LOCUS       AP007161             2668010 bp    DNA     linear   PLN 16-DEC-2016
DEFINITION  Aspergillus oryzae RIB40 DNA, SC012.
ACCESSION   AP007161
VERSION     AP007161.1
DBLINK      BioProject:PRJNA20809
            BioSample:SAMD00067075
KEYWORDS    .
SOURCE      Aspergillus oryzae RIB40
  ORGANISM  Aspergillus oryzae RIB40
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Eurotiomycetes; Eurotiomycetidae; Eurotiales; Aspergillaceae;
            Aspergillus.
REFERENCE   1  (bases 1 to 2668010)
  AUTHORS   Sawano,T., Tanaka,T., Machida,M. and Yamada,O.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-JUN-2004) to the DDBJ/EMBL/GenBank databases.
            Contact:Toshihiko Sawano
            National Institute of Technology and Evaluation, Genome Analysis
            Center, Department Of Biotechnology; 2-49-10 Nishihara,
            Shibuya-ku, Tokyo 151-0066, Japan
REFERENCE   2
  AUTHORS   Machida,M., Asai,K., Sano,M., Tanaka,T., Kumagai,T., Terai,G.,
            Kusumoto,K., Arima,T., Akita,O., Kashiwagi,Y., Abe,K., Gomi,K.,
            Horiuchi,H., Kitamoto,K., Kobayashi,T., Takeuchi,M., Denning,D.W.,
            Galagan,J.E., Nierman,W.C., Yu,J., Archer,D.B., Bennett,J.W.,
            Bhatnagar,D., Cleveland,T.E., Fedorova,N.D., Gotoh,O.,
            Horikawa,H., Hosoyama,A., Ichinomiya,M., Igarashi,R., Iwashita,K.,
            Juvvadi,P.R., Kato,M., Kato,Y., Kin,T., Kokubun,A., Maeda,H.,
            Maeyama,N., Maruyama,J., Nagasaki,H., Nakajima,T., Oda,K.,
            Okada,K., Paulsen,I., Sakamoto,K., Sawano,T., Takahashi,M.,
            Takase,K., Terabayashi,Y., Wortman,J., Yamada,O., Yamagata,Y.,
            Anazawa,H., Hata,Y., Koide,Y., Komori,T., Koyama,Y., Minetoki,T.,
            Suharnan,S., Tanaka,A., Isono,K., Kuhara,S., Ogasawara,N. and
            Kikuchi,H.
  TITLE     Genome sequencing and analysis of Aspergillus oryzae
  JOURNAL   Nature 438, 1157-1161 (2005)
COMMENT     URL:http://www.bio.nite.go.jp/dogan/Top
FEATURES             Location/Qualifiers
     source          1..2668010
                     /db_xref="taxon:510516"
                     /mol_type="genomic DNA"
                     /note="SC012"
                     /note="phrap>=30:1-2667939"
                     /organism="Aspergillus oryzae RIB40"
                     /strain="RIB 40"
     repeat_region   1..23
                     /note="IV left telomeric region"
                     /rpt_family="Telomeric Region"
     CDS             complement(join(273..853,904..1241,1297..1775,1824..2039))
                     /codon_start=1
                     /locus_tag="AO090012000001"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070161000001"
                     /protein_id="BAE60249.1"
                     /transl_table=1
                     /translation="MTSDTEKETSALELEAQPNSKPGPVYDGDEKVDYDRAGALEAEQ
                     AEHNMTVLEAVKAYPAASWWAFVMSFTIVLESYCVFLMGQFIATQQFANDFGVWSDNT
                     GKYIIEASWQSAFQCSGPVGAFIGVFIAGPITSRIGYRWATIGGLMFLNAFIFIFYFG
                     NSNGMFFASQILEGLPWGIFIANAPAYCAEIVPMRLRAPATQMLQMFWAVGSIIVGGI
                     TYHYQSRTDPSAYRVPIALQWMFPTPLAILLFIAPESPWWLVRKGRLAEAEKAVKRLG
                     RASATDNPAAAVAMMRRTIELEKTEKKPSLIELWKGTDLYRTLIVCGVYASQNLTGNL
                     IANQAVYFFKQAGMADNTAFALGLVTSALQLIMVMLSWILTTYLGRRTIYVYGQLINC
                     GFLVALGIAASVGSSIAASNAQASLGLIVSVLFCLGPAPASWVIIGETSSVRLRPLTT
                     GIGRGAYYVVNIPCIFLSSYMLNDDKWALGGKSGYVWAGTAFICTAGAWWWVPEMKNR
                     SFREIDILFRRKVPARKWKQTVVDLRDDE"
     exon            complement(273..853)
                     /number=1
     exon            complement(904..1241)
                     /number=2
     exon            complement(1297..1775)
                     /number=3
     exon            complement(1824..2039)
                     /number=4
     CDS             join(9409..9444,9532..10556,10607..11147,11179..11379)
                     /codon_start=1
                     /locus_tag="AO090012000002"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000001"
                     /protein_id="BAE60250.1"
                     /transl_table=1
                     /translation="MKKACVQCRVRKVRCDGSVPCCKTCERLQFHCSFQRDNSLPVGL
                     YAPHLPPKRRGAKACLECRAMKVRCSGATPRCHNCHRRGRQCTYPSSTGPARPASTRV
                     EELPSPTTSASSTITSDDCTVSQSNPSIPIPSAPPSPSDEVVSSLLRDYFDHLHPLPS
                     FNFLHKDTVVRRCSEGTIDESLKLAICAITALYFSQYRSEHGAWAQQSEQLILDRLER
                     PSIFLIQASLLTIRYRAGVGQFPRAFILAGLAARWAVSLRLNYEHSRLGLIAQEVRRR
                     TLWSLYLLEDSFCVGLKEFELFDPETIHLQLPCEDEDFHNERPVLTGFLHPGKGLEPE
                     FLGARAAFVKLAFIRRGIMRLNRRIFAKELSLSELFESVERFQSDLHCLRSRLTSTDQ
                     YPPANPGELHWPAPYAILHMSWHQCHCDLYRIFLSGYPESTPHPAVERMTLPERVLMK
                     EKCLGHAEQIVKVLSDFVHHKDEQQMLDFDAAVCAYHAARLILFVTYTGRSDEALPMQ
                     LAIYKAQLCLDVITRYFGFSAQLKSMADQTASNPGASHPAAQEMVGVFRPSPYSHGGS
                     KPTSACRYLTRCIYAPAPCHPQSAAAIGLCRRQL"
     exon            9409..9444
                     /number=1
     exon            9532..10556
                     /number=2
     exon            10607..11147
                     /number=3
     exon            11179..11379
                     /number=4
     CDS             join(12171..13432,13483..13526,13646..13678,13924..13971,
                     14018..14215,14264..14573,14623..16351)
                     /codon_start=1
                     /locus_tag="AO090012000003"
                     /note="beta-glucosidase-related glycosidases"
                     /old_locus_tag="AO070343000002"
                     /protein_id="BAE60251.1"
                     /transl_table=1
                     /translation="MVGKWHLGESVDNQPTGFDYWSVLPGQGLYWDPDFIEPTGERVE
                     SGYVTDIITDKSLDWIKSRDRDRPFFLMCHHKAPHRSWECDDKHKHLYKDPVRLPDTF
                     TDDYKNRAKAAKIAKMRVAEDLTYQDLGLVQPDGGRRVGEPVLQEFGSSERKVPVPGS
                     IAELQSMRLIDKDDGTVFTFKSHAELAEFKFQRYMQRYIRTIQSIDDNVGRMLDYLDS
                     EPQLAENTIVVYTSDQGFFLGEHGWFDKRFMYEESFQMPFLIRYPKEIIAGSVCDDII
                     CNVDFAPTWLDYANLPAPSYMQGTSFRPLLQGRTPESWQQVAYHRYWMHNDIIHHAYA
                     HYGIRNQRYKLIYWYNEPLDVPGARPGGKEHKEWELFDCDKDPLELFNVYHEGEYQGV
                     VRQMTTLLEKKMAEIGDEPVHPKPQWLLGLVFAWRTFKYMSIHADGKLLPPFGQVEAF
                     LFKLCVTAIAHYALAASVHSEMSVGTLHRERAEALLSQMTWEEKVGQMGGIRRLLNTG
                     PEIDEENYEYRQAEYQNGNIGFGATLNWADGILPLTNEVRQRQINESRLHIPFITVTD
                     SINSLYLSGGTIFPSNLAMAATFNIPLFSEGVAALREEQIAIGVSWVLSPPLDIAWEP
                     RYSRIGELFGEDSYLTGEFGHAYVQTMQDKDDSGNIKVATTVKHFVYGESRGGINAAS
                     MYGGINHLYNDQLRPYLRALEADPAAVMVSYASVDLVPMSANKYLVRDILRQRLGFEG
                     IVMSDAGGIAHLYTESRLAGSYAEAALLALEAGLQMELSPQSPAVFPTLVAAAEDSHV
                     GQLIDEAVLNILQLKFATGVFDKPLPDPAKVNETLRTPAHLEISRHVTRESIVLLQND
                     GILPTTPSKVALLGPFADIRNYGSYAPVNSSDSRYGNSLYQSLQAKLGTSNVTLVQGV
                     DFIDIDTTNIATAVSAAKEAGLAIIVLGSLSVGTTDPLVTKRTDGEFFTHANLGFPGA
                     QQQLLDAVLDASIPTILVLSGGQPFVLNNSTLRSNAILHSFLGGEFTGDALAEIIMGD
                     VNPSGKLPISLPQDTSATPVFYDYLPSDDTGTADSILGFHSTYQFPLLSRSPPMPFGF
                     GLSYTDFTISAPRARASNSSVEVRVNITNVGPIAGKEVVQLYHRPNTTTGIEFPVKRL
                     VRFEKVDLHAGEGREVRFVIPHKDLGYYVDGELRVKRGVYSFWAGTSSRTEDLKRVNV
                     TVL"
     exon            12171..13432
                     /number=1
     exon            13483..13526
                     /number=2
     exon            13646..13678
                     /number=3
     exon            13924..13971
                     /number=4
     exon            14018..14215
                     /number=5
     exon            14264..14573
                     /number=6
     exon            14623..16351
                     /number=7
     CDS             complement(17066..17842)
                     /codon_start=1
                     /locus_tag="AO090012000004"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000003"
                     /protein_id="BAE60252.1"
                     /transl_table=1
                     /translation="MLGIYEMMDPITPQSWLTHSSGIATLIRLRGPNAHRGGFGRTLL
                     ISFKSFIVADALIRGEACFLAEPAWQLALTDTLAAESGNGKGSQLCDLVELLFAEITK
                     CPGLYARACAIIKNNETDHSMFETLRQEATQSKQRLQYLKDQLESVVPVSLDSEALRD
                     KPDLIGLIPVSVAQKSRTFAGHGAQSALALLDQVIVITESDHHRLFTDSTMTTLPVWD
                     VLPAPANCVTMDKEETLANRLPAWPDQLALSMGMLAVKDN"
     exon            complement(17066..17842)
                     /number=1
     CDS             complement(join(19016..20044,20098..20580))
                     /codon_start=1
                     /locus_tag="AO090012000006"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000005"
                     /protein_id="BAE60253.1"
                     /transl_table=1
                     /translation="MAMLFTPIAAASLLAVVGTQPTGVFAQDAEGWYKAHPGMSRIKD
                     VNQDTHQIVDEFGRTRFFHGTNVVMKEPPWHRPLEWVPGVSSFGEQDVQNLHDLGLNI
                     VRLGHSWAGAEPVRGEYNQTFLDIMKKQTKMAEDHGLYVLVDVHQDCLARQFCGNGVP
                     DWFAKKDWVSSGKMYPFPLKTTPFPVDENGFRSPQSLCGSVDWALSYTSVALGNAFGR
                     LYNNYDGLGDAFAAYWKKLASEYGKTTNVVGYNLLNEPWVGDTWADPTLLVPGVADHK
                     VLEGLWNRAAKQIRTVDNDTLIWFEGATLDVLSGFNNVPLGDGSKSVHSFHYYNPPQL
                     GSISTTLSNRHKDNERLRTAGVLTELTFWMGDEKQMQGLADAMSATDANMVSWIGWAY
                     ENLYNGTSGQPYPELAKHYSRSYPAAVAGTPKSFSFADSSATFKLQFTSDPNIQAPTE
                     IILPPSTFPNGYSVQVSPDGSVLQYAVDKRTLAFFTSTSIKNATDITITITRK"
     exon            complement(19016..20044)
                     /number=1
     exon            complement(20098..20580)
                     /number=2
     CDS             join(22146..22172,22237..22440,22495..23479,23535..23566)
                     /codon_start=1
                     /locus_tag="AO090012000007"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000006"
                     /protein_id="BAE60254.1"
                     /transl_table=1
                     /translation="MELSNRPRKACDLCYTRRIKCDGQKPRCSNCINYATDCTHTALS
                     RKSKPRAQRRSELKKADEVKSLQAEIQRLETQLAQNRDHDQASHATQEPVRTTIAAHV
                     ADQHIDEDGDHTISSMKLPPLHQAMAMVGIYLNTYNSVLPLFHADTLLRLVGECYARQ
                     PRQRDPVVWAAINVVFALACQQVPENPRNGRSQHQTDQTTEYLNKVQSIISTVMLGET
                     HLLNIQVLVGMVMLLQTAHDLTPSLLLISATMRLAHKLGLHSHAASTHLDPVERRQRA
                     RVIWIAYILDKDLSLRTQQPSVQLDDDMDVELPSSLPTTNDDNDNTAGIVVTADGNAR
                     MNYFLARVKLAKIEGRVYDSLYSTRAVNRSFEERRNARESVVSALDEWRASIPLEFSA
                     SIVTSSTSNKPANAGLTLGIDNG"
     exon            22146..22172
                     /number=1
     exon            22237..22440
                     /number=2
     exon            22495..23479
                     /number=3
     exon            23535..23566
                     /number=4
     CDS             complement(24289..24990)
                     /codon_start=1
                     /locus_tag="AO090012000008"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000007"
                     /protein_id="BAE60255.1"
                     /transl_table=1
                     /translation="MKVGIVNAGNIGLRLGFAWIRLGHDVMLSKDTHPERLQKRVRQF
                     AMEKGIGEDEIARFQYGSITDAAKFGDVVILSAYFPRLAHILKELQNDGITLSGKLVI
                     DTMNPLNVDANFNHYHDLKYMERTSVTQDVQRAFPEAIVFKAFNSMPATLLEVQKWAP
                     RRVPPIIFIGGNPSSIDTVRKLIKDTGFKPQFAGYDLNHSGLLERLGVLLHLVAENEY
                     EGNFDVVFDVMEGKA"
     exon            complement(24289..24990)
                     /number=1
     CDS             join(25592..25867,25904..25942)
                     /codon_start=1
                     /locus_tag="AO090012000009"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000008"
                     /protein_id="BAE60256.1"
                     /transl_table=1
                     /translation="MASIKKEQYAIAPRSRVLVTGANGFIGSHVVQQLLSLGYVVRGT
                     VRSQKPWLDELFRSKYGPNSFESVVIPDLSDYDTLRKAMRDVSGVIHVLCPAMRNMSS
                     SR"
     exon            25592..25867
                     /number=1
     exon            25904..25942
                     /number=2
     CDS             join(26255..26437,26564..26660,26733..27037)
                     /codon_start=1
                     /locus_tag="AO090012000010"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000009"
                     /protein_id="BAE60257.1"
                     /transl_table=1
                     /translation="MTVDTWNEATVKAAFDEGTPADAKPFTVYVASKTEGERAAWKWV
                     KDNKPPFVFNAILPYYTLGQVLHPEIAGSTMKWAANLLDGDTTAFGFPGQFVDVADLA
                     RVHVVGLLHPEVKSERLFAFASTFTWKEFVGILRKLRPGHTGIPSPPENELRDLSEIV
                     PARRAKNLLQALFGGSGWVGLEESIRAGIASLGY"
     exon            26255..26437
                     /number=1
     exon            26564..26660
                     /number=2
     exon            26733..27037
                     /number=3
     CDS             join(27677..27843,27937..27969,28094..28910)
                     /codon_start=1
                     /locus_tag="AO090012000011"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000010"
                     /protein_id="BAE60258.1"
                     /transl_table=1
                     /translation="MANHQVDILVVNLNEKELNGLAKRTRLVISTVGPFLLYGSETFA
                     ACARNGTHYLDCTIEPQKKPGAFYIRRHFNAQTGRVDVCIHGVQSGVSGGTLASVLQA
                     FELHSLRHLYKAHAPYSLSPRQPSPTVPTKPTSIWTKLFGLLWIKRLGWMAYQPQGPV
                     DRAIVHRSWGLLESTTVSYGQNFDFHAWFKIWGPVAAILWHFGGLMLAPLILLRPIRK
                     LLPKLWYEPGGGAGQSDIENNWFEYRCVAEADTPTKPKQKALVRMRYESDPYIFTAVA
                     LGEAARILLWQKDTWAHKFGGGVLTSATLGDHYVSRLRAAGVTMEVQADDPVYKGKDP
                     FTKV"
     exon            27677..27843
                     /number=1
     exon            27937..27969
                     /number=2
     exon            28094..28910
                     /number=3
     CDS             join(29373..29962,30026..30440,30499..31098)
                     /codon_start=1
                     /locus_tag="AO090012000012"
                     /note="permeases of the major facilitator superfamily"
                     /old_locus_tag="AO070343000011"
                     /protein_id="BAE60259.1"
                     /transl_table=1
                     /translation="MQQNQPQRSATSAQTIEPLNVESTPPDTEPNYPTGTKFWFTVIA
                     LCVILILGGLDANIVATAVPSITNHFHTLADVGWYSSAFRLCTCAFQFGFAKLYTLFS
                     IKIVFMTSNVIFLVGSVLCATAASSTMFIVGRAVTNLGFAGELAGCFAVLAHILPLNR
                     RPVFAGLMACVESLAIIAAPIVGGALTQSLGWRWCFWINLPIGTVSLAVMFFLFSDPR
                     SRQEDDLTLTQKIRELDLVSNCLFIPSLTALFIALSWAGTKYPWSDGKVIGLFAVFAV
                     LLTVFLLNQYRRGDSAALPFRIIKSRNVIAGFIFTTCTNSMTNVLEWYLPTYYQVVRS
                     RSPSESGYLMIPILAGMMLGLLIQGIGTTTFGYYAPFMIFGSVCMPIAAGLMTTYNPH
                     TSLAQIIFYSGLAGFGGGIGFQGPQAAIQTTLSSADLNLGIGVILFGQSMGPAVFIAI
                     AQVIFTNQLSSTLEDVVPGLTPAYIAERGLGDIKNMVPMPRWDEVSRSIDRSLTHTWY
                     LSVALGCTTIVGSLLIEWRSVKQKQS"
     exon            29373..29962
                     /number=1
     exon            30026..30440
                     /number=2
     exon            30499..31098
                     /number=3
     CDS             complement(join(31650..32157,32443..32477,32576..32902))
                     /codon_start=1
                     /locus_tag="AO090012000013"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000012"
                     /protein_id="BAE60260.1"
                     /transl_table=1
                     /translation="MWSAYLFIIAALAIQLETGEAADMRYRDASTCVDPESFMSCRHR
                     ARESRIDCVSKRCYGAEDPCTKVCNGDDTCMREKCNALQNECHRPCECAEAQDIIDCT
                     ATSCWNEVYSCEYGVSVSGLTNIRLIARRIWDTCPNTKPFLITADYWSKYLLGSLDWD
                     ACAPYLQQYDCAGTLGFGAADAGGTQNFYEPGNIPKNGTGMLTNTGGVISTPVSGSSF
                     TWTLGSTTHPITAVVSSTATPSTTRECTATACQGRQTTGGGESIAAGQSRPGILLAGT
                     LLGLWAAWIGFCM"
     exon            complement(31650..32157)
                     /number=1
     exon            complement(32443..32477)
                     /number=2
     exon            complement(32576..32902)
                     /number=3
     CDS             join(34457..34623,34687..35512)
                     /codon_start=1
                     /locus_tag="AO090012000014"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000013"
                     /protein_id="BAE60261.1"
                     /transl_table=1
                     /translation="MSDPERQQDGCLDVSLDTGGTTHSTNTDPHCVGNCQLWSIAAGL
                     RSTDVTMHKINSLISSSIGQDAALGSVEYLSHALHYFLLSRIWRKIKARLHALLRVMQ
                     RHRTTPCHGQSTHTQIKTPAWSPLLSLSSLMFDTRCTLRLLGLFSIWTWGSETAKAPP
                     ADRIVRELTRLQLVATTVYQFLENVAFLMTKNVLPEKLWKRFDSEKLYAWSLLSLCVH
                     MMLQLGKLWRESVLRKRADQKAVASTNGKIKMIDKEVESASEADDNDTETSARREEVH
                     AARKSLVSSVTWGALCAHWGMPAGIGIPEPFIGALSFVADAWELRDTWISIEVP"
     exon            34457..34623
                     /number=1
     exon            34687..35512
                     /number=2
     CDS             join(35867..36431,36543..36613,36717..36731)
                     /codon_start=1
                     /locus_tag="AO090012000015"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000014"
                     /protein_id="BAE60262.1"
                     /transl_table=1
                     /translation="MVWRELCPASQGPRVKSGLSASRKPNSAIELLAQRPEPSAILVT
                     DEVLTLPENRAVWKAVLEYVRRGGTAVIMGHFPSFVRPNHLKPFFSQAGLNWESGSYQ
                     RTTLALNPAAVSVANAEKLPQRYSQKAVFVKNVAPGDMWYKTDDDSVVQSMVFPATKV
                     NIAGETAVALAKVGTGKLGYVGDVNAEEVTRRLFINTSPFVSVSALLVQERNINLR"
     exon            35867..36431
                     /number=1
     exon            36543..36613
                     /number=2
     exon            36717..36731
                     /number=3
     CDS             join(37353..37554,37627..37704,37766..37911)
                     /codon_start=1
                     /locus_tag="AO090012000016"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000015"
                     /protein_id="BAE60263.1"
                     /transl_table=1
                     /translation="MTDTKTAVPPSEEGPPPTSPTHITDQSQGVSMDAVPLWKRVWRH
                     SLTQMMLLSVQAFCGPAMSDAITGLGGGGLATPQVSNISTAIRYATLAAVCFLGGPIV
                     NKIGVKWALVIGSMSFPIQGSAYYCNSKFGNQWVSARIF"
     exon            37353..37554
                     /number=1
     exon            37627..37704
                     /number=2
     exon            37766..37911
                     /number=3
     CDS             join(38064..38155,38230..38313,38374..38550,38613..38696,
                     38758..39041,39109..39211,39269..39404)
                     /codon_start=1
                     /locus_tag="AO090012000017"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000016"
                     /protein_id="BAE60264.1"
                     /transl_table=1
                     /translation="MTLAPSGARGKYLALWIVSRNLGQLVGGAINLAKNHEKGADGGV
                     TPDTFIAFVIIECLALPFALLITPFERVIRSDGTHIVTSETLSTKEELRRIAKTITSR
                     LIVLSSLWALWSFFYTGTWTTYLGTYFSVRARALSSLISPFFCIIGCFGLGYILDMKG
                     LSQRRRAQIGLYTVVILNVGVYIWSIIMQTKFNRHDPGHIDWDDRLYASSFLPYFFVQ
                     TTGPLSQSYMYWLLSSFATDAQENVRNGAAFRCIEAIGQAIAYGMNTQTTSDPLTGFC
                     VTFALLGASLLPMIMLVNTTPDRIPADVIAEQQDVARDKLESA"
     exon            38064..38155
                     /number=1
     exon            38230..38313
                     /number=2
     exon            38374..38550
                     /number=3
     exon            38613..38696
                     /number=4
     exon            38758..39041
                     /number=5
     exon            39109..39211
                     /number=6
     exon            39269..39404
                     /number=7
     CDS             complement(join(39901..40559,40614..41092,41149..41320,
                     41375..41585))
                     /codon_start=1
                     /locus_tag="AO090012000018"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070343000017"
                     /protein_id="BAE60265.1"
                     /transl_table=1
                     /translation="MRTWYGRGTSLQAAITACCLVAFVLFGYDQGVFSGIVGNDDWRK
                     QFNYPDDSEEGIIVSCYNLGCLLGCLVNFFIGETFGRRKTIWLAMGVVIVGAVLQTTA
                     FTVPHLIIGRLVTGAGTGLKTSTVPMYQAEMCEGKTRGRLISSEVLFTAVGIVVAYWF
                     DFGMSFVGGPIAWRLPIAMQIVFAIFVIVLVFGLPESPRWLMNHGQEQEAMEVLCAVY
                     NKEQDDEYIVNERRAILSAIELEDAVSKQSFWKIFRNDEVKTGQRVLLAWGIQLMNQV
                     GGINLVVYFVPTVLRNNVGMSAQLSQILGGCIQIMFMLGSLLPAFMLDRMGRRKTMMI
                     GSFGLGVCMLMVAALLSQVNEPNGKAYASASVTFFFLYMLIHGMSINSVPWVYVPEIL
                     PLEARTKGTAIGVSSNWLWNFTVVMITPVIINRIQWKAYLIFMITNLLFIPIIYFFYP
                     ETSNLRLEDIDLIFSRGGDPVKQARKMAAEIKAYGYIQTEQQSNEKEISGMEVERV"
     exon            complement(39901..40559)
                     /number=1
     exon            complement(40614..41092)
                     /number=2
     exon            complement(41149..41320)
                     /number=3
     exon            complement(41375..41585)
                     /number=4
     CDS             complement(42746..43165)
                     /codon_start=1
                     /locus_tag="AO090012000019"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000018"
                     /protein_id="BAE60266.1"
                     /transl_table=1
                     /translation="MTRLGQRALGGMQRVAGRASQLSPSHKKGPAATTSSNCEVYNIG
                     PFHSEESLEEVAEVAHDQQICADEAVAMTDHQFLFDFEDLDTSGFNNFVTDPMFQDID
                     DQLGNFLNINIPKCPSDSAFINPDTMWNPDEFDFSCL"
     exon            complement(42746..43165)
                     /number=1
     CDS             join(45816..45977,46033..46473,46546..46863)
                     /codon_start=1
                     /locus_tag="AO090012000020"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000019"
                     /protein_id="BAE60267.1"
                     /transl_table=1
                     /translation="MLETIPGPETNYHSYQVHAMIERRLNRNIVVSEPLRIYKRFSVE
                     ESLNWMSALNSIDKQWDNVAQYSISIPDVNIPFGATFPMKLRFAPLSKGIKLHALTID
                     VIEQHEVKISAPAAYSAQFNVHFLSSKREHIIFNERHNLDDCIAPESEEPDLEWCITK
                     TISLPQDLAACTQDVSSKMMTIKHQVAFTVELLGVGKGLSMIKGTIPFNIYMSPHVIS
                     EHGTVRRVHIDGFHDDYVPPPPLYSKHQNDLLLPMGECPLNTKTLRLHCEQSLDNIFF
                     NSAALDCAPSYETVIQNQPLIANYTQTTYS"
     exon            45816..45977
                     /number=1
     exon            46033..46473
                     /number=2
     exon            46546..46863
                     /number=3
     CDS             join(47117..47887,47963..48114,48245..48463,48538..48667)
                     /codon_start=1
                     /locus_tag="AO090012000021"
                     /note="permeases of the major facilitator superfamily"
                     /old_locus_tag="AO070343000020"
                     /protein_id="BAE60268.1"
                     /transl_table=1
                     /translation="MSDRGSAGEVAESAKAARFWLLMFNLAAVLILSSVDMNIVVTAV
                     PSITTYFHTVADVGWYSSAFRLSQCSFQFVFGKAYQLFSIKRVFLFANAISIAGSLLC
                     GAATTSTMLIVGRTVAGLGSAGLLSGCFVILVQSTPLRRRPIFTGIMGAVEGLATLSA
                     PLLGGAIVQSIGWRWCFYISAPLGAVALVLTMCCFSDLPKSSDISRLAIREKILQLYL
                     VSNLLFIPAITALFLAIPWAGTKYSWGSGLVIGFIIAFARRSVIAGCIFIICGNSTDS
                     VLEYYLPTYYQIVRGYTHTQSGYMMLSIIYRRFAELIIYTAFSGLAYGIDFSGPQNAV
                     QTVLPVEDVPLDTSIMLFAQSFGPAVAIAIAQVLFVNQLSTNLNGLVRENLVAIDKSL
                     IQTWYLVVALACGTMIGSLRIEWRSVKSRRD"
     exon            47117..47887
                     /number=1
     exon            47963..48114
                     /number=2
     exon            48245..48463
                     /number=3
     exon            48538..48667
                     /number=4
     CDS             complement(join(48979..49217,49268..49434,49455..50212,
                     50289..50351))
                     /codon_start=1
                     /locus_tag="AO090012000022"
                     /note="metal-dependent
                     amidase/aminoacylase/carboxypeptidase"
                     /old_locus_tag="AO070343000021"
                     /protein_id="BAE60269.1"
                     /transl_table=1
                     /translation="MASISETISKHEERLWQVNQEIHSNPELAFEEVHAHDTLCDLLE
                     SLGYTVTRHAYGLKTSFEAEVGTGGGLIVYNAEFDALPEIGHACGHNLIATSSLAAFL
                     ATAEAIKANQIEGRVRLLGTPAEEGGGGKIELIKAGAYKGVDACLMGHPGPGMEKDGV
                     VAPRVMARRGATVTFHGVSAHAGNAPWLGHNALDAAVAAYSNIAMLRQQVAPNQRMHA
                     IISKGGDKPNVIPHLTELQFFARAETDAELQETARRVTACCEGAATAAGCTVEFEWKS
                     LLAIANVVGPRLENYKELQCNNILIDTFYKHSQEQKQYYMKALPAVSGASTDQGNVSY
                     ELPSLHPGFLIEVESPKIGPHHPGFEKSAGTRQAFESSLRFASIMAATGLEVLQNPEL
                     RSRLWAEHRERFGKAE"
     exon            complement(48979..49217)
                     /number=1
     exon            complement(49268..49434)
                     /number=2
     exon            complement(49455..50212)
                     /number=3
     exon            complement(50289..50351)
                     /number=4
     CDS             join(54219..54247,54301..54535,54637..54762)
                     /codon_start=1
                     /locus_tag="AO090012000025"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000024"
                     /protein_id="BAE60270.1"
                     /transl_table=1
                     /translation="MLLAGCTMIALIGNIIVYACESTGVRLFGLYLFVAYAAGIPMTL
                     SMVSSNVAGFTKKATVSAMMFIAYCTGNIVGPFLFFEREAPGYKYWGYHGGWKTHGEI
                     GYMGQRLLHLRIVLKSPLKGLLWRGRI"
     exon            54219..54247
                     /number=1
     exon            54301..54535
                     /number=2
     exon            54637..54762
                     /number=3
     CDS             55555..57072
                     /codon_start=1
                     /locus_tag="AO090012000026"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000025"
                     /protein_id="BAE60271.1"
                     /transl_table=1
                     /translation="MSNMSVSLAPNGLQQLAHKTLDYHRARRVKCDETPGACKQCIST
                     GRNCDGYDLPRLPVGMKRQRQDLAWSGPSMRILLDLPGTNPDERRCFNIFQTYTVPMM
                     VSWFDSDVWQQIVLRMSQAEPAIYHAVVALSAIHEDSEKAGLPPGAMDIRNTYHRFAL
                     AQYSKAASMLCRRLVSNDPQVRAVALMCCIMFICFDLCRGNYKAAFTHLQNGVQILEG
                     QITKANRRHTSPQSIDSGSPTESALTRVLLHLDVQSAHFGDSGPLLHLHPVVLGVGSR
                     DNLSLNSLREVKQRLDPIMNNILRFRRSCEPYVRGEISGPFLFDIAEASAEQRRIQAH
                     LDDHIRAFEDYVLRQAPYLVNSKDARSIDLMRLQNEALTNILETSLVTSEMVYDDYLP
                     VYKKITRRAEKIITSFQSDYGTHRPCIVMDMGVIPSLLWVCLKCRDFPTRHRAVKLLE
                     RWPHREGAYDSHLLVQIVKDHMVLEQPIAGDGATANVPEYARIDSVMRVNTSGEE"
     exon            55555..57072
                     /number=1
     CDS             complement(join(57407..57523,57576..57909,57967..58481))
                     /codon_start=1
                     /locus_tag="AO090012000027"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000026"
                     /protein_id="BAE60272.1"
                     /transl_table=1
                     /translation="MANRDEEILVDSGDDYDSHYVATDSEVTSMRSSIVDYVYENGRR
                     YHAYHAGSYWGSNDEKAIDAMEICHHLYGLLLHGRLHLAPIKNPLRVLDVGTGTGSWA
                     TDFADLHPGATVIGTDLSPIQPSFVPPNVYFEIDDCCDEWVYKSPFDFIHVRGLYGCV
                     ADWGKFYQQALKNLHPGGYLEQAEMSVTPVSDDGSTAGTIYEIWGQKSLEAGDQFGKT
                     LRIVDESKQRMIDAGFVNVSEHRYKLPIGPWPKDPHLKTLGRFFRIVMEESLEMWAMM
                     LWTKILGWSREEVEVIFARMRDALNNPSIHAYLEISVVYGQKPEI"
     exon            complement(57407..57523)
                     /number=1
     exon            complement(57576..57909)
                     /number=2
     exon            complement(57967..58481)
                     /number=3
     CDS             complement(join(60881..61478,62137..62244,62376..62392))
                     /codon_start=1
                     /locus_tag="AO090012000029"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000028"
                     /protein_id="BAE60273.1"
                     /transl_table=1
                     /translation="MVQLTRSQAQIKKCTINMHDSPSSGPPVMHAKDSRILGCTTDLK
                     KEDCMELYEKWAASYNEDLADASQNYIAPLLVAQAALASSKDPEATVLDAGCGTGLVA
                     EALAKGSKWTIDGMDLSPAMLKVAEQTGVYRSLFKVDLTQPIDQPDQKYDIVTCCGTF
                     TRGHVGPDPALRELIRLLKPNGVIAATVLEEIWVSGGYKAEADKLEKEGLAKVVSRDL
                     IDYRKGAGDKATLLLMKKTASA"
     exon            complement(60881..61478)
                     /number=1
     exon            complement(62137..62244)
                     /number=2
     exon            complement(62376..62392)
                     /number=3
     CDS             complement(64298..64849)
                     /codon_start=1
                     /locus_tag="AO090012000030"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000029"
                     /protein_id="BAE60274.1"
                     /transl_table=1
                     /translation="MYFSNAELAIHEVFIKAPIPTNSPDPQSLKSLHTCLLAAKSWLD
                     VWLCVPPEHYMGVSFTIFFQFCRALVDLFMLSTLDDPTWDRKAVQDCVNLFHYLDLLQ
                     TKFKRSSDQPGQDGEATIFSKGVSMISAIKERWGPSLMEARPYLPTTEMANPTVHDTL
                     DNPGDLKLDGMDDAWMMELFGFL"
     exon            complement(64298..64849)
                     /number=1
     CDS             complement(join(64916..64976,65048..65176,65234..65443,
                     65515..65969))
                     /codon_start=1
                     /locus_tag="AO090012000031"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000030"
                     /protein_id="BAE60275.1"
                     /transl_table=1
                     /translation="MQSPGITLQSSSDSERAREGETSLEGHAEESSSALSLYDIRTRT
                     PVSVLPALNYASNFVHIPCDTSTRLLEQFRNENLNYLPCIHIPPHVTPQELMQEKPFF
                     WYCLTAVLTPNLIERESLFTKVHDTIYQKLVVETTPSMDLLLGLMTFMSWKVYCAKPF
                     LNFYSHLLTGLVSELGINKAPRKDQSVLQGFNRAAGLKTEPAMKRTLEERRAVLGCFV
                     ITSSIASSLFKSDALRWTPHMEENLEILASTKECFGDELLVWLVRIQRLAISTRIGQA
                     PDTRISEE"
     exon            complement(64916..64976)
                     /number=1
     exon            complement(65048..65176)
                     /number=2
     exon            complement(65234..65443)
                     /number=3
     exon            complement(65515..65969)
                     /number=4
     CDS             complement(67013..67846)
                     /codon_start=1
                     /locus_tag="AO090012000032"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000031"
                     /protein_id="BAE60276.1"
                     /transl_table=1
                     /translation="MRLTSPMSLVMPMAILGISTIQGAAAKCSDGLVNVVFNIGHGGY
                     TKQRWEKIHSASNWLTFNFGFDEKQIPMLGNNKTAVDDAIDAVNGPNPPDFMLTFNEP
                     DNLYGSHPRKVILQPEEAANLIKPLLRRRGNHTKFIAPVPAFEKLTWLPEFFGNCSCQ
                     DAFSAYNVHIYNKTVDEAITRINAFHQKWNDKPLWITEIAPGQYTGACPNPVPWNHTT
                     EFMRDIFAWGERTEWIHKIFWNSANEISCGDTNVAASFLLDFNDNPTPLLDPFNKLTC
                     S"
     exon            complement(67013..67846)
                     /number=1
     CDS             complement(join(69147..69848,69900..70036,70105..70558))
                     /codon_start=1
                     /locus_tag="AO090012000033"
                     /note="beta-lactamase class C and other penicillin
                     binding proteins"
                     /old_locus_tag="AO070343000032"
                     /protein_id="BAE60277.1"
                     /transl_table=1
                     /translation="MDSPASACSYEELHISNPTTQMSQLTPNVTGSLQARVDEACADQ
                     EKGIPGAVVVMVGKDGLEYFAHASGKRGYGSSEPMTLDNIFWIASCTKFITGIACMQL
                     VEQGLLSLDDSAQVETICPELKRVQVLQDDGSLVDKRQGITLRMLLAHTAGFGYSFFN
                     EKLRDYSKPVGYDEFSGSSYDMLQPLVNQPGERWEYGVNIDWAGLLVERVTGLSLNDY
                     FHQNIFEPLDLHNISMFPNASMKSRLAHMNSRAPDGQLSPRDHLLRRPLIVEDARDIA
                     CCFNSGGAGCFAKPQEYCQILATLLNDGISPTTNKQILRKATVDLMFENQIPQFPNFA
                     AQEIPPAKADLTNRIAHLYPSATPPGWGLTCMLTGGSTGRSAQTGHWAGLPNLWWWCD
                     RPKGIAGMVCTQILPFADAQVLGLWSDMESLVYKGLDL"
     exon            complement(69147..69848)
                     /number=1
     exon            complement(69900..70036)
                     /number=2
     exon            complement(70105..70558)
                     /number=3
     CDS             71302..72969
                     /codon_start=1
                     /locus_tag="AO090012000034"
                     /note="predicted flavoprotein involved in K+ transport"
                     /old_locus_tag="AO070343000033"
                     /protein_id="BAE60278.1"
                     /transl_table=1
                     /translation="MPVRRELADNATRGPTDGNYADELDVDVLIVGAGFGGIYSLYEM
                     RKLGLKAVIYEAGNDIGGTWRWNCYPGAGVDSEVPEYQLSIPETWKDWTWSTNYPNYE
                     DLRKYFDHVDKVLDIKKDCAFNSVVVGAHFHTVEGRWHIRTADGRTARAKYFIIAAGF
                     AAKRYIPEWPGIEKFKGIVHHSSFWPDEKIDVRGKRCAIIGTGASGVQVTQAWGPEAG
                     ELKVFQRTPNLAVPMRKRSLTVEEQEGAKAFYPELFRYREKCFAGFLYTWCERGVFED
                     SEEEREQFLEKLWSDGGFRYWVANYKDYLYDAKANRVVYDFWRKKVRERINDPKDQEL
                     LAPSEPPHPWGVKRPCLEYDYYEQFNRPNVDLVDIKDNSIVDFTEKGIKLQDGTEYEF
                     DVVCIATGFDITTGGMTSMGLHSIHGDSLKEEWKSGAFTYLGMTVSGYPNMFHLYGPH
                     GPTLLSNGPTTVEIQGRWIADAIKQMERQGIKYINPTAKAAKEWKAKINELSDKTLFP
                     TTKSTYMGGSMPGKVFEQVNYAGGEYPYSKEIRAVLPKFNGFDIVKR"
     exon            71302..72969
                     /number=1
     CDS             73324..75804
                     /codon_start=1
                     /locus_tag="AO090012000035"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000034"
                     /protein_id="BAE60279.1"
                     /transl_table=1
                     /translation="MSYRRRQHRSCDQCRKGKRACDALLADELERSSNTAARQAYNHS
                     CSNCRKYKRKCTFDWLLSHKESRHAHSKRARNIAIALSRQVNDCSPHSSQQTSTRRNP
                     TELPLQNIEDCEWPTSVRDPLLPLPQDEELDADWLTWGCLNDAVSISPLSADMTLNGD
                     RHVNPNQTPQMSSQWNSVGAGQAWQSIGQTSLLDTMNSSITSSQFKDTPDSRSFETWD
                     ISSELPLHGLPPTEGRGVSMPTNTTLCVGSNQLAHNYAHSMMTRNLIHIYNDSMENAL
                     SCWLTERNCPYSARGYVDKTGPKTGPYTTNRIYRRICLLDRACSSIPGRRLTSVESRT
                     ATQTLHAVIMAFACQWLERPSADKDIPIPSSSAHHESGMREGLWNEARHALENSRAIP
                     SFRVAFANILFSLAQRPLHVEEGMELDELLDHDPAPMYLETALRQLFTFRSRLIKLRR
                     QGPNRALEQCCKESKGDKSTHQLSQIDLMLKDSETHHTFDLLFWLGIMFDTLTAVIYQ
                     RPPVISDEDSQIIRPRSRFSFPDAVDLDGWDISSYSASRREESVWGDLFLRKRNMLHN
                     LNQARWPCSYEEAAEVLSDAAPVKVLLFRRINHINTLVCRGGEAGAIEEAIHSALLVY
                     EYWNSTYKQFMLDCLSHHTELPARIQSWYLVLAGHWHLAAMLLADTVEDIDQARLGQN
                     SQAEHRYTTGLISVLRHENAFAVGGLAQYSYDLQGSSHPKLRNFHDSVNQAASLTEPW
                     TAVLIHSFRKAGTILIREIGKLQCGYQMQQESFMLAYQRCEHCVKALQCLGRKSDMAL
                     AAAQSLSDSLNMTLFRSSPIDSYHMCAL"
     exon            73324..75804
                     /number=1
     CDS             complement(join(77622..77727,77799..77888,77951..78162,
                     78220..78357))
                     /codon_start=1
                     /locus_tag="AO090012000036"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000035"
                     /protein_id="BAE60280.1"
                     /transl_table=1
                     /translation="MTAMLTDQIGRRPLTVYPYAVTTVSVLCLGIIGCFDYTQKSTSS
                     LLVFFACLATFSTTGASSIGYAYAAEIPQQRLRAQTAGLSLASSNLIALMFSFCTPLM
                     INGPLTKWGVKTGFFFAGTGTVAVIIAWFILPEVTRRTPAEIDEMFEKKVNLRKFKHY
                     VTDVQTHAAEQHEMEAHTHTA"
     exon            complement(77622..77727)
                     /number=1
     exon            complement(77799..77888)
                     /number=2
     exon            complement(77951..78162)
                     /number=3
     exon            complement(78220..78357)
                     /number=4
     CDS             complement(join(81205..81563,81696..81729,81795..81821))
                     /codon_start=1
                     /locus_tag="AO090012000038"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000037"
                     /protein_id="BAE60281.1"
                     /transl_table=1
                     /translation="MQTLLMGTRALYFHQGTIGNYQIAPLDDQTTPYAAYAIYQDGAP
                     SRILLYNSEYYTNGTRPSQTFTVNGLTSSSVTAKRLTAPYSTSRVDQGQVPTVAGQTF
                     ANETCVIQGDEVIETSTVSSGSATFTLSASEALLVYL"
     exon            complement(81205..81563)
                     /number=1
     exon            complement(81696..81729)
                     /number=2
     exon            complement(81795..81821)
                     /number=3
     CDS             complement(join(85234..86348,86511..86966,87034..89107))
                     /codon_start=1
                     /locus_tag="AO090012000041"
                     /note="chitinase"
                     /old_locus_tag="AO070343000040"
                     /protein_id="BAE60282.1"
                     /transl_table=1
                     /translation="MRPSFVLLAFLLGFASAVTESYNGQYADNCPSLCAHAGPSPANW
                     TNNHHVRNLESCDQTVLFGLNIHNSVTDPNTILTIRACVASHGQTYEAAASPDVPQQP
                     SQHNLVVAESCGAKVVKTAFTPQVGPSTLSKASSPAPQSTHVAEATRQLALFVDKSAE
                     CGTTILFAKHKSAVVGVYSGAQITKHAVRGFLDSFAEKQTSTVQICQPASAALTVGVA
                     SAGFVDLAAAQVAIKDWNNGLCLDETIPATPVSMDVLVSTVDNSFNAPTNTTTISHGN
                     MTARGKPQALLPRGECRTEEVHGGDSCASLASRCGISGNDLSKYNPQKNLCSTLKPKQ
                     YVCCNAGTLPDFRPRPQPDGTCNTYKVSDNDNCSDVADAHYLTQQDIEDFNKDTWGWA
                     GCAHLQSGQLICLSEGTPPMPSPVQGATCGPQVPGTEKPSNGTALADLNPCPLNACCD
                     AWGFCGTTVDFCTKSPADTGAPGTAKPGTNGCISNCGMEIVNNGKAPDQLKTIGYFEA
                     FDQTRVCLRMSVKEIPANKYSHIHFAFATVTSSFDVDISDVEYEFSRFVKMSGFKKIL
                     TFGGWAFSTEADTFQRFRDATKKEHRETFVNNLVSFMNRKNLDGFDFDWEYPGAPDIP
                     DITPGSPEEGDNYLAFLQLLRSKLPSEKSLSLAVPASYWYLKQYPVKDIAKYVDYFIY
                     MTYDLHGQWDVDNKSSMPGCPAGNCLRSHINKTETHDAMVMITKAGVEARQLVIGITS
                     YARSFRMTDASCSGPFCTFAGDKRHSMAYAGPCTTTGGYISNAELNDIIKNPGNYSIV
                     KSYIDKDSDSNILMYGNPGAVDWAAYMDSDLKTNRINWIKGLNFGDSLDSGCVHLFAL
                     DILYSQLLDSLSLFQANSEGYDDKFGWYEKWTKEQIQPRIDTFMKLGDGKGLKYFDCY
                     WAYTDGKEKKDSCLGMPHIWDVNAGWSIRYDLVDKKGFFDALAAETGIDESWVAFGET
                     SDYTCADPGDPRPGTGGLPCRKLFQKKLNYPQKGSDDKVHVGNPKKLIEASLGNVTAL
                     RTSLLSSYLSVGLSFYDDGPNDTSATDAVVAYSMPILQLTEAINSMKDIKEIGEDAKE
                     QAKKDLIFKILTIVFMVIPFVGEALGPLIGSAASVARIALLIGEAGNGALTVADIIED
                     PSSAPFAVLGLIAGVGGGSGKLSKAEALAEASKARGLLKGSDLAKFPQRFRDQDALVQ
                     KVVKSLCARS"
     exon            complement(85234..86348)
                     /number=1
     exon            complement(86511..86966)
                     /number=2
     exon            complement(87034..89107)
                     /number=3
     CDS             91415..91813
                     /codon_start=1
                     /locus_tag="AO090012000042"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000041"
                     /protein_id="BAE60283.1"
                     /transl_table=1
                     /translation="MLPLLFLAVFLAPGVMANVVAGKWQALFFYQLYRIEVEAHGLEN
                     SRMAPGCVKAGVVCDMKAFMKEVSIVKKVRALDANGVVIKPVKIVDDPDWDKVNWAQI
                     GEGANLETVAIEFDKVGFKGRMNNARIFKD"
     exon            91415..91813
                     /number=1
     CDS             complement(join(92155..92204,92408..93440))
                     /codon_start=1
                     /locus_tag="AO090012000043"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000042"
                     /protein_id="BAE60284.1"
                     /transl_table=1
                     /translation="MSDNSFHYFTRLPLELRRLIWEHCLPYRIAELDIPAFLLDGEES
                     RQACLPEYTTHQNAQLPVIAFVNSESRQVALEEGRWVQGQETTSKQLIWVQPRRDVLH
                     LNWTRMSYDVLGPLVGLYSPIGWYSLQAEELGMQPSIVAEIIYYFDLKGLLEGADGAD
                     GADGADNDEPFSASWSRRHDGMYDPLSIEEASDIAALAEFHRWYDVAMAAVSLHITRE
                     AALRSGLFGLLGDAPVQMVDVDDEARLRQFQALFREHALEKEPAVQALFELLTNARFR
                     AAVGTWKSKAEWIILASMWDYARRKNGILGTNPGSAWVPYLPEEARPRIDLSQYSPNE
                     NHPWVKEARQTSKWISDWPALLKFVT"
     exon            complement(92155..92204)
                     /number=1
     exon            complement(92408..93440)
                     /number=2
     CDS             complement(93634..94746)
                     /codon_start=1
                     /locus_tag="AO090012000044"
                     /note="dioxygenases related to 2-nitropropane dioxygenase"
                     /old_locus_tag="AO070343000043"
                     /protein_id="BAE60285.1"
                     /transl_table=1
                     /translation="MMIAHFSRLEKDYPWIACPLVASAPMLNIATAKLAVAVSSAGGI
                     GFIAGGYDLSGLEQQLIEAQDLVNEANFHDYHLQQSQGDAPILPVGVGFLNWGASLEI
                     ALPLIQKYRPCAIWLFAPKTGVDDLLPWTRAIRSEVPYNVKIWVQLCCLEDAIESTEK
                     LQPDVLVVQGCDAGGHGLARSASIVTLLPEVLDHLKSREPSSTQTIGKPFVVAAGGIS
                     DGRGLAATIILGADGCAMGTRFLASPEAQIAKGYQNEILRASDGGVSTVRSTVYDKVR
                     GIYGWPTKYDGRGLINRSYEDIVNQEVTEEENRRLYEEEKLKGDNGWGPQGRMTTYAG
                     TGVGLIRAVMPAAHIVTKIRQDAMGILQKSFVPAKL"
     exon            complement(93634..94746)
                     /number=1
     CDS             complement(97180..98790)
                     /codon_start=1
                     /locus_tag="AO090012000045"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000044"
                     /protein_id="BAE60286.1"
                     /transl_table=1
                     /translation="MSSWLPSLLLFGNLAIASSVSTVHIPLNSSSRVLRRDLYGYSIE
                     PVSLDPYLQTELASKLLGHVAEIAGVPAPIRVGGNIADQTLFDPTLEFPSEALPNDTT
                     VEVLRIRPDWFNGWKEYFPQGTDILYTLNFRNETDSWINAMEEAQAAMGALGDSLSHF
                     ELGNEIDHYINKGWRGADWDTKEYTKQWRRLTGQILSSKFYKNATHKPLFQAAVFADP
                     PMVPDQHDEIDDFDIANVTRAGLVDPKIIESYAVHLYPQSTCDAERYARLSLNLLSDH
                     NVIWKNLSQYIPQDAAARAAGSRLVLGETNSASCSGKSGISDTFGAALWATDYVLTAA
                     SIGIEQTYFHLGHQSEYSAFTPLPYEHKGENLTAGVRANFFSHIFLAHIISSRKADSW
                     RISALPAANASDFSGFAIFSDAPESSLAKLVFIDLGVWNSTVGAHNPSTLAATDSTFA
                     SPGDRPTRTVEVHTSWSPGTKIEILRLQGPGTNAKSGVNVSGVSIDSATGNLVGQEKV
                     EQGIVNDGGIVRCELSQAEAILIQKPSE"
     exon            complement(97180..98790)
                     /number=1
     CDS             complement(join(99680..99768,99825..100620,100674..101081)
                     )
                     /codon_start=1
                     /locus_tag="AO090012000046"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000045"
                     /protein_id="BAE60287.1"
                     /transl_table=1
                     /translation="MRFNVLATLVGITIPQIALAIAPGPLSTSGRWIVDANGQNITFA
                     GVNWPGASEAMLPEGLQYQSIENIVDKIKTLGMNVIRLTFAIEMIDDILETGRDVSIK
                     DSLVKALGEKNGTKVFSNIVRHNPQFGVDTTRLQVFDAVANESHRQGVYVHLDNHISK
                     AMWCCSGTDGNTWFGDRYFDVAKWHRGWQYMAEHVFKTPRSLASSVTDATTQVKSLPA
                     VKSVGMRNELRKAEDNPTLVNTTYNWRYWYRHMVENANQIHAANRNLLIYFSGLDYDT
                     RLSPIPTGAELGNGTAFRKDDFEYADKIVLELHNYERTATSCEDLKSSLWNAGFNALD
                     TQNSSIVNIMPVQMTEFGFPQDNTTYTDVYASCLREWLPSLQAGWMVWVIAGSYYIRK
                     GIQDDDELWGLLDHTWSDWRSTDAVTNGLIPMVQATLG"
     exon            complement(99680..99768)
                     /number=1
     exon            complement(99825..100620)
                     /number=2
     exon            complement(100674..101081)
                     /number=3
     CDS             join(103758..103950,103985..104192,104250..104398,
                     104466..104752,104759..104801,104829..105042,
                     105110..105710)
                     /codon_start=1
                     /locus_tag="AO090012000048"
                     /note="H+/oligopeptide symporter"
                     /old_locus_tag="AO070343000047"
                     /protein_id="BAE60288.1"
                     /transl_table=1
                     /translation="MKAPTSTTLVGVDSMLADYERRDATQDEINELPHVADSISFVVW
                     VALVVSGAERFLFYAATTPWRMTDAKMCAENYAQYDRENTSIPGALGLGEAMASNISS
                     AFYAFTFLMSVAFAVLSDAWLGRYITLCLSFCLDFCGCLVLFVTSLPAITDGSVKLVG
                     FILAVILIGLGTGGVKATITPFIGDQYPNVSPQLIITKKGERVVTDRMLTMQYIYNVF
                     YWYGAGSPIHNHLLSLTNLSRFTSIATLSLIASTYLEKKVGYWAAYLMPLCAFAVVVP
                     LLTHKALGSQRFFNFATLKLPPQGSVIPQFAKVICFSARDRFRLDAAKPSYQAEKYHR
                     EVDWDDLFVSEIKRGLSACKVMFVFPVPTFIVNNLITQAGEMRLDGVPNDAIKAINPV
                     FCIILGPLLQRFLYPGLRKAGIRFGPIARMTWAFVTMSGSMAFAAGVQKLVYSRGPCY
                     EKPLVCEASDGGRIGNDISVWVQIPIFFFLGLAEILGFTTLAEYSYSEAPTNMRTLVQ
                     SLVQVSSGIGSALGMAVSPLSKDPKVLYLYTALAATMVVVASGFWVVFHRYDRNRN"
     exon            103758..103950
                     /number=1
     exon            103985..104192
                     /number=2
     exon            104250..104398
                     /number=3
     exon            104466..104752
                     /number=4
     exon            104759..104801
                     /number=5
     exon            104829..105042
                     /number=6
     exon            105110..105710
                     /number=7
     CDS             join(107536..107788,107811..107959)
                     /codon_start=1
                     /locus_tag="AO090012000049"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000048"
                     /protein_id="BAE60289.1"
                     /transl_table=1
                     /translation="MDMAALGISSTDVEAYGRSLINVSALPDREVQRSYILSLAHAAE
                     PYMDTEMMLSLIHFVDYVKLADPVYMLIGIFRLFPVGARCSIAQPPGRHEKSPVMLSI
                     QYKCLLAIHPIHLRVLIGLYLLNANNRLWIL"
     exon            107536..107788
                     /number=1
     exon            107811..107959
                     /number=2
     CDS             110690..111826
                     /codon_start=1
                     /locus_tag="AO090012000050"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000049"
                     /protein_id="BAE60290.1"
                     /transl_table=1
                     /translation="MTMREYAGGDQQNPTGYGYGGNNNYYPPQPNRQGNPSPQSYNHP
                     NPSGYNPYPPSGSNPSETNYNYNSGNQYYPTQTEYPQPQPWGGPSPPPGNYYQQPENR
                     SYHNPPYGGQPPYPHSESPRPNQTDAYPPKPYPPPSPQQGGYGQYPPAPPPYSPQPTG
                     STDTPNAETEEKDRGFLGAVAGGAAGAYGGHKVNHGFLGAIGGAITGSVAQDAMKKHK
                     KEKEEEEKKKQWAAQQAAQQAALQHAQQQAQQHAPPPMFSPPPQHGPPRPDPTPLRGN
                     FSASSRDIRLERGHELVAHCGAISGQMRPSSIPLNNVLSNQYGKFVWARNGNFAASAR
                     NIRLIEGGKVLEAELANGRGGWDRAWMRLDERISNQDGNLVFLD"
     exon            110690..111826
                     /number=1
     CDS             join(113984..114227,114363..114462,114525..114537,
                     114611..114978,115037..115437,115491..116038)
                     /codon_start=1
                     /locus_tag="AO090012000051"
                     /note="synaptic vesicle transporter SV2 (major
                     facilitator superfamily)"
                     /old_locus_tag="AO070343000050"
                     /protein_id="BAE60291.1"
                     /transl_table=1
                     /translation="MEWLKSLQRDRSQIPDVVIPLADAQNSIPLAENDGESNVNSLDS
                     QEKGAGIATDCSTLTLEALRAEVDSSVAASGHNTVYDRKAKIINKAIQDIGMGRYQWE
                     LYILCGFGWTADNLWLQGVALTLTPLSMEFGVSESYVRFTTCALFVGLIVGATFWGLA
                     SDLIGRRLAFNTTLFLCGVFGLASGGGPNWVGTCALYACLGLGVGGNLPVDAAIFLEF
                     LPTSSAHILSSLAVFWSVGTLIASMLAWAYIPNYSCTDASTCTRADNMGWRYLVLTLG
                     AITMVFWLCRFCFFKLFESPKFLVAKGRDDEAVAAIHGVAHRNKKKTWLTTEILNEIG
                     GSAETTEKQNLSSKEIIARSLSKFSASQITPLFSSKRLGITTILIWLCWTTIGMGYTL
                     FNAFLPQYLGSTASTYETYRNYAITSVTGLFGPILALYMVDIKYIGRKGTMAISTCVT
                     AVLLFCFTAAKTADTQLVCSALESFTQMIMYGVLYAYTPEVFPAPNRGTGTGIASCLN
                     RIAGLCAPIIGIYASSNPSAPIYASGALLLVSFVAMVLLPIETAGKQSL"
     exon            113984..114227
                     /number=1
     exon            114363..114462
                     /number=2
     exon            114525..114537
                     /number=3
     exon            114611..114978
                     /number=4
     exon            115037..115437
                     /number=5
     exon            115491..116038
                     /number=6
     CDS             join(125036..127676,127858..127895)
                     /codon_start=1
                     /locus_tag="AO090012000054"
                     /note="ankyrin repeat"
                     /old_locus_tag="AO070343000053"
                     /protein_id="BAE60292.1"
                     /transl_table=1
                     /translation="MAPTPEDAVFAISAQATQLGNRISVRMLDYLSTVHDIPEGFGDL
                     SRVFLDTCRSLWTIEAGLSESTTANRPLPRIIVQEVEKKFIEAYRDFQHLDRVVTKLI
                     QYEHRGALGKLQKGWNRPSHELGKIRESLKKTMEALQISVLAFHWSLGDAKPEESVGV
                     GYAGLAAALDRMAKGRSVTGINKAKTLERGIAEMKQSSQAVKTAPAGPPPSRPVPPVP
                     PKPSSSQDDVSRDPGCSRGGTLVEPMPETLSSVLSLDSLSLSSSHHGRDLELSQIRTR
                     NTTSKGEDRPHLQSSSASTLAQDMDTNPSSVLPSKASYRKHDLPSMPQRTPSNTSAAN
                     VGHLKNALASAVRARNHQLMEQLLDSGVSPDMGENTHPLNEAILHRDIEGMRLLLLFG
                     ANPNAPDKEGKSPLFSAVEGSFMDGATLLLKYRADPSLMTGTELESPLGLCITSLKTG
                     LVHVLLAHGADPNHEMRNGSTVLIEAIRKKAPQRLVDLILDAGADPNLKSREGKSALF
                     EAVQADQVTIVTTLLDHGANPNLPGPEHVLWSAIYRPACLRILMARGADVRKTPGIME
                     QATSINNIDSVRILLQAGVDPNSKKDGIYTPLCSAIRDNRGDIFALLLANGANPNVMA
                     SEYPAWKCVTHFRTHLLPDLVDAGADLHQPPGIVEMAVQANNAEAVQWLLEHGGANPN
                     DRNAQGHTALTTAIRDNRVDLMALLLAHGADPNQRGQDWPVCMAVRSPILLQQLLPAV
                     TDLSAHKGVMEMAVLANQLESIKLLLAAGASVEYKNGGVFSPLTTALREHHEDIVRFL
                     LDEAGADPNAPGEHLPIVKAVRRCNNGDFKMIELLLEKGADPNKTYREWNAIMQAIEN
                     RDMKLLRLLVEKGGGVDLEKEDETVNVGRFIPETCQ"
     exon            125036..127676
                     /number=1
     exon            127858..127895
                     /number=2
     CDS             complement(128969..129583)
                     /codon_start=1
                     /locus_tag="AO090012000055"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000054"
                     /protein_id="BAE60293.1"
                     /transl_table=1
                     /translation="MQTARLQLVRLTEDHVAGYHAIWSDPVATRWSAHSPCKTIDDSR
                     QWMSSLLLEANPMGENYAVLLRRDVNFDAITNRLNDGQEGTDDDKPYDISAHGGFIGW
                     VGTWRTDPLPEMGFIFHRSTWGLGFATEALRAFVELYWSRKPQFNVLEAYCDTENEAS
                     VNVLRKCGFELVDVTRKDYVLPWMTPPERDTMQFRLIRADSLEE"
     exon            complement(128969..129583)
                     /number=1
     CDS             complement(join(129841..131368,131425..131480))
                     /codon_start=1
                     /locus_tag="AO090012000056"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000055"
                     /protein_id="BAE60294.1"
                     /transl_table=1
                     /translation="MAKKPKKCTRVRTGCYTCKIRHVKCDEARPACVRCTSTGRKCDG
                     YPLELLKVGEPKERRTLQPALAVPLFTKAGESISFDYFRRHTAAQLLGCFHASSKDLL
                     ILQMCYAEPVIRYAAISLADLHRSFANSVNPKGQSSSNTQHSALVHYASALTHMKSLL
                     CSKIQSMDTFLTACLLLSSIEIFQGRYQAADVHLRCAFHMSEIAKGTDRGAATQDSPN
                     TSIISKYPMIGTLMRMRFQCDLFLDVASTTPGALIKPGQHFSIAPPDIFTSLGEAQDI
                     LFNQIDRFFRLINQIALAKIATTPGVTSCDVGDRRKYPGAMAGSEVFLREMQTEGVSG
                     LDQWDRAYQAFRSRYAHTFSTPEQHAATLVEIYRDALRMLLQMDHSQGALAHDPFERG
                     FGLLLSRLQLLLDESPQPACTAEAPPVFTLEIGIVPILYFIATNCRNYGTRHAALAIL
                     AAAPRREGTWDGSIIYTIAQRSVALEEEGRLDGDQSARGIPPSSRLIGMEAGIDPVKQ
                     SAFLVLHQLEHTRREKIKW"
     exon            complement(129841..131368)
                     /number=1
     exon            complement(131425..131480)
                     /number=2
     CDS             complement(join(132333..133506,133570..134288,
                     134346..134822,134882..134905))
                     /codon_start=1
                     /locus_tag="AO090012000058"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000057"
                     /protein_id="BAE60295.1"
                     /transl_table=1
                     /translation="MVTPDEQKIINSLQANWIWTPDWVDSSRVNTTGRIVHFSRELDL
                     PESPTRAELHFSADTRYKLYVNGVRVAVGPARSSPWIWYYDTLDIAPYLSRGRNVIRF
                     VVVRYFASSRGAMPFERTTLPGLTVVGSIEAGSNVVELDSHKGWQAQVDESIQFPMGL
                     IDDGFLHIYERVAPTIHSPSVTPKAYGIKTLNGDLPPWRLRPRGIPMPDQTPIVVNVV
                     RACESYISAEEWSSCLSGGGPLTLRGRSSHMLELQADTHSTAFLRWAFQGITNASQIT
                     LKVTYSEGYELEPRSYPYFRKKTDRLDAKAGHLIGPYDAVTLDIPDTQTVAYEPFWFR
                     TFRLLRLEIIVGEEPVRMLPLEATQVNYPLAVKASWTELGDEYSERIWDVSIRTMRNC
                     MFDGYSDCPFYEQLQYSGDSRAVGLFHYLLSGDDRLMRQAITNFAASVTFEGLTQSRF
                     PSHVPQLIAGFPLYWVLQVCDHHLYFGDTRFARSFLPRIDGVLDFFDVHIDTLGLVSG
                     LPEDVWQYVDWVTTWGATEDYPDKGVPTSGRKSNRHTYFSMLYAYVLQQAARLVRDVG
                     RPGYAEEYEARAAALQQAIRAHCYDGHFFTDSTADIADEMSYSQHCQVFAVLSGTARP
                     EDHARLLMESFADSRFAKCSYMMRFYALRALSLAGDQVYDSFWPQLWDPWRNMLANNL
                     STWEEDDVRQRSDCHAWSSVPIYEYCTELAGIRPIAPGSSKILFKPRLGLSDAIQAKV
                     ALGKDNVATISWTMGGGGEKNVELRLEKPVEIVSQLPGGLEEEHGVTDCVKLVHKAG"
     exon            complement(132333..133506)
                     /number=1
     exon            complement(133570..134288)
                     /number=2
     exon            complement(134346..134822)
                     /number=3
     exon            complement(134882..134905)
                     /number=4
     CDS             join(137804..137811,137904..137936,138263..139466)
                     /codon_start=1
                     /locus_tag="AO090012000060"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000059"
                     /protein_id="BAE60296.1"
                     /transl_table=1
                     /translation="MTWWPSLAPVRRACPLVDRFSDEIQKFGRVLKWIKRLMPFLGIL
                     PVKVMLKLFRFSTEFGNKMVLPLLALFLGTGNQTPNVPSALLERLFDDKNMRLWDYDP
                     DTLLPNQPTMYTFPNLSDFYHDWARNLSSRGVHIRLKTAPELIRRDKHGVTLRPHPAT
                     DDANGDPDEADLPCEEFDEMVICCPADEAKSLLGQHATWREKYVLGGVKFFNDITITH
                     SDSEYFNHIFEARYRGDLCAKGNNQSRRDQIAFSQKTTRTRKDGWEGFAPMYYIHSYE
                     SDPDKIEMGFDCTNYQHQFREAFGENAISPESDRHVYQTIFLNDKEKHLWTWDGIDKS
                     KIIDKKWWHQFGHRWQHYLRVVPGMMFINGKNRTLYAGAWTMVVSFALSTFLPHAKHY
                     TEHARDRLYIRNCGGIPARCRL"
     exon            137804..137811
                     /number=1
     exon            137904..137936
                     /number=2
     exon            138263..139466
                     /number=3
     CDS             complement(140654..141145)
                     /codon_start=1
                     /locus_tag="AO090012000061"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000060"
                     /protein_id="BAE60297.1"
                     /transl_table=1
                     /translation="MASGCNSKVESTTDSREIGNRLDQGAIQGLCSSGLSSHALSLQR
                     SAVAYYCSSYFHNNVIQQGLDVFGKSSYIDWMAFTPDLDVDEPSLKSALLALGAARMG
                     RLSQDSRLTRLSSESYSQTLRHLHRAIQNGTQGLRDETLASMMFLAIYEARSPSHWWL
                     CSC"
     exon            complement(140654..141145)
                     /number=1
     CDS             join(141951..142050,142316..142596,142648..142686)
                     /codon_start=1
                     /locus_tag="AO090012000062"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000061"
                     /protein_id="BAE60298.1"
                     /transl_table=1
                     /translation="MDVSASSTPKTMFRWVQKLYNALGFKKGYNFILSAAFLAFFQFV
                     PAIRYKVILFHRINGYTIILLVLLSNVGALMIARHTFGGTIPTQAAVGLLVILSTCAI
                     GMAYYNVKRLQLEQHRAWMLRAFFYLLNRWDVSSPRA"
     exon            141951..142050
                     /number=1
     exon            142316..142596
                     /number=2
     exon            142648..142686
                     /number=3
     CDS             complement(join(143696..144139,144196..144521,
                     144578..144601,144658..144976))
                     /codon_start=1
                     /locus_tag="AO090012000063"
                     /note="amino acid transporters"
                     /old_locus_tag="AO070343000062"
                     /protein_id="BAE60299.1"
                     /transl_table=1
                     /translation="MIQGVIFLNHETYAPPRWQGTLIVSAASIGMSLFNIFAAKHLPL
                     AEGIFVTFHFFAFVPIIVTLLVLAPKAKAQDVFFGFKDYGAGWANPSLAVMIGQVSSM
                     FTVMGSDSVSHMSEEIEDAGVTVPKSMILSFALNIPFGIGSVLTYLFIMPDVQDALDS
                     PAGLPFIYVFSEATKNTTGASILVVAILLLFFMITISSTASASRQTFAFARDNGLPFS
                     NWLGAVHPTLHIPVNSVILTCAFSIIMFLINIGSSVAMNALLSLATSPLMGTYMICIA
                     CVIVRRITKSPPLPPSRWSLGRFGMPINILALVYSSWAFFWSFWPVNREVTDETLNWA
                     PVLFVGVMGSSGLLYWLVARKVYEGPVVKVEGRKFH"
     exon            complement(143696..144139)
                     /number=1
     exon            complement(144196..144521)
                     /number=2
     exon            complement(144578..144601)
                     /number=3
     exon            complement(144658..144976)
                     /number=4
     CDS             join(146697..146798,146915..147019,147221..147537,
                     147629..148169)
                     /codon_start=1
                     /locus_tag="AO090012000064"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000063"
                     /protein_id="BAE60300.1"
                     /transl_table=1
                     /translation="MEVSVVNHVAIIVIASVVGLVWSLLMIVIRIFLRVVGVVQTSVT
                     LHAVHNGIGQQEDLLVPDDADAGLKAFFGELFQSLSQRRSVVCRGHGILEPLINVIAW
                     YSGHPAFHKGKRLCVVLLTCLLAIKFVRWTVVETGNMLIELLIPGLIIKVLWSLQARL
                     KTKLSVLLAFSVQLLVAIPTIFRLVLLREMTTEDIRNDRTFAITNTVVLTEITMHFSL
                     MAATFPCLRKFLQAFDTNLGATTHMTTAPDGTDKSGSKGSYALKSLKRPSQGAGGSFE
                     QWPRHSRRPGRRYQPHTVTTISAGMEDSGPCIEGTDRGNGERTINNDIESGSVESDDS
                     QLAIIRRTQHWEVTVESRGN"
     exon            146697..146798
                     /number=1
     exon            146915..147019
                     /number=2
     exon            147221..147537
                     /number=3
     exon            147629..148169
                     /number=4
     CDS             complement(join(148344..148622,148720..149558,
                     149614..149919,149972..150170))
                     /codon_start=1
                     /locus_tag="AO090012000065"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070343000064"
                     /protein_id="BAE60301.1"
                     /transl_table=1
                     /translation="MSLNKYCGEDDSYEKEKAEQVEHVDTIDAEKGHLQDASELSGIE
                     DTAASKAAWLISITVSIGGLLFGYDTGYISSVLVTIGTSLGHTLSSSEEELVTSLTSG
                     GALIGAVGAGLTADRFGRRWPIWGACILFVLGTVLQTCSYSVPQFAVGRFVVGLGVGS
                     AAMVVPLYIGEIAPAKYRGRMVAFNNMSVTFGQLLASAIGAGFAQVKGEAWRATVGIG
                     AAPAVALAALLLLCPESPRQLVSHGDNASADAVLQRIYPGSTTEQREAKIRSIELSLQ
                     EATHAMSEDSIWATIKRVFTTPSTGRAVLTACVVMAISQLGGFNTLMYYAAKLFAIVG
                     FNNPTAVGITVSGTNFVFSVVNLLVVDRFGRRIILTTTVLGMGICMLITAVAFHYIPV
                     NLQTLEVETNNVGWPGIVVLVTIICYVACYSSGVATIAWIGTELIPLEVRAVGTMMNT
                     VTCWSTNIIISSTFLSMMKGITPSGAFGFYTGICFTGWVFVVFFFPECKGMPLEAIRE
                     VFSDGFGVRYSKKWQKEHKNEARAATVTSFGH"
     exon            complement(148344..148622)
                     /number=1
     exon            complement(148720..149558)
                     /number=2
     exon            complement(149614..149919)
                     /number=3
     exon            complement(149972..150170)
                     /number=4
     CDS             complement(join(151248..151641,151700..151971,
                     152027..152271,152319..152470,152530..152721,
                     152780..152909,152974..153166))
                     /codon_start=1
                     /locus_tag="AO090012000066"
                     /note="cytochrome P450 CYP2 subfamily"
                     /old_locus_tag="AO070343000065"
                     /protein_id="BAE60302.1"
                     /transl_table=1
                     /translation="MMLVVSLLLGLTGLYIIRWTLGERKTLKRLPPGPTSKPVIGNLL
                     DLPSPGTPDWLHWLKHKELYGPISSVTIFGQTIVILNDRQTVIDLMEKRSGLHSSRPQ
                     LPIAEITDWDDTLGLIPYNSRFRAYRKALHQEMGTPASILKYHDIIDMETHRLLFRIL
                     ENPEDLVQHIRKEAGSIILRVGYGYVTEPHARDPLVDLVDKAMEDFSQLVLPGAWLVN
                     FIPMLKYLPSWFPGNGWQETAKAYKKRVTAMRDVPYTFVQRQIKKQNHVPSYVSSLLE
                     QGNVEPGSEEEIVAKWSAQSLYGGGAETSVSSLACFFQAMVLNPNVQKRAQEEIDRVV
                     GTSRLPDMSDRENLPYINAVVKEVLRWHPVTPLGVTHAASEDDTYNGYFIPKGSILVS
                     NIWAIAHDPELYHDATEFKPERFLGVNGRTPEYDPHLLSFGFGRRICPGQHLAAANLY
                     LAIARSLAVFDITHLVKNGKEVPVTPEFTTGIISHPAPFELSIRVRSPEHEKLIRAVE
                     KSYPWEKSHAEELQLKI"
     exon            complement(151248..151641)
                     /number=1
     exon            complement(151700..151971)
                     /number=2
     exon            complement(152027..152271)
                     /number=3
     exon            complement(152319..152470)
                     /number=4
     exon            complement(152530..152721)
                     /number=5
     exon            complement(152780..152909)
                     /number=6
     exon            complement(152974..153166)
                     /number=7
     CDS             join(155541..155591,155765..155947,156029..156211)
                     /codon_start=1
                     /locus_tag="AO090012000067"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000066"
                     /protein_id="BAE60303.1"
                     /transl_table=1
                     /translation="MTYVLYIPLFISKSSIEKVFLCSNWAYLRLEDKLKPNQMFPYDD
                     QDPDDTTGYTVDEYVKKLDREFGLVVCGFNDPARICIIWSPGGSHKSVGHIQVKYNGN
                     WESKISTEYWVITHGEDDFQHLTNGNLVKMQAFKRG"
     exon            155541..155591
                     /number=1
     exon            155765..155947
                     /number=2
     exon            156029..156211
                     /number=3
     CDS             join(156743..156978,157134..157210,157323..157330)
                     /codon_start=1
                     /locus_tag="AO090012000068"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000067"
                     /protein_id="BAE60304.1"
                     /transl_table=1
                     /translation="MALFGTARTPAIPEWITNAVVHTSAVLGPINQNLVSTSISDTSI
                     GAATERPISVPLTNLVVMCSAASECSNSEKGYNCNTQAIVPLLFPTVEVYTCGWLIHG
                     EQMP"
     exon            156743..156978
                     /number=1
     exon            157134..157210
                     /number=2
     exon            157323..157330
                     /number=3
     CDS             complement(157699..159468)
                     /codon_start=1
                     /locus_tag="AO090012000069"
                     /note="acetylcholinesterase/Butyrylcholinesterase"
                     /old_locus_tag="AO070343000068"
                     /protein_id="BAE60305.1"
                     /transl_table=1
                     /translation="MWSWSPTIAFLWLVELLRPSWHTSGRILKTVVAIRNGTLVGVHN
                     ALYYQDFFLGIPYAQPPVDDLRYEHPQPLNESWEVPRQADSYGFWCHSAPLSLPGYTQ
                     DGFHHEEDEDCLTLNIVRPSGATPSSRLPVLVYIYGGGLQEGGSADQRYNMSFLVRES
                     VKMDTPTIGVSFNYRVSGFGFLSGRAFNDSGLANLGLYDQRMALRWIQENIAAFGGDP
                     TRVTIQGESSGALSVGYHLLAYDGRDDGLFRAAITQSGAPLSSAALIPVDDQERMYQD
                     VLNATGCAAATESIKCLRAAPVEALKAAFQQKFFFPVMDGKFIADFPSNALKQGKFVK
                     VPLLIGSNLNEGTGYIASGMFGAVNTPTELRSVITGFGAGEHLPNDTLDEIVNGYLQL
                     PIREVRADLGTVLISPSSKHGSMYGYSTFYIGDYLVNAPKRYSAQMWAEYGAPVYSYL
                     FAVVPNGLSPQILGAAHFQEVAFAFKNFDGVGFTAPPLRSFDSQTESQLRDVSRRMAR
                     MWLSFVGTLSPNNHQCRLLSYFFRSSCSPYVVPDLNIQWPVYQRRSPANLVLRLESTT
                     VESDTWRSGIIQRIIDAFDEYKL"
     exon            complement(157699..159468)
                     /number=1
     CDS             join(161582..161965,162054..162342,162448..162452)
                     /codon_start=1
                     /locus_tag="AO090012000070"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000069"
                     /protein_id="BAE60306.1"
                     /transl_table=1
                     /translation="MSPAPRRSTFLVIHGAWHHPELYGTFCKAIENRGAEVICPRLPS
                     CSGELPSTKTIEDDVALIRATAESLVQEGKKVFAVMHSYGGMVGTDALEGLGLQRLIY
                     LAAFVPPSGKNLVDMLGGSMAPFIVGDEQGMLRVPEAASVFYQDLPDDEAAFWAGRLV
                     PMPKSAFLNRITRAAYRGIPATYILCKDDRAIPASTQEMMISNVQSAGVSMDVVRITA
                     SHSPFLK"
     exon            161582..161965
                     /number=1
     exon            162054..162342
                     /number=2
     exon            162448..162452
                     /number=3
     CDS             163302..163967
                     /codon_start=1
                     /locus_tag="AO090012000071"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000070"
                     /protein_id="BAE60307.1"
                     /transl_table=1
                     /translation="MDYAILELFTSLVISTTPIDNQPTTHDESCDLSDSDIIFGLNDG
                     LLDIIKRISSLHFRSRTKKVNNSTTITEAVGIWQDLTTWQPPEALSGEEYQQLYDTYT
                     SALFTWLYLILHPDSMCDGKVQSMVEQGVVTMSAVTVLELSPFLLIPLFILGLASVQD
                     EHKDFISGAFDQIEEHTALKRWRYIARWWSAVGKTKIRESQEAGNGSSGKTQAPQGDG
                     FSP"
     exon            163302..163967
                     /number=1
     CDS             join(170740..170782,170972..171122,171253..171325,
                     171612..171722)
                     /codon_start=1
                     /locus_tag="AO090012000072"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000071"
                     /protein_id="BAE60308.1"
                     /transl_table=1
                     /translation="MKLCHYHVCFLRFVFPAGLGLESADTGFQSQTSLEAKADHPFAL
                     AQDAFGDESNAEVKYKVLSWCHDRRIDIPWCLILTSSRCCARSSPRPCDLFNGLWCCW
                     ACYIAHLFPAPDDEEYLMAFYTM"
     exon            170740..170782
                     /number=1
     exon            170972..171122
                     /number=2
     exon            171253..171325
                     /number=3
     exon            171612..171722
                     /number=4
     CDS             complement(join(175490..175561,175623..175907,
                     175955..176114,176176..176252))
                     /codon_start=1
                     /locus_tag="AO090012000073"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000072"
                     /protein_id="BAE60309.1"
                     /transl_table=1
                     /translation="MDPIYQTFSKPQDRNRMEIPYNFARMHLNGSILQGLKPDSARND
                     PLRVQFIRAAVDAGKALLKCALRSIDYQTNLNYSIDYSGSALGLAINFLSRATCVAYD
                     CIDLEGVMRILAQARDMFEGAKLAGKADEVNHILDQVAEIKRHMTAMKSSNNSNEVGL
                     DDNADDGSDFFLNARLPLSEFSLDEPSIEDILMYSGE"
     exon            complement(175490..175561)
                     /number=1
     exon            complement(175623..175907)
                     /number=2
     exon            complement(175955..176114)
                     /number=3
     exon            complement(176176..176252)
                     /number=4
     CDS             join(178942..178949,179062..179133,179243..180325,
                     180380..180533)
                     /codon_start=1
                     /locus_tag="AO090012000074"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000073"
                     /protein_id="BAE60310.1"
                     /transl_table=1
                     /translation="MDQIPLRRKLRVPKNSASPRSSGCYTAAILMFPTRELAIQVYDA
                     LICLQPGHNLHIQPKVSQSPYPITERASRYYDVIVGTPGKVLGAVEKGGLSLDSIKYF
                     MFDEVHDLLGETGAGFHCRTFCQRIPHGTGARIVTSSTRISPVMERFCLRGIEPRIHL
                     DAMARGTRAVVRAVELENHEPRSDTLARFIAFRPSPKNIVIFTDTIDDAQKVHDILVE
                     KFPDRVVGLMNKESGTDNRGILLRRYQRGELDMIVTCRLFYAGIELTAEVTSIIFYKL
                     VSLTWPHAIGARLHINRPNGEVAVIVDPNSADDLAHYEEFKRWLRCFSGDDTLIIGRN
                     SHRPSLNPSLPPCYKLIIRGLAPEVTAEELKAALQQYSPVRAEAASLNASKSVPTAFI
                     HFATVGHALECVKQIDGARILGSQVQAGFALEKKQKGGRGGRGGRN"
     exon            178942..178949
                     /number=1
     exon            179062..179133
                     /number=2
     exon            179243..180325
                     /number=3
     exon            180380..180533
                     /number=4
     CDS             complement(join(184282..184474,184528..184644,
                     184709..184950,185014..185262,185325..185366,
                     185419..185494,185541..185681,185744..185775))
                     /codon_start=1
                     /locus_tag="AO090012000079"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070343000078"
                     /protein_id="BAE60311.1"
                     /transl_table=1
                     /translation="MHITRSCGTLIFLWGAVLLCMAGADDFRSLMAVRFFLGALESGV
                     SPCFVQLTSMFYKRNEQPLRTGIWFSMNGIAQVVGGIVAYGIGHIKSDIPVYKFPFLI
                     FGSATVVWAVPFFLFAAPSPAAAKWLSSAEKDVAIKRVSENKTGLDNKEFKLYQAREA
                     LIDPQVWILILFVIANNIPNGGISAFGPLIIEGFGYSKLGTTLLGMPFGGAQVLALLI
                     TGFLAGRIKNCRIILMCGGLVVAILGLSLMYALPEENKLGRLLGYYLAIGFSATYVLS
                     LGLIQANIAGRTKKTVVTAALFIAYCVGNLIGPQLFFEREEPHYRSGFIAMIICLALD
                     FILLVILHRLYVLKNKKVNPLTIKFMAGD"
     exon            complement(184282..184474)
                     /number=1
     exon            complement(184528..184644)
                     /number=2
     exon            complement(184709..184950)
                     /number=3
     exon            complement(185014..185262)
                     /number=4
     exon            complement(185325..185366)
                     /number=5
     exon            complement(185419..185494)
                     /number=6
     exon            complement(185541..185681)
                     /number=7
     exon            complement(185744..185775)
                     /number=8
     CDS             join(186700..186825,186905..186935,187100..187676,
                     187736..188195)
                     /codon_start=1
                     /locus_tag="AO090012000080"
                     /note="metal-dependent
                     amidase/aminoacylase/carboxypeptidase"
                     /old_locus_tag="AO070343000079"
                     /protein_id="BAE60312.1"
                     /transl_table=1
                     /translation="MAINFINQPSSEGTTGLPKHVIQLVSEAIDSASSELRRLNLEKR
                     KPASCLPDDALPELGHACGHNLIATSTLASAVGASAAMKELIIPGTLIVMGTPAEETG
                     GGKYIMANHGAWKDCSVVLMTHAMPDFSTARTVTKASWKFRAKFHGKAAHAAAAPWNG
                     NNACDAIVMAYNGLGLLRQQIQKTESIQSVILEAGKAPNIIPDYAEGSFSLRAFDSKA
                     LERLRSRVIPIFDGAAASMGCTVELFWDALYEDVVTNMALASRYTHYMINDLGLTPAD
                     ILPPSDLSAKVDQNGSSYVARRNTTLDPSQKALTLQISSDFGNCSYIQPGIQTLFSIN
                     ATDMPHTPSFQKAAGTDFAHTESLRAGKANALIGLEVLLDEGFYKEVKSDWINDMKER
                     GRLPE"
     exon            186700..186825
                     /number=1
     exon            186905..186935
                     /number=2
     exon            187100..187676
                     /number=3
     exon            187736..188195
                     /number=4
     CDS             join(189820..189867,190232..190337,190895..190940,
                     191183..191984)
                     /codon_start=1
                     /locus_tag="AO090012000082"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000081"
                     /protein_id="BAE60313.1"
                     /transl_table=1
                     /translation="MEIYAAGYMPWPTSKIEPVRKSRIHPRESLRVQLFRLVPYSSRH
                     GSILLVFVCRPPHFTVLRSQVLLHSSKAQFPSTVRVIPVDYNSIPELTTALNNQDAII
                     STLTTAAADVQHTLIDAAITAGVKRFIPSEFGADTGNPNASTLPVYQSKIAVNKALQA
                     KAAENPSFTYTLIRHGPFLDWGLNAGFFFDWRSEAPTFYDGGDRPFSTTTLATIGQAV
                     VGVLLHFDETKNRPVYIHDLVTSQRQIYTIVQKLAPQRKWNPVDVSTAELEVKAREEW
                     AKGNTDLRSIVGLLCRAVFAEGYGGEFKNVDNELLGLGFKTEADLEEVVKTILGDSL"
     exon            189820..189867
                     /number=1
     exon            190232..190337
                     /number=2
     exon            190895..190940
                     /number=3
     exon            191183..191984
                     /number=4
     CDS             complement(join(192412..193212,193264..193711,
                     193765..193949))
                     /codon_start=1
                     /locus_tag="AO090012000083"
                     /note="phospholipase C"
                     /old_locus_tag="AO070343000082"
                     /protein_id="BAE60314.1"
                     /transl_table=1
                     /translation="MKSTALLTGLGLLASLGLASPVTSEYTSVREAPFGYKPGSKESI
                     ENLKDKVENIVWLILENSLWYVKTSTNIWSRSFDNILGGVRRQGLDNPINNGPFCNYK
                     NASDPSSGKYCTQAKDYDSVFNDPDHSVTGNNLEFYGTYTPNNGAIASGKVVADQSGF
                     LNAQLNDYPKLAPEEATRQVMGYYTEEEVPTLVDLVDEFTTFNSWFSCVPGPTNPNRL
                     CALAGTAAGHGKNDDDFLNYGISSKSIFEAANEKGVSWLNYDGTNGEFEPDSLFFTYV
                     NQTSRSNVVPVENFFQDAYLGVLPKFSYINPSCCGTNTNSMHPTGNVSYGEVFVKQIY
                     DAIRQGPQWDKTLLFITYDETGGFYDHVPPPLAVRPDNLTYTETAKNGQKYTLHFDRL
                     GGRMPTWVISPYSKKGYIEQYGTDPVTGKPAPYSATSVLKTLGYLWDIEDFTPRVAHS
                     PSFDHLIGTTLREDAPIALKTPHTFSV"
     exon            complement(192412..193212)
                     /number=1
     exon            complement(193264..193711)
                     /number=2
     exon            complement(193765..193949)
                     /number=3
     CDS             complement(join(195709..195846,195903..196548,
                     196606..196789,196855..197701,197788..198149,
                     198210..198630,198830..198913))
                     /codon_start=1
                     /locus_tag="AO090012000084"
                     /note="chitin synthase/hyaluronan synthase
                     (glycosyltransferases)"
                     /old_locus_tag="AO070343000083"
                     /protein_id="BAE60315.1"
                     /transl_table=1
                     /translation="MGPVRPNSTHSPQPSRSSFYSHTNPSRTQTPGLSDRDEQEQSSL
                     LRHNHPSIYGVEDPSLSSDSLRRYTLHDPGVTVFAAPPYQESETAEVYDATGMSDTSG
                     IKLDTFQPQSISNRSGLRRYGTRKINLVQGSVLSVDYPVPSAIQNAIQPEYREAEEAF
                     SEEFTHMRYTAATCDPDEFTLRNGYNLRPAIYNRHTELLIAITYYNEDKVLTARTLHG
                     VMQNVRDIVNLKKSEFWNKGGPAWQKIVVCLVFDGIEPCDKNTLDVLATIGIYQDGVM
                     KKDVDGRETVAHIFEYTTQLSVTANQQLVRPQGNDPSNLPPVQMIFCLKQKNSKKINS
                     HRWLFNAFSRILNPEVCILIDAGTKPGKKSLLALWESFYNDKNLGGSCGEIHAMLGKG
                     WRKVLNPLVASQNFEYKISNILDKPLESSFGYVSVLPGAFSAYRYRAIMGRPLEQYFH
                     GDHTLSKRLGKKGIEGMNIFKKNMFLAEDRILCFELVAKAGYKWHLSYVKASKGETDV
                     PEGSAEFIGQRRRWLNGSFAAGLYAMMHFGRIYRSGHSFVRMFFLHIQMVYNFCQLIM
                     TWFSLASYWLTSSVIMDLVGTPATANKNKGWPFGNDASPIVNTLLKYGYIFCLMLQFI
                     LALGNRPKGTRLPYTLSFLYFSIVQIYVLILSFYLVANAFTGGLMDFDFNHGASGFFS
                     SFFASDSGGIVLIALISTYGIYVIASVLYGDPWHILTSSWAYFFGMTTSINILMVYAF
                     CNWHDVSWGTKGSDKAEALPSAQTKKEDGSKQQFIEEVDKPQADIDSQFEATVKRALT
                     PWVEPEEDESTSLDDSYKNFRTMLVLLWVFSNLLVCLLITGTGVSSMCLTNTSTTRTS
                     WYFRVILWATAGLSFFRFLGSLYFLGKSGIMCCVSRR"
     exon            complement(195709..195846)
                     /number=1
     exon            complement(195903..196548)
                     /number=2
     exon            complement(196606..196789)
                     /number=3
     exon            complement(196855..197701)
                     /number=4
     exon            complement(197788..198149)
                     /number=5
     exon            complement(198210..198630)
                     /number=6
     exon            complement(198830..198913)
                     /number=7
     CDS             join(202837..202861,204160..204322,204374..205432,
                     205498..205792)
                     /codon_start=1
                     /locus_tag="AO090012000085"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000084"
                     /protein_id="BAE60316.1"
                     /transl_table=1
                     /translation="MESSVTRWVQVIITLLACWCASGIVFGFAALKPVMISEGVYQNL
                     CSETVLPKEGNVCRAQDLRLNLFFMVSSITANVSALPVGTILDRYGSRWCGFIGCAVL
                     AAGSLLMAFSFSGRVDGYIAANLMLALGGTFIFVPSFRIANAFPKYTGTIVALVTGAS
                     DASAAVYLFYRLAYEKDPVTFSPKRFFLAYLAVPACIFIALLTIMPAHDYQTTQQLEV
                     KIEEAEDVTQDVHDSDAEIESNSELWQVRTDRAKHRKDQLRKIDKVFGDKAERKQRQE
                     WEEERHETSRVWGVLHGLPAHAQMKTPWFILILLMTVLQMLRMNYFIATVRSQYEFML
                     RSVRQAEMINDFFDVALPVGGVLFTPVIGLLLDNFSVPATLAMIVLLTTSTGALNSVP
                     TVWTGYLTVILFVLLRPYYYSAMSDYATKVFGFGTFGRVYGTIICFSGLVNFAQYLLD
                     YLTHGPFHGNPIPINIFLATAGLIVGAALVAFVYIAEKRWREEKAEYDEERQRLIPEE
                     EEEEA"
     exon            202837..202861
                     /number=1
     exon            204160..204322
                     /number=2
     exon            204374..205432
                     /number=3
     exon            205498..205792
                     /number=4
     CDS             complement(join(208245..208311,208428..208963))
                     /codon_start=1
                     /locus_tag="AO090012000086"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000085"
                     /protein_id="BAE60317.1"
                     /transl_table=1
                     /translation="MPRFTPENDGTGLARQLTDPLVAQYVYSVFIALAWCNALELVVL
                     CLNTFKRYGGAYFWSLFVASISIIPFGLGYLLKMFHITFTNGYLELAITDIGWVGMVT
                     GQSLVLWSRLHLVVHNRKVLKGILYLIIIDGVLLHTAATTLEFMNNGLSYIHNVTVAF
                     GIMERIQVVWFCVQELLISGGGSSIRGLFHPPGHHKGVGL"
     exon            complement(208245..208311)
                     /number=1
     exon            complement(208428..208963)
                     /number=2
     CDS             complement(join(209695..210342,210415..214769,
                     214830..215121))
                     /codon_start=1
                     /locus_tag="AO090012000087"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000086"
                     /protein_id="BAE60318.1"
                     /transl_table=1
                     /translation="MGDVSVDPSEKVQEIWEYLSIKDREASRALSARSPQPAEYTCEW
                     FANRLSQIRSSESQLFTVTGDTGTGKTVLSEWIIQQLQTSTDPQDYDVVTFRVYDDIS
                     ATTGPIGLAKGLLLEILGRQAKDGDLLRALEHSMSLHSSGASSKSVEDSLWRALNIAV
                     KETGKMMVIVDGVDSLNGDPEVIPRLFHHLQTLVSQSPSIKVIALSRPLHGVPGEAYR
                     IKIEPSQTAGDVRTVVRNEIESSEVCIGLSLEDREEIEGGIVKKANGCFPIAQLAVGQ
                     LSALRTSSDMISLVQKIPSSLQDMLKQTLNSIDLSDWSARSLLAWTIVSHRPLRVQEV
                     RSLLEIDTKRTEVVPRVGNVEGDIRRMFGSFITIENEIISFRSPALRQFLINQAKSAA
                     SDSGKGKLPLTMKEAHSDLLTRLLAYVKLSVTDEVEVSTTSLSQSAQHRYFDQYHLLE
                     YAARYWTLHFRSSQMNEKERDSFKVTNLFKRSFPDSVLLALLEGGCNQLQYLPYQVQE
                     LQAFSVQLRRQLLPDLSLSLLQSLINAAQTSQQLESFDAIDYSYEAWRKSSSLLGSRS
                     IVTKFSAEIFIDAASQRDSKHEAFLHHKEEILEYLLQASKEELGFSNDMTIKYTQMLL
                     DHYATLERKESVGRLSKELFEMSIARYGQHSQEMEKMTQHIYRQLERLSMSEVTAEIL
                     QTEHEFSKQSLAVTDQRMIDSTLQMIKIYEESEETSKADALFMDTWRKLLAVEDTSGT
                     VTKQQAEFTMRYAEYLERHSRKGEAESVTSAAWFCLKSQLSRFDQLSSTFELVLGHIR
                     KMKWEALAQSAMETLWEYRKSQKQASHQLVQVTASLAQTVQQSSSTVSSSEASMSEEQ
                     IDLIHEILESAKSAGIQSSDTTLASMKAAKQVASSLMEREQYAEAAGVYRRALSHLCS
                     EIDSKPTTIRLTENVDETVQLATSLAECYFKDLQIDKAALVYQNVLNAVLSSDETDTH
                     MVRSTANRVITFYRTIYRFVKAITTYEALYKNISSRLGKTQKQSIEILYEWGDLAKRC
                     HHKQEAEQAYQEIYNNLRHNGQLDYRAIAAARGLVAIYEETERWTKAKGVYETLWWTI
                     SSGDRNHMLNSELVEEVYQHYKTLLETKLDADIVEIHDLAASYRKMCQRWYGTYSRQS
                     YEATLSLAKISRGDERYHGEAVELYETALQQYETFSERPEVTTMDMKHCLADLYARQS
                     RTTHKAATLYREEYTSSVQEHGYASRDHSLPQLRKLLKLLHRQNNKVTRQELQETLES
                     STVAAFEEKIDSQHLYTAAVELAKMYVDFGLKEKGVRRSRELRHRLIKEAMETKGSHR
                     ATSFVVAFEMTLRNNCNYASIIADLMAEIQLYSAFHHARKQRGFIHTFIAGIRLMNFQ
                     SLNGWTENANATDAELFQLFTERFAGIETGKTVLREFYDICISQASQGSLVRRLTRVI
                     VDNVYQKLTTGGFRPGYSHAAILHEFVKDSGGFQDQDSTRDGVKLSEHLLVQGSRKCS
                     DRGLSGKMLVLSKTILHEIISSYHEKGVNLTDFETTDLNQLAILLGGQRNFEDLEFLL
                     NELWSSRVVQKTWSSDTIILVGRRLVEARFSNGRTTQATQLCGGLCYNVKRVWGPFDR
                     SALELTNLLSALYTAEGDHVRAMGVHESVLRQLLEDSTDIRLSEAVEIASKQTALLQR
                     CYQRNGGWSKGSGRYENMFDRLNEKFAKEKKWTARNPQHWTVKEVDKLGVWEAPHDYG
                     FLMAGKGTTHQNQLRKASEPDIETFENKHQIGRAQGVS"
     exon            complement(209695..210342)
                     /number=1
     exon            complement(210415..214769)
                     /number=2
     exon            complement(214830..215121)
                     /number=3
     CDS             join(218431..218587,218632..218810)
                     /codon_start=1
                     /locus_tag="AO090012000088"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000087"
                     /protein_id="BAE60319.1"
                     /transl_table=1
                     /translation="MIPRPSTLRSTPSWPPRSSTRSWLPALPTSPRTFTLTSTSPRWM
                     IAPASTTTSDDVETCSNDKRLPTETKVTGSGCYVSISVGNASNKRDANAAVQGEVLNK
                     LGDFLTCLS"
     exon            218431..218587
                     /number=1
     exon            218632..218810
                     /number=2
     CDS             complement(221263..222201)
                     /codon_start=1
                     /locus_tag="AO090012000090"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000089"
                     /protein_id="BAE60320.1"
                     /transl_table=1
                     /translation="MHHIQSASLLTALLSATKVAAHGHVSNIVINGVYYEGFDINSFP
                     YMGESAPTVAAWTTPNTGNGPLAPDDYSSPDIICHQNATAGKGYVEVNAGDRISLQWT
                     PWPESHHGPVVDYLARCEPNCASVDKTSLEFFKIDGVGIVDGSSVPGVWGDDQLIQNN
                     NTWLVEIPKSIAPGYYVLRHELIALHSAGTEGGAQNYPSCFNLKVNGEGTDKPAGVVG
                     TELYTPTGDGIIFNIYQTVSEYPVPGPTLYSGAATGVTQAASTVTSTGTALTVGAAAT
                     TPASGSGASSSAAPSSSAAATPSSSAAPSSSAAARR"
     exon            complement(221263..222201)
                     /number=1
     tRNA            complement(224398..224469)
                     /locus_tag="AO090012t00001"
                     /note="tRNAscan-SE"
                     /product="tRNA-Arg"
     CDS             complement(225444..226169)
                     /codon_start=1
                     /locus_tag="AO090012000091"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000090"
                     /protein_id="BAE60321.1"
                     /transl_table=1
                     /translation="MKVPFVLLASLCANSALTTALPADQVSADKAILLLGDGTTKAVE
                     KKDLASHLNGISLEPPTDNLPRSFKSEGFTGLQKRGDAQFIIPLPDQEFLGWDIAMSP
                     ITHANGAPATVAIAAGQSIANSISVGASFTATVEKWLQIGASVNYQDTVTNTLTGTAT
                     MTIPINKWGAIVSNPLTHRRRGYVFSGAPGKAQYEYFQADSFDRKSVSYQQAKLDWVQ
                     GVITTCLGDGYPLKMCNGQGELK"
     exon            complement(225444..226169)
                     /number=1
     CDS             join(227532..227575,227638..227692,227748..227956,
                     228001..228013)
                     /codon_start=1
                     /locus_tag="AO090012000092"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000091"
                     /protein_id="BAE60322.1"
                     /transl_table=1
                     /translation="MKASLSLIVAALAAGVVADLHYTGVCIDTNGGVDTYNRAATEKA
                     CAAYKKRNTGNKQWDQCPDCTVKNEKDILYYCDSAAQHIGGDELNYYCKQNGAGDSVA
                     CGWV"
     exon            227532..227575
                     /number=1
     exon            227638..227692
                     /number=2
     exon            227748..227956
                     /number=3
     exon            228001..228013
                     /number=4
     CDS             232001..232588
                     /codon_start=1
                     /locus_tag="AO090012000095"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000094"
                     /protein_id="BAE60323.1"
                     /transl_table=1
                     /translation="MAFREPAYTFFVLGGTLEFISLNIPFYYIQYFAISEGITTNGLG
                     FYLLSILTTGSVLGRILPNIFANLIGPFNIIFPCTVISGAMMFALVNLSSLAGVVIVA
                     FLYGFFTEAFVSLPPTCFVKLSPDRALIGTRMGMGYAVMTIGNLVGTPAAGAILQNRG
                     FNAVWIFGGGVSIAGGIAMMISRNFQGGWKLLIRQ"
     exon            232001..232588
                     /number=1
     CDS             join(234269..234407,235014..235077,235130..235573,
                     235638..235905,235958..236296,236352..236620,
                     237519..237570)
                     /codon_start=1
                     /locus_tag="AO090012000097"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070343000096"
                     /protein_id="BAE60324.1"
                     /transl_table=1
                     /translation="MESTGKSLRYVLASLGRPSYHAESITLTGQQSGMETVPIVVWVT
                     DLLLCAGSAIVQGMDQTAVNGAQEYYFEEFNLTNPWMQGLVNGAPYLCSAVIGCWTTA
                     PLNRWFGRRGCIFISCFISFASSFWMAAAHTWWNLLLGRFLLGFAVGAKSTTTPVYGA
                     ECAPANIRGALVMMWQMWTAFGIMLGYIASVAFMKVTHPTIPGFNWRLMLGSTAIPPF
                     FVCIQVYMCPESPRWYMIRDRYQDAYNALCKLRPSEFQAARDLYYIHSALKVEEKLRQ
                     GKHLWREMFTVPRNRRAAQSSFFVMFMQQFCGVNAIMYYSSSMFRDAGFDLQTALVVS
                     LGCGITNWIFALPAVYTIDTFGRRNLLLTTFPLMCLFLLFTGFSFYIPDQAPRTACVA
                     TGIYLYMIVYSPGEGPVPFTYSAEAFPLYIRDIGMSFATATTWGFNFIVSLTWLPLRD
                     AFSVQGAFGWYAAWNFFGWVFCYFCLPETKALSLEELDQVFSVPTRKHINHYRGMMPC
                     VSIHLILRFFTRFFLC"
     exon            234269..234407
                     /number=1
     exon            235014..235077
                     /number=2
     exon            235130..235573
                     /number=3
     exon            235638..235905
                     /number=4
     exon            235958..236296
                     /number=5
     exon            236352..236620
                     /number=6
     exon            237519..237570
                     /number=7
     CDS             join(237694..237950,238003..238075,238194..238461,
                     238519..238662,238716..238930,238985..239449,
                     239563..239568)
                     /codon_start=1
                     /locus_tag="AO090012000098"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000097"
                     /protein_id="BAE60325.1"
                     /transl_table=1
                     /translation="MAPSPDHHGSAVLSDMNRDAEYDLSDKDTEKQQEEKARPEYQDT
                     FGDEEYAEVKYKVLSWWYVVALPQLSKDDNLLTSFIQAMWFSDGRGNSLTGNSLVTRR
                     GCCLRPCPFRWRYPHIQSMADAGEVLLGKFGREFLGTGQLLLVIFIMASHILTFTVAM
                     NSITDHGTCSIVFGVVGLVISYVLCLPRTSAKVSYLSIASFISVFSAVMIVMIALGIQ
                     RPWHGGVQATVDTSLYKAFLAVCNIVFSFSGHVAFFGFMSELKDPKDYPKSLFLLQGI
                     DVILYIVTAVVIYYYAGQDVTSPALGSASPVVRKVAYGIALPTIIIGGVVNGHVACKY
                     VYVRLFRGSDRMHKKDLVATGSWVLLMLGLWIVAWVIAEAIPVFNNLLSLVVRDLDFS
                     ALPPNIQLTYILGLSLRELVHLYAIPTHPDPPFPEHQILTKVIDGLSATFWLYLNKDR
                     LFATPMKIFLTILNVLIFAIAGCIR"
     exon            237694..237950
                     /number=1
     exon            238003..238075
                     /number=2
     exon            238194..238461
                     /number=3
     exon            238519..238662
                     /number=4
     exon            238716..238930
                     /number=5
     exon            238985..239449
                     /number=6
     exon            239563..239568
                     /number=7
     CDS             complement(join(240234..240526,240597..241035,
                     241144..241864,241924..242288))
                     /codon_start=1
                     /locus_tag="AO090012000099"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000098"
                     /protein_id="BAE60326.1"
                     /transl_table=1
                     /translation="MNQTVSPMVRKLPIPRQSKHYQHVHRDNPSPLSQDMAASPDNRV
                     PACAIDIGRNEELTSSIPVRGVARNTREILDVLEEWTGCITTKEATPRPQVMPEVRKK
                     GRRRILIQKYMFQISILTANGFGIFATWWFPHHWYLLMPFIGAGVVMNIAMIIALLVN
                     LLYRWCYPEKPLIPETPESLVHLIPCYNETKDEMERSLNSLIMQKGISDHRRCIMIIC
                     DGKARGYGMEKTTGEYLLEDILIQKDYRVRITKAYLAWDQQFMDVEVQRGTYHDVPYF
                     CIIKQHNQGKRDSLIAVRSFLYNYNIRHTHPETIFTSTFFVHMASFIKESGIDYIDNL
                     IGMDADTVFDDHCISELLRCSRYEDTVGSVITHKVSCLPGCCQLLKICEETCGREVLF
                     KRFGYCPVPTDGVLRHVRATASEDRNHVCHMLSARPRAQTRQALHAVAYTDVPQSWPV
                     FLSQRRRWTLGATSNDLFLSSAPGVHWFERILACTNVMTWFLNVFIFASMARFIMAMF
                     YVEAWIIFCFIAIALIPIVYYLIIPFWHIKPWRDASRFWIGCLIYIICGPFVNIAILL
                     YSCHYLDSFGWGKTRQVVAEDNRDENGQATERTSLLPRT"
     exon            complement(240234..240526)
                     /number=1
     exon            complement(240597..241035)
                     /number=2
     exon            complement(241144..241864)
                     /number=3
     exon            complement(241924..242288)
                     /number=4
     CDS             243502..244881
                     /codon_start=1
                     /locus_tag="AO090012000100"
                     /note="UDP-N-acetyl-D-mannosaminuronate dehydrogenase"
                     /old_locus_tag="AO070343000099"
                     /protein_id="BAE60327.1"
                     /transl_table=1
                     /translation="MACFKLHGNGYSQGQISEPASIESNGLPTPPPESSSGKCQPEGD
                     NVNKETFHTHAYDDPIIAVIGVGYIGLELVSAFARVYNNIIAFDINSQRIEEIRADLA
                     KKNVKATSNPSDIAVATHFLICVPTTLHQACVDTTPLQGAISLLSEYARPGSTVVIES
                     SVAVGMTRQLLKDVMRSCGLMAGMSPERVDPGRLSPAFEDIPKVISGLDDIAPGSLQS
                     IEKLYGKVFHDLVPVSCPEVAEMTKLYENCQRMVCIAFANEMADACQSIGISAMEVST
                     AAATKPFGYQSYFPGLGVGGNCIPVNPYYLLSTSELPLLQAATEEMTKRPAKLGNRVM
                     KKFYCNQASGAMSRVMQPRVLVVGVGFKRGQSFLSNSPSLALIRHLKDEWEASVEYAD
                     PLVSQEALPSIPKLDEARRWNTKSLTEEFDIIIVAVDQPGLDLTVLQRLDVVLVENFT
                     SSVAAGCSQ"
     exon            243502..244881
                     /number=1
     CDS             246565..247704
                     /codon_start=1
                     /locus_tag="AO090012000101"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000100"
                     /protein_id="BAE60328.1"
                     /transl_table=1
                     /translation="MPGNFGQKILKTFGLDDNQHGHGQGQPPQQYQHYQPPPQQGYPG
                     QLPGNRHIEDGDRDLHPDKHGTYPRLARLGDGSLLTSFTHFQGKTRVLAVSRSTDGGR
                     TFQDWGEVSRGEGDVDNVFLLEVAPGTVLGAFRNHDIGPHGPTYFRITVCRSTDAGRS
                     WHFLSQAAEKGAPNGIWEPFMRLGRQGEVQLTYSLEFAHNNQSTMMVQSFDGGATWTQ
                     PRCLHGDCDALRDGMNGIAPTWDNGREALVMIFETTSFGTFNLEALISYDDGQTWGWR
                     HRVYVPPQGHNAGAPQIASFADGSLAVIFMTDEDHNEVSWTQNASIKVVFAGPPQNGQ
                     IQWSKPTVICPHTSHWPGIAPVDGNTLFATFECEGRPKAKAITLH"
     exon            246565..247704
                     /number=1
     CDS             complement(join(247844..247880,247968..248603,
                     248689..248780))
                     /codon_start=1
                     /locus_tag="AO090012000102"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000101"
                     /protein_id="BAE60329.1"
                     /transl_table=1
                     /translation="MRGFPLRLSPCNSLTRNPTTTQRLANRTNPRFSTISPLKMRLPY
                     APSEPPASDPDAADIYARIAARRNPRPLIPLDLSLLHSPPVADGWNSFLGAIRTRTII
                     DQGLLELAVSRVAVLTGAVYEWNAHAPLALKGGIQAQELQAVRTLPSTAVGEAAELSK
                     AKEALAQSALTSRQKAIVQYADEMTQTVKVQDSTFAQLQTEGFSDREIVELTTGIAGY
                     NCVSRVLVALDVGENNAREMKSVDDVLDVCTGSSYS"
     exon            complement(247844..247880)
                     /number=1
     exon            complement(247968..248603)
                     /number=2
     exon            complement(248689..248780)
                     /number=3
     CDS             join(252004..252441,252509..253423)
                     /codon_start=1
                     /locus_tag="AO090012000103"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000102"
                     /protein_id="BAE60330.1"
                     /transl_table=1
                     /translation="MRWLPLFALVAADIWSAVTAKPLLPTEDPWYDQPANIDTYAPGQ
                     TIRTRELSSQLSPFLPLPVDVKVESVHQYLFRTTDSLGNPIAAVNTLIKPRNADPSKL
                     LAYALYYDSSNPACEPSYTLQPDSGSGLAGILSANNTLSTDTAFLAASLNQGWWVVTT
                     DYEGVNAHFSAGVISGQATLDGVRGALIEAPKLGLSKDARYAMWGYSGGSIAVNYAAE
                     LQPTYAPELNFAGAAAGGNIANLSSTLQRVTGGPFAGLAFGSIDGLSKAYPNVSEWLD
                     RSLVPEKRADFKKVASSCLIGEATQGFLKDVYSYFVNGKESFNEDVPQSVMRLAGQMG
                     VHGTPKIPMYIYKPVHDEISPGADTDELVDTYCSDGATVEYIRDLVGGHGSLWITGSA
                     NAMGWIADRLDGKEVSHPGSCTKKDVLLSDLNPHMLPFFGEELWSTLKWTLGGFLGPR
                     "
     exon            252004..252441
                     /number=1
     exon            252509..253423
                     /number=2
     CDS             254641..256206
                     /codon_start=1
                     /locus_tag="AO090012000104"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000103"
                     /protein_id="BAE60331.1"
                     /transl_table=1
                     /translation="MTTQCRERIGVLLSDYANVIPNPYVPSRHALSRCLTGYLTGYHE
                     HYPILHVPTLDLDSKSLQLILSMASLGARYCREPETSTALYQVAKAVTLEHIRREFQW
                     VEPNSGINPNRQSAPSPAAREQDLLETLQALLMLVSVSSWHEHDPPYDESLYMRSYME
                     TLLRQGGLNDLPAQDGSWESWVRSEETKRTRLIVFCYFNIQTIVFDLPPMVLTEECTL
                     DLPCTEVEWQATTAGQWMEERSQSRGEPKLQDALASLFAHNPDIKGRLESFSSLGGYV
                     LIHAIIQNIWLIQKSRRLPGFNGNSLSPSEVTSLELALEHWCQCWERNREASIDPFNP
                     HGPLSFTSAALLRLAYIRLNADFSSARRLQTWNPEEIARSLKENLSVERNDRLTRAAL
                     HCAHALSTPIKLGINYVAQTQVHSWSLQYALCSLECAVLLAKWLEEVTVASPNPSLTE
                     QESKLLEFVIEMVMETRHGVSREWLLANNTRLSAIVTRLWARLFTADYIWELVNLMGR
                     ALNSYADLLERMH"
     exon            254641..256206
                     /number=1
     CDS             complement(join(256344..257396,257444..257655,
                     257729..257750))
                     /codon_start=1
                     /locus_tag="AO090012000105"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000104"
                     /protein_id="BAE60332.1"
                     /transl_table=1
                     /translation="MAGLFEQCDVPADLSALLFAIYFAATTSLLSINEGDFLGGQKHA
                     AVQKYQRGLEVSLYNSSFLDSPTITSLQAMAIYVRCRRFHSSGRSNWVLNGLTIYAAQ
                     SIGLHRDGSNFNLPILECELRRRLWWHIITADKRVAEDHGLVGGFETISNTKLPLNVD
                     DSDLSPQLKTPPAAKETWTEMTMFLITAEASKVFARIHRVSLQSQPGKDVHDESRKLV
                     ADFDTRLSRTYLKYCDQNVPVQKATFLLGRLLLCKAKALVHIQSLNGLSAKQSAKHIN
                     EETLSYACVGLECGSEMLTDEVLKSYSWLSSSYTPYHLLTYALWHLCVCPETPGVTRA
                     WNAVQKCFELTERDSGWRECDPHWAVLCGLRQKALTIQRSRLGAKSGEELSGLYSMDQ
                     AVLPDTGSEIDFGDALMPWDLDPLAFFDWTSFAPTF"
     exon            complement(256344..257396)
                     /number=1
     exon            complement(257444..257655)
                     /number=2
     exon            complement(257729..257750)
                     /number=3
     CDS             complement(261778..263355)
                     /codon_start=1
                     /locus_tag="AO090012000106"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000105"
                     /protein_id="BAE60333.1"
                     /transl_table=1
                     /translation="MLSELLTSSYLQYKEDTNAVASWLASTAKRCGYAVDQLTQTRKE
                     KPSGRLKGKARKQAKSQKGPATPTYTIAIKDFVSLAEWIAHDHRPPIHVPSSFVTAPE
                     RAIHTRRRHGDYLAHKSKSAEDSHAYFIGILEHVRETLRPRFPREYLGAGDDDSKKIK
                     INRFEGLEVQEPSKDFLQMRDLPTAVPTSSLGSEANYQAEQMKDLDEAFTAFSLLLDD
                     YHTFRSLIHRTWAGHRKGQYDLVAASLMTNTALDLARRLEDDAKLLFDQFGGPKQMLT
                     AMYLALCSEKGEDQAFREHPGDDMNFRMWGVSSGTFWPVYQLLQSFVPMVDAQHVPQY
                     KPCFYGQYDPTSDRTKMTAREKFTEDKVILTEHLGEFALLCMRVPKMVAEDELTRGLR
                     IAFRTHEIPLAVTFATQVYLDIHHVLREDITRGYADLETTARQVSNSIELNFERHKSL
                     RVETWPPSNDLLFKNIQQTIDYWVRYDPLIKAKEKLNRPLSKPFKLWRSYPLFCGLIT
                     YHIKIKFQEASVAFVNA"
     exon            complement(261778..263355)
                     /number=1
     CDS             join(264374..265079,265144..265310)
                     /codon_start=1
                     /locus_tag="AO090012000107"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000106"
                     /protein_id="BAE60334.1"
                     /transl_table=1
                     /translation="MANAIEYATPISFTKTWHTEPYPFISPSRPELSAEGKNVVVLGG
                     SAGIGNAISVAFAQAGPKSITIVGRRLEKLQEAAEKVTAAVSDSATQVLVESANLQDR
                     AQVDRAYQSVVDKVGKIDILVINAVLLPAPGGLTNYKPEELVRTIEGNLLIVMNAFQA
                     FLPIAGPEPVVLHTSTCLANIAPTPGLAGYSISKATCLKAIDYFAMENPHVHVVSIQP
                     GWVATASNGYQEEAPDKAELPGQFYVWLASPEAKFLKGKFVWANWDAQELLERASEIQ
                     STKLLNWVVEGIPM"
     exon            264374..265079
                     /number=1
     exon            265144..265310
                     /number=2
     CDS             complement(join(267772..267876,268105..268183,
                     268339..268805,268865..268914,268999..269091,
                     269384..269767,269819..269884,270199..270241))
                     /codon_start=1
                     /locus_tag="AO090012000109"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000108"
                     /protein_id="BAE60335.1"
                     /transl_table=1
                     /translation="MDPFQCANWGQKENDLLQLKDNEGEDYSQDLSLLLAASGDLRNL
                     VKTIASLPEWYCGRIHVDINDRDETVVARNLIFLLVAFHLPPDIASEAIIHLWYSAFL
                     PEPLLQSIRDAVCPTIREFLEVSPVQISGVLQKTWSCGSSTLAATLSKKEWNRILSYL
                     PDIPDPLQGWTLTEVLQPSYGAKHDLYGQLYVHVKHTLATLRDKETFYDRIELANIAD
                     LGYLGPPKTLALFGPLLKSKKENPKATLIMLFLNATREMSTPKDQVACMFRAMETLQR
                     FLPMRPRQGDPTNKYNAEFLNQMNAMDLFTDNDTLFERLVENARFRDMGRPLGLEMKT
                     ENSIVAKWPMRLGGNPTQHEFEMAFWSGHTGCESFHLQGRISLLRVCHSNALPHLSFF
                     SQSRVSRLLPGLAIGLAVAIDTTARTKRVFRMFMMC"
     exon            complement(267772..267876)
                     /number=1
     exon            complement(268105..268183)
                     /number=2
     exon            complement(268339..268805)
                     /number=3
     exon            complement(268865..268914)
                     /number=4
     exon            complement(268999..269091)
                     /number=5
     exon            complement(269384..269767)
                     /number=6
     exon            complement(269819..269884)
                     /number=7
     exon            complement(270199..270241)
                     /number=8
     CDS             complement(join(272484..272609,272679..273820,
                     273877..274120))
                     /codon_start=1
                     /locus_tag="AO090012000110"
                     /note="transferrin receptor and related proteins
                     containing the protease-associated (PA) domain"
                     /old_locus_tag="AO070343000109"
                     /protein_id="BAE60336.1"
                     /transl_table=1
                     /translation="MRLQLPEVAIATLLLGEVGAVQLPLLQSQVPITSDKELVSSSAF
                     QSHVKAENLLKRAKELSKIADLGEEEYNHPTRVIGSKGHLGTIDYIYSTLAKLGDYYT
                     ITNQSFPAVTGNVFESRLVLGDAVPESAAPMGLTPPTKNKQPVHAPLVAVSNFGCDAS
                     DFPSDVSGAIALISRGTCPFGTKSELAGKAGAVAAVVYNNEKGSLSGTLGNPTPDHVA
                     TWGLSDEDAAPILEKLEKGEEVDGIAYMDAIVETIHTTNIIAQTTEGDPENCVMLGGH
                     SDSVAEGPGINDDGSGSLTLLELATLLTQYRVNNCVRFAWWAGEEEGLLGSDYYVSVL
                     TPEENLKIRLFMDYDMLGSPNFAYQVYNATNSVNPVGSEELRDLYVDFYNDHDLNYTY
                     IPFDGRSDYDAFIRHGIPGGGIATGAEGIKTPEEQEMFGGVAGAWYDPCYHQICDVVG
                     NVNLTAWELNTKLVAHSVATYARSFEGFPKRTKDSITAFATENNKYHGPRLVL"
     exon            complement(272484..272609)
                     /number=1
     exon            complement(272679..273820)
                     /number=2
     exon            complement(273877..274120)
                     /number=3
     CDS             join(275454..275688,275742..276399,276455..276541,
                     276600..276664,276693..276737,276831..276886)
                     /codon_start=1
                     /locus_tag="AO090012000111"
                     /note="aspartate aminotransferase/Glutamic oxaloacetic
                     transaminase AAT1/GOT2"
                     /old_locus_tag="AO070343000110"
                     /protein_id="BAE60337.1"
                     /transl_table=1
                     /translation="MRVTGCFLVPVVVLYRKEGNKLFFPRSIRRSAKYPRIVSMQTLG
                     ASGGCHTGAVLLRDLYGPWKRTGKPEIFIPRDSWLNHAFTFKSAGITPHFLPYFNAET
                     ASLDFPALSTAIRSLPAQSVVVLQTNAQNPTGCDPSPTQWRELASIFSERGHLAFFDA
                     AYPGLASGDIDTDLECVRLFAEQEIPMVFVATYGKCFGLYCERVGILSIITPDQEVRD
                     RMETQMRLLVRAESGAMPDFGSTIIETILSDERLEQQWRDEVRDMAKDLQHRRRTLRT
                     ELERLGTPGDWRHITDQNGFFSYIRLSAEQITGLRIKHHVYLQDSGRISIAGLNSSNI
                     GYVARSIDDVIRTDRMSLPLLVSQLLPPLVSNLQSPFDCQKHCSYTT"
     exon            275454..275688
                     /number=1
     exon            275742..276399
                     /number=2
     exon            276455..276541
                     /number=3
     exon            276600..276664
                     /number=4
     exon            276693..276737
                     /number=5
     exon            276831..276886
                     /number=6
     CDS             complement(join(276959..277313,277399..277760,
                     277823..277882))
                     /codon_start=1
                     /locus_tag="AO090012000112"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000111"
                     /protein_id="BAE60338.1"
                     /transl_table=1
                     /translation="MTFTLYGYDGNTRSRVVRIVAAAEGIELNHFEVIPRRGVNKAEY
                     MARFPRSQGKIPGLEGPNIKLTETLSIAMVSTHLTAFLRRLLVILAILTICYVRDQYL
                     ASIHGKAKLLGDGSPEQTAEIISWASWANQEFLPTAAQWFRPLIPSPTDQAPYNKDAV
                     EAGKKKTLDSLEYLEKHLEGRQYLVTDHITLADIMLVVYVSRLFEWVLGQQWRDEHPA
                     IMQYFENVVKHDAVRQVIPREDLIFIEEETPIEDPRLRSV"
     exon            complement(276959..277313)
                     /number=1
     exon            complement(277399..277760)
                     /number=2
     exon            complement(277823..277882)
                     /number=3
     CDS             280446..281168
                     /codon_start=1
                     /locus_tag="AO090012000113"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000112"
                     /protein_id="BAE60339.1"
                     /transl_table=1
                     /translation="MHISLRLPRLPSLLESYTCRAFLIFLIPYALLVYFARLTSWRDP
                     TSLFFRENEAYEPSYSNLRAAEGLTLIEEANNATEAPHVKASPNPTMCVGFASVAREG
                     VSYFQSAVGSVLAGLDPVERGDIFLILFIAHTDPTQHPVYSERWVHELVDKVLLYDEN
                     DIDIDHIRSLETAEARTLALEKGLLDYTYLLKACTAIGTPYTVMLEDDIIALDGWYHR
                     TKEAISAVERQTAEKKASKCEF"
     exon            280446..281168
                     /number=1
     CDS             join(281471..281773,282077..282127,282254..282256)
                     /codon_start=1
                     /locus_tag="AO090012000114"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000113"
                     /protein_id="BAE60340.1"
                     /transl_table=1
                     /translation="MLPISEGVHEMPKFGCCSQGFVFPHSRIKDLVSWYESKGIGYVD
                     MLTEDYANQNGELRWALTPSVLQHVGSKSSKTNSPVPQKGIRTIPEKLWNFAFEKNDV
                     DSCAVYSASKQVSGCA"
     exon            281471..281773
                     /number=1
     exon            282077..282127
                     /number=2
     exon            282254..282256
                     /number=3
     CDS             complement(join(286592..286602,286637..287471))
                     /codon_start=1
                     /locus_tag="AO090012000116"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000115"
                     /protein_id="BAE60341.1"
                     /transl_table=1
                     /translation="MARNTRFILVLTLFILFAVAVGDDVEGCPPGLPYSPFIPYFRYP
                     ADSAQACWGFAICTFMEADEARKQQYGATALVMGLVPLTLRDIAWPERRTVLVSAPLP
                     FIAATAVRALGLEPTLAADVEEERLRLWLSWMRTGWLTNIKAKSNIMKALFVTVTFVL
                     LLVSYAALALVEIYSKRSALGCPYPIFCLTWCLVGIVPGAVHSLFASWREDKSGRAGR
                     ETAVQGADEAWPVQLTWAIYYTAGTLVFTSIMAITVLELFVWVVVMFAVTGASKLLAL
                     YISCA"
     exon            complement(286592..286602)
                     /number=1
     exon            complement(286637..287471)
                     /number=2
     CDS             complement(join(289672..289680,289739..290451,
                     290502..290517))
                     /codon_start=1
                     /locus_tag="AO090012000117"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000116"
                     /protein_id="BAE60342.1"
                     /transl_table=1
                     /translation="MSNSEDSPSPENVKWQTTWFALVSLGLAAMMQPCGNVLGQRTKN
                     HRFYIRASPVVCAADMVQFIAFVLLGFSPDPQVWLRNVKFELRERFEGESGAKDREAA
                     ENAIIIRWILMIMGAYVFQVIKLVAMRGVPWTQAWAMMFVISILFGEILILLVHFLNL
                     DDGSTSTPPLWRSYRFSNAVDHIGLIAISLQFAISYGSLYIFVHKMNDLLRYKGLPDY
                     VNFTILVIFIGVSLSPSFPGYWRYNSH"
     exon            complement(289672..289680)
                     /number=1
     exon            complement(289739..290451)
                     /number=2
     exon            complement(290502..290517)
                     /number=3
     tRNA            complement(291716..291787)
                     /locus_tag="AO090012t00002"
                     /note="tRNAscan-SE"
                     /product="tRNA-Arg"
     CDS             join(292257..292806,292863..293167)
                     /codon_start=1
                     /locus_tag="AO090012000119"
                     /note="pyrroline-5-carboxylate reductase"
                     /old_locus_tag="AO070343000118"
                     /protein_id="BAE60343.1"
                     /transl_table=1
                     /translation="MPSLQESKLAFIGGGNMASAIIGGLVNKGVQKQNIWVSEPWDVN
                     REKMAALGVQTTTANVEAAKDADLVIIAVKPQVTKGVCEELGAAWSQRTTLPVVVSIA
                     AGITLDSLVQWLRTSDGRNAHVVRVMPNTPALVGEGASGLYASKDVTSEEKELVNAVL
                     GSVSKATEWVDKEELLDVVTGLSGSGPAYFFAMVEHLVASATALGLSEEQATRLAAQT
                     CLGAGKMLVESSDSPSQLRKNVTSPNGTTYAALQTFESLGFKETVDKAVNSATSRAAE
                     LGNTLGKQ"
     exon            292257..292806
                     /number=1
     exon            292863..293167
                     /number=2
     CDS             join(294761..295373,295439..295640,295655..296114)
                     /codon_start=1
                     /locus_tag="AO090012000121"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000120"
                     /protein_id="BAE60344.1"
                     /transl_table=1
                     /translation="MKPFLLLSSLLASSALGSNLSTKVYGKPAGLAYSVTGGGNTTPA
                     VPANVAQLLDWLTDSKPRVIVLDKEYNFIGNEGYCENCACCVFNTDTCGDGGQDAIET
                     DFGWCGHRTPVDCTYPNTTTIDVASNKAIVGLGAKGVIRGSGLRVVNSVSNVIVQNIR
                     ITGINPGYVWGGDAIYMDGCDLIWIDYVKISLVGRQMISMGYESSGRVTISDTEFDGR
                     TDHSSTCDGHHYWTILGLGENDKVSFFNNWIHHTSGRSPDLGSVSAWHIFNNYWTCFS
                     VTPEPAILLEGNIFPDVARPTEPGNGYGMFITNSSTVTTCDSAMKRPCQENLLTGSGD
                     LSPYTTNNVTSLQTIADADEQNINIMPVSQVRAYVLANAGIGKVGFNSTVTPTVSPSS
                     SVMTPPATVAPYQVHKDNSHGHQYLRFHHRRP"
     exon            294761..295373
                     /number=1
     exon            295439..295640
                     /number=2
     exon            295655..296114
                     /number=3
     CDS             join(297558..298396,298405..298426)
                     /codon_start=1
                     /locus_tag="AO090012000122"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000121"
                     /protein_id="BAE60345.1"
                     /transl_table=1
                     /translation="MPITLLDLPSELLDRIVELVLCYKGLAPERPLPPWLNYVPWPRQ
                     EGDCLSAPHGVCTVKYWSAQEKYHDAWISNSLSLLLVNHQIAEITKRRLDESIMPSIF
                     NLDVILSDERELHPRWTFLSNPCHHVDDLTVTIRVAGTCPTTNWRRYHFLPDGDSPPR
                     ILWTFFYLLERFLEVGPLAEHRVPSPGPRMDDMSFTINRLTLDFVSPVNEESLAPADM
                     GFWDWINGGADEDHTKSSTALCSGVFGLLMRPTWLADLISEYVGYLLGMSISMAPYGK
                     LLYEKYQDLC"
     exon            297558..298396
                     /number=1
     exon            298405..298426
                     /number=2
     CDS             complement(join(298774..298860,298923..299064,
                     299187..299357,299421..299829,299928..300062,
                     300186..300227,300296..300506))
                     /codon_start=1
                     /locus_tag="AO090012000123"
                     /note="monocarboxylate transporter"
                     /old_locus_tag="AO070343000122"
                     /protein_id="BAE60346.1"
                     /transl_table=1
                     /translation="MSTPRATDRSISTVATRKDSSSAETCAGNERNEKGGTWTAPDEA
                     PDGGLIAWFMVLGAWCVLFCSFGWINSIGEFQAYYEQNLLRPDCRSNLRQTWSSISSF
                     ERIASSCLRFDDDVYIEKVLPDTPIARSVSCIPSWFSKKRGAVYGIVSSGSSIGGVIF
                     PIMISKLIRILGFPWTMRICALMILFLLIVANLTVRSRLPPNPRKLSKESLMRPFHES
                     KTMLLIAGFFTLTFGIFVPMNYFVTAAMADGMGRNLAEYLVAILNAGSLFGRLGAGVF
                     ADKMGSYNIFVVVTYIAGILVLALWIPASNNAGTIVFAVLFGFATGARYIATLGWILY
                     RDEDLLGCFVDCRVDFGFGCSSSSDGLEAECYFLERGASFSIYTSLFTTSLEIAKFPR
                     FFIESH"
     exon            complement(298774..298860)
                     /number=1
     exon            complement(298923..299064)
                     /number=2
     exon            complement(299187..299357)
                     /number=3
     exon            complement(299421..299829)
                     /number=4
     exon            complement(299928..300062)
                     /number=5
     exon            complement(300186..300227)
                     /number=6
     exon            complement(300296..300506)
                     /number=7
     CDS             complement(join(302672..302833,302887..303132))
                     /codon_start=1
                     /locus_tag="AO090012000124"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000123"
                     /protein_id="BAE60347.1"
                     /transl_table=1
                     /translation="MIKMNPLVIDLQRCEPHEHAPEAERGLVWYEITDKASYLPFDLL
                     SGQVKYKACFKDLPMGLQTVIYAPLGLRTQNKWTLEDQDEFQLREDVSMECNMFMAPF
                     VKGTIKASHGPLVDRLIIEAKSPERDLESTVGA"
     exon            complement(302672..302833)
                     /number=1
     exon            complement(302887..303132)
                     /number=2
     CDS             join(304023..304167,304228..304409,304820..304861,
                     304946..305017)
                     /codon_start=1
                     /locus_tag="AO090012000125"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000124"
                     /protein_id="BAE60348.1"
                     /transl_table=1
                     /translation="MSFHQSCDLIRIEVRGDHTVLLAAAKNGDGDETVPAEIVLDEQI
                     GNGDGWFVRGGENFTETAHEIELEFREDGPWLTAFLTEVDGEDRERQGINLADHIGND
                     CGRLVWAQPQRGVPHRQHRKIAVINGTRPVFSRMQDAVSRLSLC"
     exon            304023..304167
                     /number=1
     exon            304228..304409
                     /number=2
     exon            304820..304861
                     /number=3
     exon            304946..305017
                     /number=4
     CDS             complement(join(305269..305721,305780..305863,
                     305927..306072,306139..306210,306345..306372))
                     /codon_start=1
                     /locus_tag="AO090012000126"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000125"
                     /protein_id="BAE60349.1"
                     /transl_table=1
                     /translation="MNKRAFILPTMILDNGIWKDDVALHLTVGQSAKGDDTQTVASGV
                     ERVRQILQAGQESGQGSTSIYVQAANGSIPVVVRAYNEDDISQLVLIKRDFPSVKLVI
                     YGGHGAVSVAKHLAEANIPVILTGNRGAPTNWEKKDVLTGPPLTESPAKILTDAGVLL
                     GLGVSSDSKVHGLAQEARWAGKFAGLSDREAIALVSTNIEAILGIGSKRTANGGEDSQ
                     RYRGDFVVWEGDPLRGEGSVVVSVQDGEKIADCWPDTSNVIL"
     exon            complement(305269..305721)
                     /number=1
     exon            complement(305780..305863)
                     /number=2
     exon            complement(305927..306072)
                     /number=3
     exon            complement(306139..306210)
                     /number=4
     exon            complement(306345..306372)
                     /number=5
     CDS             complement(join(306748..307007,307160..307251,
                     307327..308534))
                     /codon_start=1
                     /locus_tag="AO090012000127"
                     /note="imidazolonepropionase and related amidohydrolases"
                     /old_locus_tag="AO070343000126"
                     /protein_id="BAE60350.1"
                     /transl_table=1
                     /translation="MTTKGALLATELNHQEYVQRSRLRRLRRWRRLLWPLLLIAALVI
                     LIQRESSVNIVPYPRYSTESDLFNEGMNKCYEARSRSQSHNKATSESRVNHRWNPVSG
                     HKGDIVIQNATLFDGELTRNGTFNIHFSSGVIRSVSPTHLDHPIPEGTHIINVHGRFI
                     TPGLVDMHSHHLLLPFPQLPATDDVNERPLLGPITPFVRAIDGFKPHDPTIKIIASGG
                     VTSSLVLPGSANIVGGEAYMVKNLPLSGAAGEPVVEELLLEYGLPENNRQRYLKMACG
                     ENPKRVYGNTRLGLTWLLRKQLEEARDLHERQSAWCRVAFDVEETSFAKTHHVKTFIR
                     NHGKRPDSFELETLVALIRGELNVNVHCYEPEDFERMLSVLHEFGVHPQAFHHALEAW
                     QVPELLKNLEEKCSVQGRGIWCKSKRTQNPGRPRGQGCPKIGTKPLFLILLGSRKTSL
                     CRQLHPFLLSRCSRTTELDMFGLDTMQIWLSGMITRYKSGRHPLRSSSMVALSWATVT
                     PWNCLSTTPAL"
     exon            complement(306748..307007)
                     /number=1
     exon            complement(307160..307251)
                     /number=2
     exon            complement(307327..308534)
                     /number=3
     CDS             complement(join(309357..309373,309400..309477,
                     309696..310609,310675..311381,311455..311670,
                     311746..311814))
                     /codon_start=1
                     /locus_tag="AO090012000128"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000127"
                     /protein_id="BAE60351.1"
                     /transl_table=1
                     /translation="MDPARKRQKVSSACERCRKRKLGCDQQRPCQLCLRAGATCVPRG
                     ELVARASPTSPIAAPVEQRRAPGERQNAPVRPNDRQTAVLPELNIVDLSTRMFLRDEQ
                     HQTLGYDTSALPGGKKTYSPLLSSPIPWRDGIGIQLPPLQILDELVTQFFDSVDWFMM
                     VCSVLVILLAVLFTTCPTGLMSFGQVFHEGSFRQRYASLITSAYVAGPDNNFLWLLML
                     VLALGAHYSSLREPLDEHHRNLSVLSETLLTQIEYRFLQIIGCPNVEAVQVCVLLGSF
                     HLFNGRPTVGMGVLGSGIKIAQVIGLHREAMWHNLSEVARESRRRSWWALEVFDKYAA
                     VAFGRPCSIDDSDCKIGMVTDVGEISPRQGPLLTYHQWKFRLYRIMGPFLGRRLQSNR
                     LETVRAIHGQLVAWERELPDSLRLEKYGESGSSGDAPLIQLAALALQLTYDNLRIILH
                     RSVAFGDIGHEVGLAGRVVETESTAFSRQQLLESALRTSELYRYSHLLQASRRTHAVM
                     HIGICLFTSGVVLCALSLMEPLSITSQKAKAGIMQIIRLQKESVSNQHVLSLQSVRIL
                     EDLVNVVMQAEQRTILGGPIPASISQPKGRAKRVADNEYTGISQSQTNMNENSGGANT
                     TTQASLTPLQEVESGLADASQLWLWSDNLGYQSFAELEPEGN"
     exon            complement(309357..309373)
                     /number=1
     exon            complement(309400..309477)
                     /number=2
     exon            complement(309696..310609)
                     /number=3
     exon            complement(310675..311381)
                     /number=4
     exon            complement(311455..311670)
                     /number=5
     exon            complement(311746..311814)
                     /number=6
     CDS             join(312121..312196,312248..312468,312524..312884,
                     312931..313055)
                     /codon_start=1
                     /locus_tag="AO090012000129"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000128"
                     /protein_id="BAE60352.1"
                     /transl_table=1
                     /translation="MAPPRKALIAITSAHAPLYPDGKETGLFITEALHPFNVFKKAGF
                     EVDLVSETGTYQPDWLSQQKDWLPDEDRAVWEDHSSEFRSKLDKLLKPSDIKADNYGL
                     FFASAGHASLIDYPDAKGLQSIAAKVYTDGGIVSAVYGVPSITPSNDGDTILITSHSC
                     HGGAIFPGIIDPSTGKSVISGRKVTGFTTRGEEEEGVLDTIKSWKRPTIEASAADSGA
                     TYVSPAGPWDAFTITDGPIVTGANPASAHVTAEAAVKAFDAL"
     exon            312121..312196
                     /number=1
     exon            312248..312468
                     /number=2
     exon            312524..312884
                     /number=3
     exon            312931..313055
                     /number=4
     CDS             complement(313243..314739)
                     /codon_start=1
                     /locus_tag="AO090012000130"
                     /note="NAD-dependent aldehyde dehydrogenases"
                     /old_locus_tag="AO070343000129"
                     /protein_id="BAE60353.1"
                     /transl_table=1
                     /translation="MSAPIPHVSNWINGAYTTATTQVITVLNPATETPIATIDSTPQE
                     TVTTIVADSVQTFHKGPWSKTEPSDRFTVLSTAARLLRTRLPEFIELETRQTGRPIRE
                     MQTQLFRVPEWLEYFASLARVHEGRVTPFKGPVVNTLTRLPLGVVAQITPYNHPLLIA
                     TKKIAAALAAGNVVIVKPSELAPLSVLKLGPLFQEAGLPDGVLQIMSGHGFETGKFLC
                     ESPLLAKIDLTGGLGTYRAVAPVAARNMVPVTAELGGKAPVCLFPSLEVERAVQAALF
                     AGFIASGQTCVTGSRLLVHRDIYGAFRELLEKRVRGLRVGDPMDGRTQIGTVISKAAV
                     ERCAAFVDRAVQEGGNVLCGGRSTTGPDGKGFFFEPTIIEVRADSHIACNEVFGPVIA
                     LIECESEEEIVSIANSTPFALGASVWTNDFNQAHRVAEKIDAGIVWINGHHLNDPSSP
                     WGGFKESGIGKENGLEAYESYTKVKSTLINYGVAPVWFDDEATNARYG"
     exon            complement(313243..314739)
                     /number=1
     CDS             complement(join(316923..317467,317566..317696,
                     317824..317861))
                     /codon_start=1
                     /locus_tag="AO090012000131"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000130"
                     /protein_id="BAE60354.1"
                     /transl_table=1
                     /translation="MPGTLVATCPSNITARKPLEPQNNNHYHNLPTISPKNGIRKPTS
                     NRHFNEANTRGRVAKEYMSIAYSPTENKGAESVRHLCTADSWFWSPSTFPGCSTPMDY
                     AESHARVMASVNDLHIVRYDQAWAKDGHVLLRYTAEGSHSGEPYQGIERSDPPKKARW
                     SAAAIFEIEDGKVKSFTKDWDQKVMQVTRSNFWNSGYSIVTDWSMQIQLGWAPVGESK
                     DPRWDPEMLAQPELARDKK"
     exon            complement(316923..317467)
                     /number=1
     exon            complement(317566..317696)
                     /number=2
     exon            complement(317824..317861)
                     /number=3
     CDS             join(318917..319111,319176..319476,319533..320074,
                     320120..320356,321943..321960)
                     /codon_start=1
                     /locus_tag="AO090012000132"
                     /note="histone deacetylase complex, catalytic component
                     RPD3"
                     /old_locus_tag="AO070343000131"
                     /protein_id="BAE60355.1"
                     /transl_table=1
                     /translation="MLTSTPFDSFSLNHASQSKRRVAYFYDSDVGNYAYVSGHPMKPH
                     RMRMAHSLILNYGLYKKMEIYRAKPATKYEMTRFHSDEYIDFLFKVTPDTISKHLTEQ
                     VKYNFNDDNPVWDGLSEFCSISAGGSMEAAARLNNRKCDIAINWAGGLHHAKKSEANG
                     FCYVNDIVLGILELLRFHPRVLYIDIDVHHGDGVEEAFYTTDRVMTVSFHQYGDFFPG
                     TGDIGDIGVSEGKNHSVNVPLRPGMDDVSYSRVFQRVIKGVMDWYRPDAVVLQCGGDS
                     LSGDRLGSFNLSMRGHANCVNYVKSFNLPTMLVGGGGYTMRNVARTWAFETGVVVGEE
                     VGPDLPYDDFYGHQYYAPDYILDVKPSNMPNQNTDTYLTQVCTKVLDNIKKTMTFSPS
                     VQMTDVPRYPLIPALDEEFEDIADDEDEDENKDLPVRE"
     exon            318917..319111
                     /number=1
     exon            319176..319476
                     /number=2
     exon            319533..320074
                     /number=3
     exon            320120..320356
                     /number=4
     exon            321943..321960
                     /number=5
     CDS             join(324968..325205,325301..325588,325639..325727)
                     /codon_start=1
                     /locus_tag="AO090012000133"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000132"
                     /protein_id="BAE60356.1"
                     /transl_table=1
                     /translation="MAPAKLGSKANSRKDGQPRTQMSWNNNNINTVGDNPPSVSSPSA
                     ADEADTISSRQLWQVIMRTQQVDLDLNLAEISAAWRFRRHLRTGNTLVLRRGDINAVM
                     SAQAAASTTANTHAAATASAHTHVFSINSSASGNTTSNASAHAHSHTGIIYDVQGMAG
                     PSNASGHHAMNSGNAGASRVRRASPRKGSRLQPTSQGSGAQQDS"
     exon            324968..325205
                     /number=1
     exon            325301..325588
                     /number=2
     exon            325639..325727
                     /number=3
     CDS             complement(join(326185..326462,326549..326630,
                     326694..326729))
                     /codon_start=1
                     /locus_tag="AO090012000134"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000133"
                     /protein_id="BAE60357.1"
                     /transl_table=1
                     /translation="MPITWTAEADAKLLLGFVDQCKDANFKLDYNKLAAYVGPDVTAC
                     AVVNHVIRLRKLIAQEGGGSAASTPVTSPAKSKSTPKRKGAGVAKTPTKIAKRDIKRE
                     REMGDEDEDMMPVQVVIEVKKEAEEEVEE"
     exon            complement(326185..326462)
                     /number=1
     exon            complement(326549..326630)
                     /number=2
     exon            complement(326694..326729)
                     /number=3
     CDS             complement(join(327271..328570,328621..328783,
                     328837..329083,329138..329360,329423..329475,
                     329526..329719,329781..329907))
                     /codon_start=1
                     /locus_tag="AO090012000135"
                     /note="beta-glucosidase-related glycosidases"
                     /old_locus_tag="AO070343000134"
                     /protein_id="BAE60358.1"
                     /transl_table=1
                     /translation="MHAIAGLTGLLAGVSLSYAAPTHENITSDAYFYGQSPAVYPSPE
                     GTGSGAWASAYEKAKAFVANLTPEEKVNLTAGTDADNGCSGNIPAIPRLNFPGLCVSD
                     AGNGLRSTDHVNAWSSGIHTGASWNKDLAQKRGLHMGSEYHKKGVNVLLGPVVGPLGR
                     IAEGGRNWEGFSVDPYHSGLLVYETIRGIQAAGVGTSTKHYIANEQETNRNPESTDGI
                     DVAAVSSNIDDKTMHELYLWPFQDVVRAGSVSIMCSYQRINNSYGCQNSKTLNGLLKT
                     ELGFQGYVMTDWGAQHGGIASSNAGLDMVMPSSTLWNSNLTDAIANGTMEASRLDDMA
                     TRIIASWYQMNQDAGFPSPGVGMPADVYAPHQAIIGKSSDSRKVLLQSAIEGHVLVKN
                     KNNTLPLKSPEMISVFGYDAKGPDSLGFALEWLSYSPAIQPNHTLIVGGGSGGNSPAY
                     ISAPLDALQQQVIEDGSSILWNISAQDPEVDPNTDACLVFINSYATEGYDRAGLVDEG
                     SDELVTNVASKCSNTIVTIHNAGIRLVNNWIDHENVTAVIFAHLPGQDSGRALVELLY
                     GRSNPSGKLPYTVAKSADDYGALLHPKLPEGQYGLFPQDDFSEGVYIDYRAFDKQGIE
                     PQFEFGFGLSYTTFDYSGLNIGQVSDNSTSRYPPSAAIQEGGNPHLWDVILRVSVDIT
                     NSGPVAGDEVAQLYVGIPNGPVRQLRGFEKVNIPVGQTVTVEFALGRRDLSTWDVVAQ
                     EWLLQSGTYQVYVGRSSRDLPLQGEFTI"
     exon            complement(327271..328570)
                     /number=1
     exon            complement(328621..328783)
                     /number=2
     exon            complement(328837..329083)
                     /number=3
     exon            complement(329138..329360)
                     /number=4
     exon            complement(329423..329475)
                     /number=5
     exon            complement(329526..329719)
                     /number=6
     exon            complement(329781..329907)
                     /number=7
     CDS             complement(join(331331..331725,331784..332069,
                     332121..332487,332546..332972,333033..333144))
                     /codon_start=1
                     /locus_tag="AO090012000136"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070343000135"
                     /protein_id="BAE60359.1"
                     /transl_table=1
                     /translation="MTVEVKYDNGQLRDLLHSPYVFGAALLASFGGFSFGYDQGVISL
                     ILVMPQFREQFPETSPENPKYGFHTGFMTGMLELGAFIGCLFFPAVADRISRKWGLTV
                     ATVFFVIGAIIQTASMNYGTLVAGRFIGGVGVDTLAMGAPLYISEIAPPAWRGSLLVL
                     ESISIVIGAIVAYWITYGTRAIPGEWSFRLPFLLQMFPALIVGCAIHFFPFSPRWLAM
                     RGREEDSLFALAKLRRRPVHDEQVQLEWKGILSEVRFQRQMLEKEYPDHQSRPLLVGL
                     KQWVSLVRPKYFRRTLVALAIPFFQQFSGINAFVYYAPTFFEALGQSSETSLILSGMV
                     NICQLVGGIPILMYLDRVGRRTMAIIGGVIMAIPHLIMAGLMNRYSNDWPSHKAIGWF
                     CVALIYAYALAYAVSYGPLAWVLPAEVFPNSKRAKGVGAATAMNWLANFIIGVVVPEM
                     LIKLGWGTFLFFGLFCVAAAIFSFLFVPETSGKSLEQIAVVFGDNLDGDERGLQEKIA
                     RETFENATARVLHVEKAGSA"
     exon            complement(331331..331725)
                     /number=1
     exon            complement(331784..332069)
                     /number=2
     exon            complement(332121..332487)
                     /number=3
     exon            complement(332546..332972)
                     /number=4
     exon            complement(333033..333144)
                     /number=5
     CDS             complement(join(334019..335094,335147..335354,
                     335419..335556))
                     /codon_start=1
                     /locus_tag="AO090012000137"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070343000136"
                     /protein_id="BAE60360.1"
                     /transl_table=1
                     /translation="MGNDPVYVSEGFTPGMNGQRSLVHRVYTYPWFQIVLISFICFCC
                     PGMYNALTGIGGSGQVDGTVAANANVALLSAMAGTALFVVGPIFDRIGPRACLLIGGW
                     TYPLYSGSLLCFNRTANGAFVIAAGAILGIGASFLWVAQGAIMTTYVPESQKGRAIAA
                     FWIIFNLGGGIGSLASFGMNYHSTSGTVSDGTYIALLIIMAIGWLMGALICPPKSVRV
                     STLQTTPETEKNWLHVAKLTVKTVCDWRVISILPLFFCANVFYSYQQNTVNGMTFNIR
                     SRSLNGALYWIAQMFGGLIMGFLLDVPGLNRQWRARLNWLFLFVTGMAIWGGGYAFQL
                     WYDRRVAEGKKQDVDFTDSSISVGPMFLYIFYGMYDAFWQSFCYWLMGAQSNSPAVAA
                     ILVGAYKTFQSVGGAMAWRLDAMGKSPMLQFAVDWGLCMGSLVIAIPAVLAVTLTNTD
                     QETLDEVDIKHRQDDTTADGPKP"
     exon            complement(334019..335094)
                     /number=1
     exon            complement(335147..335354)
                     /number=2
     exon            complement(335419..335556)
                     /number=3
     CDS             complement(join(339177..339383,339454..339549))
                     /codon_start=1
                     /locus_tag="AO090012000139"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000138"
                     /protein_id="BAE60361.1"
                     /transl_table=1
                     /translation="MVKGDVKDKHGDTIHEGDYVFTRIRGGSHQGEVERIVMDEQEAE
                     EEGVKNPPKVRWSRLCRDFVEDIADITIHTIQVVFHDQRGKKVAHNPETLEKMEHE"
     exon            complement(339177..339383)
                     /number=1
     exon            complement(339454..339549)
                     /number=2
     CDS             join(341017..341454,341509..341553)
                     /codon_start=1
                     /locus_tag="AO090012000141"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000140"
                     /protein_id="BAE60362.1"
                     /transl_table=1
                     /translation="MLLQAWLLLVLYASFTYSKVSPVNERCVTAVYTACGYIPFATPP
                     EVPRGFYGSRCQNPWTVTSIYAAADVFCDPSERAAGFAQLQYSCQQFGHVNLIPRDAL
                     AANLTEDAINQMRTVDYGEISPSEPVDYPVLLSPSFYHRTFRTIDTWEFEVWTHSAYG
                     "
     exon            341017..341454
                     /number=1
     exon            341509..341553
                     /number=2
     CDS             join(347403..347703,347758..347837,347888..347944)
                     /codon_start=1
                     /locus_tag="AO090012000143"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000142"
                     /protein_id="BAE60363.1"
                     /transl_table=1
                     /translation="MKFFAVAALFATAAMAAPGSAPVPGAAAAAGNGNAPVINQTQQK
                     AFTDACSAKGNHPVCCDQIDTSKTTTVNEGLLGGLLGEGLGGVLNNLVGGEPGACSGL
                     VSALNKQCQTSIGCCQQNAKGDNYQSGLLNLNLQAPCLLSNGL"
     exon            347403..347703
                     /number=1
     exon            347758..347837
                     /number=2
     exon            347888..347944
                     /number=3
     CDS             349365..350018
                     /codon_start=1
                     /locus_tag="AO090012000144"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000143"
                     /protein_id="BAE60364.1"
                     /transl_table=1
                     /translation="MAVDRRVTSPHRRTSDTILGASHAPGLMSTRSEKPTSVQNYVLP
                     PRKTADSLMGVYWSFVFPLYPLVDGIRLRAEYEKVWTGEPLESDESMLMCTFNVIFAL
                     ACQLADFIPPEEREASADAFFSRAKDLLQFNLWDTGSAALIQCLLLMAQYLQSTDSAH
                     QCWIVTGLAIRNAQSLGLHLPQTIARLPSPQEQQLARKIWHGCVLMDRYGVPHLLNL"
     exon            349365..350018
                     /number=1
     CDS             join(350067..350449,350532..350770,350877..351193)
                     /codon_start=1
                     /locus_tag="AO090012000145"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000144"
                     /protein_id="BAE60365.1"
                     /transl_table=1
                     /translation="MISKASCESVPLPATVDEEYIPTASGVEATQPADQPSVMAFYAK
                     SLELYEIMNDILLSLYKPVPEENPEDMYDLYFNKENNQGERTIFELDRALSKWSQSLP
                     SHLRGYSPASSTDVVFHHQSVVLRARFLHVRMLLFRPILSRYCAARDITVPDSLVSLG
                     DSLPQRIAWQCSAICVKVAQEVIELIYENIPADGSSGPLPAWWYNILFLDEVTEAAIT
                     RSWNCALEILRKYQSYSTSARRCVAALEILYERVVSERPPSHEPSASHQQQSAASNAI
                     DDMSLGEGMNAIFMEGFDWPDFQDMSWLNSVPSNLH"
     exon            350067..350449
                     /number=1
     exon            350532..350770
                     /number=2
     exon            350877..351193
                     /number=3
     CDS             complement(join(351553..352617,352682..352963))
                     /codon_start=1
                     /locus_tag="AO090012000146"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000145"
                     /protein_id="BAE60366.1"
                     /transl_table=1
                     /translation="MVGKAEKSSWEASLPLEGVYPAVPTQQAEDMSSHPDNPRNWPIW
                     KKNVQILMVAFHSMVATFMAAGIIPAFDSMAEEYGVTVPEASYLTSIQVRILVLGLTP
                     FLWKPITCIYGRYHVSLVSVLGSLACNIGGARCTTYGAQMATRVLTAILISPPIGIGS
                     GVITELCEPEERAQKLGWWTLMTTLGTPAGPFIMGFVAKHIGFEWIYWIYVMINFAQF
                     LAYLLLGEETMYVAGDAGDGKGGPTSKFIPRRIDPRPLKPREFIESIFLYRYPRILIP
                     TIAQCVVFCYANTAIIVEMPIAFGQKFHFDAQQIGLQYIAVIIGSLIGEQVSGPMSDW
                     FMKALSQRRGYFRPADRLWLSYIGFATVIAGLLTWGFQLDNATSWNVTPCVGAAIASF
                     GNQILTTILISFAVDCYKDQSTDIGVFVNFVRHVYGFVRHIQTLRYHITHEANIES"
     exon            complement(351553..352617)
                     /number=1
     exon            complement(352682..352963)
                     /number=2
     CDS             354673..355389
                     /codon_start=1
                     /locus_tag="AO090012000147"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000146"
                     /protein_id="BAE60367.1"
                     /transl_table=1
                     /translation="MRLRTSLGVASACASVASAALKVTEDNSTITLANDRLTSTFAKD
                     KGRVSELFLDGQDLLGPISGNTGVGPYLDCYCIPSGFYTAGSTDPRLEVVQGTDSTGT
                     KYAGVILNDTYTPTGQQFQQYWFLRDGETGLHTFSRLAYYNETTPFLRNLQEFRTLFR
                     PNTELWTHLTSSEAQTAPLPSKEAIANEVVVQDATWRFNNTPNDAYYTQFSEYFTKYT
                     FSNCMGLFKTYWYAASANLQ"
     exon            354673..355389
                     /number=1
     CDS             join(355611..355794,356013..356767)
                     /codon_start=1
                     /locus_tag="AO090012000148"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000147"
                     /protein_id="BAE60368.1"
                     /transl_table=1
                     /translation="MEKERQTSPMASTAPLVPNIISSTVERALSHLWKICDRRLRPLP
                     TQDGTLTSTTPLPSMSSDGIFGDFVHDGVEVQARKVTKVQETWEQESAGVEVWRLGTP
                     DKSSGEFLHGDAPDPTHPLHPPQHFIYWGAYDWQQDFPNGVNYTIGSSDPAVDFNTVH
                     WSVYGPTPENPDVEYDTTHDWTINFSLDKKQLQQRKTATLTIQLAGAKTAAGNTDVYN
                     ATEPYANLALESYINEQKEPLTLLVGFNQSSSCIVRSAVSCYQVRSRMEFPADWLNVG
                     NNVLTLHLPRNATDYETAVLPGTVYVQYDALRLELA"
     exon            355611..355794
                     /number=1
     exon            356013..356767
                     /number=2
     CDS             complement(357683..358441)
                     /codon_start=1
                     /locus_tag="AO090012000149"
                     /note="predicted Na+-dependent cotransporter"
                     /old_locus_tag="AO070343000148"
                     /protein_id="BAE60369.1"
                     /transl_table=1
                     /translation="MPAEEPLWRKILEIILGQWFLIGIGIVILIASQAPAPTKDQDTI
                     ETVISYLCVTIIFFITGCTLSTRALIENYSRWKVHLFVQIQCFLFTSASVYAVVSLCA
                     TNPDFMDEALLIGLLLMGCVPTTISSNVVMTRNAHGNDALTVVESTIGNFLGPFLTPL
                     LIQMYCLPKPWYTDFLGEEQGNYAAIYARIFKQIGLSVFIPMVSRATCTQKPQPKEVN
                     PSILTKKPSSSAKSSNISSPNPFAKSSQPGNSTN"
     exon            complement(357683..358441)
                     /number=1
     CDS             join(361820..362462,362487..362712,362762..363130,
                     363185..363521)
                     /codon_start=1
                     /locus_tag="AO090012000150"
                     /note="acyl-CoA dehydrogenases"
                     /old_locus_tag="AO070343000149"
                     /protein_id="BAE60370.1"
                     /transl_table=1
                     /translation="MSKTFSRAEVAKHNTEDSVWCIIDHRVYDLTDFLDAHPGGSVVL
                     NQVAGQDATAEFYNLHRQEVLEKYRDELCIGTVEGETPEIAPREPGSLSEVPYAEPLW
                     LRPDFKNPYYKESHRRLQRAVREFTDRYIYPEAQEKEKDGTYISQELIDRMAEAGILA
                     MRLGPGKHLHGRKLLGGAVDGKEFDYLHDLIVSQELSRANARGGFGLRHLLSWRGFSD
                     GNMAGMAISLTAVQQWLRNVPLRDQITDEVLSGRKKMCLAITEAFAGSDVAGLRTTAT
                     KTPDGKHYIINGTKKWITNGMFADYFVVGCRTEKGFSVILVPRGEGVETKLIKTSYST
                     AAGTAYIQFENVKVPVENLLGEEHKGFIVIMSNFNHERFMMACGTIRMAMTVVEECMK
                     WCNQRIVFGKKLIEQPVMRQKLARMISLCESNQAWLESIAYQMCNMTYKEQATHLGGP
                     IGLLKSHATRAAQEIAEQATNIFGGRGLTQTGMGKVIEMFHRTYKFDAILGGTEEILA
                     DLGVRQAMKKFPKAML"
     exon            361820..362462
                     /number=1
     exon            362487..362712
                     /number=2
     exon            362762..363130
                     /number=3
     exon            363185..363521
                     /number=4
     CDS             complement(join(363796..363891,363954..364361,
                     364419..364427))
                     /codon_start=1
                     /locus_tag="AO090012000151"
                     /note="serine O-acetyltransferase"
                     /old_locus_tag="AO070343000150"
                     /protein_id="BAE60371.1"
                     /transl_table=1
                     /translation="MERKSSIIGDTRPLPPPLIDTKADEDQFKDTDPFVDPPISIDHG
                     LNFKVGKGTFLNFNLLVLDTCLVTIGERVLFGPNVSIYGATHPMDPAVRRGLEGPEAG
                     KEVHVEDDVWIGGSVIILAGVRIGRGSTVGAGSVVTRDVPPFHFAAGNPARVIKKIET
                     SMDSEQQSMQ"
     exon            complement(363796..363891)
                     /number=1
     exon            complement(363954..364361)
                     /number=2
     exon            complement(364419..364427)
                     /number=3
     CDS             join(365126..365304,365359..365524)
                     /codon_start=1
                     /locus_tag="AO090012000152"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000151"
                     /protein_id="BAE60372.1"
                     /transl_table=1
                     /translation="MCVPSLTVSPSTFPCTATLVNVSRPPYDTFESHARYSSPRDFTR
                     ALYIPRHDSTTSHLPLYLHSAKLSYMDKPRGDDMNARVEYLVDASKKEEVMEIQVQRR
                     SLNQSDDIKANA"
     exon            365126..365304
                     /number=1
     exon            365359..365524
                     /number=2
     CDS             complement(join(365838..365986,365992..366196,
                     366299..366935,366986..367119,367184..367491,
                     367548..367680))
                     /codon_start=1
                     /locus_tag="AO090012000153"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000152"
                     /protein_id="BAE60373.1"
                     /transl_table=1
                     /translation="MNAAPTPPEAYPPRSDKLNADTQEMSNEVAEILRLPETETLLTH
                     YDEFICPHQISEIGNESDNPYRSYILPLARKQIGLLYAVLGFSASHLGQLTGNQTMHE
                     ATAVEYRMKAIRALSEEIRRSQASTLLEDEQDAVLAIIQILLLHDIAESGISTHGIHI
                     TGAMSVCKRLLISEGLSGHRRRAVFFLGNLAWLDIIRAFAGPERLCFSQDIRELVACA
                     SESTFEMVNGCPREVFLIIGGILEKSKEHTLGWLTWDEYQIAMLVAKHKLYSWDSKEK
                     MYPSTDPRWLAVAESFRFACILRILRLLDDLRPAKSPEIQECVARILDATATIPSDCP
                     LIELLILPLFMAGADSLARHSQYYILSRFKEIERRSEIRNPVPRDLLEKVWAARAAQP
                     PDDDKNVSWTSFKHKLVAISYYELNEMLLRCCLKRGDIVIFWWLCALYHSIQAFIPPR
                     LVSNAGAVWTRTSSQILNLNCFSRIDLSSRNRCNIVNKLAITTASCSCPPLSGSNSTP
                     SLKSVGSHTTMPT"
     exon            complement(365838..365986)
                     /number=1
     exon            complement(365992..366196)
                     /number=2
     exon            complement(366299..366935)
                     /number=3
     exon            complement(366986..367119)
                     /number=4
     exon            complement(367184..367491)
                     /number=5
     exon            complement(367548..367680)
                     /number=6
     CDS             join(368756..368942,369020..369912)
                     /codon_start=1
                     /locus_tag="AO090012000154"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000153"
                     /protein_id="BAE60374.1"
                     /transl_table=1
                     /translation="MAGNLDVLRAENVLDLAQKALQGDGSVEYSLKTPYEAVALIGHA
                     CMLAVNFRLVGLGEEHTIEGSSENPTLPPGWNANDTVSFRYAHSQSSMQYLLKVSRIG
                     NNALIFALALGDDKTTSFDIPVKDFISASALPASSSSQSNATLSEVFISTPRLNDLIG
                     LFKINVIQKLAPGIYKEGYEATSQSVREQPQERPPRRDPLRDDQIPQPARPYPFDDPL
                     ATRPRRPVPPGDFAPPGFEDEYEIQRPPRGIPLGMGGRNPLNIGDRDLYPPGLGPHDP
                     LRGGIGPGLGGGGGGGMHPTFDDPLFGGPQGGGYDPQAPPGARYDPVGPGFGAPFGRG
                     RGPSGGRGAGGGGGFGGFGFGGDII"
     exon            368756..368942
                     /number=1
     exon            369020..369912
                     /number=2
     CDS             join(370558..370719,370787..370828,370922..371027,
                     371079..371612,371669..371741,371803..371875)
                     /codon_start=1
                     /locus_tag="AO090012000155"
                     /note="serine/threonine protein phosphatase 2A, catalytic
                     subunit"
                     /old_locus_tag="AO070343000154"
                     /protein_id="BAE60375.1"
                     /transl_table=1
                     /translation="MDNNMEIDTARSPEPHRLSPTSDPGSIPTLDGWIENLMSCKQLA
                     EEDVRRLCDRAREVLQEESNVQPVKCPVTVCGDIHGQFHDLMELFRIGGPNPDTNYLF
                     MGDYVDRGYYSVETVTLLVCLKIRYPQRITILRGNHESRQITQVYGFYDECLRKYGNA
                     NVWKYFTDLFDYLPLTALIENQIFCLHGGLSPSIDTLDNIRSLDRIQEVPHEGPMCDL
                     LWSDPDDRCGWGISPRGAGYTFGQDISEAFNHNNGLTLVARAHQLVMEGYNWSQDRNV
                     VTIFSAPNYCYRCGNQAAIMEIDEHLKYTFLQFDPCPRAGEPMVSRRTPDYFL"
     exon            370558..370719
                     /number=1
     exon            370787..370828
                     /number=2
     exon            370922..371027
                     /number=3
     exon            371079..371612
                     /number=4
     exon            371669..371741
                     /number=5
     exon            371803..371875
                     /number=6
     CDS             complement(join(372957..373216,373284..373406,
                     373458..373620,373684..374273,374455..374470))
                     /codon_start=1
                     /locus_tag="AO090012000156"
                     /note="homogentisate 1,2-dioxygenase"
                     /old_locus_tag="AO070343000155"
                     /protein_id="BAE60376.1"
                     /transl_table=1
                     /translation="MCALGYNPDTEATFLPLNPRVHVSPTQLAWHPFDIPSNEPVDFV
                     AGLKTVAGSGDPTLREGLATHVYTANTSMTQKAFVNSDGEMLIVPQQGALDIQTEFGP
                     LFVQPGEIVVIPRGIRFRVELPDGPSRGYILEVWGSCYELPELGPLGANGLANARDFL
                     TPIAKYEIRQEAWEVVYKLGGKFFASTQNHSPFDVVAWHGNYVPYKYDMTKFVNVGSI
                     SVDHIDPSIFCVLTAKSRDPTAPLADFLIFSPRWDVASNTYRPPYYHRNAASELMGLI
                     YGDYGGRSDAFKPGSVSFECGMVPHGVAYEEFKAASEAPPPVMRISEASIAIMFESSR
                     AFTITDYAWNSEKRHEHEPAMWDNLVDNFSKRKDEVEALLAKKAAGLRV"
     exon            complement(372957..373216)
                     /number=1
     exon            complement(373284..373406)
                     /number=2
     exon            complement(373458..373620)
                     /number=3
     exon            complement(373684..374273)
                     /number=4
     exon            complement(374455..374470)
                     /number=5
     CDS             complement(join(375532..375588,375641..376893,
                     376962..377733))
                     /codon_start=1
                     /locus_tag="AO090012000157"
                     /note="transferrin receptor and related proteins
                     containing the protease-associated (PA) domain"
                     /old_locus_tag="AO070343000156"
                     /protein_id="BAE60377.1"
                     /transl_table=1
                     /translation="MPWAGLATLFLAVAGVHGSPLDTSNFQECKSRQNLSSTALQDLV
                     QAIPNADNIRESLGYYTNGSHLAGQGLQQAQWTQELWDAIGLSNASVKSYSANLTLPN
                     EHRVALLDTAREGDPVVYEAPLIEDNPPKAGDGQLPFAPAFFRCAGVGNITAQYIFAN
                     YGTQEDYDDLVRAGINITGKIALVKSTYESAVLKKYKLPYHRARQEGVATQMGLAGML
                     IYPDPQMDDEIVVENGYQPFPNGPARPPSLIERGSVGNCNPGQIPAMPISYADAIPML
                     RALNGHGPLAADFNDRWHGGGLTSHGVTYNVGPSPENVVLNVLNNPHNYAGHVHNVIG
                     VIPGCAFPDEVIILGNHRDAWGPGAGDGNSGSAALNEVARTLATALKEGWQPLRTIIF
                     ASWEGEEMGQIGSRSWVDENQSQLNSSVAAYLNVVVAGAGTKFHAQGSPLLAQAMHNA
                     TSQVQEPSGGQTVLEAWGSELGLGSGGDAMVFQEYAYSVADFGFSRGPTDPVFPYHSL
                     FDTYSWMEQYGDPGFAHHVATTKIWLQLATSLADEVILPYRIQGYAPVLQNGLESLSS
                     TANLSAHLDLTSLKETIDIFARASAAFDAYSDSLADQVQQQPVDDSLLAQVQSVNHKY
                     TNFERFLGDPDLPGGDGYYHLIISPAPYYFQTDPFPCLTKAIVAGNWTLAAAYRDKIV
                     NQLNKAVAFLE"
     exon            complement(375532..375588)
                     /number=1
     exon            complement(375641..376893)
                     /number=2
     exon            complement(376962..377733)
                     /number=3
     CDS             join(378285..379022,379081..379216,379264..379626,
                     379703..379783,379832..379998,380059..380142)
                     /codon_start=1
                     /locus_tag="AO090012000158"
                     /note="permeases of the major facilitator superfamily"
                     /old_locus_tag="AO070343000157"
                     /protein_id="BAE60378.1"
                     /transl_table=1
                     /translation="MAPSSNSQWDDTERANEETPLLKDLKDHQSHILPRRRLLVVFPA
                     LALIHFTSFLDQTALSTSLPAIAAGLNTGSSISWVSASFLTTSTSIQLINGRLSDIFG
                     RKTCLLGALTIMVLGNLLSGWSQTPAQLYATRAFSGLGAGAINALVQIAISDITTLEQ
                     RGYYFGILGVAVALGNGLGPVVGGVLTEKTSWRWAFWFVCPLAAAAATYFGLVFPPSD
                     MADNVCTKLQRVDWFGVFTSMMAIVLILIPVSQGGSAIPWNSPIIIAMLALGAALFGL
                     FLIGEWRWVKLPLLPMRLFKYNYSTNILLAVNILIGWVFWGNLFYIPLYFQNVRGWSP
                     GTAGSLILPMVIAHGITSGLTGLIISWTGRYKVVISIGVGMWMIAAAAKSFYTQQTPL
                     WILELGGIFEGIGVGCSFQPGSDKSDRAVVTGFRNFIRDMGGSVGVTVSGAILNNVLH
                     NDLKGRFSEELISKITSSAFVLYDFNLTDEDQKLISNAYMHGLRTDYGLAGRTRIESE
                     EQAEGETRERYTDE"
     exon            378285..379022
                     /number=1
     exon            379081..379216
                     /number=2
     exon            379264..379626
                     /number=3
     exon            379703..379783
                     /number=4
     exon            379832..379998
                     /number=5
     exon            380059..380142
                     /number=6
     CDS             381082..381663
                     /codon_start=1
                     /locus_tag="AO090012000159"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000158"
                     /protein_id="BAE60379.1"
                     /transl_table=1
                     /translation="MASCLPPETQERHSVFRLPFLSSNFIELFSSSLRLPANLKHLLL
                     NPPSSTQNGELVVTFTSSFNAIWNDAGSGTTRDGGFWHPITQGTLRPLGSMAVGNFKE
                     LNGQRAALLIGAKSTSSSNPPVKAPTSYTQLWADKGSGAKLNGSFWRPIAAPGYIAMG
                     DVVQSGYTTPSTSKVWCLRSDLVADGQYADESV"
     exon            381082..381663
                     /number=1
     CDS             complement(join(382671..383482,383559..383640))
                     /codon_start=1
                     /locus_tag="AO090012000160"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000159"
                     /protein_id="BAE60380.1"
                     /transl_table=1
                     /translation="MLRTLTRAYHGALGTSIRSAAPALSPLANIPYLQAPRLDSAHDQ
                     SHVGSVQRHLQDAGVLKISLNFDDNDSHYLTNLIHGLHKWHGHGLPITHSAHRGWYWD
                     IRPSQTVFQCPDHQARSETMNEFPWHTDCSYEASPPRFFALQVLHPDQCGGGTLSVLK
                     VDNLLKLLSESTRVALQKKDYLITVPPEFRKTDNKDESIIGSLLSPDPESGSLALRFR
                     EDIFTPLTGEAGLALEELKSVLLGPKAQAEVVNLTAEMMPRGSIIIMDNRRWLHGRNQ
                     VKDPRRHLKRVRWDARQFGLD"
     exon            complement(382671..383482)
                     /number=1
     exon            complement(383559..383640)
                     /number=2
     CDS             complement(384293..385189)
                     /codon_start=1
                     /locus_tag="AO090012000161"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000160"
                     /protein_id="BAE60381.1"
                     /transl_table=1
                     /translation="MTTISRPNSDALTENVSNKVAIITGAARGIGFATANLLARHGAR
                     VVLVDLHEDALKNAVEAIGLQATYKTCDVSDWNQQIALFQWVIDTIGPIELVVCNAAI
                     NPEISLLQTQDPSRQAQLNSQARYNYLADETKEGKLERPSTQLFDVNINSVVFGLKLA
                     IHHMKQRGAGGRIVVTGSAGSYVPVPSQPLYTASKHAVLGLVRSTALIEEVIRANIAI
                     SWIAPWLTLTSMVEGLEATTQPHTLKSSPEDVAWAIAAAVASPASWANAKGFWVQGTT
                     ITEVEGAYGEVGQRLIAPENRF"
     exon            complement(384293..385189)
                     /number=1
     CDS             join(386392..386401,387651..387746,387797..388186,
                     388221..388411)
                     /codon_start=1
                     /locus_tag="AO090012000162"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000161"
                     /protein_id="BAE60382.1"
                     /transl_table=1
                     /translation="MAASHFQHLPSGLSYNGFKPTVETLQANTDLPTLDHWHSRGGLT
                     GRGVLIDFKSYAAAKGIQYSPFSAFRISAADIEAVAVHQGTTFQKGDILIIRFGVTEA
                     LGQMNGDEQSAAMAPLRCCGIEGTEDMARWLWNRQFAAVASDNIAVEAMPPIIDGVER
                     PPTEFVANWVVLHQWCLSLLGMPLGELWDLKALADVCKKVGRYSFLLTSAPLNVPGAV
                     GSPPNALAIL"
     exon            386392..386401
                     /number=1
     exon            387651..387746
                     /number=2
     exon            387797..388186
                     /number=3
     exon            388221..388411
                     /number=4
     CDS             complement(388559..390253)
                     /codon_start=1
                     /locus_tag="AO090012000163"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000162"
                     /protein_id="BAE60383.1"
                     /transl_table=1
                     /translation="MTPNKLQPRSNEPLIRRLNLNRPKLFRNREVQACHQCRLRKVKC
                     DQTRPRCQNCQTHERTCVYSQTPRTPESHHGGDLVIRLNQQGHLNTTSESQARYYSSS
                     SWVVDVDGPNGSRPSAGPGIGPCAKSRETSAPPTLQGGLEFPDGQAHLFVQLAEVDRL
                     IHWYSNYCHLWYPIVDIPEVIISLENLRHNRSSPVGSLALIAAICFAAACSFNASGDL
                     KSLSPISASSAWKDLAVQLLSSNVYPRQPNLNTVRAAFLLALPSVADGRTHPDPGPVC
                     VLLRAAQSLGLHRDPSSFNLPPSEVDFRRVLWWCIHSLDVCYSVAHALPPLIHATATD
                     VQTMEQNGMSERKLIGTIIRVNSLISAIFQTVYGIRQPTGKDIQDLDEKATKICTDEI
                     STRTSLEMTAAEKFITMSQRMCCYKMLFILHQPYLRSTQWPQTSRQKALAACQNYIND
                     YLLGIADPELAPYRWILGHFDVTHACAIVLQDMIQHPGSVESVGMRSLVETCFFTFSS
                     DSHPDWAKLEALGSKAWAANGWPCPFQQDLSSLGADASLSDWDPLFASFIWENMLL"
     exon            complement(388559..390253)
                     /number=1
     CDS             complement(join(390793..390827,390893..391256))
                     /codon_start=1
                     /locus_tag="AO090012000164"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000163"
                     /protein_id="BAE60384.1"
                     /transl_table=1
                     /translation="MKFQSLCMSLFCAATLAAALPVEPSAESAPQPCIPAELAKVLTS
                     VPKDSPLYCKGDSQPEKRDGEPSIEECGDALKAYDAGEEDEASVGDLLDACEAAYGPP
                     GNKKRQAKEPSILSGTVGSVIGDVSRVAGR"
     exon            complement(390793..390827)
                     /number=1
     exon            complement(390893..391256)
                     /number=2
     CDS             complement(join(391829..391898,392097..392128,
                     392733..394163))
                     /codon_start=1
                     /locus_tag="AO090012000165"
                     /note="predicted flavoprotein involved in K+ transport"
                     /old_locus_tag="AO070343000164"
                     /protein_id="BAE60385.1"
                     /transl_table=1
                     /translation="MTRTDLIVDAVVIGGGFGGCNALYRLREMGLTTKLFEAGSGFGG
                     VWHWNGYPGARVDSEMPAYQFNIPAVYRDWHWSERFPGVEELRRYFEHVDRVLGLSKD
                     TYFNTIVSECRFDSASRLWIVHTSTGIRATCKYLIAATGSSYKKYFPEYPGLSQYKGQ
                     LVHSAAYPDNLDVTGKKVGIVGNGASGLQIVQELAKKDCELTVFIRTPCFALPMRQRN
                     ISPEESEMMKGYYDAIFDRCYKSVTGFPHNTKPQAASTASPEERKAIFDQLWQRGGYS
                     FLVSNYYDFLLNEEANSIFYDYWVQQVRARMTNQKKMDLVAPLKQTYLVGTKRPSLEQ
                     DYYEMIDRENVVLHDLKKAPIQEFDETGVITAEGHRDLDIVIFATGYDAVTGSLLDLG
                     IEDRNQVPLSEKWKDGTATHLGLMIPDAPNLFLVYGPQAPTSLANGPPFIEMEVDWIC
                     RAIAKMHDEGLASVVPTAKAAEQWKEEGPRDVDHPIWKHILCVCVCILKGTRTVIGID
                     IT"
     exon            complement(391829..391898)
                     /number=1
     exon            complement(392097..392128)
                     /number=2
     exon            complement(392733..394163)
                     /number=3
     CDS             join(394768..394816,394883..395256)
                     /codon_start=1
                     /locus_tag="AO090012000166"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000165"
                     /protein_id="BAE60386.1"
                     /transl_table=1
                     /translation="MACKVTGTAFITGAASGIGKATALKFAEQGITSLALVDVNLAQL
                     EGTRDELRNTFPHIETEIMQVDVTNEASVNEAIKKTVTRFGRIDIAVNSAGISGIPTK
                     THELSLQEWQKVIDINQTGLWLCQRGVIQQMLTQEWVS"
     exon            394768..394816
                     /number=1
     exon            394883..395256
                     /number=2
     CDS             complement(join(395636..395854,395872..396825))
                     /codon_start=1
                     /locus_tag="AO090012000167"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000166"
                     /protein_id="BAE60387.1"
                     /transl_table=1
                     /translation="MHRAVFHGLCAASAFSLYHLRGESKYQSLAVQHDQQALQHLRQN
                     LRPGNRLDETTLVAVLTCIAAEAMSGRRSRWRAHVLGGLGMLENELDGEWLQSPTAAR
                     LLQSYLSLSLLCNFRMSAQLVALLKELPNIQNYLERSHGVSRSLVQFLADISALRESP
                     GQTTVAELDNLELQLYLQFPSLHSQETPESIVIQHALNSFYYATLIYFRRSLRRVPVA
                     DVQDLVEKAVHDLEAAEALTHRKGGCAYNWASFVVAAECSRPDLQERMLVLFDRKRRH
                     GIKNIQSLGEIVTTLWQRRASAPGVDIHWEEIANEADYDIMLSVSRPVSYSVSAVHNQ
                     RRTTDKAAHWRGKIEDRVRNLFRIGGTTQWSFFELAVHCTAFNRRADDRCVHIPGP"
     exon            complement(395636..395854)
                     /number=1
     exon            complement(395872..396825)
                     /number=2
     CDS             complement(join(397134..397167,398150..399213,
                     399262..399702,399747..400035,400070..400259,
                     400307..400388))
                     /codon_start=1
                     /locus_tag="AO090012000168"
                     /note="protein required for meiotic chromosome
                     segregation"
                     /old_locus_tag="AO070343000167"
                     /protein_id="BAE60388.1"
                     /transl_table=1
                     /translation="MASQPHQKEVPHNNHVDYVIRYSFYDTDVNKASQQFELLLRRLS
                     EVGLQTEVREGDESSVLVFVRASRKKKLQRAVYQSRYGYHAPFPSVIIRDWLYGVRNT
                     EPEPESSAEPQSESERLRVIHHMITVPREAGGAGITLKHGEWENVIAIFPLHDEETNK
                     QCMRDWSKKTFLSNEDLDQIRNTFGESLSQVGFYFAFLQSYFRFLMFPAIFGFSCWLL
                     LGSFSVIYTVGNALWCIVFIEYWKHQEEDLSCRWQSKGVSVLREKRREFKPEREIRDE
                     TTGEIRGVYPATKRLQTQLLQVPFALVAAVALGVIIATCFAIEIFISEIYNGPLKTYL
                     VFIPTILLSALIPTMSTVLVSVATRLNDYENYETQGAYDVALTQKIFVINFITSYLPV
                     FLTAFVYVPFAHSIVPYLDIFHLTVRPFVSKKDAITTRAEFSIDPGRLKKQVIYFTVT
                     AQAVNFAQETIVPMLKQRGLQKYKEYKKRTGKVEPDSNTDEKKAPEVSFEDAPEEAQF
                     LKRVRNEAEMEDYDVTDDLREMCIQFGYLALFSPVWPLVPVSFLINNWVELRSDFFKI
                     CMECKRPSPQRADTIGPWLDSLGFLSWVGSITSAALVYMFSNGHEGPNGQPTSIKGWA
                     LLLTIFFCEHIYLLVRYAVRATIAKMEPPNVRQERAERYLLRKRFLESTLQSRSSDDE
                     TDEETTPYPFRSLRNAS"
     exon            complement(397134..397167)
                     /number=1
     exon            complement(398150..399213)
                     /number=2
     exon            complement(399262..399702)
                     /number=3
     exon            complement(399747..400035)
                     /number=4
     exon            complement(400070..400259)
                     /number=5
     exon            complement(400307..400388)
                     /number=6
     tRNA            400866..400951
                     /locus_tag="AO090012t00003"
                     /note="tRNAscan-SE"
                     /product="tRNA-Pro"
     tRNA            401935..402020
                     /locus_tag="AO090012t00004"
                     /note="tRNAscan-SE"
                     /product="tRNA-Pro"
     CDS             complement(join(402637..403001,403069..403189,
                     403243..403530))
                     /codon_start=1
                     /locus_tag="AO090012000169"
                     /note="formate/nitrite family of transporters"
                     /old_locus_tag="AO070343000168"
                     /protein_id="BAE60389.1"
                     /transl_table=1
                     /translation="MSQISLDAFTPAEVIEFVGRAGVAKGNMRLDKVFFSAVSAGCLL
                     AFACGTVLSTNTTPWFQENAPGLIRTISALVFPYGLCMIILTGADLCTGSFMFTTVAA
                     LQRRLPWYKMLIHWVVTFFGNLAGSLFVVAIIFGYGNVFSADPFKSQVIAFATKKQVT
                     PDFHMIFLRGIGCNWLVCLACFFGIQGRDLTSKIIGIWWPIFAFVSLGFDHVVANMTF
                     IPLAIWVGADKITVGLYIWKGIIPTLIGNILGGGLFCGE"
     exon            complement(402637..403001)
                     /number=1
     exon            complement(403069..403189)
                     /number=2
     exon            complement(403243..403530)
                     /number=3
     CDS             join(405288..406629,406680..406994,407055..407077)
                     /codon_start=1
                     /locus_tag="AO090012000170"
                     /note="putative multicopper oxidases"
                     /old_locus_tag="AO070343000169"
                     /protein_id="BAE60390.1"
                     /transl_table=1
                     /translation="MNTAFSSLCRTKSRYASVTTIRGARRLPPRLLSSPCSPLRGPFL
                     ARQISTESRKGTSGFQIKYVLLLSTAATLSWLLYARQHGAVWLDSDKSYFTHPDPLAP
                     NNGIHQQKTTNEIQDSQKETFKSLEAEDLPTEKAILTTAPNVPPPITRDYPVILDVDL
                     TAVAKLEQLTNQYKYEKWTFNNSVPGPFIRARVGDIVNLKITNHDESGMPHNIDCHAF
                     LGPGGGSALTTVNEGETKTARFRLQNPGLYIYHCAVGPVGVHIANGMYGLLYVQPEQD
                     LPPVDKEYYVMQSEFYHEPPEPDDNGQMSSTVEFSWPHALREAADVVVFNGSEAALTE
                     KPLKATLDDTVRIFFGNGGPNLTSSFHVIGTCFNKVYRDSDVLSPPGQCVQTVSVPPG
                     GSTIVDMKMVVPGTYTIVDHAIFRLEKGAKGFLNVSGEPRPMLYYSTLPPQPCEGFNL
                     KYKCLPNEVQQFVNLLNDISHIGTFFIGELNKSSTSQFTISIIVIPGQILELWTKYLS
                     KRSTHNFPGLWHISTDSSFVNTTLIHLSLSCVLAEQHVFQFYLWGSVAQGQ"
     exon            405288..406629
                     /number=1
     exon            406680..406994
                     /number=2
     exon            407055..407077
                     /number=3
     CDS             407479..408789
                     /codon_start=1
                     /locus_tag="AO090012000171"
                     /note="flavodoxin reductases (ferredoxin-NADPH
                     reductases) family 1"
                     /old_locus_tag="AO070343000170"
                     /protein_id="BAE60391.1"
                     /transl_table=1
                     /translation="MLAKTMFLSRVVPRLTPKALLLTRPFTTTTPKNKLTPQQIQIVK
                     STIPALQDHGVAITTLFYQRLLQQHPQLKNIFNTAHQATGEQPAALAHAVWAYATNIE
                     HPEALKTAISRIGHKHASLGITADQYPIVGEGLLAAIKEVLGDAANDQVLDAWKAAYG
                     ELAGYFIDFESGLYRQAEATPGGWKGWRKFFISKKVHEGEEIISFYLTPVDKGALPAY
                     KPGQFVSVKCFVPELGVYQPRQYSLSDVPNGEYFQISVKREFGLGQKPAGRISNVLHE
                     GLPVGAELDVSMPFGDFVLDVNATTPVVLISGGVGLTPMMSMLKTIVDQGGSRRVVFI
                     HAVRNGRVHAMKDRLAKIISENPQVQRAVFYEEVSKKDKQGVDYDFKGRADLHKIKDQ
                     VVLPDADYYICGPKLFMNAQSNSLKDMGVKEDRIHMEVFGSPAE"
     exon            407479..408789
                     /number=1
     CDS             complement(join(411720..411762,411830..414854,
                     414918..415335,416091..416120))
                     /codon_start=1
                     /locus_tag="AO090012000172"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000171"
                     /protein_id="BAE60392.1"
                     /transl_table=1
                     /translation="MRSTSYRCITRIRDAIDSRIAEEQARQKSAQDSLARSNSARRPT
                     RNASPSRRTTRPRRNTGTPVRGPDPNEFEPEFAIGEDEGSSRSATPRLESAGSEENAG
                     ESKPSAEEASAGKDNTNAPETNQSSSELPPEVRVKLRRLGKLESRYQELLKAYRMAHS
                     RVLSIEPFEAALRENTPLASISDPKALTEYLNQLSLKSDMVLEELKRVSTERDDYKKK
                     MEEAQKATKAAYDELTNLKENKKEEDASTISDKTAVDNSTLNDKSSTVSKQDSAKEES
                     EEFFSFDNEIPRLEAELKEKQEEIETLKSQAENLKRDLSVARESTEGMVHNLETATRE
                     LVELRDIKDKQDSEFEKLKTSKQEEIEALTAKLATSETTIQNAQNEVEKLKVELKQKT
                     DEIEHLQSQTAKPEDADEQSELAAKLDKAKQEKEANEKRLGVLQNLVDNLRSQLKDME
                     GTMTSLKADMNRKEELQNIVDFLDNNLKDNTTWKQAKEQVAGGKQANFEDFRDSLAPA
                     KNGTEVKNETPEPKPQPANSTGAAGASKKKNKKKKKGGKGGGDDTSKAASAPAVEETQ
                     TPAAEPEPKSSNTNELEQKIESLTRQVEEKDAAIDRLSSKLKGEEDLKEEIESLRDDL
                     LNLGQDHVESKDKLKELTAEKKALEETITKLEKELVDLRTSTATRDADSEKVHNDLKE
                     EYESLKVKLTTLETELSAAQQLASTRFKDLTDLRETLQKLQPELKKLRAESTELKSIR
                     ETLATKTAELRTLEGKQEDLRAELKTLKTTISERESEVKTLNQKIRQETDNRLKAEEK
                     LTVAQADLRYSESKKQEALETKERISNDLSKAQEDLKAARTQLREAQNQVTQVNKDLE
                     GLREEIQLKTAQHASAQSLMNSMRDQGAEIGMQMKEARERCESLEEELADAHKLLSER
                     TREGETMRRLLNDIEGRTESKVRDFKERMEAAIEERDRAEDEASAQGRRRARELEELK
                     NKVREAEKALRSAEEDKEELEMSQKDWKRRRDQLEEQAERSTQELNDVRQAMARLRDS
                     LDESEKQVRDLEKEKAELRRSVEETSARLDKLRRSNKALSEEARFGTNPQSSRSSIDS
                     GSRRALTSPVPKDRSPSIRGSETPTGGANAQAPIDYLYLKNVLLQFLEQKDKNYQKQL
                     IPVLGMLLHFDRTDEQKWMSAIMSR"
     exon            complement(411720..411762)
                     /number=1
     exon            complement(411830..414854)
                     /number=2
     exon            complement(414918..415335)
                     /number=3
     exon            complement(416091..416120)
                     /number=4
     CDS             join(416856..417223,417377..421353,423252..423343)
                     /codon_start=1
                     /locus_tag="AO090012000173"
                     /note="predicted esterase of the alpha-beta hydrolase
                     superfamily (Neuropathy target esterase), contains
                     cAMP-binding domains"
                     /old_locus_tag="AO070343000172"
                     /protein_id="BAE60393.1"
                     /transl_table=1
                     /translation="MATDGGPLAASSASLDSSLSPLHASPSPSSTYTASSLALSAPAI
                     AASFSVASTFSNSLIPPPPLPPPTPSTMAGWFGWVFSFFFQVIPSVLYWVITFATITL
                     PTWLFTLFSMSLTFTMNFTTLRLPSEPQRKEPHLDLFPDVQEGDSKPGLANYLDEFLS
                     AIKVFGYLERPVFHELTRTMQTRKLIAGETLMLEEEKGFCLVVDGLVQIFVKSMRDGK
                     PNVDEGSNHMGAESSDEDDHRVDGKQGYQLLTEVKNGASMSSLFSILSLFTEDIQLRA
                     SEGSSSSASSVGPSTNARVSDSFPASPHGLEDSPRSNFVRDHGDSVAHISNSNGELLP
                     SVPPLNLGESHAMPIQEPYPKPRSQPGKRRRKSVHPDIVARAMVDTTIAIIPASAFRR
                     LTRVYPRATAHIVQVILTRLQRVTFATAHSYLGLNNDVLGIEKQMTKFTTQDLPNEMR
                     GAALDRLKDKFIKERDRLGPEEIIKGIALHNPFAGRRRRSSSFLRKEAVLHAKMAAQS
                     KRPVSMASPEDISGDRESAGPSPGDLLSTIQLSRFGPRYEHLAPKLLSPLTDKENPPF
                     MAPVMHSSPFHRKKDAVDEDALFRESILDCIMNGIGLTSSTRDVLRKSSHTSGDISPK
                     LLSYDSRRQKAVFTNNAFGFIDPYDSSADGETESMMSMSMTSAGGTSPIVNLREELRN
                     DIEIVYFPQGSVLVEQGERHPGLYYVIDGFLDVGIPVSDKGEDLVGGSRPVYGQPPEE
                     FFPTLKRTTTSSSRVSGVTSATNDTKRKRQSRKSLYLIKPGGIQGYVGSVASYRSYTD
                     VVAKTDVYVGFLPRSSLERIAERYPIALLTLAKRLTSLLPRLLLHIDFALEWVQVSAG
                     QVIYHQGDESDAIYLVLNGRLRSVLEGTDGKITVVGEYGQGESVGELEVMTESTRPAT
                     LHAIRDTELAKFPRSLFNSLAQEHPGITIQVSKLIAQRMRDLVELPMPEKGGEHANVG
                     SVKTAASVVNLRTVGILPVTAGVPVVEFGHRLQNALHQIGVTNGVTSLNQAAILNHLG
                     RHAFSKMGKLKLSQYLADLEEKYGMVLYIADTNVNSPWTQTCITQADCILLVGLAESS
                     PSIGEYERFLLGMKTTARKELVLLHSERYCPPGLTRQWLKNRMWINGGHHHIQMGFRL
                     TPEPSHPQAKRLGAVLKQRVQVIQAEIQKYTSRRIRQTPLYSAQTPFKGDFHRLARRL
                     CGRSVGLVLGGGGARGIAQVGVIKALEEAGIPIDIIGGTSIGSFIGALYARDADVVPM
                     YGRAKKFAGRMASMWRFMLDLTYPTTSYTTGHEFNRGIFKTFGDSQIEDFWLEYYCNT
                     TNISKSRPEFHSSGYTWRYVRASMSLAGLIPPICDEGSMLLDGGYIDNLTVTHMKGLG
                     ADVIFAVDVGSIDDNTPQGYGDSLSGFWTVLNRWNPFSACPNPPTLSEIQARLAYVSS
                     IDNLERAKNTPGCPWNTMVDQNNGGEFVDRGHQQIDNLGYPP"
     exon            416856..417223
                     /number=1
     exon            417377..421353
                     /number=2
     exon            423252..423343
                     /number=3
     CDS             complement(join(424043..424175,424229..424351,
                     424410..424507))
                     /codon_start=1
                     /locus_tag="AO090012000174"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000173"
                     /protein_id="BAE60394.1"
                     /transl_table=1
                     /translation="MSVVFFLPAFVSPFMPTALGKFVLLIDVIFSYLWLTAFIFAAQD
                     YNRHDCRLNAPPGISCSKKRANEAFIFLTFIFTFFGMFLEVLGLWAYRRENVPVREKT
                     GGAHGGPADAPVATA"
     exon            complement(424043..424175)
                     /number=1
     exon            complement(424229..424351)
                     /number=2
     exon            complement(424410..424507)
                     /number=3
     CDS             complement(join(428096..428128,428193..428966,
                     429018..429958,430018..430338,430406..430601))
                     /codon_start=1
                     /locus_tag="AO090012000175"
                     /note="actin-related protein - Arp5p"
                     /old_locus_tag="AO070343000174"
                     /protein_id="BAE60395.1"
                     /transl_table=1
                     /translation="MTITSVQAVLPGRFAINSTEKSTAKPPPKVYNAQEPPFKGYHAP
                     QPDGYQRSRSKPDTSAIVIDNGSNLVKAGWSFDKNPRFILPPVMSRYRDRKLNKACQF
                     IGYDAYVDATTRGQLRYAFDPGSSVVGNWDVMEGVLDYLFLKLGVDGANGGVDRPIVM
                     TEPIANLNYPRKMMNEILFECYSAPSVAYGIDSLFSYRYNRGTDGLIISSSHTSTHVI
                     PVLNNKALLSNCSRLNWGGMHASEYLLKLMRLKYPTFPARMTESQMEDLVHKHCYVSK
                     DYDQELSKYLDWTGLEDRDLVVQYPFTEHVVPEKSEEELARIAERKKESGRRLQEQAA
                     KMRLEKLMKKEQELEYYKDLQNGLQTETKKEARRILEAEDLKDEAHLERIIRDLERSI
                     KRSRNRDLGVEESEEPAEEMSFPLLDVPDEELDEAGLKEKRHQRLMKSNVEARQRAKA
                     EKEREKARREEEERLDREKRENDFEGWLSERRTNRQNILQRIKERDRLKADLGNRKSL
                     ASQMRMKTLANLAADGPKKRRRGGDDDDFGANDEDWGVYRTVAGEQSDEEEEEDLGGM
                     LDVVEKELLEHDPEFTENHTLAAQSDWTKSLVHVFLRGPWPFDPESQREAHQLHLNVE
                     RIRVPEVVFKPSIAGVDQAGLVEIAADIVNQRFINPEDQSRLLRDVFMTGGNTLFQNF
                     DERFRNEFRAFLPLDAELNVRRAKDPVLDAWKGAAQWASGADLAKSSITRQEYLEKGS
                     EYLKEHDLGNVTTW"
     exon            complement(428096..428128)
                     /number=1
     exon            complement(428193..428966)
                     /number=2
     exon            complement(429018..429958)
                     /number=3
     exon            complement(430018..430338)
                     /number=4
     exon            complement(430406..430601)
                     /number=5
     CDS             431913..432479
                     /codon_start=1
                     /locus_tag="AO090012000176"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000175"
                     /protein_id="BAE60396.1"
                     /transl_table=1
                     /translation="MAPPTPAENESHQLLLNQLDIAQVPRPFRNPHWKPSQRRNKNVK
                     QLISESSRKEASQMATQANSGATTPLVATTSASTDGSQTPADGGQRTNIAQAAQNLST
                     LVLEKNARAMYSSGPAVTYTNIESAPSLHPSQQTRYCDITGLPAPYTDPKTRLRYHDK
                     EVFGVVRSLAQGVPESYLELRAAHVVLK"
     exon            431913..432479
                     /number=1
     CDS             complement(join(434198..434333,434463..434628,
                     434768..434945))
                     /codon_start=1
                     /locus_tag="AO090012000177"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000176"
                     /protein_id="BAE60397.1"
                     /transl_table=1
                     /translation="MRNVASFDKSKNGDNVDVNGNDNMDDNVEDNIDANIADNVDVSD
                     DKSVELNYLFLFYGIGVKRHCCHKSTSPNTILVLPEASSPRENPLALWPGMRTSGGNL
                     IQAFTVSFLNPAAQLSITPPSSQNLQPLLQIRPYNRNIARKLPNRDQEIAKEDKQPV"
     exon            complement(434198..434333)
                     /number=1
     exon            complement(434463..434628)
                     /number=2
     exon            complement(434768..434945)
                     /number=3
     CDS             complement(join(438603..438783,438885..438981,
                     439051..439189))
                     /codon_start=1
                     /locus_tag="AO090012000179"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000178"
                     /protein_id="BAE60398.1"
                     /transl_table=1
                     /translation="MHNDNERPKNIPPYTPMSSLGHELGVMFAFLAACFVIMGLYVFF
                     WRAFERREAQKEKARKERFTRRDVHHERSGIPEKIWCSGESSGLGGDGCPGCAAEVTI
                     PFPYSWDTLAPEVQRCLLRVGWLGWESLRTYKMDPF"
     exon            complement(438603..438783)
                     /number=1
     exon            complement(438885..438981)
                     /number=2
     exon            complement(439051..439189)
                     /number=3
     CDS             complement(440515..440958)
                     /codon_start=1
                     /locus_tag="AO090012000180"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000179"
                     /protein_id="BAE60399.1"
                     /transl_table=1
                     /translation="MKTSNILLCLAPAVALAAEADQVPAAVAPSPSLPNITPPVPLPN
                     IQNPQNGEDESKLPLEARQMVQIANAGAAKPPAAATTEEILTTTVMDQWPEPSSGSIG
                     LGTLTASAGVTKSLRARSEGTLGQTPWIGMAIGLTCTALAAVMLG"
     exon            complement(440515..440958)
                     /number=1
     CDS             complement(442440..444260)
                     /codon_start=1
                     /locus_tag="AO090012000181"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000180"
                     /protein_id="BAE60400.1"
                     /transl_table=1
                     /translation="MPPKAAPRRGASAAAANRRTNATEPSSNSATPAPGENASAGPSA
                     SRPPVQRLQSLKKRTPSGSIGPAAKTPAPGGPGEPAKPTLKYKPRAVGRRSKEEREAI
                     EKLEAERHRERLAEAAAIQRGRGNHGPGGRGGFGRGRGGQFGSASGPLGSMQGRRGRG
                     GGPGGFGSRFNDSRASSMSRRSRSVIDVGSGAISRDVSSDESDNEIRVSIDHINLDSS
                     DEEAEQVADKKKGKLAMKNAEASGEKGLRPIRVERHEHEERVVSVNMESSSSKSAELR
                     QQAQAKAAEDDALFVPDDDGSAGSATETETGPRVKQEPTDDDHTMADVAHHADEGLTT
                     DDGLLPEQTVKVRRKISREPPAVKDPKSLLRTKEDIEEYERHEQDLAMVKDLFTKEEK
                     PPAEEPKETPPEQVESAEDTETAADGAEKDKDQEKESEEEEDESAKDKLAGQLFLMQF
                     PPMTPNLVPENSGDNSAAPSIEARGQGTPEGTASNNGIAPQQTGVKREDGVEFLDEAD
                     EFQSTEPSKVVTATDRQLRAGRVGKLNVHASGRMTMDWGGISFELDRATAVDFLQEAL
                     IVSGAADPAEGGVPEEENRVWAMGQLSGKFTVTPDWEKML"
     exon            complement(442440..444260)
                     /number=1
     CDS             complement(join(446078..447319,447421..448200))
                     /codon_start=1
                     /locus_tag="AO090012000182"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000181"
                     /protein_id="BAE60401.1"
                     /transl_table=1
                     /translation="MQAVQYERHPAPGESPIWTDHAPQESPRKSPIPKNVAFELLLDE
                     NSKVRARIPMRVQIYPHDTTDSIVTTVKNFYGIYDGAASGVSFEDEHGTTLIARYENL
                     RNNMTVYVRVIPVQAYTEGYGDRYFGHMPVEARKRPSLGEPFQMAPAMQSAQIPDHGQ
                     PPSRPGSRLARKRSMSPSGRSRRSASQHKQLSRAGNKSRGSSTHGSFHDDGASLYSDS
                     EGGYGSVSGAKKSRSEQLGSSDISMDNILQDGRRKRPKFESSVPLTTSTSSISPQRRS
                     IGQEGAVSPFARPTQRPYSYQQPLPSPQSYGHNDQIYGYNSMRNNIYATPVAPEHGHR
                     LRERTTTQSSGQFSNPAGNGAGSGILPTPDPTIASCISDEDVAMQLIRLGDASNFSHG
                     RTSASTLDDAFSGAADAASSTGATSDGEDFSEEDDDLPARSRQRVDSSPMLPPGATKR
                     THKRLDDILPSFDSSDGSDGDEEYQQDDYQDSLIKNEADDDSLYRESAPKTKKAKTRA
                     NSASSSKARGTKSAHMRQHKINKSAPAAARKVKSMPAATSHKPVVPPQMASPAPTRKT
                     STSSINFQLAADEEDLSTKPRCQRCRKSKKGCDRQRPCGRCKDAGIGIDGCISEDEGN
                     GRKGRYGRHMGVPVKKAIEATSSVNGDTQPVVAASLTSVAIDKNKKRKR"
     exon            complement(446078..447319)
                     /number=1
     exon            complement(447421..448200)
                     /number=2
     CDS             join(452412..452423,452598..453710,453766..454305,
                     454359..454619)
                     /codon_start=1
                     /locus_tag="AO090012000183"
                     /note="cyclin B and related kinase-activating proteins"
                     /old_locus_tag="AO070343000182"
                     /protein_id="BAE60402.1"
                     /transl_table=1
                     /translation="MDAKPQRIRVRGDENAAFPLTSKTVHQKNKSTPALSTMFQNGVT
                     KNGPRRAAFGDVSNTVKTVQGIRDDISVAAKKQIKPLEKPSVQATERKSSVLAQPAQR
                     PMSVAGVKGLSSNVTTSKPLEPIGKSIGVPQHTANARKALNKRGTVFKDHMEPLTEKR
                     ELTSKETTQTKEGITGGQLAHSSTAPSQLSSLKEKDVVNEGSNDESETHDEHSIVSSE
                     VDGEEKDAPKLDEDVCKVQGIKELREASEPGTATDADGSDRAVKPQRVSVPGAHMSHE
                     HVPAHSEPEESWDDEDDENEEEDEYITARSYRSRGENTTGATTTILFPKYTQQVRREL
                     ALAKQIVEATRTVEDIEDEYWDTSMVAEYSEDIFDYMREQEIKMLPNAHYMDNQAEIQ
                     WSMRSVLMDWLVQVHHRFSLLPETLFLCVNYIDRFLSCKIVSLGKLQLVGATAIFIAA
                     KYEEINCPSVQEIVYMVDGGYTADEILKAERFMLTMLQFELGWPGPMSFLRKISKADD
                     YDLETRTLAKYFLEITIMDERFVGCPPSFTAAGAHCLARMMLRKGNWTPAHVHYAGYT
                     YSQLYPLISLMVECCEIPRKHHAAIYEKYTDKRFKRASLFVEAEMRKGFHLPEVTREK
                     SLCNPPSLDAGHQWKRA"
     exon            452412..452423
                     /number=1
     exon            452598..453710
                     /number=2
     exon            453766..454305
                     /number=3
     exon            454359..454619
                     /number=4
     CDS             complement(join(457031..457305,457408..460933,
                     461030..461275))
                     /codon_start=1
                     /locus_tag="AO090012000184"
                     /note="ATP-dependent RNA helicase A"
                     /old_locus_tag="AO070343000183"
                     /protein_id="BAE60403.1"
                     /transl_table=1
                     /translation="MGPKKKADARGGGPKPGTKQAKAAAEKTAAEAAKKAQPPPDEQK
                     KPSVKQVIGGASWTGKLPVNMLSEHCQKQKWEKPEYTMTKTQEGYMSAVILKRVDPKT
                     REATTLPPMKPPPSHKHLAAQPTALEARHFAAVYALYRVCNMRNIHMMLPPTYKKLWK
                     EDFADIKTADTKEGKGWMYEADPFLAKQERESAAADLEKKRKEREKNQAKAKDQPAVE
                     LGLGSSGDNRGKRIWSNAPKVDLGSKVRREIETLLQQHAIWNPYNVKIPESERNSIIE
                     EFTRLGFRRSHVDEATSACKDREEVLEWLLIYVPEDDLPSWCLPESYSAGVSLASDDL
                     AREAKIKRLATIGYSADLCSRALDSKQGDELATAEMLQHTLVYGTSSTAGAVSSEGDD
                     SWAEEQETLEAIFGERYIKVSPKVCEIKSESSDLPESTTFRFQRPSNHYPSSVPIISI
                     QAKGIPSYIRLSAIRQAVKHAEENFLGEPMVYNVLDWLEMHLPEIMQNPGKLRDIATV
                     AATPSTTGSILELPVRQSRKKSREISWQPGSPQSISVREAWQARQSTPAQQDMTRKRE
                     SLPAWNIQDAIVRAVNSHQVTIISGETGSGKSTQSVQFILDDMIRRDLGGIANIICTQ
                     PRRISALGLADRVSDERCTSVGDEVGYVIRGDSKVKSGATKITFVTTGVLLRRIQSGS
                     GADGNVAGSLADVTHIVVDEVHERSLDTDFLLALLRDVLRYRKDIKVILMSATLDAEI
                     FINYFGGRQNVGLVNIPGRTFPVSDFYLDDIIRDTGFSPELAERDFEEDSSPQGEESL
                     GKILRNMGMGINYELITSTVRYVDAQLGDQPGGILIFLPGTLEIERCLNAVKRIPNVH
                     PLPLHASLLPAEQRRVFLSPPKGKRKVIAATNVAETSITIEDVVAVIDTGRVKETSYD
                     PKDNMVRLQEVWASQAACKQRRGRAGRVRAGACYKLYTRQAENKMAPRPDPEIRRVPL
                     EQLCLSVKSMQGINDVATFLANTITPPESVAVEGALGFLHRVGALDHDKLTALGRYLS
                     MIPADLRCAKLMVYGSIFNCIDHCITISAILTVKSPFVSPRDKREDANAAKASFSRGD
                     GDLLTDLTAYQQWSERVKAQGYWQTQSWCSANFLSHQTLRDISSNKAQLLTSLKDAGL
                     LLVDYSSDSADPRWNRNAGNRSLLRALIAGAFQPQIAQISFPDKKFMSSVTGTVEVDP
                     DARTIKYFNQENGRVFIHPSSLLFSAQSYPGSAAYLSYFTKMATSKVFIRDLTPFNAY
                     SLLLFCGSIDLDTTGRGLIVDGWLRLRGWARIGVLVSRLRMMVDEIIAARIDNPASLS
                     IDRAGKDDITGRVIEVVKRLIELNGLDQ"
     exon            complement(457031..457305)
                     /number=1
     exon            complement(457408..460933)
                     /number=2
     exon            complement(461030..461275)
                     /number=3
     CDS             join(461562..461649,461716..462460,462567..462594)
                     /codon_start=1
                     /locus_tag="AO090012000185"
                     /note="predicted hydrolase (HIT family)"
                     /old_locus_tag="AO070343000184"
                     /protein_id="BAE60404.1"
                     /transl_table=1
                     /translation="MADDSPNLEDQAAAAATVAAESKSGKRDAFAELLAPKPKHAKYA
                     KDGPSKDTSNKRAIGGPRDGLGAYIAKPESFPSSIVVYHNDDFVAIHDLFPKSTLHLL
                     LLPRDSSKTRLHPFEAFEDPEFLKKVKEETKKLRSLAAAELRRRYGKSSAQDKARQEA
                     LSADPPPDELPQGRNWEQEIMCGIHAHPSMNHLHIHVISVDRYSDRLKHKKHYNSFST
                     PFFVPIDDFPLAQNDVRRHPTSEGYLRRDYTCWRCGRDFGNRFSELKIHLEKEFDEWK
                     RLDLWSQACW"
     exon            461562..461649
                     /number=1
     exon            461716..462460
                     /number=2
     exon            462567..462594
                     /number=3
     CDS             complement(join(462696..462981,463035..463446,
                     463543..463600,463872..463880))
                     /codon_start=1
                     /locus_tag="AO090012000186"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000185"
                     /protein_id="BAE60405.1"
                     /transl_table=1
                     /translation="MQRFPVIGFALCPSLDRWQSRGKETVAPKLALTAQATFPASEIF
                     GVKIVNGYPTQALVAFTNDEPAPVKVNFIGGTLSTLDEENSVIVRNLTATGYSVEIPA
                     GETETLSYQITTEMHPQDLRLSLASIISDNEGRFYTVYAYNGTVSVVEPETSFFDPQI
                     LFLYFFLLACFSGVVYFFYTVWVAPYFPQKRKSGKGAEYTKKTSGAAKKAETVEPSSP
                     AVSSATTYNADWIPAHHINRPEARKVKGNTRSKSRA"
     exon            complement(462696..462981)
                     /number=1
     exon            complement(463035..463446)
                     /number=2
     exon            complement(463543..463600)
                     /number=3
     exon            complement(463872..463880)
                     /number=4
     CDS             join(464768..464933,465091..465684,465952..465971)
                     /codon_start=1
                     /locus_tag="AO090012000187"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000186"
                     /protein_id="BAE60406.1"
                     /transl_table=1
                     /translation="MYVNVKGLSDLCVRGGVTTEPSLIEDFVRGFNASYPLFDLVDIG
                     AGKESAHDKIGDTLADRDLIGRVSLIEGLPFASDLDLIKASYRVTKFSDLFRDTKISV
                     WAPWKAAVASKPRALLTPSPVQHVTLSRTSTNTTTTSNSVPTSSSSTTTPNSGEFQVV
                     RSKSSVPPPPKIVERNKYGQRVDRLDFKTIPRDEVNRIKKLKLCNFYYLQGECPNDNC
                     HHDHSRKLTKTEYQVLTAIARMTPCRYGLECDDPECFGVLF"
     exon            464768..464933
                     /number=1
     exon            465091..465684
                     /number=2
     exon            465952..465971
                     /number=3
     CDS             complement(join(466168..466175,466264..466526,
                     466606..467909,467962..468231))
                     /codon_start=1
                     /locus_tag="AO090012000188"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000187"
                     /protein_id="BAE60407.1"
                     /transl_table=1
                     /translation="MANNSSSSTVIDIPAALRSQGNVNVIGVVVDVFQGVFKTANSLC
                     ITFTLKSDNLKNGHVWDGLKVKYFKANESQLPPVQEGDVVLLRNIWIRNYNGKPLGIA
                     GDRANVPWAIFRFDPDPLCANAPICGPTPFEPSYSEKRRCQSLLESISGLSEFRNSSA
                     LQVTAPQSFTTQVSCSPQDARTQRKLTAIKDIREGMLVDLIGEVIKLYPQNSEKALLY
                     LSDYTTNKKLQDHPSVDDDGDSFYRSRKKWAGPPGQMSLPVTLWEPHASFARENIKDN
                     DIISLKYVHIKANRHNLTIEASMHSARYNNVHLVDPEKNDYAKELLRRKNDYYRGINT
                     GKRKAEEDAKPTKGLKARNKKRLEGMKEESEATRQLKERNRPNEHGKAAALRVDGQIT
                     DRDTIVVKASYEGVRGRRIEDIVTSEFHEFESHDGVEYRLPFQNLCYKTTVRVVDFFP
                     PNIKDFAVPQQPKENHSGSRIYQDAEDDGVTRWEWRFCLLIEDALPPPPGQPKEQIKL
                     FVSDANAEFLLKMSATDLRKDPEQLAILRERLFILWGDLEERKKTITEESGQGPLKLD
                     RASSRPFTCCIQEYGVRCSHLSDADAISYDTSGCSREDCFGWERRFGS"
     exon            complement(466168..466175)
                     /number=1
     exon            complement(466264..466526)
                     /number=2
     exon            complement(466606..467909)
                     /number=3
     exon            complement(467962..468231)
                     /number=4
     CDS             join(468770..469009,469276..469785,469840..470751)
                     /codon_start=1
                     /locus_tag="AO090012000189"
                     /note="karyopherin (importin) alpha"
                     /old_locus_tag="AO070343000188"
                     /protein_id="BAE60408.1"
                     /transl_table=1
                     /translation="MAERYIPEHRRTQFKARNQFRPDELRRRREEQQVEIRKQKREEN
                     LAKRRGIQTRDGGIGVGGGMAAATESDDEATAIESELNVELPEMVKGVFSDQIESQIQ
                     ATTKFRKLLSKERNPPIERVIETGVVSRFVEFLRSPHTLVQFEAAWALTNIASGSAQQ
                     TQVVIEAGAVPIFVELLSSPEPDVREQAVWALGNIAGDSPQCRDFVLNAGALRPLLNL
                     INDGRKLSMLRNATWTLSNFCRGKTPQPDWNTIAPALPVLAKLIYMLDDEVLIDACWA
                     ISYLSDGANDKIQAVIEAGIPRRLVELLMHASTSVQTPALRSVGNIVTGDDVQTQVII
                     NCGALPALLSLLSSTKDGIRKEACWTISNVTAGNSSQIQAVVDAGIIPPLINLLANGD
                     FKTRKEACWAISNATSGGLQKPEQIRYLVSQGCIKPLCDLLACPDNKIIQVALDGLEN
                     ILKVGEMDKEAAQTGEARVNRYALFIEEAGGMEKIHDCQNNANEEIYMKAYNIIEKYF
                     SDEEEAGGDIDELAPQQTQTGFTLGTAQQQPGGFNFANGGDSMDM"
     exon            468770..469009
                     /number=1
     exon            469276..469785
                     /number=2
     exon            469840..470751
                     /number=3
     CDS             complement(join(472640..475779,475844..476336))
                     /codon_start=1
                     /locus_tag="AO090012000191"
                     /note="cohesin"
                     /old_locus_tag="AO070343000190"
                     /protein_id="BAE60409.1"
                     /transl_table=1
                     /translation="METEPPFSSPQPGPTQEASSPATNRRKSGRVTRKPALYAESYGA
                     NDSATAGSSKRKRAGGDDEEDVEEDADASEPEADESANEEPDEEELREKRRAARKASS
                     KKASVPKAKAKPRSAKKPKVASNGIGSQLAFRPATNGKKTVSSRPRKPIVRPSLAAGE
                     RGLYAEVFGKGRNADTTAAEWLSRYQREQSQALRDMVNFVLRCIGTDLEITQDHIEDV
                     DHAPDRVKDLQNQHQQEGFGEWPLISRSRKFRAFQPVLEEFFKSLIQTFHHSSVLYDD
                     QNLFENFEIWLSAMSTSHSRPFRHTSTVILLAVMCALCDIARELMTSVSTSRKQLETE
                     KKKKSVNQGRASAIEKAIEDGEKKLEIIDEYLKDGVNVVFVHRYRDVDPNIRAESMAA
                     LGQWIRSYREYFFEGQFLRYFGWMLSDTVAQTRLIVVNQLRSLYENKDNIAGMRSFTA
                     RFRERMVEMAARDADLGVRASAIELVDLIREAGLIEPSDIDTVGRLVFDSEPRIRKAA
                     GRFFVANVHDVYDSTVEEVRDEINEMFSEEDEDDFESPKRSWIKFKCLVDTLQSYDEP
                     ENEYKPDQPTTASKDMLSGTPVNTRFVLVTEAIYPYLKELSQWQSLAGYLLYDHSQIA
                     DSSSEDDTSGSIKQLYKMQEGQEVILLEVLCSAVKLRVLEVAKSDIDKRGRKVKALTD
                     KIPELQEEIAHNLAQIIPQLLNKFGSVPEAASAVLRLEHLVDLDKIQDLQKDATAYTS
                     LLNDINKQFLTHSDQDVLTEASVAFLHAKSSDDMREALENKISELWDDMIDTLSTLAR
                     KKEVLEGRSIPDSTLNQLTNTVMRISSLASVTDCTQTLEATPSRSKGKSKDTAETPFN
                     ILLHLTERGLRETEDDEESAKAETELVSSSIRTLLFYFMWKVQSLTTALSSGNASFNT
                     EYFEVLTKSRELFVSTLVAIMGARSGLDDIRFSATTTLLDLQTLFGTLRYAGQKASND
                     EDVILQTQGLVHEIAGEASKLIAKIHSVAERTYAKRLRFSYEPADDDEPISDSEAEKD
                     SDDESDAGSEAEMIATERLRSRIVAEQRLCELTGKIVLAIVGRVIDASGEERGQLKQR
                     LVRHKSDLGQNYREVVAFLDERKPKNPPRPKGKQLPTSTEPNRNQSSSSKRQDNAKSA
                     ERVDDDDDEEEEEEVQLNLEEDDDEDLRERGLVEDDNIEEDHDEEEEDENHSAANSDE
                     DEVMGD"
     exon            complement(472640..475779)
                     /number=1
     exon            complement(475844..476336)
                     /number=2
     CDS             477325..478413
                     /codon_start=1
                     /locus_tag="AO090012000193"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000192"
                     /protein_id="BAE60410.1"
                     /transl_table=1
                     /translation="MQITSRIMPIKSPFEASIAKPGQGNVVLSLLPPSNPTLTTLTYK
                     YPLKLLTRTPGYVPQSSALSCPASRPVHLYLLTYGGGLLPGDHIEVSIKLEQFTRMVV
                     TTPQGTTKIYKTEPSRSVKGRRAPGRVLSDKSRQTLDVRIEKGAAMCYLPDPAVPYKD
                     SRYEQVQTFTVDTTTKDSQRSSLCMLDWVTEGRKSRGENWDFHLWKGKNEVYSIDESG
                     KKKLLLRDSLILDEELDEGSLEDEHETLNRTGVIRERTRPHGIVGTLILYGPVFERLA
                     NFIMDRFTSQPRIGARNWSSSAPAAVEAPPNFDSKVTFTAARVRAGFVLVKFGADHFE
                     TAKDWLGSILREEGTVIDEFGEEALCCL"
     exon            477325..478413
                     /number=1
     CDS             complement(join(478848..479557,479703..479784))
                     /codon_start=1
                     /locus_tag="AO090012000194"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000193"
                     /protein_id="BAE60411.1"
                     /transl_table=1
                     /translation="MSFTQRLLAASSPVFCYTGGLYRRGSRHQSLQGVFDTDPSQSLI
                     LLIDFKTEGEATWNTVVEQLSPLRRRGYLTHFNGTDVVKGPVTVVGTGNTPFNMVAAN
                     TTYRDIFFDAPLEILAENYGMDNAGSQGSEDNIPGDEGVMTSRSNENVGQGLSGLSGD
                     EIGPGTFNWTNSYYASVSFRQSIGFPWLFHLSDRQIDKMKAQIRGAHQRGLKVRYWEL
                     PSWPRSLRNHIWTVLVREGVDILNVDDLQSATKQDWSPKFFDWWH"
     exon            complement(478848..479557)
                     /number=1
     exon            complement(479703..479784)
                     /number=2
     CDS             complement(479999..480403)
                     /codon_start=1
                     /locus_tag="AO090012000195"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000194"
                     /protein_id="BAE60412.1"
                     /transl_table=1
                     /translation="MSSPSRSPLVSNSTRIDTPHASNDTFDCYRDSEDVELKAGLKES
                     KLSVKEPVGDEGNELGLLSGSTRLEDLPAWRRGLAATSSFTAPKNTESDDDELPLLAN
                     SSHSPNYSPRQCRRPKLPRCVLFPLLGFFIML"
     exon            complement(479999..480403)
                     /number=1
     CDS             482428..483345
                     /codon_start=1
                     /locus_tag="AO090012000196"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000195"
                     /protein_id="BAE60413.1"
                     /transl_table=1
                     /translation="MIAKALPVRDPNSKNKKSKKNVKDNKPQDKLQARQKAATDDDTP
                     KAFRRLMQFQTQGKQAPSKPNTGESKKRKRGAENTDNAKQTTRKKSAPVAIVDQSTDV
                     EPQVKPKILPGEKLSDFAARVDREMPIAGMKRSGKPAKSDLADIREHKVTKHEKHLLR
                     LQSMWRKEEAEIQEREAAEREEREAELEDQLELWKEWEVEAGQGKAKKKGAGARKRGG
                     QGADNSDPWAKLKSKDRLNKPANPFEIAEAPPQLTKPREIFKVRGGAKVDVANVPTAV
                     GSLRKREELANERRTIVEEYRKLMAEKRR"
     exon            482428..483345
                     /number=1
     CDS             complement(join(483635..484186,484251..488708,
                     488764..489237))
                     /codon_start=1
                     /locus_tag="AO090012000197"
                     /note="rRNA processing protein Rrp5"
                     /old_locus_tag="AO070343000196"
                     /protein_id="BAE60414.1"
                     /transl_table=1
                     /translation="MAPIKRKGASAEEAASARQSQKRVRVGAEERKDQKKQKTGASGE
                     GKTKPDAGSGPKASELTVLRDDEPSFPRGGGSVLTPLERKQIQIQATKDVLFEQKATK
                     GSSKNDEHDEDAEMEDVDDTTATATKKSRKRKTKSKKSADEAQDKQGVRIEGLNFKRV
                     VPGTMVLGQVSSISAHDIGLSLPNNLTGYVPLTAVSKRLEEKIENLLNEDENAEEDDD
                     DDDDDEDSIDLSDYFYLGQYLRAYVVSVGNNAADASSKSRKRIELTVDPRQANFGLLK
                     SDLVDNTAVQASVVSVEDHGLVMDLGIEGADIKGFMSKKEIDPKTDYSTIKEGSVFLC
                     MVTGQNANGNVLKLSANLQSSGSIKKSHYLSTAPTINSFLPGTAAEILLTEVTSSGAT
                     GKIMGMLDTTVDLVQSGGNSSPDDLANKYKIGAKVKGRLISTFPASDPYKVGFSLLDH
                     VCKFTSETQGPGSSEDAPAISAIVPEAKVIKVDPGLGVYVQIGSTKHVGFVHVSKLAD
                     GQVESISAEYGPFRTDSTHEGRVVGYSALDNLYLLSFERSVIDQPFLRIEDVTIGAVV
                     KGKIEKLLIGPSGLDGLIVALADGITGLVPSMHFADTALQFPEKKFREGMTVSARILS
                     VNPEKRQIRLTLKKSLLNSESAIWKDYDSIVAGAQSPGTIVNLKPHGAVVQFYGSVRG
                     FLPVSEMSEAYIKDPSQHFRLGQVVNVHALSVDSSLEKLAVSCKDPSTFTETYKKAFE
                     SIHPGLLVTGTVFEKSSDDLLLKLDDYGLVARLNLDHVVDGSPSKQSSTLSKIRVGQK
                     LNELLVLDIQRTRRLIRVSGRASLKKAAKQGLIPASFEDVQEGAEVTGFVRNITMTGV
                     FVEFLGGVIGLVPKRLVGDENLNKPDFGLTKSQVVSATVHSVDPDFRRFILSRNPAEA
                     TQAGPKKPAAKSAVKSAPSDDIVTNAIDDSVNSMSDFSFGRVTKCKIVSVKATQINVQ
                     LADNIQGRIDVSEVFDSWEDIKDRKQPLRFFRPKQLISARILGVHDARSHKFLPISHR
                     TGKFPVFELSVKPSFLQAADPLPLNLEQVQVGSSWLGFINNIADNCLWVNLSPNVRGR
                     LRLMDASDDLSLLADVEKHFPIGSALRVNVSAVDIEKGRLDLSAKKGSETLSLDDITV
                     GMILPGRVTKVTERQVIMQLTDTIVGAVDMIDLTDDYSKANPTIYHKNEVLRACVISV
                     DKANKKISLSLRPSKVLSSSLPVQDPEITSMEQVKVNDVVRGFVRKVADNGLFVTLGH
                     GVTAYVRVSDLSDSYLKEWKDSFQVDQLVKGRVTVVDPEQGRLQICLKESVLDPNYKA
                     PVKLHDLKPGQIVTGKIRKVEEFGAFIVVDGSANISGLCHRSEMAENRVDDARTVYDE
                     GDAVKAKILKIDRKQGKISFGLKASYFKDEDENDVEGSDNDDEDDDSEGISLDGFGGV
                     DVDENDSDDDSDISMGGVDVEEDSESDSEQSDDESITKAPSNRQGGLGASGFDWSGNV
                     MDDDEKAASSDSDDEDESGRKKKKKHRKPEIQVDRTGELDANGPQSVADYERLLLGEP
                     DSSLLWLRYMAFQLELGEVEKAREIAERALRTITIGQDAEKLNIWVAMLNLENTYGND
                     DTIDEVFKRACQYNDTQEVYERLISIYIQSGKNEKADELFQTALKKKISQSPKFFLNY
                     ASFLFDNMAAPERGRALLPRALQSLPSHTHVETTSKFAQLEFRSEHGDVERGRTVFEG
                     LLSSFPKRIDLWNILLDLEIKNGDAEQVRRLFERVLGIRDSKKGVASVEASKKLRPKQ
                     ARFFFKKWLAFEEKLAAADGGNEKMVEDIKAKAADYVKSLQQE"
     exon            complement(483635..484186)
                     /number=1
     exon            complement(484251..488708)
                     /number=2
     exon            complement(488764..489237)
                     /number=3
     CDS             join(489610..490252,490305..491845)
                     /codon_start=1
                     /locus_tag="AO090012000198"
                     /note="WD40 repeat-containing protein L2DTL"
                     /old_locus_tag="AO070343000197"
                     /protein_id="BAE60415.1"
                     /transl_table=1
                     /translation="MVGSHDLPDVPRSEPVFPPPLQEFPSSPPSIVSDAGVRRKPKKP
                     PPVTPRSFKRFFTPRSMLNGGNNASDVRTNRQALKALSSPAVNRLGPAFTRTLKAVAT
                     RPEPSELLRTPSRKRKFSFSSIVSPLQSSPLRKVRMRTPIQDDEEVNVTVRDLEVNTE
                     IRMSEPKPHVIAKPLRQVSPIRRSQALQTSGQFFMRSVIGARASRVTIRSNSGADWQD
                     LTSAFYSRPSDSHACASSTGDRLALPFCTASCNSESIRLKTIPTSCTDGSIANTLVAV
                     GDEEGGIRLLDSAKNDKNGFSKAYLSFRPHMNAIMDLEFSSDDMLLATASGDQTALVI
                     DMTTQKPIYCLSNHVSSVKRVQFQPSANNKVLATCSRDGNVNIWDLRCKGFEKPSLQV
                     RCSLESDSEYAAAPVVPKMTYPQVLNTIHGAHAWMPQAPASEKLEPQIGRTDITVTSL
                     AFLPPGRENLFVTASEANACVRLWDLRTAHNNRRGRPVLPLSTTREPDSHIKYRRFGL
                     TSMTLGGDGSRLYTLCRDGTVYAYSTSHLILGHAPELSLNNDRPRRSGGSDKEGLGPL
                     YGFRHPRLQVASFYVRTAVRKATGDKPEMLAVGSSDQCAVLFPTDERFLYSAPKPAPE
                     VDLPRNPMHLTRSGLRRTNSGLSGKLEDTIPIYQSGTPLIEGHKKEVSAVSWTVDGEL
                     ITVSDDYSARCWREGSDDARDLRIGGEPERWRCGWAATRDSCDDE"
     exon            489610..490252
                     /number=1
     exon            490305..491845
                     /number=2
     CDS             complement(join(493030..493413,493475..494509,
                     494568..494672,494726..494811,494877..494924,
                     494987..495029))
                     /codon_start=1
                     /locus_tag="AO090012000199"
                     /note="chaperonin complex component, TCP-1 alpha subunit
                     (CCT1)"
                     /old_locus_tag="AO070343000198"
                     /protein_id="BAE60416.1"
                     /transl_table=1
                     /translation="MAGIFEQPRNADTLFLGGQKITGPDVREQNVLATQAIANVVKSS
                     FGPSGLDKMMVDDIGDVTVTNDGATILSLLDIEHPAGKILVDLAQQQDKEVGDGTTSV
                     VLIAAELLRRGNELMKNRIHPTTIINGYRLALREAVKYMNENITTKVETLGKDSLVNI
                     AKTSMSSKIIGSDADFFANMVVDAMLLVKTTNQRNEVKYPVKAVNLLKAHGKSGTESM
                     LVNGYALNCTVASQAMKTRITDAKIACLDMNLQKERMKLGVQITVDDPDQLEKIRERE
                     AGIVIERVEMILKSGANVIFTTKGIDDMVLKLFVERGAMAVRRCKKEDLRRIAKASGA
                     TLVSTLSDLNGDEKFEASYLGHAEEVVQERISDDECILVKGTKVHTSASIILRGANDF
                     SLDEMERSVHDSLCAVKRTLESGSIVPGGGAVETALHIYLEEFAVTVGSREQLAIGEF
                     AQSLLIVPKTLAVNAAKDSSELVAQLRVRHALSQRVQDGDANEEEKAIAKKKTYRNYG
                     LDLTKGRVHDTLKAGVLEPSMGKIKQLKSAVEACIAIMRIDTMIKLDPEVKEDDGHGH
                     "
     exon            complement(493030..493413)
                     /number=1
     exon            complement(493475..494509)
                     /number=2
     exon            complement(494568..494672)
                     /number=3
     exon            complement(494726..494811)
                     /number=4
     exon            complement(494877..494924)
                     /number=5
     exon            complement(494987..495029)
                     /number=6
     CDS             join(495265..495639,495670..495890,495942..497197,
                     497269..497279)
                     /codon_start=1
                     /locus_tag="AO090012000200"
                     /note="Prolyl-tRNA synthetase"
                     /old_locus_tag="AO070343000199"
                     /protein_id="BAE60417.1"
                     /transl_table=1
                     /translation="MASQAPADTPVASDAAVTQTLPDRTKNPADKDAPQGDVSKNAAK
                     KAAKAAEFAAKKAEKAANKAAGKQEPKKPAAAKAPKKKIDGAALIGIDVSKEEDFPGW
                     YQQVLTKGDMLDYYDVSGCFILKSFRADMTQPASYFIWEEIQDWFNARIKKIGVKNCS
                     FPLFVSEDVLNREKDHIEGFAAEVAWVTHAYDSSRPSYIGSSPLEKKIAIRPTSETVM
                     YPYYSKWIRSHRDLPLKLNQWNSVVRWEFKNPQPFLRTREFLWQEGHTAHLTKDGAHD
                     EVMHILDLYAQIYEELLAVPVVKGQKTEKEKFAGGLYTTTVEGYIPATGRGIQGGTSH
                     GLGQNFSKMFNITVEDPSTKPDEKKPPLHVWQNSWGLSTRTLGVMVMIHSDNRGLVLP
                     PRVADTQTVIVPVGITAKTSDEEREKLYAEIDGLINILTGAGVRAISDKREGYSPGWK
                     FNDWELRGVPLRIEFGPGESVGQFVTAARRDIPGKDGKSSIQISELSTAVPALLEQIQ
                     KDLYSRAEETFRTHRKLITNWDDFTPALNDKNICVIPHCLTEECEDQIKDMSARKAEE
                     DSGVPEDAKAPSMGAKSLCIPFEQPEGIVAGETKCVNPKCTRLAEKWCMFGRSY"
     exon            495265..495639
                     /number=1
     exon            495670..495890
                     /number=2
     exon            495942..497197
                     /number=3
     exon            497269..497279
                     /number=4
     CDS             complement(498098..500236)
                     /codon_start=1
                     /locus_tag="AO090012000201"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000200"
                     /protein_id="BAE60418.1"
                     /transl_table=1
                     /translation="MVALKRFFQAEKSQSVHSKDGATRTSNTPESDLSSNPSPSQFLE
                     PDHPFQRIEKQFEVLHDQLQARPLSPCSPAPPSRASTRTTTRDPRHVDLLEALFSSHR
                     YHIQSAQTLSPISPYNEDIAERNMTRFLQGQSGKSGKPTMYSRILSALYQEDVADRNI
                     ARNRRGGRPSSRNTSSRSRGNSFQRNSQSHQDEARCRPRSKAGSSLARSMSQEAPRST
                     TPPRADQSTTPRQNVSPATEGPLRQQRSVPNISAEPTNSPQGEADSKSGGFLRVPPPY
                     KQGDTWSSTPLPDSPTLPLMVTGDTKTVESHSTPDLPPIRSSRSRSSSATSNSHNQSN
                     ATKSKHRKNVRDLSIDTELAARGKPSAKITHRAIQPPTPSSFGMKQNPSIAEVMNSLL
                     PAGSPISPSPGLQSDQKIAEIMDMFRQAYTSSPVISPHPTYETLQDAIIREINSHEAF
                     QRVPLPEPGPPFTPSFSQEAFYPEIDIPKTEGPSSNRTMSLRDGQISKLIRRGSFKKH
                     RRGSDARRSISTTSVPSKVFWKSSETTSRRRHTDAPPPSPGFFSTLEQNQAPKEPVTY
                     MDLISKARKSPANIPTPDMARNLGNPQPPATVSLESVNPAPSVFHMRAQASASTINSF
                     SADDSDEEVIELPSVGIPQLQIHGVDENNVTYVAENTSPRNAFRLMSWPQRSGRSVSL
                     RGNWFTNETSNSPSRSSSRGGLTTRSVASC"
     exon            complement(498098..500236)
                     /number=1
     CDS             complement(join(505152..505987,506052..506190))
                     /codon_start=1
                     /locus_tag="AO090012000203"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000202"
                     /protein_id="BAE60419.1"
                     /transl_table=1
                     /translation="MTDRRRINGPPSGTRPAVFASSLNSASDIATGRPQRQRQPNELR
                     KIFLKTGLIPSASGSAYLEYEPSASLAAARSSPKSLIPPSSALKLACTVHGPKPLPRS
                     ATFSPNLVLTTHIKYAPFAARKRKGHIRDASERDLGVHLETALRGVIVAERWPKSGLD
                     ITITILEAEDDRWWGDAPDSHDAPWGMMNVLAGCITAASAAISDARIDCLDLIAGGVA
                     AIVADESEDGEAKPKLMLDTDPAEHKAILSACVVAYMPSRDEITEIWLKGDSSKALLG
                     PDDKRSGHEALLDGAVDAARGAHSVLAEAVRESAERFAGLAPGGGATQ"
     exon            complement(505152..505987)
                     /number=1
     exon            complement(506052..506190)
                     /number=2
     CDS             complement(join(507872..507928,507990..508080,
                     508142..510728,510860..511040))
                     /codon_start=1
                     /locus_tag="AO090012000204"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000203"
                     /protein_id="BAE60420.1"
                     /transl_table=1
                     /translation="MDRGLSTSTRIDDEGLRERNVASQSTSTLSPEALTATGDVELKD
                     KTGKDCKTFGRTPDGTVFTVPQTHDMVSQLLSPSEPKNLSDVIVLAILGAHILLLWQL
                     PTGAKVPVFAIIYLFWRAAYNAGIGWLLHNQSHHKTLVRWAEKTKVFVNPATGKNPHP
                     NVYNFFKRELETKIPHDYSFDEAPIEYNTWLVFRRLVDLILMCDFVSYCLFAIACSHH
                     PVNESVLMTVLRWSAGIVLVLFNLWVKLDAHRVVKDFAWYWGDFFYLIDQELTFDGVF
                     EMAPHPMYSVGYAGYYGISLMAASYKVLFISIIAHAAQFAFLVLVENPHIDKTYNPPP
                     SRKRSAEQETGSVSSRTADSPIAPTPIDEQIPHAPTFSSSPPQSVHELLGLHNLDLYR
                     ITDTSSVLIQFLVFALTVLTPSTPWYQFLFVANAAVWRLWFSIGVGYMLHRQSNHKAW
                     TRHFVKYGETPQEAWNQWKGTYHLSMIMCYASFIAAVWKMYNFPADWGYGLVLLRHVL
                     GAGLISLQIWTSVSIYESLGEFGWFYGDFFFDGSSKLTYNGIYRFLNNPERVLGLAGV
                     WGAVLITSSGAITFLALLSHILSLAFIQFIERPHMQKLYGQSLRQDAGLVKSLKKSLP
                     PTLRQLHGSVDKIFDESFEFIEEIIETARPKLANGVNTFVKDTTALFQSYPARVTISR
                     IDEDLAGYDSRDYSLEVEGTDSSSLAEHDQSTGREGANARMPLDRRGDLKNLVFEYGA
                     PIRVKWTAPLNHSKKDWIGLYKVTDNTSREVTRVSSQGRWIAVNEGAYDNLTCEKGIV
                     KSDVVIKATQQQDGDKRDLATGEVIFSGDKLFWTQGVFEFRYHHNAKHNVMAISRPFE
                     IRIGRYEEEDDHELTQASVEKSLLPVIRSCFDRDPEIAPEAVDEPFGSLVERDGKFAK
                     RVVFAVHQMFGVEFAPGVVQADGTVRNLAWRVCNAKRVLAPYSMSRNGASTPTERKE"
     exon            complement(507872..507928)
                     /number=1
     exon            complement(507990..508080)
                     /number=2
     exon            complement(508142..510728)
                     /number=3
     exon            complement(510860..511040)
                     /number=4
     CDS             complement(join(513933..514660,514738..515002))
                     /codon_start=1
                     /locus_tag="AO090012000205"
                     /note="porphobilinogen deaminase"
                     /old_locus_tag="AO070343000204"
                     /protein_id="BAE60421.1"
                     /transl_table=1
                     /translation="METSPTPQPPLRIGTRRSNLAMVQAEGIRNCLQKIAPDRSFEIE
                     ALRTLGDRDQLTALYNFGAKSLWTTELEEKLNAGELDVIVHCLKDMPTSLPDSCELAA
                     IPPRDDPRDALIVKAGLPYTSLKSLPEGAVVGTSSVRRSAQLRRLYPHLRFANLRGNV
                     ETRLAKVDNSDSEYTCMVMSAAGLERVGLEHRISQYLGSKDGGILHAVGQGALGLEIR
                     KGDRKMQELLGQLADQQSTLACLAERSLMRTLEGGCSAPIGVETEWISAGALSIHAIV
                     VSLDGTKSVEDTIVSNVKTVEEATALGKELAARLVKAGAGEILNNINANRPPKN"
     exon            complement(513933..514660)
                     /number=1
     exon            complement(514738..515002)
                     /number=2
     CDS             join(516166..516222,516284..516622)
                     /codon_start=1
                     /locus_tag="AO090012000206"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000205"
                     /protein_id="BAE60422.1"
                     /transl_table=1
                     /translation="MGKRSRYVEGDLWTRIGQELNDGAMFPDSSSNKEDDEEVASDTQ
                     VGYKASALALRLSPQTPSIESYYPTKQHFRILWPIYLSNIRPVTMILHAPSEGEKLTK
                     AVEGHGNTSRIAVTDVRNFDVCPHVCHGC"
     exon            516166..516222
                     /number=1
     exon            516284..516622
                     /number=2
     CDS             join(522400..522430,522492..523438)
                     /codon_start=1
                     /locus_tag="AO090012000208"
                     /note="predicted ATPase, nucleotide-binding"
                     /old_locus_tag="AO070343000207"
                     /protein_id="BAE60423.1"
                     /transl_table=1
                     /translation="MSPSLVAPEPEHCPGPESEQAGQGDACAGCPNQQICASTPKGPD
                     PDIPIIRERLSQVRHKILVLSGKGGVGKSTFSSLLAHAFSANPDSMVGLMDTDITGPS
                     IPKLMGVESETIHVSNAGWSPVWVTDNLGAMSVQFMLPNRDDAVIWRGPKKNGLIKQF
                     LKDVDWGELDYLIIDTPPGTSDEHLSVNSLLKDSGVDGAVVVTTPQEVSLLDVRKEID
                     FCRKAGIRVLGLVENMSGFVCKNCNTESQIFRATTGGGKRLAKKMGIPFLGAVPLDPR
                     IGMACDYGESFVDGFPDSPAAKAIKQVVRAVGQLVGEDPDTVLPDDTAE"
     exon            522400..522430
                     /number=1
     exon            522492..523438
                     /number=2
     CDS             join(525212..525597,525656..526419,526475..526602)
                     /codon_start=1
                     /locus_tag="AO090012000209"
                     /note="aspartyl protease"
                     /old_locus_tag="AO070343000208"
                     /protein_id="BAE60424.1"
                     /transl_table=1
                     /translation="MRFLLSFLITLSIACGVLSLPSGSKSQLKGRSFKVERVRRGNEP
                     VHGPTALRRAYEKFGIVPTDLGIDLDDFEPIMTKHAVVEKKDVTEPDQKGAVSASSVL
                     GDAAFVSPVIIGGQKVVLNFDTGSADFWVMNTELPAEAQKGRTVYNPSNSSTFKKMEG
                     ATFNISYGDASYAYGGVGTDTVNVGGAIVKDQAIGIPDTVSSAFIEDTTSNGLVGLGF
                     SSLNTVKPKQQKTFFDNIADSLQEPVMTASLKANGVGEYEFGILDHDKYQGDIANVSV
                     DSSKGFWQFELAKFAVADGDIQTIKENPTAIADTGTSLMLLSQEVVDAYYAKIEGAIY
                     ASSASGYIYPCNASLPSISVAIGSNHLATVPGNLINFSEVGINKTTGGKVCFGGVQSN
                     QGSSMQILGDVFLKAFFVVFDLRGPSLGVASPK"
     exon            525212..525597
                     /number=1
     exon            525656..526419
                     /number=2
     exon            526475..526602
                     /number=3
     CDS             527298..528617
                     /codon_start=1
                     /locus_tag="AO090012000210"
                     /note="tRNA-binding protein"
                     /old_locus_tag="AO070343000209"
                     /protein_id="BAE60425.1"
                     /transl_table=1
                     /translation="MAINSAPESSLLSLIYRSYPTAVSPDATETDLLTVSPKIFPQTT
                     FSAPEEADIKQWLGTISGLQAALTKDEKPVITTILGQLNGHLATRTTILGSKPSVADI
                     AAYALLAPVVEKWSPEERTGEQGYHHIVRYIDFVQNSRLFALRIPEEEKIAIDVNDVR
                     FVPKPVDAKEEKERKKKEKAAAQNAGAPAESKPLVVGKGKPEAPKEGAAPAAEGKPKE
                     KKEKKEKQPKAKPAPAPAAPPSPCAIDLRVGHILRAINHPNADSLYVSTIDCGDAPGT
                     DNTSLDEATGKTVRTVCSGLNGLIPLEEMQGRKIVAVCNLKPVTMRGIKSAAMVLAAS
                     PRVAEGEDSHAGPVELVSPPADAPAGSRVYFEGWNDAEPEKVLNPKKKVWETYQPGFT
                     TTDDLEVAFEASAVPAVQGQEGKPALGKLVTQGGVCTVKSLKGATVR"
     exon            527298..528617
                     /number=1
     CDS             join(528966..529001,529257..529290,529378..529626,
                     529706..529792,529854..530383)
                     /codon_start=1
                     /locus_tag="AO090012000211"
                     /note="threonine dehydrogenase and related Zn-dependent
                     dehydrogenases"
                     /old_locus_tag="AO070343000210"
                     /protein_id="BAE60426.1"
                     /transl_table=1
                     /translation="MFASPTPGSFPPIRPSFVGICGSDLHEYLSGPSTVPETPHPITN
                     ATLPVTLGHEFSGTIEEVGADVTRVKVGDRVAVKPNLYDGTCARCVQGRVNCCRNLGF
                     IGYSSNAGGLSDHVVVDEERARLLPEEIPLDIGALVEPLTVAWHAVTRSPVATARTAL
                     VVGGGPIGLAVVQVLQAHGVESIVVAEVSAQRRRFAATLGATDVLDPRAEDIEAKVRS
                     LSGDAGADIAFECSGVQAGFDSALKGVRARGTVTVVSLWEEKPVIDAWELVGSEKHII
                     GSAIFDGDDFEAVIDAIASGMWAVLPCLLFRVSFG"
     exon            528966..529001
                     /number=1
     exon            529257..529290
                     /number=2
     exon            529378..529626
                     /number=3
     exon            529706..529792
                     /number=4
     exon            529854..530383
                     /number=5
     CDS             join(532711..533340,533407..533802)
                     /codon_start=1
                     /locus_tag="AO090012000212"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000211"
                     /protein_id="BAE60427.1"
                     /transl_table=1
                     /translation="MATPLSGTAIITGGNGSLGSSIAIAIAKAHPFVHLLLLARDIRS
                     DSVKELRDKIRLIGPRSIEVARVDLTSFNSVVSFTENTVERVQNKEIPPVTLLVNCAA
                     VASYVADQVTRDGFDPVYQTNCIAPFLLTIGLLEAFRAGDGTPNGGARVINVGCSSMS
                     KGSLDYFDKHDFGNQQPGTPLSSKEGNARFGSSKLIMSAAMYALRRSLVLKGKIPLNI
                     YTLDPGGLTGESHLTENAPRSVRMAHQTRSGLRPFLRVFSKSAMNNPSVPAKIITKVA
                     FQRDTVEQWGRERYYILDNDYEAGSVLPVLRDPRKMEALLKKLMGQIEIGVKGMGSPQ
                     SRISRIN"
     exon            532711..533340
                     /number=1
     exon            533407..533802
                     /number=2
     CDS             join(533805..533812,534717..535399,535455..535774,
                     535826..536248)
                     /codon_start=1
                     /locus_tag="AO090012000213"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000212"
                     /protein_id="BAE60428.1"
                     /transl_table=1
                     /translation="MGDFQPRSQPALRRRRQLIQRLFLIGSVSLLLLVLIFPSWRATI
                     LPVVSLGLLSSTEDLQLQTVRYYDLSAVQGTADGWEKEERVLMCTPLRDASSHLPMFF
                     SHLRNLTYPHHLIDLAFLVSDSKDNTLEMLSSMLGELQADSDPHMPFGEISVIHKDFG
                     QKVTQDVESRHGFAAQAGRRKLMAQARNWLLSATLRPTHSWVYWRDADVETAPFTIIE
                     DLMRHDKDVIVPNVWRPLPDWLGGEQPYDLNSWQESETALALAETLDEDAVIVEGYAE
                     YATWRPHLAYLRDPYGDPDMEMELDGVGGVSILAKAKVFRAGVHFPAFSFEKHAETEA
                     FGKMAKRMGFSVVGLPHYTIWHLYEPSVDDLRHMEEMEQERKAREKEEKEQAERSERV
                     NTLFQDAKTESEIDNAFVRDDMETKGKEQKASEDSKKPEAESVEEMKADKSSKAPEQE
                     EQKAPEPLKNKNLKDAEEVSAVKPAKE"
     exon            533805..533812
                     /number=1
     exon            534717..535399
                     /number=2
     exon            535455..535774
                     /number=3
     exon            535826..536248
                     /number=4
     CDS             537023..537472
                     /codon_start=1
                     /locus_tag="AO090012000214"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000213"
                     /protein_id="BAE60429.1"
                     /transl_table=1
                     /translation="MAFQPLKRSHNLYKSVLQFHRPRRCIANSPTSLCYQEPYRFTSF
                     SSYNPFRPFSISAQRFNSKATVHIDTLGGESIDEAKLQSFNRKVGDYVKQDDVLAVIE
                     TEKVALEVYAPETGVIQQVFVEEGDTVTIGQAIAEITIKSKPGDGKE"
     exon            537023..537472
                     /number=1
     tRNA            537929..538011
                     /locus_tag="AO090012t00005"
                     /note="tRNAscan-SE"
                     /product="tRNA-Arg"
     tRNA            538107..538189
                     /locus_tag="AO090012t00006"
                     /note="tRNAscan-SE"
                     /product="tRNA-Arg"
     CDS             join(538784..538902,538982..539697,539765..539931,
                     540019..540186)
                     /codon_start=1
                     /locus_tag="AO090012000216"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000215"
                     /protein_id="BAE60430.1"
                     /transl_table=1
                     /translation="MSTQSASSILFTHSSRQQGFKLLELPAELADLLTSKEAPTLELK
                     SSLPQQPTTITTDPENREYVNLCTPTKTYLVRQVQSSNSIHIIRPSDSGVQRGDINIV
                     GGDEDDGLNLVETMTAIAKCGSTLELHTPPEGFSAVPVLERILPVYDEVEGAEQQVEV
                     EERGDLIRRVFADVPVSRAQCEAGWIELCAFVLGCGGGGEDVAGWCRRPSAKVKLDVW
                     RRVVEGAVLQGIDLGKQFLVQDLWRSVLDEGEEPFPRALFEGVVRRVCEVGDGRLFED
                     LKWASIDRACCTQWVGETYLEAMAPTTASSIGRSEFLNAWKDLLPESWRDDVAFSKLT
                     ENSYKHPDPTTICFVYRTDRQKIKKNVSTDASSATAAKKTRNWHELFKDQKRQKR"
     exon            538784..538902
                     /number=1
     exon            538982..539697
                     /number=2
     exon            539765..539931
                     /number=3
     exon            540019..540186
                     /number=4
     CDS             complement(540304..541488)
                     /codon_start=1
                     /locus_tag="AO090012000217"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000216"
                     /protein_id="BAE60431.1"
                     /transl_table=1
                     /translation="MIAADNSYLDNTALPLGESPELILVQATPEERIAAIKLNSPAWK
                     GPLDLDAYIARENHLAQQALTKDGLTSWLLVVRGQPEGERTILSSCETYKKKAVLAQN
                     GKVEHVSALSIGSVFSRPEFRGKGYAKRMMQELVKKIDACQTELKATNRVPFSLLYSD
                     IGKKFYAQFGWRPYPSTHFSLPPLPKDEYDRAIVRGNLPKARTLVAEDVHRFMCNDDV
                     VQKELDILRVASQKSASAKVAVVPDFDHFKWHWAREEYYAKILFKDRAPPLIKGAGDE
                     QSKVYCAWNRNFGETAEENTLYILRWVYDEPTSPEETEKTAKAMAAIIRRAQLEAHAW
                     NMSKVQFWNPTPVLERAVAILDPTAQVVHREQDSVACLRWSGAEQNKDVEWIWNEKYA
                     WC"
     exon            complement(540304..541488)
                     /number=1
     CDS             join(542965..543602,543655..543931)
                     /codon_start=1
                     /locus_tag="AO090012000218"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000217"
                     /protein_id="BAE60432.1"
                     /transl_table=1
                     /translation="MDGDPMGFGFPWDQNVDDLRVPFGDERLLLGEIHHMHWGLDGQN
                     DDLGFQWNEPSLPAARPAKKMRSHCPSAAVETAGLINESLPIGLDDVPTPSRHPTNPA
                     LTVLDDPIPTPTTDPALLPQILEIFPDISHQYVEELIAQHKDTMSANGGDTPFAAFGL
                     FLVKETIIEEILENPSYPKQEKLKRKTEEVDEDDDHWIKPRALHDAHDYRKQACDILA
                     QEFLWISIPHIRQLISSKKGLYSAYITLHHEYIYPGTQSPHLRLKRPRPSLKSSMTWD
                     HDLISELNAAKRRAAKDAGKRYFRHITT"
     exon            542965..543602
                     /number=1
     exon            543655..543931
                     /number=2
     CDS             544073..545296
                     /codon_start=1
                     /locus_tag="AO090012000219"
                     /note="predicted E3 ubiquitin ligase"
                     /old_locus_tag="AO070343000218"
                     /protein_id="BAE60433.1"
                     /transl_table=1
                     /translation="MVPCEGGTVHLFCFRCIRKTAETQIGMMKYELQCLDMSECKAKF
                     ARGNLKKALGSSLMGKLDHLQQQHEVEQAGLEGLESCPFCDFKGICPPVEEDREFRCC
                     NPSCETVSCRLCKDKSHIPKTCDEARTEKGLPARHIVEEAMSEALIRNCPKCNVKIIK
                     ETGCNKMICSRCKCVMCYLCKKDISREQYNHFAKPPTYCDTHDDRQSKRFEIEVEQAQ
                     KAAIDKVLKENPDLMEKDLQIGPERKDIKTHPKPKPRRTQPGLRPTGWYTQEPMPNQR
                     QNILPQLGYQRTAAFPNLPQFVPFAPAFVVPGMPYAGPQFPLPAFEPHLNPHAATIID
                     ASPQGFNGSTPPPQNNFLPDPFPLTTNTGNAKGKGNLPSQPKYPALGNYDIPRTLPGQ
                     NANMPLWLDGPFNNF"
     exon            544073..545296
                     /number=1
     CDS             complement(546025..547371)
                     /codon_start=1
                     /locus_tag="AO090012000220"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000219"
                     /protein_id="BAE60434.1"
                     /transl_table=1
                     /translation="MDQLSTDTSSMATEIPMDADEALKGFYRDNFDIIFIRLQWQDYS
                     GVMRALVLPIEETFSILEEEKQPFHVPPLLSNCSVTNQYLPDASARHVQWLVPDWSSI
                     RRASDPKSAIVMCGVVGTTISKPVPNGDLCPRRALVDVVRQARESWGLRFLVGFEVEF
                     QVMKVSSTGEYVKHSQGPGNFSVSGLRDPCYKYVQQCVQQLLDLGVHIHGIHSEGKRG
                     QYEIALKPLPPLQAVDQLHFVHDYLKDTFAQHGYMATMAPKPIISDPHTIGQHMHISL
                     QPADSYHEASFLAGILKRLPMICAFSLPHTLSYERRLPFLAGETVCWGTEARIAPIRK
                     IETSHWEIRCIDATANMYLTLAAILGAGLLGLAGQEPLLWPDLGDFTTESKTWEEPLP
                     RTLQESLARLAMEADDFGTVFGQQLIQRYIELKQYEISLVGGMDPLKLRQLFIELF"
     exon            complement(546025..547371)
                     /number=1
     CDS             complement(join(548774..548787,548834..549148,
                     549220..549451))
                     /codon_start=1
                     /locus_tag="AO090012000221"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000220"
                     /protein_id="BAE60435.1"
                     /transl_table=1
                     /translation="MKVVNSNQGKGKPSGIRRLYRHNFSANGRSKPRSPLSMHLGMPR
                     MAAVTTWQGAVSWAGSIQGRRLSLGIDTATQPKGLFITSSKSRAVFLMMPPMKLATPN
                     GHSMPKTNNLDVFEQRYDANFYETMAKIMALRQKYLQDRFIFVEGEDMVPILKGLGAK
                     DADFELLKSITDQTGADPTLEYPFGG"
     exon            complement(548774..548787)
                     /number=1
     exon            complement(548834..549148)
                     /number=2
     exon            complement(549220..549451)
                     /number=3
     CDS             join(550655..551398,551463..551513)
                     /codon_start=1
                     /locus_tag="AO090012000222"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000221"
                     /protein_id="BAE60436.1"
                     /transl_table=1
                     /translation="MLAGRGAVIFGDSPGPGHSLADSYQVPTDEGMTPCVRNGSLSYD
                     SGIGTSLGSTSSSSFRQSKDTPKRPVSPDARLSDPRRRSSYLQCCGSTGPYNFQETGK
                     ADSRDPIRFHGDTTRGTAICSQTHAVLPPASFSEISSRNSLRREEYRIGWISALKVEF
                     RAALQMLDQRHQPILGHSSDDNLYVQGRIGIHNVVLTCLPDGRNGTNFAAMVATSMIY
                     TYPNIQTGFMVGIGGGLPSPQNDIRLGDVITGSNESASSTRHLRGY"
     exon            550655..551398
                     /number=1
     exon            551463..551513
                     /number=2
     CDS             complement(join(553760..553767,553809..554520))
                     /codon_start=1
                     /locus_tag="AO090012000223"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000222"
                     /protein_id="BAE60437.1"
                     /transl_table=1
                     /translation="MPNNQSALAASFTNFLTVSIHQILFLRSVYPRATFLPVRAYNYP
                     VRQSRHPKVCDYINDASIAVGTEILKGTITAVSIIISSLRTNQPLERYAFDLSGFPRV
                     PAGEINTTFEDRKEDSSKPGAPLSDRGSAPPADLEAQFRACLARLASACARLTPLPRD
                     DEFSFTVCIEVREDALPPAGTTTEEQTWIVAEPGKVHLRSCTAPYSVSRLRNGEPQQP
                     PPRVSNGRAKTVPVRRVEAEI"
     exon            complement(553760..553767)
                     /number=1
     exon            complement(553809..554520)
                     /number=2
     CDS             join(558353..559171,559229..559758,559825..561592)
                     /codon_start=1
                     /locus_tag="AO090012000225"
                     /note="predicted importin 9"
                     /old_locus_tag="AO070343000224"
                     /protein_id="BAE60438.1"
                     /transl_table=1
                     /translation="MEQELLSLLADTQSPVADTRKSAELQLLRLYSNENFPLSLAAIA
                     SHDSVPTNLRQSTLSVLRTFIAAAWSPNLDEFKGQILINDVNKSQVRRALLDLATVTE
                     TPERKVKSSASFAVSKIASADFPEQWPELLPTILQIINDANSTASALHGALKVLLDLV
                     DTGFNEEQFFNVARDLLTSLFNVATNESRKPMLRALAVAVFRSCFDTLEMVLEQHKTA
                     VKQFMDEVLGGWFPFFISTLKAPLPQAPNEEEESKEGEIPSQWRGIIGLKLQVVKTLM
                     KIRMVFPALMTGQSPVFFSTVWTELSNIQAAYYEFYINDERQGRLEDVDGLPYTLDFL
                     VLEELDLIQTLIKAPPVKAELQQQLQNAGQAATSSSWLPEILKLAGSYAQITTEEEGL
                     WDIDVNLFLSEETSVTANYTPRTCSGDLVVKLGEWLKALTAEGLLVYLNNVFADSSST
                     WKTRESALFILNQLLRDFHEVSQSISPELATGFSNLIQFSLQQEHEFLRARGYLVAGI
                     LAQVAGEAFSATAASYLEATLKAISEDPSEVVKVSCIRALQDLMPSLPASMTTPLQIS
                     VISAISDFVSEHDLSEPSDSDDLKVTLAETLRDTIMVNPSVVLSSIAIDVLFNIASNG
                     ATNFQLTMIVTEAFEDIAESVADQGHDSFVRLCEKVLPSLTGAIDVGNLTQENALTNF
                     AADLLRALAERALEPLPAGFVEAVMPKLNRLLLDSTDAELIRPATEAVRHMLSHDFNQ
                     FITWRDPQSGKEATEVVLVIIDRLLGPAVDDNAATEVGQLAAELVEKAGSERLGPYLP
                     QLLRAVAQRLATAEQAQFIQSLILVFARLTLISAREVVDFLAQVDIGGQSGLPIVISK
                     WLENSVNFAGYDEIKQNIIALATLYNLEDPRLAQVQVKGDLIIQETGRIKTRSQTRNN
                     PDQYTTVTAPLKIVKVLVEELAAASGSKEIDAATAAALEEEDSDDDDWEDLPSNTLDL
                     SLGVTKQELMAFGEGGTEGVFGVRKRDDETQAFLLDFFRNASTKPEFQQLFATLTPAE
                     QDKLRSLG"
     exon            558353..559171
                     /number=1
     exon            559229..559758
                     /number=2
     exon            559825..561592
                     /number=3
     CDS             join(563382..563420,563828..564544,564617..564889)
                     /codon_start=1
                     /locus_tag="AO090012000226"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000225"
                     /protein_id="BAE60439.1"
                     /transl_table=1
                     /translation="MVHPNIDEHIVVDTSDEDSLCDAQSIIDSNFSLHSTVRDYEYEN
                     GRRYHAYRNGQYPMPNDEEEQDRLAFMHHLFKLLLGGALYRAPIEQAQTPQRILDVGT
                     GTGIWAIDIAEDFPGAEIVGTDLSPIQPNWAPPNCTFLVDDAESEWAFSPSEAFDYIH
                     VRSLGGGISDWKKFLKQAYNHVKPGGWVEIQEYETWLRSDDGTAERAPMLMDWQYKID
                     EASRLFGRHMNVAPNLAQWMEDAKFINVQDDVYKAPVGSWPKNNRLKEIGRVGRVTLY
                     EAVEPYTLALFTRVLGYSPEDARNYVDKVRAELLDSSHHIYVLYHYVYGQRPLEDDTN
                     AQGMNTDI"
     exon            563382..563420
                     /number=1
     exon            563828..564544
                     /number=2
     exon            564617..564889
                     /number=3
     CDS             complement(565053..565997)
                     /codon_start=1
                     /locus_tag="AO090012000227"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000226"
                     /protein_id="BAE60440.1"
                     /transl_table=1
                     /translation="MTVQSTPHLDALQRDGFVVVRSILSPEEVAQFRTVSTKATTLTR
                     TGHWPHFRTVPKQFPPWPTTPPPASEGGIWGVQHLLHPSMPGRAEFARFYFSEKVLAV
                     AEELLGVTRTEGNEEEPLVMELFNLLVAPETKDFELRWHRDDIPETVGPEEELKLLES
                     KSPQGKQSHAQYNLALCPDASLIVVPGSHRRVRTEAERNAGPYEPDMPGQLVVELQPG
                     DAVFYDSNILHRGVYRGKAEGGEETRLTLHGSIGLKGVSGNEADKKVRATAVLQHGVG
                     AWVHRDDAAFGVGERAEKMRANLVAMGTGEGVGYSLQG"
     exon            complement(565053..565997)
                     /number=1
     CDS             complement(566887..567357)
                     /codon_start=1
                     /locus_tag="AO090012000228"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000227"
                     /protein_id="BAE60441.1"
                     /transl_table=1
                     /translation="MPLDSYGEWSAELKELKRRTRWGGILEPGKFYSHRPVDRWHYHA
                     NQQYEKTETPRNPLVSRCFNRYIYGDVAVVRSSDVRVNDYSEEFSRTELVRTLEFYKG
                     RHAGDEANRRSKASMAATMGVTAEAFERIVPEGFPYVHNPMAEEPWMPSDLPNE"
     exon            complement(566887..567357)
                     /number=1
     CDS             join(568990..569086,569148..569295,569346..569504,
                     569561..571664)
                     /codon_start=1
                     /locus_tag="AO090012000230"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000229"
                     /protein_id="BAE60442.1"
                     /transl_table=1
                     /translation="MASGTNMGFNALLIICLVLVVLPSQVHAFGAGNIASISAVEGKN
                     WRHGDIEDMLKTIAFIKGHKWTSTMIKRVYFGNWLRDYSQAMDVGTLKSVPADTIRIL
                     VWILAFMTFGYATAEFEVTSERLGTYRPEEHIDNPKDYADNEDARQYDSRLRGPVRQV
                     ELDIDPNTGMKNYIANERGDWSTSSGYIKYSLSRSIHYGRLYTRNGNEEDLCEALRCL
                     GQGLHTLEDFAAHTNYCELALREMGFRNVFPHTGQRTEMNVRGHRVYPLVTGTFGMVD
                     FFHSVLGEATDHFTQSEVNEMDIALGDAQTNTSSGSASALTALLGKVPGTKDLVNQAE
                     ELKRRSDEQESANRRGGRRSGYSTRGSTRSYDDYDSGSSRGFGGERSRAARADDSNQT
                     SSGGLPDFDANNTIQQIYPILQFRDNVVRKLSSIIENIPGLETLVETITETLTVFVMS
                     LLAPFVRPIINAASKQLQAGSSSVIDASGQHQYEPWTDPHCTDPTHSLLSKDHFSNIL
                     NEPAGQVASAILKYVAPRVLYAWENTNISDRQVAEDCLQVFHHPALRDMRNEAHRTMY
                     EAVESWVQSRPDRGSELNDILSAEGVKAGKNQTGEGGHSHGHGHSHSHAAQQSHTQSG
                     QSQYRPPQYQQQQSSSSPFDQLSSLPIPGISKLSSAFSSLGLGGFSMGDETSQQTAPP
                     PEPQHQQSHQSYHELSHQRQDHESRHQSRQSHHSGGKHSSHESRQYGHGGGKSADYYN
                     ESSSSHGYGDHSESQGHSQRRHRKKKSHSDDSDEDYDPGYNVHSRQDHSHGRDEDHES
                     RYNLRSRQDHSQGYGQEYGGGYGGGYDGGYGSGGSRW"
     exon            568990..569086
                     /number=1
     exon            569148..569295
                     /number=2
     exon            569346..569504
                     /number=3
     exon            569561..571664
                     /number=4
     CDS             complement(join(571966..572339,572369..572516,
                     572570..573100))
                     /codon_start=1
                     /locus_tag="AO090012000231"
                     /note="glyoxylate/hydroxypyruvate reductase
                     (D-isomer-specific 2-hydroxy acid dehydrogenase
                     superfamily)"
                     /old_locus_tag="AO070343000230"
                     /protein_id="BAE60443.1"
                     /transl_table=1
                     /translation="MTTITKHIATTIRPKPSILLIGKLHHSKSEWSALQTKYKTYQFI
                     GNRHQFLQNCQSGIWDGVAALYRTNSTLETGPFDKELIHSLPLTLKFICLNGAGYDGM
                     DIQTCTERGIRISNTPKVVADATADVAMFLMLGALRQAMIPLVSIRNGQWKGDTPLGR
                     DPGGKVLGILGMGAIGQAIAHRARAFGLKIIYHNRSKLARDKEGRNISFLVFSSTLDS
                     VRNRRCRIYIISLNLPATKKTCYIISKAEFEKMKDDVFIINTARGSLLDEAALVEALQ
                     ADKVASAGLDVFENEPIIHPGLLHDNRVMILPHIGTTTRETKREMELLTLRNIENALD
                     DGKLLTPIIEQQEGQF"
     exon            complement(571966..572339)
                     /number=1
     exon            complement(572369..572516)
                     /number=2
     exon            complement(572570..573100)
                     /number=3
     CDS             join(574278..575141,575235..575237)
                     /codon_start=1
                     /locus_tag="AO090012000232"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000231"
                     /protein_id="BAE60444.1"
                     /transl_table=1
                     /translation="MSPPYIFKGSSPQPSNLSTQDFNFRAIIPSVEVADEDPPSSVGG
                     ERTPSVSDSEDSSHRAYTPSQSTATPPRRKNLSLGVTESFRTLNLEGTLTSHRTPSWR
                     HDARRQSTGLSPGRSTSTYGGLFNATPEPTPEPSRVQPTLNRDSSVDGLVSDLENSHL
                     HGGGPPSDDSDQLSESDDEDDDNATDSDDSSLYNVRCERLPSAPIYNAGLQEILRDIK
                     SQLSALQNDMNRCSLSRDRGSDLFQLHEKVRMLNELDCPETRTVGFIGNSGVGKSRLI
                     NSLLDQEGLARS"
     exon            574278..575141
                     /number=1
     exon            575235..575237
                     /number=2
     CDS             575297..575716
                     /codon_start=1
                     /locus_tag="AO090012000233"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000232"
                     /protein_id="BAE60445.1"
                     /transl_table=1
                     /translation="MDGEEVKELLEELVQSFRMYYTDLYREVTSIEEQERIRDRSTRA
                     WSTLNSLFRDQPELTHEFLSDQADGALSGILERLKDWAAQSCTRRPGGAALQHTIIPG
                     NVQECRSHLDMLTMDPRGESEVAIWPFIKLIRYVQFV"
     exon            575297..575716
                     /number=1
     CDS             join(577385..577455,577511..577602,577675..578006)
                     /codon_start=1
                     /locus_tag="AO090012000234"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000233"
                     /protein_id="BAE60446.1"
                     /transl_table=1
                     /translation="MDDWENCVMAAINQSLDQLVLGLSRVETDTLHGHDSSYVAGLMR
                     PVYNECNSESGTGSDARRKMLMRSHLTSSNIFPNLANISEAQCRAVIRNTCQDMRRMV
                     DEVVGNICNDLHSIVAEEGEATEARRFPEMASTLQRKVDAAQATLERAQRIVGDLKNT
                     PDVV"
     exon            577385..577455
                     /number=1
     exon            577511..577602
                     /number=2
     exon            577675..578006
                     /number=3
     CDS             complement(join(578207..578389,578466..579121,
                     579189..579384))
                     /codon_start=1
                     /locus_tag="AO090012000235"
                     /note="ketopantoate reductase"
                     /old_locus_tag="AO070343000234"
                     /protein_id="BAE60447.1"
                     /transl_table=1
                     /translation="MSPPKANILLIGSGGVGTIAALNLEAGNLARVTAVLRSNYHAVT
                     SNGFNITSCDHGILKGWKPSTITNRIPDPTPDSPKYDYIICTTKVITDCPPSTANLIK
                     PAVTPGHTVIVLIQNGLNIETPYFAAFPDNIVLSGISMIDSHEVAPGVIEHGSADDLV
                     IGAFRNPNLDIAVEAAAAERFVGLYSAAGKTKCVLGLDVGYSRWRKLIFNACLNSICA
                     LTGLDTGRIRLAGDAVEMLVRPAMEEIRAAAGSVGVDLPGSVCEEVIGAYPVALYLPP
                     SMLEDVWKGNLIEVESIVGEPLRVGRANGVAMPTLSVLYNLLKGVQWRTKEKRGLIEI
                     PAPGSDVADL"
     exon            complement(578207..578389)
                     /number=1
     exon            complement(578466..579121)
                     /number=2
     exon            complement(579189..579384)
                     /number=3
     CDS             join(581594..581874,582190..582256)
                     /codon_start=1
                     /locus_tag="AO090012000236"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000235"
                     /protein_id="BAE60448.1"
                     /transl_table=1
                     /translation="MKAMDAMQNDDDPTSYIFYLVGQSSSDGLVPLRELLVQIYEKWD
                     HIAKRKGLTTQCPISFTEEEIREGRCQGEEWAVAFNEYENLRAQLLGKDGGISLPRRI
                     VQRGCLKPSETQR"
     exon            581594..581874
                     /number=1
     exon            582190..582256
                     /number=2
     tRNA            582686..582769
                     /locus_tag="AO090012t00007"
                     /note="tRNAscan-SE"
                     /product="tRNA-Lys"
     CDS             586018..587064
                     /codon_start=1
                     /locus_tag="AO090012000237"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000236"
                     /protein_id="BAE60449.1"
                     /transl_table=1
                     /translation="MATKPNPKDSMKSTWRTANRDEWNINHWAIELLNVHPTELNKEI
                     PIHQKDEKVPYITQWSLNIWVLFYGALPLLMHQVYATFTGHNLGPIAVFNFYFMAFNA
                     VVIFEVHILRRLGHIYGFLDGDKHDRDGVPDVGIGKVVTSLYKTTGSRIALAVYFTYN
                     INQLPSQLNWPMLPLQIGLYGIVLDFWFYWYHRLMHDVSFLWKFHRTHHLTKHPNPLL
                     AAYADHEQEFFDMVGVPMATYFSLKLMGLPLGFYEWWLCHQYIAFTEVLGHSGLRLHS
                     TGASTMAWLLELLGAEIVIEDHDLHHRKGWRKSHNYGKQTRLWDRIFGTCHDRIEGTK
                     DNIDYVNSVNMPLF"
     exon            586018..587064
                     /number=1
     CDS             complement(587791..588414)
                     /codon_start=1
                     /locus_tag="AO090012000239"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000238"
                     /protein_id="BAE60450.1"
                     /transl_table=1
                     /translation="MGPYFEAQNARLDSMELTIRHLQQRNEIFEDGLASIRSTLVESS
                     RVMSARNLDIPAEANSQTRPSNSSDATNEQYDNSNASSNATTYLLALHESLREEVGQL
                     SHAITDLDARASMAIMNECLRLKEDMAHTNAAVSSIRMQVQWLMNPRIHQGQRTGVRT
                     NSSNNGNETRSGQLGSSASGPSNATAPSPGFLRPRRLSDSGREGTKL"
     exon            complement(587791..588414)
                     /number=1
     CDS             589939..590730
                     /codon_start=1
                     /locus_tag="AO090012000240"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000239"
                     /protein_id="BAE60451.1"
                     /transl_table=1
                     /translation="MPNPSQLFLLADHIKLSLLERQRAISLDLEPNSQDGEISRSLES
                     LHDGIEDVERDLSQLERTNDDGAAELKDQLFHLKSQYQDLSSQFSGHSTSAGASGSSP
                     SPEFANVKSSPDLKQPVPQHPPSKSVRFMNSATEEADLERQNLFQPYRDSPSPTGVDQ
                     SDLSNEQIYDRHNEIMRDQDEQLDRLGESIGRQHQLSIQIGDELEGHVALLDGMDGDI
                     DRHQHRLDGARKRLDKIRRSAGDNWSLMTIVGLIIILVILIVILK"
     exon            589939..590730
                     /number=1
     CDS             complement(join(594774..594914,595602..595877))
                     /codon_start=1
                     /locus_tag="AO090012000242"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000241"
                     /protein_id="BAE60452.1"
                     /transl_table=1
                     /translation="MSASIFFQQQQHAHHGAAAHMQPSNNHHGGRSRRGPKMAAQNAQ
                     RQFRGVKSMRELAEAPAVTAFRARFEAGRSFDLDDDLEFCPSLLTEDDSDAFDFLRAT
                     APAIRFLHFHISDDTLFFILRLGKIRPFDLVSFWPR"
     exon            complement(594774..594914)
                     /number=1
     exon            complement(595602..595877)
                     /number=2
     CDS             complement(join(599951..599996,600044..600575,
                     600631..600840,600900..601059))
                     /codon_start=1
                     /locus_tag="AO090012000244"
                     /note="CDK8 kinase-activating protein cyclin C"
                     /old_locus_tag="AO070343000243"
                     /protein_id="BAE60453.1"
                     /transl_table=1
                     /translation="MAANYWASTQRRHWLFTKERLADIRESFRERDKAAHSQFPLPDQ
                     RLLNIYFSQQLIKLGKRMSTRQQALATAQVYIKRFYTKNEIRHTNPYLVVTTAFYLAC
                     KMEECPQHIRFVVAEARNFWPEFIAPDVSKLGECEFALISEMNSQLIVHHPYRTLSEL
                     QPELSLTSDEVALAWSVINDHYLTDLPLLYPPHVIAVMAIIVAVVFKPSQTSFHGTAA
                     PLAGAMRDGGMNILAALGDKNGAGPPPRIQKLVGWLAESEVDIRAVIECTQELVSLYE
                     IWENYSEKHCKELLGRMVKSKNLDKIGAVCFCVAFREFG"
     exon            complement(599951..599996)
                     /number=1
     exon            complement(600044..600575)
                     /number=2
     exon            complement(600631..600840)
                     /number=3
     exon            complement(600900..601059)
                     /number=4
     CDS             join(601690..601819,601904..601984,602173..602278,
                     602336..602949,602997..603058,603114..603257)
                     /codon_start=1
                     /locus_tag="AO090012000245"
                     /note="predicted mitochondrial carrier protein"
                     /old_locus_tag="AO070343000244"
                     /protein_id="BAE60454.1"
                     /transl_table=1
                     /translation="MAPGESKDERDERVTKLWQSLGARKDGRLDLNGLKKGLKKIDHP
                     LKNADSMLQNVLKAVDTNGDGYIDYSAAFSKADVTVSSAKLDAFFADVDTNSDGVISY
                     PEWRDFLLFLPAYSNLRAVLSYYTATGNLNPEGDVHINDLQGLGTDHSFPKRYILAIK
                     NLLYNILPVHVLAALIPAAYAEVGGALNFGVALENDSVLLDGDSELEWLPVPRTVAMW
                     MSFRYYERKLTENTPQLGYFIAGGIAGAVSRTATAPLDRLKVYLIAQTGAKSAAVCAA
                     KDGAPLRAAGNASKSLADAVKELWRAGGIRSLFAGNGLNVLKVMPESAIKFGAYESAK
                     RAFARLEGHNDPKQLAPTSQFLSGGCGGMVAQYVKQSSVHGTII"
     exon            601690..601819
                     /number=1
     exon            601904..601984
                     /number=2
     exon            602173..602278
                     /number=3
     exon            602336..602949
                     /number=4
     exon            602997..603058
                     /number=5
     exon            603114..603257
                     /number=6
     CDS             join(603489..603874,604023..604107)
                     /codon_start=1
                     /locus_tag="AO090012000246"
                     /note="predicted mitochondrial carrier protein"
                     /old_locus_tag="AO070343000245"
                     /protein_id="BAE60455.1"
                     /transl_table=1
                     /translation="MFPYAAIDLTTFEYLKRGLLARKARLHHCHEDDVPLNNFTTGAI
                     GAISGGFSASVVYPLNVLRTRLQAQGTILHPATYNSIGDVARKTIQTEGFRGLYKGIT
                     PNLMKVAPAVSISYVVYENSKRMLGLSHSLYGTSYRFWMEITYGLHLWLTLFFR"
     exon            603489..603874
                     /number=1
     exon            604023..604107
                     /number=2
     CDS             complement(join(604545..604755,604795..605108))
                     /codon_start=1
                     /locus_tag="AO090012000247"
                     /note="predicted glutathione S-transferase"
                     /old_locus_tag="AO070343000246"
                     /protein_id="BAE60456.1"
                     /transl_table=1
                     /translation="MLYYEFDDLLPANSSQKLLDLYPTSLRSEIDTSNEWIYNDVNNG
                     VYKSGFATTQEAYQKNVTTLFSSLDKIEAHLQSNASPYFFGSALTEADIRLFTTIVRF
                     DPVSGYPAIHRWLRNLYWDIPAFRETTEFEHIKFHYTKSHTQINQFAITPVGPVPDIL
                     PKDEEVRAAAAVKK"
     exon            complement(604545..604755)
                     /number=1
     exon            complement(604795..605108)
                     /number=2
     CDS             complement(join(606432..606570,606631..609415,
                     609469..609554,609632..609711))
                     /codon_start=1
                     /locus_tag="AO090012000248"
                     /note="ubiquitin activating enzyme UBA1"
                     /old_locus_tag="AO070343000247"
                     /protein_id="BAE60457.1"
                     /transl_table=1
                     /translation="MNVDNPQETVEKIKQGEIDESLYSRQLYVLGHEAMKRMGTSNVL
                     VVGLKGLGVEIAKNIALAGVKSLTLYDPAPVAISDLSSQFFLQSQDVGKPRAEVTAPK
                     VAELNSYVPVTVHEGGNLVDNLEQLKRYQAVVLTLTPLKDQLAIADFCHKNGIYLTIA
                     DTFGLFGYLFNDFGKNFTIGDATGEELVSGIVAGIDEDGLVSALDESRHGLEDGDYVT
                     FTEVKGMDGLNNSAPRKVTVKGPYTFHIGDVSGLGTYQSGGIFTQVKMPKFVDYQPLE
                     EQLKKPELMISDFAKFDRPQQLHIGVQALHKFAECHDGQLPRPHNESDAQEVLKISND
                     LASNQEDKVELDEKLIKELSYQARGDLSPLAAFFGGVTAQEVLKAVSGKFSPVKQWLY
                     LDSLESLPASTTRSEESCKPLGTRYDGQIAVFGKEFQEKIANTTQFLVGAGAIGCETL
                     KNWAMMGLGTGPKGKIYVTDMDQIEKSNLNRQFLFRSKDVGKLKSECASAAVQAMNPE
                     LEGKIVALRDRVGQDTEHIFNEEFWEGLDGVTNALDNVDARTYVDRRCVFFRKPLLES
                     GTLGTKGNTQVILPHITESYSSSQDPPEKSFPMCTLKSFPNRIEHTIAWARDLFQTYF
                     VGPPEAVNMYLSQPNYIEQTLKQAGNEKQTLEQLHDFLVANKPLTFDDCIAWARHQFE
                     GQYNNAIQQLLYNFPRDSKTSSGQPFWSGPKRAPTPLKFDSSNPTHLGFIVAGANLHA
                     FNYGIKNPGADKEYYRKVVDNMIIPEFTPKSGVKIQADENEADPNAGNAGSSFDDNAE
                     IQRLVDSLPSPKSLAGFRLNPVEFEKDDDTNHHIDFITAASNLRADNYEIPQADRHKT
                     KFIAGKIIPAIATTTALVTGLVALEFYKIIDGKDDIEQYKNGFVNLALPFFGFSEPIP
                     SPKGKYQGKEGEVTIDQLWDRFEVDDIPLQDFLKHFSDKGLEISMVSSGVSLLYASFY
                     PPSKVKDRLPLTMSKLVEHISKKPVPEHQKNIIFEVTAEDTTEEDVEIPYVMVKLRK"
     exon            complement(606432..606570)
                     /number=1
     exon            complement(606631..609415)
                     /number=2
     exon            complement(609469..609554)
                     /number=3
     exon            complement(609632..609711)
                     /number=4
     CDS             610708..613119
                     /codon_start=1
                     /locus_tag="AO090012000249"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000248"
                     /protein_id="BAE60458.1"
                     /transl_table=1
                     /translation="MLHEILLSLSGQPSPLFEAHAEEDTVSEDAFPLLSPPEKALLAS
                     LARLSRLHAKLRAHTALISSSHSSVICRAASTAISTQHLGDFQRKVLEVEKSILVEDS
                     GYVGGYGIVPLSTIVGEFSPWTRRLEWLWEVARFILPNHKKANNQSCTGAALIDYLRA
                     ESQTGYIDIGEMALHLISAAETAWMRQLSTWLLYGNLPVLGKDDFFIQEDSIAESNRT
                     PAVAQFVLRTDLQPKFVSPDAASSILFIGKTLNLIRAKRSGSRTGPPAGLSTTPVTLH
                     GEHIEHFATLKSPISTAKLSNSINSIRLSLSQSTLSKLLPLPKILEILAVLHDFLLLR
                     RGEFASALVSHADARLLERHRRPGNLASKGKFAEGLQGLSIKEGDVANALSQALAELY
                     SLQNEEDPVDDELDLARSLLQLSMNDKRKGHSVAATPSAGGSDHLANISDIPFDDLLF
                     PSPTVLSAQVHPPLDLFLSASDVLIYSKIHSYLLGIRRAQLHLGDLWKHTFLRKIHPS
                     PLGPPRSNSQFGQNKLRAGRQRDNIRTRQMRPVWATCSASLFVLSEVGSFFQGEVING
                     SWQHFRGWIGGAPASSTNSRPGTSSSSKSKPSYNSMVSEEMSEAGLDRSIQSPRTRHD
                     PETLTVAHRRYLFTMVQALFLTDRPFTKALRFLLTSVDHFIALVVRLESIQRNMDLET
                     DEGVVDSLVDYAGEEKEVWQSLSAARGEVETGIKVLVARLKDIDDSRSGEGRTMFDMS
                     KNPRENWSMYQQNGTGTEANLGHYVPRKAAGVDRLLMKLDFGNANGSIGPAAFVSGGY
                     GNAGY"
     exon            610708..613119
                     /number=1
     CDS             join(615952..616225,616288..616967)
                     /codon_start=1
                     /locus_tag="AO090012000251"
                     /note="dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /old_locus_tag="AO070343000250"
                     /protein_id="BAE60459.1"
                     /transl_table=1
                     /translation="MRSALSQMLFQASRSWQPSTTLRPLTRLSYSTTTTTHGAHHIQT
                     RMPPKESIKNGHRFKEFDLNDRVYAITGGGRGLGLAMAEALMEAGAKVYCLDRLENPH
                     PDFMAAKEHSETNYGGSLEYYRIDVRDDAEVNNVFAEIAGQNKRLDGLIAAAGINHLQ
                     SALEHSQTAMNEVMQINYNGVFNSATAAARQMFNYQQKGSILLIASMSGLIANKGMTS
                     PVYNSSKAAVIQLARSLAMEWGRHGIRVNSLCPGHIITPMVEQVFQQNPASRAVWEAE
                     NMLGRLAYPEEFRGAALFALSDASSFMTGSTMLIDGGHTAW"
     exon            615952..616225
                     /number=1
     exon            616288..616967
                     /number=2
     CDS             complement(join(617440..618052,618109..618176,
                     618241..618896,618987..619329))
                     /codon_start=1
                     /locus_tag="AO090012000252"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070343000251"
                     /protein_id="BAE60460.1"
                     /transl_table=1
                     /translation="MASLFPQPTEAAYSTSSNTTPSPVQYTPVSDRSEDESGPLNRPP
                     PGSLKVQTQFSADEDDRDDGYDSYDDPEEKPDTGFPKYTAIEEKQIVKKFDRRLVPFL
                     ALLYLLSFLDRSNIGNAKIAGMTDDLKLSSSQYEWLLTAFYITYILFEWMTLMYRLVP
                     PHIYISLCVCGWGLVACFQSLATSFGSLILLRALLGITEAAFGPGVPFYLSLFYKREE
                     LAFRNGLFISAAPLASSFASSLAWVIVKMSSNGPIAPWRTLFLVEGFPSVIVAVFAWI
                     LIPDSPGSAWFLGPRQRMVAELRMEERKPDHHEPRRGKFNWKEVRITLADPKSYITAF
                     MFFSCNVAFSSMPVFLPTIIKDMGYSSVTSQALSAPPFLFAFIIVLLTAYLSDRNRKR
                     SPYLITHALLSSASYLIIALTGHFHAHLPAAAHTTIRYLCVYPATAGFFSAITLIMTW
                     TMDNRVAKEGKGASIAIMNVIGQCGPLLGTRLYPSVDGPWYVRGMATCSFFMVVVAIL
                     AFVLKVMLLRACRKVEAEGDEIEMHGGEESEVLMGGRSIGRRVEEKFTYII"
     exon            complement(617440..618052)
                     /number=1
     exon            complement(618109..618176)
                     /number=2
     exon            complement(618241..618896)
                     /number=3
     exon            complement(618987..619329)
                     /number=4
     CDS             complement(join(619814..620310,620366..620777))
                     /codon_start=1
                     /locus_tag="AO090012000253"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000252"
                     /protein_id="BAE60461.1"
                     /transl_table=1
                     /translation="MASSWLPSPWKSRRGRRVDPERTVDDLVRKYYTTNQQSTSDILR
                     EILGSPEQASLLFSALRRQVSLIKCRSQAFEDGQITTYDRALLKLSKNGENLTDTGAL
                     ELYLTEFLGIVPISPTSQSRAILAKQLDLESVLSRASAHGTPPETAIDRKEQSETLFV
                     DQAHVKPEYKFEDHNDNYYVEHTGLNISSTRHAQEVFDRIDRLLDVYHRAKDEYYKAL
                     QTEGFVSLEAVRFLRDTAENVLRYLHANGLSDHTSVPDVEQVFLIARDKATQLTGGRK
                     RHFDEGIERHGRKRKRRALDSYRPRK"
     exon            complement(619814..620310)
                     /number=1
     exon            complement(620366..620777)
                     /number=2
     CDS             complement(join(621378..621873,621934..622328))
                     /codon_start=1
                     /locus_tag="AO090012000254"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000253"
                     /protein_id="BAE60462.1"
                     /transl_table=1
                     /translation="MEKSENRPYGQYHYVEIPTSPDATPMHARRGRISRLAVALSFIS
                     LLTLSTVFFAIPGINFSVCHKMRGKFGALLSTPKGGETPVPASSNKVPLEAHIMSKCP
                     DAQDCLQKLVVPAMEQISEKVDFELSFIASVTNQSSDIHCKHGPGECIGDMLMLCAQD
                     LPFSPEGETEKTTRMPTIRSLGFANCLVGQYEDIPDRTLVQNCALQHGIDFESLNSCV
                     SRQEDDPTNGDLSGLALLRQSAVHSADLEVHTSCTVRLDDSVWCVRDDGEWKNCAKEG
                     KGSQVSTLVEEIERLWDEKN"
     exon            complement(621378..621873)
                     /number=1
     exon            complement(621934..622328)
                     /number=2
     CDS             join(623779..624139,624218..624521,624579..624958,
                     625012..625341,625397..625770)
                     /codon_start=1
                     /locus_tag="AO090012000255"
                     /note="acyl-CoA synthetases (AMP-forming)/AMP-acid
                     ligases II"
                     /old_locus_tag="AO070343000254"
                     /protein_id="BAE60463.1"
                     /transl_table=1
                     /translation="MSDNISSLSFLHGPSEPALKSYSIGQLLNQQAAHFPTKEAVIFP
                     TEGTRYTYQELNLRVQTVSRALIAHGVKAGDRIGVFCGNCVGYVEVFLAATRIGAITV
                     LLNNAYSTTECLNVLRTTGCSLLFTATHIGQRDLTSCLRVLKASLDGDELPALKQIIL
                     LKTDGDISKQFQSFASFLGQSSTIPDSRLCEIEQKVQPDQTCTFQFTSGTTGAPKIAM
                     LTHRNVISNAHSIGHRLLLSENDVICCPYPLFHISGLVIGLLSSLTYGAAIVYPSPTF
                     DPSAVLHEVVREKCTGLHGVPTIFIALLERHRQLKTSPIHVRTGLIGGAPIPSALLKE
                     MHKAFGFEDLTVAYGMTETSPISFMSRSAEQPSDVVVVHRDILPHTFAKIIDSTGNIV
                     PRGIRGELCIAGSGVQKGYYQNPEKTREALKTDHSGVMWMHTGDEAVMDTQGHCVITG
                     RIKDIIIRGAENIYPAEIEEELNKHHAISQSCVVGVKHETLGEEVAAFLQGTPGQPRP
                     SGAEIIEWLQLSLGAQKAPAWVFWLGDGDVPVVFPITDSGKIKRNEMADLGNRLVGKI
                     RGSVPSMSCMTITVLP"
     exon            623779..624139
                     /number=1
     exon            624218..624521
                     /number=2
     exon            624579..624958
                     /number=3
     exon            625012..625341
                     /number=4
     exon            625397..625770
                     /number=5
     CDS             complement(627706..629286)
                     /codon_start=1
                     /locus_tag="AO090012000257"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000256"
                     /protein_id="BAE60464.1"
                     /transl_table=1
                     /translation="MAPMDMSRENSPQPQEENSSGLVTVPMRNLYELTRLKNLRVNAG
                     WRPNSSLIQDDFISQGVVTLAEAEYLFDRFMRINNRLLWDGILPFHHTLDSVRRASTL
                     LAAVVLTIGALHTPGKTEAFHQSYDVFVSLVCGSSLSRNHSVDDVRALCIGAFYLANL
                     SWKLSGQATRIAAEIGLHQSYQKLIQGDNTQRDRVCLWYATYVCDHQFSIAHGRPPAA
                     VDDESIRNIERFMHTTEVHPGDARLAAQVALFAILTEAYVAFGNELDRPLEDKDFDKL
                     WVSNVAIDQWRLHWQPRSKDCAALGSYPSKALVLYYHFARFQLNSLALRGINPSGLTS
                     NPELTSKSPLSLAHREAANAAIAAATSTLTLILEDDDLRRAFPGVPIFTYTMVAFCAT
                     FLLKMAATWGKTSTQFGLAVNTRHIVSLVQSSADMLADVAMSLNERHLAKHIATGMLE
                     MLQQFRALDESEINDLNDRIEGGDRNHLPALPSETNDVNAFWAGDYNFYDLGGTFGFG
                     LDETLLGQMAADNFELGI"
     exon            complement(627706..629286)
                     /number=1
     CDS             join(633344..633972,634076..635321)
                     /codon_start=1
                     /locus_tag="AO090012000259"
                     /note="hexokinase"
                     /old_locus_tag="AO070343000258"
                     /protein_id="BAE60465.1"
                     /transl_table=1
                     /translation="MAPITTAAAEKTKQEEYDDIHEDPIEDEEDEGSDLDPSQREYLE
                     HHRKLDQFLSPLSLDEAVLYKLARRFSSVYRDLALHSEEQFLPTPVTHLPTGLETGRY
                     LAIDVGGSNLRVAFIELLGDAANSDIGSTDASEQSTTIRRAQRQRVRRTLEKAWPIQE
                     HLKMDNAEDLFSWIGDRIAEVVAESLTSDATKGKVPEELEMGITFSFPIMQESLSEAT
                     LMPMGKGFAITSDLNLRNILLSGYERHTRRPDDEDEPSSKRRKLFALPKLKIAAITND
                     AVATLASLAYAVKSLPNSRVAMGIIVGTGCNATIPMKLSSLHETKANHVKSKDSEAVE
                     TVINTEWTLAGSAPPLKELDIITKWDIELDRACARPGFQPFEYLTGGRYIGELIRLIL
                     FDYLTNVRGLASKELPANLVQEYALTTTYISDNVARARSDLELADVLNHSLPSPESSE
                     WQWDAVCAGAFRKIARTVQKRAAGLIAAAVVGLLACANEIELKVESTENSPQPSSAAS
                     PEHNGGADVTAVTNFLSPSTSKVSTNAQRGNGPIVPVLSPTPTPADWQSGPEELVVAY
                     TGGIIQHYPNFKNMCQQFIDRLIMRTGPQKSGKSVFLREVSDGGVIGAGVLAGMVANR
                     "
     exon            633344..633972
                     /number=1
     exon            634076..635321
                     /number=2
     CDS             join(636534..636577,636635..636782,636872..637018)
                     /codon_start=1
                     /locus_tag="AO090012000261"
                     /note="transcription initiation factor IIA, gamma subunit"
                     /old_locus_tag="AO070343000260"
                     /protein_id="BAE60466.1"
                     /transl_table=1
                     /translation="MSNAQAYYELYRGSSLGLSLTDTLDDLINDGRIEPQLAMKILST
                     FDRVITEVLADKVRARLTFKGHLDTYRFCDEVWTFLIKDVTFKLDNQTTVQADKVKIV
                     SCNSKRPGEA"
     exon            636534..636577
                     /number=1
     exon            636635..636782
                     /number=2
     exon            636872..637018
                     /number=3
     CDS             637945..638799
                     /codon_start=1
                     /locus_tag="AO090012000262"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000261"
                     /protein_id="BAE60467.1"
                     /transl_table=1
                     /translation="MVEDEFNAVAQSFTQHLHYAEYAKRKKEVKLQNAAAIQNLARPT
                     DGVTPVSDVTRRRDAADALSARQKAGLEQVQSKRPQVDSEEENEEIEDETWAGTSLHG
                     LMMSPRKARSLVGMQGIKSSTRAAAGFSQSSGTGRDSAAINSSPPRIYEAAKSIDVDE
                     TASEDDDLDLQYETPRPTQKARLISSDSMSSNSRHSPLTPTKDRGRKMQSINARYKTP
                     TATQSKRRLLFDDDFVELPELQNSDVQVQGRGSSPSIRKTRRETPPRGNNPQSKKSRL
                     NEVPTFLL"
     exon            637945..638799
                     /number=1
     CDS             complement(join(638925..639191,639252..639329))
                     /codon_start=1
                     /locus_tag="AO090012000263"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000262"
                     /protein_id="BAE60468.1"
                     /transl_table=1
                     /translation="MECFRQIGRLVKAPFQRDSHHKALEIGPPTNFRKEEMPTFFPDD
                     ESVHVSTKLRETVSDNAVHSAQTLHSHSSSLEKDSMIKTLEREPSARQRIKNNVRRLS
                     VRVARPVSEHED"
     exon            complement(638925..639191)
                     /number=1
     exon            complement(639252..639329)
                     /number=2
     tRNA            complement(642221..642325)
                     /locus_tag="AO090012t00008"
                     /note="tRNAscan-SE"
                     /product="tRNA-Met"
     CDS             complement(join(642817..642930,642997..643881,
                     643957..644373))
                     /codon_start=1
                     /locus_tag="AO090012000264"
                     /note="NAD-dependent aldehyde dehydrogenases"
                     /old_locus_tag="AO070343000263"
                     /protein_id="BAE60469.1"
                     /transl_table=1
                     /translation="MSLETITTISPSTNQPVVTRTGVTSEDLQRIPEVAQEAFRSFSR
                     STTLKQRQEIVTRALDILEKKKDELARELTEQMGRPIAYTGVEVLTAIKRSRYLTKIS
                     DSVLGEEGVVPGEEEKGFRRYIKRKPVGVAFIIFAWNYPYLILVNSLIPAILAGNAVI
                     LKPSPQTPTIVEQFAAAFAEAGLPQNVIQYFHCGSPTLLETIVRSPLVNHVCFTGSVA
                     GGLAVQKAASDRIVNVGLELGGKDPAYVRDDVDAAWAAEEVVDGAIFNSGQSCCAIER
                     VYVHKNIYNTFVEEVKKVLSKYRVGDPFDKQTQIGPVVSKRAKDTIQAHVADAIQKGA
                     KDETPANETFENPPAEGNYVKPTLLTGVNHDMIVMTEETFGPVIPVMKVDSDEEAIKL
                     MNSSEFGLTASVWTKDVAKAEELVEQVEAGTVFINRSDYPSPDLAWTGWKNSGRGVTL
                     SRFGFEQFVKLKSHHIKAYPK"
     exon            complement(642817..642930)
                     /number=1
     exon            complement(642997..643881)
                     /number=2
     exon            complement(643957..644373)
                     /number=3
     CDS             complement(join(644702..644768,644824..644905,
                     644961..645256,645318..646218,646277..646492,
                     646559..647238,647323..647618))
                     /codon_start=1
                     /locus_tag="AO090012000265"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070343000264"
                     /protein_id="BAE60470.1"
                     /transl_table=1
                     /translation="MSPLALSPKTVDIVNIFQNDVEFSLVNEIHKGISPPAGVRKSMP
                     TMLLYDANGLKLFEKITYVKEYYLTNAEIEVLETNSRRIVERIPDNAQLLELGSGNLR
                     KIEILLREFERVGKRVDYYALDLSLSELQRTFAEVSIDDYTHVGLHGLHGTYDDAVTW
                     LNSPENRKRPTVIMSMGSSLGNFDRPGAAKFLSQYASLLGPSDMMIIGLDGCKDPGKV
                     YRAYNDSEGVTRQFYENGLVHANVVLGYEAFKPDEWEVVTDYDAVEGRHWAAYSPRRD
                     VTINGVLLKKGEKLFFEEAYKYGPEERDQLWRDAKLLQSTEVGNGSDDYHLHLLTSAA
                     LNLPTSPSQYAAHPIPSFEEWQSLWTAWDNATKAMVPREELLSKPIKLRNSLIFYLGH
                     IPTFLDIHLTRALRGKLTEPKSYKLIFERGIDPDVDDPQKCHSHSEIPDEWPALDDIL
                     DYQERVRSRVRSIYQIEGLAENRILGEALWIGFEHEVMHLETFLYMLIQSERILPPPA
                     TERPDFKKLYQDARRSMKTNEWFSVPEQTLTIGLDGADTNDVPPTTYGWDNEKPARTV
                     TVPAFEAQGRPITNGEYAKYLQANQSRRRPASWVLTHSDENYPIPMAVNGSSVGATQD
                     FMSNFAVRTVFGPVPLEFAQDWPVMASYDELAEYAEWVGCRIPTFEETRSIYLHSALL
                     KERGGVNHNGEPNGHSVNGYLNGMNGNSYSKINPGKPRTPDHQPVQYPSRDALPVFLD
                     LDGLNVGFKHWHPTPVIQNGDRLAGQGELGGAWEWTSTPLAPHDGFKAMEIYPGYTSD
                     FFDGKHNIILGGSWATHPRVAGRTTFVNWYQHNYPYTWAGARLVRDL"
     exon            complement(644702..644768)
                     /number=1
     exon            complement(644824..644905)
                     /number=2
     exon            complement(644961..645256)
                     /number=3
     exon            complement(645318..646218)
                     /number=4
     exon            complement(646277..646492)
                     /number=5
     exon            complement(646559..647238)
                     /number=6
     exon            complement(647323..647618)
                     /number=7
     CDS             complement(join(649678..650305,650418..650607,
                     650728..650888,651567..652273,652346..652741))
                     /codon_start=1
                     /locus_tag="AO090012000266"
                     /note="uncharacterized Fe-S protein PflX, homolog of
                     pyruvate formate lyase activating proteins"
                     /old_locus_tag="AO070343000265"
                     /protein_id="BAE60471.1"
                     /transl_table=1
                     /translation="MNRLSRSLCQVSSHHFRPRPSFTPLVPKRCIGIPPAFLLDEYIP
                     RYQLLTSVDASKKRSLAYAHLRECNLCPRRCGVNRYEETGVCLIGAETVKVNTIAPHR
                     GEEPCIQGFNGSGSVFFSGCNLRCVFCQNHDIAHQRNGFDLTPEELADWFMKLQQVGN
                     CHNINLVTPEHVVPQVALAILTARDMGLNIPIIYNTSSFDSLESLQLMDGLVDIYLPD
                     FKVWKNSTSKRLLKAEDYTETAMESIKAMHKQVGDLCFTSDGIAKKGVLLRHLVMPGK
                     EDEGREIMRWLAENVSKDLYVHIMEQYHPDAHVGKRKRTMKNSKGEEEAEVRYAEINR
                     AVRDDELGSVRDAAVAAGLWRFCEANENSSMFHLNNRPRPPRLLPQIPHSPRPRNSSS
                     NSNCPRPSPLVSALRPPCGLLLRRHKSHKAQLTLSATGSEGGEGQRTHIQVLANSVVA
                     TVLILLHTYVLRGSSAECFENGRSAADLLVVGIVANYAAVAADTFSSELGILSKSKPR
                     LITSPTLRVVPPGTNGGVTAAGLLAGVFGAFTVALASAVLLPFCAESSLVDRVYWTFT
                     FTGWGTLGSVLDSVLGGLLQASVVDKRTGKVVEGEGGKKVLVHPHPRAGGATGYSSAS
                     ASASGSVQQRKGEKGGIETVHESRKIESGRDLLDNNAVNVLMAFIMSVGAMGVAGWVW
                     GVSVFDIAASV"
     exon            complement(649678..650305)
                     /number=1
     exon            complement(650418..650607)
                     /number=2
     exon            complement(650728..650888)
                     /number=3
     exon            complement(651567..652273)
                     /number=4
     exon            complement(652346..652741)
                     /number=5
     CDS             complement(join(654591..654734,654793..657116,
                     657169..657622))
                     /codon_start=1
                     /locus_tag="AO090012000267"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000266"
                     /protein_id="BAE60472.1"
                     /transl_table=1
                     /translation="MSTTSIQHFTSSFSPFSSGTQPVGMAQSQTVGLDTLAEGSQYAL
                     EQLQLSREANGASAVDGGVPNPLRSSISKPQGQQLYSDESSAQHTQNATTGFRNLPQR
                     DQLAEARSTIRKSSNSGPVRRRISRACDQCNQLRTKCDGQNPCAHCIGSEFGLTCEYA
                     RERKKRGKASKKDLAAAAAAVANNGTAPTSNGNTSNDSVSSAKRHTPSDGQSTQEVSG
                     RYDPNFDASRNLATAGQSQLGQHSDMSGMAGMQGSQQTPHSQPSLGGAIDAIHLNHFN
                     TLNDSNRPQMSVPDLRSLQMLHPSGANTRSPSGALPPQGMNSGYNDGAYSLMNASEAN
                     HPSINQYRLGNSAENPPAPFLGLSPPAQSPGWLSLPSPSPANFASFSMPPFSSTLRYP
                     VLQPVLPHIASIIPQSLACDLLDVYFTSFSPSHLSPQSPYVVGYIFRKQSFLHPTKPR
                     VCSPGLLASMLWVAAQTSDAAFLTSPPSARGRVCQKLLELTVGLLRPLIHGPAPGETS
                     PNYAANMVINGVALGGFGVSMDQLGAQSSATGAVDDVATYVHLATVISASEYKAASMR
                     WWTAAWSLARELKLGRELPPNAPQPRQDGEPEDDTDVDMSKRNLPPLITSVGGNSGST
                     ILNVTEEEREERRRLWWLLYATDRHLALCYNRPLTLLDKECEGLLQPMNDDLWQAGDF
                     AGATYRQVGPQVECTGHSMFGFFLPLMTILGEIVDLQQAKEHPRFGRVFRNSADWDHQ
                     VLEITRQLDTYAQSLKEFEARYTSSLALGAGESEAAIEGSHLDHVSPSGRSTSTAGSR
                     VNESIVHTKMVVAYGTHIMHVLHVLLAGKWDPINLLEDHDLWISSESFIAAMSHAVGA
                     ADAAADILEYDPDITFMPFFFGIYLLQGSFLLLLAADKLQGDVSPSVVRACETIVRAH
                     EACVVTLNTEYQRTFRKVMRSALAQVRGRMPEDFGEQQQRRREVLALYRWTGDGSGLA
                     L"
     exon            complement(654591..654734)
                     /number=1
     exon            complement(654793..657116)
                     /number=2
     exon            complement(657169..657622)
                     /number=3
     CDS             complement(join(659946..663248,663337..664161))
                     /codon_start=1
                     /locus_tag="AO090012000268"
                     /note="mitochondrial/chloroplast DNA-directed RNA
                     polymerase RPO41, provides primers for DNA
                     replication-initiation"
                     /old_locus_tag="AO070343000267"
                     /protein_id="BAE60473.1"
                     /transl_table=1
                     /translation="MLSRIARQKNAASHLRVSKGRLVSPSLAALRFHSHLGRSNSFVN
                     ASVNVSPDRLRQPSLQSNRYLATAADHSAVEQPPYPPFENSSYTAGHRYDQPAQMASL
                     FPPISKGFNASSLIIIDDLLQTRPRALKKHKGIGGDEDEMMANLDISLKVGRIDRAAN
                     LVTRLGEYFPIGSPEYLAIHNRYLEEMVSHMVVTRQHNLVLPLQRWFEVDMAHGGVQP
                     DARTYAIMIRMALRMLHGAKRDRAVRRYWSFAKTAGVEEEVLAVPVLSELELGELSEI
                     CSSDLRRVAIGSIHSDIANNPESITDEVPAVRPVDQKGLGLSSLQDSLSMFSTGSDVA
                     FPTDSNYTEEEKLELYNQLRQRQLETDSIRTSLERWRQEFTQMQKSGLDMTGGGKKLG
                     TIMNQWHMGLVSRIQEELKLVDEAEANPIRTFEQKERYDYGVYLRSLDPERLAALTIL
                     AVISTFSRGGMEKGIKVSAIATGIGKDLQDELIAEMTLKKQQTGDARRLKALREILAG
                     RKKKDGRASWQKIVHDFEKEDPAAIWPPRVKAKVGAVLMSFLFDVGKVPVLTEHPRTD
                     KKTIVMQPAFQHSYQINWGKKSGYVHLHPEVVQIVAREPTADVLGRQLPMICKPKPWN
                     GPKDGGYFIYQSSIVRVTPGETLQPSYIKAAMENNGLEQVREGLNILGRTGWRINRDV
                     FEVMLEAWNSGEAIASLAPLNPDLPPPPKPAPEEGLAAEKKWDNAMREIENRRSGMHS
                     NRCFQNFQLEVARAYRNDTFYLPHNMDFRGRAYPLPPYLNQMGADNARGLLLFSEAKP
                     LGARGLRWLKIQIANLAGFDKASLSEREQWTMDHLDEVLDSANKGLHGRRWWLDAEDP
                     WQCLAACCELRNALQHPDPTQYPSRLPIHQDGSCNGLQHYAALGGDKVGAQQVNLEPS
                     DRPSDVYSGVAEFVKEAVAREAKEGIPIAKLLDGKITRKIVKQTVMTNVYGVTFMGAM
                     KQVRKQLVDHYPELSADDTKGGSLYIARKIFEALGTMFNGAHEIQYWLGDCASRITQS
                     LSPEQIEEIAKEALSPTQSDGGLIRKANDPAQKFRSTVIWTTPLGLPVVQPYRVRKSR
                     RVRTTLQDLSIVDMGSDDVVSKRKQLQAFPPNFIHSLDATHMMMSAIACDRAGLSFSA
                     VHDSFWTHACDVDSMNNILREAFVRMHSDDVVKRLAAEFEVRYGKNLFLAKVNVSSKI
                     GKAIRAHRRRANHKQAKVQELLEEYKRQKLLQSDDPELQAQGRAMVTPASVFEQAGGA
                     DEDLAISSSLGETVVGHVPENLEAAERKTSGMDADSSDPIIESLMTDFDDVLGPKANT
                     EDATAEADLDEIDEPKKKRRGAVHTWLWLPLRFREVPRKGEWDITRIRDSEYFFS"
     exon            complement(659946..663248)
                     /number=1
     exon            complement(663337..664161)
                     /number=2
     CDS             complement(join(664870..665423,665485..665956))
                     /codon_start=1
                     /locus_tag="AO090012000270"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000269"
                     /protein_id="BAE60474.1"
                     /transl_table=1
                     /translation="MDSSDPVIASYDVYLTDSEISRYVLQYLDRLPDYPYDDRHGQKP
                     TSFRLKPKTGLVEVDVPINTRMNYDVNKGLKYGDALKKSRSSQEGGAFGMAGGFSGGS
                     LASGNKVKMEAGGDVEMGGMGNGDSASLLRVQTLGGRIKIPEEGDPVYMLAAFRGNNL
                     HLSPVSAVVQVHPHLHHLDALDELPAKGKGKKKDDDEGGGNEARAIDIKVKAAEDDQA
                     SQLAGNLDLLKKMQEEKWGSYDWVDAEVSICSVMGSFLPRGSADSRYSKTEESWQVYE
                     SYMMHQDLENLPQLESAIDSEDYLDKMSAPRIDPANPEMTGWAMKQNRMKQNGRGSSS
                     RSSTEEQ"
     exon            complement(664870..665423)
                     /number=1
     exon            complement(665485..665956)
                     /number=2
     CDS             complement(join(666589..666615,666674..671059,
                     671118..671257,671376..671406))
                     /codon_start=1
                     /locus_tag="AO090012000271"
                     /note="sulfite reductase (ferredoxin)"
                     /old_locus_tag="AO070343000270"
                     /protein_id="BAE60475.1"
                     /transl_table=1
                     /translation="MAPVSTAGEAVARVAYLTSDIVVSVQPSLQTDSWFSKPLKALKQ
                     EKARSILPKGVPDVVSVRYNEDPLLSAFHPLQTGDVVSVVSSSSVLLSSIPHLYRLAN
                     FPIVIHVALEPSPFPDYSVISSIRQCGFAFLHSETVQEAQDISITAHALARKSGKGVI
                     HFFDPANSARDEPIAEEDVNVIQSVLNLGGHHATHSTGLGAQTLYTDSGRVATVTDEV
                     VENTKTPEGAATPAQPSQTPSSVSVDNSSVGSSRRDSSVDSRATSSAATTVDASSVRA
                     VSAADIFEWTSQIWRTLSVLVGRNYSAVEYTGPSDAKSALFIFGSTGVFVDALSKEDT
                     ASELKNIGLITARLYRPWVGGQIVNSIPASVEKIAVLEQVRKTTRWGPSFMDLLSSLT
                     PTTAGGRAPQIVGYRLGYVEPSTAIQALRGIAQNLDTPSPIQNLEVGSSKVPTLETAL
                     EQPHLENAYLKILNQLFGERLHIANQLDSKHAGVSSTIAASPEYGFGSLIARMEHRRR
                     FVREVEEASKAGTFATDAPKTSLSNWALSAGDAAKANRLAPDVIDHLSKDDSPLAKQL
                     LESKKLFFDESRWLVGSDAWAYDLGNSGVHHVLASGANVNMLVIDSQPYSERTAADPT
                     RRKKDIGLYAMNYGNAYVASVAVYGSYTQVLQAMAEAEQFKGPSVVVAYLPYNQEDDS
                     ALTVLQETKKAIDLGYWPLYRWNPGNEENNEPKFSLDSERIKRELEEFLRRDNQLSQL
                     MNRHPKFSSVLSESYGTEVRALQKRKAKDSYEKLLEGLFGAPLTILFASDNGNAQNLA
                     KRLGNRGRARGLKTMVMAMDDYPAEDLSTEENVVFITSTAGQGEFPVNGRGLWEFVKN
                     SGDLDLSTINYSVFGLGDSHYWPRKEDKIYYNKPAKDLDARVAFLGGRKLTDIGLGDD
                     QDPDAYQTGYSEWEPRLWQSLGVDKVEGLPEEPAPLTNEDIKIQSNYLRGTIAEGLLD
                     ESTGAISASDQQLTKFHGTYMQDDRDVRDERKAQGLEPAYSFMIRCRLAGGVATPTQW
                     LQMDAISSSHGNETMKLTTRQTFQFHGVIKRNLRGAMRAINKALMTTIAACGDVNRNV
                     MCSSLPELSFFHREAHTVAQKISDHLLPSTTAYHEIWLKDDDDKKIQVAGDAVVDHEP
                     LYGPTYLPRKFKITIAIPPHNDTDVYAHDIGLIAIKGSDGHLEGFNILAGGGMGSTHN
                     NKKTYPQTGRMFGYVPADQAHIVCEKIMLVQRDHGDRQNRKHARLKYTIDDMGVEVFK
                     EKVEALLPDGLRFAEPRPFKFASNVDTFGWLKDEKGLNHFTFFIENGRIEDTADFQMR
                     TGLRELAKLDKGEFRLTGNQHLILSSVKDEDLPAIKELMAKYKLDNTSFSGMRLSSSA
                     CVAFPTCGLAMAESERYLPVLISKLESTLEEVGLARDSIVMRMTGCPNGCARPWLAEA
                     AFVGKAYGAYNMYLGGGYHGQRLNKLYRSSIKEDEILDIMKGLLKRYALERNTDGEEP
                     ERFGDWCIRAGVIKETTDGRNFHEGVAEDEDDE"
     exon            complement(666589..666615)
                     /number=1
     exon            complement(666674..671059)
                     /number=2
     exon            complement(671118..671257)
                     /number=3
     exon            complement(671376..671406)
                     /number=4
     CDS             complement(join(672910..673801,673971..674164))
                     /codon_start=1
                     /locus_tag="AO090012000272"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000271"
                     /protein_id="BAE60476.1"
                     /transl_table=1
                     /translation="MGIVTQLLLTTSLLPFFSSERIGFHFRFPFLLHPPIACATPTAA
                     HRRYQRWGSHQPVFSASRGQSGLYGLLALLTGYHLSPVQLSMYLYSLLALGVATLLFP
                     HIRKQSPLQCLALAWLYLFDSVINAAYTAAFGVTWFLVISQHYESGNASGPGGETIAQ
                     TAGFTSPKYDSPSSQGAQYARSPDGLGNAVTQPESFQSIVFICSLWIIRAYFVLVMLA
                     FARQSLRLYIAVPRHTQLPTHSRNTSIASVASVADIDKEPFSPYTPDGQGWKGKLGRA
                     MISVGRNYWLGEDEDGNWMDTIGRRFRARRESTELPGPLERERRRRSGTGPPQPSQSA
                     VQAAALQQPTYEVPGMNVKMQDWSETR"
     exon            complement(672910..673801)
                     /number=1
     exon            complement(673971..674164)
                     /number=2
     CDS             complement(join(675061..675119,675175..675577,
                     675676..675764,675833..675858,675918..675970))
                     /codon_start=1
                     /locus_tag="AO090012000273"
                     /note="GTPase Rab6/YPT6/Ryh1, small G protein superfamily"
                     /old_locus_tag="AO070343000272"
                     /protein_id="BAE60477.1"
                     /transl_table=1
                     /translation="MASTSAVGSYSNPLKKFKLVFLGEQSVGKTSLITRFMYDSFDNT
                     YQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDISNAK
                     SFQNTRKWIDDVRGERGNDVIIVLVGNKTDLNDKREVTTAQGEEEAKKNGLMFIETSA
                     KVGHNVKQLFRRIAQALPGMEGEGSRGESQVIDVNINPKETTTNDGCAC"
     exon            complement(675061..675119)
                     /number=1
     exon            complement(675175..675577)
                     /number=2
     exon            complement(675676..675764)
                     /number=3
     exon            complement(675833..675858)
                     /number=4
     exon            complement(675918..675970)
                     /number=5
     CDS             join(676482..676539,676596..676630,676692..676783,
                     676845..677153,677212..677314)
                     /codon_start=1
                     /locus_tag="AO090012000274"
                     /note="vacuolar H+-ATPase V0 sector, subunit c''"
                     /old_locus_tag="AO080525000260"
                     /protein_id="BAE60478.1"
                     /transl_table=1
                     /translation="MGLVYPAGAATVSLLVIGGYMLFHGDGEQFNVGQFLESVSPYAW
                     ANIGIAMCIGLSVVGAAWGIFLTGSSIVGGGVKAPRIRTKNLISIIFCEVVAIYGVIM
                     AIVFSSKLNLVGDDEIFSGSNQYTGYALFWGGITVGMCNLICGISVGINGSSAALADA
                     ADGSLFVKILVIEIFSSVLGLFGLIIGLLVTQKANEFK"
     exon            676482..676539
                     /number=1
     exon            676596..676630
                     /number=2
     exon            676692..676783
                     /number=3
     exon            676845..677153
                     /number=4
     exon            677212..677314
                     /number=5
     CDS             join(677817..678086,678139..678179,678244..678281,
                     678337..680123)
                     /codon_start=1
                     /locus_tag="AO090012000275"
                     /note="molybdopterin biosynthesis protein"
                     /old_locus_tag="AO070343000274"
                     /protein_id="BAE60479.1"
                     /transl_table=1
                     /translation="MTDDKLKAAILIVSDTASKDPSTDRVAETLTSFFFSEGLNTWDR
                     PATKIVPDNVLDIQRALCDWTDGPNWVNLILLSGGTGFALKDNTPEAVSPLIHRHAPG
                     LVHGMIAASLQVTPFAMMSRPVAGVRNKTLIITLPGSPKGAKENLDAVFKLLPHACTQ
                     AAGANSRAIHAGGVKKLEAEAGLSSGGKVEHKRDHHHQHHHQLHSHSHSHGHGHGHVA
                     PKAHTSPSERPQSNDPNAGPNRRYRESPYPMLSVDEALAVISEQTPEPVVVEVPVTTA
                     LVGSVIAEDVYAAEAVPAYRASIVDGYAVIAPETADVGPSTKGVFPVASISYANPGGS
                     LSPLEPGTIARITTGAPLPPNANAVVMVEDTVLASSTPDGKEEATVEILTGDIKPNEN
                     VREPGSDIALGSKILQKGDLITSVGGEIGLLAASGTKIVKVFKKPCVGVLSTGDELVE
                     HDDPRKLYGGQIRDSNRPSLLSCLASWGFPTVDLGIARDTPAGELERSLRDALRGVGR
                     ANSSVDVIITTGGVSMGELDLLKPTIERTLGGTIHFGRVSMKPGKPTTFATVPFKPTS
                     STQQVQQERETKLIFSLPGNPASALVTLNLFVLPSLYKLMGMGEKQTAPGLSSTLGLP
                     LVSVSLTHAFPLDPKRTEYHRAIVTASRSDGRLYASSTGLGGVGQRSSRVGSLASANA
                     LLVLRPGSGQIEKGVLVEALMLGPVVAAQ"
     exon            677817..678086
                     /number=1
     exon            678139..678179
                     /number=2
     exon            678244..678281
                     /number=3
     exon            678337..680123
                     /number=4
     CDS             complement(join(680538..680574,680580..680992,
                     681048..681158))
                     /codon_start=1
                     /locus_tag="AO090012000276"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000275"
                     /protein_id="BAE60480.1"
                     /transl_table=1
                     /translation="MEREIDFSHILNGDGGKLIKEYANLDPEELEKHVKHIAHQAWAI
                     SKYPCFRHYEFLYSALSHSLLYEQILAQTRAGNLFLDLGCGLGQDIRRLVQDGAPSAN
                     LIGLDSTEEFINLGFELFDDRSRLGCTFIVQDFFEDTPQLDNLVGRVKVINSSYFMHL
                     FDWDTQLRVAKRMMSFPGEGGAHYWF"
     exon            complement(680538..680574)
                     /number=1
     exon            complement(680580..680992)
                     /number=2
     exon            complement(681048..681158)
                     /number=3
     CDS             complement(join(682003..683940,683998..684984))
                     /codon_start=1
                     /locus_tag="AO090012000277"
                     /note="phosphatidic acid-preferring phospholipase A1,
                     contains DDHD domain"
                     /old_locus_tag="AO070343000276"
                     /protein_id="BAE60481.1"
                     /transl_table=1
                     /translation="MTGPIHTYGPTCLLANDDPDPSSWHSLNEPPKVRPQFFYVSSLP
                     IDDPLTALPPPSSNQGPGNERAPPQPFSVKDNVALEESWLALLRTTKSELAARKHSRA
                     DSSSVRNGGIAVPGKEFLFDTSCKRQSGSHGDKSWTGSHKSYPSGPGSVLGDETCRSP
                     EASVKDSGDKSRSGRGMGESDRSGILSYRKRESSPRGNGKSTRRRTVGSQQSEGAASE
                     SVESTSWRGFPSRGGTISGSPFARAPLSQSESVFGRSLESTSSKDGDQVHRADHQATT
                     SSHATQKPSGLRTSVYQGHTSDGSDNSSDNQEVQLKIPVGVSRLHLVELPNLKMKPIY
                     WSPLHDISSVLRATWFYKNTMLPVETELANKLEDGYVYLKPWSETWQDELNSCVENGA
                     DAEMKIVHRLWPKDDTKRLSSVTLMRDQETPSPVLGGPERLATPSPAIASLDESHAAG
                     GPAAHSEAVKQYINSSVIYVDGRDAQILRPSLLPSVSRGRRPLSAIRKGRQIGIPVIR
                     GFNRRLWDQLHPSKPNPVDVRNYLRSTQSRTVSTASGGRQICYACAIEEMRPAPTDLV
                     LVIHGIGQKLSERMESFHFTHAINAFRRNINMELNSEPVWPHVRQGHGGIMILPVNWR
                     STLSLEDANFDSQGVEDPISNKFTLHDITPETIPAVRSLISDVMLDIPYYMSHHKPKM
                     IQAVVKEANRIFRLWCKNNPGFQQNGRVHLLAHSLGSAMALDILSHQPTHVPDIDFSK
                     TSIPGDIFEFDTKDLFICGSPAGFFLLLNKANLLPRRGREKPGCEGDDLVRGVAGEEG
                     TYGCLAVDNLYNIMHTTDPVAYRVNAAVDSDLANSLKVTSIPSTSASFWKSFGSVFRW
                     SSAPSMMAAANVAPSRPAVISKLPSNVELETHDFTREEIAEKRMFLLNDNGQIDYYLS
                     GGGGPLNIQYLNMLSAHSSYWTLSDFVRFLVIEIARKQGKDHTIPAFRAEKKKNWKVH
                     KG"
     exon            complement(682003..683940)
                     /number=1
     exon            complement(683998..684984)
                     /number=2
     CDS             complement(join(685571..685646,685730..686340,
                     686395..686911,687021..687034))
                     /codon_start=1
                     /locus_tag="AO090012000278"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000277"
                     /protein_id="BAE60482.1"
                     /transl_table=1
                     /translation="MLSPASFWNMSPEMGDTTLPSDTSTNSSQSIGSGSESDQSLYYP
                     EISSLSPVRNFQPFSVGVPATERLRVAVHDGYEYTPTYNTHPEAMASQAAILEYDNPR
                     KHPLSPVEEHINICKRESSELDHIDSSLGQTRSSHKRLFGRNGWLGGTADLGNLSSEK
                     HRSKSLKDLRKKIVDGFTEGMAKASLTIIHEPRGMKDDLPQPSIPISLNPSIQATLYS
                     ELEVTICVNANAFLVEQYHEGRLPGESVRRINDYWGSKNRPSVVEFQFDQATQHRLIS
                     ENKRFLRFHGESSTNPVLLNSNLRNWKAIVKEMSIRTFCTPDSVIRKHMHDVYKLLDM
                     LGAPIAALVVCQKLHMRVLSLMVKKCDMPTDSGSNPVSGQSIGPTQRLLLSSVPVFLP
                     FVDLAACFQLCSS"
     exon            complement(685571..685646)
                     /number=1
     exon            complement(685730..686340)
                     /number=2
     exon            complement(686395..686911)
                     /number=3
     exon            complement(687021..687034)
                     /number=4
     CDS             join(689090..689740,689804..690097,690151..691116)
                     /codon_start=1
                     /locus_tag="AO090012000279"
                     /note="2-polyprenyl-6-methoxyphenol hydroxylase and
                     related FAD-dependent oxidoreductases"
                     /old_locus_tag="AO070343000278"
                     /protein_id="BAE60483.1"
                     /transl_table=1
                     /translation="MAQTQEKYDIVIVGAGPVGILLSLCMSRWGYKVKHIDNRPVPTA
                     TGRADGIQPRSTEILRNLGLKRQIMAYKPAKVYDVAFWDPLPGEQGIHRTGSWPSCPR
                     FIDTRYPFTTLVHQGKIERVFLDEIEKAGTTVERPWTITGFKNDGLDETYPVEVQLKC
                     LDTNVIQTVRSKYLFSGEGARSFVRQQLGIQIHHKDPISYVWGVMDGVVRTNFPDIET
                     KCTIHSDAGSIMVIPREDNMVRLYVQIASSSDPDFNPRKTATAEEVQEVAKKILKPYW
                     VEWDRVEWYSVYPIGQGISEKYTLDERVFMGGDACHTHSPKAGQGMNTAFHDALNMAW
                     KLHAVESGLADRSILSTYETERKDIAETLLNFDAKYASLFSKRRPTAGEVGSASHATV
                     ASGGEEEDEFVKTFKSSCEFTSGYGVAYKPNIFNWDSSHPAKSSLFEVPGVRLAAGRA
                     FTPSTVTRLADANFVHLEQEVPANGAFRIFIFAGKQEKTKKAITDLAANLEKERSFLS
                     VYRRPDIADVSFFERHQPHSKLFTLCLVYAAQKNQVDMEAVPQILRDYHHHIYADDIP
                     DVRVPNAKFAAHEKLGFDPEKGGVVVCRPDSHVACTVQLVEGSGTADALNAYFNAFST
                     KPLGQDQQQSRL"
     exon            689090..689740
                     /number=1
     exon            689804..690097
                     /number=2
     exon            690151..691116
                     /number=3
     CDS             694148..695830
                     /codon_start=1
                     /locus_tag="AO090012000280"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000279"
                     /protein_id="BAE60484.1"
                     /transl_table=1
                     /translation="MNSHSQNPDDYYNLGSFHRPVTTASSEAQTWFDRGIIWTYAFNH
                     EEAVHCFEKAIEYDPTCAMAYWGLSYALGPNYNKPWQFFDQRELEMTVQRTHRAAESA
                     RKHGITARPVESALIEAVQKRYPQDQPLGDCSPWNQGYADAMGLVYQRFPDDLDVATL
                     YADSLMNLTPWELWVLQTGQPAPTARTLEIKTVLERALTQDGALRHPGLLHMYIHLME
                     MSGAPETALLAADNLRGLVPDAGHLNHMPTHLDILCGDYRKAIASNSEAIRADKKFLA
                     RAGAVNFYTLYRSHDYHFRIYAAMFAGQSRVALDTAQELESSIPDELLRRESPPMADW
                     LEGFLAMKVHVLIRFGRWQDIMHLDIPRDEKLYCVTTAMIHYGKGVAFAATGQVDQAY
                     KERELFRKALKRVVPTRMLFNNKCIDILAIAEAMLDGELEYRQGNFDAAFSHLRRSIT
                     LDDGLPYDEPWGWMQPTRHAYGALLLEQGRVEEASAVYSADLGLDDTLPRALQHPNNV
                     WSLHGYQECLMKLGRIAEARIIKQQLKLAAATADVRVQSSCYCRRSDTDQVE"
     exon            694148..695830
                     /number=1
     CDS             698341..699723
                     /codon_start=1
                     /locus_tag="AO090012000281"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000280"
                     /protein_id="BAE60485.1"
                     /transl_table=1
                     /translation="MSLPLSNDVLLLVGEFLEDHQDRYNLVFVCRRFHDLFLHLVYRS
                     ATLKSCAQTRSFMHAILHKPELARSVWSVHFDDWQQHHPFSSTSPSEQDMTSLNKWAE
                     TISHSHEEYVKWEQDLLQGVEEAWIALLLPLVNNLRQLRLVYPNKNAYLDRMMQRVMK
                     GEKPFDAQPAFSMLQEVSLGHQDSKEDTKGSYMPSQIFPFFQLPSMRMFSADSVIESS
                     PLQEDGHTSTAEALVAGSCLISEITLNSSNGSQGMENLIASCSSLKSFKYQHSDSHLL
                     AEGFQPSAFYRSLAGSKNSLHTLWLDNYGNHLPFTIAGVNETHDEWFGSLADFTALKD
                     IRIRLPNLLDIRYQPEPSTVLTDILPPSVESLYIEGCKENTLGMLIGQLKMVLNKRQT
                     RFSGLRRLDIEGFFHDEEDEDASGYQESAATTGGQKIIKPRVYEMAEPLRAACAEAGI
                     DLFLRDRVVS"
     exon            698341..699723
                     /number=1
     CDS             join(701205..701227,701315..701646,701945..702108,
                     702161..702358,702416..702610,702677..702760)
                     /codon_start=1
                     /locus_tag="AO090012000283"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000282"
                     /protein_id="BAE60486.1"
                     /transl_table=1
                     /translation="MAALGLVPALILIIGLGLVATYTGYVLGQFKLRYPHVHSMADAG
                     EILLGRFGRELLGTAQLVFLIFIMGSHILTFTVMMNTLTKHGTCSIVFGVVGLILSFV
                     CTLPRTLKKVSWLSISYYPKTLYLLQATDTTMYTVTALVIYRYGGKDVSSPALGSTSP
                     LVSKIAYGIAIPTIIIAGVINGHVACKYIYVRLFRNTDRMHKRNLVSIGSWILIGLVL
                     WTLAWIIAEAIPVFNNLLSLITALFASWFTCKFARLCWTKQSNACKIDGMSGIFWLFL
                     NWGRYTSSPRKIFLTVVNLIIVGIGGCLCGLGLYVSGKAIHDDPSNASFSCANNA"
     exon            701205..701227
                     /number=1
     exon            701315..701646
                     /number=2
     exon            701945..702108
                     /number=3
     exon            702161..702358
                     /number=4
     exon            702416..702610
                     /number=5
     exon            702677..702760
                     /number=6
     CDS             join(706906..707110,707169..708511)
                     /codon_start=1
                     /locus_tag="AO090012000284"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070343000283"
                     /protein_id="BAE60487.1"
                     /transl_table=1
                     /translation="MQPYFGLRGALLNRAIIWLVVCPAFVCYGYNQGVTGGLLTLESF
                     ARQFPQMNTLTTKGAEQHYNSTIQGTVVALYTVGGIFGSLSCIYLGDLLGRRRVIFIT
                     SAISLIGAVLMATSFELAQFIVARLVLGVGTGGYVATVPVWQAEISQAKKRGAHVVTD
                     GIFIGAGIAISLWIDFGFYFVKGNSVSWRFPLAFQVVLSVIVMLFITVFPESPRWLVK
                     RGRVEEAREILAALADQDPHSEDINMALADIERSLALSGSGSWKDMLTMGEQRLFHRT
                     VLAATGQMFQQMCGINLITFYATTIFEQYLGLSPIQSRILAASMTLTQPLGGFLAFFT
                     IDRLGRRPLMLWSAVGMSASMAILGGTTSVTDNTGTLVAAVVFLFVFEFIFTVDYSGL
                     TFLYATEVAPLQLRAAISAVSTAAVWTFNFLLAEVTPVGFNTISYKYYIIFAVLNAAI
                     VPVVYFFFPETNGRTLEEIDEIFLRSKTIFDPPRLARTLPKMHLAEDVEIEGGNESGG
                     SVAKGKM"
     exon            706906..707110
                     /number=1
     exon            707169..708511
                     /number=2
     CDS             complement(709375..709776)
                     /codon_start=1
                     /locus_tag="AO090012000286"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000285"
                     /protein_id="BAE60488.1"
                     /transl_table=1
                     /translation="MNCLSSGASNSRGDFALFDVDTGPEPILLSSFLSVIQTQLTNVP
                     ILRIGLRGRTNRLHDLLQSLRSSRGPKTNGLRREVNLVGEVVPCASHEVSRPLRLAVC
                     QPAESLLVAAVLELGEMALNPLLAYAIHRAT"
     exon            complement(709375..709776)
                     /number=1
     CDS             complement(709929..710729)
                     /codon_start=1
                     /locus_tag="AO090012000287"
                     /note="reductases with broad range of substrate
                     specificities"
                     /old_locus_tag="AO070343000286"
                     /protein_id="BAE60489.1"
                     /transl_table=1
                     /translation="MPIPVPSANSLTDLLSLKGKVVVVTGASGPRGMGIEAARGCAEM
                     GANIALTYASRPQGGEKNAEELKKTYGVEAKAYKCDIGNMESVQKLVDDVIKDFGQID
                     AFIANAGRTADGGVLESTVEAWMEVVQTDLNGTYHCAKAVGPHFKKRGKGSLVITASM
                     SGHIANFPQEQTSYNVAKAGCIHMARSLANEWRDFARVNSISPGYIDTGLSDFVDQKI
                     QDLWLSMIPMGRNGDAKELKGAYVYLCSDASSYMTGSDLRIDGGYCVR"
     exon            complement(709929..710729)
                     /number=1
     CDS             join(711324..711409,711516..711584,711633..711686,
                     711762..712223,712279..713248)
                     /codon_start=1
                     /locus_tag="AO090012000288"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070343000287"
                     /protein_id="BAE60490.1"
                     /transl_table=1
                     /translation="MSSDPVEAPSLRRVSTSYDNNFDDSFLGRHNDIRDQEIELHTWN
                     GKNDPDNPFNWSTSYKWTLTITVCIISILTGIPAGSYGAGNNYMAERFHVQNEPFPNL
                     AWATTSWNMGAAFWPLIFVPLTESSGRMPGYFVAYTILVISLFPSAFAQNFATLVVTR
                     FFGGGASSVAINIVGGSISDVWYGDKARSLPMSLFGLTSVIGIALGPFVGSAIQAIHK
                     NDPWRWIFYIQIIYNAGLIPVFWFLLYETRADVILKRRAKKLRRETGRPIYAEAELDH
                     TSVWKLLQVSFERPTRMLLTEPVVAFFTLWISFAWGILFLFFSSVVQTFSTNYGMNTL
                     QTGLIQLAISVGALIGTLVNPLQDMIYLRSASRNKEKPGVPIPEARLYTSIPGSLLFA
                     GGLFWYGWSSFPHVHWIVPTCGIAATGLGIYSIYMAVVNYLTDAYEKYAASALSAASL
                     GRNSFGAFLPLASYQLFENLGYGWAGSLLGFVGVALSVVPVVLVLKGPEIRRRSPFMR
                     ESTFAGAEEKEELEKNETAGGRTFVDGPVEVGDTASGR"
     exon            711324..711409
                     /number=1
     exon            711516..711584
                     /number=2
     exon            711633..711686
                     /number=3
     exon            711762..712223
                     /number=4
     exon            712279..713248
                     /number=5
     CDS             complement(join(713505..714892,714961..715236,
                     715311..715495,716703..717124))
                     /codon_start=1
                     /locus_tag="AO090012000289"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000288"
                     /protein_id="BAE60491.1"
                     /transl_table=1
                     /translation="MAAVGLVALATYQPELVHHARAKYSEAINRVNNALASPVESVKD
                     STLMSVISLGVFEHVSNFESWVRHVKGAAALVVARGKSQFARRPAILMFNQVRADMSA
                     ACIQSIQPFPDDMLELQAEATKYTDPSDAFWLLGVLATHHSPLSHILMTVAPPSPNSP
                     AAELQQRPPRYPGEDTTPTSKREIWGWYAYGIAAEVFAVCGVGSFLPLTLEQLAREQG
                     TFKSSHLPCVGPGSPSTSVNGTAPAMLRRDEAENDQCVVGLLGLNINTASFAMYTFSL
                     AVLVQALTLISFSALADYENNRKTLLLAFGFIGSATSMLFVFIAPPIFVLGALLVVIG
                     VTCLGSSFVVLNSFLPVLVANDPSIEKASKPAEELHPMSPDGEYIHPRDSFSASDAES
                     GPHPAAEAGSGTSSGPASPELQLSTRISSKGVGLGYCAAVLVQILSISLLFTLSKTSI
                     SKVSGTLPLRFVLLLVGIWWFSFTMVTRKWLRARPGPPLNTANTGGQVKRWRVWLRLV
                     GFAWKSLWKTVKIAVQLREVLVFLAAWFLLSDAMATVSGTAILFARTELKMSTTLVGL
                     LSITATLSGMAGAFLWPVVSRRFGLKSNHTIMLCIALFEIIPLYGMLAYIPVFKKWGV
                     IGLQQPWEIFPLAIVHGVVSGGLSSYCRSFFGLLIPPGSEAAFYALYAATDKGSSVIG
                     PAIVGMLIDATGQVRSGFFFIAPLILMPIPLIWIVNAEKGRREGVAMAQRLEKGHETE
                     MSEQTEEAEGLLARGI"
     exon            complement(713505..714892)
                     /number=1
     exon            complement(714961..715236)
                     /number=2
     exon            complement(715311..715495)
                     /number=3
     exon            complement(716703..717124)
                     /number=4
     CDS             join(718496..718779,718842..719352)
                     /codon_start=1
                     /locus_tag="AO090012000290"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000289"
                     /protein_id="BAE60492.1"
                     /transl_table=1
                     /translation="MGAVTYADGIAILQLIIFPFILVASLFIWKRTGWRVGAKIWRYP
                     FMLSLIRLAGSIATLISIDHDSKQVRIAMFVCQLIGIAPLLLAYVGILRLIDLEKKIP
                     HRPLLLVTVMGIVGLILGIVGVSTADTTNGYTPGALPKVAMGLFLAIYVIVMLLTAWL
                     FFTYSFSMRKYQKRLFLAIVLSAPFLLVRLIYAALGDYSSNTTFSMMSLAEDNNTSLT
                     AYLCMAVLEEIISMVIAMAFGVSAVLQADYVKPTREGHLEVKPDNV"
     exon            718496..718779
                     /number=1
     exon            718842..719352
                     /number=2
     CDS             join(725372..725390,725574..725866,725880..725915)
                     /codon_start=1
                     /locus_tag="AO090012000292"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000291"
                     /protein_id="BAE60493.1"
                     /transl_table=1
                     /translation="MLLFNTSTPNALDTTGLCLLSLDGGGVRGLSSLYILKHLMTQLS
                     RERPELGQVKPCEIFDLIGGTSTGGLIAIMLGRLEMSVDECIDRYIKLISTVFEKKSR
                     WPAISGRDLTQRS"
     exon            725372..725390
                     /number=1
     exon            725574..725866
                     /number=2
     exon            725880..725915
                     /number=3
     CDS             join(726041..726629,726688..726749)
                     /codon_start=1
                     /locus_tag="AO090012000293"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000292"
                     /protein_id="BAE60494.1"
                     /transl_table=1
                     /translation="MASFVCTTSHETKDIVRLRDYNVPSKDNISATICQAALATSAAT
                     TFFDPVYIGKRKFVDGALGSNNPVDEVEGEAADIWCPGTGDLKPLVKCFVSIGTGDPG
                     IAAIEDKALKFLSETLVNIATETGRTEKKFIARWAKHYDEKRYFRFNVEQGLQGVGLE
                     EYREQGKIEAATHRYLDHQAQEFRVRDCVQNLKLKRGSAMSNISRILNVCRDHELK"
     exon            726041..726629
                     /number=1
     exon            726688..726749
                     /number=2
     CDS             join(726811..728944,729135..729139)
                     /codon_start=1
                     /locus_tag="AO090012000294"
                     /note="TPR repeat"
                     /old_locus_tag="AO070343000293"
                     /protein_id="BAE60495.1"
                     /transl_table=1
                     /translation="MTLVGRRFANANFLTASSTKAPWTVPFRRNPLFVSRSAEIAKLD
                     DILSNDSAFSQVAIEGLGGVGKTQIALEYAHILRERHPDCAIFWIPVTSVESMLEAYS
                     QIAKELQIPNVGIETKNIQNIVQHRLSQESSGRWLLVLDNADDISFWADKTKGTTTSN
                     LPNSKHGSILFTTRSHKTAIRLAGRNIVTVKAMNSALAKNLLGNTLIDRSLLTDERAT
                     ADLLQKLTYLPLAIVQAAAFINKNQMTLSEYISLHESTEESTIDILSQNFEDEGRYED
                     GKNSVATTWLISFQQIRASDPLAAEYLSLMACVDSKNVPQKFLSLTQSATKTSDALGT
                     LKAFSFITNHENSQHLDIHRLVHLATRNWLQMQGTLLEWTNKALSHMNMLFPFPREEN
                     RHMWRPLLPHARHIIESLAPSTPTRAAIYLLHIFGYGVLQDGRYREARRAFSTVTDFY
                     KTSLGIEHPVTLSTQATLAQIYLRQGEWSKAESLNMQTLDSLKKVVGFESMVTLTSMT
                     AQVSIYCAQERWTEAEKLELQTLKFYERALGTKHPQTLMNKSYLALIYREKGKWNQSR
                     KLNLQILKCHRTALGTEHPLTLISTRNLADDYRYLGLLRKAEALQTQATETSKRILGA
                     EHPDTIRATGSLASIYRERGRLKDAEKLHMQVLENYRKTLGAEHPSTLWAMAPLADTW
                     RRMGRYTEATELLEKCLHLETKVLGADYSV"
     exon            726811..728944
                     /number=1
     exon            729135..729139
                     /number=2
     CDS             join(729469..729619,729671..729982,730036..730559,
                     730606..730927,730981..731123,731193..731384)
                     /codon_start=1
                     /locus_tag="AO090012000295"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070343000294"
                     /protein_id="BAE60496.1"
                     /transl_table=1
                     /translation="MHSTARQYDSLEGMSRTEPDVEPALPHEEQPLLSSEDIWKPPKG
                     FLWIQIAIMSNVFLSGFDGTITASTYAVISSEFNAANTASWLTTSYLITSTAFQPLYG
                     RFSDIFGRRASFFTATITFMVGCIGCGIAKDIIFLNLMRALTGIGGGGLMTMATIVNS
                     DLIPFRRRGMYQALQNVMHGFGSICGASFGGSIVDSIGWRWCFLMQAPVGLLALITGH
                     LVIHLPRKTDLIEPGQGLRAIWQRIDLSGACVLILGLSSQLVGLSLGGNDLPWSNIWV
                     ISSLVSSVILLGAFVVIETKTSAIPLIPPRMLRGLLPIATQVSNVCVGMAAYAFLFTL
                     PLLFQVILLDSAAKAGARLAIPSLATPVGGVISGIVMSRWGKLAQLVRVGALLMCIGN
                     LLVMSLQFNDAGWKYFTYVIPASLGQGIVYPGILFTFLAAFDHSDHAVSASTVYLVRS
                     LGTVWGVAITSTIVQNTLRSGLAEALSGVPDKWKIIDDIRHSVSAIHDLPPDVQMAAR
                     LVYYRGIRLSFMASACFGFVATIAALFTKGKGLHRANNA"
     exon            729469..729619
                     /number=1
     exon            729671..729982
                     /number=2
     exon            730036..730559
                     /number=3
     exon            730606..730927
                     /number=4
     exon            730981..731123
                     /number=5
     exon            731193..731384
                     /number=6
     CDS             join(732191..732773,732838..733177,733249..733523,
                     733598..733831,733908..734008)
                     /codon_start=1
                     /locus_tag="AO090012000296"
                     /note="amino acid transporters"
                     /old_locus_tag="AO070343000295"
                     /protein_id="BAE60497.1"
                     /transl_table=1
                     /translation="MSKQDLKPNHDLSTPSIELANGQVAVTGLPNAPMKQNFSILSII
                     AVGYNISNSWVAIAASFAIAIQSGGAVTLLYGIILVAAIMLCTGLTLAELASVYPTAG
                     GQYHFTSILATSRWSRSLSYSSGLAAVFSWITLSASIALSSANVLMAIIIRWRPEYQP
                     ETWHYFLVYQAMNAVMVLYNIFLTNKTLWVYNLGFVLSISTFLAITITCPARSSIQLD
                     SSHVWTQFANGSGGWPDGISFLTGLSTPQFMLSGLDATLHLAEECLQPERIVPKAVIV
                     TVIVGFLTAFPFSVAIIYSYKDVELSLTTPTGFPIYFIWEKATHSPVAATIFMACMLT
                     VSCIALNAVHQTSSRLTWSFARDEALFYSNKLASVSPTLGVPVYAILLDGLWVLLLGV
                     VYVASSNAFNAFISTTVVVAQISYAIPSALLLYRRRSTDYLPSSRPFKLINSVGYIVN
                     IVTIVWALVLTVFFSFPTVLPATGGNMNYTSVVLVAMLVLGIVNWFAYARKHYHGPRL
                     EL"
     exon            732191..732773
                     /number=1
     exon            732838..733177
                     /number=2
     exon            733249..733523
                     /number=3
     exon            733598..733831
                     /number=4
     exon            733908..734008
                     /number=5
     CDS             join(735617..735657,735895..736009,736067..736134,
                     736199..736283)
                     /codon_start=1
                     /locus_tag="AO090012000297"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000296"
                     /protein_id="BAE60498.1"
                     /transl_table=1
                     /translation="MSYQQQPPYPPQPAYGPPPGNYGPPQGGYPPQQYGGYPPQGPPP
                     GQYAPQPQMGYPQQQPAPQQEKKSHGCLGACLATLCCCFLCEESCECCIDCIECCEMC
                     "
     exon            735617..735657
                     /number=1
     exon            735895..736009
                     /number=2
     exon            736067..736134
                     /number=3
     exon            736199..736283
                     /number=4
     CDS             join(738036..738155,738213..738668,738719..738835,
                     738884..739073,739123..739542,739618..739772,
                     739842..739949,740014..740361)
                     /codon_start=1
                     /locus_tag="AO090012000298"
                     /note="alpha-L-arabinofuranosidase"
                     /old_locus_tag="AO070343000297"
                     /protein_id="BAE60499.1"
                     /transl_table=1
                     /translation="MLRKRFLLPLLAACGAAVEISVASSGGNATSGLQYGIMEEEINY
                     CGDGGLYAELIRNRAFQGGEKYPSNLDAWIPIDGSALSLKNLSQPLSSALPTSVNVKG
                     TAGKAGLTNLGWWGIDVREQTYTGSFYVKGAYNGTFTASLQSNKTGEVYASAVIVSKS
                     ARGEWTQHNFTLTPTKAASNTQNTFSITFDASNTVDGSLDFNLISLFPPTYNDRPNGL
                     RRDLMQAMADFGPKFLRFPGGNNLEGDTLDGRWKWNETIGPLKDRPGRATTWSYQETH
                     GLGLVEYMEWCEDLGVEPILAVWGGFALNGDAIPESELGTYVQDALDELEFLTGSVDT
                     EYGALRASLGHPDPWTVKYVEVGNEDNLNDGLDSYKSYRFQAFYDAIKEKYPDITVLA
                     STVEIDFPGDAGGDYHLYDTPDNFVEKFNYFDQYSPDHPILLGEIAAIQLNGREIVWG
                     NSSHFSQYPWWIGSVAEGVFLIGAERNADKVLGTTYAPFMMNLDNYQWSPTFLAFNSN
                     PDETARSTSWYLYDLFSHNSFTHTLPTTSNSSFGPLYYVAGVDNTSNSHIFKAAVYNS
                     TADVPVSLTFDGVKAGTSASLTVLTAADPLGMNEVGAANIVDKKTSTVTAGVNGVFDF
                     SLPNLSVAVLKTE"
     exon            738036..738155
                     /number=1
     exon            738213..738668
                     /number=2
     exon            738719..738835
                     /number=3
     exon            738884..739073
                     /number=4
     exon            739123..739542
                     /number=5
     exon            739618..739772
                     /number=6
     exon            739842..739949
                     /number=7
     exon            740014..740361
                     /number=8
     CDS             complement(742116..743633)
                     /codon_start=1
                     /locus_tag="AO090012000299"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000298"
                     /protein_id="BAE60500.1"
                     /transl_table=1
                     /translation="MVRSQSQQTPVSHRPSLASPMTGHRHSYGPQRINRHLDHVNEYS
                     PSEYAKQYLDDYQAQGGVSALSMALSTDATATGVQPSNPSFVPQYHGQSDMVNLTGLG
                     KPSLVNQPTQPVSAAVEMSRTPTTDSLCGGMGMMRFDSSGPHLNPNCSFPFASSDFIP
                     STSPMNVPFTNPFTSAQRDMDHVSFPLIDSTATPFSCSAPPATSFAPPVSTLSSSPAT
                     EMKHSMSSDSSSSSLSQPSRAARRTQEQIVQGTRPIAPKVGSQSMSPPKATEQTKMIR
                     ISSSDGTSKEVAAIPKASIQRPPRQKTYCTMCNDQPDGFHGEHELRRHIERVHAVVRK
                     VWVCVDISPGKTFLANCKACRNGKRYGANYNAAAHLRRTHFNPCQRGRGGRGKDSEKR
                     GGKGGGNHPPMEVLKHWMVQKEEVVLENAQNYIDQEALGDDLVAAPPPIPTEDMINGL
                     PTISPEDFPVPGLESTLTNGYDTLSTFPVMGLEPSLDASCYLDAQPLVPEIDSYV"
     exon            complement(742116..743633)
                     /number=1
     CDS             complement(join(743791..743802,743927..744229))
                     /codon_start=1
                     /locus_tag="AO090012000300"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000299"
                     /protein_id="BAE60501.1"
                     /transl_table=1
                     /translation="MAVNMADEELFKRAISGYRDAFLDRHSHLSEAERNELWSEQLNQ
                     FMPTAAAASSPSYRPVSGSGILDNDGSSLEKSGKRTRQDTPRTLPGSGLPPTKRRVTS
                     LD"
     exon            complement(743791..743802)
                     /number=1
     exon            complement(743927..744229)
                     /number=2
     CDS             complement(752034..752714)
                     /codon_start=1
                     /locus_tag="AO090012000301"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000300"
                     /protein_id="BAE60502.1"
                     /transl_table=1
                     /translation="MQVNSVEDFGDSIPATSIVTTQPESAVSTPASEPSVPKQSTIKI
                     QNPPAKESQKDDSITVALRQAGEEAAAKAKESKAEKATPAAEQKQPLPPAVEEKKEGG
                     ADSVRRKSSVAPEIVEGANPKRPPLVPEVAAVSSANFHADNAEALGLVEHHRGSIVSA
                     TSPEEKAKVAQDIRKSISGGHAEMLESLRDDQAQKAGQEETIDEESESGEAVEDAMNR
                     KAKKPGSS"
     exon            complement(752034..752714)
                     /number=1
     CDS             complement(join(754606..754869,754953..755186,
                     755331..755573))
                     /codon_start=1
                     /locus_tag="AO090012000303"
                     /note="D-ribulose-5-phosphate 3-epimerase"
                     /old_locus_tag="AO070343000302"
                     /protein_id="BAE60503.1"
                     /transl_table=1
                     /translation="MSPPAIIAPSILSADFASLGSECSTKMAQGSDWLHVDIMDGHFV
                     PNITFGAPVVTKIRSHVDRPTQPHGRGTFDCHMMIMEEFKNAGCDLYCFHYEAAVASV
                     AATEPADSTTTRKTSPKELIRYIHEEGMQAGIAIKPDTPVDVLWEILESKDEKERPDM
                     VLVMTVYPGFGGQKFMASELPKVQALRERYPNLNIEVDGGLGLGTVDQAAEAGANVIV
                     AGSAVFGAQDPADVIAKLREAVNKRQKL"
     exon            complement(754606..754869)
                     /number=1
     exon            complement(754953..755186)
                     /number=2
     exon            complement(755331..755573)
                     /number=3
     CDS             756962..759910
                     /codon_start=1
                     /locus_tag="AO090012000304"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000303"
                     /protein_id="BAE60504.1"
                     /transl_table=1
                     /translation="MTESLRSATARCPPPRQARGTRLNTIIEDSREGQYSETPRQREA
                     VSNKNASQPQLRLKTSGLALASRLNRLLSPLSAGTTSSCSDTEWQNQMQTFDDLYDAT
                     DEESEMSDECTSISSTRPTSMTTPTTRNSVSPTSRNRYPSLTIPSSTTWPSLQGAPKS
                     SPIPPTPPPKIPVSPAALSMLGHSVPAVHAPPSLDGSVSSDQVSNISAPATPDVQSLP
                     DNDWNPHEILVRPDLEDEEDVDLQNPETSSDLQSIEIAIENTEEDWRQFLGNFPRIPD
                     QVRSPVVANPVREDTPSDTGVHLPEDALAMLRHIPLDVTPDPWSETSESNEEMWQIET
                     PERPRSADDATPASDLSGYSFSSLSIPSPGGFFASLGPRARHTWSIPKLNNIPSSAIA
                     ERFYDLPFTRTEGEIVEQIIECPQVSTDEQLTAVYDPNGPPTAIRIPSEEPESHLEHA
                     ESPVSDDVDGVYEIARQGMYNPEERDENYEDELQKKAMASLDRTSVWLAAQASYLAAL
                     CETNPANTPVSEREDCMAIAQSVTQAVAQVVSKKSVRFDETVPEAPSSQPSALASKDS
                     IYWRGFQSIRRCASDIDTFMHRTMRFDAVQSIRLGLPNMHTNSLLGNYELVRPERPPY
                     RGPFSQAPRDSVVGSILEEKAQFSMLEKEQLVLTQISEPLWAMDALRYLNGGHLIASP
                     ALRRLAKSRSVSAKPQRSGSRRIRVLDLGGHASCEWAWQIAHDYPNVKVYTVFTEHQA
                     VNRGIKGPANHRQISVQSLWQLPFSNNKFDVISTRSLPALLKSERSSGDQQDEYDLCL
                     KECRRCLKPGGYLEFFVMDAQISRAGPYASATSVEFTYNLKTRGYDPNPTKTFLGRLQ
                     KSGFVRIKRAWMFLPMGNEPAVSAVPRETPEPRVKSHISECEAVQGPVGSTADAASVT
                     GLFGGWIWEQWLLKLQIEMGREQGRLLEGIGSVFDEGRKNGVGWTCLSGWAMKPRQKK
                     PNGSQKNRDS"
     exon            756962..759910
                     /number=1
     CDS             join(761309..761383,761722..762639,762694..763923,
                     764754..764852)
                     /codon_start=1
                     /locus_tag="AO090012000306"
                     /note="predicted hydrolase involved in interstrand
                     cross-link repair"
                     /old_locus_tag="AO070343000305"
                     /protein_id="BAE60505.1"
                     /transl_table=1
                     /translation="MSTRMRHGLLAGALQFRYHSVVPVKKGSTPSKPSSRSKQPSSVK
                     RNSSLLNFFQKADGPPQATSRQSRITQFATKVDRPTGSGHNSPSLRREDSSKSNGGGG
                     LFLDERNGKKSASLDPSTPPRSRSRTPDDIWGEDDGSIVAPKEEEDRYNENGSAVKKR
                     KVESESDSPRTEQVKDEASATTPAPAKSRQVSGPFIDESDSEEDLAAFGDFSDEPAML
                     KNAEAVKDAAGTDNDRKDDDRTSDVAVPPLVREATSHFEDNELANFDDLEEDEVRGEG
                     GLLDQENDDEGPEETIFGFDDSNDSPAPEECEVDPGGGVAVCPICQIELVGLSDVDVS
                     VHVNDCLDGKPAIVLPKPKTDTSAKALTRAELASIARPPQNDPYSSGTSKSSSAFSKL
                     MAGNAEDTAWTAAAASEVKSKGKQAYQRTCPFYKIIPGFSICVDAFRYGAVEGCNAYF
                     LSHYHSDHYIGLTASWRHGPIYCSKATGNLVRQQLKVDPRWVVDLEFEKTTEVPNTGV
                     QVTLIEANHCPGSAIFLFEKAMGSGQSKRIQRVLHCGDFRASPTHVQHALLRPEIVDS
                     VTGQKRQQRIDVCYLDTTYLSPKYSFPSQIDVIEACAELCASLDRGEDEGPAPWQSGK
                     ASKEGGGIMSKFFNSVTGSGKSQERSSRPQGRLLVVIGTYSIGKERICLAIARALKSK
                     IYATAGKQRVCACLEDAELSSLLTDDPVEAQVHMQTLFEIRAETLADYLDSMKPHFTR
                     VLGSKLIKSASPVMDVDATNKSVGIEWAVDHDS"
     exon            761309..761383
                     /number=1
     exon            761722..762639
                     /number=2
     exon            762694..763923
                     /number=3
     exon            764754..764852
                     /number=4
     CDS             join(765362..765663,765790..766596,766668..767112)
                     /codon_start=1
                     /locus_tag="AO090012000307"
                     /note="cytochrome P450"
                     /old_locus_tag="AO070343000306"
                     /protein_id="BAE60506.1"
                     /transl_table=1
                     /translation="MIAELLTPTGAAYVLTAAVIVYYILPYLQLWRLRDIPSPGFAAF
                     SNLWLMLQYRKGNRFVTVDNAHKKYGKLVRIAPRHVSIADDEAIQAIYGHGNGFLKAD
                     FYDAFVSIRRGLFNTRDRAEHTRKRKTVSHTFSMKSIGQFEQYIHGNAELFVKQWNRI
                     ADTQSNPKTGYATIDALNWFNYLAFDIIGDLAFGAPFGMLEKGQDIAEMRKSPNDKPS
                     YVQAVEVLNRRGEVSATLGACPSLIPWAKYIPDRFFRDGLEAVENLAGIAVARVNERL
                     RPEVMANNTRVDLLARLMEGKDSNGNKLGREELTAEALTQLIAGSDTTSNTSCAILYW
                     CLRTPGVIEKLHKVLDESIPKDVDVPVHAMVKDIPYLQWVIWETMRIHSTSAMGLPRE
                     IPAGNPPVTISGHTFYPGDVVSVPTYTIHRSKEIWGPDAEQFVPERWDPKRLTARQKA
                     AFIPFSTGPRACVGRNVAEMELLVIVGTVFRLFDFEIQQDGPMETREGFLRKPLGLMV
                     GMKRRSVAV"
     exon            765362..765663
                     /number=1
     exon            765790..766596
                     /number=2
     exon            766668..767112
                     /number=3
     CDS             complement(join(768565..768618,768700..768869,
                     768917..769346))
                     /codon_start=1
                     /locus_tag="AO090012000310"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000309"
                     /protein_id="BAE60507.1"
                     /transl_table=1
                     /translation="MMPGYKRMESSSPQHARRSRRIANLTGNNGVAAPVKNEDNVADI
                     LDETDEDGPSHDTDDDYSSDDEDVENEIDEDGFRAFDKDPEYQKRYIVQDEHTGRVVT
                     IIPHETLRPINGVEYSDYKIHKNTLLYLMDLRANNRRSWFKRHQKEFRRAWKDWETFI
                     ETLTPKVIAFDSTIPELPPKDVIFRIYRDVRFSKDKRLYKPSPVRVEGDHMHATIST"
     exon            complement(768565..768618)
                     /number=1
     exon            complement(768700..768869)
                     /number=2
     exon            complement(768917..769346)
                     /number=3
     CDS             complement(join(769999..770564,770669..770726))
                     /codon_start=1
                     /locus_tag="AO090012000311"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000310"
                     /protein_id="BAE60508.1"
                     /transl_table=1
                     /translation="MCHYVLSTARQSPSVAGQAGLLDLRSGSICIDEIDISTISPDQI
                     HGRVIVIPQNMPLLPGSVRFNLTPNSDIDGATSRQPDDIMISALTAVGLWENIQEKGG
                     LDIVESDLSLSSGQQQLFSFARALVQKTLVETRYGTQTHGGIVVLDEANSNVDMETSL
                     LMQNLIKEEFAGCGWTTLVVTHRRETMDFADEVIVLDAGCVGDPVNG"
     exon            complement(769999..770564)
                     /number=1
     exon            complement(770669..770726)
                     /number=2
     CDS             complement(join(770806..771335,771478..771575,
                     771691..771695))
                     /codon_start=1
                     /locus_tag="AO090012000312"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000311"
                     /protein_id="BAE60509.1"
                     /transl_table=1
                     /translation="MKGIVHSAHEAPRFSQDITLIDMALPPAVFLTLIVILYCLQKFY
                     LRTSRQLRFLDLEAKSPLYTHFLETLNGLTTIRAFGWVSTFEESNIALLAESQRPYYL
                     LYCIQRWLNLVLDIFVGALAVLLLTFAVTLSDITSPGALGVAMINLLNFNQDLASLID
                     SWTRMETSLGAISRLRDLENNTPQPIHNKHSNQWSFQRSLDFKQVSASYG"
     exon            complement(770806..771335)
                     /number=1
     exon            complement(771478..771575)
                     /number=2
     exon            complement(771691..771695)
                     /number=3
     CDS             complement(join(771968..772200,772343..772362,
                     772466..772497,772618..772884))
                     /codon_start=1
                     /locus_tag="AO090012000313"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000312"
                     /protein_id="BAE60510.1"
                     /transl_table=1
                     /translation="MLGEIPCSQGLVRRYFKDVAYCDQVPWLRNITIRQNIIGDSSYS
                     FNEKLYDSVIEACALKTDFSQLPEGDQTIVGSNGVTLSGGQKQRITLLRPTVSLRRLT
                     VMVNTEPSSDLEPVKKPIRPPMDHIIRRNKEVDATRQSGDTAVYAYYLRAVGWRDSIF
                     LLILGAVSVFCDKFPSRSLIYNQ"
     exon            complement(771968..772200)
                     /number=1
     exon            complement(772343..772362)
                     /number=2
     exon            complement(772466..772497)
                     /number=3
     exon            complement(772618..772884)
                     /number=4
     CDS             complement(773452..773982)
                     /codon_start=1
                     /locus_tag="AO090012000314"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000313"
                     /protein_id="BAE60511.1"
                     /transl_table=1
                     /translation="MIRGSLVVIIFRKTLALDCGNNSDNSASVTLMSTDIDGIASAFD
                     SVHDIWACPIEIALGLWLLERHVGVACIAPALTALGFLALPMLLVLVLTKVLVFFLAS
                     LYLARFMGRGRREWNQAVQKRITNTSSFLSLMKEVKMLGLTDAVSTRIQRLRAIELDL
                     SKKFRVMTAWTSFLCE"
     exon            complement(773452..773982)
                     /number=1
     CDS             complement(join(775719..775731,775806..776457,
                     776508..778011,778061..778198))
                     /codon_start=1
                     /locus_tag="AO090012000315"
                     /note="sexual differentiation process protein ISP4"
                     /old_locus_tag="AO070343000314"
                     /protein_id="BAE60512.1"
                     /transl_table=1
                     /translation="MKEKETEPTVAVTTGAAIDEAAPDVAISHLKQLKKEHEWDPNLP
                     EDLIDNSPYPEVRAAVPNYDEGGHTNTIRAWVIGLVLSTVASGMNMLFSLRQPYIVIP
                     SYVVQVVAYPIGVGWAMLLPNKTFNVFGLKFNLNPGPFSKKEHAIAVLMANASFGGGT
                     AYATDILVAQRAFYKQRFGWGFELLLCICTQMLGFGFAGFFHRFLVAPAAMIWPSTLI
                     NTSIFSALHDRSLPDPRKVAGWTIGRYRMFLYCLVGSFVWYWFPGYIAPFLSVFAWVT
                     WIKPQSPVVNQLFGGWTGLSLLPITFDWTQISGFNFSPLISPWHAHANTLIGMVVFYW
                     ICTIGLHYNNAYWFKHLPISDSSSYDNTGSVYDVSRILTPEFTFDDAKYKEYSPLFLS
                     TTFALCYGLSFAGVIAVLLHAILFHGKEVLARVKTFRKTEDDVHARLMARFKPVPLWW
                     YGALFLTMLGIGLGVSLGYPTHLSWWAFFVSLIMAIVWTLPVGIVQAATNIQLGLNVL
                     TEFVIGYMQPGRPMAMMLFKTFGYISMSQGLYFCQDMKLGHYMKIPPRVTFAAQMVAT
                     LWTSIVQIAVMNWALGSIDGICDKDQPNHYSCPNGRVFFNASVIWGVIGPARMFSPGQ
                     LYSGLMWFWLAGAILPVLIYLGARIWPRSKIRYLSAPLIFTGAGLIPPATPLNYLSWG
                     IVGFIFNKWIRSRWRGWWMQYNYVLSAGLDVGLTLSTIVIFLCLQLTDTTFPSWWGTR
                     IATDTMDAAGTAVEITGEKFGPTTWPSG"
     exon            complement(775719..775731)
                     /number=1
     exon            complement(775806..776457)
                     /number=2
     exon            complement(776508..778011)
                     /number=3
     exon            complement(778061..778198)
                     /number=4
     CDS             join(783567..783616,784149..784196,784273..784316,
                     784368..784413,784446..784519,784648..784766)
                     /codon_start=1
                     /locus_tag="AO090012000316"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000315"
                     /protein_id="BAE60513.1"
                     /transl_table=1
                     /translation="MEFANAISVLRQVSIIKLPWMWVESYVGSSLVAPERACATTFLL
                     LGVFGKYGSTGVCWPMTHFTIGVYDIVELGCIDDGLSEVSAFNYPYGVGCIQNDISGM
                     KTEANYMNNNSTIVGMRENKVDES"
     exon            783567..783616
                     /number=1
     exon            784149..784196
                     /number=2
     exon            784273..784316
                     /number=3
     exon            784368..784413
                     /number=4
     exon            784446..784519
                     /number=5
     exon            784648..784766
                     /number=6
     CDS             join(787056..787176,787272..787480,787534..787674)
                     /codon_start=1
                     /locus_tag="AO090012000317"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000316"
                     /protein_id="BAE60514.1"
                     /transl_table=1
                     /translation="MPLSGHCLCKAVTYKADVEAPLITAYDHCDDCQRQSGSTYSLVA
                     VVPKDKLTINGPTKSYAGQGSSGKAVHRIFCSECGSPIAHDPEAAPEIIALKAGTLDV
                     EIKKNLKPLTWYACLGHRNLDCQQASILPGTSREAFRAHAVNTPWRMDDFYRAQ"
     exon            787056..787176
                     /number=1
     exon            787272..787480
                     /number=2
     exon            787534..787674
                     /number=3
     CDS             join(789034..789536,789643..789697)
                     /codon_start=1
                     /locus_tag="AO090012000318"
                     /note="citrate synthase"
                     /old_locus_tag="AO070343000317"
                     /protein_id="BAE60515.1"
                     /transl_table=1
                     /translation="MAGLLDRHSSRPDPTKLSCFRRFAMLNADHGMALTVFSALVTAS
                     SLTDPISCLISAVAAAYGPLHFGATVSAQRTLREIGSTDKVPEFIEGVKNRRTKLFGY
                     GHRSYKGLDPRVRPIQSILKDLDLSKNDYLKITERIEEIASADDYFRHRGLYPNADFY
                     GNFVFTAMDNGPLAGIHVYVLIAVR"
     exon            789034..789536
                     /number=1
     exon            789643..789697
                     /number=2
     CDS             join(790046..790297,790365..791234,791423..791440)
                     /codon_start=1
                     /locus_tag="AO090012000319"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070343000318"
                     /protein_id="BAE60516.1"
                     /transl_table=1
                     /translation="MNNSQGAAEDGPPTEITPLLQSHPGKERYSVFSTRQKRLIILTA
                     AIASTFSPISANIYYPALNSIAAGLDVSSSQINLTITTYMICQGLAPTLTGPFADQAG
                     RRPAYILCFLIYIISNIALALQHSYPALLVLRAIQSSGSSGTVALASAVAADVITSAE
                     RGTYMSITSLGNILAPSLGPVLGGVLSEYLGWQSIFWFLAMSSTIFFIPLVLLFPETC
                     RTIVGDGSIPASGWNKSILNWWMSKRPHRRPVLIPSASTEPAPQPQLPKRMIHPLSTL
                     SLLFHLPTGLIILSNGLIFASYYAITAGLPSQLRSIYGLSDLNIGLSFIPMGAGTLLS
                     ATFNGIIVDWNYRRIVAKDRQDIENFEAEKARLGVGGPVAPPTTS"
     exon            790046..790297
                     /number=1
     exon            790365..791234
                     /number=2
     exon            791423..791440
                     /number=3
     CDS             join(792025..792163,792339..792835)
                     /codon_start=1
                     /locus_tag="AO090012000320"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000319"
                     /protein_id="BAE60517.1"
                     /transl_table=1
                     /translation="MLCILLYLLWTGAVAQISPLPADIPILYFRYPETSWIYPGDVVL
                     KSIALHWYQPDMLCIMQDTGLLDMSNNKRISDEINGYSNGGILVNKSLGAEYIAPRPP
                     PFSHHRYVYLLFTQKGDYQFPQCYSHIFPQTATARAGFDIQQFVDVARLGAPVAGNYL
                     IVEYDGPEIEPTATAGPTTTWLRSILCEGSDPTGSAAAKACEMEGSLQIVM"
     exon            792025..792163
                     /number=1
     exon            792339..792835
                     /number=2
     CDS             join(793500..793806,793870..794632,794884..794998)
                     /codon_start=1
                     /locus_tag="AO090012000321"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000320"
                     /protein_id="BAE60518.1"
                     /transl_table=1
                     /translation="MSRRLGRPAKKRDNTQDDCLDRGISNHPRHQTNRRVRSPRKRKV
                     KRDSGKRSGHDITNPQDDEEVILDEITFNDSIVDDMSTEDPRLPTPPFLDTDRLSLYD
                     GSDTIDLSDNWLQEFISGQPADLTQDRNFLDALGLNSADSTLTAIPSSTNDFTGSAKT
                     IDVASSELQDQLPLAAYYPPASGFSSYSEPTTESAQIMSEIASPYTGFVKRESLAWSQ
                     TIPSSMGNDSARLSGTGEQLNPSITTKGQRRAHEYDHSSEGPVPTTISARQYQCQCHD
                     HIARDLMLLNISASRTWPTVTIDSILKCQQILQQLTDTILECAICCKTRVNLLMIVIV
                     SIDSLITALETITSVDSGVWDGVSSVIIWKIEHDFRDKSKGAVGYDENETACETLNWY
                     NI"
     exon            793500..793806
                     /number=1
     exon            793870..794632
                     /number=2
     exon            794884..794998
                     /number=3
     CDS             join(795698..796077,796131..796280,796452..796458)
                     /codon_start=1
                     /locus_tag="AO090012000322"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000321"
                     /protein_id="BAE60519.1"
                     /transl_table=1
                     /translation="METESSCSCSIDALQILTDVRNVDTVVEFETILDLVQRVYGQGQ
                     AMLSCKDCRKLPLQSSSFLTIPALTDHCLSLFEAVCSAYSITRKNCLFDANILAFEQP
                     LPQFICIRSKVQLGETDLDEAETGIDSSGNPSNTFNGQYPGTPSWGNNPAGVRVVHPV
                     NYAPLHGIPGPDKSRTTS"
     exon            795698..796077
                     /number=1
     exon            796131..796280
                     /number=2
     exon            796452..796458
                     /number=3
     CDS             complement(796609..797241)
                     /codon_start=1
                     /locus_tag="AO090012000323"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000322"
                     /protein_id="BAE60520.1"
                     /transl_table=1
                     /translation="MAGILIYLQYFLGRLLYRIRGHDAGQIIRTAAFENLPMSNMQLE
                     ATECGPSGSLMLPHHTCVAADKNGSFPELRWTPPPKVQVKEYILISEDIDPPIPRFVV
                     MHGLFYAIPPTITGVLPDDTEQDRNTKDHITRSGWRYVPNLRGSSYIGPAPPLGHGIH
                     RYIFTIIALSEPLRFDRSQRVSKRHIAKAMVGKVAGWGQWVGHFERPWPS"
     exon            complement(796609..797241)
                     /number=1
     CDS             complement(join(797670..798028,798099..798111))
                     /codon_start=1
                     /locus_tag="AO090012000324"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000323"
                     /protein_id="BAE60521.1"
                     /transl_table=1
                     /translation="MALLGCGAKCVIAESFAFIFQRNMPNLGLLGITMPEKLFHAAAE
                     DGAEIEIDLNDSIINMDGRPFRFSLSPMERELFHHGGIASAFGKFGSNLFEAMTEGKR
                     LGVTPHRGITKATDVHPELQW"
     exon            complement(797670..798028)
                     /number=1
     exon            complement(798099..798111)
                     /number=2
     CDS             complement(798669..799154)
                     /codon_start=1
                     /locus_tag="AO090012000326"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000325"
                     /protein_id="BAE60522.1"
                     /transl_table=1
                     /translation="MKPDDDAQYVGTHEIDLSKVQSFIAKYPRPDDVVPVVDCEGMEL
                     DGCFIGACTTTEEDLILAALVLEQGLKGGMRPSVKGKRKVVPGSMTILFRLRQLGLID
                     VYQEAGFDIGIPGCSYCVGMSADQAAPGEVWLSSENRNFENRMGKGSVQACVANRSLI
                     Y"
     exon            complement(798669..799154)
                     /number=1
     CDS             complement(join(799849..799908,799962..800525))
                     /codon_start=1
                     /locus_tag="AO090012000327"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000326"
                     /protein_id="BAE60523.1"
                     /transl_table=1
                     /translation="MSRKRKTGLKDVCQILEDVRKIRIEHVESMFMRSAPCSKYTENA
                     ISDRLIEGTSSLGSNLLQNLKIAQDTLRDYGHFREADALTDVLINCAQLPELGGLGLT
                     EHTDLTEEQDSEALFLVSAWWEALNSADRAKAFPTPLRTRPEGRRGMTLSEKIFSLHD
                     IDQRGSVAPGDLIRVDVDWVIASEASWADILGHGVNVQPPLETRNIP"
     exon            complement(799849..799908)
                     /number=1
     exon            complement(799962..800525)
                     /number=2
     CDS             join(802189..802736,802793..804305,804367..805860,
                     805923..806386,806458..806884)
                     /codon_start=1
                     /locus_tag="AO090012000328"
                     /note="pleiotropic drug resistance proteins (PDR1-15),
                     ABC superfamily"
                     /old_locus_tag="AO070343000327"
                     /protein_id="BAE60524.1"
                     /transl_table=1
                     /translation="MALPREERSLHGHANIHVNQTTGPAIDKAESSDTIGADSEDGIE
                     QEGQAKITTLARTLSRISQTNSGTEGLNPFLNTSDPELDPNSDQFNSRKWTKTLLHIT
                     SRDPERYPRRTAGVSFRNLNAFGYGTAADYQATVSNVWLKAAGWLRGLFGNGNKVRID
                     ILRNFEGFVNSGEMLVVLGRPGSGCSTFLKTIAGETHGLWLDKGTDIQYQGISWDEMH
                     SRFRGEVMYQAETEIHFPQLTAGDTLLFAAKARAPANRLPGVSRDQYATHMRDVVMAM
                     LGLTHTMNTLVGNEFIRGVSGGERKRVSIAETTLCGSPLQCWDNSTRGLDSSTALEFV
                     KNLRLSTDYTGSTAIVAIYQASQAIYDVFDKVIVLYEGRQIYFGRARDAKRFFIEMGF
                     DCPERQTTGDFLTSLTSPTERLVRKGYEHLVPRTPDEFAARWRDSLERKQLLADIEAF
                     QNEFPLGGSKKEEFSRSRAAEKAKNTRASSPYTLSYSMQIKLCLQRGFLRLKGDMSMT
                     LSTVIGNSILALIISSVFYNLNETTDSYFSRGALLFFAILLNAFASALEMLTLWQQRP
                     IVEKHDKYALYHPSAEAISSLIVDLPAKAPVSIVFNLILYFMTNLRRTPGHFFVFYLF
                     SVTTTLTMSNVFRWIAAVSRSLAQAEVPASIFMMILMIYTGFTIPVRDMHPWFRWLNY
                     INPIAYSFESLMINEFAGRKFHCATYVPSGPGYDNAPLDSKICSGKGAVAGQDYIDGD
                     RYLEVAFEYYPSHLWRNFGILLGFLFFSLVAYIVASELVRAKPSKGEILVFPRGKIPA
                     FAKKVHREADPEDVLTSEKLKVGSEQDDHVGAIVKQTSIFHWQDVCYDIKIKGQDRRI
                     LDHVDGWVKPGTLTALMGVTGAGKTSLLDVLANRVTMGVITGEMLVDGRMRDDSFQRK
                     TGYVQQQDLHLETSTVREALIFSALLRQPASTPRKEKLAYVEEVIKMLNMEEYAEAVV
                     GVLGEGLNVEQRKRLTIGVEIAAKPDLLLFFDEPTSGLDSQTAWSICSLMRKLVDHGQ
                     AILCTIHQPSAILMQQFDRLLFLAKGGKTVYFGDLGPNMRTLIKYFEDKGSPKCPPNA
                     NPAEWMLEVIGAAPGSRADQDWSDVWKHSRERAQVQQELLQMKQELLQRPQPPRTAGY
                     GEFAMPLWAQFFICLQRVFQQYWRCPSYIYAKAAMCIIPPLFIGFTFWREPTSIQGMQ
                     NEMFSIFMLLVIFPNLVQQMMPYFAMQRSLYEVRERPSKAYSWKAFMLASIVVELPWN
                     MLMAVPAYFCWYYPIGLFRNAYPTDSVTERGGTMFLLVLIFMLFTSTFSSMMIAGIDH
                     PETASNIAQLMFSMCLIFCGVLASPDVLPRFWIFMWRASPFSYLVGSVLAVGIAGAPV
                     HCSDIEVLHIPPPGGQNCSGYLEAFTTMAKSTLLNPEADSDCQVCSLSTTDQFLAGVH
                     IKYSELWRNVGILFVYIVFNTVAAVFLYWLVRVPKKRALKKAKKE"
     exon            802189..802736
                     /number=1
     exon            802793..804305
                     /number=2
     exon            804367..805860
                     /number=3
     exon            805923..806386
                     /number=4
     exon            806458..806884
                     /number=5
     CDS             809725..810978
                     /codon_start=1
                     /locus_tag="AO090012000329"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000328"
                     /protein_id="BAE60525.1"
                     /transl_table=1
                     /translation="MKTPWLSSSMPLSTPGVHLTQTASPYSMEASAFPMGSDISSPFG
                     GAYSSSGAESPQSNNWRNMGCYMSPPSSCADTMLPLDHWGSCSPGPSGNVESSIAPSQ
                     IVQNYPVPIPIAAELELEAELDPELDPELDPRLDTEPLPVNEPTPVHSHNMHQHSQLD
                     PTNETLSYLGAGQAPDQDSFTLPSPPRVPANNNTGQKTTMCHNHGSKKSSRRKETLTS
                     NSVRVCRTSSKSKTKKGTRPRRTFVCTFSRYGCTSSFTSKNEWKRHVTSQHVQLGFYR
                     CDVGQCNVNNPSKGRPMSCTNDFNRKDLFTQHQRRMHAPWAKSKQATEEEKQQFDATL
                     EAVRTRCWHEQRRPPSRSACGFCGEEFAGFQSWNQRMEHVGRHYEKGDVALDSEKEDI
                     ALRDWAIQEGILSWGGGRWKLASHR"
     exon            809725..810978
                     /number=1
     CDS             complement(join(811547..812109,812207..812696))
                     /codon_start=1
                     /locus_tag="AO090012000330"
                     /note="PEP phosphonomutase and related enzymes"
                     /old_locus_tag="AO070343000329"
                     /protein_id="BAE60526.1"
                     /transl_table=1
                     /translation="MTLTQTTPYPFPFTTNPTNQPTTKGAPRDETLTLKNVRGKIPSI
                     QASTLRTMMLEAHSDPTKIIAHACSYDGLSSRLVQEAGFPIVFLAGYAVASSYGLPDT
                     GYIAMAEMCDKIQEAVRATDIPVMADGDTGYGSPMNVKRTVESFAAAGAAGIMIEDQT
                     WPKRCGHTKGKSVVSRGEAYARVQAAVDARNNGQDIFILARTDSLIHGWEEAMARAKE
                     FKRIGVDAVFVEALPDREAMQKCVQELQLPVFANIIEGGLTENLSAKDLAELGFSAVA
                     YPWTLVAAKLKSIRDTLEALKRSMTTGAPPMILGYAEVCEGVGFNKYWVSLLVVLRWV
                     SLKMFANSGLGSGGEV"
     exon            complement(811547..812109)
                     /number=1
     exon            complement(812207..812696)
                     /number=2
     CDS             join(813077..813199,813245..813305,813363..813534,
                     813588..813856,813928..814570,814647..814842)
                     /codon_start=1
                     /locus_tag="AO090012000331"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070343000330"
                     /protein_id="BAE60527.1"
                     /transl_table=1
                     /translation="MSENEVKESDAIHLEQAQSQDAKDMQHVHVLSADQASIRRKFDR
                     RVLPIVCILYILSYLDRGNIGNAKTAGIDTALGLNDKQWSWVLYSFYICYILFEWTTV
                     LWKIFPAHIYIAILCICWGAAAMCSGAVTNLPELIVCRCLLGIFEAAFGAGAPYFLSL
                     FYQRGELGFRVSMLLGMSPVANCFASALAFGITHIRNSIAPWRLLFIIEGAPTVLFSV
                     IVFFFLADSPGTAKFLTESEQTQAVERLQTVDQTAKNKMEWKQVLQGLSDYKNYIHMT
                     IHFCCNYSFAGLSNFLPTIIQEMGYTSVNAQGLSAPPYFASFLLCIVAALISDRWGHR
                     GLVITVSAVVGMVGYLILAAVEDEHKTGVRYFGVWLATCGVFPALSINITWLLNNQGG
                     DSKKGAGMAILAVFGQCSSFVSSSAFPDSEGPFYVRGCAIGCALTGLIAVLALGLYLK
                     LRHENRRRDRMYGTVDPDVRVDVTREGDNHPQFRYLT"
     exon            813077..813199
                     /number=1
     exon            813245..813305
                     /number=2
     exon            813363..813534
                     /number=3
     exon            813588..813856
                     /number=4
     exon            813928..814570
                     /number=5
     exon            814647..814842
                     /number=6
     CDS             join(815844..816747,816801..817489)
                     /codon_start=1
                     /locus_tag="AO090012000332"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000331"
                     /protein_id="BAE60528.1"
                     /transl_table=1
                     /translation="MFPLSPVLTDFYNTPENHYWLVTQEPMLCCTILMISSRYHVLPG
                     LGGTSRAYSIHNRLWQHCQHLILRIMLGQEKLSKAKTRHVGSIEALLLMCEWYPRALN
                     FPLENDGWDSDLILTEPDLRDPPAPASEIPMSDRWKEDVVEPTRRSDRMSWMLVSTAL
                     ALAHELGIFKNDNGKRKDEYDVTGMRSDAGVYLQQLEWRRRRLPSLLYVFANMLASRL
                     GCTSLIPEIPIVNAAEGVTGCPCVDNEWMYFMASWIDLTRLAKDITDTHFPAIARSGD
                     QTRNLGSSEDWDSMLYRWQASRPTLNSHLESILHIEYQYLQVFTNSIKVQSLVENILN
                     SPTQSASTDRTCIDEVINRSSEILQWLLIQPSIQYLPIRVFLRIISSSIFLMKALALG
                     VRTTQLHTSLNLLEQTISTLQSSSLDDMQLVSQYASLLQIHVSRLRQTFMTSAQEREK
                     DVQSEGQENTNTISLAGQTELVQGSHDPMLGQLDEGGDDWLWLPIDPLMAPFGTWDDS
                     GQLDYGLNAAHLDLDFIWNLPP"
     exon            815844..816747
                     /number=1
     exon            816801..817489
                     /number=2
     CDS             join(818429..818446,818751..819116)
                     /codon_start=1
                     /locus_tag="AO090012000334"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000333"
                     /protein_id="BAE60529.1"
                     /transl_table=1
                     /translation="MLWRYDSYIGLYIPLLRSSLSVWTGGNWQDTSRLPTGFEAHYDQ
                     VHAAARARGRKVLEFKVQDGWDPLCQFLGKEVPSEPFPHVNEGDFIARFHVIIFWVRL
                     VGLAKKGLIWASPVVAVGAAWWYFG"
     exon            818429..818446
                     /number=1
     exon            818751..819116
                     /number=2
     CDS             821271..822305
                     /codon_start=1
                     /locus_tag="AO090012000335"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000334"
                     /protein_id="BAE60530.1"
                     /transl_table=1
                     /translation="MSGILASLEFEQIAVYKPGEVEYEKSVATAYLLYRFARPSYVVQ
                     PTHPAQVQDIVRYLIEYNDRQKPDSQVSITIKNGSHSYAGFSSTDKGILLDLSKMNRV
                     KLNLDKVSHPKSVIIRGGALWGHLYKQLINGRHKGYMLAGGDCSTVGVSGFVLGGGLS
                     AFSRSLGMACDNLTEATIITADGRMVTVGENSDPDSDEGKLFWALRGGGAGNFGIVVQ
                     LKMNIHQLQKEDDSARTRETVIAGRYTWFPYPGEVEEAKLMATMNESYTTKWVDSLAI
                     HSTWICDLQEARTLPAIRFIVYHNGEKNSIDKQLDKLVEQGNPSDQTSERRRELAKPL
                     RRRTDYAVPS"
     exon            821271..822305
                     /number=1
     CDS             join(825011..825338,825427..825818,825916..825996)
                     /codon_start=1
                     /locus_tag="AO090012000337"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000336"
                     /protein_id="BAE60531.1"
                     /transl_table=1
                     /translation="MEQLSLSGISPKADFENIPIIDVAALKSPDRRERQRLAREIYDA
                     CTQVGFFYIKVTYISSRFQIPLIINICPAESWDIGGANNGSSRCGASILRPPRRAENG
                     IFCGEVEEEISNADDPCERTDTNNIGALLESFDIGYEILADPQRAADDVLPPDTYDLY
                     GDNQWPSNEVLPKFRETYLLYCAEALTLCRRLMRSFALALGLDEGFFDPVMNFPGVTS
                     RLLHYPPQTVEGEVRDGLGAHTITYPHCKSVTLAANGWWRLLFQGRWL"
     exon            825011..825338
                     /number=1
     exon            825427..825818
                     /number=2
     exon            825916..825996
                     /number=3
     CDS             complement(join(826846..827221,827294..827364))
                     /codon_start=1
                     /locus_tag="AO090012000338"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000337"
                     /protein_id="BAE60532.1"
                     /transl_table=1
                     /translation="MPVLPQLEGSTFDADLRNRHIIYEVVYAIHGGPMAGRKNFQAAT
                     YQCIRPGELWQINWLEETGTICSMCWDITNKCLSTLLAFSKGHWTESVAAHGDKRNPD
                     DFARWRDLAKIGTQADRILLSEQAEILEDFHGAGDLEPIDPSWPTL"
     exon            complement(826846..827221)
                     /number=1
     exon            complement(827294..827364)
                     /number=2
     CDS             833295..834710
                     /codon_start=1
                     /locus_tag="AO090012000340"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070343000339"
                     /protein_id="BAE60533.1"
                     /transl_table=1
                     /translation="MSTATSTKRTWYRTTFFNISVVSLCAFIAPGLWAAMNGLGGAGA
                     ADPHYVNAANSVIFCLQVLVCLIGSAMIAKIGLKWALVLGMVGFPIYASSVYCNIRYN
                     NTWYIMLACVIDGMSSGIFWLTEGAIVLAYPEKHRRGKYLAFWLGSRIVGQMIGGSVT
                     LGVNAGNREKGHISVKIYFIFISIQALGPFVAALLSSPDKVQRSDRSPVSLDLPRSLK
                     AELNIMCKLLCRKEILLLLPMIIQSAFSEAFFSTYNATYFTVRSRALASLVASTCVII
                     ANFMLGFFPDWKRPTVNTRAIVAFVLIYAFELSFYIYAMVVTKEYERRDTPPVLDWAD
                     DGFGRGVCVYILMLVGFNLMYEYLYWLIGTVNRSGGDIVRLSAVVRGVESAGQAISYG
                     INSIDQARFPLSGAVAVNLSFFAACIIPSAFAVFRVGIINGVKVYRSQQGENVHVDGG
                     SIEGRVSNSSSHDIQDTHMVK"
     exon            833295..834710
                     /number=1
     CDS             join(835159..835450,835495..835829,835880..836200)
                     /codon_start=1
                     /locus_tag="AO090012000341"
                     /note="dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /old_locus_tag="AO070343000340"
                     /protein_id="BAE60534.1"
                     /transl_table=1
                     /translation="MSVNSNCNVHDPGFRESKPSQGDPSRPVADLFRLDGRTIVSKVP
                     DNPLAIAKADQLLLDPVTGANGFLGTTLAMAILESGGDVVCLDLPGEPTATNWNVTDE
                     VEQTALKYARSLSYWPLDVTNETMVADVFAKFMPTLRFPLRGLVVCAGISRNGPAISF
                     PISTVREMLDVNVSGAFLAAQAAAWEMRQSDVSGSIVLVASMSGYVSNKGVDTAGYNA
                     SKAAVQQLARSLAAEWGSRKGMPLIRVNSLSPGYIRTAATAEALQKPGLEEQWVGDNM
                     LYRLSTADEFRAPVLFMLGDGSSFMTGSDLRVDGGHCAW"
     exon            835159..835450
                     /number=1
     exon            835495..835829
                     /number=2
     exon            835880..836200
                     /number=3
     CDS             complement(836341..837321)
                     /codon_start=1
                     /locus_tag="AO090012000342"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000341"
                     /protein_id="BAE60535.1"
                     /transl_table=1
                     /translation="MKTITIVGATGNQGLSVADAFLPLPDWHVRCITRNPSSPKAQAL
                     ASLGSSIVEADLADITSLHSAFVNSNVIFVNTDFWGPFNTTGKYDVAYEQEVQHGRNA
                     AIAAKTIPTLERFIYSTLAPMKKHSQGKYPHSHHCDAKAEIMEYIETQMPELAKKTSY
                     IIIGAYATNPLFMPRWDPYIQKYRFMVPLKKEQRIPIIAARESTGAFVKALIDEPPRT
                     RLLAYDSDLSIEDIVDVWTRATGSEADLVEVEAQEMHKGLGIPWEVLDAFLFIGEFGY
                     AGGIENVIHPSQLKTPVQTESFEEWLRKRNWEEVLQGGSKELNSVTENAR"
     exon            complement(836341..837321)
                     /number=1
     CDS             join(841608..842174,842232..842457,842515..842672,
                     842818..842889)
                     /codon_start=1
                     /locus_tag="AO090012000343"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000342"
                     /protein_id="BAE60536.1"
                     /transl_table=1
                     /translation="MKAYRYALYRRTRRLRLALFFVLLGWTLVEVLRIKYTLVQQSQP
                     ELVALGSEKIYITGLHWNSELILRDAWIAAVVDLANTIGRDNVFVSIQESGSWDDTKG
                     ALILLDQLLAENDIPRRILIDYTTHFDEISKPPTGQGWIETPIGTTELRRIPYLAKLR
                     NVAMEPLYELQNEGIVYDKILFLNDVIFTTSDVQRLLSTKGGNYAATCSLDFSKPPDF
                     YDTFALRDAEGHDMLMQSWPYFRSRASRQAMKASQPVPVSSCWNGVVAMDAAPFYQHP
                     PLKFRGISDSLAKSHLEGSECCLIHADNPLSREKGVWLNPNSGRGCGSGKSSRAEIWN
                     LGLFVL"
     exon            841608..842174
                     /number=1
     exon            842232..842457
                     /number=2
     exon            842515..842672
                     /number=3
     exon            842818..842889
                     /number=4
     CDS             complement(join(843547..843627,843653..843952))
                     /codon_start=1
                     /locus_tag="AO090012000344"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000343"
                     /protein_id="BAE60537.1"
                     /transl_table=1
                     /translation="MLVYFEPAAMCGLRTDLVIAPLPARKQLWEAGDELLWKAESQRE
                     SGFQTVYGLAASGDLVQLGKDQLHSTNEVLLHKTVTARGSANWEEWCSGMDGLGGLGS
                     PLPTVERNSDGKVYIEEEKQGRTF"
     exon            complement(843547..843627)
                     /number=1
     exon            complement(843653..843952)
                     /number=2
     CDS             join(845874..846567,846626..846843)
                     /codon_start=1
                     /locus_tag="AO090012000345"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000344"
                     /protein_id="BAE60538.1"
                     /transl_table=1
                     /translation="MAPFPSPTSKWHTETYPSISPTRPELSARGKTIVITGGGTGIGA
                     ETAHHFAEAGASRIILLGRREQPLLDTKASIDSKSSGVEVIVVPTDITKKDEVDKAFA
                     RFVGNGTIQVLVSNAAVIGPQDAVSDVDSDRFLDAIQQNLKGSLNVAQAFLHYASKDA
                     VVIETSSSAAHVNFAPGFAAYSIAKLAVFRLWDSLAFANPELSVFHVQPGVVDTAMNR
                     EAGGVAAMGFADDVSLPASFNVWLASREARFLRGKFLWANWDVDELKAQEEDIEASPR
                     FSIGLVGWPFGSAGWKSTWKTQTDSSV"
     exon            845874..846567
                     /number=1
     exon            846626..846843
                     /number=2
     CDS             857172..858908
                     /codon_start=1
                     /locus_tag="AO090012000349"
                     /note="choline dehydrogenase and related flavoproteins"
                     /old_locus_tag="AO070343000348"
                     /protein_id="BAE60539.1"
                     /transl_table=1
                     /translation="MATDGSHFDFVIVGGGTAGNTVAGRLAENPNVTVLIVEAGIGNP
                     EDIPEITTPSSAMDLRNSKYDWAYKTTMVRRDDYERIEKPNTRGKTLGGSSSLNYFTW
                     VPGHKATFDQWEEFGGKEWTWDPLVPYLRKSATYHDDPRLYSPELEKIGGGGPIPISH
                     AELIDEMAPFRENLTKAWKSMGQPLIENIYDGEMDGLTHCCDTIYRGQRSGSFLFVKN
                     KPNITIVPEVHSKRLIINEADRTCKGVTVVTAAGNELNFFADREVILSQGVFETPKLL
                     MLSGIGPTRELSRHGINTIVDSRHVGQNLMDHPGVPFVLRVKDGFGMDDVLLRHGPKR
                     DAVVSAYNKNRSGPVGSGLLELVGFPRIDKYLEKDAEYRKAKAANGGKDPFSPLGQPH
                     FELDFVCMFGTAFQWHFPTPKTGDHLTVVVDLVRPISDPGEVTLNSADPFQQPNINLN
                     FFANDLDIIAMREGIRFSYDLLFKGEGFKDLVESEYPWEMPLDSDKEMHRAVLDRCQT
                     AFHPTGTARLSKNIDQGVVDPKLKVHGIKKLRVADASVIPIIPDCRIQNSVYAVGEKC
                     ADMIKAEHKDLY"
     exon            857172..858908
                     /number=1
     CDS             join(859775..860033,860091..860179,860227..860581,
                     860629..860783,860832..860941,860990..861077,
                     861126..861240,861292..861321,861372..861628)
                     /codon_start=1
                     /locus_tag="AO090012000350"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000349"
                     /protein_id="BAE60540.1"
                     /transl_table=1
                     /translation="MLGIKILPVLLFGAIAQSKYIVPGGRWHDTDGNLVSAHAGSITF
                     DEGTGRFWWFGEYKIEGQEEGGGVSVYSSEDLATWESHGLALEPVKNHTYISPENVIQ
                     RPKVVYSEETSQYHMFWHADNSTYGLLLQGFATSDTPAGPYTFVNATAPMGNWSQDYG
                     LFTDYKDGRSYALYSNGDSVEGRDVYITRYNKEVSELEEVVYRFNKFDLEAPTIVQTD
                     NSYYALMSHKTGYRPNNVVAFRADSLEGPWSQPFMVAPLNTRTFNSQSGYTLKIEGSK
                     KTTYLYIGDQWDSNSLWESRYIWLPIEIDDKKKTLELAWHDVYDLNVKTGEWKPIEGK
                     TYYGKDAKTSGDAFKQEANFASHNTILTGIYGNDSTVTFEGIEGTGKPQWVSFYYQNT
                     DDMGFGDQPGGTPDRIGGEWQLRRISSVVVNGNTSNVETLYQRDTHKSIILSTPLKLT
                     LEKGKQNTITIGGLYNGFDYKGADLDRIVVYPPEE"
     exon            859775..860033
                     /number=1
     exon            860091..860179
                     /number=2
     exon            860227..860581
                     /number=3
     exon            860629..860783
                     /number=4
     exon            860832..860941
                     /number=5
     exon            860990..861077
                     /number=6
     exon            861126..861240
                     /number=7
     exon            861292..861321
                     /number=8
     exon            861372..861628
                     /number=9
     CDS             complement(join(862120..862397,862507..862949,
                     863025..863148,863211..863340,863406..863561))
                     /codon_start=1
                     /locus_tag="AO090012000351"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000350"
                     /protein_id="BAE60541.1"
                     /transl_table=1
                     /translation="MDDKGTLAELQQVIEKYNKDDPSSWMRLEDALEKVRRELVPPQI
                     FTMKQRLQTVNNVCIVVALEMGLFKTLAAKVGKSLTAEDLSKTTGYNASLIARVMRVI
                     TAIGFANETGYQTYTANGCTLAQNNPGNIGGLIISNDIVFPVASRIRQYLQQNKPVDI
                     AKTLPAYDFAMGETIWQTLAKNIEWKTGFDDNMTARNKTLSVPWHLKYPVGERLAAGS
                     LSAKPIIVDVGGNQGVDLQRFADTFPELECELILQDLPETIAGIPGQLDSRIKPTAHD
                     FFTEQTAKDDVASRKILSNIANVMQPHSRLLINEMILADVNESMIRSNMDMLMLFFTN
                     GMERTQTQWNELLATVEPPLELVQVWSATGDQQCVIETCLAE"
     exon            complement(862120..862397)
                     /number=1
     exon            complement(862507..862949)
                     /number=2
     exon            complement(863025..863148)
                     /number=3
     exon            complement(863211..863340)
                     /number=4
     exon            complement(863406..863561)
                     /number=5
     CDS             complement(join(864000..864058,865946..867230))
                     /codon_start=1
                     /locus_tag="AO090012000352"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000351"
                     /protein_id="BAE60542.1"
                     /transl_table=1
                     /translation="MRFSPGLLCLIGGLLPAIVSGATAPTPFFPELDDFYTPKHGFWE
                     ELDPGSIIDYRQVYVNSLSYGIPSNATAYQVLYVTTDLNKQKTHSVTTIIVPHNAKKG
                     WLLSVQPAYDSPDINCSPSYGLQVGAVGPALSWNMMDLSFVLPFVNKEGPILNIPDYE
                     GWNAAFTVGPQTAYHTLDSIRAAFNFEKEYSLTGLKPDAKTVMYGFSGGAYATEWASE
                     LHSTYAPDLTQIVGAAMGGPPPNVTDTYLGCNMGPWAELNVWAMLGVMNAVPEMKRFM
                     DGDLLEEHRERFYGPKTRCSRCFGREKAHEPLEYQNISSFFEHGDSFLYRFRGTLADI
                     GVMGRNGAPSYPMYIFQGTNDEIVGDIGVTNRLVRHLCDQGTVVQYHQYPDLNHMETL
                     QKGNLDAWRWILNRFLGLEATGCRPIDLNPPIGGDDVQMRLSMASTILPGWPTTE"
     exon            complement(864000..864058)
                     /number=1
     exon            complement(865946..867230)
                     /number=2
     CDS             complement(869733..871079)
                     /codon_start=1
                     /locus_tag="AO090012000353"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000352"
                     /protein_id="BAE60543.1"
                     /transl_table=1
                     /translation="MGPLHLDVPTTHHVYEGSHGERYSPPISGSVLVPVSSLDFDQAK
                     YPNVTVGLLRTVTLRNGEPASNAPNDNKKGDFLQRIRRKRVPQTQTIATPQKEGSSTV
                     ETLVQCQLWHSPEPVEWHEEAGAVVLKFLFSIPVPPGTSGTTETPFGGLSYAVRAVVT
                     SSSGVTVDATRDVQILSRIVTGPSQTVRHFKNYTGERLKSELSLTPEQPTDPKVKLAY
                     SAKLVARGTTARGDRPTERKQFFVREVRWSVEETVRLMKVSNGDGPDGETITWKEKSV
                     RQLCSGKQQGRWAPNKKLSVQERKGHDDRDRIDLSFDVIIPRTASTPDQRDLSSCSFD
                     SGAPCRHLTPCKFNEICTESSGERTTIMVDHRLRLDLITGEDTLDEKTGDLINRRQFA
                     KAFTTCYTLPIHEVAGRNAIPEGTFHGNSAPPLYEGESAMPPAYDFDEPYTSPCFV"
     exon            complement(869733..871079)
                     /number=1
     CDS             complement(join(872958..873943,873996..874098,
                     874155..874486,876355..876667))
                     /codon_start=1
                     /locus_tag="AO090012000354"
                     /note="acyl-CoA synthetase"
                     /old_locus_tag="AO070343000353"
                     /protein_id="BAE60544.1"
                     /transl_table=1
                     /translation="MVTVFAVPSPGLVRRLLDHFAKHGPMWLTSRMGNRRTAILSHIF
                     PEAMESPLILHCVLMIAAKDLLKYDSNVELQASAVEYYGRAISGLREALSGEQLANEP
                     TSGAIISGASPAYNIEEMTYALKTGNAKFLMTVPAGMDVAVPAAREAGIPTERIFLLE
                     GEKGEYISVQDLVRKGRSYGPTGQTTPFELPRGKSNRDVCGFLSFSSGTTGLPKAVMI
                     AHHNVIAQCMQVDQILRKDVNKSLAVLPLFHITGLVHQMHLPVIRNSTVYMLPSFTME
                     SMLATIVEYQITEILSVPPIIIRLLTDPIVSKYDLSHVKTFSSGAAPISGEILQKLEA
                     RFPWTGFKQGYGMTESCSCITAHPPEKQTYEYAQRAGILVANTEVKILNTQNGKELGY
                     GEEGEILARGPQVVMGYLGNEKATRETFDSDGWLHTGDVGYMDQEGFLVITDRIKEMI
                     KVKGIGVSPAELEDLLLGHPEVDDAAVTSVPDDYSGEKPKAYVVVNAAAKSRLATGDA
                     VKSVGRELIEYVKAKKVRHKWIVEVEFMDEIPKSPSGKILRRVLKDRERKRESGEKRL
                     VVRDEKATAKL"
     exon            complement(872958..873943)
                     /number=1
     exon            complement(873996..874098)
                     /number=2
     exon            complement(874155..874486)
                     /number=3
     exon            complement(876355..876667)
                     /number=4
     CDS             join(878138..878484,878596..878827)
                     /codon_start=1
                     /locus_tag="AO090012000355"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000354"
                     /protein_id="BAE60545.1"
                     /transl_table=1
                     /translation="MLTAREIGITVIEAVVCPTAFWRFTGAAFRQSHEQSDEESGDEA
                     KNGLRDALFTRPAARVSWLSSFVLLFYVGVEVTVGGWIVTIMMEVRHAAPFPSGMTAT
                     GFWLGITAGRVVLGVCVDCMVGSQFLCLCGGGVYPGFLPRSTISLRGRCHNQASAQAS
                     SCGSGWLRGCIWRCWCSSPPICGRRNCTGYRS"
     exon            878138..878484
                     /number=1
     exon            878596..878827
                     /number=2
     CDS             join(879446..879757,879938..880045,880104..880598)
                     /codon_start=1
                     /locus_tag="AO090012000356"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000355"
                     /protein_id="BAE60546.1"
                     /transl_table=1
                     /translation="MQLKQLVLPALALSGSALGSPTPAKRADEKVGYLSVYWTTDDES
                     VYFALSDNDDPLGFAAINGGKAVVSPTLGTKAVRDTSIIAGQGNNAGKYWIIGTDLNI
                     DDMPFGIPNKVSIRTLTEDQWTKLILLEQYFVHWASKFYSPDDTDHTGNATTGNVLRY
                     AYTSDFKTFTEPKDYIVGTTDVIDLCILQLDSNTLLRSNVNSSSSDGLPVEISTNGLL
                     GDWSVLGNVADSTSYEAPYFFADNAGGGKGYMMADLVGSSPGISGWTTDDLSKGVFTK
                     DTSHDLTFMRHDSVLGVTQSQYDALKAM"
     exon            879446..879757
                     /number=1
     exon            879938..880045
                     /number=2
     exon            880104..880598
                     /number=3
     CDS             complement(join(881029..881103,881261..881833))
                     /codon_start=1
                     /locus_tag="AO090012000357"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000356"
                     /protein_id="BAE60547.1"
                     /transl_table=1
                     /translation="MTSTLTPLKQPIALRTEYITSHPTTIRVKQHSNSWSGGNFTITK
                     CPTDESPLAEKLFTVDGDFKSMSQRRYIQDASGLPLFEIAHKRLGVTWFVHLPGGKEN
                     TSSSPIATIVPQWHALKDKFDVYLNNAAAGGEETILEVRGQDIFKSKTHVYYKGALVT
                     VIKLKDMVSVYIPGKGPTWELEVGEGMDLSLAIKEPHRSLLGQIQILDWEVVGRS"
     exon            complement(881029..881103)
                     /number=1
     exon            complement(881261..881833)
                     /number=2
     CDS             complement(882546..883331)
                     /codon_start=1
                     /locus_tag="AO090012000358"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000357"
                     /protein_id="BAE60548.1"
                     /transl_table=1
                     /translation="MEAFNTAGEVHYVLANTCTSYITVVAHQFNECDFEEGYDKIAYL
                     EYSSRYWIAHFRQTCVREESPLLTHAQRICDPNSDVYQMWSWIYANLGRNLPHDATTL
                     LIASCLGLADIVNVLARETVEFNSQDSGYGRTTISWAAENGYEAVVKLLLATGKVDID
                     SKDSNSRIPLFWAAKNGHRTVVELLIGTEKVDIDSRDSWGLALLYLAANNGDEAVVEL
                     LLATGKVDIDARDSDGQTPLSCAARNGHEAVVKLLQEFHQLAL"
     exon            complement(882546..883331)
                     /number=1
     CDS             complement(join(885578..885597,885699..886539))
                     /codon_start=1
                     /locus_tag="AO090012000359"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000358"
                     /protein_id="BAE60549.1"
                     /transl_table=1
                     /translation="MGFPSDSLLLVLSLVLNCSWASITPGVAEVDLIFPRNESFPPSS
                     LTPIIFAIQNPSLLSSVYPQIRYSIEEVNVNSSERVSISGSLDLAKLNYTRSDPYFLY
                     WSTSKFDIEGTFKINWALDIYNCSHEPDSTDLTLGYLGARGRRSFFSTKNGTSQPDFA
                     AATEDGTCEASLAQAIHVQDFLNVPSGQVWGSPTRTQNWYAPKQPTWRGSSCAVTADW
                     VPTPSPCNVKIGSSAATSISAALTSTACANPLRTGLNCPTPSPQNAASVAQLPVGRLW
                     TLAIALRNLP"
     exon            complement(885578..885597)
                     /number=1
     exon            complement(885699..886539)
                     /number=2
     CDS             complement(887604..889073)
                     /codon_start=1
                     /locus_tag="AO090012000360"
                     /note="nucleoside phosphorylase"
                     /old_locus_tag="AO070343000359"
                     /protein_id="BAE60550.1"
                     /transl_table=1
                     /translation="MSTGASFKLSGEGHPYILKLGVLLWELLIGKKITINPEDEEDED
                     GVDSNLSLFNALNREEINSREICVEKPILDVIANCLNIYPQTQLDERMVRSVVYWNIV
                     KPLQNYLDSLYTTRARASTLHRKRPANDMTSNESMMKSEDFGSPACRQGGLLALEPRT
                     KRVKEDDPGPQWRKQERRCENCGCLLTPESYAIGIVCALHKELLAVRILFDCTHESIP
                     VPSEDSNHYSFGRMGQHDIVAVCLPSGKYGTNSAANAIANMRRSFPAIRFCLLVGIGA
                     GVPTEQNDLRLGDVVVSHPTGTHPGVIQYDLGKQGEDGVFHPTGSLQRPPRFLLTAIS
                     HLISNPDLSPAPLQGYVDQIIATRPDYKRPDEEKDTIFDTGTVHITRNGIREHHYADG
                     EQQSNVSRRATHPHIHYGLIASGNRVMKSASARDHLASVYNILCFEMEAAGVMNICPC
                     LVIRGICDYADCHKNDLWQNYASATAAAYAKLLLTVVRP"
     exon            complement(887604..889073)
                     /number=1
     CDS             complement(889217..889888)
                     /codon_start=1
                     /locus_tag="AO090012000361"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000360"
                     /protein_id="BAE60551.1"
                     /transl_table=1
                     /translation="MCRQAISFGDAAARLRPIYTEAQRFNTIMRRLYHSQVPDTWSQS
                     QIFYTQDESGSRENNEGAVELSQAQAISNIARKVSDLLIQQSNLCTAACHTALVLLNG
                     FTQPEIEMLMSVCGDKNRPRWNIVSWSKDDPCKYSPQTGEHTDDICAVLKRSWKYKTR
                     LRISVRKDGTWTYGSTSTEDRMESNAIAPTLRLRELLHGGGDGSGGAIATRLLKRINS
                     ISLSQ"
     exon            complement(889217..889888)
                     /number=1
     CDS             892659..893819
                     /codon_start=1
                     /locus_tag="AO090012000362"
                     /note="TPR repeat"
                     /old_locus_tag="AO070343000361"
                     /protein_id="BAE60552.1"
                     /transl_table=1
                     /translation="MTSCSETTLAESTLRGQPPWTDLLAIIGQQLLTQVKTLGPVDKD
                     TIVTRANLATLLWFNGKYREAHSLQRDELELCMMEFGQEHPSTLTSINNLASTLWSIG
                     EWSEAVTQFKLAVQLRTALLGPEHPSTLTSMSNLAATYQSLGRWPIANEIYLKLSDLD
                     VRVLGPHHPSILIRMSNWAVLLWETRRFREAEELETRVLEARRTTLGREHPDTLVSVN
                     NLALTFQSLGRWRDAETLGTEATISAQNLLGSEHPFTLTSMGNLAATFRNQSRLDEAA
                     SLEVQIMEVQKKVLGNDHPDTIATRWNLAHTLRKQQQTKEALELLESCLESQARLLGE
                     EHPHTMAMSRTLNKWKVKRGSESGKEFKHHRPIAVARKVAKKRKLYDSGTED"
     exon            892659..893819
                     /number=1
     CDS             join(894744..894793,895445..895511,896374..896633,
                     896687..897245)
                     /codon_start=1
                     /locus_tag="AO090012000363"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000362"
                     /protein_id="BAE60553.1"
                     /transl_table=1
                     /translation="MDESLAPYMLWTEKDRLEGAPVLTAKVACAPTAPLREGKVSFVF
                     ILSVASFIPQIHHVWRGTDARGISPVYLLFSLICATEHVFFGFFYMVNMRSVPGLWSH
                     NPINILDWINFVQLTSVWVLFNVLFFLCLYFNPVLRPRKAIIIDIYLIFLSVSLVPLI
                     IDATTDIFCPPGRPNCSAMDRDPLAFFEGFHNFYLLPIITTLLILGFYEQVRQPPRNL
                     SIIGLKLQAAIFALSAVSWILRLYFLWKTFLEQPRGPVPIYLVIPSWWQQVGFVAGDD
                     AIFAVGQGILLRLALRQRRRGEASDAERQPLLGQA"
     exon            894744..894793
                     /number=1
     exon            895445..895511
                     /number=2
     exon            896374..896633
                     /number=3
     exon            896687..897245
                     /number=4
     CDS             complement(join(898042..898079,898268..898546,
                     898629..898704))
                     /codon_start=1
                     /locus_tag="AO090012000364"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000363"
                     /protein_id="BAE60554.1"
                     /transl_table=1
                     /translation="MVSLATVRAHNASLKSLGSGLVAVFVGGTSGIGLYTVREFARYT
                     VSPTVYLVGRNEAQAKQVIQELSLINPHGKFQFIKTDASLLCGVDSACEVIQRRESRI
                     NLLFLSCGIFTMKGRDVTRSLKMLFPVS"
     exon            complement(898042..898079)
                     /number=1
     exon            complement(898268..898546)
                     /number=2
     exon            complement(898629..898704)
                     /number=3
     CDS             join(899698..900703,900806..900900)
                     /codon_start=1
                     /locus_tag="AO090012000365"
                     /note="zinc-binding oxidoreductase"
                     /old_locus_tag="AO070343000364"
                     /protein_id="BAE60555.1"
                     /transl_table=1
                     /translation="MKAWLYSSTKGGLEKNLVFSPDARTPGSPQGDQLLIRVISTSIN
                     PADYKAPAMSTVCGKVLIATTPASPGMDFCGRVIAVGSDPAARQFTPGQLVLGCLGMP
                     RQFGTLGEFILASANNTAPLPLGVDPDAAATIGVAGRSSYQSIVPYISTPGSRVFING
                     GSGGCGVYGIQIAKLLGCHVTVTCSTRNVQFCRDLGADEVIDYTAQDVLEVLKSQGQV
                     FDHVVDHIGSPEGLYQECHSFLKPGKVFVQVGASSMLTFAHRLIRPSLLGGGKRKYVA
                     LLMKSHNDEFTQIANWIREGKIRVEFDAVYEFEDTVRAFERLRSGRTRGKIVIHVTSP
                     DILKTMWTCVFKERIKKQETAVKQKHIRKANK"
     exon            899698..900703
                     /number=1
     exon            900806..900900
                     /number=2
     CDS             complement(join(900972..901031,901096..901449,
                     901578..901814,901890..901909,901983..902390,
                     902450..902549))
                     /codon_start=1
                     /locus_tag="AO090012000366"
                     /note="NADH:flavin oxidoreductases, Old Yellow Enzyme
                     family"
                     /old_locus_tag="AO070343000365"
                     /protein_id="BAE60556.1"
                     /transl_table=1
                     /translation="MAEAMADKTRVPDQKFTRAYGEWGKGRWGALLTGNIQVDPRNLG
                     NYYDLATRESAPREDQLNAWKQYAASCQEQGTPAIAQICHPGRQSPRGAGERGIFGTP
                     IAPSPVPLKIGEGCAATIIRNIAFDVPKEMTVSDIKQVVQQFVNSARFLAECGFAGVE
                     LHAAHGYLLSQFLSPKSNIRHDKYGGSPEARARIVLEIIKETRAVVPENFCIGLKLNS
                     ADHSASDFEDTMKQIGLFAESGIDFLEVSGGTYEDPTMMGRGLKEEIASETVQRTAAR
                     EAFFFDFAKETRRRFPGLILMLTGGFRSRQGIQAALKGGACDIVGIGRPAVVCPNFPE
                     LIMDDKYTDDEAKVILGKVPTPLWARIFQIRVLGGGAETQFYAGQIKRMATGYATHAP
                     "
     exon            complement(900972..901031)
                     /number=1
     exon            complement(901096..901449)
                     /number=2
     exon            complement(901578..901814)
                     /number=3
     exon            complement(901890..901909)
                     /number=4
     exon            complement(901983..902390)
                     /number=5
     exon            complement(902450..902549)
                     /number=6
     CDS             904425..905339
                     /codon_start=1
                     /locus_tag="AO090012000367"
                     /note="hydrolases of the alpha/beta superfamily"
                     /old_locus_tag="AO070343000366"
                     /protein_id="BAE60557.1"
                     /transl_table=1
                     /translation="MPRREDVKIPATQITDLMIAVSCLLPEKCYPPPPVIIMGHGFGA
                     VKAGGLFPFAERFAEAGYAAVMFDYLFFGESDGLPRNLLSISRELQDFRDVIAWVRRQ
                     TDKWDINRVIAWGASFGGMHVTTLMAEDHDLLAGIMQGPCVDGLAASRQVPVYKTLRL
                     LPLSLFDWMLSLFSSKAIYIPLVGDGKHGSSLAMMSGSEAMAGWKRLTTDLGADFVNK
                     VTARTILTIPFSRPIKKVHRSRKPLLVVVTTWDNEAPLHKAKQAVRLAPLGEGFRVPG
                     GHFDLYAGGVAFEDNIRRQLQFLQKVLA"
     exon            904425..905339
                     /number=1
     CDS             905950..907050
                     /codon_start=1
                     /locus_tag="AO090012000368"
                     /note="zinc-binding oxidoreductase"
                     /old_locus_tag="AO070343000367"
                     /protein_id="BAE60558.1"
                     /transl_table=1
                     /translation="MSATIPDSMQALVGNRLATARLANYALGKPCGDGVKVQTVPTPN
                     ISDTEILVRVKAVALNPTDFKHVDFLAPKGAIIGCDFAGTVAKVGSKAPGNWKVGDRA
                     AGWVHGGLYYDRGSFAEFLKVPGDLAWKVPSSVSDEAASTYGVSAVTAMLALNARLDV
                     PWADGGPEGGQRDSPVFIYAGATSAGLYAIQVAKLAGLKVVTTASPRSHDLVKQYGAD
                     DVFDYRSPTAADEIIRAYPQINRALDCFSEGGSTDFCIKVVQKAKGKVVTLLDRGKTT
                     DDGVEVDFLLGYGAFNLPYQWMPPVGPRFSANPSDNAALRRFYASLHDICDQLRPPPL
                     KSIEGGLHNLPKGLDLLRKGQVAGTKLVARLE"
     exon            905950..907050
                     /number=1
     CDS             907728..908558
                     /codon_start=1
                     /locus_tag="AO090012000369"
                     /note="predicted hydrolases or acyltransferases
                     (alpha/beta hydrolase superfamily)"
                     /old_locus_tag="AO070343000368"
                     /protein_id="BAE60559.1"
                     /transl_table=1
                     /translation="MPYLKLRDGAELFYKDWGNPDGEIVTFSHGWPLSSDNWENQMFF
                     LAERGYRVIAHDRRGHGRSTQTWNGNNMDTFVDDLKELFEHLDIKGAMMVGHSHGGGE
                     VTHFLGKHGTSRVKKAVLVGAVPPLMLKSAANPEGTDQSVFDSFRQAMRKDRAQFFLD
                     VPSGPFFNFNRDGVQKSEGQIRSWWQQGMNTSFKTAYDAIKDFSETDFTEDLKKIDIP
                     VLVLHGDDDQVVPIEASGHKSVKLLRHGKLKVYPGGSHAIHNINIEEVNKDLLDFLQS
                     "
     exon            907728..908558
                     /number=1
     CDS             join(912113..912308,913598..913728)
                     /codon_start=1
                     /locus_tag="AO090012000370"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000369"
                     /protein_id="BAE60560.1"
                     /transl_table=1
                     /translation="MKVSTLLTTLCVLGVASSADPTAQCDNGPVQCCATVGLPTDSVV
                     SPLLGLLGVVVPDMSTPVGLTFVDISDVEIDVTALGSRTRYLMYFKFIVVGKDVVFRT
                     TLGFLA"
     exon            912113..912308
                     /number=1
     exon            913598..913728
                     /number=2
     tRNA            914671..914772
                     /locus_tag="AO090012t00009"
                     /note="tRNAscan-SE"
                     /product="tRNA-Phe"
     CDS             917723..918142
                     /codon_start=1
                     /locus_tag="AO090012000371"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000370"
                     /protein_id="BAE60561.1"
                     /transl_table=1
                     /translation="MVPAVKQFTKEHSKKWSAAIASFQGYIFVIPEYNLGLAGGTKNA
                     IDYLYSEWPGKPVGIISYGAKGGSNASQQLSESLRVVMKMEVMPTKVLLPFAPGSDVL
                     SASNEGTLGEDSRKSWEADGKKEQVLQVWEELKNALE"
     exon            917723..918142
                     /number=1
     CDS             complement(918496..919665)
                     /codon_start=1
                     /locus_tag="AO090012000372"
                     /note="predicted dienelactone hydrolase"
                     /old_locus_tag="AO070343000371"
                     /protein_id="BAE60562.1"
                     /transl_table=1
                     /translation="MSNQHCRGTSSITQFSAMAYSTIILLCAALAQAVQAATHLPGPS
                     GPCRVQTTHAKLLDTSRVDPFSPTHDKRAIMATSYVPVNCGHTKFEPYLPPHTEAVTD
                     QLFRSYGMPNGTTIKGFRIESGFASNDTSPSDKQYPVIIFSPGLGASRLYYSLILESV
                     ASTGFVVVSVDHPYDTSSVDFPDGSVIYGVNVSAADPVTLNTRVQDVIFTLDQIHDNP
                     HLIPSSFTDTLELDRVAIVGHSFGGATAAAAMLNEPRFAGGLNFDGALWGPVVEEGLD
                     RPFINFGHANITQLDNNSWGKIWPHLRGFRRELQLAGSLHLTFTDFPLIRDVGGWPVK
                     VKQGTEELLGSLSGLRVRAILTEYIVASATFFITGEKSKLLDGPSSDYPEVKYVA"
     exon            complement(918496..919665)
                     /number=1
     CDS             join(922777..924217,925409..925527,926229..926264)
                     /codon_start=1
                     /locus_tag="AO090012000374"
                     /note="predicted flavoprotein involved in K+ transport"
                     /old_locus_tag="AO070343000373"
                     /protein_id="BAE60563.1"
                     /transl_table=1
                     /translation="MNGTQASNGVLHLDALIIGSGFSGIYLLHKLRDELKLKVKIFEA
                     ESDIGGTWNNNRYPGARVDCPVPFYAYSLPEVWQSWNWTELYPNQKEIKSYFDHVDRV
                     LDVRKDCLFHSRVNEGTFDEATGRWTVWTTDGKVATAKYLLVAVGFASKSYLPDWKGL
                     DSFKGTIYHSAHWPEAEEISVKGKKVAVIGTGSTGIQIFQEWAREAEEAFLFQRTPNL
                     CLPMRQQELHAGYQVKDKGEYADYLAECALTFGGLEYQQTPKNTFDASEEEREAFWED
                     LYQMGGFRFWQNNYQDLLTSLDANREAYNFWARKTRARIQDPKKRDLLAPLEPPYPFG
                     TKRPSLEQDFYEQFNKSNVHIVDTKSQPIVGVTPTGIVTADEKVHEVDIIAVATGFDA
                     VTGGLLRLGLKDVNGVGLDERWKDGMSTYLGMAISGFPNMFLPYSLQAPTAFANGPTL
                     IELQGDWITSLIRKMEMENVQSVTATPHAEKSASLQGHRGSWRLHLVCHRSKCLGCST
                     LTIALKVRRRIQPEVLKVELWLS"
     exon            922777..924217
                     /number=1
     exon            925409..925527
                     /number=2
     exon            926229..926264
                     /number=3
     CDS             join(926509..926636,926703..926751,926812..926968,
                     927028..927797)
                     /codon_start=1
                     /locus_tag="AO090012000375"
                     /note="alcohol dehydrogenase, class V"
                     /old_locus_tag="AO070343000374"
                     /protein_id="BAE60564.1"
                     /transl_table=1
                     /translation="MSSSVEIPKQHKAAVYDKPGFVSTSVKLVETPEPGFGQVLINMT
                     HSGVCHSDLGVMTNSWKPLPFPTQEGQIGGHEGVGVVVKLGPGCDNSQVKVGDRVGVK
                     WVAAVCGTCLPCLSGSDGLCLNGKISGYYTPGTFQQYVLGPIDYVTPIPDGVPSELAA
                     PMLCAGLTVYAALKRSRAQAGDFVVISGAGGGLGHLATQIGSRGLGLRVIGVDHGSKA
                     DLVKENGAEAFVDITQFPKDDNGAAIAEHVKSLTNGHGAHAVIVCTASNIAYAQAIPM
                     LRFNGSLICVGIPEGDLVPIATASPGLLAFKQISIEGSGVGNRRDALDVLDFVARGII
                     KPHVRMEKLENLTSIFEEMHCGKLNGRVVIDLS"
     exon            926509..926636
                     /number=1
     exon            926703..926751
                     /number=2
     exon            926812..926968
                     /number=3
     exon            927028..927797
                     /number=4
     CDS             complement(join(928074..929302,929349..929397,
                     929453..929659))
                     /codon_start=1
                     /locus_tag="AO090012000376"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070343000375"
                     /protein_id="BAE60565.1"
                     /transl_table=1
                     /translation="MADTKSFPDPAGDPEAKKDVIEEEAPMDERTLKLDRQTVLRLDL
                     ILMPMTLMLYLLAWLDRANVGNARVAGLEKDLNLTDLQYKTAITVTYVPYVVSELPSN
                     LLLKIIGPRLLLPTLCTLWGMVTTLQSQVHNYSGFLACRFFLGLLEGGLFPGIVLFLS
                     NFYRRHELQVRIALFFSAASLSGAFSGLLAAAIQQMSGLRGMKGWQWIFLLEGLFTVC
                     FGLFSFLVLPNGPEKVITFRSEHTERCIARLQQDGNKFETETKVSFKEVFSVLKDLHV
                     WIACLILFCNGACLFGLAYFSPSIVQALGYSSTKTQLMTVPPYACGFVVTMITAYFSD
                     RYHQRGIGAFITSGIALIGAALAINGRSTGVRYAALVLLLTGVYACAPCLISWVPNNT
                     AGHVRRATAVAMAFIATNCGGIMSTWIYPQKSAPYYELGSRFNLSLTVIAMALVVTQV
                     GLLRMLNRRKNTDPVGLLRGVEDLPYEEQLDKLGDRHPRYKYTY"
     exon            complement(928074..929302)
                     /number=1
     exon            complement(929349..929397)
                     /number=2
     exon            complement(929453..929659)
                     /number=3
     CDS             join(931082..931286,931346..931836)
                     /codon_start=1
                     /locus_tag="AO090012000378"
                     /note="glutathione S-transferase"
                     /old_locus_tag="AO070343000377"
                     /protein_id="BAE60566.1"
                     /transl_table=1
                     /translation="MVLKLYGFPLSTCTRRVRTVLAEKGVEAEFHSVDLAKGEQKSES
                     YLNDLHPFGKVPVLQDTETGVQIFESRAINQYLSSKYAGQGTTLSPPESDLKAWALYQ
                     QARIHPVAYTNHTNRMQALSIEQSYFDPIVSQIAFEKVFKVRKGLGETDEARVQVLFS
                     QLTPVLEGYERVLSRHKYLAGDQVTLADLAHLPYGVFVEQFGFADLLPKYPHVQKWWE
                     ELKARESWKKVTA"
     exon            931082..931286
                     /number=1
     exon            931346..931836
                     /number=2
     CDS             join(936763..937076,937191..937563)
                     /codon_start=1
                     /locus_tag="AO090012000379"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000378"
                     /protein_id="BAE60567.1"
                     /transl_table=1
                     /translation="MDAFGGLLFGLITSRISFIEKLDVSVTLSYTEKPNTNIISTTLM
                     ETEEMRFIDSLTSPESDNPFPKYWREQSVSSSNHSSPPLSKALEDLFRNITLSLMSSN
                     IFHIYIYNRPILWAAYGTARGATALSSIAGVLVYFSNGGSYGTKFSTVFRVTQGAKVS
                     TNLSMKDYSGFDPLPDHIAKAKMTLGYNPDYPVRVSSTAPLDQPHQHPTDSSQLLDTT
                     TGDSNKSSGP"
     exon            936763..937076
                     /number=1
     exon            937191..937563
                     /number=2
     CDS             complement(join(941512..941647,941890..942245))
                     /codon_start=1
                     /locus_tag="AO090012000381"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000380"
                     /protein_id="BAE60568.1"
                     /transl_table=1
                     /translation="MRRREATDRKLSRFDQWVEAYRRLTLHDCDFVPRFLGSSHGRQD
                     DDGLVPGGFLSYIVFTSVPGDVLGTGTSGSPRAVLNISQEDQKRCRKTDIPDGTFWAL
                     SAKERAAIRQQFQSDFTYFFGEFRLDETRSTWPKMELASWGLALLPIKPQGVECDESE
                     LIL"
     exon            complement(941512..941647)
                     /number=1
     exon            complement(941890..942245)
                     /number=2
     CDS             complement(942674..943093)
                     /codon_start=1
                     /locus_tag="AO090012000382"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000381"
                     /protein_id="BAE60569.1"
                     /transl_table=1
                     /translation="MPNSRAVTSKLAVQECLPDLNVSDSRTKSSALHDVYYVGPLSPW
                     PNFLGHVGIEFRTHDWARNQHHLYLEPRGEPGPHSLLKQQSLVGNEPEVQGRWQSQLA
                     EVMTTVFHEQQFQMTFADFVCSGKDYTNVPDFVVLQA"
     exon            complement(942674..943093)
                     /number=1
     CDS             complement(join(943987..944219,944341..944410))
                     /codon_start=1
                     /locus_tag="AO090012000383"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000382"
                     /protein_id="BAE60570.1"
                     /transl_table=1
                     /translation="MGLLVVIYPATSTAASQASKQPGSHQVYYYCAAYFPSPPLLSLF
                     PLCNPTSCLDLLTYHSINSSKMAKSKAVTSKLAVQERLPDLNVLKCLFIEDAVSSV"
     exon            complement(943987..944219)
                     /number=1
     exon            complement(944341..944410)
                     /number=2
     CDS             join(949158..950112,950168..950763)
                     /codon_start=1
                     /locus_tag="AO090012000385"
                     /note="cytochrome P450"
                     /old_locus_tag="AO070343000384"
                     /protein_id="BAE60571.1"
                     /transl_table=1
                     /translation="MALEKLFIVVFLCFALRPLLLYFYDSKKLRKYPNQNFLSGVTNL
                     ASIRERQRKFRTRELYLQHQKHPIIRVAPNMLSFRDVKAIKDIYGFGSPCQKHEIYKL
                     QNSEGHMNILNVIDREDHNRKRRMLSHAFSTKNLESWEFKITDKVEKLVAQFDRRAHP
                     PAWKNEPSQQNNTTVDVRYWLNLFTVDAIADIALSERLGMLESGSDVVKVGGPGEEDS
                     AHRFIEDMHEAARVKSKIIGTLDWYYVLKQVSSFLSSRCRSQWDCGGNVGQIVEHLAG
                     KRLRRHEDGENIDDFLSCLINDKAGKSRNLDIGELKAETSILLDAGSETTAIALTHLL
                     YYLIKNPDCFVKLRKEVSGAIAGDKVAPYAKVKSLPYLKACIEESLRLSPPLPRGLER
                     VTPAAGAYIMGEFIPGNVGVSVPAYVAHRDPDLFPEPEAFLPERWFNNENIGKMRDAF
                     IPFSAGGRACIGRNITMIEQQILIATLVHRYDFSLASPDWTLQNEEAFNLWPVELPVK
                     IWERDLEA"
     exon            949158..950112
                     /number=1
     exon            950168..950763
                     /number=2
     CDS             join(951688..951995,952016..952106,952178..952284,
                     952815..952834,953088..953119)
                     /codon_start=1
                     /locus_tag="AO090012000387"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000386"
                     /protein_id="BAE60572.1"
                     /transl_table=1
                     /translation="MVWRCVGLELYRILGVETSIERFHLLCIQFLSTVLGIYAANYAV
                     RLGELTGLAFSVLSCFSTFSQKQCRQFQRSGAQHHYRMNPLLAQLLKGQTLATSPGHA
                     SASATSCRAYIQNEARVKQLAELWACNEATIDCPNNREVHLTGVSIEKASHQNEQPGR
                     SSVQTPVSRPGFIAATCENKEICSA"
     exon            951688..951995
                     /number=1
     exon            952016..952106
                     /number=2
     exon            952178..952284
                     /number=3
     exon            952815..952834
                     /number=4
     exon            953088..953119
                     /number=5
     CDS             complement(953396..953908)
                     /codon_start=1
                     /locus_tag="AO090012000388"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000387"
                     /protein_id="BAE60573.1"
                     /transl_table=1
                     /translation="MSTPLSYFQSASWCAAWLNHPDLRIDTSASNPFRETTKHDDAWK
                     KRTFLYRASQDPQGIKSEGYIVMQIGAGVSGKDGVAHGGFLATLMDELTGGLVAALGL
                     DRGLGIRTASLNTTYHKLLLAQGFIMARAEIVKVERRKVFVKAEIRDAAGNICTTSEA
                     LFIMNRSSLS"
     exon            complement(953396..953908)
                     /number=1
     CDS             complement(join(954750..956241,956294..957837))
                     /codon_start=1
                     /locus_tag="AO090012000389"
                     /note="beta-galactosidase/beta-glucuronidase"
                     /old_locus_tag="AO070343000388"
                     /protein_id="BAE60574.1"
                     /transl_table=1
                     /translation="MASLATTGWPGALPDWSNLNVLHRNTLAPRAHFYLYPNEEAALT
                     FDREESLFHSLNGTWKFHYDASPFVSPSWDSNVNDWDDIVVPGMWQTQGYGRPHYTNI
                     DYPFPATPPNVSYMNPTGSYWREFEVPSDWDGQQIRLRYEGVDSAFHVYVNGEEVGYS
                     QGSRNPSEFDITEYLSPNDTNTLATRVYQWSDGSYLEDQDQWWLSGIFRDVYLIPFPQ
                     SAITDFSVMPELDDSLEIGTLNVNVSTQGEDGDMSIKVLLPNGGVLDSWSGSSSDRYS
                     KRVEGDDLHLWSAETPNLYTILIEFNGRTISQKVGFRRVEMSGSNFLVNGKPIIIYGV
                     NRHEHHYLSGRTVPYEAMRADLIQMKRSNINTIRTAHQPPHPAFFDVADELGFYVISE
                     ADLECHGFGHIEDTEEQAATWLSDNPEWTHAYLDRAQQVVERFKNHVSVIIWSLGNEC
                     FYGQNQAAMYQWIKERDPSRIIHYEQDRKAESADIYSHMYSSPDTMLEHMANHTDKPL
                     ILCEYAHAMGNGPGGLEEYVALFRSEPLSQGGLVWEWNNHGLLKKEGDLEYFAYGGDF
                     GDEPNDADFIMDGLTLSDHTPMPSLLEYAKIIQPVTVRLTEDSSQMIVTNHYDFVDLS
                     GLNVFWHMVYDGRTTNRTELTLPRVPAGENRTVDLPLNIDDVSQEAWLTIEFELKENR
                     IWADQGHIVAWDQLYLPGTSVQRSMAAVGRAVSPSARQAGLQVTQDRAKLNITTGGTA
                     FGFDLLQGNVTWEVDGVSMFQQGPELYFYRAMTQNDEASAGDGVEWDAAKVGMMHTQV
                     RDVTWSQSENGVTVHFQIRVAPKVLEWGVEADLIYTVSTGDPAIRVQARGEFVGKNTP
                     SVVPRIGLMAVMSKEFSDVSWFGRGPGENYKDSKQACRMGRYESTVEDLFTYYDYPQE
                     NGNREDLRWLQVSNGEVTLDVRRADEGASFSFTAGRYMPFDLNDAKHPHDLNPLNVTV
                     LNLDYDNHGLGSATVGPKPFEKYKCRTEPFDFTFVMSLA"
     exon            complement(954750..956241)
                     /number=1
     exon            complement(956294..957837)
                     /number=2
     CDS             complement(959537..962629)
                     /codon_start=1
                     /locus_tag="AO090012000390"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000389"
                     /protein_id="BAE60575.1"
                     /transl_table=1
                     /translation="MRFTPKVDSNMALLLYNSGKAYLLHWAQTEDRDALEKAIIVTRQ
                     SVECTPEGDDGLANRLRSLGACAFAMFKHTDRMEDLDNWIDAFRRAAQLVPNNHPTQS
                     NSSALLRNALLVRFQAQGNLQDIDSVLSASREAAAAGAGENDHDAWALYHLGSQLDFK
                     YVNTGDVDCLHEAIQVCSQALDRPGEDHVICAKILALRGQCLRELFEHTGDISELERA
                     ITDCKQAAEIMPEDHHALPGILQRLAFSSQEQYQLSGEIKYLEEAIKIAHRSLSLASI
                     YGHEMSKFLSTLGGILLRRYSATLRLRDLDDAIKALRKSLENESQMPKVVTATNLDIL
                     ASCLGTRYRRSGDQRDLQGAEHASRQAVEIAPASHAGLPAILSNLGRYLMELFQATRE
                     PNYLEESMQTFTCALDRVRSPLHAQLCLGVMAGCRRIMYMITHNDEHLEAAIEICRKS
                     IAALPTETDILADCQDELALLLHCQNSDDQEEALGLSLQVWNSLRASPFGRIRAANRA
                     VTIYIEQSNLEKAYALATAAIDVLPLVHNQSLTLQDQQEVVQVFSGLATYAFSLALRT
                     KRSPIEALDLLERGRGVILRLLMNDRSDLFKRRNTQLGLSAEVEIPLYEMHTPTVSLC
                     SGNAANYHFDSQRAQGGSEAPTEDIHFSPTVDSSEKRVTEEEVKEGAARGRVIIVNIT
                     SVGSDALVISSTGLKVIHLQGLDPDEARDWIKKDMTATSVNRGANNKAYLRFLSWLWR
                     VCVKPVFDGLQYKVHDSPEDMPRVWWVGTGLASSFPFHAAGNHLTERNESANSRVLSS
                     YTPSLRALLYTRNREPLSNQATQCPKLLTVSMATTPGADDLDGVLAEIVAVTDTIGNY
                     VHAECLSQPDADTVKRRLADCHIAHFACHGVSEPRDPSQSGLLLQTIGDSPEQDRLTV
                     GSLYEIDCSQGQIAYLSACSTAENRSKWLVDEVLHVVSGFQVAGFRNVIGCLWPADDT
                     VCAEIAKPFYYELCRGGKMEYNDGTVSLALHKAVLQISRSSQYRKRPLHWAQYVHFGA
                     "
     exon            complement(959537..962629)
                     /number=1
     CDS             complement(963725..964549)
                     /codon_start=1
                     /locus_tag="AO090012000392"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000391"
                     /protein_id="BAE60576.1"
                     /transl_table=1
                     /translation="MRQTAFLRQFFLPPTSVKIGRFLCNIDCPHQDYHDPALQSAPPV
                     IEKVQTQYSGSEALSSTNTFASDLTALLSTWISTRTAAAIHTSTSQVKTYYLDNSEQW
                     FRDAVQQEEVRKWIERVIDEGESIYLVVGYHTVLDARIGVQKSEGKEIGGQLTAPISA
                     GLNASGVVVPLGGLVDPSVGGSRDHSESLEMQFEAPGEQIVAVQYRKVKFGFLSSRNV
                     DTAALKKVARWKRYDRPRYLQSEADDMVEVELEDLLDLDGEFEEHRIGSETILFAA"
     exon            complement(963725..964549)
                     /number=1
     CDS             join(970663..970843,970923..972619)
                     /codon_start=1
                     /locus_tag="AO090012000394"
                     /note="Methionyl-tRNA synthetase"
                     /old_locus_tag="AO070343000393"
                     /protein_id="BAE60577.1"
                     /transl_table=1
                     /translation="MTEQNKPILPESGKRNFLVTSALPYVNNVPHLGNLIGSTLSADV
                     FARYGRGRGANTLYVCGTDEYGTTSEARAIQENMTTKELCDKYYALHAEVYKWFNISF
                     DIFGRTTTELQTKITQDIFLKLHDNGFLSEHVTTQLYCEEHKSFLADRFIQGECPHCK
                     YIDAYGDQCDLCGQLLDPLDLIKPRCKLDGATPVKRDTKHIFLKLDKLQPEIQAFFDE
                     SSAKGGWSQNGKDITSSWLTKGLQERSITRDIKWGTQVPLPGYEEKVIYSWFDACIGY
                     VSITANYTDQWEKWWRNPEDVELYQFIGKDNVAYHSVMFPGTEIGTREKWLKVHHLST
                     TEYLTYEGGKFSKSRGIGVFGDSAKKTGIPADVWRYYLLSHRPETGDSEFNWDLFISS
                     NNNILLKNLGNFVSRVVKFVNSKNYDNIVPDYTAYTEPAFDAWKEEVNELLTQYIQQL
                     DAVKIRAAIDTVLTISQKGNLFLQSNSLDNKLAENEPAKCAAVIGLALNLIHLLSALL
                     APYMPETAASINEILRTEAIQIPDRWNADTVKPNHEIGKAKYLFSNIKPEKANEWRDM
                     FGDEEAKKVKEEEAKKKAAKKAEKLAKKEKKKEQKEKEAASADGVSEISQSAEKLNIQ
                     Q"
     exon            970663..970843
                     /number=1
     exon            970923..972619
                     /number=2
     tRNA            complement(973036..973137)
                     /locus_tag="AO090012t00010"
                     /note="tRNAscan-SE"
                     /product="tRNA-Phe"
     CDS             join(973702..974238,974370..974504,974565..974882)
                     /codon_start=1
                     /locus_tag="AO090012000395"
                     /note="soluble epoxide hydrolase"
                     /old_locus_tag="AO070343000394"
                     /protein_id="BAE60578.1"
                     /transl_table=1
                     /translation="MSTKTHTPPKTQHKYTYTHYPPSPQENRNNPKPTILLLHGFPST
                     SYDWRHQIPYLSSLGYGVIAPDLLGYGGTSKPTNLAAYKSKSMAAEIISILDAEGIDK
                     VHAVGHDTGCTLLSRLADYFPERLLSCVFLDVPYMRPGERFDLDMVNRVTRDILGFER
                     FGYVGFFAGKGSGVLLDRFADSFFTLFYPHSPSLWISHLCPTGAIEQWLLSDNRAPLA
                     PYITEEELKTHQKLLVGNHDSALNWYRALVSNINLEDEKESQITPALSMPVLLTCPKK
                     SELEMPGLEEGMRAVCAGDLVVRRVSTEGHWVQLEAREEVNRFLEEFFEGIGV"
     exon            973702..974238
                     /number=1
     exon            974370..974504
                     /number=2
     exon            974565..974882
                     /number=3
     CDS             join(976918..977296,977349..977533)
                     /codon_start=1
                     /locus_tag="AO090012000396"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000395"
                     /protein_id="BAE60579.1"
                     /transl_table=1
                     /translation="MIEQEELRPLYNPWGPTTTTIKSNRLVSHTYDSIIFYRWTSPDG
                     VFERGRIMARLVAEMMEKNRRRVWLDQWEMRRDTTSDQVVRQISDIFLCIPKVIILAA
                     PGDWDRFTNADDIHRWEWELSLQSDKKIWILRYGVPETTQAPSKEQLAADLRHHSTRL
                     ADLAMKGNIQVRVLTMDNLNSVLSELA"
     exon            976918..977296
                     /number=1
     exon            977349..977533
                     /number=2
     CDS             join(977867..977972,978036..978164,978224..978325,
                     978390..979738)
                     /codon_start=1
                     /locus_tag="AO090012000397"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000396"
                     /protein_id="BAE60580.1"
                     /transl_table=1
                     /translation="MTLFNATALGAFQLKHRVVFDPILSEWSHVELENYFEKLNPDGG
                     LVLVPPACSTLPNKAQKRVIDRLHALNDSIVFAQVCDDGSPIDSLSQNLAYSASKKID
                     LGYDGVEINIGGPMLQKILDETSDPSTAVATILKVISAVATLVPTDQVGIRLVPFSNV
                     ESQQQPLEFFCTLIESIASQLPTLCFVHVVAHARFDDFEYPRNASLDEFRGALASASH
                     SIAFISADAYESETASTIAARTQDLVAISLPAEIDLNLITTLRQGAPYEIAEVTADRL
                     NAIRSTFQTGKEYVLEWPSEQKRKVFGAMDDLDRYLGELDPALSYEGTDKKVVWRKSC
                     WFASEGISHPFLDTEKAIAAFDGDLHDGLAGLQALQDPSVRQSMVYLKNVLDSALVTT
                     SAAVGIDKDMIQRCTVRYRIIKYTAHAGNPGGIGLHPDGNLLSALITNGDGLRVYDLD
                     GTVRYPGYNGTIMMGGSTLYRWSQGHYPPTFHDVTTNKDQVKVSIVAFFNFPDLVTIP
                     RALNSGSASDGGFFHDIRVIKEDDKLPHGQLSPLWDVIIDKHQLVLPPAVTAK"
     exon            977867..977972
                     /number=1
     exon            978036..978164
                     /number=2
     exon            978224..978325
                     /number=3
     exon            978390..979738
                     /number=4
     CDS             980254..980853
                     /codon_start=1
                     /locus_tag="AO090012000398"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000397"
                     /protein_id="BAE60581.1"
                     /transl_table=1
                     /translation="MSTQPQPPKATTYTQPQNLISQTPLEQDQQQEQRTRHHGDNVPT
                     ITRGPQSRPSNSDALSEHTQRKQQPRDLHSAANVDTEYGVEQQPAEGDIAARVEGKST
                     RAREQAGAHAGPVGSALGPGCPASASAGDGGELRELGRKREEHDRMLGERVGQSPAEP
                     EGVEGGSERDRAWRRKLEREGEVDVGRAVGEGTGSAVVR"
     exon            980254..980853
                     /number=1
     CDS             complement(join(981048..981705,981775..982272,
                     982320..982423))
                     /codon_start=1
                     /locus_tag="AO090012000399"
                     /note="cytoplasmic tryptophanyl-tRNA synthetase"
                     /old_locus_tag="AO070343000398"
                     /protein_id="BAE60582.1"
                     /transl_table=1
                     /translation="MAASNQEQDINPWSVEGARDENGDVASIDYEAISQKWNTSIIDQ
                     KLLERFEQVTGHKPHRWLRRGLFFSHRDFDRILNLYERGEPFFLYTGRGPSTGSLHLG
                     HTIPLQFTKWLQDVFDVPLVFMLTDDEKALFKDNLTFEETMEYAKENARDIIAIGFDK
                     KKTFIYSDLKYLSNHFLMNAWEFSKLVTFNQVRGAFGFNESTNIGRIFFPSVQCVAAF
                     ATSYPEIWTDDPQPTRTQSIANIPCLIPMGIDQDPYFRLLRDNAHKMRFPSPKPALIH
                     SKFLTALQGPGGKMSSSNPNSAIFMSDTPKQIKTKINKYAFSGGQVSVDDHRRLGGNP
                     DVDVSYIYLTYFEEDDAKLEEVYKSYKSGSLLTGELKKMAIEALQEYVRLFQERRGLV
                     TDEVLEEYMQPRKLVWEGNQKPVKESF"
     exon            complement(981048..981705)
                     /number=1
     exon            complement(981775..982272)
                     /number=2
     exon            complement(982320..982423)
                     /number=3
     CDS             complement(982744..984192)
                     /codon_start=1
                     /locus_tag="AO090012000400"
                     /note="transcription initiation factor TFIID, subunit
                     TAF7"
                     /old_locus_tag="AO070343000399"
                     /protein_id="BAE60583.1"
                     /transl_table=1
                     /translation="MSEGRPSLKLTFGKKKAPEEPPKKPAPPPPSETPQRKLTLKIAR
                     KPTTEGEPEKAKKKKPSKKRPADEPAVSEPSASRPPPEQPAGPKRLKLTPSKKPGVQS
                     IRIKNKGLVPNRPVGVGYDSEASDTEIDPSIEEGFILRMLPGEECEYLRRAIAERRFD
                     RSEFSFKPLTREGRRAVFRVRDKQFAAALVDLPCIIEGMKSWDRRGWYKSGDICQMLL
                     VLGPVANEKEALEYPLPPEVERGDDKTLQYAHGLTPPLQWVRRRRFRERVSTRTIEQV
                     EKAVEDLIAQDEAAVGIPRYELVDSASLNRAEGLVQSGEYDEYDDEQDAEGEWDMGME
                     EAPGIFEDFEDALAAEMEAALAADDNAAPPAPAATPVDSGVYQAGTPMATKPSTPAAE
                     SSGDESDESDGDERGAAEDGLDEEQLEQRQQMQQQREEIAELEALIRTETAKWEKMQN
                     QILKNKLARRIQELKKDLSLKKVSIGEGDEDA"
     exon            complement(982744..984192)
                     /number=1
     CDS             join(985929..987164,987225..987476)
                     /codon_start=1
                     /locus_tag="AO090012000401"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000400"
                     /protein_id="BAE60584.1"
                     /transl_table=1
                     /translation="MVYAFTLPTTSHLSFQTHLTSTTHPSLPQAASTARHALRTALKT
                     HKRLPRGPQQDAHLSTLLTTLTDYLPYLTAITNSLTSTRLPETPSEEIEIALHSEPEP
                     SWRPTLTSASLTLKQPRPKGLGLEYELAFVLTTYAYVLSKLAHTTVTRILYAPTTPTP
                     EARTAAITTATKHLLQASAIHSLLATSPAFAHVSRSVSSAPGIVPDLDPAAQAALASL
                     ALAEATLLAVLKDDSYVSACIQARNPNDKEWMVRAPEIPKVRAHLFARLCIRAAEYAE
                     QAAAGLGAVGAQGRAGIEEDLIKYVRVLGRVARARACRFFGVDAELAGKIGEGIAWLR
                     AAKAALGVRGEKQENEVKSRGFSRLKQGWMERREERKMEKDAGRMEKGELGPGDNAGR
                     EEEGRVIEMLETKWVRMNDTINTQLIPPSSDLVANLPSGRDIHSAPGAYRLQALDDEE
                     LVRMRAPPVEDEFGPGSDVDDSEEESGLARDTPSTVPERTDSAYY"
     exon            985929..987164
                     /number=1
     exon            987225..987476
                     /number=2
     CDS             complement(join(987865..987947,988159..988384))
                     /codon_start=1
                     /locus_tag="AO090012000402"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000401"
                     /protein_id="BAE60585.1"
                     /transl_table=1
                     /translation="MPTPESAAFLAKKPTVPPTYEGVDFEDNVAVHNARDAIIREQWV
                     RSMMSRLVGEELGKCYAREGVNHLEKCGALREKYFELLKERKIKGYLFQEKNYFEKSA
                     "
     exon            complement(987865..987947)
                     /number=1
     exon            complement(988159..988384)
                     /number=2
     CDS             complement(join(989001..989667,989721..990006,
                     990065..990140))
                     /codon_start=1
                     /locus_tag="AO090012000403"
                     /note="subunit of Golgi mannosyltransferase complex"
                     /old_locus_tag="AO070343000402"
                     /protein_id="BAE60586.1"
                     /transl_table=1
                     /translation="MLRRRRLRLLIALILVLVGYFYFWTSFLERYRRSSFGGGSKFVI
                     ILESNVEGGVMELKGAREWAVERNSIRNKQEYAKQWGYELEVVNMLAKKRYSHEWRES
                     WEKVDIIRETMRKYPHAEWFWWVDLNTWIVESSYSLQDHIFNRLGDISYRDINVYNPL
                     NISHPPTGAYLDDVSRSPVGDGDPSSIQMVLSQDCSGFSLGSFFMRRSVWSERLLDIW
                     WDPVMYEQKHMEWEHKEQDALEYLYTNEPWIRSHVGFLPQRYMNSYPPGACGDGGDPD
                     IHFVEGAGDFMVNLAGCGYGRDCWSELWEYRRISQAINRPWRERVEDKATELYEKFFG
                     RQDNSPQS"
     exon            complement(989001..989667)
                     /number=1
     exon            complement(989721..990006)
                     /number=2
     exon            complement(990065..990140)
                     /number=3
     CDS             complement(join(994480..994622,994736..995409,
                     995459..995859,995922..996809))
                     /codon_start=1
                     /locus_tag="AO090012000405"
                     /note="serine/threonine protein kinase Chk2 and related
                     proteins"
                     /old_locus_tag="AO070343000404"
                     /protein_id="BAE60587.1"
                     /transl_table=1
                     /translation="MEATQESTQPCTDPRRMGYNNSGLHEQDVSDIICILHPSSPAAH
                     HAVAASASSAPQHILQRDELAFESSAALDIGLRLSSKVHDLNTGFCFGRNRTRCDLLL
                     ARDQNSKRISNQHFRIYLTEDGIIMLEDISTNGTIVDNCRLRKNQRENSRMLTNGSVI
                     QVMNGDQTSDEVRFVVRIPSREGFSMQYTENLLRYFERIQKHRAGTTQVKPRQTSAQP
                     VLQWTVSNTYGMHWTGGPKYNVTGQIGKGAFATVYKLATKQHGAVYAAKELDKRRFMK
                     NGVLDQKVDNEMKIMKDLKHPNIVQYMDHHEHERWIYIIMEYVPGGELSTYLQSTGKI
                     PEDMVKTIARQVLHALQYLHTRKITHRDIKPDNILISSLDPLRVKLSDFGLSKVVQEE
                     TFLKTFCGTLLYCAPEVYPEYDSYRRGEVRKRRRLGDPPPKTSPYSQSVDMWSLGAVL
                     YHILAGVPPYMGRGDDRGAQMLRTIMTTDPDVDILRNEGVSEEGIDFVTRLLNRDPQA
                     RPTERECFQHPWIAEVEDVDEYDDDEVYANVRGELSDIGEDAEEELDASQLSIHDEPE
                     PEDPAEQEDSDLAQSKRPRIDYPPTDVRYPSLPHIESLKEVQVAADTTPKRLFGEITP
                     SVLGSSDALGSKMHAFEGDNFSINDFISSAAEHEFVAPWHIKQSSASRRDTGTANWSE
                     GGGFCREKGGEDKAANQPW"
     exon            complement(994480..994622)
                     /number=1
     exon            complement(994736..995409)
                     /number=2
     exon            complement(995459..995859)
                     /number=3
     exon            complement(995922..996809)
                     /number=4
     CDS             complement(join(998056..998366,998657..998747))
                     /codon_start=1
                     /locus_tag="AO090012000406"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000405"
                     /protein_id="BAE60588.1"
                     /transl_table=1
                     /translation="MSFCFWDLRSTSPAHGSFELAMGNQRAGPAEMEFFQRDFEVMSF
                     FTSCHSDCFLTSHLLVVKYLREGDEVYGKIVLDDDKIKKNDGGKNVLLQTCMTERARV
                     EALKDQFGIELTEEEQNGIQGRMSALATSDS"
     exon            complement(998056..998366)
                     /number=1
     exon            complement(998657..998747)
                     /number=2
     CDS             complement(join(1000794..1000900,1000967..1001912))
                     /codon_start=1
                     /locus_tag="AO090012000408"
                     /note="threonine aldolase"
                     /old_locus_tag="AO070343000407"
                     /protein_id="BAE60589.1"
                     /transl_table=1
                     /translation="MTKPTISMLEAITQTTLLDDVFCEDPVTNDLQAYVAQRTNHEDA
                     LLVMSGTMGNQVAIRTHLVQPPYSVICDRRSHIVCHEAGGVSSLTGATVQPIDAKNGS
                     YLTLEDIQKYAVLDDDIHHCPTKLISLENTLDGRVLPLAEARRITEWAHANGIKVHLD
                     GARLWEAVVSGAGSLPEYASLFDSVSLCFSKGLGAPIGSIIVGSREFIKKARWFRKAI
                     GGGVRQAGVLAAAARVALDETFGTDPHGQDGKLRETHTKAKKVTEMWQNLGGKLSQPT
                     ETNMVWLDLDAAGLGPNDLGEIGKEKGLKLLGNRIVIHYQVSEEAIARLGEVFELAMS
                     GNYQRSTDKSLPYGSR"
     exon            complement(1000794..1000900)
                     /number=1
     exon            complement(1000967..1001912)
                     /number=2
     CDS             1003235..1004395
                     /codon_start=1
                     /locus_tag="AO090012000409"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000408"
                     /protein_id="BAE60590.1"
                     /transl_table=1
                     /translation="MSELKGAFTALRIELNGPGRFSDLGNTMNNDFNMITTVLKELKS
                     KSEEIEKLKLEIEALKLKNRYMEEQNTKQQQQTSTIAIPGPLPEVRSPGLLQAGRKRP
                     WPDSWPSGRTQPIADSFDDGDEEDSIDFSLEDPHMPPVRIPLKGPETDAMMDTPHEPT
                     APGSPNFRVQVNQSRHQSPQWGTPELRASVEQHTMSKRPRISQAPEKPPSGGESDKRR
                     PGRPRKSISQAPKPDFSQTQTPRPTPLSEQNLNVSSSGQKENAPPSTSPSQRQNGAET
                     RPGRSRSLRSRSRPPTRHSTGLNNSFSEQDQTQTLASSQRETPRGADDPVSFDQETGS
                     GKENPPGKNNGAHTDDWNKREAQEKRKAQVAARDMMARLAMQREEAMETEAR"
     exon            1003235..1004395
                     /number=1
     CDS             complement(1004775..1006994)
                     /codon_start=1
                     /locus_tag="AO090012000410"
                     /note="3'-5' exonuclease"
                     /old_locus_tag="AO070343000409"
                     /protein_id="BAE60591.1"
                     /transl_table=1
                     /translation="MTGMKKRKRTEAGYSDDEPPVNDTSNASNGFGVAQTLSLLRGSK
                     PSEESDPTTAMQLDDTPKDKGDMPAQRPSKKKRVDGEKTKYPVLTYVDGRLQSSIRIA
                     DLQGLLLYCFADGIAPQWISIKHSGHVRKVVALMVPGLEIGMFDGTIPLQPPAEDVSG
                     SQTNQNDTTGAEGQEEDPKTAEFNRWKQGLPLEDRSHRFNPRPLSRDELPDSLQPLAD
                     MFPHVWPVRAPGDSKYNKVHSPLQAILLSALPKNKEDNHKKGPKQARMDKSFVPKRTP
                     ITTFISSLEDLRENEYALHPALFTTGNEKSELMQSRKRAGQDAEAGWVDTHVANFEQG
                     DVPEAEIQQGSMTAGRNVLALDCEMCITEGGKSELTRISLVGWDGEVVLDELVKPQLP
                     VIDYLTRFSGITKEMLDPVTTTLADIQQKLLTILTPHTILVGHSLNSDLNALKLTHPF
                     IVDTTFIYPHPRGPPLKCSLKWLTQKYLGKEIQKGQTGHDSIEDARAVLELVKQKCEK
                     GERWGTSDAQNESIFKRLARSTRSGKSNPTGEGRTGAVVDWGNPERGFGSQATVAIGC
                     SDDEDVVKGISSVVNGDDSNASVPGGGVDFTWARMRELEMYRGWCNRMPDPNNANEST
                     TLVPPPEETTPTGPPASAPSETAQKSLVDTVSRTVSHIQQVYESLPPCTLFIVYSGTG
                     DPREVSRLQAMHKRFREEFNAKKPWDELSVKWTDTEEQALKRACERAREGCGFMCVK"
     exon            complement(1004775..1006994)
                     /number=1
     CDS             complement(join(1007647..1007663,1007804..1008137))
                     /codon_start=1
                     /locus_tag="AO090012000411"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000410"
                     /protein_id="BAE60592.1"
                     /transl_table=1
                     /translation="MASKDAPVGIIDPTEVGVFAAHLLSDGNPTVHNKARYVLNGPED
                     ITGKQIVDMVEQYIGVQVEEVIYKDVSFIDFLYEHQYAATHQSKNVILSIKHAPETAW
                     EGQCTASTTTAMMP"
     exon            complement(1007647..1007663)
                     /number=1
     exon            complement(1007804..1008137)
                     /number=2
     CDS             complement(join(1011673..1011701,1011775..1012819))
                     /codon_start=1
                     /locus_tag="AO090012000412"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000411"
                     /protein_id="BAE60593.1"
                     /transl_table=1
                     /translation="MAAPANLSTPTPMLVTAAANWPTVGIVQIHRNALTWNFTDIIID
                     NSDFPLANFDSTFGSSLDKAANKIPHASATTVIPGPEDAVDGIETSDALGKLSKINLE
                     LHVRVAAAEMNKTILDFNSLIYQNSPLCIDNYTLAVFTLKASQEFVQILTRLLNSRQC
                     HGIPSTSQKPVSLYPEPILLPLQSHQDNVLDSTSATSPPFFSAVLQPLLAPLALTIIS
                     IFTQLITVYGLFLEHLSTRIERLSTDPITPIPGIIFGGVPLETPCMQGMLFFNGVIHL
                     LETMEQALGISEREGGTVGLLSDRQVEVLWSELDGGLIITPDGGTMRPADVKKLLGRM
                     AMILNHFSLVDQQRQFQEVGHGL"
     exon            complement(1011673..1011701)
                     /number=1
     exon            complement(1011775..1012819)
                     /number=2
     CDS             join(1013735..1017415,1017482..1017645,1017724..1018102)
                     /codon_start=1
                     /locus_tag="AO090012000413"
                     /note="pleiotropic drug resistance proteins (PDR1-15),
                     ABC superfamily"
                     /old_locus_tag="AO070343000412"
                     /protein_id="BAE60594.1"
                     /transl_table=1
                     /translation="MSLSSSTSDTKSTVAGEERDTEDETKRDSVQHVQATWHMAPELH
                     RMRERDEAGGEKPRKLGIAWQNLTIKGVGGNATFKENVVSQLLPFHKGSNDTQLKTII
                     QDSYGCVKPGEMLLVLGRPGAGCTTLLSVLANNRQGYEEVTGDVSYGNMSAVEAQQYR
                     GQIIMNSEEEIFFPTLTVEDTIKFAARMKVPYHLPPGITTHEEYVQFYKDFLLRSVGI
                     SHTERTKVGDAFIRGVSGGERKRVSILECLTTRASVFCWDNSTRGLDASTALEWIKAI
                     RAMTDVLGLATIVTLYQAGNGIYEHFDKVLVLDEGKQIFYGLRKDAVPFMEDLGFMRD
                     PGSNQGDFLTGVTVPTERRIAPGYEDKFPHTADEILAAYERSEVKRRMLEECQIYPKS
                     KEADENTAVFKEMVSREKHRGTFKKSPVTADFITQIKAAILREYQLKRGDKATLLMKQ
                     GATLIQALLGGSLFYSAPDNSSGLFLKGGALFFSILYNALIALSEVTDSFTGRPILAK
                     HRSFALYHPAAICIAQIVADFPMLLFQVTHFGLVLYFMVGLKTSAGAFFTYLITNFIT
                     AMSMTAFFRLVGAAFPTFDAATKVSGLSIVALFVYMGYMIIKPLMHPWFVWIFWINPM
                     AYAFEALLGNEFHAQDIPCYGPNLIPSGSEYIDGAGGQSCAGVVGAAPGATSLKGDDY
                     LAAISFSHSHIWRNVGIICAWWALYVGLTILFTSRWKLLGDGSRRLLIPREQQHRSKH
                     LLQSVDEEARATEKSTVSSNTSSESIGDNLLRNKAIFTWKDLTYTVKTPEGDRVLLDN
                     VQGYVKPGMLGALMGTSGAGKTTLLDVLAQRKTSGTIHGSILVDGRPVPISFQRSAGY
                     VEQLDIHEPLATVREALEFSALLRQSRDTPTEEKLRYVDIIVNLLELNDLEHTLIGHP
                     GTGLSVEQRKRLTIAVELVAKPSILIFLDEPTSGLDGQSAYNTVLFLRKLAEAGQAVL
                     VTIHQPSAQLFTQFDKLLLLTTGGKTVYFGDIGPNASTIKKYFGRYGSPCPPEANPAE
                     HMIDVVSGKGEGQDWNQIWLQSPEHEKLSGELDSMTAEALSRNTTVNDEQHEFAASLW
                     TQTKLVTHRMNISLFRNTEYLNNKFAMHISLALLNGFTFWMIGDSLTDLQQNLFTVFN
                     FIFVAPGVISQLQPLFIDRRDIFEAREKKSKMYHWAPFVTGLIVSEFPYLLVCAFLYY
                     VCWYFTVGLPTSPYHAGSVFFVVVMYECLYTAIGQMIAAYTPNAVFASLVNPLVITTL
                     VSFCGVMIPYSQIQPFWRYWMYYIDPFNYLMSSLLVFTTWDKPVHCTPDELAVFDPAP
                     NQTCGEYLETYQRGLGVATNLLNPLDTAGCRVCQYTEGGDYLRTLNLAERSYGWRNAG
                     IVVSFVIGIYGLVFLMMKLRTKATKKAES"
     exon            1013735..1017415
                     /number=1
     exon            1017482..1017645
                     /number=2
     exon            1017724..1018102
                     /number=3
     CDS             1018687..1019580
                     /codon_start=1
                     /locus_tag="AO090012000414"
                     /note="glutaredoxin-related protein"
                     /old_locus_tag="AO070343000413"
                     /protein_id="BAE60595.1"
                     /transl_table=1
                     /translation="MSTLIEISSEAEFDSHIKSLPSTTLSILYFHAPWAAPCAQMRTV
                     LAALASQYPATQPPTTSFISINAEELPDISETYEVTAVPFVVLTRDGKILESISGSDA
                     VRVREAIERHAGSKASTGAPATIPPPLAAVPRETGPTTATQPPAGAANGDALTPEQSK
                     EALFARLRELVKAAPVMLFMKGTPSAPQCGFSRQLVAILRERSVKYGFFNILADEDVR
                     QGLKEFADWPTFPQLWVGGELVGGLDIVSLYFLFFFFLCLVSLPWLNGLVLIGEQVKD
                     EIENDPDFLREHSVNKAPVAA"
     exon            1018687..1019580
                     /number=1
     CDS             complement(1019964..1021391)
                     /codon_start=1
                     /locus_tag="AO090012000415"
                     /note="predicted gamma-butyrobetaine,2-oxoglutarate
                     dioxygenase"
                     /old_locus_tag="AO070343000414"
                     /protein_id="BAE60596.1"
                     /transl_table=1
                     /translation="MVRLLATVLRSSRAAVPSARPLYSRGYSVASGAAEDAASLGPTP
                     KKGPPGGLHEPIRNLMDPPEPQARNTQPSTPSIGRQGIRIRTGKGDVSAMHYLLRDGC
                     KCPQCVDQHSKQRNFRMSDIPTDIKPRSTEWDGSVLKVKWENDIPGFDESHTSTYTLN
                     QLRNPSANYSYHSTGRKRKRLLWHNWFQHRFVSYEEYMHDDEAFSSAMRNLARTGLLF
                     VKDIPDSRAEVEKLATRMGPLRNTFYGSTWDVRTVPEAKNVAYTSQFLGFHMDLMYMN
                     EPPGYQLLHCLQNSCDGGESLFADSFAVARQLSIDDPEAFKALCNLRLSYEYNHENDI
                     YTNDWPVFQTYVDEYTQQQRLMHANYSPPFQAPMHGQRRPFNRTMSEMRALDKFAKML
                     EDEKYIYELKLNPGECVIFENRRVLHARRQFNTATGQRWLAGAYVDEDAVLSKFATSA
                     RKYPHLWRDSPSKPSRKEAEGEGQV"
     exon            complement(1019964..1021391)
                     /number=1
     CDS             join(1023444..1023476,1023563..1023615,1023681..1023834,
                     1023919..1024635)
                     /codon_start=1
                     /locus_tag="AO090012000416"
                     /note="mitochondrial solute carrier protein"
                     /old_locus_tag="AO070343000415"
                     /protein_id="BAE60597.1"
                     /transl_table=1
                     /translation="MSAGGEHLKDEGTRRQVVLAGGIAGLVSRFCVAPLDVVKIRLQL
                     QIHSLSDPTSHQNIKGPVYKGTLPTIRSIVREEGITGLWKGNIPAELMYVCYGAIQFA
                     AYRTTTQALSQLDPYRLPPPAESFVAGATAGGLATASTYPLDLLRTRFAAQGTERVYT
                     SLYASVRDIAQNEGPKGFFRGCSAAVGQIVPYMGLFFATYESLRPVMSGLHDLPFGSG
                     DAAAGVVASVLAKTGVFPLDLVRKRLQVQGPTRSKYVHRNIPEYQGVYNTMAMIVRTQ
                     GMRGLYRGLTVSLFKAAPASAVTMWTYEKSLHYLRELEVASE"
     exon            1023444..1023476
                     /number=1
     exon            1023563..1023615
                     /number=2
     exon            1023681..1023834
                     /number=3
     exon            1023919..1024635
                     /number=4
     CDS             complement(join(1024942..1025408,1025475..1025978,
                     1026028..1026099,1026154..1026241,1026309..1026462,
                     1026570..1026628,1026804..1026815))
                     /codon_start=1
                     /locus_tag="AO090012000417"
                     /note="alpha tubulin"
                     /old_locus_tag="AO070343000416"
                     /protein_id="BAE60598.1"
                     /transl_table=1
                     /translation="MRGEICHIHIGQAGTQLGNSAWELYLLEHGLKADGRIDPEASEE
                     LNSGASFETFFSETSNGKYVPRSIFVDLDPSPIDEIRTGDYRQLFHPELLISGKEDAA
                     NNYARGHYTIGKELVDNVVDRVRRVADNCSSLQGFLVFHSFGGGTGSGFGALLLERLS
                     TEYGKKAKLEFAVYPAPRVSTAVVEPYNAVLSTHSTIENADCTFLVDNEAVYDICRRN
                     LDIPRPSYEHLNRLIAQVVSSITSSLRFDGALNVDLTEFQTNLVPFPRIHYPLISFAP
                     VVSSNRSSHESFKVQDLTFQCFEPNNQMVVCDPRNGKYMAVALLYRGDVVPRDCTQAV
                     AAIKAKASFNLVEWCPTGFKLGINYQKPVRVPNSELAPVDRSVSMLSNTTAISEAWSR
                     LDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVANDGEPLEEEEPE
                     Y"
     exon            complement(1024942..1025408)
                     /number=1
     exon            complement(1025475..1025978)
                     /number=2
     exon            complement(1026028..1026099)
                     /number=3
     exon            complement(1026154..1026241)
                     /number=4
     exon            complement(1026309..1026462)
                     /number=5
     exon            complement(1026570..1026628)
                     /number=6
     exon            complement(1026804..1026815)
                     /number=7
     CDS             join(1031889..1032512,1032583..1034730)
                     /codon_start=1
                     /locus_tag="AO090012000418"
                     /note="predicted mechanosensitive ion channel"
                     /old_locus_tag="AO070343000417"
                     /protein_id="BAE60599.1"
                     /transl_table=1
                     /translation="MSTPVEELPAPKYAEKKNRTDDHSPTSDEGTYINEGSQDTHGNN
                     HLTVDTSSADDLDRTALRSPSAQREQAKRLEDDLALLEAEKVASRSTHEDTESKGERN
                     SISRSRSHRSQNVDEFDEATNPLHEKAAVYNPPESPNTNIARFVKKIHESSFIIRYIT
                     YIVPLVLILLIPLLVGALAYPDANVGGVELLWFSVWLEIVWLTLWAGRIVAKCIPVVA
                     GLLASIFTNNAKKWRDMAKQLELHATFFFWWLGIEVSFLPTMKNHHVDGNSATRSWEN
                     TVNKIIISIFVWTILNYIEKIIIQLIAISFHTRTYADRIEINKFQIGSLTKLYDFSRN
                     KISVKDDEFEEKNDNSGSGTKTPLRYPLQYAGKAQRVAKGALNKVGDMAGAVAADFTG
                     RKATNSTHPYQVILTLLRTTSGCQVLARRLYRTFVRDGFDTVFAGDLKEAFDNSEEAE
                     AAFIMFDKDMNGDISMDELEAVCVEIGRERKAITASLKDLDSVVSRLDNVLEFFVVVI
                     SLIVFVSLISTSASGVLTSAGSSILALSWLFSATAQEFLQSIIFVFVKHPFDVGDRVT
                     IYGNAGDAGLGDDYFVKQISLLYTEFKKMQGHIVQAPNSYLNGLFILNQRRSGALAEA
                     IPIVIKYGTTLEQIDALRQRLLEFVRSEKREFQTNILTEMRAVTENFSVTLNVVFFYK
                     SNWQNEGLRLQRRNKFICMLMVALQEIGIEGPRMNLQGARVDIPFHVTGFPPQTSSAD
                     HDSRPPPTPIHDMPENTGHSSSSAARHPSILRKGMNTAAARARGESIQSHKHVDFSLG
                     MRDLSSGDVMGDVFETTSPRVDDVVRSSNREAAQRRILEEEEEEEAERQSRSSSSRAR
                     RPSNLSVPTQPGEGRRSTESQGTHSLSSISRNRFFRHRSSVSRERDDLAEQGRFDSSD
                     IRSVSPGTR"
     exon            1031889..1032512
                     /number=1
     exon            1032583..1034730
                     /number=2
     CDS             complement(join(1037064..1042652,1042713..1043291))
                     /codon_start=1
                     /locus_tag="AO090012000420"
                     /note="NDR and related serine/threonine kinases"
                     /old_locus_tag="AO070343000419"
                     /protein_id="BAE60600.1"
                     /transl_table=1
                     /translation="MAGNGTQSPQFLAPPAVTALRQEARSIVPSLTPSNRSLSDDNDM
                     QEERAELKQAAEQTLNVIVDLDLDGRIKWVSPSWRQVVGTDPESVEGRMISDLIVDNK
                     NAFQDAVEAMKEDDSRSRFIRFSLLMGPDSVLKYAPEPRPVEAETTGTDETEGAGGQE
                     EPLAETEEHNHDILSMEAQGIMAYDRTADGVSHTMWMLRPFTEPREVTIDLPPLLVES
                     LGVGAEVLASYLTTLAEAAANEPDPSKHPAPNPVLCRICERQITPWWFEKHSDLCLQE
                     HRAEMDVQIAQENLNEHRHAIVKVLDALEARQGRPLVLGESNPPLPQPEYKGLPIGPS
                     PVASAPSSGSVSNSSSAPATPPRSRDHSVSGMGHSRGRSFAVRRPLSRVVELILDLCD
                     TALEINMPVLKETRVDNNDEFRTLSPQSESRISQVYQWQSPSTNTLEQEQGLAALCTD
                     TEQVAKAKVDATVRYRRIVEYAERIRIEYTVLVEECITAALSKAERIAAGQLSDSSSS
                     EDEQVPDILDSNIVTGPIPSPAQSRESIPLPRPMSALTMSMRNSPDRHQSPHSSEGKL
                     SSVAVSTGSNSPMECPTPRSHKSVAGVLGTSQPSRRGLASADFDAGEMSDSSVLSSAF
                     PGAMRTDSPCSDRSLDRKRRSLVPPGLSSSPRRGHSPARVSGPHSPLRMPKPRLSSGA
                     ESLPSPIVSPSTNAGELAHHHFRHHRRQSSATSSDAPRPPVSPHLASASQPQPRPAPV
                     SIKDFEVIKPISKGAFGSVYLSKKKTTGEHFAIKVLKKADMVAKNQVTNVKAERAIMM
                     WQGESDFVAKLYWTFSSKDYLYLVMEYLNGGDCASLVKILGELPEDWAKKYVAEVVLG
                     VEHLHSRGIVHRDLKPDNLLIDQTGHLKLTDFGLSRMGLVGRQKRVLKSMNNEPAPDL
                     LKQGPFPRATSITSSRSASFDFQGSGSPGSTPLMTPDVAGSMPQPSYFNLNQSGISRQ
                     TSRRASGYRSDSVGSEGLNSVFRSLSLHDPSEVQGSLPVPVPGAHNLTEAEGQSEAGE
                     SPHLYPLQPTPSNSVPHDIGPQQGMMPPLMALFDPEDHNRRFVGTPDYLAPETINGAG
                     QDEMSDWWSLGCIMFEFLFGYPPFNASSPDEVFDNILHRRINWPDHVEELTSPEAIDL
                     MNKLMTTDPAQRIGANVDEKYPNGGAEIRSHPWFSDINFDTLLDDKAQFVPNLENPED
                     TEYFDARGATLQAFSEELEDGDSPRPVTTGPYPDRPHDALFKVRSQVNASKRPLMPLH
                     IPPHVRESRSRRLSEPSLEDDFGSFSFKNLPMLEKANKDVIQKLRQEAMQAQQRPFAA
                     SGPQQQPPGKDQGQAQGQGQNQAQTPAPSSSGPSLEGSPLPMSLQRTMSQNKGNNRPS
                     SPSSQANSSPSRPSQPSSPLLVQFSTGHHNHERRKTSGSSSTNSHHSSASGPPASAEQ
                     ARMASLKISSSASSPVKTSRAITHSPDKTPSGPPRHGSVPTRARSQTIGSQDGDLSSS
                     LARESYVAGHYKRRSQRFNDISPSSSDNEDPRTKQLFKNQRQRQSSRRLSQLNYPDGP
                     FFRPLDVLICEDHPVSRMVMERLFEKLRCRTITAVNGAEAMRYALSQVQFDIIMTEFK
                     LPQVNGADVARMVRETRSANRHTPIIAVTGYLKDFPETHHFDGLIEKPPTLTKLTQAL
                     CKHCQWKPPPNDSILSQPLAVPSATPRQIPIAAEHSPSSVTSSNFAPVPTSSYQGSSR
                     ADSIGSSYFGDMESVKAEDAPVVGGRKYDEWSSGQGGLGISGDTGTTQVESTQATVDS
                     NNKSSSDPAPLLHLLHAVSAPASMNASGTLTPRKQRSSEAIRAKRESLERKRYEGAES
                     GDDEDEELGRSNSRTQSPRNRSTRPGSKLGIEMMRTNSRGSVVSGSEELLKKERESLE
                     RRRSGGSESISEERAESPGIDGKFEGLHFPEDAIVLSEDNYSPRQSPTLSVSQMSPSF
                     STMSRLEPSFAHGITETGFGVSPDTSTETLKKGHITPPIVFTTEEGSSSVDPNTPFIQ
                     TSSVEDDTETIPDSEATPRPVHTPSLGLDSEITPRQGGR"
     exon            complement(1037064..1042652)
                     /number=1
     exon            complement(1042713..1043291)
                     /number=2
     CDS             complement(join(1047954..1048012,1048069..1048570,
                     1048642..1049527,1049583..1049612,1049673..1049994,
                     1051848..1052037))
                     /codon_start=1
                     /locus_tag="AO090012000422"
                     /note="choline dehydrogenase and related flavoproteins"
                     /old_locus_tag="AO070343000421"
                     /protein_id="BAE60601.1"
                     /transl_table=1
                     /translation="MSNKRPAMELGTVLVVGGCGFVGWHIVNHLLNFPSETDASVALP
                     KPEEDPRFDYPQLAGRYPVYKPLYGSKDGIPGIDASFDYVVVGGGNAGVTLAARLAEQ
                     SFNVALVQAGGFYEINYPPAKVPGAVGIGTGTDPMAIRTPIDWGFLVNTGPGADSRTI
                     HYEKARCLGGASASNFMLYQRPTIGSMKLWADLVDDESYLFDNVFPLFKKTINFTAPN
                     EELRPANATVSYREDAYEKHGQPVDVTYPHAASPFSSWFQLGLESVGVEVTSEFNSGS
                     LLGSFYCPFTLRPADQIRSSSESAFFRSPYSSRYLETLTLYKNTMGKKILFDQKRATG
                     VEVATAGSKYILSATHEVIISSGAFQSPQLLMVSGIGPADVLQEHEIDVIVDLPGVGQ
                     NLWDHVFSGPTYPVAVETFNKLAMDLQYLISQIREFKSSHTGVLTNHGFDYVAFEKLP
                     GSSRAGFTERTENDLSWFPEDWPEVEYIPAPLFVGNFSDPITMQPQDGRQYATILPTL
                     VGPTSRGNVSIISADTDDLPVIHMNWLTTETDQQVLVAAFKRVRDIFHSEAMAPIIVG
                     EEFFPGKEYQTDREILEVIRDTAMAPWHASGTCKMGTRSDRMAVLDSRARVFGVEKLR
                     VVDASTFPVLPPGHPQSVVYMFAEKIASDIIGYSKDEE"
     exon            complement(1047954..1048012)
                     /number=1
     exon            complement(1048069..1048570)
                     /number=2
     exon            complement(1048642..1049527)
                     /number=3
     exon            complement(1049583..1049612)
                     /number=4
     exon            complement(1049673..1049994)
                     /number=5
     exon            complement(1051848..1052037)
                     /number=6
     CDS             complement(join(1052522..1052531,1052593..1053500))
                     /codon_start=1
                     /locus_tag="AO090012000423"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000422"
                     /protein_id="BAE60602.1"
                     /transl_table=1
                     /translation="MLTEHSVCAKIRHENLRIAVIEPLESSLGILPHESTSAVSERVS
                     EEDDDVGEGQALSEDDKPVVDQFADLRKRRFLWYFDSYIQTIDAADSVISQERKFQRM
                     PFESQGNTMDGHFDYPELRRRVVLLREKIIYETNNWLFEGLGVKKQELSIASNLQRQY
                     EQIVEDLKRQKNFAVDLELVDTNPFLWAFTYFGRPMSHLDGGIFRFKIYISPRFPDEQ
                     PRVFVETPIFHIRVSREGVLCYSPRRTDEMRYHIEAIVAALEEESPPYDPRTTVHPEA
                     TKLFWGSMEDRKKYNRALRQSVEKSAEGP"
     exon            complement(1052522..1052531)
                     /number=1
     exon            complement(1052593..1053500)
                     /number=2
     CDS             join(1057117..1057575,1057638..1058340,1058403..1059053,
                     1059113..1060210,1060272..1060558,1060625..1061068)
                     /codon_start=1
                     /locus_tag="AO090012000424"
                     /note="adaptor protein Enigma and related PDZ-LIM
                     proteins"
                     /old_locus_tag="AO070343000423"
                     /protein_id="BAE60603.1"
                     /transl_table=1
                     /translation="MPPGDVPLPDSLVPGNGAVRPTLNTSGYGGGNQMQTPTSPADNS
                     IPFDSPRAITGGWNASGNSPVDGAQNPDGRLGRRYESNNSSPRDPSTPRDAAGYWDRS
                     TPRDRTRPNGRPVTKSPGGSSRICKKCGEPLTGQFVRALLSTYHLECFKCEDCGQIVA
                     SKFFPVDAEDGSGQYPLCETDYFRRLDLLCHECGGALRGSYITALDRKYHIEHFTCSV
                     CPTVFGAQDSYYEHEGKVYCHFHYSTQFAQRCHGCHTSILKQFVEIFRNGQNQHWHPE
                     CYMIHKFWNVRLAPTGQPLEYPELEADATDEQRNRVREEEDVMEEKVYKIWSILSSFE
                     ESSAACISDMLLHVSNGTYVDGVLVAKKFIAHVDVLFSAIDQLAANIKAQGMKDLAYG
                     REAKLLCKKIVAFFALLSKTQETGVRKLGVTQELLSLVTGLAHYLKLLIRIGLQGALK
                     LEREKETPEGLHQFLDHLGDLEALRPLEEEVTTADLMANVEVLADQLSDCCAACKEPI
                     DDECIKLGDNRWHIKPPHLTCTTCQKDLTAMPQDALWNPKDKRAFCNSCASENGFAHD
                     TQGGFTRVTKLQQFVFLLQVALARLLTVLRAGGTIPASDDANLKSHDGSDGQSTPGGE
                     LRRSTTRSKSYSHASKEGTEESSLEQTVGEMRRLRSIRNERTLSTTYKKARASRIIDG
                     PEGRSVRPGSSGGEGTDPRGHGFQIVEEKDANGETVTELTFGNQDALTLDDIPRIVAA
                     EQAKEQRPNAYKHAGAGLVGTTEPLPRYNYGHQRGVSGAGLERHLMGQGGRAKKYFSE
                     LSALEYFIVRHVAVLSMEPLLDGYFTLEELLSFIESRKPTIWNIFGRAFNKETKKGGK
                     KKGVFGVNLDFLVEKEGTESSHGVGPGALRIPALVDDAVSAMRQMDMSVEGVFRKNGN
                     IRRLKELSDLIDNKYEQVDLTKENPVQIAALLKKFLREMPDPLLTFKLHRLFVVSQKL
                     SDPEKQKRVLHLACCLLPKAHRDTMEVLFAFLNWTSSFSHVDEESGSKMDIHNLATVM
                     APNILYPNAKNGTVDESFLAIEAINALIAYNDTMCEIPEDLQSVLTDTNFFKENSEVT
                     TKEILKRYGDIARGSFSQRPANGGETFTITNQNRGANTPTSARIETDPSQDAATQLQG
                     SVRHVQGPPGHAHSASGIPELVPATTSDNRERSISNGSQQNPVQPDAQPQQLPYRARP
                     GAGPMGVAG"
     exon            1057117..1057575
                     /number=1
     exon            1057638..1058340
                     /number=2
     exon            1058403..1059053
                     /number=3
     exon            1059113..1060210
                     /number=4
     exon            1060272..1060558
                     /number=5
     exon            1060625..1061068
                     /number=6
     CDS             complement(join(1062282..1063005,1063060..1063132,
                     1063405..1063555))
                     /codon_start=1
                     /locus_tag="AO090012000426"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000425"
                     /protein_id="BAE60604.1"
                     /transl_table=1
                     /translation="MASLTSKRKSRDDDAYPVDEARTPTGSPPKKRLRVTRNQKQALI
                     DNLQLEAISVNPAMRKASAASPSPRRTKRQSHEGLYSDKENAPATGEQLDVLKNPKRR
                     AKPGAAAGTSRVVSQEVRGADFRILSPKSSNSRTYPQSPLRASPEKSQNSSYLSRPMP
                     SLKPSSPLKAAPTSLAGSLESARLRTTKGTPSVATANRPASQASKRPASRATTASKTT
                     TRSPLPRPATRQLERRGSVSSSTSSGTTVTKPTRTGANARKVTAASTASSTAKKAVAN
                     SQTTSATAKRNAASATRKTAAPAGGEAPTTGRRVLRKRA"
     exon            complement(1062282..1063005)
                     /number=1
     exon            complement(1063060..1063132)
                     /number=2
     exon            complement(1063405..1063555)
                     /number=3
     CDS             join(1064189..1064353,1064428..1064985)
                     /codon_start=1
                     /locus_tag="AO090012000427"
                     /note="26S proteasome regulatory complex, subunit
                     RPN10/PSMD4"
                     /old_locus_tag="AO070343000426"
                     /protein_id="BAE60605.1"
                     /transl_table=1
                     /translation="MRVHPQSAVGLMSMGGKGPEVLSTFTSDFGAILAGLHRTKIHGT
                     AHLSSSIQVAGLALKHRSEKSQRQRIIVFSCSPIEEDEKSLVKLAKKMKKINVSIDVI
                     AFGDLESDQTKKLEAFVENVKGGDGSHLAIIPPGPNLLSEELQMTPILGGDGAGAGDA
                     GAGGETGDFGFEDAAENDPELAFALRLSLEEEKNRQEKEKREREEQERKANLDNIPEE
                     GQSGESSGSKDKKEDGDKMDTA"
     exon            1064189..1064353
                     /number=1
     exon            1064428..1064985
                     /number=2
     tRNA            1066233..1066335
                     /locus_tag="AO090012t00011"
                     /note="tRNAscan-SE"
                     /product="tRNA-Phe"
     tRNA            1068221..1068322
                     /locus_tag="AO090012t00012"
                     /note="tRNAscan-SE"
                     /product="tRNA-Phe"
     CDS             join(1068998..1069185,1069394..1070139,1070252..1070278,
                     1070314..1070355,1070477..1070517)
                     /codon_start=1
                     /locus_tag="AO090012000428"
                     /note="O-methyltransferase"
                     /old_locus_tag="AO070343000427"
                     /protein_id="BAE60606.1"
                     /transl_table=1
                     /translation="MLGSIAINGVSRFMCSTRHGVWTSAIGFACSVRDSTRYFVIAAI
                     SHVRKTQYTRRCPRRSMLINQTIEAKARALHEHIFSKPEDTYAGKPWDVVKAINDFAD
                     ESRMMTFKNAKIEASRQQIAKIQPAPKTFIEFGGYVGASAIAWGAILRELNNTDSAVD
                     VNVYTFELSPVNAGIARDLIRLAGLENTVHVLEGPAADSLKRLFEEGKLKEAGVDVAF
                     FDHWEQFYLPDLQLCEDLGLFRKGSKVIADNTDFPGAPAYLEYVKSGGRQGGSYRYET
                     ESIETASNCGPVSSPYLYLNICVVVGTDCFSEHRRVLYLIWHSLHDEISRPAPLFPSA
                     VKAHCRHVKQVTH"
     exon            1068998..1069185
                     /number=1
     exon            1069394..1070139
                     /number=2
     exon            1070252..1070278
                     /number=3
     exon            1070314..1070355
                     /number=4
     exon            1070477..1070517
                     /number=5
     tRNA            complement(1070843..1070946)
                     /locus_tag="AO090012t00013"
                     /note="tRNAscan-SE"
                     /product="tRNA-Phe"
     CDS             join(1071182..1071498,1071565..1072066)
                     /codon_start=1
                     /locus_tag="AO090012000429"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000428"
                     /protein_id="BAE60607.1"
                     /transl_table=1
                     /translation="MTTLFTVPISSTGGSFVCSNPTASEKEKNIYLLTFTSPKDNRLT
                     PTFIDAFILALDIIEHRYPKGVVITTSGIPKFYSNGLDLELALSTEGFLDKWLWKLFR
                     RFLTFPMPTICLLNGHAFAGGLMLAMYHDYRIQNPSKGLLCINELEFGVPLQSPMMSI
                     FREKLTPSSFRDLILEAKRFGGPESVKAGLVDGVGGLEEVLTLIRERGLQKKAATGIY
                     GTMKEEMYRHSLDILDGHTANLAWREQLEDKKDQAQRDGLKAVEAFEKQRNAKL"
     exon            1071182..1071498
                     /number=1
     exon            1071565..1072066
                     /number=2
     CDS             join(1073059..1073169,1073386..1073617,1075364..1075389)
                     /codon_start=1
                     /locus_tag="AO090012000430"
                     /note="synaptobrevin/VAMP-like protein"
                     /old_locus_tag="AO070343000429"
                     /protein_id="BAE60608.1"
                     /transl_table=1
                     /translation="MSEQPYDPYIPSGSTTNAPAGASAAQNGDPRTREIDKKIQETVD
                     TMRSNIFKVSERGERLDSLQDKTDNLAVSAQGFRRGANRVRKQMWWKDMKMRVCLVIC
                     VILLLVVIIVPAGSSLFPRH"
     exon            1073059..1073169
                     /number=1
     exon            1073386..1073617
                     /number=2
     exon            1075364..1075389
                     /number=3
     CDS             join(1079887..1080286,1080367..1080383)
                     /codon_start=1
                     /locus_tag="AO090012000431"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000430"
                     /protein_id="BAE60609.1"
                     /transl_table=1
                     /translation="MGMDLSRLCLPFDTATSQHSDLLWPNTPDLSQSALSGSPGLRFS
                     FSFDNMILKDGGGIDSETNVPSSVQRSIDLGGLAATTFAEEGGILLQPDFEFDEDGNL
                     IELGEAHHQTAKGRMSRRASEAPLQSEAANIVDAHR"
     exon            1079887..1080286
                     /number=1
     exon            1080367..1080383
                     /number=2
     CDS             join(1080514..1080942,1081002..1081775)
                     /codon_start=1
                     /locus_tag="AO090012000432"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000431"
                     /protein_id="BAE60610.1"
                     /transl_table=1
                     /translation="MPQKRRAPRLQTLDDRTALRNTDLGNMNSDYVQNMAIASKQKRQ
                     NKLPTQAKKNAIYWVFGQGIGSVGIGLGASQVPHPLQQFSGEELYAALNPTVRHKGRK
                     RSRLPSDESEDSDVRRVRAREEYEEQVGRGGVVDGHDIWQDVEIGRHAPSVFRDDNSF
                     SSQMPWNITASVQSSQHGSSAASGLRGVANVSDPSASRGRDTTASHLVGRGRSRNRLT
                     SASPLAGRGFPFDAEAFDRLVLPGDDDMDVMSDFDLSQYLQTEPFSAGHGHTGDDANA
                     ITYRGRVTLQDRLSKCSLDQESLNFLGFLTRKLEAMLVEHVGATDEDGFINSPATFYG
                     SKVIGFSALLPPSETSPSVATQGLMHILTLATKGFLSVRQEDYEDRSTRYHVRYEFGE
                     IFLQLSEM"
     exon            1080514..1080942
                     /number=1
     exon            1081002..1081775
                     /number=2
     CDS             join(1083722..1083982,1084833..1084955)
                     /codon_start=1
                     /locus_tag="AO090012000433"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000432"
                     /protein_id="BAE60611.1"
                     /transl_table=1
                     /translation="MRSTFVFIACITAYSFAAPAFFDNAYNFSNDLSECLGRVSKHIE
                     HSKDILNTATCDTSSVELPAQASGLPSPSDQKLLYVALGRGTQFRRSLKKNLDRNNDE
                     QHGLDRLLKASASAIILHQLLRKVQ"
     exon            1083722..1083982
                     /number=1
     exon            1084833..1084955
                     /number=2
     CDS             join(1085108..1085198,1085405..1085559,1085622..1086329)
                     /codon_start=1
                     /locus_tag="AO090012000434"
                     /note="fibrillarin and related nucleolar RNA-binding
                     proteins"
                     /old_locus_tag="AO070343000433"
                     /protein_id="BAE60612.1"
                     /transl_table=1
                     /translation="MGFGAPRGRGGPPGGRGGRGGFGGGRGGGRGGLGSASRGRGGPR
                     GGGRGGRGGPPGRGGRGGRGGARGGAKGGAKGGAKVVIEPHRHAGIFVARGGKEDLLV
                     TKNLTPGEAVYGEKRIAVETPTEDGTTTKTEYRVWNPFRSKLAAGVLGGLDDIYMKPG
                     SKVLYLGSASGTSVSHVADIVGPTGNVYAVEFSHRSGRDLIGMATHRTNVVPIVDDAR
                     HPLRYRMLVPMVDVIFADVAQPDQARIVGLNAHMFLKEGGGVIVSVKANCIDSTAKPE
                     VVFTREVQKMREERIKPKEQLTLEPFERDHCIVAGIYKRSA"
     exon            1085108..1085198
                     /number=1
     exon            1085405..1085559
                     /number=2
     exon            1085622..1086329
                     /number=3
     CDS             1087204..1088172
                     /codon_start=1
                     /locus_tag="AO090012000435"
                     /note="nucleoside-diphosphate-sugar epimerases"
                     /old_locus_tag="AO070343000434"
                     /protein_id="BAE60613.1"
                     /transl_table=1
                     /translation="MSIIITGANGYVGQELASALLSSSPDITVTLTDIVTPAIPAAAA
                     AQHTSRVKCVQADLTSPKVVDEMFTESHRFDTVYLLHGIMSSGSEANFELGMRVNLDA
                     TRYILDRLRAVMPGVKVVFTSSLAVYGLAPAGFVIDETNFPPVPSSSYGSQKLIIETL
                     LNDYSRRGFLDGRAVRLPTVTVRAGQPTQAASSFASDIIREPFNGKKAILPVSKETEM
                     WICSPYTVVKNLLHAKDIPKEAFGESRSVNLPGLKVSIQEMLDALEEIGGKERRALVE
                     EKYDAAIDKIVQTWTPNFKTDRAIKLGFAEDVPMIENIRQYASRFA"
     exon            1087204..1088172
                     /number=1
     CDS             join(1088555..1088704,1088758..1088883,1088937..1089014,
                     1089075..1089769,1089837..1090227)
                     /codon_start=1
                     /locus_tag="AO090012000436"
                     /note="mitochondrial processing peptidase, beta subunit,
                     and related enzymes (insulinase superfamily)"
                     /old_locus_tag="AO070343000435"
                     /protein_id="BAE60614.1"
                     /transl_table=1
                     /translation="MASRRLAFNFNQALRSRAALKSIQPVKRGFSSPVTLPSTTQSTT
                     LSNGFTIATEYSPWAQTSTVGVWIDAGSRAETDKTNGTAHFLEHLAFKGTNKRSQHQL
                     ELEIENMGAHLNAYTSRENTVYYAKSFNNDVPKAVDILADILQNSKLEPGAIERERDV
                     ILREQEEVDKQFEEVVFDHLHATAYQNQPLGRTILGPKENIQTISRDNLVDYIKTNYT
                     ADRMVLVGAGGIPHEQLVRLAEEHFGSLPSKPPTSAALALTAEQKRTPEFIGSEVRLR
                     DDTIPTAHIALAVEGVSWKDDDYFTALVAQAIVGNWDRAMGNSPYLGSKLSSLVEHHG
                     LANSFMSFSTSYSDTGLWGIYLVSENLTALDDLTHFAMREWSRLCFNVTSAEVERAKA
                     QLKASILLSLDGTTAVAEDIGRQIITTGRRLSPEDIERTIGQISEKDVMDFANRRIWD
                     QDVAVSAFGSVEGLLDYNRIRADTSRNTL"
     exon            1088555..1088704
                     /number=1
     exon            1088758..1088883
                     /number=2
     exon            1088937..1089014
                     /number=3
     exon            1089075..1089769
                     /number=4
     exon            1089837..1090227
                     /number=5
     CDS             complement(join(1090874..1091110,1091275..1091330,
                     1091384..1091609,1091657..1091674))
                     /codon_start=1
                     /locus_tag="AO090012000437"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000436"
                     /protein_id="BAE60615.1"
                     /transl_table=1
                     /translation="MARSSRPHSFISTLDTRLYTPNDTFLQRPHILTQSTTPTTTPTT
                     KTQKSRKMGVPESESPAVQQQNEWSNGFWDCCSPAGTSNVYRTQASGAVVSPAVSSCC
                     LYYLTAQVGFHWVLLMIRRGEIRQRFGIEGSGVSDCCSSYWCPCCVIVQQEKEIEAQS
                     ERLQTGYQAPAGMAYAPQ"
     exon            complement(1090874..1091110)
                     /number=1
     exon            complement(1091275..1091330)
                     /number=2
     exon            complement(1091384..1091609)
                     /number=3
     exon            complement(1091657..1091674)
                     /number=4
     CDS             join(1095001..1095044,1095187..1095226,1095363..1095941,
                     1096010..1096385,1097038..1097063)
                     /codon_start=1
                     /locus_tag="AO090012000439"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000438"
                     /protein_id="BAE60616.1"
                     /transl_table=1
                     /translation="MQDRVFTVSKATAEMLASCRRILSRSLQFVQEDPLGCTTDASVE
                     DSPSPVASIPEAHHQSAPIDSAVVIAGDRKDSVGKDNRIDLDEHYGDGGSIHHDTLDL
                     SHWGGGLKISPDGTPHQDKDDAVQGLLALGSTAGSNDVRSESTNLSLPSPNIALSSLM
                     NSRPSEVKEIALQAVTTRLLDDPGHTRINELSTSIMTSTGVESEARKLELLRHYRYHV
                     ATWLDICDLRHPFGINVIQMATSSEKLLSAILSLSESCIIQRGHWNRAGLEQLTLRKS
                     NQLDQLDHNHPDFTELIMLSLLEEIRTLVTDVPKAWIDWVNRDVPYVNHLVQHAYIKD
                     IESTAYWMFLRIATGDLARL"
     exon            1095001..1095044
                     /number=1
     exon            1095187..1095226
                     /number=2
     exon            1095363..1095941
                     /number=3
     exon            1096010..1096385
                     /number=4
     exon            1097038..1097063
                     /number=5
     CDS             join(1098151..1098214,1099827..1100062,1100126..1100316,
                     1100368..1100452,1100503..1100696,1100845..1100901,
                     1100948..1101332,1101395..1101730)
                     /codon_start=1
                     /locus_tag="AO090012000440"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070343000439"
                     /protein_id="BAE60617.1"
                     /transl_table=1
                     /translation="MRLQSSDRVLAAPGLGVLLLPDSHPWMESLTLAGYDQGVFSGIV
                     ENEDFLDTMGNPGDSLMGIIVSIYNLGCFAGCIVNFLVGDWLGRRKAMWLAMVWVIIG
                     ATLQTSAFSVPHLMVGRFVTGIGTGIETSTVPMYQAELCEASKRGKLVCSEPLLVGVG
                     IVVSYFFDYGMSFVGGQIAWRLPIACQMLFGFVVIILVFGLPESPRYCYKEGRDDEAL
                     QILSDVYGRPKDDPKILAEQAEILEALAIETKHGEYKWSLLGYGMQFMNQLGGINLLV
                     YFIPTVLSTNVGLTKNLSMIIGGCAQIMFVVGSFFPTFFVDRVGRRTPMMWGSFGLGI
                     CMMMVSVLLSFKGKENGHATSSASVAFFFLFMLIFGASVNCIPWVYVPEILPLHARAK
                     GTAVGISSNWIWSFFVVMITPVIINRLQWKAYLIFMCTNFAFVPLVYFCYPETAKLSL
                     EEIDYLFTHPDKGAVKLSLELQKERKMHGHGASLVADTGVLRRTSVVADESLEKHHGV
                     DEHVEKV"
     exon            1098151..1098214
                     /number=1
     exon            1099827..1100062
                     /number=2
     exon            1100126..1100316
                     /number=3
     exon            1100368..1100452
                     /number=4
     exon            1100503..1100696
                     /number=5
     exon            1100845..1100901
                     /number=6
     exon            1100948..1101332
                     /number=7
     exon            1101395..1101730
                     /number=8
     CDS             complement(1102411..1103103)
                     /codon_start=1
                     /locus_tag="AO090012000441"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000440"
                     /protein_id="BAE60618.1"
                     /transl_table=1
                     /translation="MTKSKTPMIEQYWHKGGLCGVISRAALRTLQFVFAIVIAGLYGV
                     DLAHATEVNARAPSQWVYAEFVAAVTALTCIVHCFITVTHVAWSAWDFVLFVLWLAQV
                     GTFGAIYISNNVLDEYKQATSSIPRMRAAVWISLVSMVLWFATTVLGIAWCCRTRKVT
                     RRTDQVEAGKEQILERDSDVESGSICDEKRSMAAIPAAMVAEKSVKDKNGSKITSEIN
                     RSDSDVSPPPYS"
     exon            complement(1102411..1103103)
                     /number=1
     CDS             join(1103813..1104672,1104788..1104948,1104996..1105359,
                     1105429..1105779,1105866..1106724)
                     /codon_start=1
                     /locus_tag="AO090012000442"
                     /note="UDP-glucuronosyl and UDP-glucosyl transferase"
                     /old_locus_tag="AO070343000441"
                     /protein_id="BAE60619.1"
                     /transl_table=1
                     /translation="MADMRCFAVEDGSWELPPPYESISSSGGADGDPTRNNLATPVVF
                     PISNASFPELSPTNDGRVDVHIGPRFSRNLEWLMGNEAGEAPSQTGREAAPSVPCPAW
                     DLHLNIVIQVVGSRGDAQPFVALGQELQKYGHRVRLATHAKFEQFVRTADLEFYPIGG
                     DPVELMSYMVRNPGLIPSIKSLRAGDIQRKRASMAEILDGCWRSCIEPDPYDKAPFVA
                     DAIIANPPSFAHIHCAQALGIPVHLMFTMPWTSTRAFHHPLANLKYSGNDPSLGNLVS
                     YHFVEWLTWQGLGDLINAWRKNVLGLDPVPTTEGPNLVEALNVPFTYCWSPALIPKPK
                     DWASHIDVCGFFFRDPPAYEPPAELDVFLRAGPPPVYIGFGSIVIEDVEKTLSILLNA
                     IQETGVRAIISCGWSNLERRKTPNVHYIGDCPHEWLFQHVAAVVHHGGAGTTACGLRN
                     GKPTTVVPFFGDQPFWGNMIAAMGAGPEPIPHKNLTARKLADAITYCLTPQAVAVARG
                     IADKMRQECGVRAAVDSFHAHLPRRKMQCDLIPSEPAVWYFKTGRRTVKLSKVAARTL
                     KHQGRIHGKHLKLYQTKPFTIDIRRWDPFTAISSASLSTLTGMADATAGIFIDPYKEY
                     KRLRKSDRNRDASNPATVSHPQLATPETSSTAESALITRTHSSSDILDTECSSDDPDY
                     ARQMAIAAATSLGIFLGRSSRGALVDLPLAAVEGMRAVPRLYGEKVRLHDPVRDWKSG
                     AGVAWSTFSHGLYEGVTDIFVHTYQGKKKQGAIGVAKGLTKGLVSLTVKTGAATVGLI
                     AYPNQGIYRSLMSTVRKRPAKRIEQARWTEAEWITRAEGGMQIDAAGLCWLYDELLST
                     RETARRGR"
     exon            1103813..1104672
                     /number=1
     exon            1104788..1104948
                     /number=2
     exon            1104996..1105359
                     /number=3
     exon            1105429..1105779
                     /number=4
     exon            1105866..1106724
                     /number=5
     CDS             join(1107563..1108032,1108087..1109425)
                     /codon_start=1
                     /locus_tag="AO090012000443"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000442"
                     /protein_id="BAE60620.1"
                     /transl_table=1
                     /translation="MLLAIVSTLALAGPAFASPACKVTPLDPSWPSNSDWASLNASIN
                     GGLLRTVPVASSCWPGNPFGSSVSCGNVKSNWTNGMWLSTFPESIDYPIYANNSCLPP
                     NAPGYVEERGCTTGGLPEYIVNATTEEQIATAMQWASERNIRIVVKGTGHDLNGRSSG
                     AFALSIWTHNLRQLERNKSWLLPSKNTSEDVFIVGSGQQWGNVLNKALEHGRVVTTGQ
                     DPSVGLGGYIQGGGHGPLSRTYGLASSHVLQMRVVTTEGKILVANDAENQDLFWALRG
                     GGPGLYGVVTEYVIRHHPAPSSVTMGNLLIAPKGSSNRSAELSWDAAVTHLSVLPDLM
                     DAGLAGACMLATGQNAMTFASLSEPTTGAVIKQVFWSFNSTPSAMEALVNPILSNITH
                     AAGGNNSLSISFSASQSNYSSFFSAISGSDAAGGQSVVSSRLLGRAEVLDTPRHKRRA
                     YLKIAMRAQNETAGTYATIGLQGGPGVRNTQQEEWGALLPAWRSAYLHFISNGATVDP
                     VAAGSPKKALENAADFNEAKERMWREWSPKSGAYMNEANPFTSNFKQDFYGSNYDRLA
                     EIKAKYDPSESLFVLSGVGSDKWQYDLDTGKLCKAK"
     exon            1107563..1108032
                     /number=1
     exon            1108087..1109425
                     /number=2
     CDS             join(1110015..1110035,1110121..1110302,1110381..1112498,
                     1112558..1112867)
                     /codon_start=1
                     /locus_tag="AO090012000444"
                     /note="tRNA cytosine-5-methylases and related enzymes of
                     the NOL1/NOP2/sun superfamily"
                     /old_locus_tag="AO070343000443"
                     /protein_id="BAE60621.1"
                     /transl_table=1
                     /translation="MGKRGRKGQGGRGGGGQRQNWTDIPKTNEKFERFYNEQGFIPEE
                     EREVFWEYLRRDLPNSFRFTGSRGHALAVQERLKEFYIPEITSIKYEGNFVEPPRLVS
                     WYPDQLAWSMTTPKQVVRRFAPFANFQKFLVAETAVGSISRQEVVSMIPPLLLDVKPG
                     MTVLDMCAAPGSKSAQLMEMIHAGEEESMSQASKQVKEGTAGPEPLGPEGLNDDGRTT
                     GLLIANDTDYKRAHMLIHQMKRLSSPNLIVTNHDATMYPSIKLPSPPGPSGKVQNKYL
                     KFDRILADVPCTGDGTPRKNIGVWKEWTPGNALGLYATQVRILVRALQMLKVGGRVVY
                     STCSMNPVENEAVVASAIERCGGAANVRIVDCSNELPGLKRVPGLKTWKVMDRDTRMW
                     NTWEEIEEHRASQGISGLGRVAAGMFPPTGENADLPLERCIRIYPHLQDTGGFFITVL
                     EKQSEIRAKPEDSSKVIPKGTVAALTEELEFKQKNGNGQPLEKIDALDDMVTPNEDAA
                     EEAQKNATVAEATHQPPYSATNQMSPAKRDAESMEDEVPSKRTKLDDGSEVVVGDRPV
                     HQPAPVIEPDNMDTSDTTSTPAPPQQTTSATQAPPPQKRKPGQPVEEPFKYLDPNHEE
                     LPPIFEYYEGSDRFPRDRFMVRNAQAIPARTIYYTSALARDILTANEGQGMKIVHCGV
                     KMFVKQDVQRPGVCPWRIQTDGLRVLEPWLGPGRAVTLKRKETLRRLLVEMFPKVNDD
                     GWKELGEIGERVRDIPMGCSVLHIEPDTSETGFSERMVLPLWRSLHSVNLMLPKEERR
                     AMLLRIFNDDTPLVNITAKRANADTDADNTPAAAPAEVEEEAVKHENEVLGQDEQEHA
                     ESRETWQKVGDEEDRFNTTV"
     exon            1110015..1110035
                     /number=1
     exon            1110121..1110302
                     /number=2
     exon            1110381..1112498
                     /number=3
     exon            1112558..1112867
                     /number=4
     CDS             join(1114648..1114782,1114855..1114931,1114978..1115280,
                     1115334..1115600,1115672..1115687,1115735..1115830,
                     1115883..1116017,1116068..1116734,1116783..1118104)
                     /codon_start=1
                     /locus_tag="AO090012000445"
                     /note="beta-galactosidase"
                     /old_locus_tag="AO070343000444"
                     /protein_id="BAE60622.1"
                     /transl_table=1
                     /translation="MKLLSVAAVALLAAQAAGASIKHRLNGFTILEHPDPAKRDLLQD
                     IVTWDDKSLFINGERIMLFSGEVHPFRLPVPSLWLDIFHKIRALGFNCVSFYIDWALL
                     EGKPGDYRAEGIFALEPFFDAAKEAGIYLIARPGSYINAEVSGGGFPGWLQRVNGTLR
                     SSDEPFLKATDNYIANAAAAVAKAQITNGGPVILYQPENEYSGGCCGVKYPDADYMQY
                     VMDQARKADIVVPFISNDASPSGHNAPGSGTGAVDIYGHDSYPLGFDCANPSVWPEGK
                     LPDNFRTLHLEQSPSTPYSLLEFQAGAFDPWGGPGFEKCYALVNHEFSRVFYRNDLSF
                     GVSTFNLYMTFGGTNWGNLGHPGGYTSYDYGSPITETRNVTREKYSDIKLLANFVKAS
                     PSYLTATPRNLTTGVYTDTSDLAVTPLIGDSPGSFFVVRHTDYSSQESTSYKLKLPTS
                     AGNLTIPQLEGTLSLNGRDSKIHVVDYNVSGTNIIYSTAEVFTWKKFDGNKVLVLYGG
                     PKEHHELAIASKSNVTIIEGSDSGIVSTRKGSSVIIGWDVSSTRRIVQVGDLRVFLLD
                     RNSAYNYWVPELPTEGTSPGFSTSKTTASSIIVKAGYLLRGAHLDGADLHLTADFNAT
                     TPIEVIGAPTGAKNLFVNGEKASHTVDKNGIWSSEVKYAAPEIKLPGLKDLDWKYLDT
                     LPEIKSSYDDSAWVSADLPKTKNTHRPLDTPTSLYSSDYGFHTGYLIYRGHFVANGKE
                     SEFFIRTQGGSAFGSSVWLNETYLGSWTGADYAMDGNSTYKLSQLESGKNYVITVVID
                     NLGLDENWTVGEETMKNPRGILSYKLSGQDASAITWKLTGNLGGEDYQDKVRGPLNEG
                     GLYAERQGFHQPQPPSESWESGSPLEGLSKPGIGFYTAQFDLDLPKGWDVPLYFNFGN
                     NTQAARAQLYVNGYQYGKFTGNVGPQTSFPVPEGILNYRGTNYVALSLWALESDGAKL
                     GSFELSYTTPVLTGYGNVESPEQPKYEQRKGAY"
     exon            1114648..1114782
                     /number=1
     exon            1114855..1114931
                     /number=2
     exon            1114978..1115280
                     /number=3
     exon            1115334..1115600
                     /number=4
     exon            1115672..1115687
                     /number=5
     exon            1115735..1115830
                     /number=6
     exon            1115883..1116017
                     /number=7
     exon            1116068..1116734
                     /number=8
     exon            1116783..1118104
                     /number=9
     CDS             1119310..1119900
                     /codon_start=1
                     /locus_tag="AO090012000446"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000445"
                     /protein_id="BAE60623.1"
                     /transl_table=1
                     /translation="MPPIPQHHHNHQDQDQDQNQDLIPRNNNNNLTKRLTPIPLGPTY
                     TTISIPASYGRLTSSPSPGTIAGIILGSVFGFIFLLYLLWLGLSSGRRFGSETQTEMA
                     SASSAGGMRRRRGRRIVVEEERPMSAHGHGHGHGGDQIVVEESVTSAPSRSEGDVIEV
                     FEEASSVDRPPRRGKHGGGGGWRRGDLEGSEFSSRV"
     exon            1119310..1119900
                     /number=1
     CDS             complement(join(1120343..1120654,1120717..1120734))
                     /codon_start=1
                     /locus_tag="AO090012000447"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000446"
                     /protein_id="BAE60624.1"
                     /transl_table=1
                     /translation="MSYNKPDGPPPSYPAPVHDAGPYPPQGAQGDYYNQGGYPPQNYG
                     PPPQQGYYGSPPPQGQQPMYYPPQQGYPQPGYYADDRGGGGSSGGGICAGIMAALACC
                     CCLDILF"
     exon            complement(1120343..1120654)
                     /number=1
     exon            complement(1120717..1120734)
                     /number=2
     CDS             1122007..1123290
                     /codon_start=1
                     /locus_tag="AO090012000448"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000447"
                     /protein_id="BAE60625.1"
                     /transl_table=1
                     /translation="MSDLNWSGTYLLGLRSLVLLPLSDLSGQLLDNGGDIGLVHRGVD
                     LDLGEVLDDTNVEVELLGGGRAAVGVALLTLLALLAASADEVVILVLLQDLHALHGGV
                     INGTANLSTELRGLVLFVIQSQSSEVVGRVEVADKTLGGKDLVGVSQARGLLELLVGN
                     LLLLLALEGVPLGLLLLPANSPGLILVLLVCLASLVVGVLDLTDSSPLLLLLTVELGA
                     LVPQGVEVLESAVLLGLDGIQLLLNLGVLVAQSLGLRVVKGLLEGGNLGLDVVDDLLG
                     LIQAGEVLTLLAQAGDIGKGLLLIHQAHGTGINLLLEARDFTVNLLDTLERHAGLGVV
                     LLRNAGLERAVQSIDLLLCAGPGRLESRLLLTDGGELSTEFLLSLSRGRVLVVGLGGL
                     DLGLDLVLYEVSNLLRQWNAKMGLEKNPEQTYGGS"
     exon            1122007..1123290
                     /number=1
     CDS             complement(1125634..1126875)
                     /codon_start=1
                     /locus_tag="AO090012000449"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000448"
                     /protein_id="BAE60626.1"
                     /transl_table=1
                     /translation="MIWRRSLRIFLQFIYYFLGSTLIAVVLATLTECQPFNHYWQVVP
                     DPGAQCRSGYANLITMGVCDVITDLLLVAFPIPLIMMTHMPAKRKASLVILFALSLIL
                     VGITCYRVPSVIGHQGSQQYRSLLASLEILAATAVSNAIVIGSFVRDKGVKKAKFKKA
                     IGSASVSESMDHSSVRRTTITHHHWGSDSDLAGDLGIRLHPDLVSSDHKLPRPAPVVA
                     PCEPFTARTGTLDPNWSFHRHAPATDDDRSSTTGSLDIKVSPHEYIPTNKTPRKPSGD
                     SVPSSPGRVSMFDVGGLLDPSPRSSPPPTSHMQYQMPPPGQTTRARSGSTAFLQDVGG
                     LLSAPTSGTPPNASPNFSRPGGLRSNSYGRRRGSSVHFSDTPESPAPPYRSQSDVTAP
                     IPEGSDDVELQDVGGLLSKHS"
     exon            complement(1125634..1126875)
                     /number=1
     CDS             complement(join(1130366..1131362,1131430..1131592,
                     1131640..1131742))
                     /codon_start=1
                     /locus_tag="AO090012000450"
                     /note="histidinol phosphate aminotransferase"
                     /old_locus_tag="AO070343000449"
                     /protein_id="BAE60627.1"
                     /transl_table=1
                     /translation="MAARQSPFDLSKCARKNILQLQPYRCARECVYPPDDGTNVLLDA
                     NENAYGPGLALNSEGALQQSTVNGDSTGSSKPDIDFLGLNRYPDPHQIELKQLFCNLR
                     NTRIHSQKDLTPENLFVGVGSDEAIDALLRCFCVPGKDKILTCPPTYGMYGVSAQVND
                     VDIVKVPLDVENGFQLQPEKIIETLSADDSIKMVYICSPGNPTANLIRKSDIQKVLEH
                     PTWNGVVVVDEAYIDFAPEGSSLAEWVNDWPNLVVMQTLSKAFGLAGIRLGVAFTSPA
                     IARLLNSLKAPYNISSPTSALAMAALSPNNMAVMKKYREQIIAQRERLLQELPKIPGI
                     GRFLGGQESNFLLVELLDKPANEGGKPSNQVALAAYEAMAEKHGVVVRFRGKELGCEG
                     CLRVTVGTEEEVTRFLQELRVVLGGLLG"
     exon            complement(1130366..1131362)
                     /number=1
     exon            complement(1131430..1131592)
                     /number=2
     exon            complement(1131640..1131742)
                     /number=3
     CDS             complement(join(1132341..1132916,1132969..1133520))
                     /codon_start=1
                     /locus_tag="AO090012000451"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000450"
                     /protein_id="BAE60628.1"
                     /transl_table=1
                     /translation="MKITSTIPAVLLGLAPLSAAVSVSGSAEGFASGVTGGGDAEAQI
                     PSDIDELKEWLTDDTPRVIVLDKEYDFTESEGTTSGTVCASWGTGSGCQKIIQDDCGD
                     SPSSQATWYTAGTTGIDVASDKTILGDGDKGVIKGKGLRFRDGVSNIIVQNIEISDLN
                     PEYVWGGDALYFDGSDLIWIDHVTTARTGRQHYTFGYETNTRITLSNNFINGETTYST
                     GCDGYTYWTFEMVGEADQITLQNNYIYMTAGRSPALSGGTLLHAVNNVWEKNNGHALE
                     GGDAGARGIFEGNAWIGVSTIVGDYAGRLFNAPDSSSAGDCESALGRACEVNAVSDSG
                     DLTAYTDTSFFSDFSGLTIAPATSATDAQSSVPNNAGMGKL"
     exon            complement(1132341..1132916)
                     /number=1
     exon            complement(1132969..1133520)
                     /number=2
     CDS             complement(1134661..1136178)
                     /codon_start=1
                     /locus_tag="AO090012000452"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070343000451"
                     /protein_id="BAE60629.1"
                     /transl_table=1
                     /translation="MRLRPIYPSLPRCARIPTSLRAFSHDSTSASTLNGTYPLRNRTV
                     SRGGLSSQSASSEHHLLLPSSSAASFSTSSRLSDPGDWEDNANLSIDAFSELPSKDFG
                     VNQHMVINQEFKEALRQILWQFRAPIRYAFAYGSGVFTQSGSAPGSGQCHPSAPAAIK
                     NMQQGQGKMIDFIFGVSYSQHWHSLNLHQHRDHYSGLGSLGSYAVAQTQDRFGAGVYF
                     NPYITVNGTLIKYGVVNLDTLCRDLSQWDTLYLAGRLQKPVKILRDHPKVRLANQMNL
                     LSAVRVALLLLPAEFTEFQLYSTIAGMSYMGDLRMALPAEDPRKVRNIVSGQMANFRR
                     LYAPLIETLPNVTFNDKRCTEGDWIDDPNANVKLTQDMDPVKRGNMVRRLPESFRAKL
                     YFQYQTRFQIPRGDFNKMMKESQDADQALVRRRQGGPFEQRIASDDNLKQEVQASITK
                     TIRWPSTVQSAKGLVTSGIGRTWRYLREKQNKYKTSGKHASPPSEESTEKAAKQE"
     exon            complement(1134661..1136178)
                     /number=1
     CDS             join(1137222..1137433,1137481..1139491)
                     /codon_start=1
                     /locus_tag="AO090012000454"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000453"
                     /protein_id="BAE60630.1"
                     /transl_table=1
                     /translation="MAARWETRLGLSVRKGMMSCRNFSGINLTTVLCQMVDGGWYFCP
                     TEESNDLASCVYCKLSLDGWEPKDDPFDEHYRRSADCSFFVFAQPPGKKGKGSRTKKA
                     RTSKASRLSTQSTASEAISELEDPMDQSTVSQPATKAKGTKKSSKSKSKNAKSKKEEA
                     AEPDSQMDIDTADYSQPEPAKAKRTTRGTKRTSDQVDREQVNVVDIENFEEAEPPTKK
                     RATKVRNSTQHDSNQNDEVTVDAQLEESIPEDEAKKGRGTTKKKASSKSRKASSGSST
                     SKTASKSRVPNDNELDAAPVADLEQPEPEEQSLEAVQKPSKKSKSKKKQKTTPEPQEV
                     TNHADEEEPGTGEALQPEQPEQPEQTEEPEEPEKPEESSPSPAAPEDKPSHVKSKRKS
                     RGSNIPEPEPEIVTEKPPKTRKRSGADATLKGETDSRVHESFVSVEIPARVPTPVKQP
                     KAEPTNRSEPNDKDLKKKTKQRSSTEKAKKSKKTSKAEALEREKTSAQQEFEPKQSPQ
                     VSSTGHDLPEQSEPQDPQEQEAEQPSTRRRSSRVPPKTAERYSDIPEEKQFARTLAGS
                     SRSSDNHRMSDSADQGNMSPLPTSKSTPSLSPQSSDVENQPPSLKPSATRPPVGSPSK
                     QQTVRIPLAPNTPSPTKRNTNAGGLRTTHPWNPIDIDEILLAGNSDKENVDLSSALYS
                     VKGDLTSPEKKMSVEEWIKWHAKNGEEKLRQECERLVGQFEREGARAMRVLEGIECID
                     "
     exon            1137222..1137433
                     /number=1
     exon            1137481..1139491
                     /number=2
     CDS             complement(join(1139644..1139708,1140074..1140422))
                     /codon_start=1
                     /locus_tag="AO090012000455"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000454"
                     /protein_id="BAE60631.1"
                     /transl_table=1
                     /translation="MSKPTAATSDTAFRKTWDREEYAKKAADEESKRKEESKARYEAK
                     LLGKKWHAPVDYSSLEATTSRKQRLDVASMVGKTTIVSAGSAVGKRGRGAGFYCGDCD
                     LTFKDNLQLVEHLNIYPRRSGFFLNMLWAFDWILN"
     exon            complement(1139644..1139708)
                     /number=1
     exon            complement(1140074..1140422)
                     /number=2
     CDS             complement(join(1140811..1141381,1141449..1142335,
                     1142392..1142500,1142556..1143129,1143185..1143938,
                     1143988..1144140))
                     /codon_start=1
                     /locus_tag="AO090012000457"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000456"
                     /protein_id="BAE60632.1"
                     /transl_table=1
                     /translation="MSDHGDLTHQAISSYFIGPQAENMSYFKDNISTILHELEEARKK
                     YKFDGDQRFITSSIQNSEEFQRITRNFAQAMKKAARLMGSHSIPFWNPRYQAHMCTDL
                     SMPALLGYFMTMIYNPNNVALEASPLTTVAEMEVGEQLCHLFGYNTDPSRKDVPTGWG
                     HVTCGGTVANLEAIWVSRNLKFYPLALRKAMSETVVVDGSEKKGPLSFVADRFVVTTC
                     KGERKLFTDMSTWELLNLRPKTVLDLPQELHEQFGISPKFVESALQNFNIQSTGKDAL
                     EREFEVKQPIKCFLSNTRHYSWPKGGAITGLGSDAFEGIEVDDAARINLDVLQERLQR
                     CLDEGQAVYAVVAIIGSTEEGAVDRLSAILAMRQRFQSKGLSFLVHADAAWGGYFATM
                     LPRNLYDMPRGPSVSNPEDSFDGGAEGFVPDLSLKLETQEDLLALKYADSITVDPHKA
                     GYIPYPGGSLVYRDGRMRYLVTWTAPVLSQGSETGMGIYGVEGSKPGAAAMSIWLSNK
                     CIGLNPQGYGALLSEVSFTCTRLSAHWAAMTTKDDDYFMCVPFHKLPSEWKDPFNEHA
                     IEKEKERIRQEILPKSNREIVESDVGKPTEEKLMTLLRGLGSDLNINAFALNWRYDDK
                     DRTWNTDIEEANYLTRHVVERLSICSPDQDPTKIPFYLTSTEFTNELYGKCAKEFKRR
                     LGLPQCDRPLFVLRNVVMSPFPTDNDFISTMVDYFRSVVEDGVRLCRKRNARGSAIHR
                     FVMQGTDEIFLAYQPSFHLGKHRQQIILAVELEDHAKSDYIEIRESNPQDPIFLKSSV
                     EIDLQQVVSECERGSPVSFNGTIYTHHGGPVRTSTPVTLKRVIKSRPLNSANREVDYP
                     EDYMPFYLYGSGKQWHISHMLLQAPNATFSAGNVKLDDKLVSSLNKGHAEKGAILALT
                     EVPETPMQPFPTSKSELPACFFFQPDKKYKVKVWDDPNDASAAGPGLLEGLGEPIEGT
                     ITLSKEIHIDLEWINKDPFEREDRVGKWRDEFSQIGKKLEKRA"
     exon            complement(1140811..1141381)
                     /number=1
     exon            complement(1141449..1142335)
                     /number=2
     exon            complement(1142392..1142500)
                     /number=3
     exon            complement(1142556..1143129)
                     /number=4
     exon            complement(1143185..1143938)
                     /number=5
     exon            complement(1143988..1144140)
                     /number=6
     CDS             complement(join(1146035..1146166,1146217..1146342,
                     1146395..1146565))
                     /codon_start=1
                     /locus_tag="AO090012000458"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000457"
                     /protein_id="BAE60633.1"
                     /transl_table=1
                     /translation="MQFKLSALTALLAASASVYADSISGSKVTNILDTLTKGARDLNS
                     SLQSTQDASSTGQTILSGEQKAMAEKQDALLSLAAEGDRRVAPKDQSAVCQSLLTSTA
                     RCSTSRLNRSFSSLSLRRGRLSSFPSGLHPLRPHWAPTRK"
     exon            complement(1146035..1146166)
                     /number=1
     exon            complement(1146217..1146342)
                     /number=2
     exon            complement(1146395..1146565)
                     /number=3
     CDS             complement(join(1147192..1147239,1147321..1147827))
                     /codon_start=1
                     /locus_tag="AO090012000459"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000458"
                     /protein_id="BAE60634.1"
                     /transl_table=1
                     /translation="MFGHALRKASTATGRHPRFLSLEMNPKFAAVSKALVSIAGLDDI
                     VKIRVGPCRASLHSLAKGGKHSGSSEQQQPWDMLFLDHSKISYLNDLKLCEELGLVAP
                     GSTVIADDMKRPGNPWYSEYVRASPGKKAEDCLPFKGCLSDGGISLGNPGLVYETMLV
                     EGLEPTGLMDAVEVSKCVGLVEVQ"
     exon            complement(1147192..1147239)
                     /number=1
     exon            complement(1147321..1147827)
                     /number=2
     CDS             join(1148573..1148625,1148681..1148867,1148943..1149423,
                     1149481..1149701,1149765..1150742)
                     /codon_start=1
                     /locus_tag="AO090012000460"
                     /note="2-polyprenyl-6-methoxyphenol hydroxylase and
                     related FAD-dependent oxidoreductases"
                     /old_locus_tag="AO070343000459"
                     /protein_id="BAE60635.1"
                     /transl_table=1
                     /translation="MSETIRTDVLIVGAGPAGLIAAAWMAQTGVKAMLIDQKSHQTQC
                     GRADGLESRTLEILDSFGLADRVWAEANHTVEIALWGVTVDGKLQRQSVTANSKPGWS
                     RFHESTLGQAKVEEYLMEYVRGRDSVDVRRETAPTSLEIDYNTIDDHSTFPIRMNLEN
                     VAPRLKPHFNDMKNPGSDTSSETHSDDSGYAGVGTVVEAKYLVGCDGAHSWVRKQLGL
                     RLEGENSSDSWGVLDIIPLTNFPDIRKRFIVKSKYGSLMMIPRERKLVRVYVELPANV
                     AMRYREEQDGEILMGQVEKIMQPYTMRTKHIDWSTIYTVGQRVCRKIGLHNRIFLAGD
                     AIHTHSPKAGQGMNVSMQDTFNLGWKLASVIRGALHPQILETYQQERLPVAERLIALD
                     KRICRGMCSRRNADGETFHGAFDEDHKRALEEENSSASGLAVIYQPNLLVTSVAHHQT
                     TNLRIGARIPSMLIINQSDAQPRHLQHILPSTGEWSLIIFGGDIADPRQMQRLNHLEE
                     TLCHPESIIQRLNNHASAMRRDSAFVRIYLIHCAERLRIELHDLPAVFRPWTEDNGVD
                     YSRVWVDEKAYHHAGGGQLYKSFGIGPEGCMVLLRPDQHLSFLSDMDDGKGLERFLTS
                     ITPEESHQSATFQDL"
     exon            1148573..1148625
                     /number=1
     exon            1148681..1148867
                     /number=2
     exon            1148943..1149423
                     /number=3
     exon            1149481..1149701
                     /number=4
     exon            1149765..1150742
                     /number=5
     CDS             complement(1150837..1152225)
                     /codon_start=1
                     /locus_tag="AO090012000461"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000460"
                     /protein_id="BAE60636.1"
                     /transl_table=1
                     /translation="MDRAVPITLDYTLRDLYSDNDEDDLKTTLIYYPLQFGYMHESPS
                     AKYVYGYTLQSDDEKAASSFAMAANMVPQRYAFSAGQMPLIILDFHSSNKRKEANRKA
                     CQIIDELPAYQLDIRRTFSQLIPNQQPTLTFANSPESISLASGARIAVLLPTDCLSHL
                     PHVVHPETHYEILSKRGLALSGLPTPPSQVIDTGLIDSDNPVLLKEEVARMVESIDQR
                     QVPFVVKLPQSISGMGTFMITTEVERGRVKTLLTEQFGMMLRQLNRSNHHLYPCSMVL
                     QDFVTGPVVALSLFITKTGQPRFIACCKQRFDEQGHWIGGLISYRQQAKLRETFAVIM
                     QMVADFLHSKGYHGPAGVDIVTDDRSGEQLIIDLNVRVTGTFHLGPLTGHFTKRGLFE
                     AGMTTVDFPCSREKFEQMFADEIRNGSLIVSGWVHGESSQLNHAAITIGAREPDELEE
                     YFRRIKAATLHS"
     exon            complement(1150837..1152225)
                     /number=1
     CDS             join(1154265..1154623,1154821..1154848)
                     /codon_start=1
                     /locus_tag="AO090012000462"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000461"
                     /protein_id="BAE60637.1"
                     /transl_table=1
                     /translation="MHFQALPVLATVLALPYLAFGEPTCYNSDVWKDEAARSEAAHAI
                     DKWCNNLAPSKWEPRRERKQCLEVDYSPHNVNLWMNNGNLGDATITVDQCKKLLKKIV
                     DTCPGGGYDHTKDGWKSKQVANQVEH"
     exon            1154265..1154623
                     /number=1
     exon            1154821..1154848
                     /number=2
     CDS             join(1155612..1156105,1156188..1156194)
                     /codon_start=1
                     /locus_tag="AO090012000463"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000462"
                     /protein_id="BAE60638.1"
                     /transl_table=1
                     /translation="MNEVPHNEQPPKQPPKTLTTLPTELHLQISTYLPYPDALALKHT
                     SRHFYALVYTGVHLKVDWFVERFEQKLECPMEKCSFRTDEAFCNLRIRRIMERRRRHL
                     ECRRRAGGCLVVPGRTCQGDLVPGWLKGKGGLGGVVMFGNEGLVFVLGMLFLGVYLTW
                     GVVFGV"
     exon            1155612..1156105
                     /number=1
     exon            1156188..1156194
                     /number=2
     CDS             complement(join(1156513..1156531,1156607..1156639,
                     1156658..1156959,1157068..1157356,1157427..1157847,
                     1157916..1158294))
                     /codon_start=1
                     /locus_tag="AO090012000464"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000463"
                     /protein_id="BAE60639.1"
                     /transl_table=1
                     /translation="MVDEAQLHKGPPEQVARVLRNTKQVLHVPSTMTGRHFHELFTGP
                     NLRLEILGLFYAIAGRLSVFGLAHDKFPRQNGMAARERFSRKMLAASDAVLQICKLIA
                     PVNDLTIWMLYEILLLSKVAHGDASSAKWRRLGDLSTHIFELGLHRDSQQSSSLPLFL
                     VESRRRLFAATYQLDKSIATFLGRPPRISLRHSDCRLPLDLDDRSLEADQSEIELALQ
                     DLDSDGWNTQGSLHRSTFSRQRFLVATFREEILEVSLETQNHRTAEKLRDISMRCHQT
                     WDSMPKQLHYSPDSRDENMSNTVCMMLIVSYLAYLYNDFLIQRLLVQQDPEAYSALLN
                     VSSTILSTVLDFCAMREDMVDLRPDFMWTKQARTGKPIPYQGSRSVLIRHLSVFISHL
                     ESMSRPGVVNQELFHRASKIFSSIIDEVLEPRVAVTLPGPDIDILAGSGTCMIGSDDL
                     EFLDMLEFGGSIDQYVMPLVCWLRFGLIPS"
     exon            complement(1156513..1156531)
                     /number=1
     exon            complement(1156607..1156639)
                     /number=2
     exon            complement(1156658..1156959)
                     /number=3
     exon            complement(1157068..1157356)
                     /number=4
     exon            complement(1157427..1157847)
                     /number=5
     exon            complement(1157916..1158294)
                     /number=6
     tRNA            1159143..1159214
                     /locus_tag="AO090012t00014"
                     /note="tRNAscan-SE"
                     /product="tRNA-Trp"
     CDS             join(1160373..1160650,1160702..1160788,1160810..1161007,
                     1161055..1161238,1161290..1161316,1161373..1161507,
                     1161566..1162294)
                     /codon_start=1
                     /locus_tag="AO090012000465"
                     /note="cytochrome P450 CYP2 subfamily"
                     /old_locus_tag="AO070343000464"
                     /protein_id="BAE60640.1"
                     /transl_table=1
                     /translation="MSYMVLGLAIGVIFLYFIRSFLARTKSFAPLPPGPRPKPIIGNL
                     WDLPPQGTRDWLHWLKHKDLYGTYSQHRHIATTDRLRKNSGKAQLAPSPSWRSVPPYT
                     HLDRRAPLPICKHRLFTTYTAGYGDIMTILEYSERLRTTRKVAHQQIGSNKAISRFSH
                     IQDAEVCRYLLRMLRDPGNWLEHIKKQVETGAVILKITYGYTVEPHGRDPLVDLAEDA
                     VGKFSLAMVPGAWLVDSIPICESSFYSVMEHVEAVRGQQKQMTQGSNVPSIISYYLES
                     ENIQPGSEEEHLVKWATATLYGGGADTTVSTMMCFFLTMALYPHVQRKAQEEIDRVVG
                     ATRLPGFEDRGNLPYIDALLKEALRWHPIVPMGVAHMAMEDDMLEGYRIPKGAAILSN
                     IWCVRPRTPYFLLLTKLPCRAFTHDPNEYHDPMTFKPERFLSDNGHTPERDPHLLAFG
                     FGRRVCPGRNLADSNLWLTIARTLAAFNIAKPIRDGKEVDIQPEFQAGLISHPEPFDV
                     DIKLRSAGHHELILAGEKQYPWEESHAEELRRAIAVL"
     exon            1160373..1160650
                     /number=1
     exon            1160702..1160788
                     /number=2
     exon            1160810..1161007
                     /number=3
     exon            1161055..1161238
                     /number=4
     exon            1161290..1161316
                     /number=5
     exon            1161373..1161507
                     /number=6
     exon            1161566..1162294
                     /number=7
     CDS             join(1163122..1163487,1163543..1163593)
                     /codon_start=1
                     /locus_tag="AO090012000466"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000465"
                     /protein_id="BAE60641.1"
                     /transl_table=1
                     /translation="MSSDTWIQSISQILGWAYFVLWSLSFYPQVLHNHRRHSTDGFSI
                     DFALLNLLGLTAYTIFNACFLFSPVVRTQYAQRHPQSPKPTVQWNDFVYALHGALICC
                     YLRSHFLCARFWNFKSKPQRPFYGLWYRHRGNGLTW"
     exon            1163122..1163487
                     /number=1
     exon            1163543..1163593
                     /number=2
     CDS             join(1167142..1167162,1167250..1168386)
                     /codon_start=1
                     /locus_tag="AO090012000468"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000467"
                     /protein_id="BAE60642.1"
                     /transl_table=1
                     /translation="MPPTPQTTKLTSTLHLLIPRLRLLQKKSTASSVVQRRELSHLLS
                     ENKDASARIRVENVIATDIAVEVMEMVELYCELILARANVLDQNAFSEKGVEARNRAK
                     EAWVEMRRKEQGLGSSPGSAASGGDAAGSGKRSGFGFGALFGGGGSKREETVAVESTG
                     VQGVGDAAYIDSALDEAAAAIFYAYPRFPADVRELTILRGLLADRYGKEFMTLAQDDR
                     FPEADGLKVPERLVKGLRVKPPSQELVDSYLREIARAYGVAWGGDAEELGEAPAEFVD
                     GDGDDDATAGGDVPVTPRKEGRPADVERRMSETAELNRATPPKGLQSGKSPVSVAPPG
                     PRSDNPNPRVKVPDGNGKGEAEVEPRSPSKTTKGGIPELDELTRRFAALKR"
     exon            1167142..1167162
                     /number=1
     exon            1167250..1168386
                     /number=2
     CDS             complement(join(1168779..1169448,1169499..1169794,
                     1169844..1170025,1170076..1170985))
                     /codon_start=1
                     /locus_tag="AO090012000469"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070343000468"
                     /protein_id="BAE60643.1"
                     /transl_table=1
                     /translation="MPVPKLDLQQSSRLRSISTSSNSPVPTPALTPTHQRTFSHSNSK
                     NRNARHTRTTSWTSGHDGGEPSPLDFPAQQRRRRESNISLADLSEGSSDRYGDDSDDR
                     MALRNTSFEQSGHARNRSQSHAQASFMQPQQFSADPPPRPGPVTWMTLPRKKQLALLG
                     LCRVFDFLQIASLQAYMFYQLKSFDEGLSDADVSTQAGILQGAFTAAQFATAIPWGRV
                     ADAEWGGRKFVLLVGLLGTAVSCLGVAFATSFAQAVFWRSFGGAINGTVGIIRTMIAE
                     NVKEKKYHSRAFLILPIGFNIASLFGPVMGGMLADPVRSYPALFGPNSSFGGANGVQW
                     LERYPYALPMLANAVFLSFAAFCVGIGLEETLEACKGKPGLGVFTARIFARGIRAVVP
                     SSSPLYQRLPFADYDEEGPLLSNRRDPTESYELEEKAAKPRHKRTLPFHRLWTKNVLC
                     TLLAQAFFDFQMGAFNNLWLLFLSSPRYDSNDPAAPAQRLPFIFTGGLGMLPQSVGFA
                     TAILGVIGMLLQFTVYPAINSRLGTAKSYQYFLTLFPLAYAFAPYIALAPSSAPPPGQ
                     ANGPWVWFSIIVVLFLQVTARTFTLPTSIILLNNCSPHPSVLGTIHGIGQSVSSAFRT
                     IGPIFSGSWYGYGLEIGTVGFAWWLIALVSVFGCVAAIFVYEGSGHEIILPGEEDEFN
                     DRH"
     exon            complement(1168779..1169448)
                     /number=1
     exon            complement(1169499..1169794)
                     /number=2
     exon            complement(1169844..1170025)
                     /number=3
     exon            complement(1170076..1170985)
                     /number=4
     CDS             complement(1172106..1173263)
                     /codon_start=1
                     /locus_tag="AO090012000470"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000469"
                     /protein_id="BAE60644.1"
                     /transl_table=1
                     /translation="MLILIDHVAKTATQLHEYAPLNNNMLSSSQGNMQVLPNHNVFIG
                     WGNNAYISEHDQNGNLLLWGYIDKDRIMNYRAQKFQWDGMPTDVPALWTYSRSTEPFS
                     SLTLYVSWNGATRVRYWRFYGAMNMTGPYALLNQVTKKGFETSYTFPHYYPWTYAEAV
                     DLEGKVLGKSRHKFTFTPSRELQQYCANDMCENAQAYGLPGEEGASAFIPPLGLTTVP
                     WVDPENPEAHYDWGESSEPASQPLDEAKETLKIAYGEPFFYSRPQVKDIETNYGGVPR
                     SRMVCPCAGGWCCRDWGLHGGSKVSTATPSCLPGERAQIIRTIGRCYRRTKTAGRDER
                     HAVVALAAMDRSIRRTTLFPLEGARFEQERRCILGLGFHSLTPYITCLTLL"
     exon            complement(1172106..1173263)
                     /number=1
     CDS             complement(join(1173428..1174180,1174263..1174376))
                     /codon_start=1
                     /locus_tag="AO090012000471"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000470"
                     /protein_id="BAE60645.1"
                     /transl_table=1
                     /translation="MPGGSASLSSFRIMAALLVGLLCCLPGVFAEIDSVFRSRPDLYP
                     PALTIEHSVPGKVTPGYIFVGPYEAANSGPYIYDNEGVRHFRFPIELLSLTPSQNLVW
                     SGWGSSGPGNAHGMHVCKYKGEDHLCFFQGAQQNGYCRGHGVIMDNRYRTVKTVVPGG
                     GMASSDMHEFLPINDGKTALLTVYQQRQFDMSLWNVKTGMGWLMESIFQEVDVETNEV
                     LFEWKSLDHVDPTVSYTYPGHTDTSGTGLDPRSPWDYFHINSIDKNQEGDYLISSRHT
                     SAIYKFPARMGQ"
     exon            complement(1173428..1174180)
                     /number=1
     exon            complement(1174263..1174376)
                     /number=2
     CDS             join(1176745..1177368,1177763..1177768)
                     /codon_start=1
                     /locus_tag="AO090012000472"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000471"
                     /protein_id="BAE60646.1"
                     /transl_table=1
                     /translation="MFWNKRSHELRPAHTITPKKETKKKSRSPTEALESHSSGQSGRQ
                     ERSTHRDSLQGSVHHLVPIAGTATLEEIGHVISTGKWSVGDIFSQKFTQRAPAIADLV
                     LQQALRWDQAADFVDVILVHLLALVGEVPAEEGLEKLVQHRVVHAGSPAEVRNKAVFR
                     IAHTPKDSLHDGSVGYQLADKSPQIYSSVNLRMPRVHITSSQNNLSIRG"
     exon            1176745..1177368
                     /number=1
     exon            1177763..1177768
                     /number=2
     CDS             complement(join(1182949..1183546,1183602..1183726,
                     1183803..1183937))
                     /codon_start=1
                     /locus_tag="AO090012000475"
                     /note="diphthine synthase"
                     /old_locus_tag="AO070343000474"
                     /protein_id="BAE60647.1"
                     /transl_table=1
                     /translation="MLYLVGLGLADETDITVKGLEVVKRAERVYLEAYTSILLVNKEK
                     LEAFYGRPVIEADREKVESGSDEILAGADKTDVAFLVVGDPFGATTHTDLVLRARELG
                     IESKVIPNASIMSGIGCTGLQLYNFGQTVSMVFFTENWKPSSYYDKIKENISLGLHTL
                     VLLDIKVKEQSYENMARGRLIYEPPRYMTVAQCASQMLETEEERKEGVYGPDSLAVGA
                     ARVGAPDQKLVVGTLKELAEVEMGAPLHSLVLLGRRAHDLEKDYIREFAVDKATFDAS
                     WQKGYGATS"
     exon            complement(1182949..1183546)
                     /number=1
     exon            complement(1183602..1183726)
                     /number=2
     exon            complement(1183803..1183937)
                     /number=3
     CDS             join(1184241..1184285,1184737..1184826,1184877..1185713,
                     1186497..1186538)
                     /codon_start=1
                     /locus_tag="AO090012000476"
                     /note="histone acetyltransferase PCAF/SAGA, subunit
                     SUPT3H/SPT3"
                     /old_locus_tag="AO070343000475"
                     /protein_id="BAE60648.1"
                     /transl_table=1
                     /translation="MSTDRTPKYRQEIQQMMFVSGETAEPSVETTTLIEEIVRQQVVE
                     ILARSTTLATRRGVRSISTDDLIFLIRHDKAKVSRLKTFLSWKDVRKNVKDSDDKGGA
                     DAAEFAGADDPLAGGVVAGPQDVASKPKNKRARVGLAWDVNSFYSVQVPERDDEEDEE
                     EEEQNYATLQRLAAADERTKHMTKEEYVFWSECRQASFTYRKSKRFREWAGFGIVTES
                     KPNDDIVDILGFLTFEIVQTLTEEALKVKEREDREKNRRGGAENDSGETKKRKRETGL
                     FDPPEEGRTPVEPKHIREAYRKLQATPNKNIAMLLHNGRVPARMPLRLEGHVYFAGVR
                     VDI"
     exon            1184241..1184285
                     /number=1
     exon            1184737..1184826
                     /number=2
     exon            1184877..1185713
                     /number=3
     exon            1186497..1186538
                     /number=4
     CDS             1187885..1188595
                     /codon_start=1
                     /locus_tag="AO090012000478"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000477"
                     /protein_id="BAE60649.1"
                     /transl_table=1
                     /translation="MGHGVTLMEAENLKFLATNSKVPVPRVYAAFKDPDTKKTYIIMQ
                     YLHGDNLQKSLPSLTQVEKATICSLIKDAITELRSIPPPDYLGMLNRRPYLDGVFWTE
                     GLISKISGPFENQEDMNLAIIEKLRQTESEPYIRLLRNMVNRTLNGHRTVFTHGDLQP
                     KNIMVEKLRSRDGGPEFRITLLDWESAGWYPEFWDFCNATIACRFKPDWLELVPDILD
                     QYPVEFLMMQVVYSSVFY"
     exon            1187885..1188595
                     /number=1
     CDS             join(1189669..1190143,1190519..1190526)
                     /codon_start=1
                     /locus_tag="AO090012000479"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000478"
                     /protein_id="BAE60650.1"
                     /transl_table=1
                     /translation="MASKVHLVRHAESVHNVTHDFSQLDPELTPLGLQQATGLGQLFP
                     YAPQVGVIITSPLKRAVQTTLTAFSHILDKRYFDPDSGYGVENGAALFLEPDLQERSA
                     LPCDTGSPTRVLDAAFPRLGVQDLAEGWQVKEDFYSPADEAVEERAQKMRSRIAAVFI
                     "
     exon            1189669..1190143
                     /number=1
     exon            1190519..1190526
                     /number=2
     CDS             1194279..1195496
                     /codon_start=1
                     /locus_tag="AO090012000481"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000480"
                     /protein_id="BAE60651.1"
                     /transl_table=1
                     /translation="MKTFTSALIGAAALAQDVNSSPLSGPAGLEFPNVTGLMNHTVHV
                     SNGGSAHCVSGTVKVNATTDKNLKFAYNLPPNQSQVTQTLVSLWSSGGDGYVKSLTSG
                     TQRVTGSFDIEATYCLPAGENSKTTKVQLLTHGIGVDRYYWDFASGYSYVDTAAAAGY
                     ATFLYNRLGVGASSKEDPLNAVQSPLELEILEALASKLRQGTLGDRAFSTVVGVGHSF
                     GSILTQGVTAAYPKTLDAAVLTGFTLNSTGLPGFGLGLNAAIASETQPYRFSGLSAGY
                     LVAGTPVSNQIAFFYDPGFDPEILSLADATKGSFTLGELFTLTHVLNATSEFQGPVAV
                     VAGNEDLPFCNGNCSSPTNILADLVPALYPELSEEDTATYVAPAAGHALNLHYAAPGA
                     FNFIQDFLKKHNV"
     exon            1194279..1195496
                     /number=1
     CDS             complement(join(1199266..1199379,1201109..1201541,
                     1201592..1201824,1201881..1202213))
                     /codon_start=1
                     /locus_tag="AO090012000482"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000481"
                     /protein_id="BAE60652.1"
                     /transl_table=1
                     /translation="MKLTIASSVLLGLIAAVEAAKHGHGHNHNHQRDVNSAAEVEAPL
                     EKRGGSCEFPKDAGLVAVTPNLKNAGWAMSPDQPCKPGNYCPYACPPGQVSMQWDPEA
                     TSYSYPMSMNGGLYCDEDGKIQKPFPNKPYCQDGTGAVGARNKCNGQVSFCQTVLPGN
                     EAMLIPTLVEELATLAVPDLSYWCETAAHFYINPPGYDTETACVWGTSDQPLGNWTPY
                     VAGANTDGDGNTFVKIGWNPIYLEPTTPFRDVVPDFGVEIECEGDGCNGLPCKIDPAV
                     NGVNEVTGSSSKGAGGGAFCVVTVPKGEKANIVVFEKSGSSGGGSSSSTTVSSSSSTI
                     NRQPVQRTGSENSYQALVLPAQRLHHMWNLCRYGVH"
     exon            complement(1199266..1199379)
                     /number=1
     exon            complement(1201109..1201541)
                     /number=2
     exon            complement(1201592..1201824)
                     /number=3
     exon            complement(1201881..1202213)
                     /number=4
     CDS             complement(1202847..1203248)
                     /codon_start=1
                     /locus_tag="AO090012000483"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000482"
                     /protein_id="BAE60653.1"
                     /transl_table=1
                     /translation="MTGTVVVASIGTSGILRAKNTYSFSETIEPLAQCYPAKSSVQTE
                     FGRSLSAIGPLFNVAISDPFCRIRLPSTLLCGKICSSSGRSADLCRLVWSGPSSSTIS
                     ICHWSFPRINISKHSTNQFTWDLTYDRSAVK"
     exon            complement(1202847..1203248)
                     /number=1
     CDS             complement(join(1205066..1205587,1205640..1205939,
                     1205996..1206327,1206418..1206834,1206886..1207706,
                     1207757..1209485,1209544..1209775))
                     /codon_start=1
                     /locus_tag="AO090012000484"
                     /note="predicted E3 ubiquitin ligase"
                     /old_locus_tag="AO070343000483"
                     /protein_id="BAE60654.1"
                     /transl_table=1
                     /translation="MVHRSAFESFTRVFSTEEKRNSVWKIYQSSILDFVDDVILQQTP
                     QTLSDERTVKSDDAEAKYARVVGTAVLLFNRIIGSSTREVLEKDIATVENLLGSKSLW
                     SLCYHDDPFVRRSVYVLLRSAVSKDPEQLDWKLISAAIIGKSLHVSQLGSSSDLSELL
                     LQVTAARPQLWTDDYTGKSSSSKRLIQYIEKGSEGGLASFWQNLYELLQVIPSQTLVK
                     VDVKSTNEDSVELSSATKLTQSFQNGLNSRDEPRQNRAVGWKAYIDTGMWLANKLPQN
                     DRESFLHERLSPLIMQYVKPEQDRSEWELPAQSAEALCADYLDILATHNYDGELHKLW
                     TELSDNLLEAVKLSSPEQSKDFRSSQDAVGAQAERLLGLEASVLSRVADTGRESKLLQ
                     AFKDTNLGLLGNCLEVLQTRNGKPYGAAAVVEGMVQKVAQIAQQSQELLRFVQDDAPE
                     LLFSPSADRLISIILSCRSWDGFGPSFEKVVERVAQSEPESSNAHAVQKLLSTLDFKE
                     VDERSGLGSLIARALDRACRGSSLHWSIVIAVLQNQTSHGELTESIFLSIIDALSDES
                     KMFDTLHGVSQIATTVPTALREFQTGPHGSKLTGKLLFLAESPSEEVAGLAESLTRKV
                     KESAVSETSARSTFEILQHNFNNVNEESLSIGSLLNVAEEFLHNTKPEDLKKVVKDIL
                     PSRQNWEDALEPFLALPPRLSTAITSPLKGTVHIIDRHISDESRRRYETVPRDSSHCS
                     SALRLAYFTIRTLSSLDITSQLGVEELQTLFFYLPLAVQLIDDDLSIDNCNGITGVLL
                     LEQREDYMEIVNDGRSLINRWAHLEESVAPSITAFWESKLESLTGTSPADYRVGEAFV
                     KIMEGQDSANSKSSEEVAKLCKDVRTANAIRSASWVAILRQSILSNPAGTRLCNELVA
                     ESTGLKPHDERKDGLRKLSLLNLLVVGLEEVIESIPTQRVVFLVKHLVQCLQSENISL
                     SVKAEVFQTLSFALPCIHEMYGSHWEDCMDALSTTWREASGSDEALPVLLGSFRLFAC
                     LRSIVGNEDSNDDVKDTWSDRKAGLFNDLTATIKEFDLLCRLINSISIETLEDVSRIF
                     PLLTAQSRAVQRAAYTVLHRYIPSVQEQVSFDVALSKTAVKLPDELLSLLLEAPTMDS
                     ISLSYGDDKVWADIRSYLLSWKIIFDHFVNASFAVQENYVSSIKENDVLIPLLEFTFD
                     FLQQSHQKMVDASKFDIRSFELDQSDSQEKEIQWLLVHLYFLCLKYLANMTKSWWIDA
                     KKRTKGPVEAWTEKYISPLIIADALQGITEWISTQDPNEDRALTVKISPKTSEIIASI
                     PVDEESPPVALSISLPPAYPLQPALVVGRSRVLVDERKWKSWLLTIQGVIMFANGNIV
                     DGLLAFRKNVQGALKGQSECAICYSVISTDMQTPNKRCATCKNTFHSVCLFRWFKSSN
                     QSTCPLCRNNFVYV"
     exon            complement(1205066..1205587)
                     /number=1
     exon            complement(1205640..1205939)
                     /number=2
     exon            complement(1205996..1206327)
                     /number=3
     exon            complement(1206418..1206834)
                     /number=4
     exon            complement(1206886..1207706)
                     /number=5
     exon            complement(1207757..1209485)
                     /number=6
     exon            complement(1209544..1209775)
                     /number=7
     CDS             join(1210677..1210693,1210755..1211211,1211263..1213173)
                     /codon_start=1
                     /locus_tag="AO090012000485"
                     /note="RNA polymerase II transcription
                     initiation/nucleotide excision repair factor TFIIH, 5'-3'
                     helicase subunit RAD3"
                     /old_locus_tag="AO070343000484"
                     /protein_id="BAE60655.1"
                     /transl_table=1
                     /translation="MKFFIDDLPVLFPYPRIYPEQYAYMCDLKKTLDAGGHCVLEMPS
                     GTGKTVSLLSLIVAYQMHYPEHRKLIYCSRTMSEIEKALAELKALMKFRTQQLGYTED
                     FRALGLTSRKNLCLHPSVKREKSGTIVDARCRSLTAGFVKEKKERGEDVELCVYHENL
                     DLLEPHNLVPPGVFTLDGLLKYGEDHKQCPYFSARRMMPFCNVIIYSYHYLLDPKIAE
                     RVSREFSKDCIVVFDEAHNIDNVCIESLSIDITENSLRKATRGANNLERKINEMKSSD
                     AEKLQSEYSKLVEGLREAEQAREEDQFISNPVLPDDLLKEAVPGNIRRAEHFISFLKR
                     FIEYLKTRMKVTHTISETPPSFLTHVKDLTYIERKPLRFCAERLTSLVRTLELINIED
                     YQPLQEVATFATLVSTYDKGFLLILEPFESEAATVPNPVLHFTCLDAAIAIKPVFERF
                     SSVIITSGTLSPLEMYPKMLGFTTVMQESYSMTLARRSFLPMVVTRGSDQAQISSSFQ
                     IRNDPGVVRNYGNIVLEFSRITPDGIVVFFPSYLYMESIISMWQGMGILDSIWNYKLI
                     LVETPDAQESSLALETYRTACCNGRGAILMCVARGKVSEGIDFDHHYGRAVICIGVPF
                     QYTESRILKARLEFLRENYRIRENDFLSFDAMRHAAQCLGRVLRGKDDYGVMVLADKR
                     FQKKRTQLPKWISQAMLESETNLSTDMAVATAKNFLRGMAQPFKAKDQDGISTWSLAD
                     LERHREKQMLEEERARRQALANGHGANGVANGAAAAADEFDDDIDDDLMMLDAQ"
     exon            1210677..1210693
                     /number=1
     exon            1210755..1211211
                     /number=2
     exon            1211263..1213173
                     /number=3
     CDS             complement(join(1214408..1215991,1216062..1218822,
                     1218884..1219375,1219465..1219649))
                     /codon_start=1
                     /locus_tag="AO090012000486"
                     /note="RNA polymerase I, large subunit"
                     /old_locus_tag="AO070343000485"
                     /protein_id="BAE60656.1"
                     /transl_table=1
                     /translation="MANFARPVASSISGIDFSVYNDEDIKATSVKRIHNTPTLDSFNN
                     PVPGGLYDPAMGAWGDHVCTTCRMSSWSCTGHPGHIELPVHVYNVTHFDQMYRLLRAQ
                     CVYCHRLQMSRTQVNAYTCKLRLLQYGLVDEVAALESMELKKGSKKSAKDGDESEDDG
                     DEDEDDLVKRRNVFVKKAIREAQASGKLKGLMAGAKNPIAAEQRRAVVRDFFKDIVGI
                     KKCANCSGISPGYRRDRYSKIFRKALPEKAKLAMQQAGYNASNSLIILQETRKFNRKE
                     KEALVNDNASTTSESHGAEEEVARGNAILAQVDNKKTGDGGQFMPSPEVHAAISLLFV
                     KEEEILNLVYTSRPMSKKESRVDAGMFFIKNLLVPPNKYRPVASQGAGAVVEAQQNTV
                     FTQILKNCDIINQISKERQNGGSDSAMRVRDYRDLLHAIVQLQDTVNGLIDRDRSGLS
                     GPAAASAPNGIKQILEKKEGLFRKNMMGKRVNFAARSVISPDPNIETNEIGVPLVFAK
                     KLTYPEPVTNHNFWEMKQAVINGPDKYPGAAAIENEFGQVTNLKFKSLDERTALANQL
                     LAPSNWRMKGSRNKKVYRHLTTGDVVLMNRQPTLHKPSIMGHKARVLANERVIRMHYA
                     NCNTYNADFDGDEMNMHFPQNELARAEAMMLADADHQYLVATSGKPLRGLIQDHISMS
                     TWFTCRDSFFDEEDYHELLYSCLRPENSHTITERIQVVAPTMIKPKRLWTGKQIITTI
                     LKNIMPPNRAGLNMKSKSSTPGDRWGEGNEEGTVLFKDGELLCGILDKKQIGPTAGGL
                     IDSIHEIYGHTIAGRLIGILGRLLTRFLNMRAFTCGIDDLRLTKEGDRVRKEKLSKAS
                     EIGREVALKYVTLDQTKVADEDTELRRRLEDVLRDDEKQSGLDSVSNARTANLSTEIT
                     KACLPGGLVKPFPWNQMQSMTISGAKGSSVNANLISCNLGQQVLEGRRVPVMISGKTL
                     PSFRAFDTNPMAGGYVCGRFLTGIKPQEYYFHAMAGREGLIDTAVKTSRSGYLQRCLI
                     KGMEGLRAEYDTSVREASDGSIVQFLYGEDGLDITKQVHLKDFDFLASNYKSIISQVN
                     SSDFHTLENEEVGEWHKDAMRKVRKTGKVDAMDPVLSIYHPGGNLGSTSELFAQAVKK
                     YEDGNPDKLLKDKKKSIEGILSKKSFGNMMNMKYLKSVVDPGEAVGIVAGQSIGEPST
                     QMTLNTFHLAGHSAKNVTLGIPRLREIVMTASAHIMTPTMTLILNEELSKEHSERFAK
                     AISKLSIAEVVDKVEIRERITSGSTKAKVYDIEISFFPPEEYTAEYAIKTKDVQIALQ
                     NKFIPKLVKLTRAELKRREDEKKLSSYSTAQPEIGVSVGTVQEAPRGADDDDAPADDD
                     DEEDQDDAKRASGSKNRSNQVSYEGPEGEEEKMVQEQDADDDDDIEDSGEKQTKDVEM
                     DDASDDESDNEAKDTKLREEDIKGKFGEITQFKFNPSQGSSCTIQLQYDISTPKLLVL
                     PLVEAAARTAVIQSIPGLGNCTYVEADPIKGEPAHVITDGVNLLAMRDYQDIIQPHSL
                     YTNSIHHMLNLYGVEAARASIVREMTEVFEGHSISVDNRHLNLIGDVMTQSGGFRPFN
                     RNGLVKDASSPLAKMSFETTVGFLRDAVQERDYDNLKSPSSRIVVGRVGTVGTGAFDV
                     LAPVA"
     exon            complement(1214408..1215991)
                     /number=1
     exon            complement(1216062..1218822)
                     /number=2
     exon            complement(1218884..1219375)
                     /number=3
     exon            complement(1219465..1219649)
                     /number=4
     CDS             join(1219972..1220095,1220357..1221741)
                     /codon_start=1
                     /locus_tag="AO090012000487"
                     /note="putative u4/u6 small nuclear ribonucleoprotein"
                     /old_locus_tag="AO070343000486"
                     /protein_id="BAE60657.1"
                     /transl_table=1
                     /translation="MADLSGNMLKRPHPEDEDNNTQKRSRSNNGSPLPGQGAPASEDD
                     GSSKGRGGLDVGLHPALLSDTVEFRGAKGRQSTQSKNRRTESPVTSGRPDRAGLDLSG
                     PSLEEIRNNPYYDPSLGPKATIAKPRQSRQLIFNQKGKYIQQGAALRRQAQLEAMKKR
                     IAERARQAGIDEDLDIEKAFLVPAPPAIEWWDEGLVDGEDYSGIEDERNLKIDTPDTI
                     VTQYVQHPVLLDPPQDKHMPEQKPMYLTPKEQAKIRRQRRMADLKEQQAKIRLGLEPA
                     PPPKVKKSNLMRVLGEQAVKDPTAVEARVTREIAERRNKHEEANEERKLTKEERREKL
                     ARQQEKDAEKGILMSVYRIDSLANGRNRFKVSKNAEQNALTGVVVMHPKFNLVIVEGG
                     SHSINNYRKLMLNRIDWTENAGPNAVREGNREAQVAWLAAEDEQTGDLKDLSSNTCSL
                     LWEGQVKTRAFRKWLGARVCETDSQAKDVLARAKLENFWALGKSAKQSESWS"
     exon            1219972..1220095
                     /number=1
     exon            1220357..1221741
                     /number=2
     CDS             complement(1222069..1224216)
                     /codon_start=1
                     /locus_tag="AO090012000488"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070343000487"
                     /protein_id="BAE60658.1"
                     /transl_table=1
                     /translation="MALRKKKSSRIRFCLRSYLQLYHYYYYYYYYFPSRLWDTSFSRL
                     QRHIMSDRQPPVQPQHSLEDANEGPPVKRTCMNDTPPIALTPADDGSDFYNTPWVART
                     PAEPSENPGAAIQGQTNEPATTSHPSTLIPGLNLVNDSLKDLQPAQSDPSPSPNPGPQ
                     EGAHTDTQNGMDLEETEPKKQEPTVENIGNVEGEQNSEPRSQAEVPNQPQADDNMTNG
                     DASGTGTVPPPDAMEHDQAEQDEEEHPEWEIDFSPYESSSDDSSSDSSDDSDEDDEDY
                     PILSPEEQARILMQAELGSDDEGEGKGKSGGHIRTANEIPEEAPPIPDVTVTPEMKIV
                     HLGHVEAIVENTVLIAANTSGEYQVLESGSLLCFEDRSVAGVVAETLGRVENPLYTIR
                     FPTAAAVEERGLSKGKDVYYVEQHSTFVFTQPLKGMKGSDASNFHDEEIAEDEVEFSD
                     DEAEAEYKRKLKQKRQERKEARDGPAKAKKGPPGPSKLSQTELNYDDNAGEDGYTPLA
                     RPKNFHEMMGRQEAPVENDGPTGRGGFRGGRGRGRGFDRGRGGRGRGGGPRETQRQSY
                     QQQGSDAQPQSSNYSQHAYQQTQPNAYGMPQQYPAYPSFPQQQQQQQPQQQPQPQQQF
                     GQAAAPPGFNFQMPFQQAYPQQNPYQFPHNMQINPLFLAALQQQQQQQQYQQQQAPGQ
                     QPAQAATMNFDQVKAQLDLLRQLSNNNQGPPRS"
     exon            complement(1222069..1224216)
                     /number=1
     CDS             join(1224335..1224405,1224465..1225134,1225191..1225985,
                     1226040..1226300)
                     /codon_start=1
                     /locus_tag="AO090012000489"
                     /note="mannosyltransferase"
                     /old_locus_tag="AO070343000488"
                     /protein_id="BAE60659.1"
                     /transl_table=1
                     /translation="MASARKTIEVSSMPTGQAPRSKKRPPPPPYYIPLNITLYVFLIS
                     NAIAAFLAPVQDCDEVFNFWEPTHYLDHGYGLQTWEYSPVYSIRSWLYVTIHAIVGKV
                     ASLALVTKSSQFYAIRFFLALVCAACQTRLYAAICRTLSPKIGLFFLMIVAFSPGMFH
                     ASTAFLPSSFTMYMSMLGLTAFLDWRRQKIAQGIMWFGLGAIVGWPFAGALIVPLLLA
                     ELLVGVISGSLGTVVSGIFNGSIRCLAILAAEIAVDYAFLRKFAVVPWNIVAYNIFGG
                     EGKGPDIFGTEPWTFYIRNLLLNFNIWFIFAMSAAPLLLLQAIFRPQATKKEIPLRTL
                     AVIAPFYMWFAIFTAQPHKEERFMYPAYPFLALNAAIAIHIILTYVGSKDSKGSKGTL
                     LAQAKLTIVTAVVLAAINAGLLRTVGMITAYNAPLKVFEPLERLDIPQAGDSVCFGKE
                     WYRFPSSFFLPDGMRAKFIRSEFRGLLPGQFPDATDYPALFDGTSQIPEGMNDLNQED
                     PGKYVDISQCSFLVDSYFPSRDATELEPDYIHDESQWEVMSCKPFLDASQTGLIGRLI
                     WVPDLPGLPDQLQRKWGQYCLLRRRDVSAETD"
     exon            1224335..1224405
                     /number=1
     exon            1224465..1225134
                     /number=2
     exon            1225191..1225985
                     /number=3
     exon            1226040..1226300
                     /number=4
     CDS             join(1226772..1227079,1227142..1227187)
                     /codon_start=1
                     /locus_tag="AO090012000490"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000489"
                     /protein_id="BAE60660.1"
                     /transl_table=1
                     /translation="MIFTALPTTITQHHLSNVTAICLLATLTTYLLHSLWKKHHSSKS
                     PESDPEQKSLSPASKFKQPTRKPGEWTPSDFKRPPAAPYPDWDVHTTKPKPYRPFRYG
                     PEPTVNTSSQWACEA"
     exon            1226772..1227079
                     /number=1
     exon            1227142..1227187
                     /number=2
     CDS             join(1227298..1228150,1228254..1228279)
                     /codon_start=1
                     /locus_tag="AO090012000491"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000490"
                     /protein_id="BAE60661.1"
                     /transl_table=1
                     /translation="MDAAMELLEELYVAFLSIHPPLHIPPIHSSTQPIHDTNHPPPKN
                     QNHQLTPPTHRTTYLPERYPTLFRKTPTGITNLLTQETLTTVPPLSEDPMQTCGRLIQ
                     DDLALMLERPDGEYYLLAGSILLAGFWRLEDKYGMRLSEIHTSGSVPGYKEKLEKGML
                     NFFRRLRPEDPVLRNNYFIQVDESLPWSHSIGSEDGETVSWNTAEKNRAIEHHFFRSE
                     RQSLRRLPRSGAVVFTIRTYFEPITEVVKEPYVPGRLASAVRSWGEDVARYKGREKYG
                     EVLLEYLDRVWVSLCL"
     exon            1227298..1228150
                     /number=1
     exon            1228254..1228279
                     /number=2
     CDS             complement(1228581..1230224)
                     /codon_start=1
                     /locus_tag="AO090012000492"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000491"
                     /protein_id="BAE60662.1"
                     /transl_table=1
                     /translation="MASFEDLGQSRCGESRSDGKQWWRRVWYYPVFFPPGFGGLCLLW
                     GADGLTKRLVEHPNSTEGRTKERERHVAREKEWATGATDAVADNRAPIERFRKPPNKA
                     FSVTDLISPAWCELQYWYTLTKFGRKRRTPAMKQGSTIHKTLEDELYTTVPVEITTKE
                     DALALRIWNIIQGLRTLREYGITRELEVWGLVDGELVNGVIDQLSYECPDSELEATAA
                     SYYADVEASRAVLPEYQMSLSDYLLSPSQGGKRLTDLSWNGEQEDSLDDSGIGSQSSS
                     EAFSLPRIYMTDVKTRASASVPTVKSSSFRPTLLQLQMYYHMLNRLATSEDVSIELLA
                     SRYGLDPTRTFTDAFIAEVGGLNDQFFDTLSSQEFDRDFTPEDAAGRRTSYGADSAPP
                     GSQDSTSILLAHNNLTSLWKLMKDQLRLTFLPPAHSTPVSVAPSIPSEFQPGLLEPYP
                     TVLSPLLTARYLSSAPTTDTESRLLGSRSFLFDPTALTAYLSDQMEWWRGERNPRGVE
                     VMDAWKCRICEFRDECSWRQERELAFAKRRRRRSSSLAV"
     exon            complement(1228581..1230224)
                     /number=1
     CDS             complement(join(1230850..1231258,1231323..1231855))
                     /codon_start=1
                     /locus_tag="AO090012000493"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000492"
                     /protein_id="BAE60663.1"
                     /transl_table=1
                     /translation="MRHTLVTQLGKRPTLFSRSHLSSRIRPQGNRSTSSSPKSPEKNV
                     PSQNAQSKAAPPSSTQSSCSSATPRTVPASARSRSLRDVIVEGPLGKLGRSYSRIQER
                     RPYATQFWSSIVVYLCGDLSAQLLFPSDNKSVKDTARENSESEDNDAATSGGGYAPWR
                     TLRHLTVGAGSSIPSYNWFMFLHHHFNFASKFLSILTKVCVQQAVFTPVFNTYFFSVH
                     SLLSGATLEETWERLKKALPVSITNSAKLWPAVTAFSFMYVPAQFRNIFSGVIAVGWQ
                     TYLSWLNQKAAREVEANELAEAAASQIGIGASATLKA"
     exon            complement(1230850..1231258)
                     /number=1
     exon            complement(1231323..1231855)
                     /number=2
     CDS             complement(join(1232547..1233739,1233807..1234061,
                     1234110..1234470))
                     /codon_start=1
                     /locus_tag="AO090012000494"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070343000493"
                     /protein_id="BAE60664.1"
                     /transl_table=1
                     /translation="MSNEKGAPGESPMSRKIPYWRMVIDQGAVTQEVIDHPYPGSGTE
                     EDPYAVTWLPNDPRNPMQFANSTKWFITMLAAISTLAVALVSSAYTGGVAQIRQQFHV
                     GTEVSTLGVSLFVLGFAIGPLLWAPLSEMFGRQIIFFVTYLALTAFNCGSAGAQNIQT
                     LIILRFFAGSFGSSPLTNAGGVIADMFSAKERGVATSLFAAAPFLGPVLGPIIGGFLG
                     MNAGWRWVMGFLGAFSGFVWIVASLLTPETYAPVLLRRRAERLSKITGKVYRSKLDID
                     QGKVSLKQAFGTALSRPWILLFREPIVFLLSLYMAIVYGTLYMLFAAYPIVFQGVRGW
                     NQGVGSLPFLGIMIGMLAAVAYSIIDNKRYVKTDEKHGGFAPPEARLPPCMVASLAIP
                     IGLFWFAWTNYPSIHWMACVAAGAPFGFGMVLVFLSILTYLIDTYTIFAASVLAANSV
                     LRSIFGAVFPLFTTYMYSDLGIHWASTIPAFLALACVPFPFLFYIYGPKIRLRCKYAA
                     ESDAFMRKMAQQIKQQQGEPEDKELEPAYDRTEAPGVEVSDSSDDESGSHVGELPPVQ
                     QVRTKSSVRTAGSARQSIYDGNPYDIDRVHTRESFK"
     exon            complement(1232547..1233739)
                     /number=1
     exon            complement(1233807..1234061)
                     /number=2
     exon            complement(1234110..1234470)
                     /number=3
     CDS             complement(join(1238056..1238333,1238393..1238500,
                     1238614..1238638))
                     /codon_start=1
                     /locus_tag="AO090012000495"
                     /note="histones H3 and H4"
                     /old_locus_tag="AO070343000494"
                     /protein_id="BAE60665.1"
                     /transl_table=1
                     /translation="MARTKQTARKSTGGKAPRKQLASKAARKAAPSTGGVKKPHRYKP
                     GTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQESVEAYLV
                     SLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERS"
     exon            complement(1238056..1238333)
                     /number=1
     exon            complement(1238393..1238500)
                     /number=2
     exon            complement(1238614..1238638)
                     /number=3
     CDS             join(1239460..1239469,1239542..1239817,1239877..1239902)
                     /codon_start=1
                     /locus_tag="AO090012000496"
                     /note="histone H4"
                     /old_locus_tag="AO070343000495"
                     /protein_id="BAE60666.1"
                     /transl_table=1
                     /translation="MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGV
                     KRISAMIYEETRGVLKTFLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFG
                     G"
     exon            1239460..1239469
                     /number=1
     exon            1239542..1239817
                     /number=2
     exon            1239877..1239902
                     /number=3
     CDS             1252313..1254466
                     /codon_start=1
                     /locus_tag="AO090012000498"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000497"
                     /protein_id="BAE60667.1"
                     /transl_table=1
                     /translation="MSMYPSIRNKGFISEPTSTPFINFQDPVFIQDEFLPDLSQEAAL
                     QFYNQQLPRLQSPFQYHSGLEFYSPPSSAPSSPTSSPASSTTHLPATTAVAAEYPNSF
                     EAPSMTPVSSYNSAFNIQHTATPPSSQPYLSQYPQYLFENSPMLAQQPVANTHGWENN
                     LQLLSSARMQHKASPSTSSTRSAPAGSSYQRSNASTLSKPLPTPVQTPIQNSFLAAPY
                     QQNYDTSVHDGSQAEAEMVRRAVMEQQQKQQQQQSHHQHQPSDYSLAPSVSSVSHNSP
                     VTPQIKPEELDEASKAMVNGEKRYPDIDRWMDDYLHLDAFADYNNHNGNNLPIGIPKI
                     NRTMSDIYQDELYNPALMPTPQVSKQTTNQQNLLNPFRNVFADRLQAANQGHMTARSH
                     SPVVNMHRDRSPFRQNSPLAAEYNNGFQQPQMATSVPMTQNVGQSQGEGEPKTMSPKD
                     ALLDFNEGDDAGIPLFPTSQPDFNLGEALGLRRESSSSFPQSQNFTSMESFPTQYTTP
                     NGLPQQYPFAQQQQDHQQQQQNNLLHQTPEFPASLPHFESTNSDAGVNNGVASPPAQP
                     TMAMRPVKEEITRPERTSADSGTYTCTYHGCTLRFETPTKLQKHKREAHRQTTPGGHL
                     VGRDTSARNSQAGPHKCERINPSTGKPCNSVFSRPYDLTRHEDTIHNARKQKVRCHLC
                     TEEKTFSRNDALTRHMRVVHPEVDWPGKQRRRGRE"
     exon            1252313..1254466
                     /number=1
     CDS             complement(join(1260559..1261238,1261495..1261860,
                     1261912..1262109,1262260..1262335))
                     /codon_start=1
                     /locus_tag="AO090012000500"
                     /note="predicted protein"
                     /old_locus_tag="AO070343000499"
                     /protein_id="BAE60668.1"
                     /transl_table=1
                     /translation="MLSLLRSSKRIQRTQQIAQISLLCRDTLCDVAASAGGDSSRIVT
                     IEKLEGGFSKALLMKKGNGKEVIAKLPCRIAGPTSLTTACEVGVLEYVRKYTSIPAPR
                     VFSWSSDDSNPVGAEYIIMEKVAGVPLFEQWGKMAEIEKLELIKNLTKLEAQLAAIRF
                     PAYGGLYRQADVSSLQCQELNGSICIGPSCGRSFSTDSAAVLSTQSEKLDYGPLTFIW
                     AIFLLRLARTQKIVSLIDFQSLSVLPLFLQAQWPVFLKPPQNYTKGLVQPKLPGDFDE
                     LDEEGKAAALQEWSQSKLAKAYEVATVLENGVAHNAMNIPRVFRELFIRCGEVSEVGV
                     VPLRECLIEIFRNWSSLGFTGQCPYSFSNEEITTHEHQFAEYQAWDEVQQLAQECLDT
                     DAEGWIAPQLDIEEKRRQNRELLSLYIKRMAGEKSPDEARAMWPFPG"
     exon            complement(1260559..1261238)
                     /number=1
     exon            complement(1261495..1261860)
                     /number=2
     exon            complement(1261912..1262109)
                     /number=3
     exon            complement(1262260..1262335)
                     /number=4
     CDS             complement(1268402..1273189)
                     /codon_start=1
                     /locus_tag="AO090012000502"
                     /note="pentafunctional AROM protein"
                     /old_locus_tag="AO070343000501"
                     /protein_id="BAE60669.1"
                     /transl_table=1
                     /translation="MAEPTKIKILGQESIIADFGLWRNYVAKDLISGCPSTTYVLITD
                     TNIGSIYTPGFQKTFEDAATAVSPAPRLLVYHCPPGEVSKSRQTKADIEDWMLSQSPP
                     CGRDTVVIALGGGVIGDLTGFVASTYMRGVRYVQVPTTLLAMVDSSIGGKTAIDTPLG
                     KNLIGAIWQPTRIYIDLEFLETLPVREFVNGMAEVIKTAAISSEEEFTALEDNAEAIL
                     TAVRSERKPGQRWFEGIEDILKARILASARHKAYVVSADEREGGLRNLLNWGHSIGHA
                     IEAILTPQVLHGECVAIGMVKEAELARHLGILKGVAVARIVKCIAAYGLPTSLKDSRI
                     RKLTAGKHCSVDQLLFNMALDKKNDGPKKKIVLLSAIGRTYEPKASVVPNEDIGVVLA
                     PSIEVHPGVEPASNIICIPPGSKSISNRALVLAALGSGTCRVKNLLHSDDTEVMLNAL
                     ERLGAATFSWEEEGEVLVVNGKGGNLQASPSELYLGNAGTASRFLTTVATLANASSVD
                     SSILTGNNRMKQRPIGDLVDALTANGASVEYVERKGSLPLKVAASGGFAGGRINLAAK
                     VSSQYVSSLLMCAPYAKEPVTLKLVGGKPISQPYIDMTTAMMRSFGIDVQKSTTEEHT
                     YHIPQGRYVNPAEYVIESDASSATYPLAIAAITGTTCTVPNIGSKSLQGDARFAVEVL
                     GPMGCTVKQTDTSTTVVGPSDGILRPLPNVDMEPMTDAFLTASVLAAVARGDGASHTT
                     RIYGIANQRVKECNRIKAMKDELAKFGVVCREHDDGLEIDGIDRSTLRQPAGGVYCYD
                     DHRVAFSFSVLSLVAPQPTLILEKECVGKTWPGWWDTLRQKFSAKLEGKELKEEESSP
                     LAGAGRATASVFIIGMRGAGKTTTGRWVAKTLNRPFVDLDTELENVEGQTIPDIVKQR
                     GWQGFRDAELSLLQRTLKERSSGYVLACGGGIVEIPEARKLLIDYHKNKGNVMLIMRD
                     IKQVMDFLNIDKTRPAYVEDMMGVWLRRKPWFQECSNIQYYSQHATGKLAKASEDFTR
                     FFNVVTGEADSLSIIKRKKHSFFVSLTLPDLRTAGDILEKVCVGSDAVELRVDLLKDP
                     ASDSDIPSVDYVAEQMAFLRSYVSLPLIFTIRTKSQGGRFPDDAHDAAMELYRLAFRS
                     GSEFVDLEIAFPDEMLRAVTEMKGYSKIIASHHDPKGELSWANMSWMKYYNRALEYGD
                     IIKLVGVAKNLDDNTALRKFKSWAEEAHETPLIAINMGDNGQLSRILNGFMTPVSHPS
                     LPFKAAPGQLSATEIRKGLSLMGEIKQKKFAVFGTPVSGSRSPVLHNTLFSQAGLPHE
                     YGRLETANVEDVKDFIRSPDFGGASVTIPLKLDIMPLLDHITPEAEIIGAVNTIIPVA
                     DGDKPARLVGSNTDWQGMTLSLHNAGVETANKDASALVIGGGGTARAAIYALHSMGFS
                     PIYVIGRSAPKLQSMVSTFPSSYNIQVIDSPETLKTIPTVAIGTIPADKPIDPVMRET
                     LCHMFERAQEADADVVKTGEKAHRVLLEMAYKPSVTALMQLASDSNWHTIPGLEVLVG
                     QGWYQVSSKPYTYSIQYQKLTRYIVQTLDWDFSPLRGCKSRRA"
     exon            complement(1268402..1273189)
                     /number=1
     CDS             complement(join(1273986..1274604,1274666..1276449,
                     1276506..1276631,1276680..1276951,1277006..1277312))
                     /codon_start=1
                     /locus_tag="AO090012000503"
                     /note="5'-3' exonuclease HKE1/RAT1"
                     /old_locus_tag="AO070343000502"
                     /protein_id="BAE60670.1"
                     /transl_table=1
                     /translation="MGVPALFRWLSNKYPKIISPVIEEQPYEVNGEQIPVDTTRPNPN
                     GEELDNLYLDMNGIVHPCTHPEGKPPPANEQEMMLEIFNYTDRVVNMVRPRKLLMIAV
                     DGVAPRAKMNQQRARRFRSAQEAKEADEKKEEFRKQFLKKSKGDQEIHEEVIQKTWDS
                     NVITPGTPFMDILAASLRYWIAYKLNTDPAWEKLKIIISDATVPGEGEHKIMEFVRSQ
                     RAAPEHDPNTRHVIYGLDADLIMLGLATHEPHFRVLREDVFFQESKARTCHLCGQAGH
                     KAEECRGQAKEKNGQFDEKGKGTSLKPFIWLNVSILREYLAVELYVPHQPFPFDLERA
                     LDDWVFMCFFVGNDFLPHLPSLDIRENGIDTLIAIWRDNIPVMGGYLTKDGHVEFKKA
                     QLILQGLAKQEDAIFRRRRQVEEKKLANEKRRKEEAQARDRARKRRRSSPNYEPSEPP
                     ASNRARGGGGDSAPPNDVELIIPGRGELSRENRELTHSMVVNRGAVYRANMANKSAAA
                     ILKSKLMKGSQEGDDTAESTPMPDADGASDSKIEPTSPSVLGKRKAEEPEGETDTPAD
                     NTDSTPKPSKDDEMPPDTVRLWEEGYADRYYEQKFGVDPQDKEFRHKVARAYAEGLAW
                     VLLYYFQGCPSWNWYYPYHYAPFAADFVDIGDMELSFEKGTPFKPFEQLMGVLPASSN
                     HAIPEVFHDLMQDPESEIIDFYPEDFAVDLNGKKFAWQGVILLPFIDEKRLLAAMEKK
                     YPLLSDDERHRNTVGREVLLLSDGHPLYQDLVANFYSKKQGAPKYTLNMRVSEGLAGR
                     VERNETYIPHSSLVSSLEEYGMPTLEDDRSLTVNYEIPKSNHIHKSMLLRGVKFPPPA
                     LDNADIQATRSKAQHSGRSFGGAPFRGGHGNRGGRINYASDRPNPFAAHLDPNFMPPS
                     NAGAQGMPSGWAPPVPGSANFSRGPPPPPRGNHRNHYGSGHAQQQGYQQTNYGRNDYY
                     GRGQQGHQHQGSYGNQSGQYSGRQSGYGGAEYRGGGYQRGGYQGQGQGRDYYNSRNQG
                     GYGRY"
     exon            complement(1273986..1274604)
                     /number=1
     exon            complement(1274666..1276449)
                     /number=2
     exon            complement(1276506..1276631)
                     /number=3
     exon            complement(1276680..1276951)
                     /number=4
     exon            complement(1277006..1277312)
                     /number=5
     CDS             join(1277877..1278152,1278210..1278260,1278312..1278507,
                     1278585..1279048,1279105..1280953,1281434..1281681,
                     1281738..1281824)
                     /codon_start=1
                     /locus_tag="AO090012000504"
                     /note="ER-Golgi vesicle-tethering protein p115"
                     /old_locus_tag="AO070343000503"
                     /protein_id="BAE60671.1"
                     /transl_table=1
                     /translation="MFRILESQAPAKQTATDTINTLSSRLQSATLLEDRRAAIQGLRS
                     FAKIYPASVASGALRPLIGCLRNDQEDVDTVKVVLEALLMLFSPDESSPEASDEIALW
                     LSDEFTQRQDNITALLDLLDTRDFYSRLYSLQLIFQISSARPERTQECILTAPLGIPR
                     LVSALGDAREPVRNEALLLLIALTPSSEELQKLVAFENAFDLLFTLIEKEGSLSHGSE
                     VIEDCLSLLANLLRLNISNQSYFRETGCVKRLAKLLADVNHEQESDEPTPQWTLAQRD
                     KNIWGLLVIIQLFLVRGGINTPANQMAFWHSGVMEQVLSTAFSQRFSVNVTSKALATC
                     ADLIRGNQPLQERFGDVEVFWGAQPAEGASNGELANQGLQPINVIEALLKLSLEPATL
                     QLLDARLAACECVKAFFANHAGIRVHVLRRAIDGHLSGQDEIPNILTALLLPPESRGN
                     ADPYQTWMASVLMFHLLFENAEAKAIAMEVTEGDAESGEEVITCIQSIVGNLLTGMQR
                     GDDERISVGYLMLLCGWLFEEPDAVNDFLGEGSSIQSLLQEIKHRYVSNVLVSGLCTI
                     LLGVIYEFSSKDSPIPRKTLHQLLTEQMGREQYIDKITRFRESPMVRDFEVLPQTVGG
                     QYEGGLPEIFFDKTFVDFLKDNFGRMIRAIDREPGLEISVITNGIERGVSRELVDSLK
                     AELEERSQAVQKLESDLVALHNRLEQEQLEYRKARETSAMEITRIQQINESLQRHHAQ
                     ELAALEEQHQHAKNELVKQYGEQLRTIDYQLKETSVEYEKKSYKARQHHEAEVADLQK
                     KIRSLEAELGRAQEQHTGEAANLKATIQALRSSADKANENHAAEVSNLHNTVQKLDFE
                     ASQSQRQHAAEVSNLNQTIHSLQSEVEALKQQNESNSAEHKITNERLQKELDTAKEKA
                     TQDIQAVHDDYTSKCAALEKRAEEAEQKTGQKLQRELEKVKLEAKDQAEEARKAKENE
                     SVAQKSTQEIDELRKELEKLKSEVKEKEEARKSAQSELEDLLIVFGDLEAKRNEDKKR
                     LKDLGQEVSEAEDDDDDDEEDEDDEE"
     exon            1277877..1278152
                     /number=1
     exon            1278210..1278260
                     /number=2
     exon            1278312..1278507
                     /number=3
     exon            1278585..1279048
                     /number=4
     exon            1279105..1280953
                     /number=5
     exon            1281434..1281681
                     /number=6
     exon            1281738..1281824
                     /number=7
     CDS             join(1282170..1282658,1282721..1285525)
                     /codon_start=1
                     /locus_tag="AO090012000505"
                     /note="Isoleucyl-tRNA synthetase"
                     /old_locus_tag="AO070343000504"
                     /protein_id="BAE60672.1"
                     /transl_table=1
                     /translation="MSIDFPKEEELTLKRWREIDAFQRQVELSRGRKPYTFYDGPPFA
                     TGLPHYGHLLASTIKDIIPRYWSMKGHYVERRFGWDTHGVPIEYEIDKKLGMSGLEAV
                     EKLGIEKYNEECRAIVMRYASEWRETIERLGRWIDFDNDYKVESQPMSYFYFCKERGK
                     RPLTMNTSFMESVWWVFKQLFDKDLVYRGYRVMPYSTALNTPLSNFEAQQNYKDVQDP
                     AVVVSFPLVEDPETCLLAWTTTPWTLPMNTGLAVNPTFEYIKILDEASGKHYILLESL
                     LRTLYKDPKKAKFKIVDRFKGSAMKDWKYTPLFDYFYEEFKDHGFRVLNAEYVTADDG