start=1
                     /locus_tag="AO090102000306"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000113"
                     /protein_id="BAE61374.1"
                     /transl_table=1
                     /translation="MNVETGDIKLTSHITEKSLLSFSQSLLVVDSKKYVWRLSHLSVV
                     EYFERRQTLLDRPARFKCGSVCLSFLIEAYGKLNDHSASVHPSSSAVTVFPGDKLDIN
                     NPFHQYAKQHWPVHFRNNVPDDHSKRILKRFLGSPQESSPYFRHWI"
     exon            complement(828780..829226)
                     /number=1
     CDS             complement(join(829509..829804,829932..829961,
                     830177..830783,830837..831475))
                     /codon_start=1
                     /locus_tag="AO090102000307"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000112"
                     /protein_id="BAE61375.1"
                     /transl_table=1
                     /translation="MEQSKVTCFTRMRSKVHHICNRKGKEKEKQESELPSSLAPAIVD
                     PQEQADSEPAVKPAIIEVQSIGEASASGAILDESTLPEPLSLQTCGEDDNREQIKPET
                     PERPQNAKRDLWHEAYVRLAPELQENLKSLGFDQQSPEPVKQRIEGVLAEAKRQRDKC
                     EEKDWIIKVGDHEIKVRDTAVQIIGWVTKIGDLAVGFAQPAEGPWSVIKLLLGGIEVY
                     DKEKGALLSIVENVTRVIYSGQIYESIYKLDKAGVEPTSRLYDVLVEIYNFILELVIK
                     STDVSSNTAVQFLKSVFDPEKASDMLCTLRDHKSRLADAVRVCEATAQANLDSLLRIQ
                     LEDAHMALVGVTHRIENVVQRMDDQERDKLLSWISDIKYGNHHDHVVERRTPETGTWL
                     IRHETFREWRDTTSSGILWLRGYPCWSLERLSIDALDEVAVNERRQLIRVLDELVSQS
                     TSTVKVFIASRPDGDISFQFASKLNVQIRAADNMEDIDKFVTNKLEEITALADLPSYL
                     KIDIRKALLSGCDNM"
     exon            complement(829509..829804)
                     /number=1
     exon            complement(829932..829961)
                     /number=2
     exon            complement(830177..830783)
                     /number=3
     exon            complement(830837..831475)
                     /number=4
     CDS             complement(join(832432..832646,832704..832991,
                     833051..833276))
                     /codon_start=1
                     /locus_tag="AO090102000308"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000111"
                     /protein_id="BAE61376.1"
                     /transl_table=1
                     /translation="MSPTRAAQVEEYGWTAVSCDPQQRAATNPPTKPSVPQLVKDTTL
                     PDTPLVKDAIEYVKAELPAHTFNHSMRVYYYGLAIARQHFPEWKFSDETWLLTCLFHD
                     IGTIDKYTQDVFMSFDIYGGIVALNVLTEKGAPAPQAESVAEAIIRHQDPVKVGTIHS
                     IGLLIQLATQFDNLGAHKEYVHPDTVEDVNQHYPRRQWSKCFSSKLREEIGLKPWCHT
                     TAEGEGFPIGIENNTLMEPYDGRF"
     exon            complement(832432..832646)
                     /number=1
     exon            complement(832704..832991)
                     /number=2
     exon            complement(833051..833276)
                     /number=3
     CDS             join(836571..836955,837022..837461,837539..837775)
                     /codon_start=1
                     /locus_tag="AO090102000309"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000110"
                     /protein_id="BAE61377.1"
                     /transl_table=1
                     /translation="MAEQPTAANTTSSPPKLSVLRPEDDLPLLEVAEEEDEEDFSPTD
                     SALGSTGTQSYATSLLSEVRNYKYENGRRYHSYREGQCVLPNDEQEQDREDLLHHVRN
                     LHFSGDLFHAPIPEDVENVFDIGTGTGIWAIDFADTHPNARVIGTDLSPIQPAWVPPN
                     LEFFVDDVEADWTFKRDYFDFIRACDLAGSIADWPKLLRQAYSHMKPGGWLELSDFEM
                     EHFSDDDTLDLAPSLGEWFRLLIEASSRFNRPMKVAADHQRNMIDAGFTDVKEKIYKF
                     PMGPWAKEKRLKEAGRFHREVMVMSLESYALALCTRVLGWSPVEVAVFLASVRNELRD
                     PRVHIYGKFHVVWGRRPVE"
     exon            836571..836955
                     /number=1
     exon            837022..837461
                     /number=2
     exon            837539..837775
                     /number=3
     CDS             complement(join(840273..840684,840746..840897,
                     840955..841050))
                     /codon_start=1
                     /locus_tag="AO090102000310"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000109"
                     /protein_id="BAE61378.1"
                     /transl_table=1
                     /translation="MASTATAIANETATIIFTEMDSVDLVGKVIGTDGPLTTYVINCN
                     PKPPNQNFYQVGDCVSSSHGWTVTAGPSTMRVAFDDPEATMIEACTLHDSTSLNCDIT
                     MDYGSSTDVESDGGTTAPASDFYRTVTITGTEIASGSASAQTSPTAGRATATTTGTAS
                     ATAAAGESGSGAQKAAANTASSTAGASQSTNAAMAQVTGNARWAVSGAAAMAAIAMVL
                     E"
     exon            complement(840273..840684)
                     /number=1
     exon            complement(840746..840897)
                     /number=2
     exon            complement(840955..841050)
                     /number=3
     CDS             join(847348..847467,847517..848505,848559..848751)
                     /codon_start=1
                     /locus_tag="AO090102000313"
                     /note="FAD-dependent oxidoreductase"
                     /old_locus_tag="AO070322000106"
                     /protein_id="BAE61379.1"
                     /transl_table=1
                     /translation="MDKNSRIVIVGAGVFGLSTAAKLASEGYKYVTVVDRHMPPVPDG
                     SSSDISRVIRFDYADEDYLNIAYEAYQKWSQLPKYQGIFFKAPFILTGNTTVHGRAWI
                     EKTTAALTKKQLPWAKLDSAAAAKSRYPILSGTLATPNFTGYYNEQAGWADANKAVSQ
                     LRDDCLELGVSFICGRAGTVISLDTDSQKKIKAVRTLAGTSIEGDHFILASGAWTSGL
                     VDMYNSTLATAQVIGYTPLTDAEVKKYKDVPIYANFNTGWFNFPSHDDTKTLKMAVHG
                     WGYTRAPTAEDHQSVKTNISSPPLIPPRQRVNFTPPDGEDRLRTGLREILPELADRPF
                     ERVALCWYTDTPSGDFIMDSHPDYKNLFIAGGGSGHAFKFLPVLGDYTFLAFTKRLPE
                     HLAKKWRFRTEYKDDKDTFLGDGSRGGPARRELHARERAKL"
     exon            847348..847467
                     /number=1
     exon            847517..848505
                     /number=2
     exon            848559..848751
                     /number=3
     CDS             850307..851452
                     /codon_start=1
                     /locus_tag="AO090102000315"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000104"
                     /protein_id="BAE61380.1"
                     /transl_table=1
                     /translation="MTCHQRHTNQISSVLSLISSLLHCPLDSSPLLVITESVFHPIMF
                     TSTFPTMSLDLVGIIFLADLSLIAQRTALTGGSTFLDTFILCPGLHRQQDAANVHRGE
                     YPAVAAMTTGYVFRVENPATVNFLQRVGHTGQLTTLSVTNTRKTRKGWRSHFMSSIDS
                     SMSLGAVAAYLLAVSSTIAVSYLLVLTEDWWGLLVLTVLMFTRFINVLLIRSRSRVGW
                     SGASEPGVVGDLLVLLSQDRWVRIRGYVDDLKAVTSGEWLHDMTWVESAISGFTTLLV
                     YLNVALASNAKLSGQVMLLLLFVGTGGLLGLVNMLTQGLQMHGNLITVDIPRRKYRRR
                     LDLVEALICETGRDDWAVRLGMINPSQASATKGSSAGNAAFNETLTM"
     exon            850307..851452
                     /number=1
     CDS             join(852567..852710,852785..852825,852890..853718)
                     /codon_start=1
                     /locus_tag="AO090102000316"
                     /note="NADPH:quinone reductase and related Zn-dependent
                     oxidoreductases"
                     /old_locus_tag="AO070322000103"
                     /protein_id="BAE61381.1"
                     /transl_table=1
                     /translation="MKQWVLSGTCGIDSLQLQDVPIPDPGDYEVLVKFHAASLNFRDI
                     MIANGQYYIKTKDRVIPGSDAAGEIVKVGPKVTRFSTGQRVSPIFHLTHLYGSVKDTD
                     IQNQLGGTYDGVFCEYGVFNEHGCVEIPSTLSYREAATLPCAALTAWNALYGGPRKLK
                     PGDVVLTQGSGGVSIFALQFAKLGGAQVISTTSNAEKGAKLRDLGADVIINYAEDSEW
                     GQTAKSQSHRKRGADFVVEIANTMVQSSQAVANNGCIATIGRRGDSERGAGSSHSSVL
                     ATVRRILVGNRQLQEDMNAAIEVSHLKPQIDGLSFKFHELKEAYDYFQQGSHFGKVVV
                     DFD"
     exon            852567..852710
                     /number=1
     exon            852785..852825
                     /number=2
     exon            852890..853718
                     /number=3
     CDS             complement(join(855086..855310,855365..855488,
                     855540..855789,855841..856451,856502..856905))
                     /codon_start=1
                     /locus_tag="AO090102000317"
                     /note="permeases of the major facilitator superfamily"
                     /old_locus_tag="AO070322000102"
                     /protein_id="BAE61382.1"
                     /transl_table=1
                     /translation="MIKIDFGFRSRSQDGEGEGWFGKLPQFTVISRPGSSLGHSTPSS
                     GLATPTEEKGLTTLQPCPEIGRLASWRGALILLVTSGSQFLDNVFMTSSNIALSSIQE
                     EFGVSSTELQWMISAYTLTFGGFLLLAGVLSDRYGRKMILCLGLFWLSVWTLAIGFGQ
                     SFIQLAVFRGIQGIGAALTVPSAIGIISSYFTGVDRTRGLSIYAASGTLGFCVGLIFG
                     GFLTSSLGWRYIFYLIVTITGSIGVLGAIVLPKDDLAGKEKPKMDYFGALLSTAGLIL
                     LQFVLSSGGDYGWGTSFIIVLLILAVALLVAFTFLEWYISYPIMPLDLWKIPNFAGLW
                     IAGFTCYGSYQNVIYYIVLMAQQVDNLSAGETALRFLPMGVIGFIASMGTGKALEYVN
                     GKYTLIAGLVLTVLAPVPSALTATDSEPDFWVNVLPTSLISITAVSLIFVTTSTTILT
                     TVPVNVKSLCGGMLNTAFQIGSGVALAISAAVTEAVDIKKGHGLAQQYSTGLWCSAGL
                     AALGLVIAMISVRRRGIGPGDRNDTLVAI"
     exon            complement(855086..855310)
                     /number=1
     exon            complement(855365..855488)
                     /number=2
     exon            complement(855540..855789)
                     /number=3
     exon            complement(855841..856451)
                     /number=4
     exon            complement(856502..856905)
                     /number=5
     CDS             join(859545..859858,859908..861174)
                     /codon_start=1
                     /locus_tag="AO090102000318"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000101"
                     /protein_id="BAE61383.1"
                     /transl_table=1
                     /translation="MTNKQPEANIYAHASFDLTALLSIARAIRQKNCTCDESQRPKSG
                     SLNWAIFVVFEDGVEWVFRSPRKAFGLEARTATEALLSEVATLEYLAKIGCIPIPRVF
                     SYCSTGKNDIGIPYILMGKATGVPLSTYKWDDDKIHSTGPDCEQDPAVLTFSQKAKIV
                     KQLGEIQAHLSNVRFDKVGSLFLKNGEFVIEKCLYPSLVWQGRDEFDEQDIPRGPFTD
                     AKSFYVALIRELFAHAKELPMEHHLFHGPVPVPQEYDNFQEYRTATDRWNDYVVIGLK
                     TESTQNRLDYALVGMSLEDNVPLLVEKGNDIKCDGFPLCHPDLSCQNIFVDDELNIIC
                     IIDWAFASSVPPSMLLVCPGLPHPRDRIQPCLTKYFAEGFIAAKGYDGEKDLHFSDSS
                     IFWTFVRLVNLDGLQDHVYFSEFMRSCIGQEVPPYIRKLRDRGEFKEFETILLAYEID
                     GEGPSKDEKNYFSCVGHERFTLSQHLTVMKKIDRDFVADKRLWKWMAQHLKERDVYMY
                     PTNEDEKRGRKRKINEAL"
     exon            859545..859858
                     /number=1
     exon            859908..861174
                     /number=2
     CDS             862449..863078
                     /codon_start=1
                     /locus_tag="AO090102000319"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000100"
                     /protein_id="BAE61384.1"
                     /transl_table=1
                     /translation="MSNCNGANGDPTDLIAQALCQELFDKCPRLDLEEFAVQAAHNAK
                     LDWDRLVKEWARERVDNTPCPPLEDFIGLYVNTAFDISIRVAKTLDQSAKPGTDTEPL
                     SFNINSLPRQTAKLRHCRYDTWTFIPSSRNDAARKGMMNLLKLPRLLLSFVRNSEGKI
                     SHLEWDLQGGSCEGPAPDLADRVGPVKFHKLESEHTNALTPEMDPVTVF"
     exon            862449..863078
                     /number=1
     CDS             865170..865937
                     /codon_start=1
                     /locus_tag="AO090102000320"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000099"
                     /protein_id="BAE61385.1"
                     /transl_table=1
                     /translation="MAVASTHWACTLPSDRRRTIAATRFRHKATRIYRQSLQQPIGRD
                     NMDMLITSCILLGMFSFAAETTSPLDSWVFSDDPISMNWLSVQCGLRCLLEITKPWMD
                     DSIWNEPFQESSNYEYADDHRVGREDLDPELADLCDITDTTTEETNPYHWPLRMLCPL
                     LRIPRHKCGASRITNFMGRLLSDFVNLLAAKEPRALLIMSYWLALMCTSVDEWWVGPR
                     VTLECRAICMYLEACGDRRIVELLDFPARSCGFKITS"
     exon            865170..865937
                     /number=1
     CDS             866447..867784
                     /codon_start=1
                     /locus_tag="AO090102000321"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000098"
                     /protein_id="BAE61386.1"
                     /transl_table=1
                     /translation="MAIFQQVLDHLDFTKIPPFALSICQQRERQEGRTPTCTSCTVLP
                     ERLFGSNNILFPLEFNTAEKWILKIPMNGYPGRFNDMHARVLTAEASTMQFLRRETTT
                     PTPTVFSFSASLVNDLRCPYILMEYIDGKSTSHVWFNEELDDATLERHRIHVLQDLSK
                     IMLQLNKFTFSEAGSPIFDDGNNPIGVGPLRVMDMPAMLEELRTNDVWDRVIQSEIQP
                     TSDPKAWMLCMFERHEPPDDKFSQGAHQLLKHFIKWLPWSELAQEPFVLTHPDFNFQN
                     ILVSDEGKVCALIDWEGVSTVPRFLGNERYPGWLTRDWDPMNYGYGMEECFVQENSPE
                     ELSHYRDIYRDMVKSAIAEAEAEADANCIALSKRNLHRHLPVLESLSIAADQPINLPE
                     IVQKLFTEVSKQEGFPEDLELWEVCFGLADDDLEDEQLESVRRGFEKFLQSAQ"
     exon            866447..867784
                     /number=1
     CDS             complement(868715..870055)
                     /codon_start=1
                     /locus_tag="AO090102000322"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000097"
                     /protein_id="BAE61387.1"
                     /transl_table=1
                     /translation="MSLRNDLDNGRPTKRLESWDIASMWLSDRKDEIQDWWDFSGPQL
                     ATLAHEAGYSTMTQIELLLFFRSVVLPRMGRFPDACRPRACAQSRSILTYDGSPIEYS
                     WKWNNSANDHPEIRFCVEPVGDGLCADGIVGGKLRATDEILVQLAKRVPSTDLEWYHH
                     FRDSFGLGHWTDGPLHEDAGTWQVRRPRMPVAFEFTPKGIVTKVYFTPPATLDDMPSF
                     NMFADVVRPIGDKDTTALDESMEYLSRDPVGATLRPDVLAIDCISPLKSRIKLYAGTA
                     MTTFTSAISVLTLGGRIPVTRHSIDEMWALFRMVLGLHDKFLQDEELPVQNPFQPSRA
                     HPEDYYSGLLYYFNLAPGALLPDVKLYLPVIRYGRSDADIALGLQRFMASRHRGQYVD
                     GFQRAMEIISQRHKSGNGHRIQTYIACSFDKDGSLSLTSYLNPGVYFSSETVDV"
     exon            complement(868715..870055)
                     /number=1
     CDS             join(874746..874977,875251..875772,875925..875971)
                     /codon_start=1
                     /locus_tag="AO090102000324"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000095"
                     /protein_id="BAE61388.1"
                     /transl_table=1
                     /translation="MEWNTRGIFPARRRTYRQYISSDDDMIKEAASMTQVNPVARQRT
                     PAMLLIKQPKALKQYQTSSFLREAVRYLVYKGEEDEDDGIFHRTKVKPNPISDISQFS
                     STLKHSIDKANADTILELLQHKHDHLAQDKDGWCALDYAARTNNEDVCRTRIRSECLQ
                     TSQQSIDTYNHTGATPLQFAVSIGRLGTVRALLEAAANPHATDHYQRSPLFIASERNH
                     LQAAEFLLSSRVQIPRDATAWLKELLCEKNWCNHSEPAYRCNPSSGVV"
     exon            874746..874977
                     /number=1
     exon            875251..875772
                     /number=2
     exon            875925..875971
                     /number=3
     CDS             complement(join(882932..883348,883982..884074,
                     884130..884158,884217..884298))
                     /codon_start=1
                     /locus_tag="AO090102000326"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000093"
                     /protein_id="BAE61389.1"
                     /transl_table=1
                     /translation="MLYASLRSLIISLVRSFGDSEVQKVHTGNSYLRLGRCNLKYFLF
                     TFTSSTAQRWLQSGLSLPSNSPFKCSKGSPALSSATLVDRAGRQWSGNLMTLKGALIR
                     MTEYWPNLPDTKGVSCPVQFTNAELEEFFEKEEQLFQLNAVVNLWREQIGGASEDGWI
                     SNGNYESARQKVVELMESLIAIAEGDQEDIALLEKGWPFRDQEGDN"
     exon            complement(882932..883348)
                     /number=1
     exon            complement(883982..884074)
                     /number=2
     exon            complement(884130..884158)
                     /number=3
     exon            complement(884217..884298)
                     /number=4
     CDS             886166..887617
                     /codon_start=1
                     /locus_tag="AO090102000327"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000092"
                     /protein_id="BAE61390.1"
                     /transl_table=1
                     /translation="MQSVRIIPTYIERAPGAPATGSSLHSHGHWMPENVELRRAWLSS
                     LLDKTKAEIPRKLRDNVENPVETFRKLIENDSTLYMLAHSMFDEVPEKAPYDRDPTTL
                     KKQVRNYKTMLYLFNTLLTEVPEYFLRDNPNVPSGLIGFPFNIIVDWPMGTPSGRQFF
                     LDTRVNKCLKDILNKWNEFLKDPTAQGNGNKGGNQALIDAGWSSDAAVEQLVNKANES
                     TTDKKKTFSEIFQHPANGTQENFFNYACWDNFFTRRFKDGVRPVADAAVVNACESFPL
                     SFDTDVSRRNTFWLKGTPYSLHDMLGATQDERVASYVDGFVGGSVYQAFLSADSYHCW
                     NAPVTGKVVYRSLIDGTYFAETAAAGFGGSNGPDPAGPDVSQRYITHIAARGVLIVDT
                     NVTGGAKIGLVGFVPVGMSEVSTCDWFDNTEEGKTISKGDVIGAFHSGGSTHCLIFQR
                     DAVKKLQFIPKAQYPEIATTNLAVNSELAKLTS"
     exon            886166..887617
                     /number=1
     CDS             complement(join(888229..888234,888352..888654,
                     888715..889142,889243..889453))
                     /codon_start=1
                     /locus_tag="AO090102000329"
                     /note="Zn-dependent alcohol dehydrogenases, class III"
                     /old_locus_tag="AO070322000090"
                     /protein_id="BAE61391.1"
                     /transl_table=1
                     /translation="MITTTAIVAREPEEPLSINWTMEEVEVYTPGEGEILVEMRATGI
                     CHTDIVLSSVPAGTSGIQYPKILGHEGAGIVRALGQNVKSVEVGDPVLLSYYSCSSCA
                     SCQSAHPAYCEAFAGENYVGRQGGMKISKNGEEPWSKYFGQSSFARHSLASEISVVNV
                     KDMIKSEDELKLFAPLGCGFQTGMGAILNSSNAGPDDVVMILGLGAVGMGALMTAKIR
                     ECKAIIVVDKVEARLEHAKRLGASHTINTGTPDKPNLKDAVRQLFPSGASVVIDTTGV
                     PTLIEQSLQATQKRGKLVLIGVPPLGYELNVDVVQHINV"
     exon            complement(888229..888234)
                     /number=1
     exon            complement(888352..888654)
                     /number=2
     exon            complement(888715..889142)
                     /number=3
     exon            complement(889243..889453)
                     /number=4
     CDS             complement(join(890247..890431,890515..890616,
                     890677..890974,891196..891476,891590..891772,
                     891836..891999,893945..893973))
                     /codon_start=1
                     /locus_tag="AO090102000330"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000089"
                     /protein_id="BAE61392.1"
                     /transl_table=1
                     /translation="MRGECDATSNMLFYRAFWHRLCGFPGPFLARLSNFYVTSLSAKR
                     LHLYEEVQKLHQQYGDYVRLGPTELSIADPQAVKALYSGQAKVTKGPWYTVLEPRVSL
                     QMSRDKKEHARRRKVWDQGFSSKAVRKNVGKPMDMAKWFNYYSFDVMGDLSFGKSFNM
                     LAGGQDTYFSTQLHADMKSIGLFSHLTWLFPFFKRIPILNKDYLKFWDWVGGRVEERI
                     KTNMCSDTTAATLTNLFFHLAADHTWQAKLQEELDALPDLTQEKVTNVKLLDALINET
                     LRLHPAVPSGTQRLTPPEGLQIGDKYIPGDVMVCIPTHTLFRDERAFVRPDEFLPQRW
                     MTQPELVKDASVFIPFNAGPYSCVGKQLALMELRRVTAEILTRYDVEFAQGQTTEDFL
                     DGKRDTFTLVTAPLKLVFRER"
     exon            complement(890247..890431)
                     /number=1
     exon            complement(890515..890616)
                     /number=2
     exon            complement(890677..890974)
                     /number=3
     exon            complement(891196..891476)
                     /number=4
     exon            complement(891590..891772)
                     /number=5
     exon            complement(891836..891999)
                     /number=6
     exon            complement(893945..893973)
                     /number=7
     CDS             complement(895429..897216)
                     /codon_start=1
                     /locus_tag="AO090102000331"
                     /note="beta-xylosidase"
                     /old_locus_tag="AO070322000088"
                     /protein_id="BAE61393.1"
                     /transl_table=1
                     /translation="MTEILFAFMLLGSLALGNVTHQNSTYTDPILPGFHPDPSCIFVP
                     SWDNTYFCASSSFNVFPGIPIHASKDLRNWKLIGNAISRPEMLPRLATTIKDTSGIWA
                     PTLRYREGSDSTNENESDHGKGRFWISTTLVFDNLAADDESRWDNFVICTDDPFEPDS
                     WTDPVHFDFGGYDTSLFWDDDGQVYVTGSHEYKVWPGIQTATINLETGETGPWENPWN
                     GTGGLAPEGPHLYKKDDHYYLMLAEGGTGEGHMVTMARSRDINGPYEPAPHNPVLSNA
                     NTTAFFQAVGHADLFQNVHGSWWAVALSTRSGPDFKNYPMGRETVLTPVQWEKGEWPI
                     FQNVSGITSGWELPSEPILVSDGEGPYVDSPDHLTFPPNSTLPLHLIHWRLPTPDTYL
                     ISPPGNENSLVLRSSVLNLTSTNGLSTSGKGQTFISRRQTDSLFTYQLDINASNLRNK
                     EDDVGVSIFLTEAYHFDLGIVLLPQTDKNDTSGELAPYVRFRGMSGYSVPETVFPFPQ
                     YLSIDSPITLEIKAFNWTHYSFAAGPRDARHLMQTYGIARGEQLSAGFTGTLVGPYAT
                     TNGREGSQNGEFEVAVGNWTYLPQGQIIN"
     exon            complement(895429..897216)
                     /number=1
     CDS             join(898241..898266,898338..898974)
                     /codon_start=1
                     /locus_tag="AO090102000332"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000087"
                     /protein_id="BAE61394.1"
                     /transl_table=1
                     /translation="MGEICAWQCVLNTSTAYPFGKFLGQRYPYLPKTLVGDTNPYWQN
                     KTAVKADYANGGAPPTYEVTDWSPVYDDLANGIVAGEREAIAATSAQNATTWSPLMSI
                     HPTNQWFTGGPLALAHAFFGNRTWLTLDASQSGHADYPPNPPIPWWNCRRGWEPVELM
                     YAAGSVPGGRARPVIDNEAHYENRYNNGNSSEAFWNASDVRIGSWQAVSFISTTDSLM
                     GW"
     exon            898241..898266
                     /number=1
     exon            898338..898974
                     /number=2
     CDS             complement(join(901724..902192,902334..902503))
                     /codon_start=1
                     /locus_tag="AO090102000334"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000085"
                     /protein_id="BAE61395.1"
                     /transl_table=1
                     /translation="MHHLTRAMWVRAYYPRVGKGDRLSVTNSRWSLSSAVQFVRQKPR
                     GCYFRIRRELDWGPPDANNTTFNLNQYLPLHSNSTHLTSFLPSATPKMRFIPVALGLM
                     ATTSVMANPANVQSVTVQLANDQSGANANVDIPADGNQRSVQALWVKTSVSTNGIVSA
                     SSAQLNKFQQTTHCRITQNPNVNAELDAQRTWTQLDQGKVVQLTHAFIVCKD"
     exon            complement(901724..902192)
                     /number=1
     exon            complement(902334..902503)
                     /number=2
     CDS             complement(904455..905324)
                     /codon_start=1
                     /locus_tag="AO090102000335"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000084"
                     /protein_id="BAE61396.1"
                     /transl_table=1
                     /translation="MQSRSVLICVLLALDILNFTVASLTQRPIYAIAHRVLRNEAVTA
                     ALSHGANALEVDLTAWYFGWWADHDGKLFSAGSTARDLFKFIAQKQWTKDYNISFVWL
                     DIKNPDFCRKGRPCSIEALRDLAREILEPAGIRVLYGFFETAESRGFKVIRDGLNSNE
                     AVVLSGETSTILHLYNISGAGIPVKQMVMDFGDSWLRKGVDIYPELRYGSWKRDHGKL
                     GKVFSWTSAQGDTEMVRYLLREAGIDGLIYGYQTDEYNDKSGPKSALKDIVDFVEAHS
                     DTHRMATEDDTPW"
     exon            complement(904455..905324)
                     /number=1
     CDS             complement(join(908216..908221,908262..908383,
                     908443..908465,908648..908751,908790..910252,
                     910283..910739,910772..910798))
                     /codon_start=1
                     /locus_tag="AO090102000336"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000083"
                     /protein_id="BAE61397.1"
                     /transl_table=1
                     /translation="MSSVGITPYVGNGNFAFGADITGLQTLLPFNILSSWCWCNDSLP
                     TTANQTEPSDFTGMDWLTHDRLVNYDIQNPAEAEISQWLVANPHRANLGRVGFLYKGN
                     NISSDDITGIRQSLDLYSGILTSEFTLHGQIVSVTTIGDPSSDIIAVDVQSSLLVDGS
                     LRLNKFEAPFVGNWTAVSEHTTALNIITENEAAIGHSLGGTTYYNTIEWEQTGQITGP
                     FHGTHRYLLQPTGKTNRFTVSTEFSASSRTSIKPFAAVKEASIHWWAQHWESGAFVDL
                     TESGSSDAEELQRRIILSQYLLAVNSAGKDPPQESGLQNNGWYGKFHLEMVFWHLGHW
                     ARWNKWDMLDRSLGVYSRFLPSSIERAKRQGYAGARLGKMSDPSGASAPGSQNALLIW
                     QQPHPMYFAELEYRSSPNVETLKKWDYILDELATWMVSYAWWNVSTQVYDLGPPMYPS
                     SENTSPNSTYNPTFELAYWRFGLKIASDWKTRQGILVPESWTRVLNNLAPLPIVDGAY
                     SICADLPDMWNKSSYTSDHPSQIAVYGLLLPTEGVDPSTVNATMDLIAQTWNFTASYG
                     WDFPMLAMTSLRLGNVDQAVEYLLHSNFQFDDVGNPVGTVVPTPYFPASSAFLLAVAM
                     MAGGWDGDEGIHFPKSWGAKVEGLSDHTLKRHNDNFILISIKTKDRKGLSISIECTSS
                     QSTICSSSSPGVSLAASSPRGTTRARMVLGIAVTRRRPMLSFIFACLWLSA"
     exon            complement(908216..908221)
                     /number=1
     exon            complement(908262..908383)
                     /number=2
     exon            complement(908443..908465)
                     /number=3
     exon            complement(908648..908751)
                     /number=4
     exon            complement(908790..910252)
                     /number=5
     exon            complement(910283..910739)
                     /number=6
     exon            complement(910772..910798)
                     /number=7
     CDS             complement(join(911819..911854,911928..912921,
                     912980..913509,913560..913732,913814..914363,
                     914446..915055,915112..915638,916132..916248))
                     /codon_start=1
                     /locus_tag="AO090102000337"
                     /note="multidrug/pheromone exporter, ABC superfamily"
                     /old_locus_tag="AO070322000082"
                     /protein_id="BAE61398.1"
                     /transl_table=1
                     /translation="MESSSSLPANHNVGGDNIDRPQQPQGDGGNRSSSLKSYIPVRKL
                     DETSVGTVTNAITGLSNTIQQSVSDRLAILFQSLALLVAAYAVAFRYSWALTLVVSSA
                     ILFVLVGLSITVPIIVKAQQMVDRADEKQAAVAAEVFSAIRTVLALGAEVPLSHKYSS
                     WVKEARKRAARTCPVTGIHLALLFFAMYSSYALAFWFGLKLYREGHIANVNTVIVVFF
                     SVLLVVTVLGGIASPLMAITKATSASGPFFDVIDADRVSTTGLGSSEASSQEDIFFDS
                     VSFAYPTRPDTQVLRDFTAHFQRGNTTALVGPSGSGKSTVVALIERWYQLRNTSLSEE
                     SPTAQGRIHVGKHNINDLDIKWWRSQIGLVEQEPVLFNESVYTNVAFGLIGTPWEHEP
                     EPVKMDLVVTACRDAFANEFIDRLPLGGITLSGGQRQRLAIARSIVSNPSILILDEAT
                     SSIDIRGEKVVQAALDRVSRDRTTIMIAHRLSTVIRADHIIVIKDGSKSEEGTHQTLM
                     DRRGVYYSLVHAQQLEVVSMDATTAIEQLSHSLPEETKLEAYAADGYEVTDSEEVVRK
                     KGERGAIRTLWHIIREQKTHWPIFALTVIGTMGAGSAFAFQSWLFAKLVQVFQFTGNK
                     LAEAANFWSLMFFILALAMGLFYFDVGYASTSFSMHIAANYRQDYFQSILHKPVSYYD
                     QEENSSGTLMARLSTDPKQLQELFGVNGVFPLISIFSLVGCVAISFSFGWKLAAVAFF
                     AALPFILLASYFRIQYEVQFEGMNAEVYAESSKFATEAIRAFRTVTALTMEDTILQRY
                     SNLLCQQRVRAIRKAWLATVVVAFSDSIDLCAMALTFWYGGQLLASREYDPVAFFVVY
                     IAIIQGGQSAGQFLSFGPNMAQTTASARRILETRSAFNERDNDRTHFEQLTAGITPFH
                     QADVCCRDLTFQYPSRGGPVFTGMNFSIRSGQYVAIVGPSGCGKSTIVSLLERFYDPT
                     KGSIEFAGRDIRFYPLASYRRALSLVSQEPKLFEGTIRENLLLGLEPGDDGELEPSRE
                     ARMIEACKDAELHDFTTSLPEGYSTSLGINAQLSLSGGQKQRLCIARALIRRPRLLLL
                     DEATSSLDSQSERLIQKALERLAARKTMTIIAVAHRLATIQKADLILVCGEGEPGRGS
                     VIIERGTHTELLQRQGVYWQMCQVQSLDSHTY"
     exon            complement(911819..911854)
                     /number=1
     exon            complement(911928..912921)
                     /number=2
     exon            complement(912980..913509)
                     /number=3
     exon            complement(913560..913732)
                     /number=4
     exon            complement(913814..914363)
                     /number=5
     exon            complement(914446..915055)
                     /number=6
     exon            complement(915112..915638)
                     /number=7
     exon            complement(916132..916248)
                     /number=8
     CDS             join(916870..916933,918829..922143,923944..923981)
                     /codon_start=1
                     /locus_tag="AO090102000338"
                     /note="non-ribosomal peptide synthetase modules and
                     related proteins"
                     /old_locus_tag="AO070322000081"
                     /protein_id="BAE61399.1"
                     /transl_table=1
                     /translation="MKVSIVRDQSSSSSTWVYRLGDRQSLSAWNLPIPSVAKSTVPEL
                     IHEMALKQPQAAAICSWGGNLTYDQLNRLSHALMTRLKKHGVAPGVFVPLCLEKSMWM
                     GLAMIAVMKAGGAFALLDPSYPLSRLRQMCEAVKSSLVVSTNQTHSLASQLGLGVLVI
                     DEEDPHLLLQRVRTCDVTGPIARCSAQNPMYATFTSGSTGAPKGVVVEQGGYTTSATA
                     HAEQYNFTSHSRVLQFASPGFDSCIIEHISTLIKGGCVCVPDVDECRSRLAQTINKYS
                     VNNVCLTPSVARILSPADLPILQDLAFVGEAVLNGDIARWKPFVHVRNAYGPAECSAV
                     FSVQPTLTEHDPKNIGLPTGGVGWVVHPEDPQILMPVGSTGELLIEGPIVGPGYLSNP
                     VLTAQSFIHPPKWRGQFGEVHGRMYKTGDLVQNTNTGSFRCLGRKDTQVKLHGQRIEL
                     GEIEHLLQSIAFTDAPQVVVDIVQHDNVHPPVNTLTAFICWPATSDGTYDQEPDGGAF
                     LAPNDIFRHSCTVAESRLSSLLPSFMIPNLFLPVRRMPLTPSGKLDRRQLRTHAGTLS
                     AETVKSYRVAPCSPQPPSTPEEVLLQSIWAQVLNKNANEVGITESFFNLGGDSVSAMQ
                     VGANCQAAGYRVSVADIFQFPTIAQLAHNMKPVSSYHPCVTKEYPEDTWFRLSPIQQL
                     FFELCPNGHNRFTQQFLLRLSRRQDNARIWKAMEAIVRRHSMLRAQFHRPPTGPWVQR
                     IRKYGPDCFVIREHTLQRLDTRIHEILVDSQGLLDIRTGILLVVDIITTATGDQYISL
                     MAHHLVIDLVSWRVLLQDLEDFLATGTLAGLAPLSFQQWCHLQEEYVAEFLEPRKALP
                     GEVPPAPLSYWGGQTLVDRNIWAEAKQYSVAVSEQVTQAILGHANNAFRTRPVELIHA
                     ALLYSFLQVFHDRQPPTIFTEGHGREPWDLHIDLSRTVGWFTTLAPVWAPVSKEEDMS
                     TFVLRAKEARRAIPANGWTYFSSRFLHPQGRHYHQGQSPMEILFNYTGLFQQLERRDA
                     LLELAAIPDHGIIEMPEDMPRFALIDVSAVVMNGQLNISFMYNRHMRHQARLEKWFHE
                     CERAFEDLPKALRGHRQLAPSDFPLLSLGNHGEFEKLITNSFSLVQGSHP"
     exon            916870..916933
                     /number=1
     exon            918829..922143
                     /number=2
     exon            923944..923981
                     /number=3
     CDS             join(934844..935123,935173..936302)
                     /codon_start=1
                     /locus_tag="AO090102000339"
                     /note="fatty acid desaturase"
                     /old_locus_tag="AO070322000079"
                     /protein_id="BAE61400.1"
                     /transl_table=1
                     /translation="MALDAKSPTVATLNDGTTDYVPMRKKYTSNQPHITEQPITWGNW
                     YKHVNWLNCFFILFIPFLGCLGAYWTPLHLYTGIFAVVYYFNAGLGITAGYHRCWAHR
                     CYKATLPLRIYLAAAGAGAGQGSIRWWSRGHRSHHRYTDTEKDPYSVQKGFWYSHIGW
                     MVLKQNPKRIGRTDVTDLDADPVVVWQHTNYIKSALFMCLVFPTLVCGLGWGDWLGGF
                     VYAGILRVFFIQQATFCVNSLAHWIGEQPFDDRNSPRDHVITAFVTLGEGYHNFHHEF
                     PSDYRNAIEWWQYDPTKWSIWIWKQLGLAYDLKQFRQNEIEKGRIQQLQKKLDQKRST
                     LDWGIPLDQLPVMDWDEFVAEAKNGRALVTIGGVIHDITSFIKEHPGGKAFISSAVGK
                     DATAIFNGGVYNHSNAAHNLLSTMRVAVLRGGCEVEIWKRSLPEGKMPMLMDSTGRRI
                     VRAGDQVTRMVQPVPMVSA"
     exon            934844..935123
                     /number=1
     exon            935173..936302
                     /number=2
     CDS             join(937533..937612,937653..937941)
                     /codon_start=1
                     /locus_tag="AO090102000340"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000078"
                     /protein_id="BAE61401.1"
                     /transl_table=1
                     /translation="MKLSTLTGVSLMSVSAGWLWFLQRLLEDQGKRKSACDFDGSASI
                     QSPKDLSGTCKSLVSQAGSAGTGKVTSHPTGGGSAASTSTSEGASSGIVSPVAVRVSG
                     WFGVAYFVAAAVAGFLMVSL"
     exon            937533..937612
                     /number=1
     exon            937653..937941
                     /number=2
     tRNA            940108..940179
                     /locus_tag="AO090102t00008"
                     /note="tRNAscan-SE"
                     /product="tRNA-Glu"
     tRNA            940689..940760
                     /locus_tag="AO090102t00009"
                     /note="tRNAscan-SE"
                     /product="tRNA-Ala"
     CDS             complement(join(941375..941719,941770..942223,
                     942283..942686,943073..943138))
                     /codon_start=1
                     /locus_tag="AO090102000341"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000077"
                     /protein_id="BAE61402.1"
                     /transl_table=1
                     /translation="MSLLGLACVPQLGTNANKPYGLDNFCIMTVKAYHTPADDFSRYG
                     GATAHLPKLEVNGLQHAGPPPGPGAKYTPPQPGPAQPWYNPRGWSLRTKLIAGVVGVA
                     VVVAVIVGAVEGTKANRYPDYTKLNYQLVDTYSGTNFLDRFDYYHGEDPTEGFVQYVD
                     QAAANALNLTYATDSSVVLRVDTSNKNAVKGRQSVRLESKTGYDNGLFVFDILHTPYG
                     CGTWPALWLTDTYNWPDNGEIDVLETTNNAPEGNAVTLHTTRGCNMNVRRKQTGDTVY
                     TTCDNSTNGNAGCGVQGSPDSYGEPFNNNGGGVYALELRDAGIRAWMFPRDSIPDDIT
                     NSSSSPDPSTWGTALADFPNTDCDIPSHFRNQSIIANIDLCGTLGAQKQFYTEQSHCP
                     GTCNNFVATNPSAFTEAYWEFKSFKVYQAR"
     exon            complement(941375..941719)
                     /number=1
     exon            complement(941770..942223)
                     /number=2
     exon            complement(942283..942686)
                     /number=3
     exon            complement(943073..943138)
                     /number=4
     CDS             complement(join(943478..943551,943621..943695,
                     943776..943923,943984..944253))
                     /codon_start=1
                     /locus_tag="AO090102000342"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000076"
                     /protein_id="BAE61403.1"
                     /transl_table=1
                     /translation="MILYRYYPAPPPDPIRKATHHINSLSLSPRIPIPKRKPHPPKPV
                     QSNPKTQSKMRIISIGLLLLASAFTAQACTYCQCEFEDGSHCCVYSDATQGNLDCPSV
                     CKNAHRADGKTSDDGMPGTACNAGGKYKCASAFTALDRFDGVAMDFLHICGTKHLEIL
                     VLCLNLYEGNSMLKFQNRRFNDMVMPIE"
     exon            complement(943478..943551)
                     /number=1
     exon            complement(943621..943695)
                     /number=2
     exon            complement(943776..943923)
                     /number=3
     exon            complement(943984..944253)
                     /number=4
     CDS             complement(join(946534..946555,946737..949051))
                     /codon_start=1
                     /locus_tag="AO090102000343"
                     /note="Na+/K+ transporter"
                     /old_locus_tag="AO070322000075"
                     /protein_id="BAE61404.1"
                     /transl_table=1
                     /translation="MFSSFIRGVSSLKSQVPLLKNLHLNYILIHYTYIIAMSIITSII
                     IYPGNDLAYIDALFFAAGAATQSGLNTVDFNLLRTYQQVILYWVSMLTTPIFINTVLV
                     FVRLYWFEKRFQHVVRDARALRQTRSRMRTISEDKDNQTHDREEAGVGGRAIVVLRNN
                     QGDAPGREQQDAIYKTPSDSESGPSSSAARDESGNTSEQETDPNNNLKRGFGSLRVPA
                     QLSPEQHIAFLENQRKPKGALRIPSPREYDRGGVPEALEEGEGEGAEAARQTSNLSDE
                     PPSPRHVEEDDQVGPMEGPHITINEPDMIRTRTRNSTFPRLDTRPTVRETRDFGDPSP
                     LARTTTRRPTFTGVFRSLTQERDRNTLPYLSWNATVGRNSQFVDLTEEQRDELGGIEY
                     RALKTLAVVLISYYVFFHLLGVVCLVPWIMTTRWGAVVTNIGQGRPWWAIFTAASSFN
                     DVGFSITPDSMSSFQEAVFPLLLLAFLIIIGNTGFPCMLRLIIWLLSKFARKESPLWE
                     ELRFLLDHPRRCFTLLFPRNATWWLFAILVALNGIDLIFFIILDLKDSAVTSLSTGIK
                     ILDGLYQAACTRTAGFSVVSISELHPAVQVSYMIMMYISVFPIAISLRRTNVYEEQSL
                     GVYPAEEDDNEDNQTAPSYIGAHLRRQLSFDLWYVFLGLFIITIVEGGRLQRQDDYSF
                     QIWSVLFEVVSAYGTVGLSMGYPGVNASFASQFQTLSKLVIIAMQVRGRHRGLPYSLD
                     RAILLPSEALNHHEIADAERRMRRRASSLSQISSLALS"
     exon            complement(946534..946555)
                     /number=1
     exon            complement(946737..949051)
                     /number=2
     CDS             complement(950941..951768)
                     /codon_start=1
                     /locus_tag="AO090102000344"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000074"
                     /protein_id="BAE61405.1"
                     /transl_table=1
                     /translation="MKSIIWFSLFTAAFSITNPHLPQHSNMSSENDTLSEGQYYRGGA
                     DDLRSPCPIINSLANHGYIARDGRNITGIQLKAALEHIGLGFDTAGGLVKIAFQDHVD
                     PPEGTPRTTANFGLRDAGQVNEDGDPVLNLDQLGRPHAIEHDVSVTRQDRALGDYIHL
                     NPDLYQQLLASSSNGTSFSISDIGNLRKKRFEQSKRDNPELDLDKRMHYIACAEVGGI
                     MGVFGKGLYHVPKEYIEAIFGEERLPFDEGWRPRWTKLYLPEAGAVTLAISHYAWPF"
     exon            complement(950941..951768)
                     /number=1
     CDS             complement(join(952068..952904,952970..953260))
                     /codon_start=1
                     /locus_tag="AO090102000345"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000073"
                     /protein_id="BAE61406.1"
                     /transl_table=1
                     /translation="MTHRQTSGFAAETNGHVRLKLYPPLTHDLSITTSQTHKIVTMAP
                     LTAAEIVKHPVYDSVAWNLPPTTSGTCPVAQNRRGGPLNLYYEIHGTGPAKLVWIMGL
                     NASHDDWKRQTKYFGHQNASKYTCLVFDNRGVGRSDKPVNYYSTSEMAQDAVDLLSHL
                     GWIDLSAPATRSIHVIGASMGGMISQEVGMLIPDRLASLTLCCTAPRLVRTAPFLENL
                     RERASMFIPRHVDVELARLGHTLFGGDFLDQPDTEYEDPKKNFPTRRERFAAGQLKKR
                     EDPDSFTKKGFLMQIVACYFHHKSPEQLKTLGDAVGRERIAVLHGTEDRMLTFRHGEI
                     LHEEIGKGILWKVYEGSGHVLMWENEDEVNQLLEELVDRTS"
     exon            complement(952068..952904)
                     /number=1
     exon            complement(952970..953260)
                     /number=2
     CDS             complement(955159..955797)
                     /codon_start=1
                     /locus_tag="AO090102000346"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000072"
                     /protein_id="BAE61407.1"
                     /transl_table=1
                     /translation="MYRSLMLIALYISALAAAAPNPPSNEPDNQPPNQPVVGIRPPNQ
                     PVVGLPDNHPLDQPGAGSRPPNQPVVGLPDNHPLNQPGAGSRPPNQPANPLADQQDLS
                     PARLATRNLHNNCQNIRIENPPPPLQNMDTANAQPRYATELTASPESEYWSDASTLRG
                     SERRANLPRAPKPLLVGNCKKRDGQSRETKLSLDYCLGWREENGGTLVAESR"
     exon            complement(955159..955797)
                     /number=1
     CDS             join(956430..956509,956571..957013,957115..957452)
                     /codon_start=1
                     /locus_tag="AO090102000347"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000071"
                     /protein_id="BAE61408.1"
                     /transl_table=1
                     /translation="MDENHQKACTYIREAASQGAHLAVLPEYHLNAFPPTNPLYLPQT
                     NSQITTKYLQSYQSLAKELNICIVPGTIVENHTPTSENTNTNTDTQPKDPILYNTAYF
                     ISNDGTILSSYRKKNIWHPERPYLTSSGSDPHEVFDTPIGKVGLLICWDLAFPEAFRE
                     LIAAGAEVVVVPTFWTQYDASPALRAKNPDCEKLFLESVLTARCFENTCGVVFANAAG
                     ENEGDGFLGLSRVTMPGVGVVGSLGWEEGVCVVDLDIGLIRDAEENYRVREDLGREGW
                     YYSYRHQGRE"
     exon            956430..956509
                     /number=1
     exon            956571..957013
                     /number=2
     exon            957115..957452
                     /number=3
     CDS             complement(join(957810..957978,958030..958114,
                     958164..958425,958485..959120))
                     /codon_start=1
                     /locus_tag="AO090102000348"
                     /note="vacuolar sorting protein VPS1, dynamin, and
                     related proteins"
                     /old_locus_tag="AO070322000070"
                     /protein_id="BAE61409.1"
                     /transl_table=1
                     /translation="MMHIKQTLPDIKARISSSLQKYTAELSQLGDSMLGNSANIILNI
                     ITEFSNEYRTVLEGNNQELSSIELSGGARISFVFHELYSNGIKAVDPFDQVKDIDIRT
                     ILYNSSGSSPALFVGTTAFELIVKQQIKRLEDPSTKCISLVYDELVRILSQLLNKQLF
                     RRYPMLKEKFHAVVISFFKKCMEPTNKLVRDLINMEACYINTGHPDFLNGHRAMTIVN
                     ERQAGSKPTQVDPKTGKPLPPRANSPSVDLGNTESGSGSGFFGSFWASKNKKKMAAME
                     APPPTLKASASLSERESTEVEVIKLLITSYFNIVKRTMIDMVPKAIMYMLVQFTKDEM
                     QRELLENMYRNNELDELLKESDYTVRRRKECQQMVESLSRASEIVSQVQ"
     exon            complement(957810..957978)
                     /number=1
     exon            complement(958030..958114)
                     /number=2
     exon            complement(958164..958425)
                     /number=3
     exon            complement(958485..959120)
                     /number=4
     CDS             complement(join(960947..961003,961059..961955,
                     962024..962691,962758..962842,962956..963069))
                     /codon_start=1
                     /locus_tag="AO090102000349"
                     /note="vacuolar H+-ATPase V1 sector, subunit A"
                     /old_locus_tag="AO070322000069"
                     /protein_id="BAE61410.1"
                     /transl_table=1
                     /translation="MAPSGKGSQDEAHHGAVFSVSGPVVVAENMIGCAMYELCRVGKD
                     QLVGEVIRLDGDKATIQVYEETDGVTVGDPVERTGKPLAVELGPGLMETIYDGIQRPL
                     KAIFHQSKGIYIPRGITVNALDREKKWDFTPGQYKVGDHITGGDVWGSVFENSLLNDH
                     KILLPPRARGTITRIAEAGSYTVEEKLLEIEFNGKKSEFGMMQTWPVRVPRPVNDKVP
                     SDAPFIVGQRVLDSLFPSVQGGTVCIPGAFGCGKTVISQSVSKFSNSDIIVYVGCGER
                     GNEMAEVLMDFPELSIEIDGRKEPIMKRTCLIANTSNMPVAAREASIYTGITIAEYFR
                     DQGKNVAMMADSSSRWAEALRELSGRLGEMPADQGFPAYLGAKLASFYERAGKSVALG
                     SPERIGSVSIVGAVSPPGGDFSDPVTTSTLGIVQVFWGLDKKLAQRKHFPSINTSMSY
                     SKYTTVLDKFYEKNYPEFPRLRDQIRELLTKSEELDQVVQLVGKAALGDSDKIALDVA
                     AMVKDDFLQQNGYSDYDQFCPLWKTEYMMKAFMGYHDEAQKAIAQGQNWAKVREATAD
                     IQTALRNMKFEVPENQQEVSEKYEKVLQTMSERFASVSDE"
     exon            complement(960947..961003)
                     /number=1
     exon            complement(961059..961955)
                     /number=2
     exon            complement(962024..962691)
                     /number=3
     exon            complement(962758..962842)
                     /number=4
     exon            complement(962956..963069)
                     /number=5
     CDS             join(964218..964595,964654..964682,964735..965461,
                     965639..965854)
                     /codon_start=1
                     /locus_tag="AO090102000350"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000068"
                     /protein_id="BAE61411.1"
                     /transl_table=1
                     /translation="MAQQRSTNAKICKCWGYTFEWIDGLHSSVEQLHSIMLNYDKLVD
                     ECLDRLDEISPPGSARTESTGSTDIKTPKRDLYSLLEKHAKDDPKLDELWSEINTVPD
                     WVDWEQIKRGQEVFFRYGTPILNVLGFQSLLGGMGSPRVVETLARTGGFSADVVRRRL
                     LETLQHILQVSLSLDSIKPGGKGHVSSVRVRLLHASVRRRVLSLVKNRPEYYDIKKYG
                     IPINDLDCIATIHTFSTSVVFLGLPRQGIFLRNQEIEDYIALWRLVAFYMGTPTDCFE
                     TTAQARAMMESLSVSEIDPTDTGRILAQNIILGLEYTAPTYASKEYLEAMARKLNGDE
                     LSDSLNLPRPSLYYQALVYGQCILVMAACYGLRVFPMLDQAIIEPHNTFRETQGVPTS
                     MVRCRDSGTARSSHCVPCWSGPVLRVYLWNQTASPNCCSGCIRPRCLLKETIWPSFV"
     exon            964218..964595
                     /number=1
     exon            964654..964682
                     /number=2
     exon            964735..965461
                     /number=3
     exon            965639..965854
                     /number=4
     CDS             join(966222..966453,966507..966909,966940..967308,
                     967366..967546,967598..967690)
                     /codon_start=1
                     /locus_tag="AO090102000351"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000067"
                     /protein_id="BAE61412.1"
                     /transl_table=1
                     /translation="MADGGIVVPLVGALQACVSVLLTMSYGVAAQRLRLIQESSINDM
                     AGLGVKLFLPALIIINLGEQLQLGNALNYIPVLIWSILYTCASVGLAYFVSKGLKLPP
                     WVTPACAFNNTTSLPLLLLQSLESVGSLKPIIKDGDTESKAISRAQSYFLLCAVVSKT
                     IGYAVGPKLLQDGNESTNTEDQEADGTDPETQNGTTEHGQVDEETSLLPQRAIRHGAQ
                     RISSMLPKRIRQRLMAPFESPFADVAIGCTIIGVILGLVPQLHKAFFNKYEDGGIFNA
                     WLTSSVKNIGKLFTTLQIFVVGCKLGVSFEKMKTSGDSGRMPLKAIGTIFLVRLVIWP
                     ALSISIVYGLAKKTNIVLTDPILWFSLMLMPAGPPALVISGLAELARISELEKMAIAK
                     SLTAMYVLSPFICFSITGALKASQAALEQRNST"
     exon            966222..966453
                     /number=1
     exon            966507..966909
                     /number=2
     exon            966940..967308
                     /number=3
     exon            967366..967546
                     /number=4
     exon            967598..967690
                     /number=5
     CDS             join(968229..968233,968909..968996,970256..971271,
                     971333..971427,971492..971895,971948..972428,
                     972483..972630,972682..972793)
                     /codon_start=1
                     /locus_tag="AO090102000352"
                     /note="WD40 repeat-containing protein"
                     /old_locus_tag="AO070322000066"
                     /protein_id="BAE61413.1"
                     /transl_table=1
                     /translation="MRISFFFLFSILPLHVWPQTSLRGSGAGDALSQVKGQIYQAFDL
                     ADHPFTYIPSSTAPDRPDPPIPIEPTSSYPRSAAASDNILSSSRSDPSVDSSYPAVGA
                     SGNFYLSSTRRRRRPSTPGVSESNIDGTGGLTGDHTASEAGISEQRVVYANTAEGHSP
                     SPKRRRLTNMRPDGVSSANGPSHVSNGSVASPSHKVGLSHSLNGQASHASSNGDLQTN
                     GVQKSSAVPPSYFGHDREEVTRILIQSLYELGYNGAASLLSKESGYQLESPAVAAFRG
                     AVLAGRWAEAERILVQSFYPDGTRRTTSGDGDLPTKERLVLVESADMNEMLFYLRQQK
                     FLELLEARNLSAALTVLRHELTPLNYDIGRLHALSSLLMCPPEHLHDQAGWDGSITSS
                     RERLLSELSKSISPSVMIPDNRLAILLDHVKQNQINQCLYHNTATPPSLYSDHMCDRA
                     DFPSRPGIELSQHSDEVWYCQFSHDGTKLVTAGRDHSVIIYDTSTFAVLHKLMEHDDG
                     VAHACWSPDDSKLITCSQDKKARVWSVDTGRCLLTINHHRQPVTAAAWAADGDSFVTA
                     SLDKDSHLCHWSMRGHALHMWQGDFRVQDCAITPDGRRLIAADVEEKIHVYDFLTHEE
                     EYCLALKSKPTSVAVSKDSRHMLVNLSEGQIQLIDIDTTDVIRRFQGQKQGSFVIRSA
                     FGGAAENFVVSGSEDSRVYVWHKENGTLVETLEGHIAGCVNAISWNPTNPGLFASAGD
                     DCLVRIWTRERDANSHTTARTQRPTSASGFARTSALRSTMSF"
     exon            968229..968233
                     /number=1
     exon            968909..968996
                     /number=2
     exon            970256..971271
                     /number=3
     exon            971333..971427
                     /number=4
     exon            971492..971895
                     /number=5
     exon            971948..972428
                     /number=6
     exon            972483..972630
                     /number=7
     exon            972682..972793
                     /number=8
     CDS             complement(join(973972..973991,974052..975228))
                     /codon_start=1
                     /locus_tag="AO090102000353"
                     /note="predicted ATP-dependent RNA helicase FAL1,
                     involved in rRNA maturation, DEAD-box superfamily"
                     /old_locus_tag="AO070322000065"
                     /protein_id="BAE61414.1"
                     /transl_table=1
                     /translation="MYTDKGANSDRMEFNTSKEVTVAPTFEDMHLKESLLRGIYAYGY
                     ESPSAVQSRAIVQICKGRDTIAQAQSGTGKTATFSISILQVIDTVVRESQALVLSPTR
                     ELATQIQSVIMALGDYMNVQCHACIGGTNIGEDIRKLDYGQHVVSGTPGRVADMIRRR
                     HLRTRHIKMLVLDEADELLNRGFREQIYDVYRYLPPATQVVVVSATLPYDVLDMTTKF
                     MTDPVRVLVKRDELTLEGIKQYFIAVEKEEWKFDTLCDLYDTLTITQAVIFCNTRRKV
                     DWLTDKMREANFTVSSMHGEMPQKERDSIMQDFRQGNSRVLISTDVWARGIDVQQVSL
                     VINYDLPTNRENYIHRIGRSGRFGRKGVAINFVTSDDVRILRDIELYYSTQIDEMPMN
                     VADLLS"
     exon            complement(973972..973991)
                     /number=1
     exon            complement(974052..975228)
                     /number=2
     CDS             join(975548..975637,975696..977083,977136..977160)
                     /codon_start=1
                     /locus_tag="AO090102000354"
                     /note="splicing factor 3a, subunit 3"
                     /old_locus_tag="AO070322000064"
                     /protein_id="BAE61415.1"
                     /transl_table=1
                     /translation="MLLEDQRFIHEDLERLEQAIADRVADEPRNIKDRLARDHEIAQF
                     LDRIDEQSKRLLDIYKDADGAREKEIQAISTGDQFEEFYTQLNEIKDFHKRYPNEPVE
                     NLERAYKRHEGEPIGMDIDNLFTGEEGFGQFLDLTKAHEDYLNLPGVKRLTYVQYLEV
                     FDAFTPPQMLIKRPNKLSDRYFQYVGELAAYLEGFIKKTRPLQDSDKLFGSFDEEFEK
                     QWAANEVPGWSEETAQNGAQGPQTEGSGEGIWCAACEKEFKNENVYKNHLTGKKHIRA
                     AEAKKASGDSGEKSAAANGVSAVASRLKERAVAEREHRVRSLAKVLDAERQATRTNVE
                     RKQGMTERERQMELEALLAESENAGGDRAGDQSDDDGDDRIYNPLKLPLAWDGKPIPY
                     WLYKLHGLGVEYPCEICGNFVYMGRRAFDKHFSEGLHIWGLKCLGITSNTNLFREITR
                     IEDALRLWEKLEHDRKKDKDSRDNVVQMEDAEGNVMPERIYLDLQKQGIL"
     exon            975548..975637
                     /number=1
     exon            975696..977083
                     /number=2
     exon            977136..977160
                     /number=3
     CDS             join(977832..978799,978860..979820,979886..979903)
                     /codon_start=1
                     /locus_tag="AO090102000355"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000063"
                     /protein_id="BAE61416.1"
                     /transl_table=1
                     /translation="MFPEKRTDRVYWLQDTSLARVIGRCLLLGSSRREELERWRVSGG
                     IDLARCVENVMRQAENHIREGQEVTVEEIDDALNRVASRCRFSGPRVRRQRAAVDVDE
                     TLSPLYRRLSSRDAKWLTRMILKNYSPVTLPRNLTLKSFHFLLPHFLLFQDDFEATLN
                     MLVSEPISHFPPHPEPGLARDLGMIAMQHLSPVVGIKIGRPDYYKARSIKHCCQMIGR
                     RRMSIERKYDGEYCQIHVDLSKPSRSIQIFSKSGKDSTADRSGVHHVVRDSLRIGRPG
                     CKFSRRCILEGELLVWSDRHGKIMDFHKLRKFIARSGTFIGTENDSPPQPYEHLMIVF
                     FDILLLDDDVCLKKPHRERRLLLKDVVHVIEGRADISEQRIIDFSRSGSQSHLENIFA
                     KGVAQRWEGFVLKGCEDPYFTIFPSQANGSMGRWIKLKKDYIPGLGDTVDLAIIGGKY
                     DSRDAGGLKQIQRLLWTHFFIGCLLNKEDVLQSRSKPKFRVVDVINRHCMSPKNMQIL
                     NQFGEYTACGIDSGHGFDIEYGTGNIPGLGVVFRTPFVVEMLGSGFEKPSGSRYYTLR
                     FPRIMKIHWDRSFEDAASFSELQLLADDARAVPSEELAQEETEWNKRLKLGNGSSEYI
                     VDRSQSLTSSSGVTQSPVKLRENM"
     exon            977832..978799
                     /number=1
     exon            978860..979820
                     /number=2
     exon            979886..979903
                     /number=3
     CDS             979965..980780
                     /codon_start=1
                     /locus_tag="AO090102000356"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000062"
                     /protein_id="BAE61417.1"
                     /transl_table=1
                     /translation="MSPSDDSDMHGNFLTSNKNLSSHQGSRQQKNNSSTTNSTRSKQS
                     KSTEFENSDITIHSDTTSTLTNSSTQDPKVIEKQTNPQKTTKSPLTTLPIYFIHNNLS
                     NPEQPISTLPLTVTPNLNILIKSLLSRSLKTQPRTTSALVILLLNPTQTPLGQALLDL
                     ATNLHKRLQAPSHHPGHLQTGSIFLLDSSLLDLGTDVTDPSSCVRMTWGDIGKKYFYA
                     CVSWRLKGGVETVPCTPLDGVPKGVVDQGVRVSVVFDRRVMGVLESVGGLGDE"
     exon            979965..980780
                     /number=1
     CDS             complement(join(981109..982145,982198..982381,
                     982439..983156,983221..983324))
                     /codon_start=1
                     /locus_tag="AO090102000357"
                     /note="anaphase-promoting complex (APC), Cdc23 subunit"
                     /old_locus_tag="AO070322000061"
                     /protein_id="BAE61418.1"
                     /transl_table=1
                     /translation="MAAQFTEENVQELKFRLEDATIKCSERCLYQSAKWAAEMLDAIV
                     PIDQYDTDPESPMDIPDTPSTRPNPYLRTQDPVEASLEAQESYKYLLAKSYFDTREYD
                     RCAAVFLPPTIPPVALSTSSPNQKKRQSLTPQKGKSKSSQYAGGKDSNVSRNPYPRLS
                     QKSLFLALYSKYLAGEKRKDEETEMVLGPADGGATVNRELPDLARGLEGWLTERREKG
                     LEDRNQGWLEYLYGVILLKGRNEEEAKKWLIRSVHLNPFHWGAWQELNDLLSSTEDLK
                     QVVDLLPQNIMTLLFHVYCSQELYQATEDTYQALSELETIFPNSAFLMTQRALLYYHS
                     KDFEEASRIFTEILIASPHRLDSLDHYSNILYVMGARPQLAFVAQVATATDKFRPETC
                     CVIGNYYSLKSEHEKAVMYFRRALTLDRNFLSAWTLMGHEYIEMKNTHAAIESYRRAV
                     DVNRKDYRAWYGLGQAYEVLDMSFYALFYYQRAAALRPYDPKMWQAVGSCYAKMGRVP
                     QSIKALKRALVAGSYYAEDPSQLGGSGRKILDPETLHQIATLYERLGDDEEAAAYMEL
                     TLQQESGQMPVEEDASSDNENDDNQSEAGAQKSSRRARQSSTYNQNDDDDDSWHGTGP
                     TVTTSKARLWLARWALRNGDLERADQLAGELCQDGVEVEEAKALMRDVRARREGDE"
     exon            complement(981109..982145)
                     /number=1
     exon            complement(982198..982381)
                     /number=2
     exon            complement(982439..983156)
                     /number=3
     exon            complement(983221..983324)
                     /number=4
     CDS             join(983824..983940,984011..984934)
                     /codon_start=1
                     /locus_tag="AO090102000358"
                     /note="polyprenyl synthetase"
                     /old_locus_tag="AO070322000060"
                     /protein_id="BAE61419.1"
                     /transl_table=1
                     /translation="MPATDRAAFQEVFPSLAEDILAYAKESNLPENALQWFEKALNVN
                     VPGGKLNRGLSCPDTGLALLEKPLTEEQFKHLSILGWLTELLQAFFLVSDDIMDSSIT
                     RRGQPCWYRQEGVGLIAINDAFLLESSIYVILKKHFRSHPAYADFIDLFHETTWQTEL
                     GQLCDLITAPEDKVDLNNFSMEKYMFIVTYKTAYYSFYLPVALALLYLQRATPSNLRQ
                     AHDILIPLGQYFQVQDDYLDAYGDPEVIGKIGTDIKDNKCSWLVNQALQRCNAEQRKV
                     LDEAYGRKDDALEAKVKALYKELDLEKVYQEYEEKIVGELKEKIAAVDESGGLKKEVF
                     NAFLGKIYKRSK"
     exon            983824..983940
                     /number=1
     exon            984011..984934
                     /number=2
     CDS             join(986189..986590,986691..988130)
                     /codon_start=1
                     /locus_tag="AO090102000359"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000059"
                     /protein_id="BAE61420.1"
                     /transl_table=1
                     /translation="MIMLNVVLILLVLVIARVQADHGPYFQSAAYDEGKFGEWPTETY
                     RSSPIVGPALNYLQYSDECKDGLYTFIAPRGNKVANPGPMILDQDGHLVWTKRYGQSY
                     NLNVYTFKGQDYLTFWMGNDGVGGHGEGAYYMLDSSYREVYKINAANHLPGDLHEFHI
                     TQDDTALITIYDIIPADLTTVGGLEEGWIWDGTFQELDIETGKTLFQWRASEHFNFTD
                     MKRDREGNGDSDVHPWDFFHINSVEKDAKGNYLISSRYASCLTYIDGRTGDIIWRLGG
                     KNNDFTDLSDGAATNFSWQHHARFRDNGTAITIFDNASRGAGAPELPSRGLYLDIDQE
                     NMTVKVRHEYWNPDPISSQSQGSVQLLTSSNGNTKVLVGYGHIPTWTEYASDGTVLCN
                     THFGAASGDGNIMSYRVLKYPWVGHPTTSPDISAYNYTAAASWNGATEVVTWALEGAD
                     SPNPKTYTFIAAVPKSGFETVIPIPADTESTYIRAHGLNSTGHILGTTKLVRWDPDSN
                     EAVVGRHDEDDGDSPVHSLLFFFGGFASAVVLAFAGWFIYRRFKSRTGAQSTEDRERG
                     NWQPLDRFNGDEDLSDGEMDDVEFALLRGERSGSWPEEDDDDRCTGK"
     exon            986189..986590
                     /number=1
     exon            986691..988130
                     /number=2
     CDS             complement(join(988755..989426,989478..989627,
                     989683..989854,989951..989985))
                     /codon_start=1
                     /locus_tag="AO090102000360"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000058"
                     /protein_id="BAE61421.1"
                     /transl_table=1
                     /translation="MSTDKITFLTNWHATPYHAPLYLAQSKGYFKEEGLKVALLEPND
                     PSDVTEIIGSGKVDMGFKAMIHTLAAKARNFPVTSIGSLLDEPFTGVVYLKDSGITED
                     FRSLKGKKIGYVGEFGKIQIDELTKYYGMTADDYTAVRCGMNVTKAIIRGDIDAGIGL
                     ENVQMVELAEWLASQNRPRDDVQMLRIDQLAELGCCCFCSILYIANDAFLAANPEKVQ
                     KFMRAVKRATDYVLAEPAAAFEEYIDMKPIMGTPVNRKIFERSFAYFSRDLKNVSRDW
                     AKVTNYGKRLGILDADFQPNYTNQYLSWTLDADSTDPLGDQKRMAELQKEVACEGGFK
                     RLQVASSA"
     exon            complement(988755..989426)
                     /number=1
     exon            complement(989478..989627)
                     /number=2
     exon            complement(989683..989854)
                     /number=3
     exon            complement(989951..989985)
                     /number=4
     CDS             complement(join(991378..991498,991564..991759,
                     991838..993200,993258..993722))
                     /codon_start=1
                     /locus_tag="AO090102000361"
                     /note="glycogen synthase"
                     /old_locus_tag="AO070322000057"
                     /protein_id="BAE61422.1"
                     /transl_table=1
                     /translation="MASEETGAEPPKRDVRNHMLFEVATEVANRVGGIYSVLKSKAPV
                     TTAEYGERYTLIGPLNRASAAVEVEELTPSNPRMIETIKSMQERGIEVIYGRWLIEGA
                     PRVLLIDTSTGYKFLDEWKGDLWNTAGIPSPAADTETNEAIVFGYLVAWFLGEFIAHE
                     RRVAVVAHFHEWLAGVALPLTKKRHMDLTTIFTTHATLLGRYLCAGSVDFYNHLQHFD
                     VDAEAGKRGIYHRYCIERAAAHTADVFTTVSHITAFESEHLLKRKPDGVLPNGLNVKK
                     FSAVHEFQNLHSQSKEKINDFVRGHFYGHNDFDLDNTLYLFTAGRYEFRNKGVDMFIE
                     SLARLNHRLKASGSKTTVVAFIIMPAQTTSLTVEALKGQAVVKSLRDTIEMIEKGIGK
                     RMYERCLAWKEGDNMPDEKDLMASQDRVLLRRRLFAMKRHSLPPIVTHNMNNDHEDPI
                     LNQIRRVQLFNDPTDRVKIIFHPEFLNSSNPVLPLDYDDFVRGTHLGVFPSYYEPWGY
                     TPAECTVMGVPSITTNLSGFGCYMEELIENSSDYGIYIVDRRMKGVDDSVNQLTDFMF
                     NFALKSRRQRINQRNRTERLSDLLDWKRMGLEYVKARQLALRRAYPSSFGSGEDFYDI
                     IGGTEQKISRPLSVPGSPRDRSGMMTPGDFASLQEVKEGLSTEDYIAWRLPGATDEDE
                     PDDQYFPLTLRTKKTSDRPASPLDRISVNGGN"
     exon            complement(991378..991498)
                     /number=1
     exon            complement(991564..991759)
                     /number=2
     exon            complement(991838..993200)
                     /number=3
     exon            complement(993258..993722)
                     /number=4
     CDS             complement(995473..996459)
                     /codon_start=1
                     /locus_tag="AO090102000362"
                     /note="NADPH:quinone reductase and related Zn-dependent
                     oxidoreductases"
                     /old_locus_tag="AO070322000056"
                     /protein_id="BAE61423.1"
                     /transl_table=1
                     /translation="MSTMRAVVAHTAGSPDVLKVIQYPIPQPSSGQVRIKVKAFGLNR
                     SEMFTRQGHSGSAVQFPRILGIEAVGIVDAAPGLEDKFPLGATVATAMGGMGRAFDGG
                     YAEYTCVPAKQVQILKTKLPWDVLGALPEMLQTAWGSLIRTLTLRPKDRLLIRGGTSS
                     VGLAAAAIAKKHGAFVASTTRKTEREALLRDFGVDEVWIDNGAISQQIAETSGQYFDK
                     VLELVGTATLADSLRCVKKGGTVSMTGILGNVWHLENINPMELIPSESKLTAYSGGDE
                     DFMRTPLKELLKMVEEGKLQVRVGRLFKMEDIAEAHRCMEESEVERKIVVIP"
     exon            complement(995473..996459)
                     /number=1
     CDS             complement(join(998066..998258,998311..1001164,
                     1001213..1001432))
                     /codon_start=1
                     /locus_tag="AO090102000365"
                     /note="vacuolar sorting protein VPS45"
                     /old_locus_tag="AO070322000053"
                     /protein_id="BAE61424.1"
                     /transl_table=1
                     /translation="MSSASPRKSIDSLASGASTPSLSQYSFNQLESPRVPPQRYPLRR
                     GSTASSIASIGGILDSSNRHGSIAESGQNAISTLLQPPIVRTGLVPHTAVPSSGYKPP
                     SSRDIPPVTLTNIPRVDAKVFDPYLSQVGSLYDVFQQAKESAGDQESQLARDGGKASP
                     KPDDSEFLSSQWSTERRPSTLSLNSRASSPFDNRGRRRSSARGRGHGVTPLSTIPQIY
                     FDDDFHLENPRIFDVVSEKSEVVTPPKTPGKDGRFENGAVVGPAPTGRKALATNAILQ
                     EKLSWYMDTVEIHLISSISTASKSFFTALGSLRELHSEAADSVKRIQLLRKDLQKIDR
                     EMALGGLKIVNLRRRRENVRLLADAVSQLQEVVQSVSRCEELVENGDIEEAADSLEEV
                     ERLMAGETVFGSPAGVDSHEHPRKAIDLRRLKALEGASDDLAQLRTRIGMGYESRFLN
                     DLLGDLRQHVENVPLEVTLQRWGSSFQRQRGVQRSGVTVSPAYMTFDDQLRSRLHTQL
                     TGLARAHHTTAAATSFKTAVLREMKSLIRKHMPSSSDDDNESMVSVSTHRSSQLSQQE
                     KSSILARNLRALDAEDAYAMLARVYTGISESLRRLSVQVKVLLDLASGLGSNSVLKSP
                     RSPHSPNLDSAAGFGASSQTAATIMAQDEILQVLDMSSLLGQAVDIAQSQVNKVLKVR
                     SEQTSHLPKEEFLKYFTLNRLFADECEAISGRSGTALKTLVGNQIRDYIARFGDKQRH
                     SIVEVMDADRWDARDFGETENTILSRILDASTKDIEAWVDASKIWLSQDKPEGNTLEN
                     TTNGSGKDKVRSAVVDEQKYILSESAVAMMRSIEEFQFLMANIPSMIQDIAPGLLESL
                     KLFNSRSSQLILGAGATRSAGLKNITTKHLALSSQALSFIIALVPYIREFVRRHSPSS
                     PLMGEFDKVKRLYQEHQSGIHEKLVDIMSGRSSVHVNAMKKIDWDASGSSTVNPYMET
                     LAKETGTLHRVLSKHLPDMTVSMIMDPVFNSYREQWTKAFDEVTIHTENGKQRLQRDA
                     EFFQSKLSKIDGFGDLGERLLELVKQKTPTAEAKEKGSNGANPSSSSDTSNGEKSPQA
                     "
     exon            complement(998066..998258)
                     /number=1
     exon            complement(998311..1001164)
                     /number=2
     exon            complement(1001213..1001432)
                     /number=3
     CDS             join(1001965..1002101,1002155..1002281,1002343..1003745,
                     1003807..1004299)
                     /codon_start=1
                     /locus_tag="AO090102000366"
                     /note="DNA replication licensing factor, MCM5 component"
                     /old_locus_tag="AO070322000052"
                     /protein_id="BAE61425.1"
                     /transl_table=1
                     /translation="MDRRTPYTLSVLAPSTDGAEESRTQIQQRLRDFVLEFQLDNAFI
                     YRDQLRQNVLVKQYYCDIDIAHLVSYNEELAYKLTTEPADIIPLFENALQQCTQRIVY
                     PSQRDVVLPSHQLLLHSSAAHISIRDLNATNISHLVRIPGIVIGASTISSKATVVHIR
                     CKNCDHSENIRVEGGFSGLSLPRRCGRQQQPGDAPGEQCPLDPYVVSHEKCQFVDQQV
                     LKLQEAPDQVPVGELPRHVLVSADRYLANRVVPGSRCTVMGIFSIYQSKGAKKDGAPA
                     IRNPYMRAVGISTDLDQTVKGSAIFSEEEEQEFLELSRRPDLYDALARSIAPSIYGNF
                     DIKKAIVCLLMGGSKKILPDGMKLRGDINVMLLGDPGTAKSQLLKFTEKVSPIAIYTS
                     GKGSSAAGLTASVQRDQATREFYLEGGAMVLADGGVVCIDEFDKMRDEDRVAIHEAME
                     QQTISIAKAGITTILNSRTSVLAAANPIFGRYDDLKTPGENIDFQTTILSRFDMIFIV
                     RDDHDRNRDENIARHVMGVHMGGRGIEEQVEAEIPLDKMKRYISYCRTRCAPRLSPEA
                     AEKLSSHFVSIRKQVHRAELDANARSSIPITVRQLEAIVRITESLAKLSLSPIATEAH
                     VDEAIRLFLASTMDAITQGEGQGSKEMMEEVSKIEDELKRRLPIGWSTSLATLRREFV
                     DGRGYTEQALNRALMVLQRRDTVRIRSGGSQVYRHGV"
     exon            1001965..1002101
                     /number=1
     exon            1002155..1002281
                     /number=2
     exon            1002343..1003745
                     /number=3
     exon            1003807..1004299
                     /number=4
     CDS             complement(1004609..1005739)
                     /codon_start=1
                     /locus_tag="AO090102000367"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000051"
                     /protein_id="BAE61426.1"
                     /transl_table=1
                     /translation="MSGILLSSHRSSATGVLQNIQLTPHFSGIRKKHKTSVKAKMLSL
                     EVLRNFLREYLVIDHPVAVSDIQHREQDQTHTPDTPGNPTTAAVTAVTIEYEPLESAT
                     NKRKSPPTSPLTATQQKRLKKELKLEDKRRRTAGHRVFHHELEDGFYGDLISLHYEDA
                     IATAQHAHTLPLTEGKYHFHNFWVDASGSQGSAGAAIAYKDPYYGEEWMDWGYAISDL
                     KGKTRVDMSELFAIGAALRLALARIGKRVAVAEGAEEHAVTVFSDSMRALGVIRRWAN
                     LWSEGEIDRSALGTLAGDVCGLSRQLFGLGVKVRVYWVPAHCEVCIVGHKRADVLSRA
                     AARHVKPLVQRDEKYSADGVVQLVDSTSLKTLHLLADECDPL"
     exon            complement(1004609..1005739)
                     /number=1
     CDS             1007785..1008930
                     /codon_start=1
                     /locus_tag="AO090102000368"
                     /note="sugar kinases, ribokinase family"
                     /old_locus_tag="AO070322000050"
                     /protein_id="BAE61427.1"
                     /transl_table=1
                     /translation="MAPTIRVVGSLNADMVSVTPRFPEAGETITSSSYFISAGGKGAN
                     QAVACGRLSRARSASSTSSGKGSVKVEMVGAVGGLDGHFDALLKPTLEKSGVDTSRVK
                     IVEDAYTGVAVIIVDSSAGGENRILFSPGANYQGMQPEPSVLGMAMAAPVPDVIVMQG
                     EIPVDSVIGILREIRAWKTKNRAEGKRGIEAGPDVMFNPAPAPPGGLPEDVYAAVDHF
                     IMNETEAELMTPPAEQLLKVVPDAEGLSGNDKVARYFHQLGVTYVLITLGSKGVWYSA
                     TDAGTSGPADGVNRFTNQIPAAKVSRVLDTTAAGDTFVGAYAVGVARWREQRRADGKA
                     GQDLTSEEKPVRYQKVMDDAMGLATQASARCVERQGAMDSIPWEDEI"
     exon            1007785..1008930
                     /number=1
     CDS             join(1011336..1011447,1011486..1012447)
                     /codon_start=1
                     /locus_tag="AO090102000369"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000049"
                     /protein_id="BAE61428.1"
                     /transl_table=1
                     /translation="MAALTMTPTVRQPFASLDTPRVRPLLKSKMNLKNQQNVTRPSGA
                     ILSGKRQPLSEVDTENIDPTIFNSSTKRKRGSDEDEHEPIKNITKPMKTSRITLTTVK
                     SNAAPRIPTTPPKASRSTPKSAPTLKPAGRSPQAKPCKPFARRSTIAKSRPEPASKKS
                     VNRPFSLAAALASGKPTSQPASKAPSGWSFDIYVDSEQEEMTNLMQHSTCVLDISDDE
                     GKGGSTTPGKENIPPAELGIDLPRSRQRESPAAAARKSVMMEESRAPLGDLIAADYYG
                     EDCHAFSYTIVYDDEEADATSTKKTPLPTLPRSCHSRSKLSSVSSISSILEATTPVED
                     AKSGPSEAEVEVWESGSAVEESA"
     exon            1011336..1011447
                     /number=1
     exon            1011486..1012447
                     /number=2
     CDS             complement(join(1012956..1014147,1014206..1014447,
                     1014529..1014831,1014918..1015058))
                     /codon_start=1
                     /locus_tag="AO090102000370"
                     /note="RNA polymerase III transcription factor (TF)IIIC
                     subunit"
                     /old_locus_tag="AO070322000048"
                     /protein_id="BAE61429.1"
                     /transl_table=1
                     /translation="MSEQHGSRTAPSYPIPSRRIVTVEHPAIIKNVDKAIDTLRGNTG
                     ISKILNPPKADFPANLYLRPEDPMSRPIQSTSLPSNNILLKVTVPRRTGRKRKRGSDE
                     PFTGVPVSTLGPEFQPRRSARELLRSLSDNVGRYQIEPVGLVSRTHGCRTLLFRVLVV
                     HSPIGFGSKFCLLTVCFVPFFGSSGMETNNIADEKMKQFNLDMAKGMSSNVDIIPPPS
                     FSQGDIPFTYAYRQNQAVRQSIDSSGNITTVNTQKSTKVLTHLVSYDVPEVPSKPNEN
                     TPPLETQDATLRETVAIIRDLFDKRPAWTRRGLRNHLSTIEQRYALRLAIPYVGYIMR
                     SGPWRDAIIKFGHDPRTSPDYRPYQTVMFRILPKEADVARDGYAGRRHAVPRLNEPVT
                     DPSTDLRSNTHIFTGQLPLPLDGRMWMFCDITDPLLRSIVFPAEEAPGFIRETCDTIS
                     DGWYGSGTLAKLKLIMRHKILGLIEERIPDDQDFARILSFPDYATPENVNTAFTLDAS
                     VVSTKELTMATEIRAMIKGTPSWRESTNQGQEQDATGKRGKSATGRRVQWRDATGEEE
                     SEGEEEAIEKQEILEAAVEEVMEAATSGVDEDGNDDTGESDGGEEIEESRPRRKSGSR
                     R"
     exon            complement(1012956..1014147)
                     /number=1
     exon            complement(1014206..1014447)
                     /number=2
     exon            complement(1014529..1014831)
                     /number=3
     exon            complement(1014918..1015058)
                     /number=4
     CDS             join(1016820..1016843,1016963..1017292,1017392..1017991,
                     1018059..1018412,1018474..1018644,1018698..1018825,
                     1018880..1019195,1019534..1019605)
                     /codon_start=1
                     /locus_tag="AO090102000371"
                     /note="serine/threonine protein phosphatase 2A,
                     regulatory subunit"
                     /old_locus_tag="AO070322000047"
                     /protein_id="BAE61430.1"
                     /transl_table=1
                     /translation="MKGFRQRVLSRAKDANKSSKKKDSSHSSQNQASLGVNHNQQSSS
                     PKNGTPTSSTTSVNDTRGKSPDNAAQAGVYPPGQYNVPQGAGVAGQPVNNGGPATPTK
                     QGQVPAPSVIISPSAPHVPPPGAAETMPGDLAPPRKSHVFDRLQTTPKDMSEGIRTPK
                     RQHSSRFDISDQRQRELEKLPGFHEVPPNRRQDLFMQKIDQCNIIFDFNDPTADMKSK
                     EIKRLALHELLDYVANNRSVITEPMYPRVVEMFAKNLFRPIPPPVTPQGEAFDPEEDE
                     PVLEVAWPHIQVVYEFFLRFIESQDFNTNIAKAYIDHHFVLQLLELFDSEDPRERDFL
                     KTTLHRIYGKFLNLRSYIRRSINNVFFQFTYETERFNGIAELLEILGSIINGFALPLK
                     EEHKLFLTRVLLPLHKAKGLSMYHPQLAYCIVQFLEKDSSLTEEVVLGLLRYWPKVNS
                     TKEVMYLNEVEDIFEVMDPAEFAKVQVPLFQQLAKSVASPHFQVAERALYFWNNEYFC
                     NLVSDNVETILPIMFPPLYENSKGHWNRTIHSMVYNAMKMFMEINPQLFDECSHEYNE
                     RQNSAEQRERARKERWEKLAEQAKDRQNGVPAPPPPADIPVYVDEVDTITEDSQNRLQ
                     SLKLDDSGSVKERRSSTISHSDGIATTSCDECFVFTWFDI"
     exon            1016820..1016843
                     /number=1
     exon            1016963..1017292
                     /number=2
     exon            1017392..1017991
                     /number=3
     exon            1018059..1018412
                     /number=4
     exon            1018474..1018644
                     /number=5
     exon            1018698..1018825
                     /number=6
     exon            1018880..1019195
                     /number=7
     exon            1019534..1019605
                     /number=8
     CDS             join(1020481..1020532,1020639..1020796,1020844..1032330)
                     /codon_start=1
                     /locus_tag="AO090102000372"
                     /note="histone acetyltransferase SAGA, TRRAP/TRA1
                     component, PI-3 kinase superfamily"
                     /old_locus_tag="AO070322000046"
                     /protein_id="BAE61431.1"
                     /transl_table=1
                     /translation="MERNIDIYASKLGDEKLDIKIRANVAVELRDNIEPLCSGASYPI
                     FLSKLWPVFKGILKGEPVFTNLSFEQTYVVGSELMCCLTAQKLRNCVLETLHRLPMAS
                     PDVEPYAADMVDFLMDLVRIENEENAVLCMKTIMDLERNQAKATAARVQPFLELIQEM
                     FQTMEQVVRDTFDTPSQATPSGMPSTPGATAQNFQSPRPSSPATSVSDLGPSDQQGSN
                     VLLRGMQSFKVLAECPIIVVSIFQTHRNSVAANVKLFVPLIKSILLLQAKPQEKAHAE
                     AAAQGMIFTGVCKEIKNRSAFGEFITAQVKTMSFLAYLLRMYAHQLQDFLPTLPSVVV
                     RLLQDCPREKSSARKELLVAIRHIINFNYRKIFLEKIDELLDERTLIGDGLTVYETMR
                     PLAYSMLADLIHHVRDHLTRDQIRRTVEVYTKNLHDDFPGTSFQTMSAKLLLNMAEKI
                     SKLDDKREARYFLIMILDAIGDKFASMNYQFDNAVKVSRAYKESKKDIEPSSKRYLAD
                     KDHPPDWDEIDIFSASPIKTSNPRDRGGDPVSDNIFLFKNLINGLKNIFHQLKNCNPD
                     HIQIDPNSVPINWSEVSYGYNAEEVRVIKKLFHEGARVFKYYGVDQPPPEVNYSSPFD
                     FLASQYTAPMSREEKELLESFGTVFHCIDTATFHEVFHSEIPYLHELMFEHGALLHLP
                     QFFLASEATSPAFSGMVLQYLMDRIDEVGTSDMTKAKILLRMFKLSFMAVTLFSVQNE
                     QVLHPHVTKIVTKCIELSVTAEEPMNYFLLLRSLFRSIGGGRFELLYKEILPLLEMLL
                     ETFNNLLSAARKPQERDLYVELTLTVPARLSHLLPHLSYLMRPIVVALRADSDLVGQG
                     LRTLELCVDNLTADYLDPIMAPIMDELMTALWDHLRPHPYNHFHAHTTMRILGKLGGR
                     NRKFLNHPPELTFEQFTDDAPSFDIKLIGPSEKRPFPIGIGIDLAIAKLMETPKTPAA
                     KASDGYYKQQAFRMISSQLKLFIGPETLPEDLASLLRLHANDLFENKTTGMADILDKS
                     ERSSSIPKKLSQEVSLKKLLKACVFATTVPDLKQTANSFVADVCKHFAVVEVGRALAQ
                     VRHNRKPFDVASGEGSVYLDSRVLAEAIVESLSSDNALVREGAQAAMQIMKDAAGVIF
                     GTPERISKLPFFQHLGRVFCHSCHSEEWFTKAGGSLGIHLFATDLDLGDSWLFDKQAE
                     FVRALMYVIKDTPADLPASTRIRAQDTLDLILRRCCKNVSKDDLKNEKSRLYSLCGFF
                     VYELSHMNKYVREASRRSFSTIAEVLGSQVHELIFPVKDRLLQSIFNKPLRALPFPTQ
                     IGFIDAITFCLSLHNNIVTFNDPLNRLMLESLALADADDESLASKPNEFKNAEMIVNL
                     RVACLRLLSMAMSFPEFANTPQNTSRARIISVFFKSLYSRSPDVIEAANAGLRDVLTQ
                     TNKLPKDLLQNGLRPILMNLQDPKRLSVAGLDGLARLLTLLTNYFKVEIGARLLDHMK
                     VIADDAILQKVSFSLVEQSPPMKVVAAIFNIFHLLPPAATSFMEHLVNKVLDLEEKLR
                     RTSNSPFRKPLVKYLNRYPKESLAFFQARFKEERFGRFFGQVLADPESEALRSAVVAD
                     TEGFTSAFFGQESADGKNTAAINGIYVTHSICSYQSTKRWLVSHADLRAKLLSSGREL
                     EKKLRNDKLPAAERLRVEQAEDQLMDIFTIYLAESTQDLDFLFEVMDGLSADELKRTL
                     AFPKFIYRHIITNESIDYRRSVIMRCLDLYGQRTCSQKMKTYAFRNLVNPIFAMDVQT
                     TWNHPPNSPKLMDKSMTEFIQSRLWKPQLADLSEESSQSGVDHSRMELLQLSALLIKY
                     HHQTVQDSRKDIIKFAWNYIRLEDIINKYGAYVLISYFIAHYETPFKIVVQVYVALLR
                     AHQNEGKALVTQALDVLAPVLPTRIMTASSSAQAPDARYPLWAKWPRRILAEETANLQ
                     QVMSIFHFLVRQPDLFYESREHFVPLIVPSLIKIASPPNSSNESKKLALNLINLIWHW
                     EEKRVKSHTAMPNGTIESPNTKKRKLEETQGTSSSPSLAPPNARERSEYMVPPDLRAA
                     LTKYLITFITTIPERFPVPASRIRDLPSSKTQQPVLTGDMVKKAVHLLRNLLSPEYWG
                     DLDIELYQKVTEPILAGEKADKSDEKHITSMVNALQVVRVLLAAKPDDWITGRLPLIQ
                     KLFEKPLRSDNPEIQDCLHGVEDEVDISPKLLPPVRRVLDALPDDQPEEEDAMDVEHS
                     PSEFVTYLSAIATETLSANNYVSSLNVLWTLSKNKPAEMDTHIPQVMKVFSQKLAKEH
                     VAASVNNQNQVIPGTKPAEGVPDQQEFEIGVDLIFKTIELISVRMSHLGEQRRPFLSV
                     LAQLVERSQNIKLCSKVLGMVETWIFHSNESWPTLKEKTAVLHKMLLFESRQDQTMLK
                     KFLDLVIRIYEDSKITRTELTVRLEHAFLIGTRAQDVEMRNRFMTIFDRSLTRLASSR
                     LSYVLTCQNWDTLADSFWLSQASHLVLGCVDMNAPAKLHSDDYTVYPLSFLFGNADKD
                     SRKADIMVDIQLEAFVSERKRFVADIGDVRARDLMEPLCQLQHTDPNVAYTLWTNLFT
                     IFWSTLSREDRIDLEKGMITLITREYHQRQLDKRPNVVQALLEGAVRAKPRFKIPPHV
                     MKYLSRTYDAWYTAAGYLEETAINPIIDTPTVRESNLDALVEIYAGLQEDDFFYGTWR
                     RRCKFVETNAALSYEQQGMWDKAQQLYENAQIKARSGAMPFSQGEYYLWEDHWLICAQ
                     KLQQWEILSDFAKHENLNDLLLEAAWRNIENWQSEGNREQLESLIKSVSDAPTPRRTF
                     FQAFMALLQYHIKKENIQEFNGVCDESIQLSIRKWLQLPKRITNAHIPILQHFQLLVE
                     LHDASHICASLSQTNERNLDTKSAELKLLLGTWRDRLPNLWDDINAWQDLVTWRQHIF
                     QLINATYLSLLPPQTNNVASNSYAYRGYHETAWIINRFAHVARKHQMPEVCINQLSRI
                     YTLPNIEIQEAFLKLREQAKCHYQNPKELNSGLDVINNTNLNYFGAQQKAEFYTLKGM
                     FLAKLSHVSEANDAFGVALYYDLRLAKAWSEWGQYSDQRFKKSDPSDYELASNAVSCY
                     LEAAGLYKNSKARKLLSRILWLLSLDNEEGRVAAAFENFKGDTPVWYWITFIPQLLTS
                     LSHREARLCKALLVKIAKLYPQALFFLLRTNREDMLNIKKQHDQKQEKLNRARQQQAQ
                     AQAQASPQPKPSPSAVGSSPAQNAQPPNANTSTPVQGQANLPNQQQAQNQIQQGMVQG
                     QSPQVNGQAQQSPAQGQNQGQGQTQNQAQGGQQQNLQVPGQNGVSQPNQSASTEPEKE
                     PLKKPWEYSDEIMSGLKTAFPLLALSMETMVDQIHKNFKCPPDEDAYRLIVALLNDGL
                     AYVGRMPGSYAQDFKLPAPTEANITRFAETILLAHIRKSFEADFVVKKPTMYEYIQKL
                     RRWRDKFEEKLDRRPQSQFLETYSPHLSEFRFLKFDEVEVPGQYLLHKDKNQDFVRID
                     RFLPDIDLVRGIGVCHRRLKIRGHDGSIHPFAVQHPAARHCRREERILQLFRIFNGLL
                     GKRKESRRRNLYFHLPLMVPLAPHIRLVRDDPSYISMQGIYEDYCRRVGINKDDPVLF
                     TMEKMRSLAETKQSVSETTAPTYLNMTNIPQRTPDQQQVLRTEILTAIQEKWVPSNIV
                     LDYFQKTYPNFSDFWLFRRQFAYQYAAIAFMTYVMHMGNRYPNKIMISRTTGDIWSSE
                     LIPAINPAKAFFYNPEQVPFRLTPNIQTLMGPIATEGLFACALMAIARCLTEPRHELE
                     QQLSIFVRDEMMFWATAQHRGVLPVPQLRDLVYNNSDIIVNRAVSLASPPEGNLPANQ
                     TTIDLISKAVNPQHLATCDALWMPYL"
     exon            1020481..1020532
                     /number=1
     exon            1020639..1020796
                     /number=2
     exon            1020844..1032330
                     /number=3
     CDS             complement(join(1032704..1033399,1033463..1033561,
                     1033627..1033653))
                     /codon_start=1
                     /locus_tag="AO090102000373"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070322000045"
                     /protein_id="BAE61432.1"
                     /transl_table=1
                     /translation="MSERKVLSKYYPPDFDPSAITRTKNKQTGPKVITVRLMAPFSMK
                     CTQCGEFIYKGRKFNARKETTEEKYFSIPIYRFYIRCTRCSGEITFKTDPKNMDYTAE
                     KGAKRNFEPWRDPKNETYNETEEQLLDRLEKEENEEHERAERDKMAELEEKMLDSKRE
                     MAIADALDEIRTRNARIERNEALGDETALAHVREEVDEDKLKAEREIEEAARRAFTTE
                     TGEKVKRLVEEDFSNGATPDPKPSDAPPSFARVKKAKKPLPNSLGIKKKAKPSLV"
     exon            complement(1032704..1033399)
                     /number=1
     exon            complement(1033463..1033561)
                     /number=2
     exon            complement(1033627..1033653)
                     /number=3
     CDS             join(1035453..1035553,1035616..1037833)
                     /codon_start=1
                     /locus_tag="AO090102000374"
                     /note="anaphase-promoting complex (APC), Cdc16 subunit"
                     /old_locus_tag="AO070322000044"
                     /protein_id="BAE61433.1"
                     /transl_table=1
                     /translation="MEKFLRSWRQDALNRGQHDAAVYIGDKVLALTSRDSDAFWLAQV
                     HFSNNNFTRALALLSRKDLIPRSTACRYLAAHCYIKQNQFEQALSILGDHNPTHLIRS
                     NNNSNSRRKLQHLNSQSHVTLRNGKTTASRIDRGEEREREDASNIRFEAAMCYLRGLC
                     FAKQNAFDRARDCYKDAVRIDVQCFEAFDQLMKNSLMSPAEELEFLESLDFDSISSPD
                     PSVSQEAAHFTKMLYTTRLSKYSSPAILSDATETLSTHYNLSENPDILLSRAEALYTQ
                     CRFAEALELTSSILSTSQSSTALTATTASIPAQNHLGHAPAVYPLHLACLYETGATNA
                     LFLLSHTLADHAPEESYTYLAIGVYYLSVSKVAEARRFFSKASLLDPHSAPAWIGFAH
                     TFAAEGEHDQAIAAYSTAARLFQGSHLPQLFLGMQHLALNNMSLAHEYLSAAYAMSTG
                     ATSGSVPALPPTPSTGASSLGGDPLVLNELGVVLYHQNHLEPAVKLFRQALSLAASLN
                     CEPGAWVATRANLGHALRRIGRFTEALVEFDECLRIGAAGASFGYTPFLGGSGGNASG
                     AASSGVGGYEDRGLIGSLHTARGLVLLELSRTVEAVTALHEAVRVLGASGGGDAAAGA
                     GVAGTLLSRALEIWALEGNEAEPMLSEEVSRAGSGSRSSNRSSRDKGKGKVARRRAIP
                     EEPYSEEWTDEVAQVDSHNLRGGSETLEDKVEMELDDEADGLLRQAMSRVRGGRSRRR
                     PMLSPEVEASDTPEPAAGRRRGSRTLRTNARQ"
     exon            1035453..1035553
                     /number=1
     exon            1035616..1037833
                     /number=2
     CDS             join(1038354..1038706,1038764..1040078)
                     /codon_start=1
                     /locus_tag="AO090102000375"
                     /note="arylsulfatase A and related enzymes"
                     /old_locus_tag="AO070322000043"
                     /protein_id="BAE61434.1"
                     /transl_table=1
                     /translation="MGSAPRPNFLIIVADDLGYSDTKPFGSEIETPALDFLARTGTCL
                     TNFHTASACSPTRSMLFSGTDNHIAGLGQMAEYMRNAKQYQGKPGYEGYLNWRVAALS
                     EVLQDAGYFTTMSGKWHLGLKKEIAPCSRGFEKNFSYLAGCGNHFNYEPQLEHPGDGF
                     LAPLKSSAFWMEGDRFLDRTTDIPSDFYSTTTFTDQLLQYLTSREKDDDRPFFAYLPF
                     TAPHWPLQAPRELINKYKDLYNEGPEVLRQKRLERLIQLGRVPKDVNAAPITLESDDW
                     AWDKLSDEERAGSARKMEVFAAMVDLIDQNIQRVIDHLQSTDELDNTFILFMSDNGAE
                     GAMLEALPVMGPSGNMKTIIDKYYDNSLENIGNPDSFVWHGPAWASAAMAPSRGFKTW
                     ITEGGIRCPCVVRYPPLGVSNGQTDSFATVMDVFPTVLELAGVSLPGEQFRGREVVPV
                     RGSSWVPHLAGRTAEFHEDEEGYITGWELFGRRAIRQGSWKALYMTAPLGKDRWELYN
                     LDEDPGEVVDRADSEPEILQRLIEHWEVYYAETGMVDPAQELPHTKT"
     exon            1038354..1038706
                     /number=1
     exon            1038764..1040078
                     /number=2
     CDS             1042054..1043220
                     /codon_start=1
                     /locus_tag="AO090102000376"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000042"
                     /protein_id="BAE61435.1"
                     /transl_table=1
                     /translation="MGVSVGSSEENCDENSNSNENSNSNSNSNSNENSNTNTWGSSTD
                     SGSMPPGGMPPIGGMPPSGGTPPGGMPPSGGTPPTGGMPPTGGTPPSSGTDTCEDCEG
                     GTPPSGGTPPSGGTPPTSGTPPTGDVPTGDTPSGTPPTSGTETGEETGTETGGSPPSG
                     STPPTSGTPPTSGTPPSGGTPSGTPPTGDVPTGDTPSGTPPTSGTETGEETGTETGGS
                     PPSGSTPPTSGTPPSGGSPPTSGTETGEETGTETGGSPPSGGSPPTSGTPPTGDVPTG
                     SGTPPSSGTETGITTGEETGTSTGGSPPTGGMPPSGGTPPNSGTECEACQGGNNSGNS
                     SGSSSSSSSSSSSSSSSSSSSGSSGNHASANASGPNDCAECEVSASVSPEDCEE"
     exon            1042054..1043220
                     /number=1
     CDS             join(1044084..1044603,1044673..1044698)
                     /codon_start=1
                     /locus_tag="AO090102000377"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000041"
                     /protein_id="BAE61436.1"
                     /transl_table=1
                     /translation="MESMNDSFNVQIQTVPPGIEPPHSRKSHPKMAPGPSVPLEIKYA
                     NASDLGALVSIEIRSFPSSNYMRSTYKGCDPLAVHTFKTVCSLEYFAKSDCHILAGVD
                     SETGETIAYSRWNIPAIYGVERAVDTSLSIDAQAQMQNAWAYAPKLNKGTYMFYEESI
                     KRSRNRHLKQTDIVLELLCLT"
     exon            1044084..1044603
                     /number=1
     exon            1044673..1044698
                     /number=2
     CDS             join(1046852..1048202,1048266..1048693)
                     /codon_start=1
                     /locus_tag="AO090102000378"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000040"
                     /protein_id="BAE61437.1"
                     /transl_table=1
                     /translation="MPNSVTNATSNREERRISQIQGLPPDDVKKATDQWSDEGRPHKA
                     CPSLTKREGLSTPRRVSFRASPRHCLSRRHSRPLILLLHSFILPAAPLAQFCPPLSLS
                     FFSFLLPLSYNAIDLFTRHLVFAGAMAIPSCSRWRLRPIGLLYLFYLVGFMSFACIVA
                     IWYGVNSDRDYIHPLLTQLIPAGHCACQTSTTFQCSTCLSCSEHSLVPQLTSAPKWEF
                     NSDRDSNNEGLSTPQCKAAFPGLYEDVFRAESFWRSQGALATEDLDRIPLGFGMVRAF
                     ISRGELYVVAARAKQEDHRRKIVAALSSIHRALVADSDRATRRDIEFVFSVEDKVEDV
                     TSSDNPVWVLARSAAEQGVWLMPDFGFWAWDNPRNSIGPFDQVVERVKRADIPWSQKT
                     PQLVWRGKPSFAPKLRRALMDAARDKPWGDVKQVNWFERTNIMSMEDHCRYMFIAHVE
                     GRSYSASLKYRQACNSVIVAHKLQYIQHHHYLLVPDGPNQNYIEVERDFSDLESKIEP
                     LLDDPSTAQRIANNSVRTFRERYLTKAAEACYWRQLFEGYGHVWNSSVPVWSDVYQRE
                     RGLRYESFILLDSQMMFDFSATGGMP"
     exon            1046852..1048202
                     /number=1
     exon            1048266..1048693
                     /number=2
     CDS             complement(join(1049053..1049347,1049416..1049438))
                     /codon_start=1
                     /locus_tag="AO090102000379"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000039"
                     /protein_id="BAE61438.1"
                     /transl_table=1
                     /translation="MTVKEITSYPTLQETIQSPTPTIVDFTAGWIGPCRPMFSAFEQI
                     SHTTPYMAFYRMDVRKLSDEEIAKLGIVAMPTFMVFREGRKVGDLVGGSPGVLEGFVT
                     GVL"
     exon            complement(1049053..1049347)
                     /number=1
     exon            complement(1049416..1049438)
                     /number=2
     CDS             join(1050720..1051478,1051547..1051858,1051922..1052032,
                     1052100..1052266,1052315..1052486)
                     /codon_start=1
                     /locus_tag="AO090102000381"
                     /note="cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies"
                     /old_locus_tag="AO070322000037"
                     /protein_id="BAE61439.1"
                     /transl_table=1
                     /translation="MMPTFFQAVCSTCIALAIYTASLAIYRLFLSPLAKFPGPTLAAL
                     TGWYEVFFDVLLGGQFMWEIERLHGKYGPIVRINPHELHIKDPDYYNTLYAGPTRRRD
                     KYLWFLSVGAPTSTFATPESDHHRLRRGMLSPFLSKQAVRDLEGVIKAKLDLLCEHMK
                     KAMRSGEAVELHAYFVSFAVDVVSTCAFGESGCFEELRRERLDDRWKNVVTGAFGKLL
                     LTRHFPWLVVVFRFLPVWATALLTPVVRHIDYMEKGVENQMQHVYAMNKDGVKENGIF
                     SQLMHNLKLPLKERVLYRLADDAKFLMVAGIDAPSQVLAITMFHVLRSPLVCRELREE
                     LQDKTAHSRDELCLNTLEKLPYLTAVIKEGLRVSAVVTSRLPRIAPEETLEFRGWKIP
                     PGTPVSMSSHFILRDPAIFPDPLVFQPERWLKQSTTGSSLDRYLVPFSKGSQGCLGPN
                     MAHAWLYLALATLLQRFEFSLFETTEENIRTVRDCFNGQTKPGQNNIRVKVLTEFI"
     exon            1050720..1051478
                     /number=1
     exon            1051547..1051858
                     /number=2
     exon            1051922..1052032
                     /number=3
     exon            1052100..1052266
                     /number=4
     exon            1052315..1052486
                     /number=5
     CDS             join(1054010..1054118,1054178..1055472)
                     /codon_start=1
                     /locus_tag="AO090102000382"
                     /note="cytochrome P450"
                     /old_locus_tag="AO070322000036"
                     /protein_id="BAE61440.1"
                     /transl_table=1
                     /translation="MPSPIPKPKGVPILGNVFDLDGNNTWGSFNKLAKDYRPIFKINI
                     LGKDIVFITGAHLLEEVCDETRFRKCVAGPILAIRDAVNDSLFTAKHTTEEIISWGIA
                     HRIMAPLVSWEAVEQVFSGIQETTDDLIKKWTTGSRQRINVTNDLDRCNHAANMLCFF
                     DQRVHIMEGPEPAVIKAMGCATNEAMHRPFRLRIVNWLFHSRKWNAWIKTMRDYGKDI
                     VETRRANPTDKKDMLYALLEGKDPETGKGLTDSQVLDEIINIFIGSATAPNLIAFAMY
                     YLANNPDAAAKAREELDAVVGGPSVRIEHEHLARLPYTEGVLRESFRLSGVAPGFNIE
                     PIPENEGPVLLAGGEYEVPKGQALIAILAAVNRDPAVFEDPEAFKPERMVGENFDRLP
                     KGVKKGFGNGKRECIGKRYAWQWSFMVLASILKDVEFELADPNYKVGNDGVNCNGAFS
                     VRPQEMFVVTGPRARAA"
     exon            1054010..1054118
                     /number=1
     exon            1054178..1055472
                     /number=2
     CDS             complement(1056275..1057684)
                     /codon_start=1
                     /locus_tag="AO090102000383"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000035"
                     /protein_id="BAE61441.1"
                     /transl_table=1
                     /translation="MGLIITTIALVLSALSWLDCAVSVPRAPPELDLSKFQDENIITR
                     DVCIIGGGSAGTYAAIRLRQMNQSVVVVEKEDHLGGHVNTYDDPITETAVDYGVLYYE
                     NLPVVRDYFDHFDIELEKISILEQNSTQHRVDLRTGTPVGPAEGNMLLALAAYTAQLL
                     KYSYLNTGFNLPYPVPPDLLLPFGDFVKKYNLEGAVDIIAMFNQGTGDMLQQTTLYML
                     KYFGLDVVQSALGGFLIPASHNNSELYGAAREELGEDALLNSIVTYTYRNEEREYAYA
                     VVETPSGAKVIRARKLIIAIPPRLDLLKGMDLDELERGLFGQFNNTCYYTALTRIPGF
                     PEDIQIVNRATDTLYQLPPQPAVYVINTTRAPRLFTILYGSKDHMTEAEVKGNMTRSV
                     MQLRNTGLQIEPPEFVQYSDHSPFLLTVPPDAIRNGFYRHLNDLQGHRKTYYMSATFN
                     TQASAQIWSFIDGLLQTSF"
     exon            complement(1056275..1057684)
                     /number=1
     CDS             join(1066822..1067359,1067422..1067729)
                     /codon_start=1
                     /locus_tag="AO090102000386"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000032"
                     /protein_id="BAE61442.1"
                     /transl_table=1
                     /translation="MALTPPFKGRKIRDRIAKLQERVIASELRAAASLNGWGYHHPTA
                     PLGGVPTSAYDVDRKVLSPAAEIMPAMSGPYLPGSTGTYYPYSTLSPASTLPPQPSPT
                     FPQYEATAKEADPSSSLSPSVLTNSSVCSPDAGSLNLDMATNASNNYVPPDMNGQLQT
                     DPWNIYTQNSQSSFYYLTTEASLPQILQMLDNGNMKPKAVILLQPSSPLAGVPPPPTS
                     QPPSPVEQVPATSSFTMQGLTCHCQNRNFLSESPVNWIHPTASTSICPLHSSSILDSY
                     QQKLQ"
     exon            1066822..1067359
                     /number=1
     exon            1067422..1067729
                     /number=2
     CDS             complement(join(1069163..1070228,1070297..1070387,
                     1070442..1070576,1070630..1070889,1070949..1071814))
                     /codon_start=1
                     /locus_tag="AO090102000387"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000031"
                     /protein_id="BAE61443.1"
                     /transl_table=1
                     /translation="MTSPYQPSMSFSPSVNGPDMTAAPSRPVSDLPQSQVDAIIRTKR
                     KAREPKACYPCHARKVKCDRNLPCDGCVKRDHADLCSYERPSKKRIMGAAGPSQYRDS
                     PAATPGGSESVGLPGSAETPIRLKQEPGVARSNPLTSAGRVSIPREEWDNVRTRLKEM
                     EQTINNLRVGLEKAEEGQASSLETGSVQSGDASIRSKAASPEREGIHAANTLGEGTVH
                     LGSRSVLAYILNNKSGSDQLQALLEGGILPKLGLDNESATYPFVDLWSSDMSTFDVSA
                     VCSALPSDQQCKEFFYYYRDIAGAIYPVLEDIPNFEMHLDLLLRTRTATGGIYRSDND
                     QAQKPFGVSIAFLGLLFAVLASGCQSSDLPGKERELTSQVYVCCSYQCLRMTNFLSQP
                     TIDAIQTLLVIGNVLSYNMNPGISYVLLGMTLRMGLALGLHVESSRFSAAERYRRRHV
                     WWSMAWQDSHFSLSYDRPSTTAVCQPEIAYKEDSTPGECSYFETLCRVIQLALEVVRS
                     RMLNPHAQLSQKTIHAYKERIQHIMIEAKPYLRDRKYCFSTSEHLERVVLKLHSSYFA
                     SELLRPALKMTADPSDPLTTSMRSDCVSNLMTTVEAYVEMHTVSSHASRSWIALQRAI
                     SSVFLLAVTEESKTNPRFWTLLREMKMIIAERANEEGLFGQGDASGLPQTDRNGSFNA
                     AIPTTTNTTATSPAALSTASPASAAVGMDTQTQWAKPLTKTLRALDKLEAAFSSHGQL
                     PTGHGTYLNPATASMQNLAPPVSAAMTPSVGSLPPPTPESSTSGEWTMPNILDRAAEY
                     IHPPLWS"
     exon            complement(1069163..1070228)
                     /number=1
     exon            complement(1070297..1070387)
                     /number=2
     exon            complement(1070442..1070576)
                     /number=3
     exon            complement(1070630..1070889)
                     /number=4
     exon            complement(1070949..1071814)
                     /number=5
     CDS             complement(join(1072514..1072779,1072834..1073165,
                     1073221..1073824,1073874..1074291))
                     /codon_start=1
                     /locus_tag="AO090102000388"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070322000030"
                     /protein_id="BAE61444.1"
                     /transl_table=1
                     /translation="MQDNHLRRSSDAARTLSGSGQDTDYLDLPVRQVTRDANLEEYTT
                     ETAAGQIIKPVRSAASGKMEDWKLVTFTIDDPENPKNWSKAFKWYCTMVVAFTCFVVA
                     FASSVITADIEGPAEEFGVSREVSLVVVTVFVIGFGVGPMAFAPMSEMFGRRPVYALT
                     LLIAVIFIIPCAVSKNIGTLIVCRAIDGIAFSAPMTLVGGTLADLWKNEERGVPMAAF
                     SASPFLGPAIGPLAGGYLADAAGWRWLYWLMLILAFVAWVLITFTVPETYAPTILKRR
                     AKKLRKTQNDSKYVTETELDSRPLGEKLRIFFFRPFQLLFLEPIVLFISIYMSVLYGL
                     LYMFFVAYPIVYQGGKGWSAGSTGLMFIPLAIGVIMSAACSPFINKHYLSLYAKYGGK
                     PPAEARLIPMMFSCWFIPIGLFIFAWTSYPQIHWFGPAVGGWPVGFGFIFLYNSANNY
                     LVDTYQHQAASALAAKTFLRSIWGASTVLFTEQMYDRLGDQWASTLLAFIALACCAIP
                     YVFYFKGESIRRFSRYAYNEDEENTGKVEKS"
     exon            complement(1072514..1072779)
                     /number=1
     exon            complement(1072834..1073165)
                     /number=2
     exon            complement(1073221..1073824)
                     /number=3
     exon            complement(1073874..1074291)
                     /number=4
     CDS             1076226..1080320
                     /codon_start=1
                     /locus_tag="AO090102000389"
                     /note="phosphoribosylformylglycinamidine synthase"
                     /old_locus_tag="AO070322000029"
                     /protein_id="BAE61445.1"
                     /transl_table=1
                     /translation="MTSASSASTFLALPGSVAFSRSRGHAIAASIGAQDVRAQWIHYV
                     HASQPLDEPQQNVLKQLLQYGDITDIPPSFSAEDGQFDVFYVFPRTGTISPWSSQATG
                     IAHVCGLRKYVDRIERGLKISCLRASSAEYKSGFQDVLHDRMTQVLGQEEPDLHLMFS
                     EHSPLPLETIPLHGSDKSPKEVLQEANKRLGLALEESEIEYIAEAYGPNGPIARDPTD
                     VELFMFAQVNSEHCRHKQFNASWVIDGKQMPNSLFAMIRNTHKKNPEYTVSAYSDNAA
                     VLEGDVAAHWAPDATTGEWNHTKEIVHFLAKVETHNHPTAVSPYPGAATGSGGEIRDE
                     GAVGRGSKPKAGLAGYCVSDLQIPGLKQPWELDVGKPNHIASSLDIMLEAPIGSAAFN
                     NEFGRPCISGYFRTLLTEIDIGNGQKEVRGYHKPIMLAGGVGTVRPQHAIKKPEVVKP
                     GAFLVVLGGPAMLIGLGGGAASSITSGEGSAELDFASVQRGNAEVQRRAQEVINACTA
                     MGDNNPIKFIHDVGAGGLSNALPELIHDSGLGATFELREIDSADKSMSPMQIWCCEAQ
                     ERYVMAVGEDSMNKFTAIANRERCGFSVVGRGGGTSEEEKRLVLMDRDSTEYPKPIDL
                     PLSVLFGKPPKMTRVVESRKLKLPAVDATLTKYLPALAPNHLELIGEAANRVLSLPAV
                     ASKSFLITIGDRTVGGLTARDQMVGRWQTPVSDVAVTATALLQGVKTGEAMAMGERPS
                     LALISPAASARMAVAESLMNIAAADLVDRLSHVKLSANWMSASSHPGEGAAIYEAAEA
                     IGMDLCPKLGISIPVGKDSMSMKMKWTDEASKQAKEVTAPMSLVISAFAPVGNYRKTW
                     TPALRRLEDVGETVLMFVDLSFGRKTLGGSALAQVFNQVGDDCPDVRDVEIFKDFFDA
                     TQQLQDAGIVLAYHDRSDGGLFTTLAEMMFAGRCGVEVMLDNICPSSGTKDVVETLFT
                     EELGAVFQVRKEHEIQFRSCFATCGPPAGLIHKIGRVSERTKQNLAIYHGHTLVYRNN
                     RANLQQTWSSTSYHMQKMRDNAACADQEYANILDDADPGLSWNPTFDPKDKALPMLTS
                     LTSMSPFSNKPRVAILREQGVNSQAEMAFAFNMAGFSAVDVHMTDIISGRVSLASFVG
                     MAACGGFSYGDVLGAGQGWAKSVLLHENTRSEFQSFFERPDTFALGVCNGCQFLSRLK
                     ELIPGAQNWPSFERNASEQYEGRVCMVRVSDPDPSRPSVFFHGMDGTSLPIAVAHGEG
                     RASFSPSSNVTAQSFVQEGLAPVQYVDNAGLKPTMKYPFNPNGSPEGIAGIRNANGRV
                     LAIMPHPERTVMGGIASWLPAKAQEWGDIGPWGRVFYSARRWVG"
     exon            1076226..1080320
                     /number=1
     CDS             complement(1080688..1083315)
                     /codon_start=1
                     /locus_tag="AO090102000390"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000028"
                     /protein_id="BAE61446.1"
                     /transl_table=1
                     /translation="MAIPASISALTDELVATVAKVDKGTPRFKILKRRTEDTLRANAH
                     VRTDQFAVANQLEGLQEKFQVLNKDDLADALRVRLTELNEHKNSCFPEILSLLLQLAD
                     RPAQLSKVDRLESIKKPQERVESLSWTELDVSGTAYCEEDIWESVDFGAGSSEDDLSS
                     VSSDSYQGRSLPQTSIALEEDYVIPEDLFSSGEDEDLVVSIKSAQFWRNKTSTDTEQH
                     GGKPSQVLTELQIVRETIFMLQGLPTSLFWRHHESVEVDRKYSLAHLSSETLSSLLRS
                     FCSIGSKIDILRRYNQVPRVIPYLQTFHRGIEDRLREFDRFLSNVQAQYLSQSRTIAV
                     SLLQLYESVLRESKLLLLLAEIVSNLRHDASDSPVRCLDLLYDSVCMTQATGDENEFK
                     FLAQLFFSCFETYARPIRLWMEKGELEETVQGSFFIRDNRNNDLDLRTLWHGWYTLDE
                     SAWISSAPKFVQPVARKIFVAGKSMVFLRHLDVSGDDEHARKSSLTLGDVFPEDSASV
                     YMPFSALLDSAFGRIVDENHSFTSSLLRRELDQQCGLWISLQALEHIYHCKDMSVYGP
                     IDHKIFDLIDRGRGAWDDRYLLTELAQSAFSTLPFIDPSRVIVRSSKDPTNKAHTHSR
                     SVKLLQAISFDYVLPWPVANIITKDAILSYQRLSTFLMQIRRAKHTIVKQRLQYSPEI
                     YEARKNAQAYALRHNMLWFLNTLYSHMTDFVISTTTDSLRKDLSACNDVDTMVSVHQS
                     YMSSLEDQCLLSQNLVPLYEAIISLLDLCVSFSDLQSTRYTQTKSAQKEYGQDKDQSD
                     EEEDEDEDDEPEHDEKQTPVHETQYLQQVKTTQDQFNQLVGFLAAGLKGVGRANAQVS
                     WEILAERLEWRKERTADHV"
     exon            complement(1080688..1083315)
                     /number=1
     CDS             join(1083627..1083780,1083870..1084133,1084186..1084804,
                     1084865..1085021)
                     /codon_start=1
                     /locus_tag="AO090102000391"
                     /note="glycolipid 2-alpha-mannosyltransferase (alpha-1,
                     2-mannosyltransferase)"
                     /old_locus_tag="AO070322000027"
                     /protein_id="BAE61447.1"
                     /transl_table=1
                     /translation="MAVARPIRMLGASCIILILFLIFKMNNGPTSIISKGPKGDYTGI
                     QNDPLKEPTGEPEGHLWRADENDYSPDSANSARTNAALISLVRNEELEELIPTMRDLE
                     RTWNSKFNYPWIFFNDKPFTEEFKKRTQALTKAKCQYEQVPKEHWDVPDWINMDLFRE
                     SAEVLKEQGIQYSDKISYHQMCRWNSGLFYQHPALKNYRYYWRVEPKVQFFCDVDYDV
                     FRFVEDRNITYGFTINLFDAPQSIPTLWPETKKFLAANPTYLSDNNMLDWLTDDQLRP
                     EHTNAANGYSTCHFWSNFEIGDMEFFRGEKYSAYFNHLDRAGGFYYERWGDAPVHSIG
                     LGLFADAAKVHWFRDIGYNHIPYYNCPNSPKCSGCTPGKFYAGEPFLAKEDCRPSYFK
                     HVGTH"
     exon            1083627..1083780
                     /number=1
     exon            1083870..1084133
                     /number=2
     exon            1084186..1084804
                     /number=3
     exon            1084865..1085021
                     /number=4
     CDS             join(1085934..1086235,1086354..1086385,1086448..1086496,
                     1086568..1086689,1087401..1087572,1088507..1088657)
                     /codon_start=1
                     /locus_tag="AO090102000392"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000026"
                     /protein_id="BAE61448.1"
                     /transl_table=1
                     /translation="MVDYLLLAGVELFTESNAEFLAETLEGLKVLLVLVLGLDLGLDT
                     YSDEPCEFMTVSQSHDKMQGKIWGCAPSKTRTAVGKSLTRRAALRAAERTSTEGTRSL
                     DDYKTENQVDILDTVEFLLESIALQAHQEITANRIEPLLSLFEARSRLVAGSMAGWLG
                     WHTWQRTPRLRNAILITLSLSRTVFQTMIQIIVRLYNLKLYTIVFLYGSEGETRLSSI
                     YIATKVELYVNQAALDKHRAAPYFQDLIKKAPELLGKPLELKVGSELLQESAQVVRV"
     exon            1085934..1086235
                     /number=1
     exon            1086354..1086385
                     /number=2
     exon            1086448..1086496
                     /number=3
     exon            1086568..1086689
                     /number=4
     exon            1087401..1087572
                     /number=5
     exon            1088507..1088657
                     /number=6
     CDS             join(1090129..1090539,1090599..1090881,1090936..1091282)
                     /codon_start=1
                     /locus_tag="AO090102000393"
                     /note="fatty acyl-CoA elongase/Polyunsaturated fatty acid
                     specific elongation enzyme"
                     /old_locus_tag="AO070322000025"
                     /protein_id="BAE61449.1"
                     /transl_table=1
                     /translation="MALEFLQNVPRPTIDRPFGIHLWPIFDQAFEKVVGYPASEFKFV
                     EGQTPMSGFRETAAMLVTYYIVIFGGRMVMKNFPALKLNALFMIHNFYLTAISATLLA
                     LFIEQLLPTIWRNGIFFAICDHQGGWTQPLIVLYYLNYLTKYLELLDTVFLFLKKKPL
                     TFLHTYHHGATALLCYTQLIGLTAVQWVPITINLLVHVVMYWYYFQSARGIRIWWKEW
                     ITRLQIIQFVIDLGFVYFASYTYFSSTYFPWAPNMGKCAGEEFAAFAGMAILSSYLFL
                     FISFYIATYNKAAKTGRPRRNTGRQAVIDMAKMEVVPSANGSAANGSAKSNGAATASG
                     RSNGPVTRSRKA"
     exon            1090129..1090539
                     /number=1
     exon            1090599..1090881
                     /number=2
     exon            1090936..1091282
                     /number=3
     CDS             1100187..1101659
                     /codon_start=1
                     /locus_tag="AO090102000396"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000022"
                     /protein_id="BAE61450.1"
                     /transl_table=1
                     /translation="MYDTAGPIRLDYINQQHLPRRYESDEEDISESEMGGHDNAFSPV
                     ENYEPSNPATNESEIERPGFPRLLPTYSSSGKTSRPVSMDTIKRSSATTFVADSYIFE
                     HDDDVIIELPSPDATSPLQSPIFLPPSVYVPSESPVSTRPQSLTSISSSSMYSDDEES
                     GLLVAEQVKIVEPIAKPNLILISPVSEHSPSPFKDSTPTPNTTKDKSNESGAQGLYSH
                     RRAAASQPLLWNKCDQNSAKTEALKRGSMHLTTHDLERLPMVASGPIVSSPVEVSELP
                     SPMTLPNHSMTFPRPATAVSEKVSSEMHSRRPTDILRRPPSIKSLSSASLPFFHSRQA
                     PTSAGPDSRTRSMSYTHSSARSVHGLPLQSSCPPSRTASPSPYYSSPSFTRERSGSTY
                     SISSFTRAPTPLRQPLKKTSTSSSIYSSSSLRSEVESVRSLDPRDVAEPDFQQKVKRK
                     KSLRRIRQSTMESSDLSGKKSFMGFMFGSKRKSTIKSLNA"
     exon            1100187..1101659
                     /number=1
     CDS             complement(1111457..1113487)
                     /codon_start=1
                     /locus_tag="AO090102000400"
                     /note="predicted sugar phosphate isomerase"
                     /old_locus_tag="AO070322000018"
                     /protein_id="BAE61451.1"
                     /transl_table=1
                     /translation="MAPSTDVERLDLLQTEARTSTADKIDLLDTLGLCEEFNKEERRV
                     GGAVACCLPTIASLIDDLAPRLEAGGRLIYVGAGNSGRVGFMDCSELPVTFSVDPQQF
                     LTVVAGGTEAIIQAQEGAEDVESDGALRMEALQLNEKDTVIGISASGRTPFVLGALRV
                     ALKHDALTAGITNTYPSRIDKLGVKHSICPLVGPEFLTGSTRLKAGSAAKQILNMIST
                     CSMVKLGKTYKGLMIDVRVNNWKLKARGRRIVRQVCNGAPMHIIEKNGLPSSQAVDVP
                     ETADGDAIIDSLIRECQGSVKLACAVAISGFPPDVSKQMLDSAGGNFHVFVQGIRMKA
                     PPSPVSLGESDYCLCVDGGGTNCTVSIATESMVVGQGVAGPCNFNAVTLDELMDQIKL
                     ATKRASSTILARQGFGYPNLPRFSKVWVGLAGLYHADQVATLTRRLEELFDVSIKNGT
                     LRLTSDGILLGSCIAMDDSVECAISVIAGTGSVATAFKKAPSNEIVQVGRTGGWGYLI
                     GDQGSAFDIGKRALQLVLSSVEQRQFQATHELTEFERVILEELNSNEAGVLTQIYHSD
                     AKPKEKISDMAKVVTKLGFRERDPDPQALGILTSAAGTLVQHIKPLTEICDPRKCALI
                     LSGALMNLPDYQNLILQEWDKQQQSPFKKVLVVNDASGYAAQFLARQNMTIY"
     exon            complement(1111457..1113487)
                     /number=1
     CDS             1113927..1115336
                     /codon_start=1
                     /locus_tag="AO090102000401"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070322000017"
                     /protein_id="BAE61452.1"
                     /transl_table=1
                     /translation="MSETKSAEPDVISSSRDEESIPPRPAKNIWARIYHDPWFQVSLI
                     SFISFCNPGMYNALTGMGGSGQVDGTVAANSNVATHACTAGAALVLVGAFYKYLGPRL
                     SLLIGGWTYALYAGSLLHFNRTANGAFVIAAGAILGLGAAFFWVAQGTIMVTYTNDNT
                     RGRAIALFWVVFNLGGAIGSLASFGLNFHSKSGTVTDSTYIAYIVVMLFGWVLSVFVC
                     STESLSRKYHGSRISQDSKAVNWSNLKRTIMETVKIVFDWRVMCLYPMFYNANVFYSY
                     QQNTVNGMTFNLRTRSLNGALYWIAQMVGGLLMGSVLDLKGINRRARAWIGWAVLFVT
                     GMAIWGGGYKFQLWNDQRMQLGFKQDIDYKAGSQYLGPMFLYFFYGAYDSFWQSYCYW
                     IIGAQSQNPVVNAVIVGTYSALKPAGGAMAWRINANKLNAMSEFAMNWGLCIGSLLVA
                     LPSVLTLRKGKDNVETDHC"
     exon            1113927..1115336
                     /number=1
     CDS             1116584..1118257
                     /codon_start=1
                     /locus_tag="AO090102000402"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000016"
                     /protein_id="BAE61453.1"
                     /transl_table=1
                     /translation="MERFKDKKTILTEMSGLIYVMCALAAPFYCARVIASKEDGPSSA
                     VLYFDAGRGWAEAAMQCLFSSFGSPRIECIITAVLLHEYYLRVGDYAKGFLISGFIAR
                     HVQLLQLNMEYDDDILCRKSKMSWAAKETRRRVLWACYLLDASIECGINQLCLISSSD
                     IYVQLPCSEDLFVRNIPCNTEMLTRGKLLPFADAAVVSAAENLDIRAYYIRAMAIRSK
                     ILKYVKHLEGEIPWEVTETSQFHKLDNEIRELDASIPDSLKMSAENIYIFKASGRLNL
                     FFGVHILIAQTFNDLYRVGVSRLVFPNTATKWIRENAPAEFIKLCHRTCISKAAYIGS
                     LLQDLWNCHKLSIVDLPYAVHTQICSSVLVTSLSSWREPEPPLPHISHSDYKDILQTN
                     VTILKYLQRYIKADLYYESATQALKHFNTRFSNETPERRATSSIRETSPIESNDHNRP
                     SQSSLEHILNPLGTYPMARKQVQHYDQQHARDGTSDKPSVPQSDIAAFCPSTADNPAN
                     MDGFLGFQDQSFFSQFPDWAPDIPIISDMGYPTFLDQYPVSIADGGLVI"
     exon            1116584..1118257
                     /number=1
     CDS             join(1120561..1120618,1120669..1121159)
                     /codon_start=1
                     /locus_tag="AO090102000404"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000014"
                     /protein_id="BAE61454.1"
                     /transl_table=1
                     /translation="MKMATTHPRTIPYLTSPTMNFDLPSYSSMTDSRVGVCPWKGGTY
                     IIRDPETKLVIALEKGILGLYPEASVVESIYQFGRGSHWHCVENDRMWLGFYNAVSGT
                     YIGHDNRKSNWRFQAKAERHDEWEWFCARQHPDGGHVLLVKHWGEFLPMRIGGKDNRE
                     LMVDAKREGGTVWEFIKVDLEK"
     exon            1120561..1120618
                     /number=1
     exon            1120669..1121159
                     /number=2
     CDS             complement(join(1122013..1122130,1122239..1122408,
                     1122468..1122514,1122722..1122728))
                     /codon_start=1
                     /locus_tag="AO090102000405"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000013"
                     /protein_id="BAE61455.1"
                     /transl_table=1
                     /translation="MDDQDEVDKELLRTFIPRVTRIHARIRTTQSSQCPEPTNDVFKE
                     ERRFFEDSWKQIIQSIVQQRSSPITFVPEDGSFPYHPFGAAASYSDVADSEGHRLRTL
                     WETFAQEASSS"
     exon            complement(1122013..1122130)
                     /number=1
     exon            complement(1122239..1122408)
                     /number=2
     exon            complement(1122468..1122514)
                     /number=3
     exon            complement(1122722..1122728)
                     /number=4
     CDS             join(1124415..1124716,1125014..1125122,1125206..1125223)
                     /codon_start=1
                     /locus_tag="AO090102000406"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000012"
                     /protein_id="BAE61456.1"
                     /transl_table=1
                     /translation="MAAYSAQLRGASRVFVVDRVPERLAVAEKIGCTPIDFTKGDAVD
                     QIIRLNGGEVDRSVDAVGYQAVDTSGSKEKPNIVLENMIRVTRACGGMGIPGLYVPRL
                     DHAEVAYEKFDKREDGYTKVLIHPNGGFESTTVGQVTSKL"
     exon            1124415..1124716
                     /number=1
     exon            1125014..1125122
                     /number=2
     exon            1125206..1125223
                     /number=3
     CDS             complement(join(1126070..1126383,1126440..1126452))
                     /codon_start=1
                     /locus_tag="AO090102000407"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000011"
                     /protein_id="BAE61457.1"
                     /transl_table=1
                     /translation="MSAQGRLWDIQHGVEGEVEAGKGQITRYSNGQPTRFTFKKRFQR
                     TPNVQITPILTNRHGTFNPFYLYLMSPSGGPPADEDGFYLGIYSKPGVSMDFEYFATG
                     IYDGED"
     exon            complement(1126070..1126383)
                     /number=1
     exon            complement(1126440..1126452)
                     /number=2
     CDS             complement(join(1130988..1131287,1131342..1131481,
                     1131536..1132624,1132680..1132854))
                     /codon_start=1
                     /locus_tag="AO090102000409"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000009"
                     /protein_id="BAE61458.1"
                     /transl_table=1
                     /translation="MYLARAWLALWLVLHAQQGQTLVLEEISHTQVEPNPLVVRGVEH
                     TNLDLLKQDSFYYSGEQNGQSSFANFTVSLDGEQENIVSMERFEDLLESIHCTNTSVV
                     MSFKEEQAFTYAEHAWQWVNDMGNRTFVLIVGKGCCKWNTNRLPFIISKVTSDENTKT
                     MKLHGKGSSWLEIAHTYELNIGKQRASTSTARRDIDRSASLEFNHVIPVKSGRLPDDN
                     IDVTWECADCSTQGAFELDFHVKTVAGIPKTGSLHLSPNAVSATFMPRLAFDGDLKDQ
                     KSGEIDLGRIPITGISIPGGILNIGPQMVFSLGYVIGPLTGSATVTAGITANLDDSAE
                     VSIDLESRSVDSDGWTPSVEAIPMSVDAELEGEIELYPKASLQISAQVIGNVPVSTNK
                     TSRLTEIGKGVEVGLNLKPSLAATMAAIHSTDGACPDDPKHRENGITVDPSASVSLNF
                     EATFGDNNGEPDVNHVLAEYTAPLESRCYPLGPEPSSTPTPSGSPTPSSSAHPTSSEI
                     PSSSSDAPISSTTPSSVPPSSSTSPSSSILPSTSSATQPSKRAHHHHRRMGSHQRHRL
                     L"
     exon            complement(1130988..1131287)
                     /number=1
     exon            complement(1131342..1131481)
                     /number=2
     exon            complement(1131536..1132624)
                     /number=3
     exon            complement(1132680..1132854)
                     /number=4
     CDS             complement(join(1133996..1134349,1134398..1136173))
                     /codon_start=1
                     /locus_tag="AO090102000410"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000008"
                     /protein_id="BAE61459.1"
                     /transl_table=1
                     /translation="MQIQLMQTYLSIIVHASQHSLFLDNEGYESLLPSMRELTVERLS
                     PSTYPTKKPDTDAHASYEYNSYDDPYDEWAHSMYPDDFDGPYGRAPGVNKWPPYRSRH
                     GRRAAETNNYSFLRSWYDSLVEDGFYWDSNRLLYCTLALMGDAGGRHRLDGISWQDLF
                     RCPEHTLPQDEQLLLTELDKVSFLAEVSSGQPQTEYGKFHDKLSDRAQNIASSILSSA
                     PHLVNSRPYLSWMLAETDARPQAINAGRVDPRTSHNSFISRWQHRRQIDSKQRSQSTK
                     LQQDTLSQRTLNVIKEESMNLGDYQQQSRALKAIYRHSDYFSTCLESLQELGQLQYNV
                     MGDMAGYLSSLIEEYFLIEYFHPPNSKPFREHLAQRLSEFDRQFPYGPDFESTAREKM
                     DIFFFDNPLLKWMQRNVQAALLRSLDRHTEAEVAEMQITVPELHLPSYFSKQLKIFKS
                     CAGCKDCGSTSGKTRKTYHPAEPAVPARRAMDSSSAQPKTTTYRVPLVIQSEANATEG
                     KEEDVLHVEQMIRNHRNIRGKERKPHRRTVMFDESSTPRYTPQHSVSKDRRSEALANT
                     APTTIIVEDPNGKALMFPYDLCHTWKGMEDLIKQAFSGDRNALSQDIARGNYELLSED
                     GSIVLPVVWENLVQPGWKVKMQMKNTQPENKEMNHGDTDTANAEGSHTPENEKDNRPK
                     SYQAVAVEAWSSEEDIAPNPRREDEDV"
     exon            complement(1133996..1134349)
                     /number=1
     exon            complement(1134398..1136173)
                     /number=2
     CDS             complement(join(1136238..1136619,1136665..1136732,
                     1136781..1137098))
                     /codon_start=1
                     /locus_tag="AO090102000411"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000007"
                     /protein_id="BAE61460.1"
                     /transl_table=1
                     /translation="MPRHQQHIVPWTDSESDYSLSDYSTEDAHHETSSRRPSFGSSTL
                     NPGASTGARRRRRSSEPVPQPPDVIINIKDELRKKGSNRSTNRTREAYIDPYESDDET
                     FRREARVTEGEHDIQSSNRDITVHIDLLNRLGRFKEGIILFNERLAPHLDFFPVVAEY
                     ADLLLEQANFRSLGELISQVLGSHAKDFEKDQVLLLKLLGSLAGMHSKGALLPALDTA
                     KEVIKFLEDQDGEDSSDERLTGIQVRMDFMLTRPKCK"
     exon            complement(1136238..1136619)
                     /number=1
     exon            complement(1136665..1136732)
                     /number=2
     exon            complement(1136781..1137098)
                     /number=3
     CDS             join(1137351..1138188,1138238..1138707)
                     /codon_start=1
                     /locus_tag="AO090102000412"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000006"
                     /protein_id="BAE61461.1"
                     /transl_table=1
                     /translation="MSLFRRRKVSENSSRQAKPFRYVEFCQNQTSASLCEHQARKVRV
                     DCCFLFSKTQWGQLDDRDSGLMYLDLTFHQPSECKLANATITMTFNHTNEQRGGLKDS
                     VEVTEFFGPQMLSGEKKERHISKCFYMNPKFGAANASFEGVGGSRTSDATLSSRWKFT
                     GSRFTVNDPLSRRSNRAYRQLVWHLEENDLERQAIHNPVIHTALAFHHQSKPFYLDLE
                     IKAKLHSWHHRFKQHLVYPPPSQVSRTRAKIDPGVETDPFFAKTARNLNRSMIEANLH
                     PVTEVSDPKPTMELPDQKDESTLSLPGHDLLALAQQLTGQRVILPKQTLAVHNPETHP
                     TPPPSTISNSSTKVESTPNEHQPDKPAPITLDAYSSNPVEPKTVMMQAPLLQISQLLT
                     ALLASLIVGLSKLHSDLARAGKGSEGVQALQDDNYGSLDSKQT"
     exon            1137351..1138188
                     /number=1
     exon            1138238..1138707
                     /number=2
     CDS             join(1139416..1140223,1140271..1140514,1140572..1140836)
                     /codon_start=1
                     /locus_tag="AO090102000413"
                     /note="FAD-dependent oxidoreductase"
                     /old_locus_tag="AO070322000005"
                     /protein_id="BAE61462.1"
                     /transl_table=1
                     /translation="MTTHNPSYLIVGAGVFGVSTAYHLIQKYPNASVTLVDRDAYDAE
                     SRVAASWDWNKVVRADYDDKVYCQLALEAQDIFKSDPLWKPHFHQTGVYWTCRSSYAQ
                     NVITNHKELGRNDDIIALPVAEARKLYGGIFDNADYTGVKEVLINRASGWAAAGDALR
                     AVTKKCLELGVKYVTADIATLQFDGRGSCTGVKTKSGQTLSATHVIVAAGAFTPTLLE
                     WSAAASGNPGLRAEERILAAGITTGMAQLNEEQYEKFKDMPVGFQGYTPNEGKPFIGS
                     IPPTKDRELKWWGSKIFTNTREVLPGRYISSPPPTFDYNQWKVPGPLKQDIVEARNLW
                     YGPASADWKMTKHRICWDAFTTTSDFIISPHSASKGLYIATCGSFHGFKFFPVLGKYV
                     VQMLEGELAPELIERWAWDRQRPDSSQNVEYPNAEMKHLLQPASKL"
     exon            1139416..1140223
                     /number=1
     exon            1140271..1140514
                     /number=2
     exon            1140572..1140836
                     /number=3
     CDS             join(1141223..1142877,1143051..1143198)
                     /codon_start=1
                     /locus_tag="AO090102000414"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000004"
                     /protein_id="BAE61463.1"
                     /transl_table=1
                     /translation="MWLLNARTVTLEDFFESQAPSYAILSHTWGAEEVSFQDIQERQE
                     VCKKKKGYQKIIHTCRQALKDGLEYAWVDTCCIDKSSSSELSEAINSMFRWYGKAAVC
                     YAFLADVLPGCDPRDTQGPFATSRWFTRGWTLQELLAPENIVFYASDWSQIASKTELR
                     KELNLITGVDVRYLSSGRARHVTIDSPSRFGKPPGSVSDSTRRKLHQASVAERMSWAS
                     SRQTTRTEDLAYCLLGIFGISMPLIYGEGERAFVRLQEEIIKSSNDQSILAWGYLEPW
                     KSREDNQSELYAQVRVNEKRMGVLAHSPAAFRGCGSIIPSLVDKGNSLPLSVTNKGLH
                     ICLPVSDGEFPVALLRCRPVDNPTIVLAVNVKHVQGNIYSRADDMIEWVDHRTWSRWP
                     RKEIYLSLDEHLEEELHESEFSYPGSSIFIRHVPDTFSVQELSPYTRDMATSIFPPNY
                     KTISPGLSPCTGNIALLFTSKQDSRKVALYFSLTKLPRVGASPLMMRKETFLMSVPCH
                     ITNNEARDYLYHRSTWKNASNYIWCGADALYCSVTLQRVARVPLCRPYVQTGIYPASD
                     SLQFCDETRDSMAEDSSESIACDSSLVHGVHATF"
     exon            1141223..1142877
                     /number=1
     exon            1143051..1143198
                     /number=2
     CDS             complement(join(1144041..1144190,1144243..1144755))
                     /codon_start=1
                     /locus_tag="AO090102000415"
                     /note="predicted protein"
                     /old_locus_tag="AO070322000003"
                     /protein_id="BAE61464.1"
                     /transl_table=1
                     /translation="MHGQKLSSFPLFIKPACEGSSKGIYPSSKVDNFTELERGIQVLQ
                     TRFPGASILIETFLSGQEYTVSIIGTGKRSRVIGTTHIDWEGLSRQKQQASVAEKGPA
                     NTSDGSFWDVNNKNGPDADEPERFLNSRDNPNVQAVEDLALQAWRALECCDVGRVDIR
                     YGADNRPYVLEINPLPGLRPDWSILARTAVHEGISHKELIGKVIDSALERYPILKAKC
                     DH"
     exon            complement(1144041..1144190)
                     /number=1
     exon            complement(1144243..1144755)
                     /number=2
     CDS             join(1145996..1146193,1146248..1146586,1146635..1147201,
                     1147246..1147536)
                     /codon_start=1
                     /locus_tag="AO090102000417"
                     /note="lysine 2,3-aminomutase"
                     /old_locus_tag="AO070322000001"
                     /protein_id="BAE61465.1"
                     /transl_table=1
                     /translation="MRRVYWRSLYRHRLGIRWHATTSPCTSLDDSRHLPSAAAASRIS
                     YWKRIPAWSEVTESEFIDYKWQMKNSLQSPKALLNFLAAVLPSEIRSSSTQGYVTRAE
                     FIADVATGMKKAPMAVRLTPHILSLINWKEAYSDPIRRQFIPIASSFKPDHPQLQLDS
                     LHETHDSPVKGLVHRYPDKNDSYLATSVCPVYCRFCTRSYSVGQQTETVSKKRFLPLQ
                     KYWEPMFEYIARTPEVTDVVVSGGDTFFLEPSQLREIGTTLLGIDHIRRIRFASKGLS
                     VCPSRILDPSDEWTRVLIEISNRGREKGKNIALHTHFNHPQEISWITEQAAQKLFHNA
                     VTVRNQTVLLNKVNNNVPTMKRLIRKLADNNIQPYYVYQGDMVQGVEDLRTPLRDILH
                     IESHIRGTIAGFMTPSFVVDLPGGGGKRLASTFESYDTRTGVSRFLAPGVKGNTVHQY
                     YDPLWSLPEGSQTL"
     exon            1145996..1146193
                     /number=1
     exon            1146248..1146586
                     /number=2
     exon            1146635..1147201
                     /number=3
     exon            1147246..1147536
                     /number=4
     CDS             join(1149941..1150119,1150292..1150511,1150563..1150672,
                     1150723..1151066,1151123..1151774,1151803..1152406)
                     /codon_start=1
                     /locus_tag="AO090102000418"
                     /note="predicted protein"
                     /old_locus_tag="AO080611000001"
                     /protein_id="BAE61466.1"
                     /transl_table=1
                     /translation="MIYSIEIAEANIDQVEALSKRTQGCKSYQRRSRPDATATKTIRR
                     KLRCFPEDKALSEVSILPTKPRERFLVTAKDIDHLLHHLFGEDDHDYVHERARVQTAS
                     SLALFSGSAARAGAIVESSSYRKTNECLYYKHLTFNIKWSGDAGGLKRWVVIDPEFLK
                     GLRYRDDKMIPKNWFREHPVPGKSFVFWVIVHGIADGAFKGISTVEELLEKRPPKGRE
                     SWTLEWKEDVKELPFFRMTTSQGPKADEAWTFSSLRHHLTSLAERDGFRDRLRVHGIR
                     GAMANKIDPKATAATRGQALDHMDHDSYLKYQSSLKAVDMMALYYDLDPDYECREMEQ
                     SMAHHRDQNVPLRLDAASLAEFEKDEEVILINQRISELTQEIRGRPDKHADLVSERSK
                     LYTRKAKKLRTKRSEFIENWWNVCYDEYITGNDFLERDTTCLFQIYRKYMPERARLND
                     NIFKQVPLDSDIGRQCLRDAVSLCTSVEKVAYYPGMTPVEGKCPICAKQMSSRVLLLI
                     LTSIGLQERSKHILQCKRKSLNAAPYQQTYRNGKRAHRHTRRSFVQFCYLCAELICNE
                     EDWINHCQSHLQALQPRCGLLTFRYTLVAAGLCPFCLGDEKKRADERFQQWVKKATLL
                     NHIDRHLENLPPEGNVSCPHPCCNGRQYSDVSDLRRHFFNRHSIAEPRSNCVARKRKW
                     AETSMALESVKCDRHLEGSD"
     exon            1149941..1150119
                     /number=1
     exon            1150292..1150511
                     /number=2
     exon            1150563..1150672
                     /number=3
     exon            1150723..1151066
                     /number=4
     exon            1151123..1151774
                     /number=5
     exon            1151803..1152406
                     /number=6
     CDS             join(1153630..1153860,1153973..1154008,1154061..1154126)
                     /codon_start=1
                     /locus_tag="AO090102000419"
                     /note="predicted protein"
                     /old_locus_tag="AO070177000003"
                     /protein_id="BAE61467.1"
                     /transl_table=1
                     /translation="MSPNGRKLRKPYAGRRTMISIDFLGWTPKLDRGKNSQKLKQIHK
                     ASSLMTEWKNLRLYYQRLTQTQINEQDSKEILTKEDAGVYRRYRSRIQVCLFNSLALF
                     TVHRQNAL"
     exon            1153630..1153860
                     /number=1
     exon            1153973..1154008
                     /number=2
     exon            1154061..1154126
                     /number=3
     CDS             join(1157600..1158277,1160877..1160888)
                     /codon_start=1
                     /locus_tag="AO090102000421"
                     /note="ankyrin repeat"
                     /old_locus_tag="AO070177000001"
                     /protein_id="BAE61468.1"
                     /transl_table=1
                     /translation="MALEHGRTPSVKFLLKHVSPTVLNRAAKDGKTPLHVAASQAGNC
                     DIIQILLEYGAVRAISMVENDDRTPLHLAASLAGNAETVQLLLDHGAVESIKLVDNDG
                     RTPLHLAASLAGNAETVQLLLDHGAVESIKLVDNDGRTPLYFAASLAGNAETVQLLLD
                     HGAAESINMTDNNGKTPLHLATCLPWNNETVQLLLDNGAVETINIIDNNGRTPLHLAT
                     RLAGNDETSLI"
     exon            1157600..1158277
                     /number=1
     exon            1160877..1160888
                     /number=2
     CDS             complement(join(1162633..1162726,1162840..1163264))
                     /codon_start=1
                     /locus_tag="AO090102000422"
                     /note="predicted protein"
                     /old_locus_tag="AO080611000004"
                     /protein_id="BAE61469.1"
                     /transl_table=1
                     /translation="MSSDTLGSEGSCAEVVQQGVGDEKSGIRRKDTNLTVETEYVHML
                     LELDCIHWIYNFVSGFASWILLAGYLVVPGTFTTLQSSHTVKQELDTNPTRKAVLSTI
                     QNPPLVGISCSLLVIGALTMTYLFFRWKQNYFWLINRLFIQKWELVHYGSSNGNCNGN
                     DSVLLISSGTIL"
     exon            complement(1162633..1162726)
                     /number=1
     exon            complement(1162840..1163264)
                     /number=2
     CDS             join(1163731..1164325,1164488..1164609)
                     /codon_start=1
                     /locus_tag="AO090102000423"
                     /note="predicted protein"
                     /old_locus_tag="AO080611000005"
                     /protein_id="BAE61470.1"
                     /transl_table=1
                     /translation="MSGKRKTLLPKTLHLVHEQDLQDSPTTSISSFIEKPETHLAASS
                     NAAPQKSPGKLLKRDTDLQKCTSKIDKYYTIDQAGLGVLALKDAHHLPFCVIKKYPRN
                     SQKHIRNLKPARHKNLICLFEYAEVQSEMHLVYEYEHIPISLGCLAGSVQFSEVAIAT
                     VSREVLEGLQYIHSELRMSHGAINPSNILLTWKGEVKIGAETLDTITAESNLSVSAQE
                     FIDNTKCKSIKELLKVKGSG"
     exon            1163731..1164325
                     /number=1
     exon            1164488..1164609
                     /number=2
     CDS             join(1165782..1166196,1166268..1166560,1166631..1168017,
                     1168076..1168170)
                     /codon_start=1
                     /locus_tag="AO090102000424"
                     /note="predicted protein"
                     /old_locus_tag="AO080611000007"
                     /protein_id="BAE61471.1"
                     /transl_table=1
                     /translation="MEAGGLGQRADQITRRRLRSYRGCALVELRHLMFEGEEVLGSRP
                     LDPKNVDRLAKIYELEGCQQLEPEHRVAALIKEDILYQTIEQCNIIPNALFDYANPPT
                     LSFNQNVRLLCLYGKHRLKAAEIHAVASWLVDLYLDDIPAEAIIQLREESTNAKNFKE
                     GDSFRIYRHYKLAQNYAQERKWWARFQTDERRKHIRRLEQTPILINGFDLLLPYIGLW
                     DHLSASQVRQVLGLRCHELVSHYLKVIYRQWSDFFGTEKGGMVDAESVRLIEGRMPKY
                     SLDDQSFISEVMRSGQLFPRLPEPEDRHCLLQKILQTPGRILSLHTLSQDIRFLESPA
                     KAFRHLIPLRKKDTVNQALLKHFRVGDIGNNTEIQISEYEFSPAPAPVNLSFIGIIQL
                     WLFALRHFTRPPKVNGQQQTEAWYLHGQSLGEMAVLATRLGFSSNRIRELQSTDESRL
                     GPEKLFRSLCINMFYLVNDSKVHNMARHFNAGMRSLSRNKEGPRSPPAFTTERFEDMS
                     RRRYNSPTLDEYLRDRAHLFVGNIYSADQSPSQYPTSFAVTREIIFAFFGKEPLYSIF
                     SQRQPSSPSEVPELAREGQIPAPMESGSVAHDNAVVGLEQNIPALDANGDADEYGRAV
                     TLGSPNDYQYEPVELLPHPPGTPDRSLMDVITDDVPLATGFEEYDSKAPLAIKAEISV
                     HRKAVDILQIWYGADDVVVGNCALPYRIFPESIISSFAMSSVLSRLR"
     exon            1165782..1166196
                     /number=1
     exon            1166268..1166560
                     /number=2
     exon            1166631..1168017
                     /number=3
     exon            1168076..1168170
                     /number=4
     CDS             complement(join(1169075..1169110,1169207..1169641))
                     /codon_start=1
                     /locus_tag="AO090102000425"
                     /note="predicted protein"
                     /old_locus_tag="AO080611000008"
                     /protein_id="BAE61472.1"
                     /transl_table=1
                     /translation="MGTTKALGSPIQMNPPPYNQGTSCTAAEGGDQQDATFVKYGSPF
                     TMDRLFIGLDPTDGGITAIELIENRPVSFVLKVKINDRDIKLDRLRPTCHRHLANLKE
                     AFVCHESLLFIYERWDGVSLKGIQELRPTFELGEVEVATICCQPWSLKRAEYLY"
     exon            complement(1169075..1169110)
                     /number=1
     exon            complement(1169207..1169641)
                     /number=2
     CDS             complement(join(1171511..1172166,1172367..1172640))
                     /codon_start=1
                     /locus_tag="AO090102000426"
                     /note="predicted protein"
                     /old_locus_tag="AO080611000009"
                     /protein_id="BAE61473.1"
                     /transl_table=1
                     /translation="MESSSKDRTSLHCLPVELLEMIIRLLSSTTSLKPLSTVNRVFRQ
                     LCVPFIFRTLRISCSTSGLNCLVEASHCSIAPYVKAIRYEISERIDPHQQEIIQSNRD
                     LTSLCTSLPLFTGLDTIQLCFSSYFKPPFDWCAERMLLDGQLSFPRHVEVMATAIAAA
                     KKYRVAIRTLIISGFYPRVLCHSRLVTDIINEAFSDVKELQLHDSPAILNFFEQCPLP
                     QLERFEIGCYWMSVSHLERFIYAHARTIKFLHLEDIWLFRENREGNILNLTLADTKMI
                     LDSLTNIRYSGILSELTINRKIDGCYEMKESFA"
     exon            complement(1171511..1172166)
                     /number=1
     exon            complement(1172367..1172640)
                     /number=2
     CDS             complement(1173397..1175166)
                     /codon_start=1
                     /locus_tag="AO090102000427"
                     /note="predicted protein"
                     /old_locus_tag="AO080611000010"
                     /protein_id="BAE61474.1"
                     /transl_table=1
                     /translation="MAHEVPGTELNINTTSNDQSAEVGNAGGVASAGTVQAPVGTASV
                     SRKRQGSPLEAENPWVIDIIREATSKQIHEELKASFLRGEPDMSAATVFFAEVNQKIQ
                     KANDEHGAERDRGTIPGDAYEKLYADFKTALEKAKLERNEEAALYVVQETHSKFAKFN
                     QEHHLPEEWNINPDAFKHDSMPEVAPKPEPQDNDSLFSGSLPDYTGSETDIPDNVSTL
                     EELEREARYNQSLSAGEVLYWWKRGVGTQTFVQYGQGSSKTYRIRAGSYEVYDPESVP
                     RILSSGALSGDPSSVSCQGKQKLQYRNEKGRIEEAWAYTRDQVRGIVGVGWKVDDDDE
                     EGIEPLDLLVPEPYATYPHTRILVLWVDGAVTLEDRAFIRRITKGSYLNVARIIYHKA
                     LRQEIRYRKAERLPYEHLLDRMPTRAKEKQDIELGDEEYEQDGEELNSVEEVQPEYRG
                     SVQASTIRSASTRPPSNHGRSRTSEVRFVEPALEPRRPTSERGTARPSPNRVPHKSVD
                     IEDPRDAKIRWLEEQLEMSLNRNHQSSYDSSSRWRRYNRYDGRQSEVSEYTPEPRRRR
                     RAVHRERVWDNWTGSWVTARRVY"
     exon            complement(1173397..1175166)
                     /number=1
     CDS             complement(join(1175979..1176179,1176252..1176578,
                     1176618..1176683))
                     /codon_start=1
                     /locus_tag="AO090102000428"
                     /note="predicted protein"
                     /old_locus_tag="AO070206000011"
                     /protein_id="BAE61475.1"
                     /transl_table=1
                     /translation="MLKWDTLSGRFARSTERYCITKSSTEPSLKDQIEILRNENATLL
                     QKLKLSEEYSAEVSQRKTELEFEVSNLQDAINASNSIISNYQQEIQQWTSTVKYYEAY
                     CHQCTDELNQVISSLQRLKDCFAPIMCGELQDLICVSFLFILYGYNENKDAISTPVYL
                     ITPRATYTDVERHWLFTVHGHVVMSKKHGMAQWSVAL"
     exon            complement(1175979..1176179)
                     /number=1
     exon            complement(1176252..1176578)
                     /number=2
     exon            complement(1176618..1176683)
                     /number=3
     CDS             complement(join(1177356..1177372,1177512..1177674,
                     1177748..1178527,1178622..1179134))
                     /codon_start=1
                     /locus_tag="AO090102000429"
                     /note="predicted protein"
                     /old_locus_tag="AO080611000012"
                     /protein_id="BAE61476.1"
                     /transl_table=1
                     /translation="MKLTEGPYFIIISVVITLMALHWLYRCLSSFFNTRHSCLGRTSP
                     YHLFLRYLVYPRTTFRLLQIDTLSPLGFVLLIFYFAGTAIFNFVGATTTAEKGVRAAH
                     LALANLIPLYFSSGREFGAHILGISLEAYGIIHRTTGFMAALQAAIHVTIGYQNNAFN
                     LSSPTGFNGLLGGCMLLSLLILPMVKRRVYEVFFITHLVCAVIALVAIWRHIDSSHSQ
                     SRRYILASLCGLTATGALQLLRLIYRNVAVGRKSVRIVARPYSEDIVQAVLYIPRPWK
                     VRAGERINLGVPFLGIFYLFQAHPFTIAWWEEDYEGNADSISLMFRARTGFTRKVLDC
                     LEPDREYWAWIDGPFGPSSPQNFGSSREIADFGHILMVTTGIGIAAQLPYIKELLRKY
                     RNASVNTQTISLVWQLDRTGDWESARDWLRQLVKEDDGYMLKVAVYDPLRTDSPQEPR
                     KIGHHELISLYGGEVNWADILAGEMGKRTGKLLVTALARG"
     exon            complement(1177356..1177372)
                     /number=1
     exon            complement(1177512..1177674)
                     /number=2
     exon            complement(1177748..1178527)
                     /number=3
     exon            complement(1178622..1179134)
                     /number=4
     CDS             complement(1180242..1181072)
                     /codon_start=1
                     /locus_tag="AO090102000431"
                     /note="predicted protein"
                     /old_locus_tag="AO080611000014"
                     /protein_id="BAE61477.1"
                     /transl_table=1
                     /translation="MGTGEAASRPDQTPHFRHVFRDSFLRRGFDAFMSNLDTKAKWLQ
                     MVDQLDCTVRGDYLRMDVSLGGMPCTLDNAEIMDDYRNLVILQPGSARLAKEAAIGLL
                     VARFFFTLDGDFEKPVIGLDLWYHGTIRCKGPAMAVVEALRRLSLDNVDFVTDSETLG
                     AFGGVQDICPACGRYSKTVSFTLRHPGEIMNIYMRVNQHKQWRISGFPASMSSFAEKQ
                     YLYDQFGRLDHGRPATTPCNTCNPAADSFRGKRRKRTSVTSTEERRNKRVCIAGDVAD
                     "
     exon            complement(1180242..1181072)
                     /number=1
     CDS             complement(join(1181802..1181871,1182013..1182607,
                     1182744..1183755))
                     /codon_start=1
                     /locus_tag="AO090102000433"
                     /note="predicted protein"
                     /old_locus_tag="AO080611000015"
                     /protein_id="BAE61478.1"
                     /transl_table=1
                     /translation="MRPKTDTSWLDVGVGENGSYVIRDYGRLDEVVSELTQPRQQYPF
                     LSVFLGGKNKDIALQAIFPQNNIRRTQPSSRIGLRYDITSSNSESPILFADGNVTPTK
                     GVLGAMPGVHDYPITWPISSTDNASRLVYARLIFLFADLVCLFADDFPDLMSVAHFLV
                     DCVSMRSASLMLVAVRPRVLVVLMGNPDRSERNGPLQQFYKQLYEADSTHLSECFSHI
                     NVVYLDPIQSDSLRYDSVRTWIHNQKENIQIVRRENWSQVNAVQLQALFTSAIRNLVS
                     QNQAFFDFVKTSREWNPVGAGLSDHVAHFLEVGHREECKFEILLSSLVSALILDHCLP
                     GMMLMDPHAVFQTLYHDPVLRAFRHRQAPRFSKSVPELVSLIEQEFVTQYHIYASGEQ
                     SSIEYRRQHLLSTNHELCRVQSDKICLYCLVRTAQHSQVCCHTICDLCPQLFGNAAPD
                     AEYQFSMVGCLLCNSRAVTTIDVLPPTMNPTVLAIDGGGVRGGIPLEYLLLIQESLGP
                     ECKLADLVDLAVGSSSGEYRLSIPRSRGLTVLRGVFFASADNPLYRGYFA"
     exon            complement(1181802..1181871)
                     /number=1
     exon            complement(1182013..1182607)
                     /number=2
     exon            complement(1182744..1183755)
                     /number=3
     CDS             join(1184569..1184843,1184925..1185363)
                     /codon_start=1
                     /locus_tag="AO090102000434"
                     /note="predicted protein"
                     /old_locus_tag="AO080611000016"
                     /protein_id="BAE61479.1"
                     /transl_table=1
                     /translation="MLLPFNMYDFPPLTYNATDSGIGDEQPNYSRLMCQDMFNDQNIS
                     VTGIDDIDGTGGTSQTAHPSSRDAAELGQGDRYELQVNGSTTYDHDSRVSSLQRFSYG
                     QEPLIPTSQLILRKLLQMEATVNRLEQARKEGVDKTLNERMNILAERLDKMDVRVNAF
                     AGIVDELLDLPDKVENLSKWMNDLGNTFQREKEWMNNLMSGVDDACKRFRYLIFGLSQ
                     PRGRNRLGNGHEKEQENEG"
     exon            1184569..1184843
                     /number=1
     exon            1184925..1185363
                     /number=2
     CDS             join(1185533..1185619,1185699..1185727,1185747..1185804,
                     1185860..1186483)
                     /codon_start=1
                     /locus_tag="AO090102000435"
                     /note="predicted protein"
                     /old_locus_tag="AO080611000017"
                     /protein_id="BAE61480.1"
                     /transl_table=1
                     /translation="MWAKPFCILVTRIEKLDTTITCTIWRTTELHRDRMSWNSESKKS
                     TMMASLPMQNMSPPIFRNQSSHNEEILGLVNVFVHREKESVLRQKQLESRLSAESARL
                     QNERHQFTQLQEKLAKAESLKGLLEVQLLKMSEEVEILQQELIMERAKSQELESRVSI
                     LFHVNDMLVRKAIETESSGTSFGQRPLDFFPLHLDNLRHQETTKDLGTVAKTKDEVMM
                     PLAASIPTGFQSSSPLVESENSWDSVVPNGISIDTSLVPQLPVQSDS"
     exon            1185533..1185619
                     /number=1
     exon            1185699..1185727
                     /number=2
     exon            1185747..1185804
                     /number=3
     exon            1185860..1186483
                     /number=4
     CDS             1186945..1187328
                     /codon_start=1
                     /locus_tag="AO090102000436"
                     /note="predicted protein"
                     /old_locus_tag="AO080611000018"
                     /protein_id="BAE61481.1"
                     /transl_table=1
                     /translation="MDSYTCHVLYPIEEEITPQDHLILQNGGTSSNIERLQSRLQQSK
                     LPPRSLKKRVEDLAYENSYLKAELAWHTETKHALLQFREEMYTMFHRMEDALVELKNC
                     LRNAESRYLSFWGLDVCDTNSNDMI"
     exon            1186945..1187328
                     /number=1
     CDS             join(1189048..1189247,1189375..1189415,1190884..1190963)
                     /codon_start=1
                     /locus_tag="AO090102000438"
                     /note="predicted protein"
                     /old_locus_tag="AO080611000019"
                     /protein_id="BAE61482.1"
                     /transl_table=1
                     /translation="MRVQAFIFVLLGLGKSYAAHFSKTCSSYELEGSMLFAKCQESPD
                     KERHTTVDLNKCLGHKEGTLVRGGKGVIAPSSPLNLANCSNLLRISWDSILQLCPNAI
                     DNIA"
     exon            1189048..1189247
                     /number=1
     exon            1189375..1189415
                     /number=2
     exon            1190884..1190963
                     /number=3
     CDS             complement(join(1194931..1195328,1195378..1195405))
                     /codon_start=1
                     /locus_tag="AO090102000439"
                     /note="predicted protein"
                     /old_locus_tag="AO080611000020"
                     /protein_id="BAE61483.1"
                     /transl_table=1
                     /translation="MGKFLHVLMRRQNGAKARSREKRITQNDAPKNIPPAGVYQAVSQ
                     NFKMDLPPGTLQTDIDQMVFKSDWTLNPQWEVRLVGVKTKRGWEYVFRHRGTGKEYDE
                     VDLLRYRHSWADMSEKQRQERLAKGTSPYLGGGGGIRRG"
     exon            complement(1194931..1195328)
                     /number=1
     exon            complement(1195378..1195405)
                     /number=2
     CDS             join(1196756..1196958,1197066..1197121,1197170..1197237)
                     /codon_start=1
                     /locus_tag="AO090102000440"
                     /note="predicted protein"
                     /old_locus_tag="AO080611000021"
                     /protein_id="BAE61484.1"
                     /transl_table=1
                     /translation="MRYQALSLALLGLGKSYAAHFSDTCNSFDLQGSLLMAKCSKSPN
                     GYYYDTVVDLNKCVGNKDGVLIRGCMCYGTKGVLAPSSVLNLDDFISNQGGTLTCDQE
                     VQVAPR"
     exon            1196756..1196958
                     /number=1
     exon            1197066..1197121
                     /number=2
     exon            1197170..1197237
                     /number=3
     CDS             join(1199142..1200159,1202082..1202233)
                     /codon_start=1
                     /locus_tag="AO090102000441"
                     /note="predicted protein"
                     /old_locus_tag="AO080611000022"
                     /protein_id="BAE61485.1"
                     /transl_table=1
                     /translation="MRPSSRDEFAIAIICALTLEAEAVEALFDETYDRLSAFYKKQSG
                     DDNAYFNGRIGSHNVVLCLMPRMGKGNAASVAASLKISYRKIQVALVVGICGGAPYSP
                     TKEEVFLGDVIISDAVIEYDFGRQYRGGFMRKAGVRDTLGRPNREIQSLLAGLQPQQS
                     RRDFQAKMLQHLRVIQAAQPYWRQPSSADDVLYEASYQHKHYGSGSPHLCSCLDDTSD
                     EVCPEALDASCILLGCAQDQIHRRRGCRENTNPTIQIGTVASADTVMKSGEHRDNLVK
                     SEGVIGFEMEGAGVWNNISCVIIKGVCDYADSHKNKAWQAYAAATGAATAKAFLEYWD
                     PTVLEGQAARRPKRFLTIRKLVQRQTICCLSLSFMLIKIPLVAQPLLPRLHLTYC"
     exon            1199142..1200159
                     /number=1
     exon            1202082..1202233
                     /number=2
     CDS             complement(1213398..1213841)
                     /codon_start=1
                     /locus_tag="AO090102000442"
                     /note="predicted protein"
                     /old_locus_tag="AO070266000053"
                     /protein_id="BAE61486.1"
                     /transl_table=1
                     /translation="MTCFNGIFLQAITPPWLGWFCFGQRSPIDWMDCDNGRQDDSKSV
                     TSHDKPLSGSSEYQTPRPLSYEEDQPNPPALAKSPKYSLFPKQSNPSSSPKIQRIKPA
                     SHAGSEEEAKAARTETLRKDQASTDRIKGTSTSMDSGEIIVLPEP"
     exon            complement(1213398..1213841)
                     /number=1
     CDS             join(1219026..1219152,1219263..1219438)
                     /codon_start=1
                     /locus_tag="AO090102000444"
                     /note="predicted protein"
                     /old_locus_tag="AO070266000051"
                     /protein_id="BAE61487.1"
                     /transl_table=1
                     /translation="MFTNVRQLNQQLFLQWTVIQTTMFLSTRQNLSQTQTQTVIRINT
                     MSPSNHPQFVPPTSIDTTIFSSYPQFAPLDMMMFSNYPQFIPEPPQESEMGNLFNN"
     exon            1219026..1219152
                     /number=1
     exon            1219263..1219438
                     /number=2
     CDS             complement(join(1219796..1219926,1219995..1220161,
                     1220205..1220283,1220413..1220446))
                     /codon_start=1
                     /locus_tag="AO090102000445"
                     /note="predicted protein"
                     /old_locus_tag="AO070266000050"
                     /protein_id="BAE61488.1"
                     /transl_table=1
                     /translation="MAIRSALSKISDLGSSHVMNRPTLPHHAPQLNIHSDAEPRAISI
                     YHLISAPNTIRELKEISISAYLYCFHPTGPKESVSRYYTIEHRHSDIAIDCAENTRVL
                     GIEEILLWRNWRVSYGRLTGNRRVTIHISVMIPD"
     exon            complement(1219796..1219926)
                     /number=1
     exon            complement(1219995..1220161)
                     /number=2
     exon            complement(1220205..1220283)
                     /number=3
     exon            complement(1220413..1220446)
                     /number=4
     CDS             join(1221836..1223218,1223264..1223671,1223845..1224063)
                     /codon_start=1
                     /locus_tag="AO090102000446"
                     /note="vacuolar sorting protein VPS1, dynamin, and
                     related proteins"
                     /old_locus_tag="AO070266000049"
                     /protein_id="BAE61489.1"
                     /transl_table=1
                     /translation="MDTPPEKDWIQLDSGQARNGLGLVSSKTSERLNQVDRIRANGVG
                     DHIALPQLVVCGDQSAGKSSVLEGISGIPFPRQDGVCTRFATEIILRHELKYRRNTAT
                     IIPHISRSEDERARLSAFHREVTDIAQLPGIIDEAARLMGVQGANELADAPTFAADVL
                     RLEVVGDTGLHLTLVDLPGLISVSENEDDLQLVNDLVNSYLENSRTIILAVVPASSDV
                     DTQSIIQRARRYDKDGLRTVGIITKPDLINDGTEARVARLANNADRTKLKLGFFLLRN
                     PRPLDLEKGITMIERRKMEADFFANQPWNKLGLDPSRVGIDNLRVFMQDLLDRHIERE
                     LPKVRKDVAQLLNEINKELMDLGTQRTSPAQIRMYLTRIGTDFQNLVRAGVEGLYGNR
                     DAFFDEINGEKDYHRLRAAVHMANGRFANYMRQHGQKRKIVSAEGQEGTDSDTGQILV
                     TEEQMSAWIKNIYDRTRGRELPGNYNHALLGELFHEQSSRWADIAREHVTTIADLVSR
                     FIQAASEFVIKDPSARDNILRIIVAKLDENAECAFHELCKLLDDEAGCPITYNHYYTD
                     NVQKARNKRSRQDLGTSLNNAINKDWNGRFHVAMKTFVDNVCRQVIERHILAKLPAVF
                     SAMTVATFSDEDLVHLAAESPKLSRRRTEAIQLQEALEDSLRDLR"
     exon            1221836..1223218
                     /number=1
     exon            1223264..1223671
                     /number=2
     exon            1223845..1224063
                     /number=3
     CDS             join(1226921..1227251,1227617..1227633)
                     /codon_start=1
                     /locus_tag="AO090102000447"
                     /note="predicted protein"
                     /old_locus_tag="AO070266000048"
                     /protein_id="BAE61490.1"
                     /transl_table=1
                     /translation="MSTRVTPNPGRYFPQVPLRVYQALFISVQVATSSSGYCTGTGKM
                     EQQELSPQHSKTMADPLSVHNGSSSFFNASIRVLCLILRSICLFPRVLGMGKVSIKEL
                     VLSSSSFPQHEVE"
     exon            1226921..1227251
                     /number=1
     exon            1227617..1227633
                     /number=2
     CDS             complement(join(1229958..1230075,1230181..1230388,
                     1230487..1230535,1230592..1230617,1230671..1230832,
                     1230862..1230899,1230941..1230984))
                     /codon_start=1
                     /locus_tag="AO090102000448"
                     /note="predicted protein"
                     /old_locus_tag="AO070266000047"
                     /protein_id="BAE61491.1"
                     /transl_table=1
                     /translation="MLPTIIETRIYNIYQFIYFVKHSKISRGDNGGTSDSAHHIPYNV
                     SICMPRQTNFTGYRNHFRMPSPQSGGVGNSVFVRQWHVRMKLEEARKDLSSVDRNKAP
                     WIIAVAAGHRPWYISAKNESGTVCEDCRKVFEPIFLKHGVDLVLSGRTHLYERNAPIR
                     TFNADPNGLNNPSAPCKLTSHNRTHLTHEFISSSNGTVLDAATLFKSRDCSGNH"
     exon            complement(1229958..1230075)
                     /number=1
     exon            complement(1230181..1230388)
                     /number=2
     exon            complement(1230487..1230535)
                     /number=3
     exon            complement(1230592..1230617)
                     /number=4
     exon            complement(1230671..1230832)
                     /number=5
     exon            complement(1230862..1230899)
                     /number=6
     exon            complement(1230941..1230984)
                     /number=7
     CDS             join(1232081..1232122,1232178..1232365,1232435..1233656,
                     1233704..1234088,1234158..1234417)
                     /codon_start=1
                     /locus_tag="AO090102000449"
                     /note="predicted protein"
                     /old_locus_tag="AO070266000046"
                     /protein_id="BAE61492.1"
                     /transl_table=1
                     /translation="MIRQMSQENRLITHRKCDHQDREVRSLNKALRLSCQRCHSQKVK
                     CTGGKPCSRCLVAGCEKECRYIKRDRKVRVDESYLEQLIQDSQELHRNQRESVSNITF
                     GAESGGVPTSTRNPISENDSSTRNPLLKDWAWFQTQNKSALPIYVSEVACTAFATRLC
                     QCLNSKDASTSDMPRMRYVKESALGVLSYGEIEWPSLARARLLVNTALGHANPPFHLA
                     LRKTSVDYLQTIYQNATFDDPVLVCKYFALFALGEVCSVPSGRLNNDTSPGTTYYARA
                     INMISVLPERPNMAHIEALLILVLLSLFLFTSGFTDLYEALCSQFLNRWHSAYVLVGI
                     ALRLGLSAGFHHNIPETQYPDPIARENRIRVWWTIYIFDRFWGLKLGLPMQVNDDDIH
                     VDFPSNLAVETFHDEFADSSYQVAVIELARISTHIMRNIYSRQKSAETLLQREQKLLN
                     EMKQWMQSVPDHIRLQPDTHNRRCTVLIHLQFNYCLILAIRPLLLGILDHIATTDFSP
                     ETTLSPALATLTEACIHSARHTLILCADEWTKGSISVFGYAFAQYIFTSSLVLVISNL
                     LPYGNADDLASIDTAAEMLRSFAADGNLMAGDLYEHIQKVQKCHSSDDAPSVPHPTAT
                     TYVPPTNSQIYPTSVAQLPISDPQYKTAEMSLYQPTMEDFLTQSVTDIGLLDPEEIST
                     NLPDSWPSIPLWTNDF"
     exon            1232081..1232122
                     /number=1
     exon            1232178..1232365
                     /number=2
     exon            1232435..1233656
                     /number=3
     exon            1233704..1234088
                     /number=4
     exon            1234158..1234417
                     /number=5
     CDS             complement(join(1235131..1235395,1235882..1236114))
                     /codon_start=1
                     /locus_tag="AO090102000450"
                     /note="predicted protein"
                     /old_locus_tag="AO070266000045"
                     /protein_id="BAE61493.1"
                     /transl_table=1
                     /translation="MLLDKKANVNRVYRLPEFEDLWVRHETILWKRFEAYITGVGKDR
                     AEVDWRRCVALQTMQLSTRIMAPTMQRWDRRHQQDVVEVLLRSDTLDVDSKETDTLRI
                     PQATDNGEPDLIVTLAESKLMTAGPPVLCCREGVQGGGGNTTKLKQGRCQLKGRTRVD
                     TTNVC"
     exon            complement(1235131..1235395)
                     /number=1
     exon            complement(1235882..1236114)
                     /number=2
     CDS             complement(1239775..1240182)
                     /codon_start=1
                     /locus_tag="AO090102000453"
                     /note="predicted protein"
                     /old_locus_tag="AO070266000042"
                     /protein_id="BAE61494.1"
                     /transl_table=1
                     /translation="MKDAKPRDRLARQLGIICFEMEAAGLVGDFPCLVIRGISDYAKF
                     HKNDQWHGYAIATAAAYAKELLSVVLPVEVVEKDPADVRSTAASESSLMSPDRSVYSG
                     TFFSGGGPIFLRNQNAGRDRNIRTGSHSRDSTF"
     exon            complement(1239775..1240182)
                     /number=1
     CDS             complement(join(1241093..1241163,1241217..1241320,
                     1241387..1241543,1241594..1241723,1242452..1242469))
                     /codon_start=1
                     /locus_tag="AO090102000454"
                     /note="vacuolar H+-ATPase V0 sector, subunits c/c'"
                     /old_locus_tag="AO070266000041"
                     /protein_id="BAE61495.1"
                     /transl_table=1
                     /translation="MQLKPDPFFGTVGCASAIVFTSFGAAYGTAKAGVGICSMGVLRP
                     DLIVKNIVPVVMAGILGIYGLVVSVLIANNLAQKVTIYTSLVQMGAGLAVGLAGLAAG
                     FAIGIVGDAGVRGTAQQPRLYVGMILILIFAEVLGLYGLIVALLMNSRAGIVEHTCE"
     exon            complement(1241093..1241163)
                     /number=1
     exon            complement(1241217..1241320)
                     /number=2
     exon            complement(1241387..1241543)
                     /number=3
     exon            complement(1241594..1241723)
                     /number=4
     exon            complement(1242452..1242469)
                     /number=5
     CDS             1249352..1251064
                     /codon_start=1
                     /locus_tag="AO090102000457"
                     /note="predicted protein"
                     /old_locus_tag="AO070266000038"
                     /protein_id="BAE61496.1"
                     /transl_table=1
                     /translation="MATEAIIQDFLTNEVPVFRVGEVEYERSVATANLLYRFTRPDCV
                     VQPRGNGDVQYIVTQAKARNVSLTIKNGGHSYAGFSSAETGILLDLVRMKKVTIDRKT
                     MIVTLQGGCQWGHAYKQLVNERMNGAIINGGRCPTVGVSGFTLGGGLGPFTRSFGMGC
                     DTLKEATIVTADGKLVTVTDGDDPKSDKGRLFWALCGAGGGNYGVVVELKLKIQELQN
                     SGGEVVAGRFTWMPKVDEMDDFMQTMIRFYTTDWPEQMTLDSSWLCDLKQTSSELGVR
                     VLSYFDGSKDEFDNVINTFVQQPVLKKQLKRRSMAEPSTRFLHETLVSQWSEETVKSF
                     PTNRSYQIYSSFVFKNDRSRMKAVTEAIRKEMQAFRKLFNGEQGLLQVTWIHSGGEAS
                     RKKRSATAFRWRDCTYHVYIMLQWEDKWLERDMWGFLGLFKQKLQPYSMMGRAAFINF
                     PDRTLTTEAHEKVYYGNNRQELQRIKRIWDPDHFFDWKQGIQRPTSTREVQSRMATIQ
                     LRTEPDTGTAAADEEEEGGYEVSLDEKDLTDKIAGSQWNDVSLPPQNAVGGSGVFALT
                     DLGF"
     exon            1249352..1251064
                     /number=1
     CDS             complement(join(1251150..1251471,1251531..1251881,
                     1251958..1251974))
                     /codon_start=1
                     /locus_tag="AO090102000458"
                     /note="predicted protein"
                     /old_locus_tag="AO070266000037"
                     /protein_id="BAE61497.1"
                     /transl_table=1
                     /translation="MSIEVKSLNGQWVGVYTFDNGNGATNGESEFFLSFDSDPNDRTL
                     ARINGQGFDDAGSFTIVGTLDSKNLINLRKNYSSHGWTYSGKLDRALSVLHGSWGDIR
                     NGPMGFFAFQQVGDEDVVSAGERTWRINGRWKGTYSAAREDTRWPCEFELTASPGKKE
                     EQMAIVGKGVDNAGAYWIKGMVLSAHQVIFVKQYAGHSWIYRGELDEDGSVMEGDWEG
                     KGDQGTFTFTH"
     exon            complement(1251150..1251471)
                     /number=1
     exon            complement(1251531..1251881)
                     /number=2
     exon            complement(1251958..1251974)
                     /number=3
     CDS             join(1253697..1253781,1253827..1253903,1253981..1254391,
                     1254448..1254591,1254608..1254616)
                     /codon_start=1
                     /locus_tag="AO090102000459"
                     /note="predicted protein"
                     /old_locus_tag="AO070266000036"
                     /protein_id="BAE61498.1"
                     /transl_table=1
                     /translation="MQTSLPRQYGQYWIPEQGLPHLPPSPGEATVTSAAPAACAVRSS
                     AMSVRAVETSVTQCSERKHDQYFQKAVTRQPQLAFVYAPTEHWEAHAKPFLLGQFTIV
                     TLHGARVYGSLDFLPQLLERAGTESTLYKVCDAIASAYFANRSRSDSIEFGHRKLYVR
                     ALQSLSNDVSDVEKQSQDTTLAAVWLLCLYELIVGARGQEPRGWRTHGEALIGLLRLR
                     GQNQFQTRTGCQLFQLAYQTVAE"
     exon            1253697..1253781
                     /number=1
     exon            1253827..1253903
                     /number=2
     exon            1253981..1254391
                     /number=3
     exon            1254448..1254591
                     /number=4
     exon            1254608..1254616
                     /number=5
     CDS             complement(join(1255593..1256891,1256948..1256995))
                     /codon_start=1
                     /locus_tag="AO090102000460"
                     /note="predicted hydrolases or acyltransferases
                     (alpha/beta hydrolase superfamily)"
                     /old_locus_tag="AO070266000035"
                     /protein_id="BAE61499.1"
                     /transl_table=1
                     /translation="MRLRSSLCIGALFTLATASRSIPNVTITNSTTSTYQLSSDSEFA
                     FVLETFLSFANGGGAATGEILRAASQIKPGDMESFYREFKYLADQIADQAMSVNTTRF
                     PVSAREAHLRASSYYRAADFFLHGNASDPRIQTLWDSVLDHYDTAMKLLPDPPEQVEL
                     DGTEYKIPIYFHPPPKSSHANATSGQRKRLPTILIGSGYDGAQQDTYHQLGKEILARG
                     WNFVTYEGPGQPTVRRQSNIGFIPDWWSVVTPVVDWLRTRDDVDTDRIALGGISFGGQ
                     LAPLAATREHRLAAVLAIDGMLDLHETVLQQFPASIQKLYQSGNKTAFDAIVWEAYKE
                     TTDTSQIWGIDQGLWSFKTSSPFEWMTKMKKMAIDQTMLDNITCPVFVASGQDDHIAP
                     GQPERMARLLGDKAYYHLFKNNVGAGEHCTIGAEPQLAMATMDWLDEIFENPTSRS"
     exon            complement(1255593..1256891)
                     /number=1
     exon            complement(1256948..1256995)
                     /number=2
     CDS             join(1260071..1261292,1261358..1261597,1261640..1261866)
                     /codon_start=1
                     /locus_tag="AO090102000461"
                     /note="nucleoside phosphorylase"
                     /old_locus_tag="AO070266000034"
                     /protein_id="BAE61500.1"
                     /transl_table=1
                     /translation="MDSQRKRLAHRDYRIGWICALPKELTVAIAMLDEQHERLLPASY
                     RDNNTYVFGKIGNHNVVIACMPMGVTGNAPAALVANDLLHSFPHLQFYLMVGIGGGAP
                     NDQNDIRLGDVVVSAPTGQHGGVVQYDFGKTLADGVFHRTGTLNRPPSVLLSTLSYLR
                     SSYELLGRPDFLRHLSAARSRYPHRAAAFSYPSTLSDTLFKADYDHAKPLQPCEGGCD
                     RRRAVRRPLRRNNNPSVFFGNIASANQVMRHGLTRDRIAREHNVLCFEMEAAGLMDQF
                     ACLVIRGISDYSDTHKNDQWQDYASAVAAAFAKDLLLVIPTRALSGGLPRSPDTDSLH
                     SDMPLTDVHDEEDAGRQDDRTESNCATETVASPSTPDTTEATASGPLPSQNSTYPEII
                     QLRPRVPLNWQQFHSFPHEALQEPLTTAVPLGLDRSLDFELSIIMAQRPDSRIGVVYI
                     CDVHLEPRRSSKNRIIRIGSTTDVYRHLKARLNSSTHESDTYRQILNCGQVELLIHTT
                     LQKFKYDKKCQCGNNHTTLFEIGEDELDNILKTVEHWVSWSERKFGHIVVPRGG"
     exon            1260071..1261292
                     /number=1
     exon            1261358..1261597
                     /number=2
     exon            1261640..1261866
                     /number=3
     CDS             join(1264429..1264480,1264535..1265475)
                     /codon_start=1
                     /locus_tag="AO090102000464"
                     /note="voltage-gated shaker-like K+ channel, subunit
                     beta/KCNAB"
                     /old_locus_tag="AO070266000031"
                     /protein_id="BAE61501.1"
                     /transl_table=1
                     /translation="MATLAGKQISQNGLGLMRLIWHYGPTPDEKAFRVLKTALSAGAN
                     VWNGADFYGLPNNNSLHLMNRYFTAYPEDAEKVVFTVKSGLVDMKTFTMDGSRNGLRA
                     FADNTLKILDGKKKIDIFGLGRVDPDVPIEESVKALAELRVEGKIGGIQMSEVRADTI
                     RRAASVTKIDMVEAEVSLWSREVFENEVAEACAENDIVLVAHTPLGAGMLTGSIKTVD
                     DLPQTHHRTVPRFQPESIAQNRLLVEQLERFAESKGCTAAQLALTWLKVQSRKPGMPF
                     IVPIAGARSEERVLENMADIELDDTDLERIQSILDNYPVAGARYPPAAARLIEY"
     exon            1264429..1264480
                     /number=1
     exon            1264535..1265475
                     /number=2
     CDS             complement(1266690..1275725)
                     /codon_start=1
                     /locus_tag="AO090102000465"
                     /note="non-ribosomal peptide synthetase modules and
                     related proteins"
                     /old_locus_tag="AO080558000019"
                     /protein_id="BAE61502.1"
                     /transl_table=1
                     /translation="MNREDEKVTLPRSLCRTKTKDRLSRENAARKCRIDTHEIEAIRP
                     CTKEQLLYAPLLSRGDEAPIAEWTFDISEAINLDLLKKAWQDIARSNEFLRTRIIADG
                     SPEIFLRVVLDGETLLWSEGDDIDDPWVLGSSLARFHIIKMPKTNQRRLVLKVHHAVC
                     DPSSLYAVFESVDHAYHREDDHTLQHCEAEVNCNTEGPFYHATTFPELPPSVRYPAAR
                     HTIQQSISLGTSTYRLGEITTYIWLAWAITQSQYQSSDRVLFGTAARCDEERPGSPPS
                     VNPRLLVLDNQAVVRDILQELRVMLIRSSEATTAVPHSAAAKQISGAIQTVVSVGKRS
                     QHQPLRFANLVDSQKQNPFQSYALTLDCRVEGDSLLTVQVHYDNNVIPQWTTQRVLSH
                     FLHILSQSLHGNLDTKLANFKGLSPNDEGQLAYWNGHPLPIVDQPAHHIIHRICLKQP
                     DAEAICSWDGKLTYHELDILSASLASRLVELGMGGAESIIPVYIDKSRWVPIAILAVL
                     KSGAAFTLFDPSYPVQRLRLMAEDVDARVILCSKMTAELASQIVPQTLQIDDETDCSE
                     LHPGPVSHVLRPSRPEDALYVAFTSGSTGKPKATVIEHGSYCTGAREHIKAFRLNKNV
                     RVLQFALYAFDVSIMEILSTLMAGGCICILNEVQRTTPQAFEEAFSTLGITHALLTPS
                     FARTLRHVQLPSLDVLILGGEPMSPVDAEHWASRDINLMNAYGPAECSVNTTVQPCVF
                     SNPGNIGFPTGAACWVVDPRDHNNLVPIGAVGELLVQGPIVGRGYLNDPALTKASFVK
                     FVPSISPRLPGTEIAYRAYKTGDLVRQQMDGSFVYIGRKDQQVKIRGQRIELHEVELQ
                     VQKSLKNDCDVVIETVITEGQPQPLLVAFLNLKVHGGHVNRDLGPFAMPDEEWLRHIE
                     AIEEALKQSLPPSMVPEVFFPLAYTPTTPTGKIDRRLLRELSTSLPRPQLELYRNRNK
                     NKFKQLPSTHVEETLQQLFSEILEIEQHTISVRDSFFQLGGDSISAIRLVGAARGAGL
                     DFTVGQLFSTPTISGVALHAKELGFLKDEPSKLSPFVLLGASGNFPEIMQLVRNQCKL
                     PNIDNIEDIYPCTALQEGMFALSVKSPGTYTGDILLRLPGSMDIERLLSAWHATVEAN
                     PILRTQIVQTPKALFQVVMRQVSFKCKQHASLDAFEKLHDLHDRGVSSNPMCQVGLVK
                     HNGDQHFALKIHHSLCDGWSLKLILDQLDVAYRKDVSLTPSYFNTFIRHLTSIDGWED
                     YWACELRDLQAPIFPALPSPSYIPRPTSLREHAIDNICMADSGMRLPLLIKLAWSILV
                     SNYTDSDDVVIGLTLNGRNAPVPGIEHLTGPTITTVPLRIRIHENDTVRTALDCLHNK
                     LTAMIPYQHAGLQRIAKLNDNCRSACSFQMQVGIQPSADFDTKGRCFDIVERSIGASM
                     DYSDFSIYGIVAVCELSATGTALRVKMRYDPDLISSDEANCMVHFFEHILRQMCEYPD
                     TRLSQLELAGPQDIELFAQWNATVPAPVEACLHELILSHSRTQPGASAICGWDGHLTY
                     KELGPIIIQIAYYLRESYGIGPGVKVPICPNRSKWAIVSMLSVLYAGAACVLLDPNHP
                     QARMQGIISDTAADVVICNTETEEKVAGLTRHLVIVGPGLLDSLPPSTSHSQCLPNAT
                     PKDPAFIIFTSGSTGKPKGIIMSHQSLSTSIYYHGPPLGVNEQTRTLHFCSYAFDASI
                     YEIFTTLVRGGCVCVPSTTDCTNNLAGFIRDFKVDWALMAPSVVRLLHPDNVPSLKCL
                     VVGGEALTRDIVNLWADRVRLVNAYGPGEATIMAGGVVQANHWITGLIGPVVGANPWI
                     TKPFDPNRLVARGMIGELLIEGPVVADGYIIAPGKGPDPFISAPAWLRSIRPNSAGAT
                     RFYRSGDLVQQQRDGSIRFMGRRDNQVKLRGQRIELQEVEHCATSHFPEAVVVAEVAS
                     FLTNGRSIDELVLFIKGSNAKAESDMNTSNSQDTSTLFSSPTNVDHTAMAGLKDHMAR
                     NLPRYMVPRIILPLEKVPQTASGKIDRTRLRVAAGNLERRTLDEYMNTAHIVKRQPST
                     DQESHVRSIFAQVLSLSESTIGIDDSFFNMGGDSISAMRFLTLCRQANLHLTMPAFLN
                     YNTVALFCSNASTLSDVSRFDTSEEMDRPFSLSPIQNMVLGSDESANRRFNQSFFLKI
                     QCPVDLGEMRNILYEIVQHHSMLRARWVQSPGKEPQQIISSSSIDTSFCVQHHHLRRR
                     EHVVRIARESHSRLDIRHGPILSLDIISVEDDADYALFIAHHLSVDLVSWRVILGDIE
                     NILRGKELGNIRPFSFQTWVRLQADQARNYDPPVVLPFDVLPASYEYWGLTREQNVFG
                     SAIESMFTLDVDTTNMLLGEANTPLNSQPQEIFHAALLHAWQKAFNDRLMPTVFLERH
                     GRDPWDSEIDLSRTVGWFTTLSPCTVSASGGRTLSLVDLICRVKDNSRRIPGKGLPYF
                     SSRVYNRQCKTAFKDHDSAEILLNYAGRYQQFECPDAVFTQPDWTLDERMDVAEDMPR
                     LALFDVSINIRSDKLHCSIWFSKHCQRQDQIARWIKEYQNSLQIAGAELVTRRRQLTM
                     CDIPLVTINDYEQLNILETTLRSQLGLKSVSPIESIYPCPSSHVGLIKGLVGNGDRHN
                     VRAIFKLYGSKAVDPTHVLECWHTLVQRHAILRTVVVDNPLTLGGPLHVVLKQLAIDT
                     AVLSFQSQNVVEELCDVRPSFDWATSPAHQMVVGQGLDGEVFCKLESGKALIDWTSFS
                     ILVDELCLAINGLLPSKPAPLYGDFISYVQSQPLDKIMNYWEGTLHGVTSSFIPRSLP
                     EAPDTPDAVPVLHSRRIILDGFKDIDGFWRKNRLTLTNVFQVAWGLVLSFYSRSPEVC
                     FGTLVSGRDIPITNIENMVGPCFNVLPCRLDLSPSRNIMETLQQNQQDMQRRTDHQHC
                     SVRDVTRNVADTTSMPLFNTCLSVKQMAEPKEDSVGDVQVKIVEIHDPTEVCSSLQIL
                     LSFPLLAIF"
     exon            complement(1266690..1275725)
                     /number=1
     CDS             complement(join(1276650..1276756,1276891..1277603,
                     1277653..1277902,1279536..1279689))
                     /codon_start=1
                     /locus_tag="AO090102000466"
                     /note="predicted protein"
                     /old_locus_tag="AO070266000029"
                     /protein_id="BAE61503.1"
                     /transl_table=1
                     /translation="MKAPEYLAPLREELAAALKQTDNAWSFDIFKHTPKLESFTKECL
                     RVFTPSGIIEIMREKRSEDLETQIIQGLQFDSLQLPQDLLWDDAGQILFDDLCNSSVY
                     YLTRKEKEILHKYSSDMVATIPEGSALIELGCGSLRKSGIILSALEKSKKAVTYYALD
                     VSQESLQNGLAHLHKGLGPLDHVELRGLWGTYEDGIAWVADQGPMNAYTSITFLWMGN
                     SMTNMHLAQTQSLLSRMSDTCASSGIRCQFLVSADGCTAEDTVMAAYSTESQPFRDFM
                     LNGLQSANRILGQDVFCSSNWTFGTVFDRTRHEVQMFYTPTHDVSIYINSERRKISKG
                     EKVAVVTSGKWPEPYFRSIVEGIGLQVLDLWTDSDQVYSSFRQRISQKEQRWWDLSSN
                     EYGHVFPDIESICLC"
     exon            complement(1276650..1276756)
                     /number=1
     exon            complement(1276891..1277603)
                     /number=2
     exon            complement(1277653..1277902)
                     /number=3
     exon            complement(1279536..1279689)
                     /number=4
     CDS             join(1285694..1285784,1285848..1285961,1286060..1286754,
                     1286824..1287630)
                     /codon_start=1
                     /locus_tag="AO090102000467"
                     /note="predicted protein"
                     /old_locus_tag="AO070266000028"
                     /protein_id="BAE61504.1"
                     /transl_table=1
                     /translation="MKTILGFLLLPIFLRDRKKKISQFLRTATPDSVLSDLYTCLVRE
                     RVSSITPQDVFYASSIRDSLQAEPYWTIKSFHNHLARTHPDTTIPEAAIDVLWSCFCF
                     YAYLPFSFAGAGDRKLHLPAFERGLILLPLQGTRLLGTIVDDFGPCWKRNEDPCSCRS
                     RINRIFRSISLVNRQSSSDPRVARFDTFVTDDVIDAILLISPAHPLLNPSFEQLNPLA
                     ERFLERRPDQYHMKVNDLAALLCLMMRLRVNKPTWGRDFHYGSFEESCPEKEELANIL
                     ARSFCLDQNEYLDPDAVFRALDILPNLEQCFHQLWATLFQPPTSTGIPDVETESSPDT
                     TIDGILRAASLFIPPFQAHKRTELARNVELITFQKCYDSISQSLTDSLDLGHILQQTF
                     HDDPSRLSHLVLFLGYQAQESEKVVVGAFFSSCTETHAAKEGKEPEKIGKSRIAPPLL
                     LFQLQPSFSLFRWSGEDSMSSSQAYNSATGHTDHPNGIGDLNRSKVGMEIDSVTRQAT
                     FLRGTATATNRMSGGYEEVTRKYDGTETIDGDQQERKTIFTVTRIAIFNVDGGPNYDY
                     PW"
     exon            1285694..1285784
                     /number=1
     exon            1285848..1285961
                     /number=2
     exon            1286060..1286754
                     /number=3
     exon            1286824..1287630
                     /number=4
     CDS             complement(join(1288363..1288405,1288566..1288643,
                     1288706..1288891,1289070..1289302))
                     /codon_start=1
                     /locus_tag="AO090102000468"
                     /note="predicted protein"
                     /old_locus_tag="AO070266000027"
                     /protein_id="BAE61505.1"
                     /transl_table=1
                     /translation="MYDDEKEFFVGWESRVIDLHVDHIASTWVLDEKLAELYHQHTAY
                     EHHLRPRTAAAYGTFSCHELHEPSSEAIIKVFMHSAPKLLHMEQNEQDHTGPVPGGFL
                     FYLLIQRPPGQYLNHEIFWGMAEQDRWTIRRAFKQAWLDCVSSGFKPAMSAIENLIWD
                     AEKRKIMDCLGSSKGAAEI"
     exon            complement(1288363..1288405)
                     /number=1
     exon            complement(1288566..1288643)
                     /number=2
     exon            complement(1288706..1288891)
                     /number=3
     exon            complement(1289070..1289302)
                     /number=4
     CDS             1291128..1292378
                     /codon_start=1
                     /locus_tag="AO090102000469"
                     /note="ankyrin repeat"
                     /old_locus_tag="AO070266000026"
                     /protein_id="BAE61506.1"
                     /transl_table=1
                     /translation="MSLLDLPTELLLLIIRNLVNDKDISAFVQTNSFLYDSLSDHLYQ
                     NNALRHNGSALLWAAEHGVPQAALRSLRNGGHIERCTLSCHTPLSLATGNGNEELVRI
                     LLAHGADINHLYPSPGSIIKNETALMKAASAGHDVIVQLLLDHGAPIDWSPKYEKTPI
                     CLAAEAGRLSTVRLLLTRGANPRLPKSNLADTPLAVAVSHGYPEIVELLIQHGANVRH
                     QNRNGNTLLSDAVEKQHWETAKVLLKHGAKVDKKDSCGLNALTNAARSNNIAGARLLI
                     EHGAQVNADSWLGETPLFAAARRGYEDMAKLLINNGADINSLSKLVSHEHPSVYEKLG
                     KLSRRKGVDYSYTLSIPVTPLLVAAANGNGAMCRLLIDNGAEVNYETLTAMTLECLAE
                     AYGYHEIKSLIEKATSGQESESTV"
     exon            1291128..1292378
                     /number=1
     CDS             complement(join(1292778..1292809,1292857..1292931,
                     1292988..1293176,1293225..1293393,1293442..1293588,
                     1293640..1293773,1293821..1294075,1294125..1294295,
                     1294351..1294512,1294565..1294616))
                     /codon_start=1
                     /locus_tag="AO090102000470"
                     /note="NAD/NADP transhydrogenase beta subunit"
                     /old_locus_tag="AO070266000025"
                     /protein_id="BAE61507.1"
                     /transl_table=1
                     /translation="MAGLVQAGYLISSVLCIGSISGLASQQTARRGNILGILGVASGI
                     LASLAAVGFSSEVLAQFGAVAGVGSVVGALIGRRITPTGLPQTVAALHSVVGLAAVLT
                     SIGSVLTDVADISTLHMVTAYLGVLIGGVTFTGSIVAFLKLAGRMSSRPTILPGRHVI
                     NSTLLGTNLATMSAFISMAPGSPVIAATCLGANTALSFLKGYTTTAAIGGADMPVVIT
                     VLNAYSGFALVAEGFMLNNPLLTSIGSLIGVSGSILSYIMCVAMNRSLTNVLFGGIAA
                     PQEAKKIEGQVTQISIDDTVDALANAENVIIVVGYGMAVAKAQYAISEITRMLRAKGV
                     NVRFAIHPVAGRMPGQCNVLLAEASVPYDIVLEMDEINDDFAKTDVTLVIGANDTVNP
                     IALEPDSPISGMPVLHAWKSKEVIVMKRGMSSGYADVPNPMFYMPGTRMLFGDAKSSC
                     DAIKANLEARK"
     exon            complement(1292778..1292809)
                     /number=1
     exon            complement(1292857..1292931)
                     /number=2
     exon            complement(1292988..1293176)
                     /number=3
     exon            complement(1293225..1293393)
                     /number=4
     exon            complement(1293442..1293588)
                     /number=5
     exon            complement(1293640..1293773)
                     /number=6
     exon            complement(1293821..1294075)
                     /number=7
     exon            complement(1294125..1294295)
                     /number=8
     exon            complement(1294351..1294512)
                     /number=9
     exon            complement(1294565..1294616)
                     /number=10
     CDS             complement(join(1294706..1294908,1294963..1295338))
                     /codon_start=1
                     /locus_tag="AO090102000471"
                     /note="predicted protein"
                     /old_locus_tag="AO070266000024"
                     /protein_id="BAE61508.1"
                     /transl_table=1
                     /translation="MAPQEKSFGVDLSDEVVRGSIVTLNGEILPPAPRPAPPPTPKVE
                     AAAPAKEQTELALTPWQKATRDVATVTAGMGTTLALGKATGPIFMGNMLTFGLAGLVG
                     YRAVWGVAPALHSPLMSVTNAISGMVGIGGFFIMGGGYLPSTIPEFLGAVSVLLAFVN
                     VSGGFVVTKRMLDMFKRWCFCFQSKMLAAYNL"
     exon            complement(1294706..1294908)
                     /number=1
     exon            complement(1294963..1295338)
                     /number=2
     CDS             complement(join(1296270..1296826,1296894..1296990))
                     /codon_start=1
                     /locus_tag="AO090102000473"
                     /note="NAD/NADP transhydrogenase alpha subunit"
                     /old_locus_tag="AO070266000022"
                     /protein_id="BAE61509.1"
                     /transl_table=1
                     /translation="MSVSLTLRSALGPCRAASIARPGKSLFAFQHSVIQSRTPYVPYQ
                     RNAYERPSVSRWPQVARRSASSSSSPSPVPVVPYSSLTVGVPRETYPNERRVAITPQN
                     VALLLRKGFSRVLIERGAGEAAELLDQAYEQAGATLVDRATVWSQSNIILKVRGPQPG
                     DEIEALQQGSTIISFLYPAQNKQLVDQLASRRVTAFAMDMVPRISRAQTFDALRCVA"
     exon            complement(1296270..1296826)
                     /number=1
     exon            complement(1296894..1296990)
                     /number=2
     CDS             join(1299447..1299557,1299661..1299681,1299734..1299782,
                     1299836..1299911,1299962..1300187,1300258..1300378,
                     1300440..1300783,1300843..1300965,1301026..1301428,
                     1301520..1301707)
                     /codon_start=1
                     /locus_tag="AO090102000476"
                     /note="amino acid transporters"
                     /old_locus_tag="AO070266000019"
                     /protein_id="BAE61510.1"
                     /transl_table=1
                     /translation="MAPAQQQADLLVDQDAHPIVNEEVRSQTESQDDAALLRTMGYKP
                     VLHRTYTLFENFATTFAALYFVGGVRVTFSTGIAAGGNLAYWTSYLVTMVFTYITAAV
                     IAEVCSASPSAGSIYLWAAEAGGPRFGRLLGFIVAWWSTTAWTTFCASNTQAAVNYML
                     SELTVFNVDFPTDTSSVKFRAVQWICTEILLALAAILNFMPPKYFRYVFWFSSMVVLL
                     DFILNIIWLPIGAHNTWGFRTAEEAFMSTYNGTGAPPGWNWCLSYLATAGILIGFDAS
                     GHVAEETKNASITAARGIFWSTVVSGIGGLATIILFLFCAPDPDTLFSFGSPQPFVPL
                     YAVVLGRGGHIFMNVICIVALWLNTAIAIVAASRLVFAVARDGVLPFSSWVSKVHNGQ
                     PRNAVIVVWAVAALVTCTLLPSDVAFTSLVSAAGVPSAAAYGLICLARLICTPKRFPK
                     PQWSLGKWSKPFQFIGVFWNGWVVAVLFSPYAFPVTGANLNYAPIIMAGVTIFALISY
                     FAMPEEAWLPRNRISHFIDSKGAQATVEEVERPSGEDQGTSTPRL"
     exon            1299447..1299557
                     /number=1
     exon            1299661..1299681
                     /number=2
     exon            1299734..1299782
                     /number=3
     exon            1299836..1299911
                     /number=4
     exon            1299962..1300187
                     /number=5
     exon            1300258..1300378
                     /number=6
     exon            1300440..1300783
                     /number=7
     exon            1300843..1300965
                     /number=8
     exon            1301026..1301428
                     /number=9
     exon            1301520..1301707
                     /number=10
     CDS             complement(join(1302357..1302470,1302528..1303331,
                     1303429..1304238))
                     /codon_start=1
                     /locus_tag="AO090102000477"
                     /note="predicted protein"
                     /old_locus_tag="AO070266000018"
                     /protein_id="BAE61511.1"
                     /transl_table=1
                     /translation="MEIQTVVCAQAKPPSATPQSAPAPEKRKRVRRWHHRGFTGCSTC
                     RRRHVRCDEASPSCKNCTRLGLECDGTQGRMTFKVYGPPQAPESSSSPPKKREAKKPI
                     SHVLDPTDGNKLIKIEPGEEDESYDALVVSPTTIAESKPMKYRFQEPISPAVFMSSSL
                     DCVDGRYYTHFIDSVATLLLIYDNSININPYRRYFPELARSSPTMANAMQALGALHLA
                     NTSRGQQRNLHFQRAMGKYGEVVKSFRTRYTQPDQNLQLTDLATCLLLSLFEMMDSQN
                     HNWNIHLKGAREIYRLLFLPNSDPAKEAQRQAEMNHPLRHFLVSLLSYLDVAGACATS
                     EGTVVEGSYWRTHGGGWEYNLGIPSLSTDTSAENPLLVELRQCWSVMMEIQAAISSFG
                     KAKSEGQMPPEQQDLLYQDLMGRLVQWRLNAPKCIQEVGELDDESLKQYPYPEVLEYA
                     GCIESYEKATVLYLHKVAAADRPDRVPQRALLDMLASRILNLIEKLAKDVGQLAVLWP
                     LFTAGRETRNEREQKFVRETMINLQRFGFKNVEKGLEELEKAWFKQRAFPEGWIDRME
                     DVRSSILLP"
     exon            complement(1302357..1302470)
                     /number=1
     exon            complement(1302528..1303331)
                     /number=2
     exon            complement(1303429..1304238)
                     /number=3
     CDS             complement(join(1309002..1309161,1310803..1311073,
                     1311132..1311359,1311421..1311580,1312583..1312639))
                     /codon_start=1
                     /locus_tag="AO090102000478"
                     /note="glutathione S-transferase"
                     /old_locus_tag="AO070266000017"
                     /protein_id="BAE61512.1"
                     /transl_table=1
                     /translation="MLVGNTIWLSSAGQLFSFQGIHLITSLTPNGRKVHILLEELKDV
                     YGLEWTTSLIDLDTKEQKKEWFLKLNPNGRIPILIDNTRSPPHPVMESSAELLYLVSS
                     IDKDHQFWFSDPIEQSEAYQWLIFWHASGQPIQGQYNYFRRHTIDPHATTRFRDEVLR
                     IYQVLEAHLSGKHSCNAREYLAGPGSGKYSIVDINAWAWIRTYRSIGFSEDEIAAWPS
                     LGQWVDRIAERPAVQRGLGECRLKRLRFHPSYTSNGEQYSKCTSISLTSNSWICQDSA
                     GSMSGPDIYKSTDYS"
     exon            complement(1309002..1309161)
                     /number=1
     exon            complement(1310803..1311073)
                     /number=2
     exon            complement(1311132..1311359)
                     /number=3
     exon            complement(1311421..1311580)
                     /number=4
     exon            complement(1312583..1312639)
                     /number=5
     CDS             complement(join(1313245..1313253,1313291..1313836))
                     /codon_start=1
                     /locus_tag="AO090102000479"
                     /note="predicted protein"
                     /old_locus_tag="AO070266000016"
                     /protein_id="BAE61513.1"
                     /transl_table=1
                     /translation="MFQAGRFVCGLGIGILVTVCPMYLSEMSSAFRRGWLVGHHAIFL
                     VFGYMLAGWVGYACYFAEGELGSFGWRFPLCLQCLPAIVLLLGSPWLPRSPRWLISKG
                     KHEEAKIVLQKLRQSPDDPDNLVAKEEYFQTAEQIRLEAERLSTYGNVWNAVLRKKSY
                     RKRMAIGFLTQWGAEFGGPLIITH"
     exon            complement(1313245..1313253)
                     /number=1
     exon            complement(1313291..1313836)
                     /number=2
     CDS             join(1315874..1316165,1316226..1316381,1316459..1316781,
                     1316839..1316905,1316970..1317103)
                     /codon_start=1
                     /locus_tag="AO090102000480"
                     /note="predicted protein"
                     /old_locus_tag="AO070266000015"
                     /protein_id="BAE61514.1"
                     /transl_table=1
                     /translation="MGSLSPFDVPFDELPNPKQVWVGKPGSYEEGLGKLAILTSEVVA
                     KAASTEIKTGRRVTMGWDLTKLNYPNLNRQPCQHKIVPLLGGVAYDDIYTMNPQQSSQ
                     WDGLRHFSQTVPGQTERVFYGGVTSEEINDRSNDRIGMQHWAREGIAGRGVLIDYAAW
                     AEKKGITYSTFSTHQVRLSDILEIAKECNITFQKGDILFVRVGVTKEWDTVMTDEQKK
                     QYSDNPSPEHAGVEATTDMLRWLWDSGFAAIASDTISWEVYPPQSDVFLHEYVLAGWG
                     MPIGELFDLEALARICQDLQRWSFFVASVPLNMPGGVSSPPNIMAIF"
     exon            1315874..1316165
                     /number=1
     exon            1316226..1316381
                     /number=2
     exon            1316459..1316781
                     /number=3
     exon            1316839..1316905
                     /number=4
     exon            1316970..1317103
                     /number=5
     CDS             join(1319118..1319575,1319641..1319998)
                     /codon_start=1
                     /locus_tag="AO090102000482"
                     /note="predicted protein"
                     /old_locus_tag="AO070266000013"
                     /protein_id="BAE61515.1"
                     /transl_table=1
                     /translation="MVMYGPTAYLTKVSLLWIMTRVFSPFRKAVTFIYIFLGVMLAYY
                     IPAVIVKIRICDPISKFWDPDRPGTCLNQRSIIMADAVVSVVSDLIILLVPLPLTLGL
                     QLPTKKKMRVMGILGAGGLAVASSIIRLILIAYTGQSEDGTMAFMRINMFGNAEIAIG
                     VICACLPALSAILSRVYHEYSSSNKATGGTSGHELSKMKNQSRSMKTDKSRSRMSYLE
                     MTSDQDVLMHNAQSEPKVETTVHGDRNYYGENPGGSLAIFKTVDVETSVSRRA"
     exon            1319118..1319575
                     /number=1
     exon            1319641..1319998
                     /number=2
     CDS             join(1320801..1320821,1322084..1322410,1322466..1322669,
                     1322737..1323003)
                     /codon_start=1
                     /locus_tag="AO090102000483"
                     /note="dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /old_locus_tag="AO070266000012"
                     /protein_id="BAE61516.1"
                     /transl_table=1
                     /translation="MGTLLILGKVAIVTGIFLSYNSWRGMHIANDEPGGGSGFGAAIA
                     RRFGEEGAKVIITDINVEGGQKVAAQNPESLVFQQMDVTKADDWTAVMDLAFSKFGRL
                     DILVNNAGITYRNKPTAEVTEEEWERVFNVNVKGIFLGSQALVTRLMEQGQGGSMINI
                     SSTGASRPRPGLVWYNASKGAVSNATKGLAAEYGPHNIRVNTVSPLLSGTGLFSMFTG
                     MPDTPENREKFIGNVPLGRLTDPDDVANMCLYLASDEGSFINGAEMIVDGGKCI"
     exon            1320801..1320821
                     /number=1
     exon            1322084..1322410
                     /number=2
     exon            1322466..1322669
                     /number=3
     exon            1322737..1323003
                     /number=4
     CDS             complement(join(1323170..1323373,1324042..1324473,
                     1324522..1324845))
                     /codon_start=1
                     /locus_tag="AO090102000484"
                     /note="predicted protein"
                     /old_locus_tag="AO070266000011"
                     /protein_id="BAE61517.1"
                     /transl_table=1
                     /translation="MRSNWLSTENPSTVLLGFFPFITADSLFERCRQVYFATEEYSDA
                     TFIVVNACLVYLFSEFSFSESETSKREIYDKYHDLCRVNLETGLANLSLLTPATMESI
                     EALSMGAIHAIEISKPSLALALTSTAFRLCQTLGYHRASSMENDSYTVKQNKRRLFWS
                     VYVTEKALSLRLGRASSIQDYDISLPTTFELLGDFEPWRTIYPLWINLARIQGKVYEM
                     LYSPAALRKPADERASYARQLAAEMQMNVEEPFKAEAGDVRWNGPVPVPGPIPQGLAE
                     GAEGQGFQNTMPPTTLGSWFSGNQHMMGLLEEDLSLFDPSAWS"
     exon            complement(1323170..1323373)
                     /number=1
     exon            complement(1324042..1324473)
                     /number=2
     exon            complement(1324522..1324845)
                     /number=3
     CDS             complement(1326425..1328359)
                     /codon_start=1
                     /locus_tag="AO090102000485"
                     /note="predicted protein"
                     /old_locus_tag="AO070266000010"
                     /protein_id="BAE61518.1"
                     /transl_table=1
                     /translation="MPRPKTLPLVEEWTDPDGYVDALLSFATSSDLFRHLCGGVHNLD
                     FLTREPDVYTSLLPEHWRAFFELHDLQDLLDLFLREDLQPLLDQSRNPATDEGNPNAR
                     QEWRGAPLPPTDLLEYLQQIRRLSLGRDFRPPQPGKPTIPKHIAVGMNVKKYHEVAHF
                     SRYVDSLCATVDGQRGDNITHVVDFGSGQSYLGRTLASPPYNRHIVAIERKHQFINGA
                     KDFDIFAKLQVKKKNRLYNKKAACKDCEEPERPVTIDENASSRESEDAENVTIDDSTK
                     QDVDEEDVAMINVFRDFSIAPDEIGSAPHKNDLNKKAAAKKQESNQPRGTMDYIEHEI
                     KDGYLEPIIKDVISPPTENSTSAEQESNGKSNNARVMVISLHSCGNLLHHGVQSLVLN
                     PSVKAIAMIGCCYNLMTERLGPATYKLPILRTMHPRLTKDAIAYDPHGFPMSKRLEDY
                     EHDSGRGVKLNITARSMAVQAPYNWGREDSENFFTRHFYRSLLQKVLVDRGVVEKPSI
                     PKDLYGAESLDSSEAGNPLIVGSLRKSAFTSFPTYVRAAVVKLSRDPHNGEKVKAGMA
                     DITEEELNDYVEKYGHTRKYLGIVWSLMAYSSSLVEAIIVVDRWQFLREHDSVKDCWV
                     EPVFDYGVSPRNLAVIGIKK"
     exon            complement(1326425..1328359)
                     /number=1
     CDS             1329843..1330628
                     /codon_start=1
                     /locus_tag="AO090102000486"
                     /note="predicted protein"
                     /old_locus_tag="AO070266000009"
                     /protein_id="BAE61519.1"
                     /transl_table=1
                     /translation="MNYHAEQRLVQRLERGLYVLFHMADIARDTYKTKQKINPLVPDV
                     TGRLLVLTRMLEEYHEIPRNKRRLMSFQEYASHAYTVLKWGYREVDIGRRRLKFRGYL
                     DEQTEVDFHVTLRMLRELMERMLLRHGPKVWHRDARNEYSMISWFLLKQSPQSLAKLL
                     LSPQDECCGLEEKASESGLRKCQFSDPLDNYWKAWKNVPGLGCQACDCKRRVRSWSVK
                     PALIDDQGRQYNRAAEKYLKDMWTQRHAGLHQVFTMGYFNIVL"
     exon            1329843..1330628
                     /number=1
     CDS             join(1330931..1330965,1331025..1331680,1331764..1331840)
                     /codon_start=1
                     /locus_tag="AO090102000487"
                     /note="predicted protein"
                     /old_locus_tag="AO070266000008"
                     /protein_id="BAE61520.1"
                     /transl_table=1
                     /translation="MDHADPFLHVQADVLATLQTAKPLFSSYLRIRSLAKSPSNPELQ
                     QARSELETTLTELTTDLDDLVESVRAIEQDPYRYGLELEEVQRRRKLVEDVGGEIEQM
                     REELQKAVTSSAATGSARLDAPTGSSPSGLPNPSDFDNVLSPSADDRGDDYYAALEQQ
                     RQMELMHEQDEQLDGVFRTVGNLRQQADDMGRELEEQAVMIGEVDTLADRVGGKLQSG
                     VSKIKYIVRKNEDTMSSFCIAVLIFVLVLLLILVIAL"
     exon            1330931..1330965
                     /number=1
     exon            1331025..1331680
                     /number=2
     exon            1331764..1331840
                     /number=3
     CDS             complement(join(1331913..1332025,1332076..1332891,
                     1332946..1333066))
                     /codon_start=1
                     /locus_tag="AO090102000488"
                     /note="predicted protein"
                     /old_locus_tag="AO070266000007"
                     /protein_id="BAE61521.1"
                     /transl_table=1
                     /translation="MSTDFGASLLDRLQGSEPTEAQLKKMSFLEEKRSRIDVDCLRDS
                     TLKMHDWYNERDAFVNGNDEIKENFWVRVFANAPSEIDQYIMTPDAAALGSTLTNLKV
                     ERFELNEQGQGEPRSIRLTFEFRTGEENPFFENEKLVKELYWRRRSVKNADGKTKSWE
                     GLVSEPVRIQWKKDMDLTKGLLDAACDLAEAEKGGKDRKKLPELEKLKNKIVELETTA
                     DQEEDEDEDFPLSPAGASFFAFFGYRGNDVSAEESKVATKQADERFAKLSKGETVEDE
                     EEEEDEEFEDIEVFPDGEQLAIAIADDLWPHALELFNRDEGMDIEELEGDVDDEDEDD
                     GDDEEDARPKKKTKV"
     exon            complement(1331913..1332025)
                     /number=1
     exon            complement(1332076..1332891)
                     /number=2
     exon            complement(1332946..1333066)
                     /number=3
     CDS             complement(join(1334917..1335331,1335395..1336250,
                     1337353..1337362))
                     /codon_start=1
                     /locus_tag="AO090102000489"
                     /note="predicted protein"
                     /old_locus_tag="AO070266000006"
                     /protein_id="BAE61522.1"
                     /transl_table=1
                     /translation="MNHNLLQIFCRTFFIGLSRLSTCVLFYPAISSLPSNNRRRGFPK
                     VAFAYYGTSVSPRFISPSSPSRPLLFSVSPRMTQQKTIAVVNATGRQAASLIRVASAV
                     GHHVRAQVHSLKGIIAEELESLLNVTLFQGPLLNNIPLMDTLFQGANLAFINTTSQSG
                     DEVAIGRALADAAKRAGTIQHYIYSSMPDHSVYGPWLPVPLWAPKFTVENYIRQLGLP
                     ATFVYAGIYNNNFTSLPYPLFQMELMPDGSFEWHAPFDPDTPLPWLDAEHDVGPALLQ
                     IFKDGPKKWHGHRIALTFETLSPNQVCAAFSRALNRPCHYVHVPRVEVKVNIPPGYRE
                     QLEAIEEVFGRCNAPYFPQPEFSRPAAGSPKGLGPANGKGAGAGMMQGPGGVVSLRVT
                     DEARHLWEGWRDMEEYAREVFPVEEEANGLDWML"
     exon            complement(1334917..1335331)
                     /number=1
     exon            complement(1335395..1336250)
                     /number=2
     exon            complement(1337353..1337362)
                     /number=3
     CDS             complement(join(1339015..1339338,1339405..1339769,
                     1339830..1340811))
                     /codon_start=1
                     /locus_tag="AO090102000492"
                     /note="asparaginase"
                     /old_locus_tag="AO070266000003"
                     /protein_id="BAE61523.1"
                     /transl_table=1
                     /translation="MATIDDIIPEMIERQLEPQLPEARVLIIMTGGTICMRPSPSGFI
                     PARGFQEQCLARVPTFNDGSPSTMMDVVVDNTGQIKGHQSLRTPQTAYGRRVRYTVFE
                     FEELLDSSSIDAKGWAEIARTVERNYTLFDAFVILHGTDSLAYTSSALSFMLQNLGKT
                     VILTGSQAPMLELQNDATDNLLGSLVVAGHFMIPEVCLYFNNRLFRGNRSSKVAASDF
                     AAFDSPNCTPLAVTTSMRTNVNWELVNRPKGIEHFSIQTHLDTTHVACLRIFPGIKPE
                     MIDAVLRLDGLRGLVLETFGAGNAPHGQDNALIKVLADAIKRGIVIVNVTQCLTGSVS
                     PVYATGMSLSRAGVVAGLDLTTEAALTKLAYLLGLPDATPESVARDMSKSLRGELTEV
                     SQPVFRHPDGALTERVQALTILGYAIAQGDLTRVEEILKLENHYLLNDADYSGNTPMH
                     LAATSPSLSILRFLLMQGGSVHIRNRNNRTPLFLAANAGLSEHVMLLRKSGAHLHSDE
                     RTAAQLLARRRPGVWGLAGIGPREVSDREMEEVGEERLAERVMAGSAP"
     exon            complement(1339015..1339338)
                     /number=1
     exon            complement(1339405..1339769)
                     /number=2
     exon            complement(1339830..1340811)
                     /number=3
     CDS             complement(join(1342117..1342253,1342313..1343250,
                     1343322..1343815))
                     /codon_start=1
                     /locus_tag="AO090102000493"
                     /note="amino acid transporters"
                     /old_locus_tag="AO070266000002"
                     /protein_id="BAE61524.1"
                     /transl_table=1
                     /translation="MADFDIEKKPNVNPASKSENASGADDSDALRLAEMGYTQDLQRN
                     FSILSLIGIAFCMSNSWFGISASLITGISSGGTVLIVYGLIWIGFISTCVGASLSELA
                     SSMPNAGGQYFWANELAPKKYARFASYFTGWFGYAGAVFACASVALSLGSAGVGMWQL
                     GHPEFVPEPWHTVVAYQLINFFCYLFNCWGKTLPAVAKVTLYISLLSFFVILVTVPAC
                     AKTHASGAYVFGHFVNSTGWKSDGMAFIVGLINPNWIFACLDSATHLAEEVPQPEKNI
                     PIAIMATVGIGFVTAWFYCISMFFSLNDLDKLLNTATGVPILELYYQALDNVPGAIVL
                     ETLLLVTGMGCLIACHTWQSRLCWAFARDRGMPGHKWLSQVNHTLDVPLNAHNASCFL
                     VGVLGLLYLGSSTAFNSMVTACITLLYISYSCPIVCLWYRGRDNIKHGPFWLGKWGAF
                     ANIVTILWTIFCLVMYSFPSTMPVNTGNMNYVSAVYGVVIFIVLCDWFARGRRVYKGS
                     VSAVEGHGASEDSE"
     exon            complement(1342117..1342253)
                     /number=1
     exon            complement(1342313..1343250)
                     /number=2
     exon            complement(1343322..1343815)
                     /number=3
     CDS             complement(join(1348804..1349947,1350009..1350165,
                     1350218..1350395))
                     /codon_start=1
                     /locus_tag="AO090102000494"
                     /note="predicted protein"
                     /old_locus_tag="AO070266000001"
                     /protein_id="BAE61525.1"
                     /transl_table=1
                     /translation="MRQTMRLDVGLVTCLAAFSGLAEAFWRLPCRGRAGLARLDPLMD
                     PGKDSYHVHAIHGPDSFSMTADMDSLRDSSCTSCAVTQDKSAYWHPALYFMHENGDTE
                     VVDQVGGMLAYYLLYGDNVTAFPENFRMIAGDTFKRDFKWPIPDPPTSEWSGEQESQA
                     ALRQKAIGFNCLNYNKAAEPSLGRHFLPNKTYLDEHCTDGVRFEIMFPSCWNGKDVDS
                     DDHKSHVAYPSTVMDGTCPEGYDTRVVSLFFETIWDTYAFKDKKGTFVISNGDPTGFG
                     YHADFIHGWESGVLEQAVKRCTNPSGRVEDCDVFDIQTEAEQRKCKFEVPTLLKNEDV
                     YSHKGGLPNDLVVEYGPAYASPISYTTATATQAPGASVSASVSVSIGLSIDLPGIVAV
                     ETSTSSTTTPTWTPTPTTSYIEGDVTQAIVYVEREVTVLVDGQGNPLATQTGGLETVS
                     TVMSTTTSIISTVVTTPTASPAKRDLHEHKHAHGHHRHGHHH"
     exon            complement(1348804..1349947)
                     /number=1
     exon            complement(1350009..1350165)
                     /number=2
     exon            complement(1350218..1350395)
                     /number=3
     tRNA            1355252..1355346
                     /locus_tag="AO090102t00010"
                     /note="tRNAscan-SE"
                     /product="tRNA-Ser"
     CDS             join(1356591..1356687,1356750..1356875,1356931..1357002,
                     1357029..1357065,1357115..1357196)
                     /codon_start=1
                     /locus_tag="AO090102000495"
                     /note="predicted protein"
                     /old_locus_tag="AO070209000009"
                     /protein_id="BAE61526.1"
                     /transl_table=1
                     /translation="MFSPKYDTHFIDFQIPEERNQEMTCTLGRYVGAQAAQTRNTPGA
                     TRINNAGGALRGRGNGGWGGFPSMKFFGWLFPWSHSIACSAVRSILHDSLWRTAGLSF
                     SSSLDLCGSRNMVRCIEEYCAKLDELERAWEGDKC"
     exon            1356591..1356687
                     /number=1
     exon            1356750..1356875
                     /number=2
     exon            1356931..1357002
                     /number=3
     exon            1357029..1357065
                     /number=4
     exon            1357115..1357196
                     /number=5
     CDS             complement(join(1360079..1361669,1361728..1362188))
                     /codon_start=1
                     /locus_tag="AO090102000497"
                     /note="predicted protein"
                     /old_locus_tag="AO070209000007"
                     /protein_id="BAE61527.1"
                     /transl_table=1
                     /translation="MFGEGPEDGSRVYIPPLLDSERSDDPDDSDILPQNEEHGASYIP
                     VWLRESSKSFKWGWVPLPIRKVARATANWVKGPDPPHDLLLKPLFPHIQELPVRYLER
                     FFPKRKQKIALLGLFYLAWFLPWTIILLHSRSAGYIEGFGRPETLTCRATLWEYGNEC
                     GLNGNDCRPFTAATIPFRCPANCRDAKLAAPHMVGNQTYSYKGLVVGGPQPGSDDTPV
                     YRADSFICQAAIHAGVITNTIGGCGVLKLEGATHSFPASKQNGISSVGFPSTFPKSFS
                     FVSLGSSQETCPNDPRWPLLGITIGALATLWLLCRSPPVLFFSTFFMVFCQVGLVSDP
                     PTLPQFADLVSSLLANLLPASFVAFVLFRYCARPLLRPLSDATYQITKTFLYLPPVFI
                     GALNNYTFARLIPLERLTPHDIQRQPGAKVALAMVIPTVICIILSQAWQIRQGGLMPH
                     YLKIYCTMGLILLILLPLPGLRLRIHHYILAILLMPGTAIPTRPSLVYQGLLLGLFMN
                     GIARWGFASIIETPAALGELPGGAHGWWGSTFPNVTDTTVNITLPGPGSNELYHGNGN
                     ITFTLWEKERMADLGVDGVSVLVNDVERWRGYLDEDTLGEFTWHRHGHNGLELLHRPT
                     IESDQADIDSTDMADEDDNRPEDLFFRFAFLKGAEAGKYGGAGVWLEDGGWISPPPPK
                     R"
     exon            complement(1360079..1361669)
                     /number=1
     exon            complement(1361728..1362188)
                     /number=2
     CDS             join(1363357..1363477,1363560..1364142,1364237..1365287)
                     /codon_start=1
                     /