LOCUS       AP007160               18226 bp    DNA     linear   PLN 16-DEC-2016
DEFINITION  Aspergillus oryzae RIB40 DNA, 47Q_0173.
ACCESSION   AP007160
VERSION     AP007160.1
DBLINK      BioProject:PRJNA20809
            BioSample:SAMD00067075
KEYWORDS    .
SOURCE      Aspergillus oryzae RIB40
  ORGANISM  Aspergillus oryzae RIB40
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Eurotiomycetes; Eurotiomycetidae; Eurotiales; Aspergillaceae;
            Aspergillus.
REFERENCE   1  (bases 1 to 18226)
  AUTHORS   Sawano,T., Tanaka,T., Machida,M. and Yamada,O.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-JUN-2004) to the DDBJ/EMBL/GenBank databases.
            Contact:Toshihiko Sawano
            National Institute of Technology and Evaluation, Genome Analysis
            Center, Department Of Biotechnology; 2-49-10 Nishihara,
            Shibuya-ku, Tokyo 151-0066, Japan
REFERENCE   2
  AUTHORS   Machida,M., Asai,K., Sano,M., Tanaka,T., Kumagai,T., Terai,G.,
            Kusumoto,K., Arima,T., Akita,O., Kashiwagi,Y., Abe,K., Gomi,K.,
            Horiuchi,H., Kitamoto,K., Kobayashi,T., Takeuchi,M., Denning,D.W.,
            Galagan,J.E., Nierman,W.C., Yu,J., Archer,D.B., Bennett,J.W.,
            Bhatnagar,D., Cleveland,T.E., Fedorova,N.D., Gotoh,O.,
            Horikawa,H., Hosoyama,A., Ichinomiya,M., Igarashi,R., Iwashita,K.,
            Juvvadi,P.R., Kato,M., Kato,Y., Kin,T., Kokubun,A., Maeda,H.,
            Maeyama,N., Maruyama,J., Nagasaki,H., Nakajima,T., Oda,K.,
            Okada,K., Paulsen,I., Sakamoto,K., Sawano,T., Takahashi,M.,
            Takase,K., Terabayashi,Y., Wortman,J., Yamada,O., Yamagata,Y.,
            Anazawa,H., Hata,Y., Koide,Y., Komori,T., Koyama,Y., Minetoki,T.,
            Suharnan,S., Tanaka,A., Isono,K., Kuhara,S., Ogasawara,N. and
            Kikuchi,H.
  TITLE     Genome sequencing and analysis of Aspergillus oryzae
  JOURNAL   Nature 438, 1157-1161 (2005)
COMMENT     URL:http://www.bio.nite.go.jp/dogan/Top
FEATURES             Location/Qualifiers
     source          1..18226
                     /db_xref="taxon:510516"
                     /mol_type="genomic DNA"
                     /note="47Q_0173"
                     /note="phrap>=30:59-18169"
                     /organism="Aspergillus oryzae RIB40"
                     /strain="RIB 40"
     CDS             complement(join(2540..4596,4648..4876,4926..5309,
                     5361..5557,5616..5619))
                     /codon_start=1
                     /locus_tag="AO090673000002"
                     /note="vesicle coat complex AP-3, delta subunit"
                     /old_locus_tag="AO070190000007"
                     /protein_id="BAE60243.1"
                     /transl_table=1
                     /translation="MDKKATALLKLIYLEMFGYDMSWASFHVLEVMSSTKYLQKRAGY
                     LAAVQSFRPDTEVLMLATNLLKKDLVSPSIPNMSLPLITLPNIITPSLAMSLLPDVLS
                     RISHSHAMARKKAVVCLYRLALVYPEALKLAWPKIKDRLMDDGEDSSVTTAVINVVCE
                     LGWRRPHDFLPLAPRFFELLVDGGNNWMAIKIIKLFATLTPIEPRLTRKLIRPLINII
                     QTTTAMSLLYECINGIVQGGILDGEEVLEEKNEIASLCLGKLRGMVVTESDPNLKYVA
                     LLAFNRIVMSHPVLVSAHQDVIMDCLEDPDISIRLRALDLVTRMVTSDTLQSVVNRLV
                     DQLFNARQVTKSTLAAGSCETGIRTDMGEFTLSEGPHAQKLPIALPDDYSIEVVHRIL
                     DVCSYNNYSELPDFEWYVDVLVQLVKLLPPSIEELPTHYTSYRDPEHYKNCVAFRIGS
                     EIRNIAVRVRDVRMEATRAAETLILVDNKQGPSPLVSKQTSDILGPLAWVTGEFAEHL
                     AYPSQTLQSLIDMSNVSLSASTLSLYIQAIPKVLANLICDGDETWDSLKNSEMSLLLA
                     RIIEFLDVLAAHPDLDVQERAIEFLEVMRLAADAVQSETLEVGQAPSLLSSMVPSFFH
                     GLELNPVATNAQKKVPLPDQLCLTQEFNKHIYGLFNNPANGLPEPAGQLPSQMFYHVR
                     EVSVLDKQPVEFLPVDLQLNPTYQDLSSGFGDDTAALKRREERKERNRDDPFYIAAED
                     ESSCTLTPFHQTLNMSNSSGLDIDSIPIVDLNLNGAGSHRTLASLSRDNRQGGSRPKK
                     YEIAPDEIIGQEDSPHLDSNDEPGKAKRSLLQVDSSGLEHLSLDGRGGSSGDPTVPTV
                     VGGHDVEMAMAVQKVEKLRLEMQRASERVHPNGIPAEGTLVRKKRKSKKPTRIGSQEA
                     ALLKAEDEMSVDNTQQMPVSSVAPKKKKRAKKQINAGSSSAL"
     exon            complement(2540..4596)
                     /number=1
     exon            complement(4648..4876)
                     /number=2
     exon            complement(4926..5309)
                     /number=3
     exon            complement(5361..5557)
                     /number=4
     exon            complement(5616..5619)
                     /number=5
     CDS             join(6260..6640,6691..6897,6950..7102,7228..7458)
                     /codon_start=1
                     /locus_tag="AO090673000003"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070190000006"
                     /protein_id="BAE60244.1"
                     /transl_table=1
                     /translation="MAHATPDFHAIHSSSPITTLRFSQQAPVILERQLHSEKNLISAL
                     IGKQEEPEKYGIIEQLFFSCLQTGDDRSALLCLEQLTRRFGSSNEKVMGLRGLYEEAI
                     CENQSDLEDSLRKYDSYLLENPLNLPILKRRIALLRSLARPADAITGLVELLKAVPTD
                     AEAWCELADLYQSQGLSSQAIFSLEEALLIAPNAWNIHARLGEVLYICARAAETEVTS
                     RYLRRSIQYFCRSVELCDDYLRGFYGLILATSLQLGREYTMDFSQASASASSEDFLPK
                     EKVEKLNLLARRKLEDIVKQRSVNRQLWEHAQGELIAAKELLDRESC"
     exon            6260..6640
                     /number=1
     exon            6691..6897
                     /number=2
     exon            6950..7102
                     /number=3
     exon            7228..7458
                     /number=4
     CDS             join(8777..8790,9006..9245,9286..9544)
                     /codon_start=1
                     /locus_tag="AO090673000004"
                     /note="predicted protein"
                     /old_locus_tag="AO070190000005"
                     /protein_id="BAE60245.1"
                     /transl_table=1
                     /translation="MGGILFNIRIGPSPHGSDHSSLSDEEDSSGVQVSPPSDSGSHDY
                     QDPYDEWAHLPYPDELKPSDSASRPRTSHRARSRHPVHGSSNGNISLVVLGASLPPSL
                     QRAWTRGTSMTVLMVEYLMRRESGRLWPKVQGMLAAPLQYPRMFTPMVVHRMQLMHTK
                     AVTSLLQISL"
     exon            8777..8790
                     /number=1
     exon            9006..9245
                     /number=2
     exon            9286..9544
                     /number=3
     CDS             join(10636..10801,10914..10982,11144..11382)
                     /codon_start=1
                     /locus_tag="AO090673000006"
                     /note="predicted protein"
                     /old_locus_tag="AO070190000003"
                     /protein_id="BAE60246.1"
                     /transl_table=1
                     /translation="MHMWPIPEKPKTPEPAPPPDPPVPEAAAAPEALPAPEDVAVAVP
                     AEEPKKKSDSTGAKKPRTRAPDPGAFAMWMAGGNRLKLRSRWEVNAEHVNGFCMFCDI
                     FRFLRQPGANARSLNLIYLSFSGGAWLFLSHSRDWFLMPQGGIARPNPFTFCFCF"
     exon            10636..10801
                     /number=1
     exon            10914..10982
                     /number=2
     exon            11144..11382
                     /number=3
     CDS             complement(join(11772..12430,12510..12841,12893..13002,
                     13056..13355,13407..15048,15109..15313,15364..15691))
                     /codon_start=1
                     /locus_tag="AO090673000007"
                     /note="inositol-1,4,5-triphosphate 5-phosphatase
                     (synaptojanin), INP51/INP52/INP53 family"
                     /old_locus_tag="AO070190000002"
                     /protein_id="BAE60247.1"
                     /transl_table=1
                     /translation="MSNLRVFSRDNPQRTLTITTNDFALIFKHRSTAPTINKSPSNGT
                     PRCLVEFATLQSVDLRGYRALGDGLGTLGLITLGEEVFLCIVTACSDAAAVRPGETIS
                     KIDNVDFFCLSHSDYESRLEYESESSFATEEFGRGPSFENKEMVTDHPFLALKKLLSD
                     GSFYYSLDFNLTDRLQDRSEKSAAFDIDTLDEDMLWNSYMIHPLLLFRSHLSPAEKQR
                     LDSSQILTCVIRGFSGTLTIPASISILPQLRTSYPSTLTIISRQSSRRAGTRFNSRGI
                     DDDGHVANFVETETILWIPPNTTFSYVQVRGSVPIFWEQATGFLPGQQKIEITRSSEA
                     TQHAFNKHFENLELEYGAIHVVNLLSKLKSGESELSTEFSNQLRKSPLSQKADSNISS
                     NHALLRATEFDFHVETRGPLGYGASSQIKPEISDSLDGFAYFLSEGSVSATSDENQDE
                     PRSSFVILQQEGVFRTNCLDCLDRTNLVQTIISSMALESFMLQRKGRLNPEVQLKHST
                     LWADNGDALSKIYAGTGALKSSFTRHGKMSIAGALADARKTATRLYVNNFSDKARQKT
                     IDLLLGRLTDQLPVRLYDPINDLVSDELNNRALEYSSTKPIRIWTGTFNVNGRHRGPD
                     VDLAPWLWAGIDEQTEDPTIFAVGFQEIVSLSPQQIMSTDPTTRKVWEVAVGNCLNSR
                     ARSRGTSKYVLLRSGQLVGAALMVYVREDALRDVKNVEGSVKKTGLSGMAGNKGGCAI
                     RFEYSNTRICFVTAHLAAGFANYDERNRDYETIYHGLRFQKNRAIEDHEAIIWLGDFN
                     YRIGLDSHFVRELVAQKDYQKLYNNDQLNLQMLAGRAFPFYTEGLITFPPTYKYDIDS
                     DTYDTSEKARIPAWCDRILWRGSCLRQIDYNTAKLRFSDHRPVWATFSCVINVVDEAM
                     KAKLRRILYTERRNDPYNILSKTIEQARAQSEEHIPPTPIAPGLPPASSDHHRWWLEN
                     GALVKSALRPPGDGYNLNIHHSSNPFSSSSDASWINTHRSFKRQTITKNQDTVSQGPQ
                     LPPRLKVQIPPIDRGTGSHSSSSLNTINRYSGQLGNEKAAPPIPRKPVSLSSKQCLTA
                     SCQVTSSPQTVANTEPIFKGYNPIGQNLGGKVNNSTPSAPTERLPDTGMSNGFWIGGQ
                     EEHRQGKSLQTNSSIRSPPRSTDEVHDLLGGTGDEIIEWKPLIPQ"
     exon            complement(11772..12430)
                     /number=1
     exon            complement(12510..12841)
                     /number=2
     exon            complement(12893..13002)
                     /number=3
     exon            complement(13056..13355)
                     /number=4
     exon            complement(13407..15048)
                     /number=5
     exon            complement(15109..15313)
                     /number=6
     exon            complement(15364..15691)
                     /number=7
     CDS             join(16018..16040,16106..16982,17032..17052)
                     /codon_start=1
                     /locus_tag="AO090673000008"
                     /note="telomerase elongation inhibitor/RNA maturation
                     protein PINX1"
                     /old_locus_tag="AO070190000001"
                     /protein_id="BAE60248.1"
                     /transl_table=1
                     /translation="MGLAAPRKRTKISHDPNNTNWSRSTSGYGHKIMSSQGWTPGSFL
                     GARNAAHADMFTAASASHIRVVVKDDTLGLGARSKRDPLDEPTGLDAFKGLLGRLNGK
                     SDADLEAEQKKHEDAKIARYAATKWHTVTFISGGLLAQEKLVSLSAQKESPGAQHGSH
                     QNRGGLDMQKSEEDANTSIKDNTLKALREEQVSSVPIAEDTSRSKSKRHRKDEQGKKD
                     KKERKTKKRKHMDEPSPIDSDIPERAILETDLQATVTDSRDTTPPVAKVLSKERRPMG
                     RHLLRGRHIAQKKKALMDDRSLNEIFMVKS"
     exon            16018..16040
                     /number=1
     exon            16106..16982
                     /number=2
     exon            17032..17052
                     /number=3
BASE COUNT         5073 a         3997 c         3904 g         5252 t
ORIGIN      
        1 tatagattct ataataaata atttatttag aattaatata aaatttagat tattaaatct
       61 taatttaata aaaataataa taataatata ttaaaattat taaaaatttt taaatattat
      121 tttttttata gtactaaaaa ttaaaatctt taaatacaaa aattttaaat tatttaatta
      181 aattaaattt taattttatt ttaaatatta gatatctaat ttaaaaaata gatatttaaa
      241 taattaatta atataaaata aattttattt aaaattttat attaaaatct aatttatata
      301 aaaaaaaatt taaataaact ataatatata aattatatat attattttta tttaaaataa
      361 attttaaaat aaattttaaa atttaaatta aaaatttcta taactctaga tttaaaaatt
      421 ttatttaaat aataataaaa atctagttaa tttctatata ttttataaaa atttaagaat
      481 taaaataatt attaatttta taaaataatt taaataaagt ttttatttaa aaaaagctaa
      541 agctttaatt aatttaaaaa tttatttatt attaattaat ttcaatattt tagttttttt
      601 ataatttaaa atagttgatt taataatata tattattaaa ttaactattt attaaattta
      661 tttaataaaa attattatat aaaattttaa aaaatagttt taagtataaa aacctcaatt
      721 aaatatataa atattttttt ttatattttt ttattatata actaatatat tagattatat
      781 tattactata atatatataa ttttattata gtagttaata ttagtatcta tagctttttt
      841 taaataatta ctaaataaat aatttattaa gtatcttcta tttagaaatt aattattatt
      901 attctattat tattctatct tatatatcca tctttaataa gatgtgctag ataaggatct
      961 ataacaatat actctcagtg tattagacac aatattcctt ttggatgttc tagcagccga
     1021 taagcggccg ctttatcgct tttcctacag cttaatggca gaatacgtaa ctacaacact
     1081 gggaatgaca ttgagccgac ccctttgggt cggcggtgag acgtgtaggg cggtctcaag
     1141 cacctaaagt gcaactacgt tgcatgacat gcagcacata caaagactcc agtgacttta
     1201 ctccattaac cacccctttc acctagtttg cgtgaccccg aaactagctg aagggggcgg
     1261 ttagaggttc ttaattactt acccttaaca ttgatacact atatctggct agggtgacag
     1321 ccctgactgc ttctactggg gcaagactat tcattgtaaa tataattgta catgtaggat
     1381 gatagaagag atttaggttg gctggtgtca tccccccagc cctcgtccaa tacgtcattt
     1441 cttgccatcg tctaccatgt gcactaacag ggcagcagca accccaggac aggagacagt
     1501 tccaatgggt tggcgtagaa agggccattt ccggggtaaa tgctgcaagt caaggcaagt
     1561 gtatgaaatt atcctttaat tgtcaagtgg gacttggcag atacctatta ctttattcca
     1621 accatgctaa agcaacgtgg cctctcatcc cagcctattc ctcctgatta ccttcaagac
     1681 taaccccaaa ctaaccgtcg acgcaatttt ggcctgagat gattgattga tatcaaccac
     1741 cctttctttg ccacagtaca atctcggccc ccactgtcac ccttaaacag tacctggact
     1801 tcctgaaaag tagaacataa ggaaagcaaa atggtaagct ctaacctcgc acttaccttg
     1861 cggcttatag ttgctgaagt agctacctca ggcacagacg ccacaacaac ggaaagcgaa
     1921 tgaaaagtac gcgaagagtg aagctgcaaa gcgtggcaaa ggaaagactg caacaaaaca
     1981 aaaacagaac ttgaagtctc cggtgtcgac cgggtgggtt ggtatgtctc gaaagtccag
     2041 aattatcacg gttcccgagg ctaatgaggc cccgacagtt gttcttgcct ttgcggtctg
     2101 cggtgggctt gcatttgagg ctctgaggat tgttccggag ttatggtcgg cagctgttgc
     2161 gatgttcaat cgcaagttgg cataaatcta gactaaattt ccgctaatcg aatacagtgg
     2221 ttttgaatat tgtatttatt taatatagga cactctgaac tcccagtcct cagtagatca
     2281 attcaccgta cgtgattcat atattgcatc ggacaaatcg tgtcatcgtc ggaatctagc
     2341 agcgacaacc acttgcaagg tgagaccact actttctggt caagggcgta cagaggagct
     2401 tgggaacact ttcatggcct caataatggt taacccactg tgacaagcgg atggatatcc
     2461 tagctaatac caccggcact cccaaccacc aatctcctga tacataactc catgacaccc
     2521 acaaagaagt ggatatacct tagagtgcgc tacttgagcc agcattgatt tgttttttcg
     2581 ctctcttctt tttctttggt gccacagatg aaactggcat ctgttgagtg ttgtccaccg
     2641 acatttcatc ttcagctttt agcagtgcag cttcctgaga tccaatacgt gtaggctttt
     2701 ttgattttct ttttttcctt accagcgtcc cttctgcagg gatgccattc ggatgaacac
     2761 gttctgaagc tctttgcatc tctagccgca gcttttccac tttctgcaca gccatagcca
     2821 tctctacatc atgcccgccg accaccgtag ggactgtagg atctcccgag gaaccacctc
     2881 taccatctaa ggatagatgc tctagtccac tcgagtcgac ctgtagaaga gaccgtttgg
     2941 ctttacccgg ttcatcattt gagtcaagat gcggtgaatc ttcctgtccg ataatctcat
     3001 caggtgcgat ctcgtacttt ttagggcgtg agccaccttg tcggttatcg cgcgacagag
     3061 atgccaaagt gcgatgactc ccggcgccat tcaaattgag gtcaactata ggaatagagt
     3121 caatatccag tccgctacta tttgacatat tgagagtctg gtgaaatggg gtcaatgtgc
     3181 aggaggattc atcttcagca gcaatataaa acggatcatc cctgttacgt tctttccgtt
     3241 cctctctccg ctttaaagcg gcagtgtcat ctccaaagcc actggagagg tcctggtatg
     3301 ttggatttaa ttgcaaatcc acgggtagga attcaacagg ctgcttatct agcacagaaa
     3361 cttccctaac gtgataaaac atctgagatg gtagttggcc ggctggctcc ggaagcccat
     3421 tggctgggtt attaaaaagc ccatatatat gcttgttgaa ctcttgtgtt agacaaagtt
     3481 gatctggcaa aggaaccttc ttttgggcgt tggtagcgac tggattgagt tctagtccat
     3541 ggaaaaagct gggaaccata gacgacagca aggatggagc ctggcctact tctagagttt
     3601 ctgactgaac ggcatctgct gctaagcgca tgacctccag aaattcgatt gccctttctt
     3661 gcacgtccaa gtctgggtgg gcagccaaaa catcaaggaa ttcgatgatt cgagctaaaa
     3721 gaagggacat ttcactgttc tttaacgagt cccaggtttc gtccccatca caaatgagat
     3781 tggccaagac tttgggaata gcctgtatat aaagggacag cgtgctcgct gataacgaca
     3841 cgttcgacat atcgattagt gattgaaggg tttggctggg atatgcaaga tgctctgcaa
     3901 attcaccagt gacccaagcg agaggcccta agatgtcact cgtttgtttg gagacaaggg
     3961 gagacgggcc ctgcttgttg tcaactagaa tcagagtctc tgcagctctg gttgcctcca
     4021 tcctaacgtc cctaacacgg acagcgatat tgcgtatttc tgacccgata cggaaagcaa
     4081 cacaattttt gtagtgctcg gggtcccgat atgaagtgta gtgggtagga agctcttcaa
     4141 tacttggagg aagcagcttg actaactgga ccagaacgtc aacataccac tcgaagtcag
     4201 gcagctccga ataattgttg taagagcaga catctaagat tcggtgtaca acttcaatac
     4261 tataatcgtc tggcaaggcg atcggtaact tctgagcatg tggaccttct gataatgtga
     4321 attctcccat gtcagtgcgt atacctgtct cacaactccc ggccgcaaga gtacttttgg
     4381 tgacttgacg ggcattgaaa agttgatcga caagtcgatt caccactgac tggagtgtat
     4441 cgcttgttac cattcgagtc acgaggtcaa gggctcgcag tcggattgaa atgtccggat
     4501 cctctaaaca atccatgatg acatcctgat gagctgacac caagacgggg tgagacatca
     4561 caattctgtt gaaggcaagg agagcaacat attttactac agacttatgt taggctcacg
     4621 actacgcttc gatctgaaag gacttacgat tgggatcgga ctctgtgact accatgcctc
     4681 tgagctttcc gagacagaga cttgcaatct cgttcttttc ctccagcact tcctcaccat
     4741 caaggatacc gccctgaact atgccgttga tacattcata gagcaatgac atggcagttg
     4801 ttgtctgaat tatgttgatc aatggccgga taagctttcg tgttaatcgt ggttctatgg
     4861 gtgtcaatgt tgcaaactag atctgttagg aagatatcac agatccagaa agaaaggaaa
     4921 catacaagct ttataatttt tatagccatc caattgttcc ctccatccac taatagttcg
     4981 aagaatcttg gcgccagagg caggaagtca tgtggccttc tccatccgag ttcacataca
     5041 acattgatca ctgctgtggt gacgctgcta tcctctccat catccatgag acggtccttg
     5101 attttaggcc atgccaattt tagcgcttcg gggtaaacca gcgcaagtct ataaagacac
     5161 accacagcct tcttacgagc catagcatgt gagtgagaaa tgcgtgacag aacatctggg
     5221 agcaacgaca tcgccagtga aggtgtgata atgtttggta atgttatcag agggagggac
     5281 atgtttggga tactaggcga cactaaatcc tatgaagata ttagacgtcg agacaatttg
     5341 tccattgtgc ctttgaatac cttttttagc aggtttgtag ccaacattaa gacttcagta
     5401 tctggtctaa agctctgtac agctgcaagg tagccagctc tcttctgcag gtacttggta
     5461 gatgacataa cttccagtac atggaatgaa gcccaggaca tgtcataccc aaacatctcc
     5521 aagtagatta gtttcaacag agccgtagct ttcttgtcta tacagagtaa gctatagaat
     5581 ggattgacag aagcatgata ataacatgaa cgtacccata tcctgagact tgacctcagc
     5641 cttacactct cgaagacatt cttgtatgta gtcctcctca gcgcccttgt gattcctcag
     5701 accttttata aggtcataaa gagatttttc aaacctacat tgcttaatga ttagcgaagc
     5761 tttcgagtag cgagaacagg cgaggtgcga acattatggt tgagtatgcg ctgctggttg
     5821 gctctcaggc tcattggaat tactgctgat tgatagtcac atgggagagc aatgtttcag
     5881 ccctggttat atctttcgcc tgccgcgaat aatggcagcc atcaatcatt catagcatag
     5941 cccggaagcc agtagaggac cctgtacaga gttgatataa tgatagcctg agaagtagag
     6001 ctaagatgtc gttgctactt gaggtggagg gataagtgaa ccgacatcta tttggtcacg
     6061 ggaacgggtt atcagatcaa atgactaacc acaatgggaa cagacctcat atggacccct
     6121 ggcagtgtta cgttttgtct ctttcgttct gccccttcgc gtctcttcct tgcaaagagg
     6181 gttttgagca tagtagagct tgttcttctc acaatagcat atgaatcagt gtgcctactg
     6241 ggtttaagtg tatactatca tggcccatgc tacacccgat ttccatgcca ttcatagctc
     6301 aagcccgatt actacccttc gcttctctca gcaggcacca gtgatccttg aacgtcaatt
     6361 acactcagaa aaaaatttaa tctctgcgtt aataggtaaa caagaggagc cagaaaaata
     6421 tggcataata gagcaactgt tcttctcctg tctacaaacc ggcgatgata ggtctgctct
     6481 gttatgtctc gagcaattga cacgtcgttt cggctcttcg aatgagaaag taatggggct
     6541 gcgtggcctg tatgaggagg ctatatgcga aaatcaatct gatctggagg attccctgcg
     6601 taaatacgat tcctacctgt tggagaaccc acttaatttg gtttgtcacg atgtgttcgt
     6661 tgatgatcac ttactgactg gttcttgtag cctattctaa agcgccgtat cgcgctcttg
     6721 cgttcacttg caaggcctgc agatgctata acaggcttgg tagagctcct aaaagcagtg
     6781 cctaccgatg cagaggcttg gtgtgaactt gcagatctat atcaatctca aggattaagc
     6841 tcacaagcaa tattcagtct cgaggaggcc ctgttaatcg ctcctaatgc ttggaatgta
     6901 ggtatccatt gtttgctttc catcaaaact cgtctaacct ctactgcaga ttcatgctcg
     6961 ccttggagaa gttctataca tctgcgcccg cgctgcagag acagaagtta cctctcggta
     7021 tttgcgaaga tcaatccagt atttttgtag aagcgtcgag ctatgtgacg attatcttag
     7081 aggattttat ggcttaatct tggtgagccc ttacacgttg cacgactttc cttataaccg
     7141 ctgtccagcc cccagtcttc tgtttaccga gacttggtta tgacgtttgg gtcaattgct
     7201 tatttatact gacgtttgat cttctaggcg acttcgcttc agcttgggag agaatacaca
     7261 atggattttt cacaggcgtc agcgtcagcg tcatcggaag atttcttgcc caaagagaag
     7321 gtcgagaaac tgaatcttct cgccagaaga aaactcgagg atattgtgaa acagcggtct
     7381 gtgaaccgcc agctttggga gcatgcgcaa ggtgaactca ttgcagccaa agagcttctc
     7441 gaccgcgagt catgttaaat tagcacgcaa gtcagtttca agataagccc gtgaactcct
     7501 tcatgtatga tgactatatc tccctatgtt gttacctccc ttgagaggtg cacactttac
     7561 acactttcca cacggatacc attacctgga gttcttttta aatgcctagt aggcttcgtc
     7621 cccagctcgg cccgaccgtt caagtttgta ataaatgtgg tttggctaag gggggtctta
     7681 gggggcaaat cagtcgctta ctgatcgcga taatgaagag tcatgaacta tgtatatatt
     7741 tccatgtgta gtgaatcgtc ttgtagatgg taactgtaac tgccatcgct tggactgctg
     7801 aacgaacgca caagcgggtt cttatagtaa gaaacgtgcc ttgcgtatat cgtagtatct
     7861 aaatggtaat accctgtagg tgagagaaga actgttgatt ctgtagcatg ggtctactac
     7921 tgagacactt tttagctagg cgaatctgca tatgaagttc ccagtggtgg gtttaattag
     7981 gaactcctaa ggccaattaa aacatcaatg tcgctgtcaa aaggagaggt gaatggatca
     8041 tacgtcatca atctgtatct aggcgcctat tcaattaata aattaactta ataattacag
     8101 cttcaatctt tattatttgc tacacaagaa gcaattttca tgttatttaa gctacatagc
     8161 catgaaatcg accaaagcct ttctgcacaa tcccagagac atgtttcgta cctgcttcag
     8221 ctgtcgcccg attgtggtta cttgacccga aggttgaatg ttgattgggc acttgggcag
     8281 catatgcagg cctgcaagaa aagagagggt tgacaactca gtgcctaatt atcttgaact
     8341 tttagaatca tctccccatg gcatgcccaa cgatcattta tctgagcagg ccgtcgacta
     8401 atgagttagg tcaaagtttt ccacagtctt ctctggtatt tttctttgct cctcgcacca
     8461 acccctcaca cgcttaggac catttgactc ggctcgtctt tcggaatctc tgctttggtt
     8521 cctggagacc cttcccttct ctccaattcg cacccgacgt tctaccttgg cggggtatat
     8581 acccgggttt tgaattcatc ttctattgtc acctgtctcc aaggatcccg tcttgcgcag
     8641 ccctggaaaa aaaatgctca tcatccctaa cgcaaagaat cttgggtgat agcggaaatt
     8701 ttctatacga acttttgaga tcaaccccag ggtctacgaa cggccacctg aggctcaaat
     8761 atagttgccc aggtacatgg ggggcatcct gtccctccat ttagactccg ctgtacttcc
     8821 gcgaagcagg aaatcgcgtt gagttacagg cctgatccta gcgaccatag tccatatctc
     8881 ttttcttctc attgttctac gtggagcaat aataacggta cctgaagatt tcttgtcgct
     8941 actgattcca tggcgtgcgt ctcacacctg cacccccata gtatcttggt tctaattatt
     9001 gttaggttca acatcagaat tggtcccagc cctcacggct ccgatcattc ctcactttct
     9061 gacgaagaag actcctccgg cgtgcaagtc tccccgccgt ctgactcggg aagccatgac
     9121 tatcaggatc cttatgatga atgggcacac ctgccatatc cagacgagtt gaagccatct
     9181 gattccgcgt ctcggcctag gacgtcgcat cgtgcccgta gccgtcaccc ggttcatggg
     9241 tcgtcgtcaa cccgtcgtca cccaggtaga cgtcatattg tacaggaacg ggaacatttc
     9301 actcgtcgtc ctcggcgcca gccttccccc gagtctccag agagcatgga ctcgggggac
     9361 gagtatgaca gtccttatgg tcgagtatct catgagaaga gaatctggcc gcctgtggcc
     9421 caaggtccag ggtatgctcg cagcccctct ccagtaccct cgtatgttta ccccaatggt
     9481 ggtgcaccgc atgcagctta tgcacaccaa agcagtcacc agcctccttc agatcagctt
     9541 ataagattgg gcccccacgg acatcccgct cagccgaacc cttacggcca agcaagttat
     9601 gcctataatc accaactgca gcaacctcat ggctcctcta tgctgccata ttttcatgac
     9661 catcatttgg ggcaccatcc gcatcctacg ccaccttccc atgttcgagg tgatggccat
     9721 accccatctc aacatccatt ggcacgttct ctctcctctc atggcccatc accctatggc
     9781 ggccccccac tgggccccca tgacttggtc ccttatggac cagggggtta ttatcccttt
     9841 agagagccat atggtatggt tcctggcatg attcatccgt catatttcaa tccatacccc
     9901 cgcgtgccat ctccaagtca ggttgaatca actggttccc cacctccgcc acccacagac
     9961 acatcaaagg acgaagcgat tgcaaggctg gagaagttga tcctggagga aaggaccgaa
    10021 cgtgaagcga gggaacagcg agaagctgca cgacaagcgg caatggagca agaagccgcc
    10081 gaacaagccg caagagaaga gcgtgctgct catgagatga ggattgtaga ggaagctgct
    10141 gcccgtgcca gagaggaggc agagcaaaag gctgccgaag aagcagcgaa agcaaagaaa
    10201 gaggcggagg aagcggctgc agccgccgcc gcagaggctg cagccgcggc cactgaagca
    10261 gccaatgcag cagcagcaga ggctattgct gccgcgaggg cggctgcatc agataagccc
    10321 cccccggaaa agaaaaaacc cataaagttc aaagatgcgg tcgggaggaa gttcagcttc
    10381 ccttttgacc tgtgctgtac ctggcaggta ggtttattgt tttttcttat ctttgctttc
    10441 tattcaccta ctaggctcta tatctgactc tgttaaacca agggcatgga agagctcatc
    10501 cgccaggctt ttctccacat agagataatt gggccccatg tcgccgaggg acactatgat
    10561 ttgataggcc ccaacgggga tatcatactt ccacaggttt gggaaactgt aattgaacct
    10621 gattggacta taactatgca tatgtggcct ataccagaga agccgaagac acctgagcca
    10681 gctccacctc cggatcctcc tgtaccagag gctgccgctg cccctgaagc tctaccagca
    10741 cccgaagacg tggctgtcgc tgttcctgct gaggagccta agaagaaatc tgactcaaca
    10801 ggtgcgtcct ccgtccgctg tctcgtcaag gagtccctca gaacctgttt cttcagtgga
    10861 acacagttat cccctcgtct cgttctatga cgaaaactga cttgctttta taggagcaaa
    10921 aaagccgcga acaagagcgc ccgacccggg tgcgtttgcc atgtggatgg cgggtggtaa
    10981 ccgtaggttc aacaaagctt taaaagtggg aaaaaagcct agagtagtcc tgcaacacgg
    11041 gcttgcttct cgtgttatgt gataggatct aagcttttag ctactgcctc tagtctgcgc
    11101 attgcgatag gtatagcgtg catcactact tttttcgagc taggcctaaa gcttagatcg
    11161 cgatgggaag tgaacgcaga acatgtcaat gggttttgta tgttctgcga tatctttcgc
    11221 tttttaaggc agcctggggc gaatgctaga agtttgaact tgatctatct aagcttctct
    11281 gggggggcat ggcttttcct ctcgcatagc cgagattggt ttctcatgcc tcagggtggc
    11341 atcgcgcgcc caaatccatt tacattttgt ttttgttttt agcttcccct tcccttccct
    11401 tctttgatag cggtgaaaca aggagcacgg aaggcatctg tggttattaa aaaaaagtcg
    11461 tggcatgctt ctatcatgtc ttaaacattg tgggtgttgc ggcgtgctat tatacccata
    11521 gagcgttgaa tagcatattt tactccttcc atatgcatat atgtgctatt atgtgttctg
    11581 gctcaaatgc atgttttcaa gcctagtagg caacaccggt tgcatgtaac atagctatct
    11641 tttcccatac tgccgacatc ttgcaaaaat ataaagttag acttgtattc taacattatg
    11701 tgaattttgc ggtttctact gactccatca tcccccgaag tgacgtggcc tcgacttctg
    11761 tcataacagc ttcattgggg aataaggggc ttccattcaa taatttcgtc tccagttcca
    11821 ccaagaagat catgaacttc atctgtagac ctcggaggtg acctgattga tgaatttgtt
    11881 tgtaagcttt tgccttgtct atgttcctcc tgtccgccga tccaaaagcc atttgacatg
    11941 ccagtatctg gcaacctctc agttggggca gatggcgtac tattgttaac cttgcctcca
    12001 agattctgtc ctattgggtt atatcctttg aagatgggct ccgtattagc aactgtctgt
    12061 gggctactag taacttgaca ggatgccgtt agacattgct ttgaactaag ggaaaccggt
    12121 tttcggggta tcggtggtgc agccttctca ttacccagtt gtccgctata cctattgatt
    12181 gtgttcaagg aacttgacga atgactcccc gtaccccgat caattggcgg aatctgaact
    12241 ttgagccttg ggggaagttg cggaccttgc gatacagtat cctggttctt agtaatagtt
    12301 tgtcttttaa aggaacgatg agtattgatc caactcgcgt cactgctgga ggagaaaggg
    12361 ttggaactgt ggtggatgtt gagattgtat ccatcaccag gcggcctcaa agctgatttt
    12421 acgagtgccc ctttaagtat cccgattaga atacatgaag actgacagat gcgatgcaaa
    12481 agtacgccac gaatgattgg gttacatacc attctctaac caccacctat gatgatccga
    12541 actagctggt ggtagaccag gagcaatagg cgtgggtgga atatgttcct cactttgtgc
    12601 cctcgcttgc tctattgtct ttgacagtat attgtagggg tcgttgcgtc tctcagtata
    12661 aagtattcgc ctgagtttag ccttcatagc ttcatcaaca acgttgatga cacatgagaa
    12721 agtggcccaa acgggacgat ggtctgaaaa tcgtaatttt gcagtgttat agtctatctg
    12781 acgaagacat gaccctcgcc acaatattct atcgcaccaa gcaggtatac gtgctttctc
    12841 tctgcaacta gtcagtctga acacctatct tgtaagataa gccagatctt acgatgtatc
    12901 ataagtatcg ctgtcaatgt cgtatttgta cgttggggga aaagtaatga gcccctcagt
    12961 ataaaacggg aaggctctgc ctgccaacat ttgtaggttt aactagaact tgatgttaaa
    13021 cagaggcata ttccagagtt atgcaattgg aatacctgat cattgttgta aagcttttgg
    13081 tagtctttct gtgccacaag ttccctgacg aagtggctgt cgagaccgat ccgataatta
    13141 aaatctccaa gccaaatgat ggcttcatgg tcctcaattg ctctgttttt ctggaaccgg
    13201 agtccgtgat atatagtctc atagtctctg tttctctcgt cgtagtttgc aaatccagcg
    13261 gcaagatgag ccgtgacgaa acatatccgc gtgttggagt actcaaagcg tattgcacag
    13321 ccacctttat taccggccat tccggagagg cccgtctaca tgatcattgt cagaaatgtg
    13381 tttatgggaa ccctgtaaca gcctaccttc ttaacactcc cttcaacatt cttaacatct
    13441 ctcagtgcat cttctcttac atataccata agtgcggcgc caacgagctg gccacttcgc
    13501 agaaggacat acttcgaagt ccctctcgac ctcgcgcggc tgttcaaaca gttcccaaca
    13561 gcaacttccc ataccttacg agttgtaggg tccgtcgaca ttatctgctg tggacttagt
    13621 gaaacaatct cctggaagcc cacagcaaat atagtcgggt cctcagtttg ctcgtcaatt
    13681 cctgcccaca gccatggagc taggtcaaca tctggcccac ggtgtctccc attgacgtta
    13741 aatgtccctg tccagattct gataggcttg gtagaggaat actccaacgc tcgattattt
    13801 aactcatcgg aaaccagatc attgatcggg tcatagagac gcaccggcaa ttgatctgtc
    13861 aatcgtccta atagaaggtc tattgttttc tgacgagctt tatcggagaa attgttgaca
    13921 taaagccgtg ttgcggtctt ccttgcatct gccagcgcgc cagcaatgga cattttgcca
    13981 tgtcgtgtga atgaactttt taaagcccct gtacctgcgt agatttttga caaagcatcc
    14041 ccgttgtcgg cccaaagggt tgagtgcttc agctggactt ctgggtttag ccttcctttc
    14101 cgctgcaaca taaaagattc cagagccatg gaactgatga tggtttgcac aagattagtc
    14161 ctgtcgagac aatctagaca atttgtccgg aatacgcctt cctgttgaag aatgacaaag
    14221 gaacttctcg gttcatcttg attctcgtcc gaagttgctg agacactccc ttctgataga
    14281 aaatatgcaa aaccatccaa agaatcagat atctcgggtt ttatttggct gctagccccg
    14341 taccccaagg gacctcgagt ctcaacgtga aaatcgaatt cagttgctcg caaaagtgca
    14401 tgattggatg agatgttaga atcggctttt tggctaagtg gactcttcct gagctggttg
    14461 gaaaactccg tcgacagctc agactccccg gatttaagct tactgagaag gttaaccaca
    14521 tgaattgcac catattctaa ttcaagattc tcaaaatgct tgttaaaagc atgctgagtc
    14581 gcctcgctag atcgagttat ttcaattttt tgttgcccag gcaggaatcc agtagcttgc
    14641 tcccagaaaa taggcacaga gccacgtact tgaacataag aaaatgtggt attgggtggg
    14701 atccaaagaa ttgtctctgt ctcaacgaaa ttggcaacat ggccatcatc atcaatacct
    14761 cgagaattaa accttgtacc tgctcgccga gaggactgtc gcgaaatgat ggtcaacgtg
    14821 gaaggataac tcgtgcgtag ctggggcaag atggatattg aagcagggat tgtcagtgta
    14881 ccagaaaagc cgcgtataac acatgtcagg atctgggaag agtcgagacg ttgcttttcg
    14941 gcaggggaca ggtggctcct gaaaagaaga agcggatgga tcatgtacga gttccacagc
    15001 atatcctcat ctagagtatc aatatcgaaa gctgccgact tttccgaact agtgtaatat
    15061 cagctaacat tttattatta gaccaatata catcctatat cgactaaccg gtcttgcagt
    15121 cgatcagtga ggttgaaatc aagactatag tagaagctgc cgtcactcag gagcttcttc
    15181 agggctaaga acggatgatc agtaaccatc tccttattct caaagctggg tccacgaccg
    15241 aactcctcag ttgcaaagga ggattcggat tcgtattcaa gtctactttc atagtccgag
    15301 tgactaaggc aaactgagtt tattagctat tattgatcaa aggagatgat aatgagataa
    15361 tacagaagtc aacgttgtca atttttgaga ttgtctctcc tggtcttact gctgcggcgt
    15421 ctgaacaagc agtaacaata cagaggaaga cttcctcgcc caaagtaatc aacccaagag
    15481 tcccaagccc atcacccaaa gctcgatagc ctctcaagtc aacagactgt aacgttgcaa
    15541 attcaacgag acatcgtggt gtgccattac tgggtgattt attgattgtt ggagctgttg
    15601 agcgatgttt gaagatcaag gcgaagtcgt ttgtggttat agtaagagtg cgttgaggat
    15661 tgtcccgaga aaaaactcgc aaattagaca tgttataggc tatccaacgt atctaatgac
    15721 cattttcata caggcttaaa tcttgaggag ccgtaagtta tactgccgag aatattgata
    15781 gaatactgga agagggcaag ttgctccact gattagaagt gggaccccct aaaaaagcag
    15841 gcggtctatg tctgttatca ggcctttact tttctttttt cctctgattg ttatattatc
    15901 aatttgccag tctactataa tttcgttact ccaccccttt gttccacact tttgttgatt
    15961 ggttcgagga ttttgaaatt agggactcaa tatccattgt aatatataac gttgcaaatg
    16021 ggcttagcag caccccgcaa gtatgttatt ttgtcgcgcc ccgaatattt gaataacttg
    16081 aatactgacg gcaagggatt ataaggagga cgaaaatctc tcatgatcca aacaatacaa
    16141 attggtcccg atcaaccagt ggttatggcc acaaaattat gagctctcag gggtggactc
    16201 cgggcagctt tttaggtgca cgcaatgccg ctcatgctga tatgttcact gccgcgagcg
    16261 catctcatat tagggttgtt gtgaaggatg atacacttgg ccttggggca cgctctaagc
    16321 gtgaccccct cgatgaacct actggacttg atgccttcaa agggttgcta ggtcgtctga
    16381 atggaaaatc cgatgcagat ttggaagccg aacaaaaaaa gcacgaagat gcgaagatag
    16441 cacggtatgc tgcaacaaaa tggcatacag ttacatttat cagcggcggt ttgttggcgc
    16501 aagaaaagct tgtttccctc tccgctcaga aggaaagtcc gggagctcag catggttcac
    16561 accaaaaccg gggtggtcta gatatgcaaa agagcgagga agatgcgaac acttccatca
    16621 aagataatac gctcaaggca cttagagagg aacaagtttc atctgtccct attgcggagg
    16681 acacctccag gtctaaaagc aagcggcata gaaaagacga acagggaaag aaggataaga
    16741 aagagaggaa gactaagaaa aggaagcaca tggatgagcc tagccctata gactctgaca
    16801 ttccggaaag ggcaatcttg gaaactgatc tgcaagctac tgtcaccgat tcccgagata
    16861 caacacctcc agttgccaag gttttatcaa aagaacgccg tccaatgggg agacaccttc
    16921 tcagaggtcg acacattgcg caaaagaaga aagccctcat ggatgatagg tctctcaacg
    16981 aggtaattta atcatgttct accaccgtgg acctgaagct aataggcaca gatattcatg
    17041 gttaaatcct gaataattac gcattatatg tcctctgact acatgatctt gtcaagttaa
    17101 ggagcgtgtg gcacattaaa gcgcttcttg gcgggcattc tatgcaggaa aatagtctaa
    17161 gcccctgtat cctgattccc gtgcgattag aggaagctca gcatcacgat gcactgtatt
    17221 tatatacccc tttcttcttt tgagagactt acgcatctgc aaacgtgata aaggacatga
    17281 agttttccgg gtttctatgt atatatgaat ctccatcttt gctgagacaa actatcatga
    17341 gatactgtct atggttggtc aaaccaataa actgcttagc atatgaaaca aacatctggg
    17401 gttgtctggg caaccagcta gcataataag gccatctcta accagggagt ctctctcatt
    17461 gttgggaaga caatgaggag ctttggtttt cgagtggcat gacattgtat ctcctcgaga
    17521 aagtatgtag taattcatta atagggagct gcgcgagatg aattggtttc tgattagtca
    17581 gcgtttctga ttctgattaa tcggagattt tattttattc taattagtcc acggttctgg
    17641 atttccattg gttgagaatt gactattaat acaaagttaa tataatcagt aagcaagcgg
    17701 ccattgtaag tataataaag gatctactat atagggtaga tagcctatca actagataag
    17761 aaaatagaag ataaaagata aagctctatt atcaactaga tagtagaata aatataaaaa
    17821 aaattaattt ttattttttt ttctatatct ccagtagtat ttaaataatt taaaaattct
    17881 ttttttttaa aaattttttt tcttaaaatt ttaactaaat aattttttaa attttttaat
    17941 taaaaaaatt aaaaaattaa gatattaatc tttttaaaat taatttaaaa ttataaaaaa
    18001 agctagaata tatatagatt aaataaagat taaaaaattc aaaaattcta tatattctat
    18061 agattaattt tatattactt ttataataat tatttttttt taaattaatt atttttaatt
    18121 agctaatctt tatatatatt atttatttta ttaaaaaatt attaataaaa atatattatt
    18181 aatattatat aataaattaa tattttttat tattttttta tttttt
//