LOCUS       AP007159             2324132 bp    DNA     linear   PLN 16-DEC-2016
DEFINITION  Aspergillus oryzae RIB40 DNA, SC026.
ACCESSION   AP007159
VERSION     AP007159.1
DBLINK      BioProject:PRJNA20809
            BioSample:SAMD00067075
KEYWORDS    .
SOURCE      Aspergillus oryzae RIB40
  ORGANISM  Aspergillus oryzae RIB40
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Eurotiomycetes; Eurotiomycetidae; Eurotiales; Aspergillaceae;
            Aspergillus.
REFERENCE   1  (bases 1 to 2324132)
  AUTHORS   Sawano,T., Tanaka,T., Machida,M. and Yamada,O.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-JUN-2004) to the DDBJ/EMBL/GenBank databases.
            Contact:Toshihiko Sawano
            National Institute of Technology and Evaluation, Genome Analysis
            Center, Department Of Biotechnology; 2-49-10 Nishihara,
            Shibuya-ku, Tokyo 151-0066, Japan
REFERENCE   2
  AUTHORS   Machida,M., Asai,K., Sano,M., Tanaka,T., Kumagai,T., Terai,G.,
            Kusumoto,K., Arima,T., Akita,O., Kashiwagi,Y., Abe,K., Gomi,K.,
            Horiuchi,H., Kitamoto,K., Kobayashi,T., Takeuchi,M., Denning,D.W.,
            Galagan,J.E., Nierman,W.C., Yu,J., Archer,D.B., Bennett,J.W.,
            Bhatnagar,D., Cleveland,T.E., Fedorova,N.D., Gotoh,O.,
            Horikawa,H., Hosoyama,A., Ichinomiya,M., Igarashi,R., Iwashita,K.,
            Juvvadi,P.R., Kato,M., Kato,Y., Kin,T., Kokubun,A., Maeda,H.,
            Maeyama,N., Maruyama,J., Nagasaki,H., Nakajima,T., Oda,K.,
            Okada,K., Paulsen,I., Sakamoto,K., Sawano,T., Takahashi,M.,
            Takase,K., Terabayashi,Y., Wortman,J., Yamada,O., Yamagata,Y.,
            Anazawa,H., Hata,Y., Koide,Y., Komori,T., Koyama,Y., Minetoki,T.,
            Suharnan,S., Tanaka,A., Isono,K., Kuhara,S., Ogasawara,N. and
            Kikuchi,H.
  TITLE     Genome sequencing and analysis of Aspergillus oryzae
  JOURNAL   Nature 438, 1157-1161 (2005)
COMMENT     URL:http://www.bio.nite.go.jp/dogan/Top
FEATURES             Location/Qualifiers
     source          1..2324132
                     /db_xref="taxon:510516"
                     /mol_type="genomic DNA"
                     /note="SC026"
                     /note="phrap>=30:1-2324125"
                     /organism="Aspergillus oryzae RIB40"
                     /strain="RIB 40"
     repeat_region   1..23
                     /note="III right telomeric region"
                     /rpt_family="Telomeric Region"
     CDS             complement(join(828..871,1750..2581))
                     /codon_start=1
                     /locus_tag="AO090026000001"
                     /note="polyketide synthase modules and related proteins"
                     /old_locus_tag="AO070195000001"
                     /protein_id="BAE59502.1"
                     /transl_table=1
                     /translation="MGIFTGQGAQWAGMGRELLLASTVFRKSIERCEHALATLHDGPS
                     WSLQEELLADKPSSRLSNPAISQPVTTAIEIAAYDLLCTSGVNVDVVVGHSSGEIVAA
                     YALSIISAEDAMKIAYYRGLHTKPARSGRMLAVSLSFHDARELCSWPSFSGRVVVAAS
                     NGPASTTLSGDYDAILEVKALLDRKKTFARTLQVDVAYHSHHMVPCSAAYLESLRACN
                     IQVKSPRSGCTWISSVTGRNAILDGDIQSFSATYWVDNMVKPVLFSQALDKSLCGTQD
                     LAVSRRSHRFCGLGS"
     exon            complement(828..871)
                     /number=1
     exon            complement(1750..2581)
                     /number=2
     CDS             join(5192..6345,6410..6569)
                     /codon_start=1
                     /locus_tag="AO090026000002"
                     /note="predicted protein"
                     /old_locus_tag="AO070195000002"
                     /protein_id="BAE59503.1"
                     /transl_table=1
                     /translation="MEISKKAATLLPKPFYVLSQALNLSNKDHTKWWYSTAPMFATMM
                     AGAGYDVHAQYKFLCIHREVIIPALGPYPEKGQPMHWKSHLTRFGLPFELSFNYSKSL
                     LRFAFEPLGSLTGTKDDPFNTQAIRPVLQDLKAMVPGLDLEWFDHFTKALVVSEEEAR
                     TLLDRDIEIPVFKTQNKLAADLEPSGDIVLKTYIYPRIKSIATGTPKERLMFDAIKAA
                     DKFGKVATPLAILEEFIAERAPTLLGHFLSCDLVKPSESRIKVYCMERQLDLASIEGI
                     WTLNGRRNDPETLDGLDALRELWQLLPVTEGLCPLPNCFYEPGTSPQEQLPFIINFTL
                     SPKSALPEPQIYFPAFGQNDKTIAEGLATFFESRGWGGLAKSYPADLASYYPDVDLQT
                     ANHLQAWISFSYKGKKPYMSVYLHTFEAFSAAAQEVAMCHDGHNP"
     exon            5192..6345
                     /number=1
     exon            6410..6569
                     /number=2
     CDS             complement(7038..8405)
                     /codon_start=1
                     /locus_tag="AO090026000003"
                     /note="predicted protein"
                     /old_locus_tag="AO070195000003"
                     /protein_id="BAE59504.1"
                     /transl_table=1
                     /translation="MAVRIARFLGLSTVAYLALANGIDARDTISRDVIILGGGSSGTY
                     AAIRLRDQGKTVAVVERNNYLGGHGETYYTEDNTPLNFGVEGFFNTTVTRNYLERLQV
                     PYGRRDPAPAHEDYVNLNTGQRTEYTPGQLQDREAFAKWVDAISQFGFLDDGVYRIPE
                     PVPEDLISPFADFVKKYHLEDAVYALFSHTSGDVLEMITLYVIQYIGVPHAAALNEGY
                     VRPIEGIAALYKSAGKELGSDVLLETTPEAVQRFEDGVEVIVRSADGTKTLLKGKQLL
                     VTIPPLLENLHGFPLSDQESRLFSKWQYHQYWAALVNDTGLPDDVNIVNVDTERLYGV
                     PEEPFIWRLDNHWAPGYHNIKLVGGSEFGEDEAKAYMYERLDLLHAEGTYATHKPEIV
                     KFASHTPVTMFVSAEEIRGGFYRQLYELQGLNSTFWTGATWASDYSTLLWGYTDEVLD
                     QMASS"
     exon            complement(7038..8405)
                     /number=1
     CDS             complement(join(9652..10590,10653..10880))
                     /codon_start=1
                     /locus_tag="AO090026000004"
                     /note="cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies"
                     /old_locus_tag="AO080563000005"
                     /protein_id="BAE59505.1"
                     /transl_table=1
                     /translation="MDKDTPLYKGPTAPHSIVTVDGELHRFYRRLLAKGFSDAALREQ
                     EPVIQRNINLLVEKLHKEVAAGKTPEMTAWFNYATFDLIGELAFGETYGCLENSHYHP
                     WVEMILEVMKLRAMTHAVGYYPWIFHILMWFVPKSLREKFVTHRRYTHDKVQRRMDQK
                     IHYKDLTTNLVDPQNGLERYEIDGNCSTLIIAGSETTATALSATLYFLTQNENAKRKV
                     IGEIRTTFNNAGDINSISVNQLKYLSACMNEALRIFPPGPAVFPRRVPQGGDFIDGHW
                     IPGGTQVGIAHYCINRSRRNFVDPDKFIPERWLGDPTYQTDDRHAVQPFSYGPRNCIA
                     HNLARLEMRLVLARLIWEFDWELAPGSERWEEEALVFNVWSTKPLMIKFTPVAR"
     exon            complement(9652..10590)
                     /number=1
     exon            complement(10653..10880)
                     /number=2
     CDS             join(12669..12869,13821..14423,14483..14708,14765..15369)
                     /codon_start=1
                     /locus_tag="AO090026000005"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070195000005"
                     /protein_id="BAE59506.1"
                     /transl_table=1
                     /translation="MSRDYDFSGTVLDLACGNGEFGATLHENGVSAKVTGIDVSEGMT
                     RSSYIQDHYERPLLIGPMDELIMGEGPAEKTSKPSTEEVGWDGPTDPARPVNWSRKKK
                     WWNMGIISYLTFLTPLTSSIVAPAQGLVMKDFHSTNRTLASFVVSIYLVGFAVGPLFL
                     APLSEIYGRLRVYQVGTFIFTIWNIAGAVAPNVGALLVFRLFAGISGSGPVTLGAGSV
                     ADMFARQERGVAMSLYGLGPLLGPVIGPIAGGYLSQAQGWRWVFWLLAIVSGVAVILV
                     LFVLSESYEPVLLRQKAKRIRRENSSVEVNAGQALKLDSRKVFIQAITRPTKLLFLTP
                     NVALFSLYTGVVFGYLYLLFTTVTEVYETTYHFSQGATGLVYIGIGVGALIGISCFGA
                     LSDKIQNILIARNNGQAEPEFRLPPLIPGSFLIPIGLFWYGWSTQMHIHWIMPIIGLG
                     WVGCGMIATLLPIQAYLVDAFGEYAASAIAANTVVRSIVGAFLPLAGPSMYATLGLGW
                     GNSLLGFVALGLLPVPVVFYFYGKKIRMNSRYQVSV"
     exon            12669..12869
                     /number=1
     exon            13821..14423
                     /number=2
     exon            14483..14708
                     /number=3
     exon            14765..15369
                     /number=4
     CDS             complement(join(17710..17745,18033..18377))
                     /codon_start=1
                     /locus_tag="AO090026000006"
                     /note="predicted protein"
                     /old_locus_tag="AO070195000006"
                     /protein_id="BAE59507.1"
                     /transl_table=1
                     /translation="MGGSAGGSGIKAPGSGARLKIPRPAPDNWKSNAIIAWPYDSQVS
                     PLILEGCCGNPDHLHTYGDNDAFRFCDSASNPSSVKQCLENQGIKGVEELHKNGGSTL
                     LSSRSVSMPALGIIPSDRLLHHHS"
     exon            complement(17710..17745)
                     /number=1
     exon            complement(18033..18377)
                     /number=2
     CDS             join(21698..21808,21882..21975,22050..22327,22394..22730,
                     22792..22895,22974..23591)
                     /codon_start=1
                     /locus_tag="AO090026000008"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070225000001"
                     /protein_id="BAE59508.1"
                     /transl_table=1
                     /translation="MLIDEAADASSHISGMKLYLIVLSLLLAVFCVALDNTILSVAIP
                     RITDEFHRLNDIGWYASAYLLTTCAFQLLYGKLYALFSTKWVFLVALGIFEVGSLICG
                     VAPSSVVLIVGRAIAGVGSSGIFTGALVTIAHIVPLAKRPVYMGLLGGMYGIASVAGP
                     LLGGAFTNEVTWRWCFYINLPVGGVTAVVILFLLRIPKSADLRTHGAWEMLKGLDPLG
                     TIVFTPSIICVLLALQWGGVDYAWSNGRIIALFVLFGVLLITFIIIQVLMKDNATVPI
                     KVASQRSVACASVFVFFIGASMFVMIYYVPIWFQAIRNQSPVQAGIDSIALILANTAG
                     AIISGAVTNKTGHYAHWFIVSSVIMSIGAGCLTLFTVDIAQSKWIGFLFLYGIGVGFG
                     FQQGAVAVQAVLPMAQVPIGTALIWFVQMLGGALFTSVAQNIFSTHLAENLANLQLPG
                     LDPEAIFVHISSRSGSSETRSHLPSCKGARGPRACPEKERCLFLFNSCQTASALPRST
                     AGPLF"
     exon            21698..21808
                     /number=1
     exon            21882..21975
                     /number=2
     exon            22050..22327
                     /number=3
     exon            22394..22730
                     /number=4
     exon            22792..22895
                     /number=5
     exon            22974..23591
                     /number=6
     CDS             complement(join(24932..24985,25040..26452,26512..27069,
                     27122..30844,30909..31203,31269..31555))
                     /codon_start=1
                     /locus_tag="AO090026000009"
                     /note="polyketide synthase modules and related proteins"
                     /old_locus_tag="AO080562000085"
                     /protein_id="BAE59509.1"
                     /transl_table=1
                     /translation="MAQSRQLFLFGDQTADFVPKLRSLLSVQDSPILAAFLDQSHYVV
                     RAQMLQSMNTVDHKLARTADLRQMVQKYVDGKLTPAFRTALVCLCQLGCFIREYEESG
                     NMYPQPSDSYVLGFCMGSLAAVAVSCSRSLSELLPIAVQTVLIAFRLGLCALEMRDRV
                     DGCSDDRGDPWSTIVWGLDPQQARDQIEVFCQTTNVPQTRRPWISCISKNAITLSGSP
                     STLRAFCAMPQMAQHRTAPIPICLPAHNGALFTQADITTILDTTPTTPWEQLPGQIPY
                     ISHVTGNVVQTTNYRDLIEVALSETLLEQVRLDLVETGLPRLLQSRQVKSVTIVPFLT
                     RMNETMSNILPVSFVSTETRTDTGRAIPASGRPGAGKCKLAIVSMSGRFPESPTTESF
                     WDLLYKGLDVCKEVPRRRWDINTHVDPSGKARNKGATKWGCWLDFSGEFDPRFFGISP
                     KEAPQMDPAQRMALMSTYEAMERAGLVPDTTPSTQRDRIGVFHGVTSNDWMETNTAQN
                     IDTYFITGGNRGFIPGRINFCFEFAGPSYTNDTACSSSLAAIHLACNSLWRGDCDTAV
                     AGGTNMIYTPDGHTGLDKGFFLSRTGNCKPYDDKADGYCRAEGVGTVFIKRLEDALAD
                     NDPILGVILDAKTNHSAMSESMTRPHVGAQIDNMTAALNTTGLHPNDFSYIEMHGTGT
                     QVGDAVEMESVLSVFAPSETARKADQPLFVGSAKANVGHGEGVSGVTSLIKVLMMMQH
                     DTIPPHCGIKPGSKINRNFPDLGARNVHIAFEPKPWPRTHTPRRVLINNFSAAGGNTA
                     LIVEDAPERHWPTEKDPRSSHIVALSAHVGASMKTNLERLHQYLLKNPHTDLVQLSYT
                     TTARRWHYLHRVSVTGASVEEVTRKLEMAIQNGDGVSRPKSKPKILFAFTGQGSQYAT
                     MGKQVYDAYPSFREDLEKFDRLAQSHGFPSFLHVCTSPKGDVEEMAPVVVQLAITCLQ
                     MALTNLMTYFGIRADVTVGHSLGEFAALYAAGVLSASDVVYLVGQRAELLQQRCQRGT
                     HAMLAVKATPEALSQWIRDHDCEVACINGPEDTVLSGTTKNVAEVQRAMTDNGIKCTL
                     LKLPFAFHSAQVQPILDDFEALAQGATFAKPQLPILSPLLRTEIHEQGVVTPSYVAQH
                     CRHTVDMAQALRSAREKGLIDDKTLVIELGPKPLISGMVKMTLGDKISTLPTLAPNKA
                     IWPSLQKILTSVYTGGWDINWKNYHAPFASSQKVVDLPSYGWDLKDYYIPYQGDWCLH
                     RHQQDCKCAAPGHEIKTADYQVPPESTPHRPSKLDPSKEAFPEIKTTTTLHRVVEETT
                     KPLGATLVVETDISRKDVNGLARGHLVDGIPLCTPSFYADIAMQVGQYSMQRLRAGHP
                     GAGAIDGLVDVSDMVVDKALVPHGKGPQLLRTTLTMEWPPKAAATTRSAKVKFATYFA
                     DGKLDTEHASCTVRFTSDAQLKSLRRSVSEYKTHIRQLHDGHAKGQFMRYNRKTGYKL
                     MSSMARFNPDYMLLDYLVLNEAENEAASGVDFSLGSSEGTFAAHPAHVDAITQVAGFA
                     MNANDNVDIEKQVYVNHGWDSFQIYQPLDNSKSYQVYTKMCQAKENDLVHGDVVVLDG
                     EQIVAFFRGLTLRSVPRGALRVVLQTTVKKADRQLGFQTMPSPPPPTTTMPISPYKPA
                     NTQVSSQAIPAEATHSHTPPQPKHSPVPETAGSAPAAKGVGVSNEKLDAVMRVVSEES
                     GIALEELTDDSNFADMGIDSLSSMVIGSRFREDLGLDLGPEFSLFIDCTTVRALKDFM
                     LGSGDAGSGSNVEDPPPSATPGINPEIDWSSSASDSIFASEDHDHSSESGADTGSPPA
                     LDLKPYCRPSTSVVLQGLPMVARKTLFMLPDGGGSAFSYASLPRLKSDTAVVGLNCPY
                     ARDPENMNCTHGAMIESFCNEIRRRQPRGPYHLGGWSSGGAFAYVVAEALVNQGEEVH
                     SLIIIDAPIPQAMEQLPRAFYEHCNSIGLFATQPGASPDGSTEPPSYLILHFIAVVDV
                     MLDYKLAPLHARRMPKVGIVWAADTVMDERDAPKMKGMHFMIQKRTEFGPDGWDTIMP
                     GASFDIVRADGANHFTLMQKEHVSIISDLIDRVMA"
     exon            complement(24932..24985)
                     /number=1
     exon            complement(25040..26452)
                     /number=2
     exon            complement(26512..27069)
                     /number=3
     exon            complement(27122..30844)
                     /number=4
     exon            complement(30909..31203)
                     /number=5
     exon            complement(31269..31555)
                     /number=6
     CDS             join(32308..32727,32880..32939)
                     /codon_start=1
                     /locus_tag="AO090026000010"
                     /note="predicted protein"
                     /old_locus_tag="AO070225000003"
                     /protein_id="BAE59510.1"
                     /transl_table=1
                     /translation="MNLHLLTIPILIETTRQPAQLVHQWSRIFYSGHRKGPGIALVTG
                     ALYGYAAWAKYSVGEPWHHWMVAGVTTVSMVPYTWMFMNATNTALFHAEDQFEKGGVE
                     ISLQESVRLVGKWDWLNTVRALFPLAGSVMGMLGVCGVRSANVKSSGHGHACPSLLW"
     exon            32308..32727
                     /number=1
     exon            32880..32939
                     /number=2
     CDS             join(33244..33346,33399..33936,33995..34094,34159..34233)
                     /codon_start=1
                     /locus_tag="AO090026000011"
                     /note="predicted protein"
                     /old_locus_tag="AO070225000004"
                     /protein_id="BAE59511.1"
                     /transl_table=1
                     /translation="MNGSLSQHGQERLSTPCRDRPPEETVYLVTGASRGIGRGLIEAF
                     LQRPKSTVVACVRNVATATPALSPLTVAEGSRMIIVQLNCDSETDAQAAVQTLREEHG
                     VTHLDVVVANAAMATNFGPASTMPLEHLQAHMMVNMYAPVLLFQATRLMLQQSKQQAK
                     FVLIGAPISTITNMHDYARAPLTAYGVSKLAANYMVRKFHFENKWLTAFIIDPGHVQT
                     DMGDQGARLMGRPQAPTTVADSVAGICARIDEATKETTSGHFVIHTDGSQLPW"
     exon            33244..33346
                     /number=1
     exon            33399..33936
                     /number=2
     exon            33995..34094
                     /number=3
     exon            34159..34233
                     /number=4
     CDS             complement(join(35548..35670,35721..40282,40338..40692))
                     /codon_start=1
                     /locus_tag="AO090026000012"
                     /note="3-oxoacyl-[acyl-carrier protein] reductase"
                     /old_locus_tag="AO070225000005"
                     /protein_id="BAE59512.1"
                     /transl_table=1
                     /translation="MAQKAVRGIVIQGKRLAASSIQLLASSLDAKKLCYEYDERQAPG
                     VTQITEEAPTELPPLSSPPSLPQAPNVSPISASKIVIEDVALSRVQIVQALVARKLKT
                     AIAQLPTSKSIKDLSGGRSSLQNELVGDIHNEFSSIPDAPEQILLRDFGEANPTVQLG
                     KTSSAAVAKLISSKMPSDFNANAIRAHLANKWGLGPLRQTAVLLYAIASEPPSRLTSS
                     SAAEEYWDNVSSMYAESCGITLRPRQDNMNEDAMASSAVDPAVVAEFSKAHRRLGVQQ
                     FQALAEYLQIDLSGSQASQSDALVAELQQKVDLWTAEMTPEFLAGISPMLDVKKSRRY
                     GSWWNMARQDVLAFYRRPSYSEFVDDALAFKVFLNRLCNRADEALLNMVRSLSCDAYF
                     KQGSLPGYHAASRLLEQAITSTVADCPKARLILPAVGPHTTITKDGKIEYAEAPRQGM
                     SGPTAYIQSLRQGASFIGLNSADVDTQSNLTDALLDAMCLALHDGISFVGKTFLVTGA
                     GQGSIGAGVVRLMLEGGARVLVTTSREPATTSRYFQQMYDNHGAKFSELRVVPCNLAS
                     AQDCEGLIRHVYDPRGLNWDLDAILPFAAASDYSTEMHDIRGQSELGHRLMLVNVFRL
                     LGHIVHCKRDAGVDCHPTQVLLPLSPNHGIFGGDGMYPESKLALESLFHRIRSESWSD
                     QLSICGVRIGWTRSTGLMTAHDIIAETVEEHGIRTFSVAEMALNIAMLLTPDFVAHCE
                     DGPLDADFTGSLGTLGSIPGFLAQLHQKVQLAAEVIRAVQAEDEHERFLSPGTKPTLQ
                     APVTPVHPRSSLRVGYPRLPNYEQEIRPLSPRLERLQDPANAVVVVGYSELGPWGSAR
                     LRWEIESQGQWTSAGYVELAWLMNLIRHVDDESYVGWVDTQTGKPVRDGEIQALYGDH
                     IDNHTGIRPIQSTSYDPERMEVLQEVAVEEDLPEFEVSQLTANAMRLRHGANVSIRPS
                     GNPDACRVKLKRGAVILVPKTIPFVWGSCAGELPKGWTPAKYGIPENLIHQVDPVTLY
                     TICCVAEAFYSAGITHPLEVFRHIHLSELGNFIGSSMGGPTKTRQLYRDVYFDHEIPS
                     DVLQDTYLNTPAAWVNMLLLGCTGPIKTPVGACATGVESIDSGYESIMAGKTKMCLVG
                     GYDDLQEEASYGFAQLKATVNVEEEIACGRQPSEMSRPMAESRAGFVEAHGCGVQLLC
                     RGDIALQMGLPIYAVIASSAMAADKIGSSVPAPGQGILSFSRERARSSMISVTSRPSS
                     RSSTSSEVSDKSSLTSITSISNPAPRAQRARSTIDMAPLRAALATWGLTIDDLDVASL
                     HGTSTRGNDLNEPEVIETQMRHLGRTPGRPLWAICQKSVTGHPKAPAAAWMLNGCLQV
                     LDSGLVPGNRNLDTLDEALRSASHLCFPTRTVQLREVKAFLLTSFGFGQKGGQVVGVA
                     PKYFFATLPRSEVEDYYRKVRVRTEAGDRAYAAAVMSQTVVKIQTQNPYDEPDAPRIF
                     LDPLARISQDPSTGQYRFRPDATPALDDDALPPPGEPTELVKGISSAWIEEKVRPHMS
                     PGGTVGVDLVPLASFDAYKNAIFVERNYTVRERDWAEKSADVRAAYASRWCAKEAVFK
                     CLQTHSQGAGAAMKEIEIEHGGNGAPKVKLWGAAQTAARQRGLEGVQLSISYGDDAVI
                     AVALGLMSGAS"
     exon            complement(35548..35670)
                     /number=1
     exon            complement(35721..40282)
                     /number=2
     exon            complement(40338..40692)
                     /number=3
     CDS             join(41382..46047,46101..46580,46629..46744,46824..47228)
                     /codon_start=1
                     /locus_tag="AO090026000013"
                     /note="enoyl reductase domain of yeast-type FAS1"
                     /old_locus_tag="AO070225000006"
                     /protein_id="BAE59513.1"
                     /transl_table=1
                     /translation="MGSVGREHESIPIQAAQRGAARICAAFGGQGSNNLDVLKGLQEL
                     YKRYGPDLDELLDVASNTLSQLASSPAAIDVHEPWGFDLRQWLTTPEVAPSKEVLALS
                     PRSFPLNTLLSLALYCATCRELELDPGQFRSLLHSSTGHSQGILAAVAITQAESWPTF
                     YDACRTVLQISFWIGLEAYLSTPSSAVSDAMIQDCIEHGEGLLSSMLSVSGLSRSQVE
                     RVIEHVNKGLGECNRWVHLALVNSHEKFVLAGPPQSLWAVCLHVRRIRADHDLDQSRI
                     LFRNRKPMVDILFLPISAPFHTPYLDGVQGRVIEALSSASLALHSIKIPLYHTGTGSN
                     LQELQPHQLIPTLIRAITVDQLDWPLVCRGLNATHVLDFGPGQTCSLIQELTQGTGVS
                     VIQLTTQSGPKSVGGHLAAVNWEAEFGLQLHANVHGAAKLHNRMTTLLGKPPVMVAGM
                     TPTTVRWDFVAAVAQAGYHVELAGGGYHAERQFEAEIRRLATAIPADHGITCNLLYAK
                     PTTFSWQISVIKDLVRQGVPVEGITIGAGIPSPEVVQECVQSIGLKHISFKPGSFEAI
                     HQVIQIARTHPSFLIGLQWTAGRGGGHHSWEDFHGPILATYAQIRSCPNILLIVGSGF
                     GGGPDTFPYLTGQWAQAFGYPCMPFDGVLLGSRMMVAREAHTSAQAKRLIIDAQGVGD
                     ADWHKSFDEPTGGVVTVNSEFGQPIHVLATRGVMLWKELDNRVFSIKDTSKRLEYLRN
                     HRQEIVSRLNADFARPWFAVDGHGQNVELEDMTYLEVLRRLCHLTYVSHQKRWVDPSY
                     RILLLDFVHLLRERFQCAIDNPGEYPLDIIARVEKSLKDKAYRTLYPEDVSLLMHLFS
                     RRDIKPVPFIPRLDERFETWFKKDSLWQSEDVEAVIGQDVQRIFIIQGPMAVQYSISD
                     DESVKDILHNICNHYVEALQADSRETSIGDVHSITQKPLSAFPGLKVTTNRVQGLYKF
                     EKVGAVPEMDVLFEHIVGLSKSWARTCLMSKSVFRDGSRLHNPIRAALQLQRGDTIEV
                     LLTADSEIRKIRLISPTGDGKSTSKVVLEVVSNDGQRAFATLAPNIPLSPEPTVVFCF
                     KVDQKPNEWTLEEDSSGRAERIKALYMSLWNLGFPNKASVLGLNSQFTGEELMITTDK
                     IRDFERVLRQTSPLQLQSWNPQGCVPIDYCVVIAWSALTKPLMVSALKCDLLDLLHSA
                     ISFHYAPSVKPLRVGDIVKTSSRILAVSVRPRGTMLTVSADIQRQGQHVVTVKSDFFL
                     GGPVLACETPFELTEEPEMVVHVDSEVRRAILHSRKWLMREDRAIDLLGRQLLFRLKS
                     EKLFRPDGQLALLQVTGSVFTYSPDGSTTAFGRVYFESESCTGNVVMDFLYRYGAPRA
                     QLLELQHPGWTGTSTVAVRGPRRSQSYARVSLDHNPIHVCPAFARYAGLSGPIVHGME
                     TSAMMRRIAEWAIGDADRSRFRSWHITLQAPVHPNDPLRVELQHKAMEDGKMVLKVQA
                     FNERTEERVAEADAHVEQETTAYVFCGQGSQRQGMGMDLYVNCPEAKALWARADKHLW
                     EKYGFSILHIVQNNPPALTVHFGSQRGRRIRANYLRMMGQPPIDGRHPPILKGLTRNS
                     TSYTFSYSQGLLMSTQFAQPALALMEMAQFEWLKAQGVVQKGARFAGHSLGEYAALGA
                     CASFLSFEDLISLIFYRGLKMQNAVPRDANGHTDYGMLAADPSRIGKGFEEASLKCLV
                     HIIQQETGWFVEVVNYNINSQQYVCAGHFRALWMLGKICDDLSCHPQPETVEGQELRA
                     MVWKHVPTVEQVSRENRMERGRATIPLPGIDIPYHSTMLRGEIEPYREYLSEHIKVGD
                     VKPCELVGRWIPNVVGQPFSVDKSYVQLVHGITGSPRLHSLLQQMA"
     exon            41382..46047
                     /number=1
     exon            46101..46580
                     /number=2
     exon            46629..46744
                     /number=3
     exon            46824..47228
                     /number=4
     CDS             complement(48507..49841)
                     /codon_start=1
                     /locus_tag="AO090026000014"
                     /note="predicted protein"
                     /old_locus_tag="AO070225000007"
                     /protein_id="BAE59514.1"
                     /transl_table=1
                     /translation="MVDHISPRASPGPIRSSQTRRARKLRDSCTSCASSKVRCTKEKP
                     ACARCIERGLACQYMVSKRMGRNPRAPSPLDSTRRPSESLPSARSEQGLPAHNTYSTP
                     HAHTQAHTHAHSHPQPHPQSHPQSNQPPHALPTPNGSSSVSAIFSHQSPPPPVETQGL
                     GGDLAGQEQSTLSSLTVDSEFGGSLQSMEHGNHADFLAESTGSLFDAFLEVGTPMIDP
                     FLESAPLPPFQARYCCFSLALQTLTHLFPHAPLGCQLRLTDGEDSSYNLMTTDMVISG
                     NKRATDAVRKILGCSCAQDGYLLSMVVLIVLKVLAWYAAAAGTQCTSTAASGETNSGS
                     CSNSPATVSSGCLTEERVLHLPSMVGEDCVDEEDQPRVAAQLVLSELHRVQSLVNLLA
                     KRLQEGGDDAAGIPAHHPASPFSLLGFSGLEANLRHRLRAVSSDIIDYLHRE"
     exon            complement(48507..49841)
                     /number=1
     CDS             join(50581..50763,50859..51371,51432..52031)
                     /codon_start=1
                     /locus_tag="AO090026000015"
                     /note="predicted protein"
                     /old_locus_tag="AO070225000008"
                     /protein_id="BAE59515.1"
                     /transl_table=1
                     /translation="MTLTDLEICAEEIATAARTLASDGHSGGYSAGLPDHLRPVQRTL
                     IANASQVLALASQPADLNQLLACLRWLGEFQVLACIPLDESVPFEDVADIAGVPECRL
                     RRLVRPLFTIGFLCEPSPGHVAHSVLSKQFVTQPALLDAILFMSETLAPSASAMGTQT
                     RRFGASEQAEDSAWNMAVGSDSPFAACLQQRPKVKRQLGAYLSYVSSSIDAGVEDTLT
                     RMNWQNLGMATVVHVGAQSPSLVVALAPQFPSLRFLVQTEAKTESGGHQPCLDNHGIS
                     ALKLASIPLHLRARITWGTRLSTATQPVLDAAVYLISIPFPSPQSPAMEITMRVAQAL
                     KAHVEVLRNNSDERLILTLPMSSATRSMDAAARAAVSLSDLSLLQLTNGGSLNMGEIR
                     DLLRSRSDGLVVMREVRSPTNAVIAFEIQYRVDNDDNRY"
     exon            50581..50763
                     /number=1
     exon            50859..51371
                     /number=2
     exon            51432..52031
                     /number=3
     CDS             52593..53429
                     /codon_start=1
                     /locus_tag="AO090026000016"
                     /note="predicted protein"
                     /old_locus_tag="AO070225000009"
                     /protein_id="BAE59516.1"
                     /transl_table=1
                     /translation="MEVLNTTVDLGTLRGKSALITGGASGIGLATARAWAAAGMYVTI
                     ADIQPLETGQNILADLAGGHVHYVCCDVTSWESQIKAFKEAIQFTPSKALDIVAAFAG
                     VSFAGGNQVDHVLAAGDPRLDVNPSPPDIRNIQVNLIGVYYTSWLGLYYLRLPPTNKA
                     ANPSPDKSLILMGSIGSYMDSPKASTYPASKFGVRGLFRSTRARTRELGVRCNLLAPW
                     FIDTPLIAPMKKAMAARGIDMAQRLTFASVDACVEAATTCAANPQLHGTPPMRYAYCL
                     KT"
     exon            52593..53429
                     /number=1
     CDS             join(53836..53871,54440..55351)
                     /codon_start=1
                     /locus_tag="AO090026000017"
                     /note="esterase/lipase"
                     /old_locus_tag="AO070225000010"
                     /protein_id="BAE59517.1"
                     /transl_table=1
                     /translation="MSNPLAKGAVNSFVEDLGQTPCLPGKDLDSILAGWGQLAGTLAT
                     RYGFPPPDESVTTEDVQLDGLWLRCYTPPKATGQEPVGLYFHGGGWVMGGVNEEDGFC
                     RVISRQCQMRLVSVEYRKAPETRYPGALNDGVIAALWALSRYENQPLILMGTSAGGNL
                     AFGTALRLIDQDMADKVSGVVALAPITVHPDAVPEHLKEQYTAYEENAELTVNSRAAM
                     QVFFDCYKAPVDDVYTSCLLHPRLLALPKVYIAELGLDTLRDDARLMKGALDTAKVPV
                     MYDAYPGFPHCSFMFPFKSLGEHQRTFFGGVAKAVRWMS"
     exon            53836..53871
                     /number=1
     exon            54440..55351
                     /number=2
     CDS             join(55642..56212,56270..56646)
                     /codon_start=1
                     /locus_tag="AO090026000018"
                     /note="voltage-gated shaker-like K+ channel, subunit
                     beta/KCNAB"
                     /old_locus_tag="AO070225000011"
                     /protein_id="BAE59518.1"
                     /transl_table=1
                     /translation="MVLPTAPEPPTLLGYHRILSPSAGVRVSPLCLGTMSFGNGWKGV
                     MGECDQATSFNMLDTFYESGGNFIDVANFYQGGDSERWVGEWMAQRQNRDEIVLSTKY
                     TMGYTMFGPQKIKSNYQGNHTKSLRLSVKASLQKLQTDYIDLLYVHMWDFTTSVEEVM
                     RSLNHLVANGKVLYLGVSDTPAWLVVKCNAFARANGLTPFSVYQGHWSCAFRDFERDI
                     LPMCESEGMGLAPWGVLGRGQFRSAEEFSREGRKMGPQDEKHRRLGEKLDQMAQQKNI
                     KATSIAQAYVMHKAPYVFPVIGVARWSTSRRTLRLSAWY"
     exon            55642..56212
                     /number=1
     exon            56270..56646
                     /number=2
     CDS             join(57740..58066,58117..58440,58502..58639)
                     /codon_start=1
                     /locus_tag="AO090026000019"
                     /note="dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /old_locus_tag="AO070225000012"
                     /protein_id="BAE59519.1"
                     /transl_table=1
                     /translation="MSDNHRLDGKVALVTGAGRGIGAAIAVALGERGAKVVVNYAHSR
                     EAAEKVVEQIKANGTDAIAIQADVGDPEATAKLMAETVRHFGYLDIVSSNAGIVSFGH
                     LKDVTPEEFDRVFRVNTRGQFFVAREAYRHMREGGRIILTSSNTACVKGVPKHAVYSG
                     SKGAIDTFVRCMAIDCGDKKITVNAVAPGVIKTDMFLAVSREYIPNGETFTDEQVDEC
                     AAWLSPLNRVGLPVDVARVVSFLASDAAEWVSGKIIGVDGGAFR"
     exon            57740..58066
                     /number=1
     exon            58117..58440
                     /number=2
     exon            58502..58639
                     /number=3
     CDS             join(59671..60152,60207..61206)
                     /codon_start=1
                     /locus_tag="AO090026000020"
                     /note="cytochrome P450 CYP4/CYP19/CYP26 subfamilies"
                     /old_locus_tag="AO070225000013"
                     /protein_id="BAE59520.1"
                     /transl_table=1
                     /translation="MPEFQLLAGHFGTLKKTIQGMPSDATLHSIMLKISQQFPSGIFY
                     INMWPFSGTWMIVSTPSAASQIQKLNLSKPAILRRPLEMVTGGPSMMSMHGETWKKWR
                     ALFNPGFNPAYIIGLAPNISDEVAIFCAQLRKIAQQGEVFPLESLTTRLTVDSICSVV
                     LDTQLHHQIKDHPLATALQRQIDWTSFGTTFNPFKRYLTIRPLVLWYNNKFMDRIIDG
                     EVDRAYCTPPGHPSKSVISLALREYLQEQASNNSTRSLAEFKRLVAPQLRVFLFAGRN
                     TTSSTLIYTYYLLAQHPEALAKIRAEHGDVLGADPAEAQGRIKEDVQLLNKLPYTTAV
                     IKETLRLFPPSASMREGRPDAEIIGEDGQRYPTVGCNVWTLTVALHHNSDYWDQVENF
                     IPERWLVGPEDPLYPVKGAWRAFEFGPRSCIGQTLAMLELRIALAMTIRQFDITPAYD
                     EWDSIHPATTAREVNGHRAYQAERGAGGAHPADGFPCRVKERC"
     exon            59671..60152
                     /number=1
     exon            60207..61206
                     /number=2
     CDS             complement(join(62258..62593,62652..63746,63793..63849))
                     /codon_start=1
                     /locus_tag="AO090026000021"
                     /note="cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies"
                     /old_locus_tag="AO070225000014"
                     /protein_id="BAE59521.1"
                     /transl_table=1
                     /translation="MGGDGWPSDGHILLLIVLTVLTPPSLALYRLWIHPLRSYPGPRW
                     WAIWRGPYILSNIRGNLVRDLQRLHQQFGHVVRIAPNELSFIVPEAASPIYTSNPEFP
                     KDPMHLPPFHNGTPGILAADHAHHRRYRRLLAFSFSDKGLRQQRSLIERSVNLLITRL
                     HENCGQGPLDLTLWFNWATFDIIGDLAFGNSFGCLDNVQTHPWISSIQGNVKLIPILN
                     AFRRYRLDGLLQLLGSRKLLEQRRRNAQFTTDQVDRRLKNSSTPRGDIWDAVLAQKPD
                     GEPPMSREEMISNTSAIVLAGSETSATLLSGCTWLLLKNPGHLHQLTSRIRSQFTHAS
                     EIDSQSVSRVEGLQAILEESLRLYPPVPMQSNRIVPQSGAYIAGGWVPGGTSVGLQQF
                     VACRSSSNFHRPEEFLPERWQGQGEFAHDRREVSQPFSIGPRNCIGRQLAYVETRLIL
                     VKLLWHFDLRLDTTRMKDTDWLAEQGIWILWDKNPLWVNLEPRNE"
     exon            complement(62258..62593)
                     /number=1
     exon            complement(62652..63746)
                     /number=2
     exon            complement(63793..63849)
                     /number=3
     CDS             complement(join(64217..64567,64622..65773))
                     /codon_start=1
                     /locus_tag="AO090026000022"
                     /note="cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies"
                     /old_locus_tag="AO070225000015"
                     /protein_id="BAE59522.1"
                     /transl_table=1
                     /translation="MYFLSLPALAIIVPVGYVLLHLGYNLFFHPLRGYPGPLLWRASS
                     LPWKIALLRGTMHHDLMRFHQKYGDTVRVKPDEISYANAQAWRDIHAHVPGRPEFLKD
                     PVRLPLAPNGVMSILVSDTKNHARFRSLFGHAFSDKGLRTQESTIVQYADLLVEVLRE
                     MANTGRSAEMVYYFNMAIFDSIGALSFGESFDSLKSRQLHPWVDAIHKNLKSVAISHV
                     LRSMGIEFLTPYVLPKELRGKRQENYSYAVEKLNKRMKMEGDLGDFWDKVLVKSADDN
                     QRGDGMSAGEMLNNAAVMVVAGSETTASALSGAMYLLCLSGKIEKATAEIRKSFASPE
                     DIDLISVSHLPYLAAVIDETLRMYPAVPGQPPRVVPAGGATVCGRFVPEETRVGVSHL
                     GAYFADYNFTHADKFIPERHLQKTEEPYKYDNYGAYQPWSVGLRNCIGRNLAYAEVRL
                     TLAKLLWHFDFTLDVGKTGNFLDQKIWSIWAKRELYMFIKTRGTSSSSPQ"
     exon            complement(64217..64567)
                     /number=1
     exon            complement(64622..65773)
                     /number=2
     CDS             complement(join(66148..66503,66551..66605))
                     /codon_start=1
                     /locus_tag="AO090026000023"
                     /note="predicted protein"
                     /old_locus_tag="AO070225000016"
                     /protein_id="BAE59523.1"
                     /transl_table=1
                     /translation="MTTTAIQATAVVMGSFMSGAMMSVYGLAMPAFLQTVTQSGQLVG
                     YQRRLYQIGTTKGRVLGLTTTLLYASVSVHQYLARKPWLVSAAAGLTTISLVPFTEIV
                     MASINNALARLETETNKGVVISREETEQLVRKWD"
     exon            complement(66148..66503)
                     /number=1
     exon            complement(66551..66605)
                     /number=2
     CDS             complement(66810..67658)
                     /codon_start=1
                     /locus_tag="AO090026000024"
                     /note="predicted protein"
                     /old_locus_tag="AO070225000017"
                     /protein_id="BAE59524.1"
                     /transl_table=1
                     /translation="MVTYALLGATGATGSSILRHLLHDPPDSLRIQILVRSKIKLLQA
                     FPDLQTRRNPQVHVIQGTSTDADALSECLRNATIAFMCVAQNGSPIGTTLCQDSARAI
                     ISALQQQQQSEGASYQPCTIVQLRSASLNPALAVQVPVFVHPIVSFCLFANYADIKQA
                     CQYYSEARKQGTLEYIFVDPPTLHDANGTQSTGYRLISTESQATALSYADLGAAMCEI
                     AQRRSEFHGRAVGVTATGSVHQTWGVLLRHLLEGGSARLREKIAKNTVVVGIVCSFLV
                     ALAYLM"
     exon            complement(66810..67658)
                     /number=1
     CDS             complement(join(67836..68589,68651..68774,68825..68951,
                     69015..69170))
                     /codon_start=1
                     /locus_tag="AO090026000025"
                     /note="predicted protein"
                     /old_locus_tag="AO070225000018"
                     /protein_id="BAE59525.1"
                     /transl_table=1
                     /translation="MTGLGMETIFAKIKEEYARTDDVGKRKIQGHIRELQVGFYSDWD
                     VVMRLSSGPLQVALAKVGIDLGIFRSLKESDTPITLAEFVKKTGASPRLLGRILRTQA
                     AFGLIKETGPQEYTSSAFTDVFANPAAAGAVVQLFDISGPCTQILPDFLAERHYQDIT
                     SNKDCVFQKAFDSDLTMFEWMPQHPKHMESLGHLMALERPVSWVDHFPVLEELGDFPA
                     PDKVLMVDIGGGFGQQSKALRAKFPNIPGRVIVQDIPQTLANAQPAAGVEFMEHNFFE
                     PQPIRNAKFYYLRHVFHDWPDEQCVLILKQIIPVMGPESEILIDEMVIPSTGVPWQAA
                     FTDLLMMNSLGGVERTRAEWDYLMKQAGLEIIQSKVYDSKEQTILVAVPRRT"
     exon            complement(67836..68589)
                     /number=1
     exon            complement(68651..68774)
                     /number=2
     exon            complement(68825..68951)
                     /number=3
     exon            complement(69015..69170)
                     /number=4
     CDS             complement(join(70436..70727,70787..71147,71200..71336,
                     71369..71492,71553..71922))
                     /codon_start=1
                     /locus_tag="AO090026000026"
                     /note="predicted protein"
                     /old_locus_tag="AO070225000019"
                     /protein_id="BAE59526.1"
                     /transl_table=1
                     /translation="MALPNKAALVGLAHTLSEQVKHYLVTADETKSPEDHKLCIEREI
                     TPSSTEHAQAWEIVRTCDRIGSLVHGPVPWLLSNALSHLDSACLAAATQLNLQDIIVD
                     GPSPTSLDTIVAATGVSEDLLRRILRGCAQRFIFEEVAPDQYAHTDASKMLRVTGIHA
                     LVGFSCPHQGDRVRCDEVMRSGAYFSDFLQQTKGKPPSWNVPSPFSLAFDPTKGLFDY
                     YSTVDEVRGRRFDLGMGGTEATKPLVEEMFDFSSLPEGSTVVDVGGGRGHLSRRVSQK
                     HPHLRFIVQDLPAVIHGVEDTDKVTMMEHDIRRPNPVRGADVYLLRSILHDYPDAACV
                     EILSNIVTAMDPSKSRILLDEMIMPDLLAQDSQRFMNQIDMTVVLTLNGKERSPKEWN
                     SLITMVDGRLETEKIWWRKGEEGSHWGVQQLRLRK"
     exon            complement(70436..70727)
                     /number=1
     exon            complement(70787..71147)
                     /number=2
     exon            complement(71200..71336)
                     /number=3
     exon            complement(71369..71492)
                     /number=4
     exon            complement(71553..71922)
                     /number=5
     CDS             join(73168..73363,73440..73569,73625..73816,73881..74032,
                     74082..74326,74385..74656,74719..75118)
                     /codon_start=1
                     /locus_tag="AO090026000027"
                     /note="cytochrome P450 CYP2 subfamily"
                     /old_locus_tag="AO070225000020"
                     /protein_id="BAE59527.1"
                     /transl_table=1
                     /translation="MIYSIIICAGALLGLWILEKLLAPKDTRPPLPPGPWRKPIIGNL
                     TDFPPKGTPEWLFWAKHQERYGPMSSLEVMGQTIIMINDAQLGIEIMHKKSALSQMIP
                     DAPFAHMAGWGMSLATERNRQAWKTIRANMKQEIGTRRAISTFHSKMEIGIRRFLLRT
                     LDNPDDLRFHIRKEANAFMMDVAYGYTIAPHGKDELYDLTQQSVRQFSHIFSPGEWSV
                     NFFPILRYVPSWFPGASFQIKAAEYKWTIERMTMVPYLWIKDQVARGCSRPSILLRLL
                     QKGHYESGSHQEQVLVWTNAEFVMGGSDTTVSAVSSLFVAMALYPEVQRKAREELDRV
                     VGPTTLATFEHRSQLPFIDALVKEVFRWHPASPLGAPHITQEDQIWDGYLLPKGALLL
                     PNIWTFTHDPSVYHDPMVFKPERFLEGKDSPPETDPMKFVFGFGRRICPGRFVTDEKL
                     FLIACHAVSCFFISPKDPGAPEPDWLPGVISQPGTFDLNVVPRSPAHEELIRSIETDH
                     PWKNADATDISRFMARNQMI"
     exon            73168..73363
                     /number=1
     exon            73440..73569
                     /number=2
     exon            73625..73816
                     /number=3
     exon            73881..74032
                     /number=4
     exon            74082..74326
                     /number=5
     exon            74385..74656
                     /number=6
     exon            74719..75118
                     /number=7
     CDS             join(75633..76162,76218..77619)
                     /codon_start=1
                     /locus_tag="AO090026000028"
                     /note="choline dehydrogenase and related flavoproteins"
                     /old_locus_tag="AO070225000021"
                     /protein_id="BAE59528.1"
                     /transl_table=1
                     /translation="MGRNWFQVTAMAVVPVVGIMAAVNPTILSSAASSLPSLGAMFTS
                     DDFASQMDGRIQAQGLLSSHFGMYGWPGQSFDYVIVGGGTAGLAMARRLSQDGTASVA
                     VIEAGGFYETDAGNATEVPMYLFNYFFDNGKVKNPLFDWYQYTTPQPGLAQREMFYMQ
                     GKTLGGSTARGAMLYHRGSKGAYDMWADHVGDDSYRWDKWLPYFQKSVHFSGPETNPR
                     PANATALNDNTAFTASGGPVHVGYPFQVNAISSWVDKALAKMGFPEAQGFSNGNLLGR
                     SYITHTINPYTRRRETASSSYLREALMESNNLNIFTRTLVKRVLFDDQNRATGVTVST
                     DGFEWQIGAKKEVILSAGVMRSPQLLMVSGIGPKEHLDQLGIPVRSDLSGVGQNMQDT
                     IILGPTVPVKVESHSQLMGNKETLPRAIREYNEQRKGLLTNPGQDYFAFEKHQPGMLK
                     ESTAADIDAAFPDDWPTFSYIALDDTFVPQYDGKNYFSMSAALMTPFSRGTVTINSND
                     TANPPIVDPQWLADPRDQEMAVAAFRRCREIVASDVMREVVAGPEILPGPQYQTDEEI
                     LNYIAETSDAYYAGVGTCAMGKADDSKAVVDSKARVLGVKGLRVVDASIFPFAIDGQP
                     MGTVYALAEKIAAEMMAEQ"
     exon            75633..76162
                     /number=1
     exon            76218..77619
                     /number=2
     CDS             complement(join(78163..78421,78477..79636,79704..79811))
                     /codon_start=1
                     /locus_tag="AO090026000029"
                     /note="predicted protein"
                     /old_locus_tag="AO070225000022"
                     /protein_id="BAE59529.1"
                     /transl_table=1
                     /translation="MTNTASRELIRAIEHVPLTWWFLAVGGAWIVSKIVKILQTAYFS
                     PLRKVPGPWYARLTSARLAWASFANNRIYYVQSLHEKYGPIVLIGPEEVDIADPVAAK
                     QIHRMGSGFVKAPFYKLLSPGPVDNIFNFRDAKLHSTRRKLYAKGFTLNSLRQQWEPT
                     IRNIVALTVERIRHDAQQGEAEILGWWTLMANETVCKLTFNGGHDTVRNGTKDPFVLM
                     LERRMGDLAHLLQHFAPPLYYLGRLLGRAEPRLHDVFFSQETMFEAGKHVVAIARSAR
                     DAEGDRNLFVKALAAGDLESKIGCLNDTEIITDAGALLLAGSDPTALSLTYLIWCVLN
                     RPKLQADLESEVAGLQGDITDAACADLPTLNAVICESLRLYGPAPGSMPRSPPPDGAT
                     LCGYYIPPSAVVVTQNWSLHGNPKVWKDPHTFDHTRWLPGSSLSEEAKMSFNPFGQGA
                     RQCLGIHLGWMQLRLATALFFRRCPGAKLAPSTTPESMVMIDSFIAGMPKARRCAIQL
                     "
     exon            complement(78163..78421)
                     /number=1
     exon            complement(78477..79636)
                     /number=2
     exon            complement(79704..79811)
                     /number=3
     CDS             80360..81889
                     /codon_start=1
                     /locus_tag="AO090026000030"
                     /note="predicted flavoprotein involved in K+ transport"
                     /old_locus_tag="AO070225000023"
                     /protein_id="BAE59530.1"
                     /transl_table=1
                     /translation="MSKVDYSQPGSTGYEIPPDLTWMDPANRPLRVVTIGTGISGILM
                     AYQIQKQCPNVEHVLYEKNADVGGTWLENRYPMAGCDVPSHAYTYPFAPNPDWPRYFS
                     YASDIWNYLDRVCKFFDLRRYMVFHTEVVGCYWNEDRGEWTVRLRQHASGSEPREFED
                     HCHVLVHASGVFNNPQWPQIPGLHDRFQGRVLHTARWPDDYQESQWKSDRVAVIGSGA
                     SSIQTVPGMQPTVKHLDVFVRTGVWFGVLAGNTGSQTKEYSPTERDEFRRNPAALVAH
                     AKAIEDQVNGMWGAFYTGSKGQAMGSAFFRQRTANLIKDERLREGLDPPFAFGCRRIT
                     PGDPYMESIQKENVHVHFTPVVSCTEKGVVGGDGVERQVDTVVCATGFDASYRPRFPI
                     VGRDGVDLREKWKECPNSYLGLAVPEMPNFFTFIGPTWPIQNGSVIGPLQAVSKYVVQ
                     WIKKAQNENLRSFVPRQDRTDQFNDHVQEWVKHTVWKDNCRSCTFLLSPRSQLNLLRT
                     I"
     exon            80360..81889
                     /number=1
     CDS             complement(83642..84481)
                     /codon_start=1
                     /locus_tag="AO090026000031"
                     /note="predicted protein"
                     /old_locus_tag="AO070200000008"
                     /protein_id="BAE59531.1"
                     /transl_table=1
                     /translation="MHPPYPAEFLTATEQHVECNGRPRSLPILSTVEMMRLDPVVATA
                     VGPKDGNNRIADALLKRALKELIPHLSHFQVERTEEDLARKTAEILQASAYICGAAQH
                     PRKVEALDFVMLHSLTAAVFFPTIIRQEWISIETRARLLEWKGRSDLITYAALGCPQL
                     YPDRITGYRPKEVATGWPDVVQHARVYQDDGHACKVIRALMCAEKVCQPFEGEEGFPL
                     KKADFLTLADMTMDSVERMLDPNWVRQTEKVKQMSAQGRGQHSQVSAIMLRWVRWCGT
                     EGA"
     exon            complement(83642..84481)
                     /number=1
     CDS             join(85656..86041,86061..86574,86692..86922)
                     /codon_start=1
                     /locus_tag="AO090026000032"
                     /note="NADH:flavin oxidoreductase/12-oxophytodienoate
                     reductase"
                     /old_locus_tag="AO070200000007"
                     /protein_id="BAE59532.1"
                     /transl_table=1
                     /translation="MARAGQAVDPSPLGEPLEFHFARRSTPNRFLKAAMSERMCSWSE
                     ENPSARGIPSSELIETYRTWGRGNIGAIVTGNVMIDPNHIEVEGNPIIPPSAPFSGER
                     FGQFTNLAAAARANGSLILAQISHPALVSDVPLDTKNMGNTFAVPRAATEDEIKNIIT
                     GFAHAAEFLDRAGYDGIELHAAHGYLLSQFLSQATNLRRDKYGGSPTNRMRLILEIRA
                     AITENVRPGFIVGIKINSVEFEPDGIVRDEAWELCRAREEHEFDFVELSGGRYKNLDE
                     DDTAKHVISKKHEAVSSLDFTLSEVDGIGLARPFCQEPFLCHDILSGKIPGATIPVMD
                     QLNYQLAVAAACIQMRQIRNNVQPMDLSSQDAVDAVTAAVKG"
     exon            85656..86041
                     /number=1
     exon            86061..86574
                     /number=2
     exon            86692..86922
                     /number=3
     CDS             complement(join(87384..88045,88103..88822,88889..89084))
                     /codon_start=1
                     /locus_tag="AO090026000033"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070200000006"
                     /protein_id="BAE59533.1"
                     /transl_table=1
                     /translation="MVAGGGVVSSSGMDAYRALPNNTNSNWFKDKGLRRLNFGLMLMF
                     ASAAANGYDGALMNGLLTLPMFAKNVGENISSNMEGLIISGISLGGMFTFIPASYFAD
                     YFGRKMSVALGSAIMIVASVIQAATVGRWAFFGTRIAMGIGLGFAQTAAPPLTTEIAH
                     PRHRGVVTAIFQATWYWGAILAAAVCLGTFYVEGSTWSWRIPCLLQCFFPAVQLVGLL
                     IVPESPRWLVSKDRRDEALQILARYHGNCDTSDPLVQFEFSEICSAIELENSVAHKSG
                     WSAFIATKGARHRLAICLLVGVMIQWAGNGVISYYLAPILRSVGITNPTQQSAINLGL
                     QAWNAVCAAGGAVAAEKYGRRPLWMLSTVLMLLFFTLATVLSAVFDESAIKAAGSAVV
                     AFLYLFYGAYDIAYTPLSIAYPVEIMPFYLRTKGLSLSLTAQFGAGFFNQFVNPIALG
                     AIKWKFYFVYLGLLVIFLGIIYFVFPETKGHTLEEIAVIFDGPGAETEVQRDLAAIIA
                     VEREVKAPMKEELEHAP"
     exon            complement(87384..88045)
                     /number=1
     exon            complement(88103..88822)
                     /number=2
     exon            complement(88889..89084)
                     /number=3
     CDS             join(89722..90075,90152..90281,90340..91664)
                     /codon_start=1
                     /locus_tag="AO090026000034"
                     /note="alpha-amylase"
                     /old_locus_tag="AO070200000005"
                     /protein_id="BAE59534.1"
                     /transl_table=1
                     /translation="MATQHKTQSSPVNAAWWKEASVYQIYPASFKDSNGDGIGDIPGI
                     ISELDYLKALGIDLVWLSPILQSPQVDMGYDVSDYYRIHPPYGTVEDVDALIQGLHQR
                     GMRYVMDLVVNHTSDQHEWFKQSRSSSDNEYRDWYIWKKPKYDANGVRQPPNNWGAYF
                     GGSAWQYDETTDEYYLHLFAPEQPDLNWENPKVRSAVHQIMRYWLDKGVSGFRMDVIN
                     MISKDQSFPDAPITDPKAQWQHGAMHYCCGPRLHEYLQELGRVLKEYDAFSVGEMPNV
                     YDPVEIGKAVGFDRGELAMAFQFEIMDIDHGPAGKFSPHKYRMSDLKHIVSKWQDFMY
                     ENEGWNALYLENHDQGRTISRFTSAGPEYRATAGKMLATFLGLQGGTPFVYQGQEIGL
                     VNVPETWGIEQFRDIETLNYWNEITAAYPNDTELHKVTSQQFRVKSRDNGRTPMQWTS
                     GKFAGFTAAHNGPWIDVHDDYEDWNAASQVGNPNSVFQHWAKVLALRKAHKRLFVYGS
                     YKLIDEANNDLFTYLRVYGSQSALVLANFTGKEVSWVVPAETISILKNGAVLLESYQR
                     HRPVRPDGTIAVMPFESFVMFLDSPNARVGAGGGKL"
     exon            89722..90075
                     /number=1
     exon            90152..90281
                     /number=2
     exon            90340..91664
                     /number=3
     CDS             complement(91838..93358)
                     /codon_start=1
                     /locus_tag="AO090026000035"
                     /note="predicted protein"
                     /old_locus_tag="AO070200000004"
                     /protein_id="BAE59535.1"
                     /transl_table=1
                     /translation="MVRRRACDGCSLRKTRCSGGQPCQPCVQSGFECSYLKPAAKPGP
                     KGPRAETYMRINRRLQSIRDRAPRGATETASPANVRAGLAEAADSSRAIPAFEVAGDE
                     QMPFLTEWPSQLPLADVLGHLEAYEHRMYPVWPVVDVARLRNSLMLDVNNDELRSLAF
                     AVCAATCAQLQCHPDNQRTQMFRVGKCSLADHFAKESEYCRSMYDYRESGTFEAVLGP
                     LFLHFYFGATNKMSTASLLLRESVTLCQLQGLDREDTYQDMAVEEETYRRRAFWLLYV
                     TERGHAIQHGINTCLKGSIRLPTRDCANECHLVEAFDSLVGLFISVEGVLLEPGGSPR
                     GPNTIMCSKDMLCRLQSQLRQRLQWPTAYHALQRTDIAITQQWLRVLLWQLSLKNIFL
                     SSASADDCMRLTYPVHVARDAIVLISNVPQDTFMAHGPGMVGGCVSRWHTVSLLNPGN
                     QTLRNHKYPTGCDSLCSLPCAPQPSWDIRYSPPFMLFTVISEPQTIWPRVAAEEIR"
     exon            complement(91838..93358)
                     /number=1
     CDS             94091..95098
                     /codon_start=1
                     /locus_tag="AO090026000036"
                     /note="predicted protein"
                     /old_locus_tag="AO070200000003"
                     /protein_id="BAE59536.1"
                     /transl_table=1
                     /translation="MTPAVDAHKIFPITTFISDLPSNLTPQLFSSSAENEPRSAGRRL
                     VIVGDVHGMKKSLDALLEKVCFDKGKGDHLIFVGDLVNKGPDSPGVIDRAVELGASAV
                     RGNHDNAVLDAAVEIKARGDNLMHAGGITSGSAKLPEDSGAELPSETVACDGPETSAS
                     PNASPLTRHSATTYSTARALSTRHLDWLAGLPLILRIKLPYHLTSSLDDTLVVVHAGL
                     TPGIPLEKQDPHAVMHMRSLTHAPGDERTLIPAEASGEEGWVAQWDQWQDQLTTRTTV
                     IFGHDAKRRLQLGRHTIGLDSACLYGHHLSALVIESTDRGIEHRIVQVECADTPVVPK
                     A"
     exon            94091..95098
                     /number=1
     CDS             97007..98542
                     /codon_start=1
                     /locus_tag="AO090026000037"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070200000002"
                     /protein_id="BAE59537.1"
                     /transl_table=1
                     /translation="MAGLQLNVDWKSNRRAIAFCLVAAIGALCYGYDTIYYTGVQGMA
                     WFAKDYGEEGSDGSFALGTTFLSLSASIIYVGELVGAIAAAPINDLFGRRAVFLSASI
                     CIIVGAVVQACSFGSHPVFYVSRVLIGLGVGQFTATCLIYIGEVAPSAIRGPALMCFQ
                     FMQSISQLVGACVNQGTQSIQSSQSYRIPMCLLVVLPGIMLLCLPFTPESPVWYMYKG
                     KREQAIKSLRKINHSNRDYDPSADIQAIDEAVQQEREMAKDATWASLITDPVERRKLF
                     YACGVMFVQQINGIQFWYTYGVVFAQSIGVADPFTINTIIYVLQIITVGVSVVFGNRM
                     KRRTNLLVCSCGMFVSLLTVGGLGTTKAADGTLSRGIGIGIVVLAYVNIIFYNFSIGT
                     LSYSIASEMSVGRNRNKITSCAMGVFFVTVWLMVFTSPYMYYTANLGPMIGFVYGGTS
                     LFLLAYSWFCVGETAGRSNADIERLFQDRVPVREWATYVIPSDDGEDLKKKGTNDEHI
                     EMA"
     exon            97007..98542
                     /number=1
     CDS             join(100931..101041,103795..104673)
                     /codon_start=1
                     /locus_tag="AO090026000038"
                     /note="ATPases of the AAA+ class"
                     /old_locus_tag="AO070200000001"
                     /protein_id="BAE59538.1"
                     /transl_table=1
                     /translation="MLKVATSRGHALVCLDARRRTELKVVEHRGNQEQEHLYDRGLRN
                     SQDLRSLFHNLVGFETIIGTFEGYQTMTANMNTPGLNPRKEVPFSFIFKGPPGSGKTT
                     TARALGKMYYSMGFLCTTEIMDCSVTDLIGTYVGQTGPKVKNLLEEALGKVLFIDEAY
                     RLGILRDAFTREAVGELVDCMTKERYMNKLVIVLAGYERSMDQLLSTNEGLRSRFTEI
                     VFPRLRPKDCLRLLQAKLLDKKINILRPRAVHVQQRVLVLFKKLGETASWADARDVGA
                     IAKEITLQLFMNPLPAGQPMEITLEEIARILKRFYRDRRSKKEEEEGGDSSES"
     exon            100931..101041
                     /number=1
     exon            103795..104673
                     /number=2
     CDS             join(106961..107159,108043..109635,109701..109840)
                     /codon_start=1
                     /locus_tag="AO090026000039"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070213000001"
                     /protein_id="BAE59539.1"
                     /transl_table=1
                     /translation="MKITAQSADGLADQEYQVLEAGFAEGPDGSGLAVIFQRDLLAEG
                     PWNGDRETDDYFNNSYCVTLGSGFGSVEGFNKVLYHTGLTGRLLLVTIIISLGLTMFV
                     YAMDEGVTQQFTMIAASSFHMHAQLGAVNTASTVINGISKPVIGKLADVLSRPTSYII
                     SLLFYVVGYAVAASCTNFVAYTVGVALTAVGKAGLNILCQIIVGDLTTLQWRGFWTSM
                     IIAPYLVTTFTNGFVVDAFVPDEWRWGLGMFAIMVPVLLTPAIIALYGTQQRARRMGI
                     MGSSSAEKGEQTTLYTAWQCLVAIDIPGLVLLGFSFSLILLPLSLAESAENGWNNRSM
                     IAMEATGFAILVLFVVFEIYLAPKPMMTKRIIANKVFLAALGANLFDQMTTTLGSNYF
                     SSYIYIIKGWNNYTWTVFTGARNLAITIFSLVGGFLQVRYHRYKTQMIIGAVLKVVGY
                     ATCFTSNQRSTQSTAALAISQVLLGTSALTALGSRIGAMASVPHEDMASIIAAYFLWT
                     YLGSAAGYAIASAIWTDKMLGFMRDELPDTPDSTLKKIYGSVDILRTQYDLDDPIREG
                     AIRAYTRTNGIIFIVAAAISTLSILCSFLMPDYYLGKQQNAVTNLGLDGKPVDIPTCG
                     KNERSFWTRIKYIISRRRS"
     exon            106961..107159
                     /number=1
     exon            108043..109635
                     /number=2
     exon            109701..109840
                     /number=3
     CDS             110359..111192
                     /codon_start=1
                     /locus_tag="AO090026000040"
                     /note="uncharacterized protein, possibly involved in
                     glyoxylate utilization"
                     /old_locus_tag="AO070213000002"
                     /protein_id="BAE59540.1"
                     /transl_table=1
                     /translation="MGNDKISAYYAPTGGLPPQTQLLTDRAMFTEAYAVIPKGTFSDI
                     VTSFLPFWEQTRLWVIARPLSGFAETFSQYIMEVQPGGGSDRAELDEGAEGVIFVVEG
                     EVSITLGGETHRLTEGGYAYLPPKSGWTLRNTGVATARFHWIRKAYEAVAGLDAPDPL
                     FLNERDIVPTAMPNTNNAWATTRFVDPTDLRHDMHVTIVTFEPGGVIPFAETHVMEHG
                     LYVLEGKAVYRLNQDWVEVEAGDFMWLRAFCPQACYAGGPGKFRYLLYKDVNRHMKLS
                     R"
     exon            110359..111192
                     /number=1
     CDS             complement(111698..112507)
                     /codon_start=1
                     /locus_tag="AO090026000041"
                     /note="predicted protein"
                     /old_locus_tag="AO070213000003"
                     /protein_id="BAE59541.1"
                     /transl_table=1
                     /translation="MAYTGRTLHPIAVFWLYTTTFYGTGIHLMQTIRRLGWTYGFLNG
                     DKHQRDDIPDVGVRRVAAELLSVPTLRLAMSVYLSYRPQELPLSLSWGWLALKIGLYS
                     ITVDFWFYWYHRLMHSVPWLWKFHRTHHLTKHPHPLLGAYADHEQEFMDILGIPLLAY
                     GTMKLMGFPMSFYEWYICYQYVVFSEIIGHSGLRMHGGTPSTINWLLQMFDAELVIED
                     HDLHHRYGWRKSHNYGKQTRVWDRVFGTCRERIEGHKDNIDYVNRVTFPLF"
     exon            complement(111698..112507)
                     /number=1
     CDS             115491..115937
                     /codon_start=1
                     /locus_tag="AO090026000043"
                     /note="predicted protein"
                     /old_locus_tag="AO070213000005"
                     /protein_id="BAE59542.1"
                     /transl_table=1
                     /translation="MKTSTVIGFLAMLSSQALALELEGTYTVASAGTELYLEDASGQI
                     IFEEGDPQAWFFIEAETDRYAIVNGVTNQYIHCGSTEGAICEASDVAQLFQIDNISDN
                     VYTFLEPESQLLLHRTTDNQLDLSLPTPTNDESFELTQASCKSLAD"
     exon            115491..115937
                     /number=1
     CDS             complement(join(122276..122832,122872..122992))
                     /codon_start=1
                     /locus_tag="AO090026000045"
                     /note="predicted protein"
                     /old_locus_tag="AO070213000007"
                     /protein_id="BAE59543.1"
                     /transl_table=1
                     /translation="MSQETSLNKTRTSGTKGERLDNLLQFLETHPISKETLDHFAYRA
                     IPTYGRVRKSDSSEDYLFAQTMNTPTTIPHFLTLQRKDFFPPPESPRGTISLSAGPRT
                     TSYRAPEYPDCITLLELGSAALDGHYGILHGGIAGATLDETLGLTASLHLAPRSQQGL
                     LGFTATLNVTYRTPVFTPSTVAVRSWVEAREGRKWVCKGQIVDADGVVLTEAEVLMLT
                     KVQKSTL"
     exon            complement(122276..122832)
                     /number=1
     exon            complement(122872..122992)
                     /number=2
     CDS             join(123441..124790,125194..125280)
                     /codon_start=1
                     /locus_tag="AO090026000046"
                     /note="NADH:flavin oxidoreductase/12-oxophytodienoate
                     reductase"
                     /old_locus_tag="AO070213000008"
                     /protein_id="BAE59544.1"
                     /transl_table=1
                     /translation="MVSPPGLLGLNVPAPNVSYFTPKHRQSPGAPVNIDASTPTLFTP
                     LKIRDVTLRNRITVAPMCQFSTAPEGPSIGALTDYHIATLGHFALKGAALVFVEATGV
                     QPNGRISPYCPGLWDDAQIPALKRVFDFVKSQGALAGIQLAHAGRKSSTAAPWVAGST
                     ELRKASLRAGEDQYGWPDDVVGPSGGIEQTWDGLGLREEGGYWPPRALTGDEIKELVG
                     DWAKAAKRAVQAGADVIEIHAAHGYLIHQFLSPVSNHRTDSYGGSFENRTRLLLEIIE
                     SVRKEMPAGMPLFLRVSSTEWLESTEIGTKYGTWTVEDTIRLAKLLPEAGVDLLDVSS
                     GGNHPMQTVNSFLTKDYQTKIAARIRKELKQSGVNLLIGAVGMITEAEQARDLVEADK
                     LLSQEAKDAADVTDAKQGSEPSADVLLIGRQFLREPEWVLRVAWKLGVDVAWPSQYLR
                     AQMAWARRLSGSSRQLGKPPAQGLKALI"
     exon            123441..124790
                     /number=1
     exon            125194..125280
                     /number=2
     CDS             join(125983..126092,126116..126243,126310..126491)
                     /codon_start=1
                     /locus_tag="AO090026000047"
                     /note="predicted protein"
                     /old_locus_tag="AO070213000009"
                     /protein_id="BAE59545.1"
                     /transl_table=1
                     /translation="MRTARRNSWEQGIRINYVAPWYTSPFPFSFAANQMEAYIKSAIR
                     SPTYEAELISKGVEFAPQEDVAKCFMRIATDRSINGHSLMITPASVAKEGFMDIDMDD
                     YTEGYFKRTQDVQLRIIEDQWVEGWEKGRTAEGGKKP"
     exon            125983..126092
                     /number=1
     exon            126116..126243
                     /number=2
     exon            126310..126491
                     /number=3
     CDS             join(126789..127451,127518..127751)
                     /codon_start=1
                     /locus_tag="AO090026000048"
                     /note="dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /old_locus_tag="AO070213000010"
                     /protein_id="BAE59546.1"
                     /transl_table=1
                     /translation="MTKIAIPTTPPSRSLQGKTAIVTGAGCLGDGIGNGRAIAILLAS
                     DGCNVLCVDRNLEWAERTVNMIKAQAEDALVEGKSVYGNATAMQADVTNPGDCESIVS
                     TALTTFNRLDILVNNVGISGAAGTAVDVDMEEWAKSLEVNVSSMVFVSKYAIPAMMQN
                     ERDEYSGMRGSIVNMGSVAGLRGGTPHLLYPTSKGAVVQLTRAMAAHHAPDGIRVNCV
                     CPGMLFTPMMYGGGMSEEAREARRKRSLLQTEGNGWDCATAVVFLAGPHARWMTGVIL
                     PVDAGTTAAVGIGMPKSASVNG"
     exon            126789..127451
                     /number=1
     exon            127518..127751
                     /number=2
     CDS             complement(join(129400..130230,130279..130892,
                     130940..131270))
                     /codon_start=1
                     /locus_tag="AO090026000049"
                     /note="predicted flavoprotein involved in K+ transport"
                     /old_locus_tag="AO070213000011"
                     /protein_id="BAE59547.1"
                     /transl_table=1
                     /translation="MAISTEQLAANGHTNGHTNGTATPLDSSSTSEKPVHPRSVPLNR
                     EYGYTPRKLRIITIGAGFSGLLMAHKIQHRFKELEEYVTHTIFEMRKDIGGTWLVNDY
                     PGVQCDVPAHIYAFPFDPNPNWTKFYASGPEIQAYIKNTVAKWNLDRDVQLNTRVVGA
                     RWNENDGVWKVTVERDGVQRDEFAEILISGQGVLCHPSWPTIPGLRQFKGKVVHSAEW
                     DHGFDYSHKRIAVIGNGSSGIQITPQMANLPGTEVVNFVRGGGWIYYRIPPSRHLGRT
                     TDEVNPTYTEEEKTRFQDPEYHHQYRKGIIDRTNKAYKLFLKGKNNEEAVRFGTEQMA
                     AKLNHDPELCRILIPKWEVGCRRVTPGPGYLEAFSKPNCNLTDSPITHISENAVHTTD
                     GNVFECDVVICATGFDVSHRPRFPLIGQNGANLAEKWADEPESYLSVATAGFPNYFIF
                     SGPNSLGGHGSLVEALNWTGDYFVKWIKKIATEDIKSVVPKKSAEEAFVRYGDEVHKT
                     IVWTGSCKSWYKRNKANGRVTALFGGSALLFNRLISELRPEDFEIEYHSANNFRFLGN
                     GFLEYEMDPEQDLSWYVELPEPLKQ"
     exon            complement(129400..130230)
                     /number=1
     exon            complement(130279..130892)
                     /number=2
     exon            complement(130940..131270)
                     /number=3
     CDS             join(131605..131697,131747..133699)
                     /codon_start=1
                     /locus_tag="AO090026000050"
                     /note="predicted protein"
                     /old_locus_tag="AO070213000012"
                     /protein_id="BAE59548.1"
                     /transl_table=1
                     /translation="MVTSTPWLQFTGHQPKRKRAELACIICHSKKIRCDLQVRSRQGL
                     RTCTNCETASKECRTRPSKRRTRRTRDPLSPLNSGSIEQAQPVVEDSAKDTTDENVTL
                     PEPQWAWSFDNPSPLPEDSTQLTHAHLNPPVDHPGGNLSCSPATCRTNDTDTRRDFSS
                     RYYELEIQADARNQEQRLLAQRQPDVPHLPSPDLQQSFIETYLEYCSPWCPVLDRDQL
                     EIDELSQSPLLVNALAIVGSHIQPPVLPHDGPAAYYERARNLFYNDAEPDVVRSLQAV
                     SLFYWWSPRPPTILHRHSSWWWTSCVVRHCQQLGVHHQPSLGPGPASSQHNQPANHRS
                     HLIRRRIWWTAFARERLTSICQGRPSIIDEADCDITEPTLDDFPDALIDHRARVRAEI
                     FIHWVRLCAVIGRIAKYLTRPASAINTRFPTHLAQELIAWVQSLPPHLQLPINADRTT
                     TFNRDVHQMHLPYLAVIIMLHLKLPYQPHNSAAYPPAILAASCVARILRDTLARGGTR
                     FLMAITGSYCGMAFIALLQACRVDGLAAAANEDLDILTLAVDQLRSMWPTAQIFHDGF
                     QRLRPSAAGAEALLSLSNSGPSAPVGLASTVPNVELAITEVPVGPGTGNGLANNLLEG
                     LNWMDYFPFATAQTSGVAERLLVPRTGEMTFEEFPESMVQFQDLFADCNFPDINLFT"
     exon            131605..131697
                     /number=1
     exon            131747..133699
                     /number=2
     CDS             complement(join(133795..134089,134143..134494,
                     134559..135355,135433..135626))
                     /codon_start=1
                     /locus_tag="AO090026000051"
                     /note="predicted flavoprotein involved in K+ transport"
                     /old_locus_tag="AO070213000013"
                     /protein_id="BAE59549.1"
                     /transl_table=1
                     /translation="MGSIGSTPYTHNNGHLDYDVLIIGAGLSGIYTLHQMNTFGLRAK
                     VLEAASGPGGTWFWNRYPGARFDSESYSYGFSWSQEVLDEWSWSEHFAAQPETLRYCE
                     FLVDKFNLRPGMQFNTRVKAAHYQEDTKSWLLTDERGQQYSSRWLVTCMGILNEYTLP
                     NIPGVHDFAGQAIHTARWPHSPVSFEGKRVGIIGTGATGIQTIQEVAKTAGHLTVFQR
                     TPNWSAPLNNGPITTEEMEEIRKQYPEIFKKCKESYSCFIHKSNPASVFSVSEEERER
                     FWNELYETRGFQKWLSNYYDIGTDKRANALYSEFIANKIRERVKDPKTAELLIPKCHG
                     FGTKRVPLESGYFESFNRPNVSLVDVKSDPIERITASGIKTRDNAYDLDILIYATGFD
                     AVTGAFAAIDFQGVGGVKLSKRWSEGPRTFLGLFVESFPNMLMVMGPHQMFGNFPRSI
                     EYASHWVAEFIRWASEQGVSSAECTREKVEEWTEHVHACAEGLLANEVDSWMTGVNKN
                     LAHKQKRIIARYNGPAPGYRARADDVAARGFEDLVIT"
     exon            complement(133795..134089)
                     /number=1
     exon            complement(134143..134494)
                     /number=2
     exon            complement(134559..135355)
                     /number=3
     exon            complement(135433..135626)
                     /number=4
     CDS             complement(join(135896..136490,136560..136700,
                     136754..137100))
                     /codon_start=1
                     /locus_tag="AO090026000052"
                     /note="predicted protein"
                     /old_locus_tag="AO070213000014"
                     /protein_id="BAE59550.1"
                     /transl_table=1
                     /translation="MAQDRLIEIPSGASITVKLINPVNFGPSHLTRFMAPQVPGLDTF
                     ARNPAFSFLIEHSSGRKLVFDLGIRKDWENYAPKIAEYIPTTGYKIEVTQHVADILEE
                     HGVKAKDVEAVIWSHWHWDHIGDPSTFPPSTDLIVGPGFRDAMLPGYPANPDSPIRET
                     DYANRTLREIPFTGPTTLHIGQFPAYDYFGDGSFYLLDSPGHAIGHLCGLARTTTAPD
                     TFILMGGDIAHYTGIFRPSKHLPLPDSIQPHPIFPSCEAAFCPGSAWEELQSSRGRKV
                     TDSLFEPTFGHDIPLAIETISKLQEIDCDEDVLVITAHDFAVRDGVDHFPAALNDWKE
                     KGWGRKLRWAFLRELEAYWKAKGLVE"
     exon            complement(135896..136490)
                     /number=1
     exon            complement(136560..136700)
                     /number=2
     exon            complement(136754..137100)
                     /number=3
     CDS             join(137519..137779,137834..138112,138162..138202,
                     138249..138967,139017..139225,139279..139305)
                     /codon_start=1
                     /locus_tag="AO090026000053"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070213000015"
                     /protein_id="BAE59551.1"
                     /transl_table=1
                     /translation="MDSPPQDSLSEGKPVADHIEASPQKTEKIDTTRTDEAMKVLAHY
                     TGEQSWEPSEEKRLVRKIDWRLLPVLCMTYGLQYYDKAMLSQAAIFGLRQDLGLIVGN
                     RYSMSAAIFYLGFIVGAYPTMFLAQRYPIHHVASGIVTLWGICLILTSVCHNYQSLYA
                     QRFFLGLLESGISPMFMMIVGGWYKKNEQALRMGIWYSCTGYVSIFSPLINYGLGHIK
                     GSLSSWKYMYLFAGALTIFWGVCLEFLLPSDPVSARGFNERERYISVARMRTNNSGVR
                     NTHFKMGQVVELALDIKFWLIFFTAFLAMIANAPVSTFTPIIINSFGFSTLESLLLVI
                     PAGFYGGTMMLILPWLGYKYTSKGIRSWLVIGGQIVTTVACLLLLLLPLNETGGLLFA
                     CYILPTMGAGYAVLMGLQIGNIAGYTKRSLSSSGLYIGYCLGNFVGPLCFREQDSPRY
                     VPGFIVTVVTSVIAAVLVFVYRFVCLYDNRRRDATGVLEGFENAYQDDLTDKTNPQFR
                     YTV"
     exon            137519..137779
                     /number=1
     exon            137834..138112
                     /number=2
     exon            138162..138202
                     /number=3
     exon            138249..138967
                     /number=4
     exon            139017..139225
                     /number=5
     exon            139279..139305
                     /number=6
     CDS             join(142481..142803,142862..143174,143253..143287,
                     143336..143374,143465..143606)
                     /codon_start=1
                     /locus_tag="AO090026000054"
                     /note="predicted protein"
                     /old_locus_tag="AO070212000018"
                     /protein_id="BAE59552.1"
                     /transl_table=1
                     /translation="MLESSASTYVVLKVYVTGQARAHVRELRIYKQMNEVETNYPGRN
                     FIRKLLDHFDIEGPHGRHVCLVHEPHGTSADFLVKMFPGHAMTLDDMKPGIRQLLIAL
                     DFLHSGPNTVADLQLKNLLLPGPETSYLSRFEEAEVADPSPRKALKDRTIYKSLGFPP
                     KGGLPILADFGEARLGDQEHNEDIMPNVYRAPEVILRSNWGYKVDIWSVAMVLSHSDQ
                     WQKPRWPSTARIPETETPQGRQRRVLAVAPDGLAVEPRGPTDGVGTPIRRVADEGARG
                     MRRGTSK"
     exon            142481..142803
                     /number=1
     exon            142862..143174
                     /number=2
     exon            143253..143287
                     /number=3
     exon            143336..143374
                     /number=4
     exon            143465..143606
                     /number=5
     CDS             join(144270..144405,144469..144698)
                     /codon_start=1
                     /locus_tag="AO090026000055"
                     /note="predicted protein"
                     /old_locus_tag="AO070212000017"
                     /protein_id="BAE59553.1"
                     /transl_table=1
                     /translation="MAGNFYESAEAVRLDGPVLFARLRNVDGGWEDAEIDLNEFIGNV
                     DGQFVWDEPNFFETAAEVEFNFEGDDNVPILRAQLRDREGQWVPADINLGERLINING
                     HFEFQYVSCTDLYILRPNY"
     exon            144270..144405
                     /number=1
     exon            144469..144698
                     /number=2
     CDS             complement(join(145266..145566,145641..146539,
                     146632..146763))
                     /codon_start=1
                     /locus_tag="AO090026000056"
                     /note="predicted protein"
                     /old_locus_tag="AO070212000016"
                     /protein_id="BAE59554.1"
                     /transl_table=1
                     /translation="MGSTREKPIARLPLKQDNCKEPDWRWVSSLPLFAVLQGIACLYH
                     VLRITVTSETGSLRRIARRADSQPYYDDSNVFMRPFRYVGILSALARIAVADEQTECN
                     PLNATCPADPALGTEHTWWFNSTLDEKLWNMTTGVPTYTSEGAEFSIKTENGSTLLQS
                     NFYIFFGVMEAHVKMAKGAGIISSVILQSDDLDEIDWEWVGYNTSQVQSDFFGKGNTT
                     TSDRGGYHAVANADTEFHNYTSYWDKDRLEWWIDNELVRTVNYSEPLTVYGKNYPQTP
                     CRVKVSNWPVGIASQSIGNIEWGGGLVNWTNLPFTMTVQRIRVQDFHSGKEYTYSGNS
                     GSYDSINVVSGNSTAKTEINKKPAKTLAQKWDDLGKAAHIGVYCGAAAAGVLIVAGIA
                     LWCVRQRRKGRLERGLAEGPPSTAKPIEMEDYKNRWRQSDWGHRGYQAVDQ"
     exon            complement(145266..145566)
                     /number=1
     exon            complement(145641..146539)
                     /number=2
     exon            complement(146632..146763)
                     /number=3
     CDS             complement(join(147941..148095,148147..148239,
                     148296..148355,148411..148544,148602..148696,
                     148751..148908,148958..149338,149390..149646,
                     149708..150084,150149..150280))
                     /codon_start=1
                     /locus_tag="AO090026000057"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070212000015"
                     /protein_id="BAE59555.1"
                     /transl_table=1
                     /translation="MDEKTSLGATAHNETLTQATKSGLADPADRRESFALNLVENPLT
                     RSSPEQAVLDARAFAESHQMAEHADLFGRAALVARDPQRFEMITELSEDERAALIYER
                     DHKWHGPFMLWYSIALCAVGAATQGWDQTGSNGANLSFPQEFGLVGTARAEWIVGVIN
                     AIIFLTAGLIGAFIVDPLNHYLGRRGEIFVTACCLTATPIGSAFAKSWQGLFAARFVM
                     GIGIGAKNATVPIYSAEMAPARIRGALVMFWQLWVVAGIFLGFCANVIVKDTGDISWR
                     LQLGSAFIPSFILGAGIYFCPESPRWLMKHGKYASGFKSMLRLRAHPIIAARDFYYSW
                     IIYEEELKEARGAGYFARMWDCFAVPRIRRANYGASTVMLAQQMCGINIISFYSSTIF
                     EDVGYTSEQALYASLGYGAIQVVSTIPTLFLIDTKGRRTLTLATFPLMCIFLLAGGLS
                     LLKDDGSRGEQIGPVVLFVYLFTICYSLGEGPVAFQYSAEVFPTIQREQGMAWAVCIN
                     NTFAGVLSLTFPRMRTVMTPTGAFGFYAGLNLIAWFMIFCFVRETKQLTLEELDQVFS
                     VPTKDFIHHELTVWLPYFIKRHIFRRNIEKPPPIIAAADGPVGSRAA"
     exon            complement(147941..148095)
                     /number=1
     exon            complement(148147..148239)
                     /number=2
     exon            complement(148296..148355)
                     /number=3
     exon            complement(148411..148544)
                     /number=4
     exon            complement(148602..148696)
                     /number=5
     exon            complement(148751..148908)
                     /number=6
     exon            complement(148958..149338)
                     /number=7
     exon            complement(149390..149646)
                     /number=8
     exon            complement(149708..150084)
                     /number=9
     exon            complement(150149..150280)
                     /number=10
     CDS             join(152280..152387,153824..154399)
                     /codon_start=1
                     /locus_tag="AO090026000058"
                     /note="predicted protein"
                     /old_locus_tag="AO070212000014"
                     /protein_id="BAE59556.1"
                     /transl_table=1
                     /translation="MLDNVLGRSILKLGNPDIMQMHARISYFISAHGICHIPNAIMLN
                     GMAALPAHPHVVLAGDARLGAVFRIDTDTGNVGIAFKDPLLTAPTNASTPIGVNGLKI
                     AGDYMYFTNTAREIFARVPIDGFGQKTGDIEVIVALNDAESYNWDDFVVLEDLNVAYL
                     AQPDNAIAQVSLDGEQKIIVGGGDDGTTLVGTTSLAITQDGKTLYATTRGGTVDGSVY
                     GGQVVRVQL"
     exon            152280..152387
                     /number=1
     exon            153824..154399
                     /number=2
     CDS             join(154934..155450,155551..155585)
                     /codon_start=1
                     /locus_tag="AO090026000060"
                     /note="predicted protein"
                     /old_locus_tag="AO070212000012"
                     /protein_id="BAE59557.1"
                     /transl_table=1
                     /translation="MSSDLYKSLPLEPNATRMVRLLPDKETNAEIECELFTYDLTETE
                     GGKHLYEALSYVWSGDEEGSAEKHKEIILHDHTIPITANLHAALVNLRDHQLERVLWV
                     DAICINQDDMDEKNQQIPLMRTIYAQADRVIIWLGEAFEDGDKALEIIRTLAEKKFMS
                     GNDSATKLLESSSTSRSRCCSVD"
     exon            154934..155450
                     /number=1
     exon            155551..155585
                     /number=2
     CDS             155767..157212
                     /codon_start=1
                     /locus_tag="AO090026000061"
                     /note="predicted protein"
                     /old_locus_tag="AO070212000011"
                     /protein_id="BAE59558.1"
                     /transl_table=1
                     /translation="MYRYHMASTSHDKVYALLGLAADDPNTPGLKPDYNVPWYDVFSN
                     TIQYILSGEGIVETYPEKDIAIIQTKCWILGCIGSVEDIYESNRQKLNILFNDTPESS
                     VFQNEWGRRWMIQASAEPIQSCDILCLLRGNSNPCIIRLSKDHFTIINIAITPQQPGY
                     NDNPDTESLREMDPRQNPPYDITLIWAIPVSDTENEVRPRDPMELIQIAPQYQKERPD
                     TEKGSTDLRVIVDGIAVQLADQGEPDLFKGWLTQMGTAVPVSEQVVKAVVGNTTPDGP
                     QIVKVLLQYQDNLPVTEEVVKVAAGNEGYCGDEIMRLLLKYRHSLHISEEVVKVVAMN
                     KGPYAHYIMERLFKYQKNIPVTEEVIKAAAGNRGVRGPELMEILLNHRHSLPVTEELV
                     RIVAGNEGLYAKDIMWVLFKHQDDILINEEMVTTVEQSELPERYEIVKWMLFKHQEMI
                     RKPGWKEKFQNTARKFRQEGLSIMSTKHHRK"
     exon            155767..157212
                     /number=1
     CDS             complement(join(157548..157834,157919..158033,
                     158144..158773))
                     /codon_start=1
                     /locus_tag="AO090026000062"
                     /note="threonine dehydratase"
                     /old_locus_tag="AO070212000010"
                     /protein_id="BAE59559.1"
                     /transl_table=1
                     /translation="MAFIHHSNASRFSIQAQTEAAVCMKNLSNWTPAVAEIRTWPEYT
                     PQPLRTLPGLAQKLGVNQVFVKDESKRFGAYFGSFKAIGAPYAVYKILADESYTKTGV
                     RPSPVELRTFKYRDITKSVTVCVASDGDQGRGLAYGAQLFGCRCAVYIHSHVSEGRAD
                     ITKELGAVVIRVYGEYKASVSRAKEDARMNNWFFVSSTSWPDFDNDIPQHGFYTRLHD
                     DRPSGIPQFIVVEPSEADCLLQSARHGNQNGFVAVPDTIAVDSMKTLASGCEGDISVV
                     SGESSAASMCVLLRASTDSTVRNKLGLDANSQVLLFVLEGTTDSQIFESLVGTSPAAV
                     FAAKGPFAV"
     exon            complement(157548..157834)
                     /number=1
     exon            complement(157919..158033)
                     /number=2
     exon            complement(158144..158773)
                     /number=3
     CDS             complement(join(161839..161969,162028..162299,
                     162368..162605,162655..162742))
                     /codon_start=1
                     /locus_tag="AO090026000063"
                     /note="predicted protein"
                     /old_locus_tag="AO070212000009"
                     /protein_id="BAE59560.1"
                     /transl_table=1
                     /translation="MKLLLLTLSAALASALSQDIPWSPPGPGDVRSPCPVLNALANHN
                     ILQHDGKDITQQDTISAMDALHVDEELSNTLFAAALKTNLTPNATTFSLDDLDHHNII
                     EHDGSLSRGDFYFGDNHSFNQTLFDQVKSYWTEPLIDLHLGAKARLAGVNRSKATNPT
                     FDLSGFRLRFSYAQTATYILVFGDKVSGTVNKTWIEYLFEKERLPVELGWEKQETPIS
                     TSDLDSMIERVMQATKEIENSQEM"
     exon            complement(161839..161969)
                     /number=1
     exon            complement(162028..162299)
                     /number=2
     exon            complement(162368..162605)
                     /number=3
     exon            complement(162655..162742)
                     /number=4
     CDS             join(164523..164849,166077..166110,166168..166602,
                     166658..167329,167385..167806)
                     /codon_start=1
                     /locus_tag="AO090026000064"
                     /note="uridine permease/thiamine transporter/allantoin
                     transport"
                     /old_locus_tag="AO070212000008"
                     /protein_id="BAE59561.1"
                     /transl_table=1
                     /translation="MLEESLRRTWWELVFSEGILSGLYRHQRFTRATYFSDVLLPCEE
                     TDYENLTIPDPSNLVSLTQFDKRIFNPNSVEFSSYSYRIEAVRIFVNVLTLTEPDSNM
                     RPSQVHAWRNRDLIPLPPDRTTWSSWDFLYLWSTVFFTTFGWQITSSLLGLGLNVWQS
                     ILCNIITKFLQTAVVFCVAWPGGVWHIGFTVNSRSVFGMWGSYVPVILRIFLCIIWYG
                     VQAFTGGQLVAIILSTIFSGYHHMENTLPESAHMTTKQFVGYVIFNIISLGLLWVPPD
                     KLKKPFKLIAAINLLVILGLAIGLIAGARGGSLGTLQTSQRTDNLGWTFIHGFAVVFS
                     GNAVGMASHSDFSRFARRPGAQVKGQLFSFLISGNVVPILGIFGTAAAAKMYGDVNEL
                     GLWNPPNILQMWLDNQYHNKAMRAAAFFVAFGLTSSIMAMNSIENGVSGGMDIAGLYP
                     RYFNIRRGSYLLAAISVVINPWQIIANGAIFTNTLNSFGVILFPLMGTMVADYYVVRK
                     QKLKLSDLYRADASSIYWFEGGFNWRAFTAWLVGFAPSVPGLAALNPHNTGIPIGLTY
                     TFYLWPIAGFFASFVLHAGLCYLSPPAGIGKVDEQEFHDPMYSERSDEMQSQTITAME
                     KGQHR"
     exon            164523..164849
                     /number=1
     exon            166077..166110
                     /number=2
     exon            166168..166602
                     /number=3
     exon            166658..167329
                     /number=4
     exon            167385..167806
                     /number=5
     CDS             join(168367..168468,168560..168814)
                     /codon_start=1
                     /locus_tag="AO090026000065"
                     /note="predicted protein"
                     /old_locus_tag="AO070212000007"
                     /protein_id="BAE59562.1"
                     /transl_table=1
                     /translation="MIAEIHSLAEYEAELAKPGLAVLDFYAPHCGPCHTRAAYASTRY
                     TASMFLCMPVLMQVLQVNGVDEEGAEVQKKAEVTWWPTLVVYKDGKEIWRDRVPNPPS
                     RKPLESLEYYLKTVVA"
     exon            168367..168468
                     /number=1
     exon            168560..168814
                     /number=2
     CDS             join(169223..169256,169319..169885,169958..172344)
                     /codon_start=1
                     /locus_tag="AO090026000066"
                     /note="N-methylhydantoinase A/acetone carboxylase, beta
                     subunit"
                     /old_locus_tag="AO070212000006"
                     /protein_id="BAE59563.1"
                     /transl_table=1
                     /translation="MQSVRIGVDVGGTNTDAVLIDLGQRETPSRGILSSHKAPTSPDV
                     TTGIQEAINTVLRDSQVAPDNVASVTIGTTAFLNSVLEQDPRRLSKVAIIRLSKSFLR
                     DVKPFSEWPAGLASLINGYVGYIDGGLHIDGSQEAPVVESQVVRECENIKALGLTTVV
                     VAGVYSPIDEVFRQEETVREIITREIPGVDVVCSKEIANIGFLERENAAILNGAILRY
                     ARQTIRRFHGAMKSLHLQCPLFLTQNDGTIIDATTAAKTPIRTFNSGATNSMRGAAYL
                     AGEDLANKSTIVVDIGGTTTDVGVLLPSGLPRQASAYVKAAGIKVNYSMPHLYFVGLG
                     GGSIVRDGQSGAKKGAVTVGPDSVGHRLLTEGLVFGGDVLTATDIAVAGGQCVVGNAE
                     SVKHLASKLVSASQTRIKQILERSIDLMKTSPEPLPVLLVGGGAVLAPAELEGASKLI
                     NPPFFDVANAVGAACAKVGGTVDKITSIANQSIKDAVEEAKKAAIERAIQAGAVEDSV
                     FIAEVESMPIPYISNQLRTVVKAIGNLDTERSMGMFVDNDDGPVEEDTIDENPRTTEH
                     LQVPEVIPVDHLTYRPNVVFNEKAGWHEWLLTETDLNYIADGAYVLGCGGGGSPDAGR
                     IQLQEMLRQGYKIRCIDHSVLPDDALVYWGGRMGSPATTVERLQAHETVDAIGQLMHY
                     MGHKSFDAVMGLEIGGSNGLEAFQWGSDRFYDRPVIDADFMGRANPMIWQTTMAVYRP
                     GELTPCAIDSGDGRSVIMPRAGDDEMVDRVLRAALTEMGSLVGLSARPTNGAAVREFA
                     ILNTVSLSWRIGRAIAQAAQYSTLLTVPEAIIAEAGGPQSAKVLFRGKISGIEQTVYK
                     GHSYGELIITEVPAEDDDQATNQNCSPAVAQGGHIRIPFKNENIYAEHHAADGSKKII
                     ASVPDLICILDKESGKPIGVPEYRYGYQVVVLGLACSPHWSKTERGLEIGGPKGYGYD
                     FAYEPLGEYFEPRSVIDEFKEVN"
     exon            169223..169256
                     /number=1
     exon            169319..169885
                     /number=2
     exon            169958..172344
                     /number=3
     CDS             join(173272..173280,173304..173406,173502..174214)
                     /codon_start=1
                     /locus_tag="AO090026000067"
                     /note="predicted protein"
                     /old_locus_tag="AO070212000005"
                     /protein_id="BAE59564.1"
                     /transl_table=1
                     /translation="MIVMKLGELVNTVPTIGFNVETVEYPRKYRWTIWDMSMSRRSVK
                     QLIHSYFPGTDIVLFIHNCDPQQPEPIYDFHYFVDFVHKHGCKHMWILLNKQDTLPAE
                     SAPEIVDGLRKKYEKEMAKYDQLSWKILDHKLSAKTGEGVQEILHQLHSSANLLLRTR
                     PKPQPQPRTEPEQDPEPNPAPEIAEDTVSSPRLSEPINRKASQDSVNAQAFWNSFVTG
                     DIPVWDHHAHLKVTYILVLEYVQQRRSTFAMADTMLAHLRRLRNSQPEKFGNREHR"
     exon            173272..173280
                     /number=1
     exon            173304..173406
                     /number=2
     exon            173502..174214
                     /number=3
     CDS             join(175633..175970,175978..176356,176378..176417,
                     176526..176791)
                     /codon_start=1
                     /locus_tag="AO090026000068"
                     /note="choline dehydrogenase and related flavoproteins"
                     /old_locus_tag="AO070212000004"
                     /protein_id="BAE59565.1"
                     /transl_table=1
                     /translation="MSTLRRRPEALLQQRGIRAKQRPCASIITEALVQKVLFNETTAT
                     GVKVITGGGAHTTEAKKEVILSCGALNTPKILELSGIGNKEILDRYRISVVVDNSNVG
                     ENLQDQLMTGSFEVVDGVIRGDALMRQETETMEEATKLYYEHNASPLTIGGVQSTAFM
                     PCLDENGARYEKHIKDLMDRFLSDTDDREPAIRGILEQPDSPTWAQFMFICQANLHET
                     GTISLARSFCWAILSALVLFRRPHFVCERGGQAGSERAFLTNLESANQYLRDTATTTY
                     RPCGTAAMLPREQGGVVDEKLRVHGTTNLRVCEASILPLITVGNIMSTVYAVAERAAE
                     IIKADA"
     exon            175633..175970
                     /number=1
     exon            175978..176356
                     /number=2
     exon            176378..176417
                     /number=3
     exon            176526..176791
                     /number=4
     CDS             join(177834..178157,178216..178512)
                     /codon_start=1
                     /locus_tag="AO090026000069"
                     /note="predicted protein"
                     /old_locus_tag="AO070212000003"
                     /protein_id="BAE59566.1"
                     /transl_table=1
                     /translation="MSIHNHNKPWLRGAEEFRGQRLLPHVIDYHAHNEPNRVFNSMPR
                     TQNIADGFRDVDMKTMATAVNFMAWWLDGHFKDVPKEKKVLAYVGVPDIRYPVLLFAA
                     IKAGWTTFWVSPRNPPDHNLYLLLEAKVNLVLYADLMEPVVKGIQQLNSTAQIPYTVV
                     PSVDEVLNGQSPPYPFDVLFADVKDERCLAMHTSGSTGTLPPLKAY"
     exon            177834..178157
                     /number=1
     exon            178216..178512
                     /number=2
     CDS             178704..179714
                     /codon_start=1
                     /locus_tag="AO090026000070"
                     /note="predicted protein"
                     /old_locus_tag="AO070212000002"
                     /protein_id="BAE59567.1"
                     /transl_table=1
                     /translation="MPPLRPVPFCDHTTNEKKLGGTMAFMVIPTFSTTATTVWGPSTM
                     PPSGQLVSSITNQTTVRALYLPPSTIEQWWTCDPDARKKAEGLDFVLFGGGPLAPSVG
                     QKLSELTDLCQMYGSIESGQIQMLVPQPGEWQYLEPNPAEECDMQRVEEGSGLYELVL
                     HQDEKFRGRRTLSHTFPDVKEWRTKDLFTPHPTKAGLWQFHSRTDDLIALGTSAKVFP
                     VPMETALQGDPNIAGALVVGNARPAVVLIIEPVQSVSHENREEFVDKIWPSVVEANGA
                     APTQGKISRSRILLTDPEVGFARTPKGTIARKTSEAIYTAAIDALFRGGIVEDNGLTG
                     AF"
     exon            178704..179714
                     /number=1
     CDS             complement(join(180406..181214,181315..181946,
                     182015..182157,183730..183732))
                     /codon_start=1
                     /locus_tag="AO090026000071"
                     /note="amino acid transporters"
                     /old_locus_tag="AO070217000014"
                     /protein_id="BAE59568.1"
                     /transl_table=1
                     /translation="MAPTSANRASKGNIQVDEARLEAALGHKQELVRGFGLFSLTSLG
                     IIIANSWAATGGTIVTALYNGGPMAVLYGLILVTIFYAFISASLSELASAIPSAGGVY
                     HWSSVVAGKYGRAAGFFTGYLNACAWLLSAASMSSVLGNEAVAMYLLRHPGVEWHSWQ
                     PFIVFLVVLWMCCAIVCLGNRYLPLINRISLVLSMGGWFITIVVLAVMPRGRHASNAQ
                     VWRIYYNETGGWSDGICFLSGLLNAAFAVGTPDCISHLSEEVPQPERKVPQGIMLQLL
                     TAFLTAFVYLIALFYGINDIDAVFNTNVNYFPVAEIYLQATGSTAGAVGLIALLFLAT
                     FPTLVGTLTTGGRMWWSLARDNATPFPSFFGQVHPTLDCPVNATVAMAVMVSCLGCVY
                     VGSTTAFQALISSFIVLSTLSYAGAIVPHILSRRRSVVLGPFAMPHKIGYVVNILAVL
                     YIAVTVLFFCFPFTLPVTVQNMNYTSVITVGLMTLVGIWWLFQGMRTYKGPTYSREAA
                     ERLAMGKQESSAEMSAMDGM"
     exon            complement(180406..181214)
                     /number=1
     exon            complement(181315..181946)
                     /number=2
     exon            complement(182015..182157)
                     /number=3
     exon            complement(183730..183732)
                     /number=4
     CDS             complement(join(186202..186313,186368..186502,
                     186575..186702))
                     /codon_start=1
                     /locus_tag="AO090026000072"
                     /note="predicted protein"
                     /old_locus_tag="AO070217000013"
                     /protein_id="BAE59569.1"
                     /transl_table=1
                     /translation="MRFTLACLAALASSAAAYMVNAPMTGDQVPIQAGTIITWSAVDT
                     DQPTFDLWLVNMRHFEPYARQIGQGINRDAQTYRVQGVSGVPPNTGYQFNFVRHGADA
                     NEAKERPLAQSGDFTVYGEGTV"
     exon            complement(186202..186313)
                     /number=1
     exon            complement(186368..186502)
                     /number=2
     exon            complement(186575..186702)
                     /number=3
     CDS             complement(188478..189998)
                     /codon_start=1
                     /locus_tag="AO090026000073"
                     /note="2-polyprenyl-6-methoxyphenol hydroxylase and
                     related FAD-dependent oxidoreductases"
                     /old_locus_tag="AO070217000012"
                     /protein_id="BAE59570.1"
                     /transl_table=1
                     /translation="MGKTWDVIIAGAGPVGLFLACELAIAGVSVLVLEREMQPESPWK
                     EGLFGRRGLYTPAVEAFYRRGILKRIFGDDERPTHLKKTEGFQYGGHFAGLVLNANNI
                     EFSRWPYRLPGPSFLPGPTSLGRLEAVLSERAETLGVQILRGMEVSRLADEGESVKVW
                     AGDQWFTAQWLVGCDGGRSTVRKTAGFEFVGTEAEFTGYIAVCDLDRPDLLKSGFKHT
                     NSGMYIVSGPGQLHVIDFDRSFDRSQTITREHFQEVLRRVSGTNIVVEALHLASSFTD
                     RSKQATEYRRGRILLAGDSAHTHSPLGAQGLSTGIGDAMNLGWKLAATVKGFASPGLL
                     DTYHQERHPEAARVLEWTRAQVAALRPDPYGQAIASLMRDMINTQDGATYLADRIWGL
                     SVRYGPGDAHPLVGSSAPDFEFDDGMRLGAKLETGSFLVIDFGSNNQVAEHVQSLQSL
                     QFMIQYCACSAKEEFGLKGLLLRPDGVVAWVSTEEINIIRLHVALSRWISLPSFEA"
     exon            complement(188478..189998)
                     /number=1
     CDS             join(191077..191481,191560..191690,191729..191753,
                     191767..191912,191952..192255)
                     /codon_start=1
                     /locus_tag="AO090026000074"
                     /note="predicted protein"
                     /old_locus_tag="AO070217000011"
                     /protein_id="BAE59571.1"
                     /transl_table=1
                     /translation="MDLPRYRYEPLSEPSDIRVIELGTNKERIEAYISHVSISNSSFQ
                     ALSYTWGNQEQANEAIILDEHGSSIGSIPLTKNLSDALGNLRDARELKSKVLWIDQIC
                     INQLDEKEKSHQAAMMKDIYSCAKQVITYLGPVIHEAGSIEGFWSRIHDGSIQPEQLP
                     PGLELVQERTYHEGTISKLIRGKDLANEQWINKEITALRGHRLVDWNSIMTIPILFAT
                     GHLPWVYREAGRKDSSENTWWERYSRLDPGIRHTRPSLFHNLQRYRHLLCGDPRDKVY
                     AILSLSNDAEVLGLSPDYSPLNTVDMLLKQLSASVLKHAINLNLLCFALLWRQPSSTL
                     PS"
     exon            191077..191481
                     /number=1
     exon            191560..191690
                     /number=2
     exon            191729..191753
                     /number=3
     exon            191767..191912
                     /number=4
     exon            191952..192255
                     /number=5
     CDS             complement(join(192683..192701,193309..193455,
                     193518..194059,194126..194281))
                     /codon_start=1
                     /locus_tag="AO090026000075"
                     /note="glycerol uptake facilitator and related permeases
                     (Major Intrinsic Protein Family)"
                     /old_locus_tag="AO070217000010"
                     /protein_id="BAE59572.1"
                     /transl_table=1
                     /translation="MSNADALDRVSRPVEDEVTKDASDPYGGEAEHFNKWSRVRHRLR
                     EPFAEWLGTTVAMLIGLCATLAISTGKGDAGNKLTLYWAWGLAITVGIYIAGGISGGH
                     LNPAISISLWIYRGFPGRRCIYYVIAQILGALTAGGLAYCIYRDSIFHSGSNSGTGIT
                     MGATGLGFYTEPLAYVRNVTAFFNEFVAAAILICTIFAMGDDSNAPPGAGMHSFIIGL
                     LIFVLAIGFGYNTGGCFNPARDLGPRLVALMAGYGGSTFTERGGWWFWGAWLATISGA
                     LVGGAILQASP"
     exon            complement(192683..192701)
                     /number=1
     exon            complement(193309..193455)
                     /number=2
     exon            complement(193518..194059)
                     /number=3
     exon            complement(194126..194281)
                     /number=4
     CDS             join(197299..197702,197763..198927)
                     /codon_start=1
                     /locus_tag="AO090026000076"
                     /note="predicted protein"
                     /old_locus_tag="AO070217000009"
                     /protein_id="BAE59573.1"
                     /transl_table=1
                     /translation="MSSLPNASNNSKPRFEIPPNISNQPRWLLDLDDWVVRAYSRIRF
                     HQDPKNREYGYGIISYTWGKYWNRTDTVPEKDAPDGIDWKIPRLAKDAISLDEAKKVI
                     TSMGKRYVWWDWMCVPQGGSHKDIAEQEIGKQMAIYKNAKASIIWLHDTNWAQSSDVG
                     KFLRNHYPERPLRQWLQNFSTGLQRIREREPWLTSIWTLQEGVLLNHSRLVDRHGARL
                     PDVPKDKRFHSDEATVVDLAIVPAKLARDIAMALFTGEGNPDPLFRDFTSVRENRVYA
                     QQILCEIIRSGLFGYYDNPVPLTILAGKGSRRYDKATNPDQYWALIGALDLKVAPNYN
                     LTIQKARENFFKGLLEKYQWNLLLAPSLPLDISRRGWPEVIADGHILPLDDLFFISEL
                     VDRLPPLSWTGTETGGPIIIGGAGGTQFKAFRLKKTGHFRRYIQARNKQGQDLVDVLG
                     PATEAPIEDATYLHIAKLQPKSGLPGKRCIEMRGYQRGAGQFNGVVDLWVAEDDVALE
                     SISKITLHLPQKSL"
     exon            197299..197702
                     /number=1
     exon            197763..198927
                     /number=2
     CDS             complement(199549..203193)
                     /codon_start=1
                     /locus_tag="AO090026000077"
                     /note="predicted protein"
                     /old_locus_tag="AO070217000008"
                     /protein_id="BAE59574.1"
                     /transl_table=1
                     /translation="MHSSLMRIYAGWPFRSAAIERTELVWDPRDAWRPVPLRAPYLLT
                     LAGLLLLTAIALEVCRQYNDRIGWLVRYKHASDLPTTVSVAYVIVPTAIALVVVNLWE
                     FSSCDVMRLEPYFQLAKSRGASATVLFTNYSFCYGIFAPITAARNRHWIALCVSLMSL
                     VIRMLLPSLFAGMIVMGELNLTDPKIIETWPALVDLQTQEGWMAAETSGLSESSQDAE
                     FLSLRSPHYAAAPVSMPVDDENDTSMLRLNQTIYWANLTCVDMPLYGIAPTTHSMNYT
                     SSDDEQTISWNMRNISLPTLSDSTAGCSINFALDSVAPTDTERFQLGYWEPSQPSRNS
                     NTTSAFTGSGCGSPTLYGVVIEGDVLKNNSIKPSKAAAFACMATYHYAEAEVFIATNT
                     SIVAAQIQQDTVSSLSPAEFSIDQFEDQFRVGPRAAGIRIINTTSSSSLFDTGSTSKF
                     IALEEYQKKLRNSWNHRFLVTVNKMFDPTRPTKTHAEQQSVSVILQMLHDPAIHAEII
                     LCVASLLLSFLAFVYPRRPNFLRSDPGSIAAQCAIVANLFSPTIALARPDTDFDRATT
                     RQLLQWAKGLWCQWSGVSKERRLEIVSLDGNPVPLATGKSRRKKDFMPHFLRLPLFFM
                     ECLSLAFVLALFGLALRYLRMDDPNSMTGPQLVLYVSMLFVPTIVASMISALLASVLR
                     HLSVLEPWTQLQKGLATAKQSLLMDYGCQTSFAVLWKCARRGPRLLVIISLACILDLL
                     LTVVSGGLFEPQVRHYSTAASGLFATYNLSTLSRQSQSPVLDSYSVIPSAITQDAPFL
                     PWTTSNHSLVPIRIDGPESERTFYTALTRGIGVNLICESLPSSDSGIDGNSTNPYWRY
                     TTFNSSTESACSVEAPWAASDYPENFIHFMAPTGSSASTECETSTLLVIARLDKITGK
                     SLHRDSTFALHCQPTIHIQDFLVQFDHSGQVEDYEAVPGSSITDGPLYQNASDLLGQF
                     NMAFTQSIQALPAHPNSSFYQYDWPGVLTARTIEKLNPKSDSVDTALLIDAVQLTYRT
                     VFSTYLTLWRDLYLQRLPESHSITIDGTVTQGVWGILPSTPSILIVIILVSLDVVLMV
                     GVFVTYRGRFNGPRIPKSIGSLIPWIAHSQMMRDFKGTHAWSEVQQRKHLEELDRTYS
                     LGTFPCPDGMSRIAVDYKDDEQAYELHDLATSGAVPSESTAQEPQHGYQGVSRTPQGG
                     PVDTICADRR"
     exon            complement(199549..203193)
                     /number=1
     tRNA            complement(204252..204325)
                     /locus_tag="AO090026t00001"
                     /note="tRNAscan-SE"
                     /product="tRNA-Val"
     CDS             join(207445..207594,207630..207700,207856..207945,
                     207993..208075,208153..208550,208648..208977,
                     209024..209509)
                     /codon_start=1
                     /locus_tag="AO090026000078"
                     /note="amino acid transporters"
                     /old_locus_tag="AO070217000007"
                     /protein_id="BAE59575.1"
                     /transl_table=1
                     /translation="MGHYELKQAPPAALHEIDGSSQENLDDINLARIGKRAVLRVKIA
                     YPHNERRNFGLMSILGFSCTILITWEGITAGGPAGSVYAFLFVWAGVTATFVVLSELV
                     SMAPTAGGQYHWCSMLAPRSAMKLSSYITGWLTVIGWQATYATAIYLNGTYIAAMISL
                     THSDYVPQAWHMTLYSYATALIGLAINCVGGKLLPRFEGTILILHILGFFAILIPLTY
                     MADHKSAKEVFTHFINEGQWPTQGLSFFIGLIGPVFAFAGGDAAVHMAEEISNAPTYV
                     PWSLMLTVLINGTLGFAMLLALLFCIGDIDTALNDPTGLPFVGIFLQATESIPGTVVM
                     ASIIIVLCFCTSVGMLASASRQFWSFSRDRGIPGWQLWSQVTTRTAIPTYTVVFTTTI
                     SLLLNLINIGSDVAFNSLVSMSTSGLYLSYMVVAGLLLYRRCTGGIMERNNGTRGSEI
                     KINTAGAQLVWGPFHVRGVLGIVLNVFSLVYMTIATFFSFWPPNNHADVQSMNYSVVG
                     TVGTIILSLVYYFVRARRIYSGPVVEI"
     exon            207445..207594
                     /number=1
     exon            207630..207700
                     /number=2
     exon            207856..207945
                     /number=3
     exon            207993..208075
                     /number=4
     exon            208153..208550
                     /number=5
     exon            208648..208977
                     /number=6
     exon            209024..209509
                     /number=7
     CDS             complement(join(209650..210299,210348..210891,
                     210970..211132,212982..213286))
                     /codon_start=1
                     /locus_tag="AO090026000079"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070217000006"
                     /protein_id="BAE59576.1"
                     /transl_table=1
                     /translation="MLQNVTTLDTTDSSSSDSNSSTATPTTCLPSHDVAIGAGVGVPL
                     GAIAILLLIWALLERRKASRALQSQPAALGGGYSASGHATAAAAYMNITEMNAHPPVD
                     WSKGKKWTFTVVASLMTFSATFASSVFSTAEKQTAAEFHVSHEVTILGLSLFMLGYCF
                     GPLLCGPLSESHGRSLPLMLGVIVFCIFQVPVAVAQNIPTTVICRFIGGLFACSPLSI
                     VGAILANIWDPVERGIAACIYSGATFSGPVLGPIVGGFVVDSYLGWRWTAWLTLIREV
                     YFWVLGMVFVPGTHAPTLLRWFQARECSSDARDELGRANANLPVSHMNWREFTTKYLA
                     RPLVMLASEPILLLTTLYMSLVYGTLYLFFEAYPISFQDQRGWNAGVGALPFLSITIR
                     VVFGNLTIAATTAFHLKRKYNEGGGKVAPEERLIPMMVGAVVLPPGLFWFAWTSSTHI
                     TWVPQVLAGIPIGMGIQVIYTMGLNYILDVYTPYAASAVSEYTFVRSMAAAGFPLFAT
                     PMYDRLGISWATSLLGFVSVLMMPVPLLFYVYGERLRKLGRYSVK"
     exon            complement(209650..210299)
                     /number=1
     exon            complement(210348..210891)
                     /number=2
     exon            complement(210970..211132)
                     /number=3
     exon            complement(212982..213286)
                     /number=4
     CDS             complement(218346..219233)
                     /codon_start=1
                     /locus_tag="AO090026000080"
                     /note="enoyl-CoA hydratase/carnithine racemase"
                     /old_locus_tag="AO070217000005"
                     /protein_id="BAE59577.1"
                     /transl_table=1
                     /translation="MEANSFKTILYEKSPDGKIAYITLNRPDRFNAIDGHLPRDLRDA
                     VKLANADPTVHCIILKGNGPGFCGGYDLDIYSQNAVRGETAGSQDLSKGYDPLIDYTM
                     MKENTDCFSELFHSHKPTIAQVHGAAVAGGSDIALCCDLVIMATDARIGYPPSRVWGC
                     PTTAMWAFRIGVEKAKRMLFTGDLISGAEAADMGLVLKAVPEEELEETVLLLANRIAS
                     VPQNQLWMQKQVINGLIEGPLLRSQKLSTIFDGITRNSPEGVAFQELSKEKGFKAAIH
                     ERDSPARSERYGKVWKSVL"
     exon            complement(218346..219233)
                     /number=1
     CDS             complement(219583..220344)
                     /codon_start=1
                     /locus_tag="AO090026000081"
                     /note="putative intracellular protease/amidase"
                     /old_locus_tag="AO070217000004"
                     /protein_id="BAE59578.1"
                     /transl_table=1
                     /translation="MPAKKVLIILSDADSFPLKKTSGQDAGKTVDQPSGFFLMELAKP
                     LQKLLDAGYEVTFASPKGQEPTPDPNSESLLAFAGNFYERRRENELIDRMKRENGFSH
                     PRTFSSISDDELESFAGVFIPGGHAPLRDLGADKDLGRILRYFHAKSRPTAAICHGPF
                     AFLSTKFAGDGEFAYKGYKITSWSDAEERMMEMMMGGEIEKVESVLRNEGAVMIEGAK
                     EKIGSITVDRELVTGANPTAANALGDQFLQMLSVH"
     exon            complement(219583..220344)
                     /number=1
     CDS             complement(join(220861..221123,221200..221270,
                     221327..221700,221753..221881,221983..222180))
                     /codon_start=1
                     /locus_tag="AO090026000082"
                     /note="predicted protein"
                     /old_locus_tag="AO070217000003"
                     /protein_id="BAE59579.1"
                     /transl_table=1
                     /translation="MPQQPMSDDGVPGDFEHPNQDLRRSVIITLYFAFILSTTAVALR
                     LLARKLNGTRLYLDDYLIIIALVALMPSFHPHARVQVANLMPVLFNGLGSHITMIPEK
                     NLTIYLKIGWSNSLVYSSCIAFVKFSVLALYKRLFSTPRMIFAANIVAGFVILWWLSV
                     CVVGILLCLPVNKFWDPTVPGSCLDSAQYYYGQQIPNILTDAVLLVMPLKFVWALPIS
                     KTQRLLLSGVFVTGGLTLIFDIVRLVAMINLTRSGPDVTYNQTPVVVYTCVEATVGII
                     AACLPNLRPLLKLSRGSFWSQIRSGTGQSKQPLNPAQDLSMEESNYDPYFTQTNIYAR
                     HSVSIQYSKP"
     exon            complement(220861..221123)
                     /number=1
     exon            complement(221200..221270)
                     /number=2
     exon            complement(221327..221700)
                     /number=3
     exon            complement(221753..221881)
                     /number=4
     exon            complement(221983..222180)
                     /number=5
     CDS             complement(join(224930..225002,225059..225233,
                     225309..225484,225535..225702,225753..225893,
                     225953..226143,226206..226764,226820..227083,
                     227147..227358))
                     /codon_start=1
                     /locus_tag="AO090026000083"
                     /note="predicted protein"
                     /old_locus_tag="AO070217000002"
                     /protein_id="BAE59580.1"
                     /transl_table=1
                     /translation="MRPLSHLSFFNGLLLGLSALSAATSVVHERREATSSNWVKRARV
                     NPSDKHVVRIGLTQSSLEEAHDLLMDVSNPSSPNYARFYSADEVAAKFAPSTETVNEV
                     QNWLTEKGINASRVAQTQNHGWLVFHATSKEIENLFDTTYYEYHNRKTGKKAIACEQY
                     HVPASVQKHIDYVHPGVNLNPSSGKPSSIRRRAAASKKTKLPARGPRPIQQHDVKGLN
                     VTNCDQLITPECIRALYKIPSARAAPHPNNSLGIFEEGDYYAQEDLDLFFKTFAKDIP
                     QGTHPIPAFIDGAEAPVPVTKAGGESDLDFELAYPIVHPQSITLYQTDDANWASNTTG
                     FLNTFLDALDGSYCTYCAYGECGNDPSLDPVYPDDAGYDGQLMCGVFKPTNVISVSYG
                     EQENDLPANYQQRQCMEFLKLGLQGVSVLFASGDNGVAGPPGDGNSVNGCLNNGTVFS
                     PAFPNSCPYITNVGATKVYPGYTVSQPESAVYDPDGLYSYASGGGFSNIYPIPDYQAE
                     AVATYFKDHNPPYPYYEGAENLGKNGGLYNRLGRGYPDVAANGDNIAVFNGGEFGSSG
                     GTSASTPIFASIINRIIDERLAVGKGPVGFINPVLYKNPSVLNDITNGTNPGCGTDGF
                     STAPGWDPATGLGTPNYPKMLKLWLDLP"
     exon            complement(224930..225002)
                     /number=1
     exon            complement(225059..225233)
                     /number=2
     exon            complement(225309..225484)
                     /number=3
     exon            complement(225535..225702)
                     /number=4
     exon            complement(225753..225893)
                     /number=5
     exon            complement(225953..226143)
                     /number=6
     exon            complement(226206..226764)
                     /number=7
     exon            complement(226820..227083)
                     /number=8
     exon            complement(227147..227358)
                     /number=9
     CDS             complement(join(228461..228543,228592..228826,
                     228882..229045,229105..229300))
                     /codon_start=1
                     /locus_tag="AO090026000084"
                     /note="C-8,7 sterol isomerase"
                     /old_locus_tag="AO070217000001"
                     /protein_id="BAE59581.1"
                     /transl_table=1
                     /translation="MIPHQYYPTTIQLPHFAANETSVVSLIAQFGFLWAAVLGTAFFV
                     IRRVRPTASRADKLAFVWMCLTGFIHFFFEAYFVIHHETLAGSQELFGQLWKEYSLSD
                     SRYLTSDAFLVTMEAVTAFCWGPLAFFIAYCIAVQHPARHALQLLLSVGQVYGDVLYY
                     ATSLFDLYFHGETFCRPEGYYFWFYYFFFNFIWMFIGSYYVKQSIGEIYRAFKTVQEL
                     GSSRKLN"
     exon            complement(228461..228543)
                     /number=1
     exon            complement(228592..228826)
                     /number=2
     exon            complement(228882..229045)
                     /number=3
     exon            complement(229105..229300)
                     /number=4
     CDS             complement(join(231756..232808,232890..232999,
                     233054..233253,233319..233345,233365..233393,
                     233455..233909,233918..234194,234257..234310))
                     /codon_start=1
                     /locus_tag="AO090026000085"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070169000001"
                     /protein_id="BAE59582.1"
                     /transl_table=1
                     /translation="MPLTETDSLPHFRAGERSREAGQETKLLHFIYGQPHLDEIRGHS
                     QKVLDLMNRFEEGYYMMTVGAPKGRIVTDLIDEIKPKTMIELGCYMGYSAILFGDAVR
                     RNGGERYLTEPGIANMLIELAGLRDFVRVIVGRSDVSLDRLYRRGEVSKIELMFLDHY
                     KPTYLTDLKLCEHHGMIVPGSVLAADNVLYPGNPPYLEYVRSSVEQKREAAKGGPMKG
                     YNVERTSQRQVNSHMPEGDTPAFEVIGNPNLVYQSVLQQPEGEWDAIEVTRCVGAGSL
                     KSINLFTYDNCFWNVPRFHGKVNLLPHVLKCDLRDALWFNHSSVTVEPKRVWRAWIEG
                     LFDQAISTSDRISYMYPKATGVGPHFHKQTARYGPRPRLRDIRDRTLHSFSTLTMPVE
                     NYGVWKAKPVRFTYETDADDHVSPHLSLFFTTSDNPRGEGRAAINIKSGDKSDSRLVF
                     WQARKFENFQNEQLRELKPGFHRLEGTMEQAPNGLALDYIRGNLFHRETGRLLPHDIP
                     GPDNDILDELIPLLDGAVDNDSVIYIYGSHFSHGNGIHNIHMNQGSPRKWKSDNGIYQ
                     DGGILLDFGDHWKGVFIGFASQAVHTDAEGQPTPPHGYLTWNELLNPEIPGDQRKRRD
                     VHDRTVSISEALIRHHGADPTAKPDMITLTNRADAPVVLNGWSIRNHKGDNEYLPDGT
                     VLRRRRRQSFQLHNCALSDEGGTITLLNEQGLKVDGVRYTATQSSPGHVVSF"
     exon            complement(231756..232808)
                     /number=1
     exon            complement(232890..232999)
                     /number=2
     exon            complement(233054..233253)
                     /number=3
     exon            complement(233319..233345)
                     /number=4
     exon            complement(233365..233393)
                     /number=5
     exon            complement(233455..233909)
                     /number=6
     exon            complement(233918..234194)
                     /number=7
     exon            complement(234257..234310)
                     /number=8
     CDS             join(234440..234467,234605..235019,235118..235212,
                     235230..235285)
                     /codon_start=1
                     /locus_tag="AO090026000086"
                     /note="predicted protein"
                     /old_locus_tag="AO070169000002"
                     /protein_id="BAE59583.1"
                     /transl_table=1
                     /translation="MASVSSQRRVSTRSMNVNWPNRALCTPDPAENYYLPVLDEDWNN
                     GVSRVQQCYCIQLLITSQTYPNAPPYTVSSPCAEKMGKFARLAQAAHLLSRVLRHVSD
                     TEISRHFLREEGDILDRAIRSFLSLTVSEEELCGVAYCSPVAVLGRHEVPSHAAGEDR
                     SLTAMERTAEVILPIAHRLLPIPTRDGLAVPVCGHIY"
     exon            234440..234467
                     /number=1
     exon            234605..235019
                     /number=2
     exon            235118..235212
                     /number=3
     exon            235230..235285
                     /number=4
     CDS             join(256089..256342,256607..257218,257266..257536,
                     257682..257708)
                     /codon_start=1
                     /locus_tag="AO090026000087"
                     /note="predicted protein"
                     /old_locus_tag="AO070279000001"
                     /protein_id="BAE59584.1"
                     /transl_table=1
                     /translation="MPPSSNSPSLRSRQKNTSLRLAVPGKRNKKAYRSLAYVSDSLYG
                     FPLHKYHVDTSKAYLHNKISANREKDRSQCHIQEGSHHRQRSKLVLGKRSSRTHPIHS
                     PLVLFSSCLTKSRSTTIEYLWDRQTSNASSVIYIFCQFSSRDQQFLTAILQCMIRQVI
                     EQADEGLLLAMKQLCADPAKQSTPAGLAELFAAACELKSTYLIVDGPDEVPKAEGLLP
                     YLPFFVGAGCKIMVTSRDLSHIRKHMGTAVKMEVYSQIHDLELYISSRFQDSDFPDTE
                     DFTEDIMRKSSNVFLHVKLILDELMDLTTIRQMRKALKKESKGLEQAYTSIVQRIDIQ
                     PKAKRALAHRFIGWIAFAKRRFKLSELIHAFAVEKDEEEIYEDNTRHVYATCV"
     exon            256089..256342
                     /number=1
     exon            256607..257218
                     /number=2
     exon            257266..257536
                     /number=3
     exon            257682..257708
                     /number=4
     CDS             257768..259624
                     /codon_start=1
                     /locus_tag="AO090026000088"
                     /note="ankyrin"
                     /old_locus_tag="AO070279000002"
                     /protein_id="BAE59585.1"
                     /transl_table=1
                     /translation="MVFLDYASRHWGEHLQDLEDLEGDTESLVQFLILDGNLRDAAIQ
                     ALHFRNGFETDLSNALFEAMPAKQTALHVAAYWNLTRNLKTLIKSALDTSPKDTQGWT
                     PLHYACANGHFASAELLIENGADIDTPDDQGWTPLFWASFTGSLDIVRLLLSNHAKYT
                     RRSKSGSTALHWAISRGETEIVQALLQHHQTQLSLTLKADIRTLSVDDVRRLSTPVGV
                     SPIQVAAEAKHAPIFDLLVVYLQAPGSRVGDDVFDKLWSRESFKVPVAENSWRMLLKS
                     SKGGKSSKKTKALLYSAETISGQTYLAEDPRKYFKNEWVETSPSVWKAIVLGSTIRDG
                     YLNAARLLIETGVDVNFKSKEGSLLHIAACQKDTSFARLLLDKGAKPDQQFGAGELAL
                     HVAIRHGNLETVKVILASPHDVNIRGHHGTPLHVAAGQEDPRFAQLLLENGANPESYD
                     SHGRNALHLAVMNGFIETARAIIDGGADINQFSLQLDRILDMGPIPRSETCLMLAVLL
                     ANKASEKQQALATEMARMLLSKGADPTLQNSEGETVLHIAAMCGILSFIDPLMATGSR
                     VDTVDNMGRTAIHTMMQFAEVCWDVEEVRRALHLMLQGLPERPAASLLNQRA"
     exon            257768..259624
                     /number=1
     CDS             259700..261430
                     /codon_start=1
                     /locus_tag="AO090026000089"
                     /note="predicted protein"
                     /old_locus_tag="AO070279000003"
                     /protein_id="BAE59586.1"
                     /transl_table=1
                     /translation="MLDISPTFALWHNTSINEEDELDTPLTLALRRRAWGISCVLISF
                     GAKIPATPYLQSILAAATRDLDYEIMDVLLGHGVSPNEDAALVLVSEMVGHFHDQSPG
                     HEGSSSSHRKSLKEIAQAFPRILVSLKSAGVNVNFQSPFTGMTPLLAARSIPMAEITL
                     ALLEAGADAFHACGETSDSVLTAAVFNNPEPLKHLTAHVSISPKPDHWTRHLCSPTPS
                     DIKDIFCRICNALAQFGRLDSQNSMSQTLLHLAAMRGNTDLVVSLLDHGAHANIPDKD
                     GWFPIHHAGFSRDYCKLSDRLKRRHHHDTLWHLLPVNIVQRTSNHHPYRSRETGLRLG
                     DQVICQEIAEKRNNYGNTMLEEALITGDEIMFSHLLRLVADVNSCISFCRKHHSILHA
                     AVSRANFGNVVSLLLSRGADIEAAGIDGWRPLHVAAYWGNVAIVERLITAGASIHVPT
                     RRLDMCHGRLPNPDEKEWNGQPLHLAAMGGHVAVVELLLKHGADVNATTNHFERPTGW
                     YGPTALHIALDRVRLQREKGSTNRLKVANILVENGACVEGVVDQLQVDDIPCFENFEQ
                     LWDRLRGYTK"
     exon            259700..261430
                     /number=1
     CDS             complement(join(261588..262278,262356..262399,
                     262500..262780,262844..263243))
                     /codon_start=1
                     /locus_tag="AO090026000090"
                     /note="glutamine synthetase"
                     /old_locus_tag="AO070279000004"
                     /protein_id="BAE59587.1"
                     /transl_table=1
                     /translation="MSFPEVTAANVAEVLHNDRMVIAGVDVDGQLRGKLMKKSKFLSI
                     ATGGFGFCSIIFGWDQQDTGYPKELAICNEENGYRDLIAVPDLSSFRRIRWENKVPFF
                     LLSFLDPDTQEPVCACPRGLLKNATAKVEAAGPPADMFAAEYEFGHFRIPGDSFSPER
                     AASGITSFIQNNSVDSLPSLTEGMFGYSMTRSLHSENYHDGILDACEQFRCNIEEWRA
                     KSGPGAFEACSEAKDMADKASLCKYVVKAYGIKHGITPCFMAKPRHELPGNGGHMNIS
                     LITADGKSAFTRDTPDPSPPYPDVAHLSDLGRQFLTGLLVGLPDIMPLFAPTINSYKR
                     LVEDLWAPNTVSWGLEHRAAFIRLITPPTANANATRFEIRVPGADANPHFVFAAIIAL
                     GWRGVEKKLEIPVPPLPKGEDMSSSSDKSMPLAKALKEAVATFTRLDSVAREVFGDSF
                     VEHFGGTREYKIQLWEQAVTD"
     exon            complement(261588..262278)
                     /number=1
     exon            complement(262356..262399)
                     /number=2
     exon            complement(262500..262780)
                     /number=3
     exon            complement(262844..263243)
                     /number=4
     CDS             join(264376..264630,264699..265100,265176..265886)
                     /codon_start=1
                     /locus_tag="AO090026000091"
                     /note="predicted protein"
                     /old_locus_tag="AO070279000005"
                     /protein_id="BAE59588.1"
                     /transl_table=1
                     /translation="MAETETISTNPNLPRPPSISSDNTIHVASVPAGPGSEDDTPPLH
                     AVNVALRWNGSKTMIWRVLATFWCALVMGSNDAAYGAIIPYLEVSYDKSYTIISLVFL
                     SPFLGYTVSAVVSNLIHQRFGRRGVAFIGPACHLLAFAVISSNPPFPVLVIMYIFVGL
                     GSGIQNAGWNVWISSLANSHEVLGCFHGFYGVGATVSPLIATTLITKAGWHWNSCYYL
                     LMGAAALELVNATSAFWTETGSKYRQDNPSSPGSNGSRSPNQTRLSLTYRVTWICAIF
                     LFLYGGCEVAIGGWIVVFMTSIRHGTPFASGMAETGFWLGITLGRFILGFVSPRIGER
                     LSIIVYIVLAIVLELIFWLVPKFIVSAVAVALVGFFLGTIFPGVVVVATRMLPKHLHV
                     AAIGFAAAFSMGGGAVFPFMIGAIAQAKGVAVLQPILLAMLAVALMIWGTLLRAPLHQ
                     SQHQV"
     exon            264376..264630
                     /number=1
     exon            264699..265100
                     /number=2
     exon            265176..265886
                     /number=3
     CDS             join(267648..268097,268146..268612,268670..268973,
                     268996..268998)
                     /codon_start=1
                     /locus_tag="AO090026000093"
                     /note="predicted protein"
                     /old_locus_tag="AO070279000007"
                     /protein_id="BAE59589.1"
                     /transl_table=1
                     /translation="MYPFLDRQSFEETAFSATLAQTLEGTPAFSALYHAVLALGCQYH
                     DGGSFDPGKGKAWKFFQMSLGLMVDILVPRESLLSLQALTAMSIFAMNTCCLQIDEIL
                     IMEAARMAHALRYHRAICSREQQVWCLRTFWVIYGMEKQLAFQNRENSLIADYNVGCP
                     IPETPEASFGSYNWFLSSIRFARITSQAYELLFSITATQSSTETYYTRIDHVHERLEK
                     WRLTVPDGFRPGESCSPQTFTEPVSKMVALQTHYSYHSMVIALARLTLQIGSDDGVRQ
                     EDSRRSLMASARRIIELTQYIDKAPHTPLFILAIMPLVALFLLFDFVIHNPTHPETKT
                     SLAMLDIVSGHFALVEHASNGSLPCSLASEFAHIARQHVRDVNGGRGLGEIMDATLTP
                     AQRPFRGHIKTGSGV"
     exon            267648..268097
                     /number=1
     exon            268146..268612
                     /number=2
     exon            268670..268973
                     /number=3
     exon            268996..268998
                     /number=4
     CDS             join(270089..270176,270230..270705,270766..271303,
                     271360..271778)
                     /codon_start=1
                     /locus_tag="AO090026000094"
                     /note="cytochrome P450 CYP4/CYP19/CYP26 subfamilies"
                     /old_locus_tag="AO070279000008"
                     /protein_id="BAE59590.1"
                     /transl_table=1
                     /translation="MAVSLSFLTYLFLIVAGVYLARKISRAVQIRQFKKRHGCLPPPR
                     DHHKDPVLGLDEVRSMLRVFREDYLMEYTLEKYRRHGNTFATSVLGDDDIFTAEPENI
                     KTILAVKFKQFDLGETRRRTFHPLLGDGIFAADGPQWEHSRTLLRPSFTRTQIAATDL
                     HERHIQRLISRIPRDGSTVDLQELFFNLTLDTATEFLFGESVESLRLGSSAGSSSFAH
                     HFNVAQDEIAFSMVIAPFDQLIFRPRFRESVREARGYVGNFVKKAIEYRHSLDAEKHA
                     GDTTDSQSRYVFLEELAKETDNPSDITDQILNILLAGRDTTASLLSMVFYNLARRPDI
                     WDLLRSEVATLDGKCPSFEELKQLKYLSWVINETLRLYPVVPSNSRTANEDTFLPVGG
                     GPDGKSPVFVAKGQRVAYDVYVMHRRHDIFGPDAEEFRPERWETIRPGWGYLPFNGGP
                     RICLGQQFALTEASYTTVRIVQSFKEITSRDPEPYRERLALTLASRHGTKVAMVPA"
     exon            270089..270176
                     /number=1
     exon            270230..270705
                     /number=2
     exon            270766..271303
                     /number=3
     exon            271360..271778
                     /number=4
     CDS             join(274563..274916,274992..275231,275307..276233)
                     /codon_start=1
                     /locus_tag="AO090026000095"
                     /note="predicted protein"
                     /old_locus_tag="AO070279000009"
                     /protein_id="BAE59591.1"
                     /transl_table=1
                     /translation="MKYPTTGQLQQVHLGIGPKGYEPVASYQGDKQLYTQEHEILQAS
                     ILGFCPEHLWHHGSNKASCPRPILVTAKHQEQLEQLHNALVTAIVDIVKRWWTDLDAR
                     FPERMPLTRDEEDLLRWLEHQHSHNGVPYEARLGSWRPDFLVGDYSGGPSTETYRLTE
                     INARFCFNGFMHQAYGQEGLSDLGAGRNGLIHATDSSKILDGLLSLFNPDRPLHLLKG
                     EEPGIDIHMFIDFVYRHIGIKPRLITPADLRLIPDPQRKNGSKLCCLVKDQQNASLIN
                     ESPLLVTSKGEVVEEVHQVGLELHQHELFGLSREMLREISLRCFNDMRTILLVHDKRI
                     LGIIKQEIPTLVARKVLTHDQGEALERGISDSFIPGSSELNELIQTLADSPELRKEYL
                     LKPIRGGKGAGIIFGDEVGPDEWLSTLERLRNPHFVSGNTMYVVQRRIWPRLYEVILN
                     SSGDRGNYPLIGTYHTTNGQLLGLGTWRSSPDRICAVSHGGGWICSVLDEYAESSE"
     exon            274563..274916
                     /number=1
     exon            274992..275231
                     /number=2
     exon            275307..276233
                     /number=3
     CDS             277471..278034
                     /codon_start=1
                     /locus_tag="AO090026000096"
                     /note="predicted protein"
                     /old_locus_tag="AO070279000010"
                     /protein_id="BAE59592.1"
                     /transl_table=1
                     /translation="MQEFPWHTDCSYEHAPPRFFALQVLQHDRYGGGTLSVMKIDRLS
                     QFLSPTTKAALLEPEFQITIPPEFIKHPDQRHIVGSLFAIDTEDHCLMMRYRDEIVTP
                     LSARAAAALKELKGALQDMEALSQSTLHLTAADLPERSIILLDNYRWLHARNGIKDPA
                     RHLRRVRWNAIPFANGVVSHSAEVSST"
     exon            277471..278034
                     /number=1
     CDS             complement(join(278981..279054,279117..279659,
                     279857..280252,280340..280526))
                     /codon_start=1
                     /locus_tag="AO090026000097"
                     /note="ornithine decarboxylase"
                     /old_locus_tag="AO070279000011"
                     /protein_id="BAE59593.1"
                     /transl_table=1
                     /translation="MGSVGISADEVVDNLIRKHIEELSNDPYVSQSDHPFFVADGSRI
                     VEQHLRWKSSLPDIQPFYAVKCNSDVNFLRYLDRLGVNFDCASQGEIELILSLGVDPS
                     RIIFAHPCKSISALHFAAKQGIRWATFDNIDELEKVKQHSPQIGLLLRIFAEDDGAKV
                     CLGDKFGAPWNTTVALLERARELHLQIVGVSFHIGSGASDPEAFTTAIQQARHVFDQG
                     ERLGFNMTVLDVGGGFQHTNFEFMASSLRPALAREFGDRPVRVIAEPGRFFATPCYTL
                     VCKVIARRTHIGAAPSNPADMLYQNDGLYGCFSCGWSEGEEYMPVLVKQNEGRDDHRE
                     SGEHRYSLWGPTCDSIDQIAKEVVMDGEVKVGDWLVYKDMGAYTMSASSQFNGFPNSY
                     TVIYQDF"
     exon            complement(278981..279054)
                     /number=1
     exon            complement(279117..279659)
                     /number=2
     exon            complement(279857..280252)
                     /number=3
     exon            complement(280340..280526)
                     /number=4
     CDS             join(281315..281496,281545..281778,281834..282812)
                     /codon_start=1
                     /locus_tag="AO090026000098"
                     /note="predicted protein"
                     /old_locus_tag="AO070279000012"
                     /protein_id="BAE59594.1"
                     /transl_table=1
                     /translation="MTMKSFSLSEVLAVANRHPFYNPEIQYPLDETALQAVRDWAVKN
                     QTGVDLRSQPLLHKNDIYKTVERLTHDASPENVYRESSYMSITGGGSGGVPMMFAVDV
                     HENRQQRAQMGKLLRICGVIRRKDWVLSVHISGGFYRSLDLTTETMENAGATVLSAGN
                     YMEPEEVVQALAHYHVNVLTGDASQIVQLACYISTLPLERQRQIQINKIIYTSEPLTG
                     AQRAFLHATLGDVKICSVMGSSEAGPWALSNPDLVGEENLNSSSMDFVFDTRDMIIEI
                     LSPAGLDDGKPPSDIDPLPLGETGIIVQTSLRRLRNPLVRYITGDLGSLHPLPEMASA
                     VVPESERQYLRVLRMQGRDRRFSFKWYGAYFEFEKMKALLQAEECGILQWQVILDQLE
                     SSGLPTLQVRLLRAPSRADVLSEEQLVKRVRTFFLVLPENEDVFSIVFVKNLDGFERS
                     STAGKVISFVDRLH"
     exon            281315..281496
                     /number=1
     exon            281545..281778
                     /number=2
     exon            281834..282812
                     /number=3
     CDS             complement(join(283868..284211,284300..284729))
                     /codon_start=1
                     /locus_tag="AO090026000100"
                     /note="predicted protein"
                     /old_locus_tag="AO070279000014"
                     /protein_id="BAE59595.1"
                     /transl_table=1
                     /translation="MGQQASVPQPDTQLQVIGAGLSRTGTASFSAALEILLDGPIYHG
                     GTQTTMGPPVEIKSWNQILRTWLAGDRATTLSLLRRRTTGYAAITDAPASQLVPELLA
                     LYPDSKVIVTVRDPDAWVKSMQQISSLVQLWFLGAVLLPLPGMRHFVTYISLLRAQWD
                     KIYDGSRDNAYVYQRHIEWLKEVVPADRLVFFNVKEGWGPLCKALGEDVPKDIPFPRI
                     NDSKAIDRVAEYHIKRGLARWAVVFTVVGVLSAWWFMRV"
     exon            complement(283868..284211)
                     /number=1
     exon            complement(284300..284729)
                     /number=2
     CDS             complement(join(287556..287944,288001..288610,
                     288668..288816,288877..289136,289223..289377))
                     /codon_start=1
                     /locus_tag="AO090026000101"
                     /note="amino acid transporters"
                     /old_locus_tag="AO070279000015"
                     /protein_id="BAE59596.1"
                     /transl_table=1
                     /translation="MNPERNAEDVPDDEASIEAAPLIHQAENETVVPPGQGQPNRRLG
                     LVSTTFLITNRMIGTAIFSVPSAIAHSTGSAGASLVVWVAGYFLAFCGFFIYLELGSL
                     LPHNGGEKIYLEAAYPRPPLFATVIFATHIIFLGFTGIGTIAIAENILLATQATADDR
                     TKRCMAIAFVASVAAMHICAKTWNVKLMNILASLKLFVLALMVLTGLGLVIFGSPNIP
                     YPGASYKHPFAGSSTDVADYTVALFKVLATFQGWSNAMYVLDEVKDPRRTLKVAGFLG
                     VGSVGVLYVLLNAAFFVAATPKELSETGITVVALFVGKVFGQHMQRFTAILAALSSLG
                     NIMTASFSMSRVIRSFAQEGLLPFSRFFASRSRSGSPAGAFALVFFSSCVMIIAVPFG
                     EAYNFVLDVGQWAVALIQFFVVCGLFIIRKRVTYPPRAFKVWTSVACLFLATQVFLIV
                     SPFVAPVTGRTSIPVWLTPLTGTLLFCLGGMYWYIWWILLPRLGQFSWEKSALIGPDG
                     EHAVAWRRVSKN"
     exon            complement(287556..287944)
                     /number=1
     exon            complement(288001..288610)
                     /number=2
     exon            complement(288668..288816)
                     /number=3
     exon            complement(288877..289136)
                     /number=4
     exon            complement(289223..289377)
                     /number=5
     CDS             complement(join(290255..290334,290397..290629,
                     290727..291133))
                     /codon_start=1
                     /locus_tag="AO090026000102"
                     /note="predicted protein"
                     /old_locus_tag="AO070279000016"
                     /protein_id="BAE59597.1"
                     /transl_table=1
                     /translation="MKLSLALATLVATAFSQELCAQYDSASSPPYSVNNNLWGQDSGT
                     GSQCVYVDNLSSSGAAWHTTWTWNGGEGSVKSYSNSAVTFDKKLVSDVQSIPTDVEWS
                     QDNTNVNADVAYDLFTAADQNHVTYSGDYELMIWLARYGTIQPIGTQIDTATVEGHTW
                     ELWYGTTIQAGAEQKTYSFVSATPINTFGGDIKKFFDYITSKHSFPASAQYLINMQFG
                     TEPFTGGPVTFTVPNWTASVN"
     exon            complement(290255..290334)
                     /number=1
     exon            complement(290397..290629)
                     /number=2
     exon            complement(290727..291133)
                     /number=3
     CDS             complement(join(298438..298834,298895..299250))
                     /codon_start=1
                     /locus_tag="AO090026000103"
                     /note="predicted protein"
                     /old_locus_tag="AO070279000017"
                     /protein_id="BAE59598.1"
                     /transl_table=1
                     /translation="MVSATRLLLLLPFLGALASPTDPTPNEPVGRGEKSYDLLQEIGE
                     SIFNATSEDKLQGRSTDLRTSKDGVNSAGYYYSLYNDNHAGADYTEFPDSGRFQLKWN
                     TNKEFLGGKGYRGGSTRKLTWDGHFKADGDYTLAVYGWTTDPVTEWYVVEQHGTGTPG
                     NGHILGQVNVDGGVYDVYMIPYRNVPKIYGVTNFNQLWSVRRNPRTTGSVDVTAHFKR
                     WKELGLQPGNPVFQMVTAEGFKGSGNLDFQLH"
     exon            complement(298438..298834)
                     /number=1
     exon            complement(298895..299250)
                     /number=2
     CDS             join(302606..302688,302751..304240,304291..304337)
                     /codon_start=1
                     /locus_tag="AO090026000104"
                     /note="predicted protein"
                     /old_locus_tag="AO070279000018"
                     /protein_id="BAE59599.1"
                     /transl_table=1
                     /translation="MVDKQTKPNSKSRRTSSKRSRTGCRTCRARHLKCDESPGACRNC
                     TSTGRTCDGYDLYRLPIATTKVARAQITPALVDGLRWVMTSDERRCFSHFQHHTIPTL
                     LALYDSLLWQKLVMQMSYSEPAVYHATNALSAIHQDIEANGIPLPGQGVDSPWNRFAL
                     EQSNRAISFLTIRHATSDPHLQTVVLLCCLLFVMQELLLGHYDSAYKHLQSGVRILKD
                     LKADIQLINGSETKLPFDKCLIETFLHLDSQLMYGGVGGPLSSLDRELEYTPGESQDI
                     YGEYNSLQEVRHAFSCLMRKRFRFLSRTQELSAEDIKSNYEALHLKQQQILSQLYRVA
                     WKLEAFSARSYTQLTEKDQRGLDMIDLALKSITLGARRCFIRSNSLVKLYTPEYDALM
                     LEIEDVMCKLPDRPSMVLDVGVIIPLYYVALGCSDYGVRRRAIKLLRSWPHFEGAFDS
                     NMVALVAEELIKAEQMMEEEYEPGSCKSEDQMEPRASEERQTQITGDIHSKRWPTAGQ
                     NTYSLDDCLKTNNCLERMRRPKMIGWKDSYS"
     exon            302606..302688
                     /number=1
     exon            302751..304240
                     /number=2
     exon            304291..304337
                     /number=3
     CDS             join(307264..307296,307350..308216)
                     /codon_start=1
                     /locus_tag="AO090026000105"
                     /note="predicted protein"
                     /old_locus_tag="AO070279000019"
                     /protein_id="BAE59600.1"
                     /transl_table=1
                     /translation="MPKVETVAIAGASGTLGPYVFQALVNAGFRVSILTRSQKPGAYA
                     SNIKVFEVDFNSVKSLTAALQGVDVVVSTVGVAAVDNQNVLIDAAIAAGVKRFIPSEF
                     SSVTTNPKLETLPLYSSMFKIRNYLQEKTAAGELSWTVLACGAFLDSVLDSPILLDFQ
                     NHTVTMLDEGDNRISSTSLPGVGRAIVAILQNFDATENRVIRVSEAILTQNQLIGFAK
                     ELRPDIKWRTSKERTNVLLQESLEQFGAGDFSMAAFIKLIKGTALAGDTYGSAFDVTD
                     NELLGIKELAPADLKKLIAEKLA"
     exon            307264..307296
                     /number=1
     exon            307350..308216
                     /number=2
     CDS             complement(join(309098..309320,309364..309699,
                     309781..309788,309823..310065))
                     /codon_start=1
                     /locus_tag="AO090026000106"
                     /note="dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /old_locus_tag="AO070279000020"
                     /protein_id="BAE59601.1"
                     /transl_table=1
                     /translation="MSRLVNNIAIVTGSSSGIRRAIALKFSREGAVVVCADIREIART
                     EILTETEIATHDLITQNGGTAVFLRVDVSKAEDVERLICTMINNAGVSAEADNPRPIW
                     DFSQEIWDKDIALNSTGVFLGCKYASAQMIQQDHVPCGDRDWIVNIISVFGLTGAASI
                     AGYVASKHATMGVTKVAAWDCAPHRIHVNAICPGYKVLLLVHIITLLDTDTAFISGIS
                     GEVRGFVQQLHPFRGLGKPEDVANAAIFLASEENTWVTGIGLPVKGGYTSL"
     exon            complement(309098..309320)
                     /number=1
     exon            complement(309364..309699)
                     /number=2
     exon            complement(309781..309788)
                     /number=3
     exon            complement(309823..310065)
                     /number=4
     CDS             join(311225..311638,311700..312056)
                     /codon_start=1
                     /locus_tag="AO090026000107"
                     /note="predicted protein"
                     /old_locus_tag="AO070279000021"
                     /protein_id="BAE59602.1"
                     /transl_table=1
                     /translation="MKPTVVFVPGAWLVPEFYRPFLEAVQAAGFPTYTAELPSLDPVD
                     PTATDCATDAASIRRLVFSLVEDEGRDVVLVMHSYASMPGGAAAVGLSKSERVQQEKK
                     GGVLGLVCMGAFLVPEGVSCAGTQGGNLPPWILLDQPSTGLNIPDQPEKTFAADVSEE
                     QALAISSVIKPHASLAFFSAQPSPAWADPAYTGRLSYVVTTEDLAVPKVSQYGMMSGT
                     GQNWHVREIESSHCAPFITKVAESVGILQDFIQTFERL"
     exon            311225..311638
                     /number=1
     exon            311700..312056
                     /number=2
     CDS             join(312716..313157,313271..313371)
                     /codon_start=1
                     /locus_tag="AO090026000108"
                     /note="predicted protein"
                     /old_locus_tag="AO070279000022"
                     /protein_id="BAE59603.1"
                     /transl_table=1
                     /translation="MHFSVFHILLASLISIAQLASGQGTDGCNVPPAIITNFTWHNST
                     YNCGCDDGGCLPTGLHGGPGCGQPDMVEATFSQRSPTYNDTLTCGASDPGSVPARAIP
                     GGPFNCRSLGRHFIFTVNGTEGTLTYVEPNFIWWVRRQHYLCTLRSFEILLVCRANPP
                     FSLNRMRSWVFIELRPQLPK"
     exon            312716..313157
                     /number=1
     exon            313271..313371
                     /number=2
     CDS             join(314171..314715,314772..315846)
                     /codon_start=1
                     /locus_tag="AO090026000109"
                     /note="myosin-crossreactive antigen"
                     /old_locus_tag="AO070279000023"
                     /protein_id="BAE59604.1"
                     /transl_table=1
                     /translation="MTHKESSARRDPGDVQAWLIGGGIASLAAAVHLINDAKVPGEHI
                     HLLDEHKHAGGGMQSFGDAENGYVLRTPCLPYFHDICVQDLLSYVPSPGDPNQSIMDV
                     VRASESGEGEKPTASSRLVEQRSTGLEKVDDRQFHLGIKHRWDLIKLMVEGEKAVADK
                     AIKDLFDESFFNSHFWTLWSTTFAMRPEHGAVEFQRHMRKYLEKIKDINNVSALDRTQ
                     YTLHDSVILPIIAYLEKEGVDFRFNAKVTDLVMYPEGDPTTISEIKLVHDDNSPSLVI
                     IDPMDIVIVTLGSVSSGSAVGSNNAPPKWEAWDALEDTIMEDWSLWNKVSGMATRKFG
                     NPVPFRSHIKESKVVTFTITLKDSTFLEDYQRMTHNEPGSAALVSFVKSNWNLSLSVP
                     SQPLFANQPANVHVVWGYGNDPEKPGNFVHKPMQDCSGKEILLEVLGHLGIDQERILP
                     SANTIPYIIPLATASLLKRSHFDRPEVVPHNATNMAFVGQFVEIPHDTTFSMEYSVRS
                     AQMAVYNLMGLSKRPPPVKTNVLLEVFGLLA"
     exon            314171..314715
                     /number=1
     exon            314772..315846
                     /number=2
     CDS             316356..316949
                     /codon_start=1
                     /locus_tag="AO090026000110"
                     /note="predicted protein"
                     /old_locus_tag="AO070279000024"
                     /protein_id="BAE59605.1"
                     /transl_table=1
                     /translation="MLTTFWPHTEYAEDQPFPKLILTSHVLDRSFQAGSLLGSTTGLI
                     RIGLLAYQPTSNNKFYTRYIIPPGSTPATLLMRSTGTGAVIGLGAMAAMLPYYLVKWD
                     PIEWQDRSWRLLENPGQVEVDTWGFAGAVMGVTGLVVLARRNGRMFQLTGHEEVSSLV
                     LLRALGWRNVFASAGMGSLSGVLGYLGWRYGVMGGKR"
     exon            316356..316949
                     /number=1
     CDS             complement(join(317253..319673,319764..320021,
                     321584..321880,322022..322126))
                     /codon_start=1
                     /locus_tag="AO090026000111"
                     /note="alpha-glucosidases, family 31 of glycosyl
                     hydrolases"
                     /old_locus_tag="AO070279000025"
                     /protein_id="BAE59606.1"
                     /transl_table=1
                     /translation="MSVPVYTSARMSPTSSSNFRFDCLNSGPSHRAGIPPARVMPPLT
                     SFRVSHFVLIFISLKGMSMKNEQSFSLSDHSSQAITAFPKSLRQHRLVPFVSSKTNKG
                     FNENVFRSLYSSPNEKQGWSGSGRNVKQIQFILFEASFHWLVCVVFTSPSKSQADIQN
                     KANKLPGNRRPSCVYVLYVFLNVVKGTKTELDRDHGRISLEGQSGVTRQTAWTKCGES
                     HVFEMEKYVFPTKPKANAGSIVSGPKYRFTVLTDRLLRFEWAEDGQFEDRASTFAINR
                     DLPVPEFRIIDNDGLEIITEHFHLSYDKKRFSPNGMVAHLSAKTTKYGTEWRFGTPST
                     LNLGGTARTLDLCDGRCDMGDGVLSKAGFAVIDDSESMLFDGQGFVVSRPAGDRVDGY
                     FFAYGRNYKAAIKAFYAVSGKQPVVPRYALGNWWSRYHPYRQEEYLELMDKFHKMDIP
                     LSVAVLDMDWHLVSDEQVPHAGWTGYTWNKKLLPDPAMFARELHERNLKITLNDHPHD
                     GIHSHEDSYEEMAKFLGRDTSHKTPILFDSTDPKFMDAYLNILHRNLEAVGCDFWWID
                     WQQGPYSKIPGIDPMWMLNHFAYLDHGRDGKIPLILSRYAGPGSHRYPLGFSGDTVVT
                     WASLEFQPEFTATASNIGYGWWSHDIGGHIHGGRDDELVTRWVQLGVFSPIMRLHSSS
                     SRWMSKEPWLYSDECRSAMTQFLRFRHRLVPFLYTRNIICAKEDEPLVQPMYWEYPGR
                     EEAYSVPNQFIFGSELVVAPIVQPRDKRTGLASVKAWLPPVGQLVDIFTGTVYDGDRE
                     LTLYRPLYGYPVLAREGSIIPLDASPSNGCLNPGAFDVFVVVGKDGYTNVLEDSRDDR
                     LQEDDNARDGKQRVSTIRYAQAEGNLTAEVTGRVWTFYFLGITSVPQNLRVLVNGIDR
                     TEDAIVDVYSYPKGQNLNVRCPYESDERYVITIELGRSPQLSAMDHIPRIEAMIMDYQ
                     IEFQMKNKLWDAVQGFHDRPLNVTIGRLTALGYDEAIMGPILELILADSRTVKV"
     exon            complement(317253..319673)
                     /number=1
     exon            complement(319764..320021)
                     /number=2
     exon            complement(321584..321880)
                     /number=3
     exon            complement(322022..322126)
                     /number=4
     tRNA            complement(324613..324691)
                     /locus_tag="AO090026t00002"
                     /note="tRNAscan-SE"
                     /product="tRNA-His"
     CDS             complement(join(326324..326407,326503..327468,
                     327574..327708))
                     /codon_start=1
                     /locus_tag="AO090026000113"
                     /note="predicted protein"
                     /old_locus_tag="AO070279000027"
                     /protein_id="BAE59607.1"
                     /transl_table=1
                     /translation="MYLANRRRKICLALVAAFFVLQIFHLRSLLSGRPASKVHNLKYF
                     TFILHLAAAVHNPLPSRKLLSPGITCPAIRGVQEATVIPVTDVFDEHGLQSLGYETDL
                     QRWSDPAAKAAATKRVDYYTNIVEGPSQIIEAKARTESYWQWSAVRFVLEGFVLPWTP
                     NRWRSAARRFQLTRPLQQCVDSVLPDLVPHAIAMHLRMWPSDLSFGQHDACYRGQVPV
                     LKHIFSKCDWTGSYLYNNVLRVQKSDTQPVIIATDDKEHPAIVDLVRRLGHRAYFMEM
                     TAACTAAIQDAHPSNETQWRSATYWPIVEAAVMVRTESFIGSFWSTFSQLIAIRRHRI
                     HRTFFVQNRLQEFVWDHRWIIILVSAGTLGSIIFYRPAIFHTRISVYTSFPIRSEYSS
                     IP"
     exon            complement(326324..326407)
                     /number=1
     exon            complement(326503..327468)
                     /number=2
     exon            complement(327574..327708)
                     /number=3
     CDS             join(329207..329533,329608..330057,330094..330702)
                     /codon_start=1
                     /locus_tag="AO090026000114"
                     /note="predicted protein"
                     /old_locus_tag="AO070279000028"
                     /protein_id="BAE59608.1"
                     /transl_table=1
                     /translation="MSMIAVSDLAPSIPLSLNYPAHTEEIESLKDAASTAARGMLKYY
                     HGNEPGQTPGTLDGTWWEAGAMFMTLVQYWRVSGDSSYNDLTTQGLQWQSGDDHDYLP
                     ANSSAYLGNDDQMFWGLAAMTCAESRYPDVSDGPSWLSLVQGVFNNQIPRWEMQTCHG
                     GLRWQIHSWLPGYDLKNTISNGGLFQIAARLARYTGDQKYADWATKIWDWIASSPLLD
                     TKTWNVADTTSVTNDCTTNGNEQWTYNYGTLLSGAAYMYNLSHPNPRSQTNGDQKWLD
                     AVDGLLNASLRLFFPPMYNNGTVLSEVSCETIETCDRNQMCFKGFLSIWMAYTATLVP
                     STAERIIPRLQGSAEAAARQCSGGEDGTACGVRWYEDKWDGKNGLETQMSSLSIFTAN
                     LMLQSDEQPVTSTTGGESKSDPDAGTGGKSRKPEEPRKIKAGDRAGAWIMTLVVGVAW
                     IVIIVWLVWEK"
     exon            329207..329533
                     /number=1
     exon            329608..330057
                     /number=2
     exon            330094..330702
                     /number=3
     CDS             complement(join(332916..333904,333973..334534))
                     /codon_start=1
                     /locus_tag="AO090026000115"
                     /note="FAD/FMN-containing dehydrogenases"
                     /old_locus_tag="AO070279000029"
                     /protein_id="BAE59609.1"
                     /transl_table=1
                     /translation="MSKKQLALALTCALSFSPACAIAFRDTMALPVSLQQCLNSTGVA
                     VMYPSDMNYDALSRPQNANYQPHPKVIVVPTSSEEVAASVRCVAAEKGDVKLSTRGGG
                     HSYAAYGFSGEVVVDSSQMKGMSFDDDKKEVTVQFGQTLGPLAVAMGRKGYALPHGTC
                     PGVGIAGHALGGGWGFTSRKWGWLLDHIVSLELVDIGGNIKLLNSSSVGMDAELWWAL
                     RGAGANNFGVVTSFTYAMEAAPTAVMNYGISFSSKSDCAQVLLAVQELGSISTDDPDG
                     LPVELGGEVIISGADATNVCSFTGQYLGERAAFVPVLDRLLGKLADRGVRPVNSTSYI
                     KEFDDWIDALTDLMGSLDEPSTPQPYYAQSLVDDGAPNYTSHGVEHIIDAIQNAKLVK
                     DTENHVSFDLNGPGSRTNIPPTSGDTSFIHRDSLFLVQIFSYKFPGFNNTDGRDQGLK
                     KVTNVADSIKQAKPSGQWHAYQNYIDPYLDDFGQAYYGVNLEHLKSLKAVADPDSVFD
                     FPQGLGHA"
     exon            complement(332916..333904)
                     /number=1
     exon            complement(333973..334534)
                     /number=2
     CDS             complement(join(336328..336598,336646..336677))
                     /codon_start=1
                     /locus_tag="AO090026000116"
                     /note="predicted protein"
                     /old_locus_tag="AO070279000030"
                     /protein_id="BAE59610.1"
                     /transl_table=1
                     /translation="MKIAELGTGTGVWLFEGAKYLPATTQLDGFNISDEQFPLKEQCP
                     PNLRFDIMDSFVDPPASLVGQYDVVHLRMWTSNFRNRDSGVIIHHVRELLSELRLI"
     exon            complement(336328..336598)
                     /number=1
     exon            complement(336646..336677)
                     /number=2
     CDS             337799..339130
                     /codon_start=1
                     /locus_tag="AO090026000117"
                     /note="anthranilate/para-aminobenzoate synthases
                     component I"
                     /old_locus_tag="AO070279000031"
                     /protein_id="BAE59611.1"
                     /transl_table=1
                     /translation="MAVLPTSIYLRPGPPDALQRVATVLSKLKSDDYYAYERTGVWYL
                     GIGNRSSVTIDPEGRKATFSTNGKDEVRSIDGGVTDVVREYTSANEDCGTRIYGYIGF
                     SYALLLRGIPHTAGEWPMLSLMVPRTEVVFYPDRITLTGVDKGETVELSALVDDTTCI
                     EPSPGHPIDTNTRASEYVEQVEAALADIRAEKYTKVIPSRAVSLPWRVDMPGTLLCGR
                     QHNNPARSFCLRHGNNQAIGFSPELVMSLRDGKVTTEPLAGTRSQEEGGDKSKKLKEA
                     LVSDPKEIVEHVLSVKEAINELDRLCSPGTVVVDDLMTVRPRGSVQHLGSTVSGALLP
                     GKDAWDAFNILFPSITATGIPKQAALEGIGRLEKHPRELYSGAILLIEDPETWDVALV
                     LRTVFQGREKQRIQAGAGIVAQSSPGRELTETSEKLASIAPYVIAERNQKD"
     exon            337799..339130
                     /number=1
     CDS             complement(join(339564..339730,339776..339907,
                     339937..340104,340188..340319,340340..340387,
                     340434..340623))
                     /codon_start=1
                     /locus_tag="AO090026000118"
                     /note="predicted dehydrogenases and related proteins"
                     /old_locus_tag="AO070279000032"
                     /protein_id="BAE59612.1"
                     /transl_table=1
                     /translation="MASKIFNVGVIGYGLSAKIYQIPFISAVKSLKLYAVVQRTPKPD
                     NNAELGFHGIKSFRSTELNDSHLELAKLALNAGKHVNCSRNNMWNQSVVVEKPFTPTY
                     QEAQKLIDLAKKQSRLLTVYQSRRWDADYLTLSKLIKDGSLGRIVDYETRFERHVPDI
                     PGSRWRTESIPGGGAIYDLVIRPAKRITAFLGNQREGIDGSDDSFTVLMHYDEFMATA
                     KAAGIRTFKKVSDSALIIYEQELLLGLSQFYFDMQEEQLKSGIRPRDDSYRIEPSERY
                     GK"
     exon            complement(339564..339730)
                     /number=1
     exon            complement(339776..339907)
                     /number=2
     exon            complement(339937..340104)
                     /number=3
     exon            complement(340188..340319)
                     /number=4
     exon            complement(340340..340387)
                     /number=5
     exon            complement(340434..340623)
                     /number=6
     CDS             join(342483..342740,342797..343090)
                     /codon_start=1
                     /locus_tag="AO090026000119"
                     /note="predicted protein"
                     /old_locus_tag="AO070279000033"
                     /protein_id="BAE59613.1"
                     /transl_table=1
                     /translation="MSSSLKFLGVFLPALAVACTGPPVNQNGLNLIKSFESFQPSVYD
                     DGFGNPTIGYGHLCGDATCSEVTYPKPLSEADASRLLADDLVSYQDALTNALADPVTL
                     NDNQYAALVSWTFNIGNGNMQKSDLVARMNKGENVATVAHDELPQWNKANGQVVNGLT
                     RRRKAELDLFDAPAIYGALPVPC"
     exon            342483..342740
                     /number=1
     exon            342797..343090
                     /number=2
     CDS             complement(343370..344587)
                     /codon_start=1
                     /locus_tag="AO090026000120"
                     /note="predicted protein"
                     /old_locus_tag="AO070279000034"
                     /protein_id="BAE59614.1"
                     /transl_table=1
                     /translation="MQLGHAKLFLFFLSLFTPALSRRIGHKHTHVAEREAPACTPTAG
                     GSPTVDDVPAIESAMAACPSGTIMIPAKSTYHINSELSFAKCSGCTLQVEGTLLVSDD
                     TKAWSGKDAVLNLEDVNDVSIVSKTGKGVIDGNGQAAWDLLNKDKNYSRVKCLLYLTG
                     KTSGVTISGLTMRNPPNVFSSVKQSVTNVTYSNLILTAVSKSDALPKNTDGFDLGGTG
                     IRMDNIKVQNGDDCIAIQNGAEDITVMNIQCTGSHGLSIGSIGKTPGEVDTVKNIHFK
                     NAKMTKCSKAAGIKIYSGGYGTAEVSNITWENVMVDGTSYAFQVQTCYGSDEKECASQ
                     PSTAKLTDIVVKGFSGKTDKDEPVASINCPAKGTCGLSLTEMKVQSATGGEEYQCSNA
                     GTIGVKCAPGASG"
     exon            complement(343370..344587)
                     /number=1
     CDS             complement(join(345917..346805,346861..346898,
                     346952..347187,347241..347399,347464..347722,
                     347776..348018))
                     /codon_start=1
                     /locus_tag="AO090026000121"
                     /note="2-polyprenyl-6-methoxyphenol hydroxylase and
                     related FAD-dependent oxidoreductases"
                     /old_locus_tag="AO070279000035"
                     /protein_id="BAE59615.1"
                     /transl_table=1
                     /translation="MAKRDSYTDLLIIGAGPAGLMAACWASQYAITTRLIDLKSERTA
                     AGHADGINSRTMEILDSFGLADTVLRQAAGNMDAAYWGPNEKTGNIRRIKHQPSQTQE
                     LSRFDQMLLNQGAIEQILIDYLVSKGRVHVERERKAEELELPCHSDKKSDEEYPVHVR
                     VVSVNGDDGQPDNAEVIHARYVIACDGTRSWTSAQLKIDSDVWKTESTWGVMDIVPET
                     DFPDIQRACAIQAGDGLSMMVVPRENNLVRFYLHLNGGEERSPNGPDKSEGSLEDLMD
                     MAEKTLKPYKLSYKYCDWWSIYPIGRRLIKQYRSDRIFFAGDAAHTHSPKGGQGLNIS
                     MQDTYNLVWKVAAVISGSVDPAILETYQSERRPEAEQLMEFDTRLVYAYEEGSTEDDS
                     EDGVEAVRDKYAGFMAGVAVTYPPSILVDESESNAAVTRNVQLGKRLPSYLIVGQEDG
                     SVVHLAKKLNSNGCWRLLIFPGDLHHPGVLDRLSVFAKDLSGRINNHLIPQSTNNSEF
                     LETLLIHSSPRASVNQSQHLGAFHQFDTELGCDHTKVFVDDPSCDGDTGQAYEQYGID
                     KQRGCLIVCRPDQHVGWIGAIEDAEGLEKYFSKFLFNKGRT"
     exon            complement(345917..346805)
                     /number=1
     exon            complement(346861..346898)
                     /number=2
     exon            complement(346952..347187)
                     /number=3
     exon            complement(347241..347399)
                     /number=4
     exon            complement(347464..347722)
                     /number=5
     exon            complement(347776..348018)
                     /number=6
     CDS             join(352080..352372,352442..352497,352673..352744,
                     352811..353076)
                     /codon_start=1
                     /locus_tag="AO090026000122"
                     /note="predicted protein"
                     /old_locus_tag="AO070279000036"
                     /protein_id="BAE59616.1"
                     /transl_table=1
                     /translation="MRSFYAVVPLALALRAAALYEDWHFGNMFAVGPAANNAQITKAT
                     YSLVPPAIPCGTVQEKQNDAPWLSIWVGISASMSDQAADLFQPLLNWSPDQKSQACPA
                     TAQEWCVAASTYHLFTVDDKKITQQVSIGGKQVSEQSDDKSINPTFLYSSNECYLGTC
                     GTVAGYSWDKLTIHLSQADPNFGNTLNLMNATSSGFATSDQGKTWYAESIKINEDYFY
                     SDGSRKECSV"
     exon            352080..352372
                     /number=1
     exon            352442..352497
                     /number=2
     exon            352673..352744
                     /number=3
     exon            352811..353076
                     /number=4
     CDS             complement(join(353423..355305,356987..357074))
                     /codon_start=1
                     /locus_tag="AO090026000123"
                     /note="beta-glucosidase-related glycosidases"
                     /old_locus_tag="AO070279000037"
                     /protein_id="BAE59617.1"
                     /transl_table=1
                     /translation="MDLTTQSKVVFGRIATFAMKVLAPGYLAEASLTALASGCQALST
                     RPYVPRGYSLSRRNDSTPIYKDASYCIDERVDDLLARMTIEEKAGQLFHTRLMDGPLD
                     DEGSGNNAHNSTSNMIGEKHMTHFNLASDITNATETAEFINRIQELALQTRLGIPVTV
                     STDPRHSFTENVGTGFKAGVFSQWPESIGLAALRDPYVVRKFAEVAKEEYIAVGIRAA
                     LHPQVDLSTEPRWARISNTWGENSTLTSELLVEYIKGFQGDKLGPQSVKTVTKHFPGG
                     GPVENGEDSHFAYGKNQTYPGNNLEEHLKPFKAAIAAGATEIMPYYSRPIGTEYEPVA
                     FSFNKRIVTELLRNELGFDGIVLTDWGLITDGYIAGQYMPARAWGVENLTELQRAARI
                     LDAGCDQFGGEERPELIVQLVQEGIISEDRIDVSVRRLLKEKFVLGLFDNPFVDAEAA
                     GRVVGNDYFVRLGREAQRRSYTLLSNNEDIVPLKKIEKSTKFYIEGFNASFIESWNYT
                     VVDSPEEAEYALLRYNAPYEPRPGGFEANMHAGSLAFNDTEKARQAKIYSAVPTIVDI
                     VMDRPAVIPEIIEQAKAVFASYGSDSNAFLDVVFGVSAPEGKLPFDLPSSMEAVEAQM
                     EDVPFDTRNPVFKFGHGLSYANPCASSSSKCS"
     exon            complement(353423..355305)
                     /number=1
     exon            complement(356987..357074)
                     /number=2
     CDS             join(358333..358484,358623..358850,358915..359014)
                     /codon_start=1
                     /locus_tag="AO090026000124"
                     /note="predicted protein"
                     /old_locus_tag="AO070279000038"
                     /protein_id="BAE59618.1"
                     /transl_table=1
                     /translation="MSRCITIQGQEFRLLDYISLKQSEDLYDMCEVHNAQRVSDGRPV
                     IVKLRYQDFLMEYQSLQDNQMLGVPVYLGHQELIQRGEHARFVPGGYLNALVMGKVPG
                     KPVTHLRLTATEADLIKTQLAQMFNNMRRKVYDVDDPNTEHVFFDRETQQTYVSLGV"
     exon            358333..358484
                     /number=1
     exon            358623..358850
                     /number=2
     exon            358915..359014
                     /number=3
     CDS             360145..361452
                     /codon_start=1
                     /locus_tag="AO090026000125"
                     /note="predicted protein"
                     /old_locus_tag="AO070279000039"
                     /protein_id="BAE59619.1"
                     /transl_table=1
                     /translation="MMYSGALSLTLATTLANAAAVIPRATATSLTTPSAVAVLNDPIA
                     RPCMAPGVVCLKKHAANLPYPFHRAAPDGRNIPTYGDTEVPADASWKHISTADFIVFD
                     ESRATDVLGDSPSVDFVLSVDANHIHEGPVFVPTQNRIYFSELSTNLPQFAIDLNQDP
                     PSLSHFTADPPIYIPNGGFYHNNTVYFSVAGSNTSIPGLGEQRPGIVTLDPATNKSTT
                     LLNNYYGLTFTDCDDLIVDPATGFIWFTAPYYSWWLELADIPPQTKSGTYRFDPTTGS
                     TVIVNDEMFSPNGIALSPDRRHMYISDSAASGLSAPISSDVPSPGGAGILYNVTGTRA
                     IYKFDLVDDGRAIINKRSIYYDAIGSVPDGLKVARNGYVVTATGNGLSVMDEYGDMIV
                     RVQTNFTVNNFVWTNANEYREVWMVGMGGVARLKWGLQGQEAV"
     exon            360145..361452
                     /number=1
     CDS             361834..362565
                     /codon_start=1
                     /locus_tag="AO090026000126"
                     /note="predicted protein"
                     /old_locus_tag="AO070279000040"
                     /protein_id="BAE59620.1"
                     /transl_table=1
                     /translation="MFQWLTDWYTGTTTPPSRANYKVKGDTIVKQTLTRPRSMSPWAI
                     IEVYCDLHFLGYDWILMWSQQNQTDDDIIKEINVPIGVKTENRIEDKNALLAGLDLKD
                     LKLGVGGEHKHFSEKETGAITSERRSVTVKAHSNTFYYQKRYNFLSRLWHFIYAEGRL
                     WVASLPGTTKPSTADTAFSVMADEFLVVPDKLVGEGKVATVEATKVWRMGDYPLRPGP
                     PSLEDERIMSEVKLLRATGYSVSPS"
     exon            361834..362565
                     /number=1
     CDS             complement(join(362809..364212,364225..365328))
                     /codon_start=1
                     /locus_tag="AO090026000127"
                     /note="alpha-glucuronidase"
                     /old_locus_tag="AO070279000041"
                     /protein_id="BAE59621.1"
                     /transl_table=1
                     /translation="MRWSFLTVLLWLVSLTGAENGFNGWLRYAPVQCDKRCQRALPSS
                     IVTLNSTDSGPIGTASQELQAGLENIVGKQLSIKRSSCGSRSSILVATLEQYRQACNR
                     SSEVPSLGIDGFWLRAYGDTVQIVGENERGALYGAFEYLSLLAQGNFSHVDYTTSAHA
                     PVRWVNQWDNMDGSIERGYAGPSIFFEDGHIVEDLSRVKQYARLLASIRINGVIVNNV
                     NANATLLTSQNMDGLARIANVFRPYGIQIGISLNFASPDTLGGLGTYDPLDPSVISWW
                     ANITDSLYDRVPDMAGYLVKASSEGQPGPDTYNRTLAEGANVFAKALQPHGGILMFRT
                     FVYDHHINESIWTNDRANAQVDFFKELDGQFEDNIKYGPIDFQVREPVSPLFANLYKT
                     NMAIELQVTQEYLGQQDHLVYLSPLWKELLDFDLRVDHQPSLVRDIVSGQRFDRQLGG
                     WAAVVNVGTNTTWLGSHLAMSNLYAYGRLAWSPTDDSQGILQDWIRLTFGRDQNVLDA
                     ITDMSMASWPAYENYTGNLGIQTLTDILYTHYGPNPASQDNNGWGQWTRADHDTIGMD
                     RTVKNGTGNAGQYPAEIAQVYEDLDSTPDDLLLWFHHVPYTHRLHSGKTVIQHFYDAH
                     YDGAETAHRFLSQWESLKGRIDQQRYNEVLSRLVYQAGHSLVWRDAINNFYWNMSGIS
                     DEKNRLGHHPWRVEAESMTLDGYEPYTVSPFETASNYKAVVTTSNSTTGTAQTKLQFP
                     SGTYDLGVNYYDMYGGKSEWTVYVNDRVVGQWEGNSENTLGHTPSIYIDGHSATRITF
                     RGVEIENGDQLKIVGVPDGVEPAPLDYVVLLPPDVVD"
     exon            complement(362809..364212)
                     /number=1
     exon            complement(364225..365328)
                     /number=2
     CDS             366239..366838
                     /codon_start=1
                     /locus_tag="AO090026000128"
                     /note="predicted protein"
                     /old_locus_tag="AO070279000042"
                     /protein_id="BAE59622.1"
                     /transl_table=1
                     /translation="MSRAISKPALKVPLHALEVDYDSSEQRLEALQEQLAVINQTLAQ
                     ITQSAAPGTTGLVSVPESSTHATLPFEGQSSFHHETLLAKDAALSAIATSHNSGLNDH
                     VSAVLSSLKNSLAEEHLSNNGQPTETNLPSSSPDSKSLLPVDLVVAVVRAVKGMGDLF
                     LPFISSSDKISKTSVFSRQPFLERLTPSRISLPIYLLPN"
     exon            366239..366838
                     /number=1
     CDS             join(367158..367526,367576..367811,367860..367990,
                     368115..368122)
                     /codon_start=1
                     /locus_tag="AO090026000129"
                     /note="predicted protein"
                     /old_locus_tag="AO070279000043"
                     /protein_id="BAE59623.1"
                     /transl_table=1
                     /translation="MCQTVGLHRSSTTKGDPSTLAETKRHVFWLLYTIDKNISLNLGF
                     TSHFQDHDIDTDLFTPSDHHQYRSWDLMTLVTAEFATIQGRVYDELYSISASRASDEK
                     RLNAIEKLSVDLIAVRDKLLAIDVSAGLYADSLHGMAACADFITYSVLTVIYRAETRP
                     RNAMAISSRCYEAATLALHSHLKCFTYFRGRQTHKQIEYVHWILLYPSFAPFVIVFTH
                     AITTASNADLSLLQETVKSLDLIKGLSLR"
     exon            367158..367526
                     /number=1
     exon            367576..367811
                     /number=2
     exon            367860..367990
                     /number=3
     exon            368115..368122
                     /number=4
     CDS             complement(join(368409..368656,368718..369049,
                     369104..369936))
                     /codon_start=1
                     /locus_tag="AO090026000130"
                     /note="sterol reductase/lamin B receptor"
                     /old_locus_tag="AO070279000044"
                     /protein_id="BAE59624.1"
                     /transl_table=1
                     /translation="MPRNRRANGSANSSEKPVSKSLSPTETHMEFGGPAGVTALMLGF
                     PLLMYYMYIGATLYDGHLPTPQNGETISDFLYHLFDLAYTHAFPHRRAWIIYWTFLIL
                     QGIGYIYLPGVYGKGKCLPHLNGKQLDYYCSAVSAWYITIAGSLALHFTGVFRLDTLI
                     NEFGSIMSVAICSGFLVSIIAYVSALARGAQHRMTGSHIYDFFMGAELNPRLFKWLDM
                     KMFFEVRIPWYILFLLSLATALKQWEELGYVSGEVCFVLMAHFLYANACAKGEELIIT
                     SWDMYYEKWGFMLIFWNLAGVPMSYCHCTLYLASHDPSTYRWNRVALAALFAMYLFAY
                     WVWDTCNSQKNMFRAQERGFWVDRKTFPQLPWKYIENPDKIPTVTGDSILCSGWYGMA
                     RKVHYTCDWFFAFSWGLITGFNSPFPWFYSVFFTTMIIHRVIRDIQRCRERYGEAWAE
                     YERRVPYLFIPVSSHAWRPT"
     exon            complement(368409..368656)
                     /number=1
     exon            complement(368718..369049)
                     /number=2
     exon            complement(369104..369936)
                     /number=3
     CDS             join(371119..371311,371375..371507,371596..371787,
                     371849..372000,372045..372298,372359..372627,
                     372686..373082)
                     /codon_start=1
                     /locus_tag="AO090026000131"
                     /note="cytochrome P450 CYP2 subfamily"
                     /old_locus_tag="AO070279000045"
                     /protein_id="BAE59625.1"
                     /transl_table=1
                     /translation="MMYTLSTLVFLAGILGLYVLLNSKAPRAPLPPGPKGLPIIGSVG
                     SDLPRGGRDWEHWLKHKELYGPISSITTAGHTHIILNDANVATELLEKRSARYSSRPR
                     LVMANELSGSDIFVTTQNEHAIVRALRKRILSQLRSEEVLLSFYPQVDTLIRRFLLRT
                     LQKPEELIGNIKTGIGGVILKVVYGYTVEFHDRDPLVDLVGETAVAFGRINQPTGYLV
                     DSIPAPLSVKYLPSWFPGAGFKKEAREYRRGFDTLLNWPFTFARRQMEEGNYEPSFVS
                     RLIEQRGSLLSLEEEVKIKHAAAAVYQAGYDTTASTITSFFLAMALFPAAQHKAQEEI
                     DRVVGARLPTPEDRGKLPYVNALINEVLRWNPVAQIGIMHAATEDDIYEGYLIPKGAP
                     IVPNIWAIAHDPDVYSDSMSFKPERFLASDGHTPERDPHTLVFGFGRRICPGRPLTDF
                     NNFLTIARSLAVFQVQKATKDGKEIDPIVDYQGGIIGHLSPFEVSIRPRSAEHEALIR
                     SIEVEDSISRGDSAALESVRV"
     exon            371119..371311
                     /number=1
     exon            371375..371507
                     /number=2
     exon            371596..371787
                     /number=3
     exon            371849..372000
                     /number=4
     exon            372045..372298
                     /number=5
     exon            372359..372627
                     /number=6
     exon            372686..373082
                     /number=7
     CDS             join(374042..374410,374492..375049,375100..375241,
                     375286..375296)
                     /codon_start=1
                     /locus_tag="AO090026000132"
                     /note="predicted protein"
                     /old_locus_tag="AO070279000046"
                     /protein_id="BAE59626.1"
                     /transl_table=1
                     /translation="MRNTRRTGLNIAFVYDPKDYYESIGFSKSECADLADDVTINGVA
                     SALESLGHRVVHVPGIKTLVKHLSAEHHKQWDLVFNYSEGVFGSARESQVPALLEAYQ
                     IPFTFSDAATLATGIDKGKTKMLLEHYRIPTSPFVIVPRSGEAVDYAALEDQLPYPLF
                     AKPIAASTSNGISPLNKILRKEDLQEVVEDLRAEFKDQEILLEKFLDGREFTVAVLGS
                     GDRARVLGVSEVTWYNPEGRKSDDLSVDFATSFSKAGRGVGHDMGHVHADPADPLVKE
                     IAEIGLSAYQALGCKDGGRVDIRMDGAVPCVIEVNPIFGLRPDHSLFTWIAKNNGMEY
                     QDIIAEIVDNALLRQKPVTEANESH"
     exon            374042..374410
                     /number=1
     exon            374492..375049
                     /number=2
     exon            375100..375241
                     /number=3
     exon            375286..375296
                     /number=4
     CDS             complement(join(376845..378527,378577..379011))
                     /codon_start=1
                     /locus_tag="AO090026000133"
                     /note="Cdc4 and related F-box and WD-40 proteins"
                     /old_locus_tag="AO070279000047"
                     /protein_id="BAE59627.1"
                     /transl_table=1
                     /translation="MQSDDRSVREGSDSSQTFLMKMAQPTGELTHPSQQQQLQLQQQS
                     FQSIFGGASDTTEEIDTETDSNHRRPHSFGAAATTPAKLANKNVAPFLVKHIPEQYGP
                     LGSRRTDKLEDLSSPNSKFCYRHRPDLKCRRQADEPSMDKLQRELETLPPSDQQGIAH
                     VWSLFSAAPAKHRKLILQGIMAQCCFPQLSFVSATVRDLIRIDFLTALPPEISFKILC
                     YLDTTSLCKAAQVSSRWRALADDDVVWHRMCEQHIHRKCKKCGWGLPLLERKRLRESK
                     REIELRATTWDVSGPAQNAGGAECSAPHADDVITQKRKADSSDDETAIVKRHCSSLDA
                     RPEPDEDYYTTRYRPWKEVYKDRFKVGTNWKYGRCSTKVFKGHTNGVMCLQFEDNILA
                     TGSYDATIKIWDTETGEELRTLRGHQSGIRCLQFDDTKLISGSMDRSLKVWNWRTGEC
                     ISTYTGHRGGVIGLHFDATILASASVDKTVKIWNFEDKSTFLLRGHTDWVNAVRVDTT
                     SRTVFSASDDCTVRLWDLDTKACLRTFHGHVGQVQQVVPLPREFEFEDHDAECDNDNM
                     STTSGDTESNSLQATLGLESNATETSVFGPSFDNGRPAPPRYIVTSALDSTIRLWETT
                     TGRCLRTFFGHLEGVWALGADTLRIVSGAEDRMVKIWDPRTGKCERTFTGHSGPVTCI
                     GLGDSRFATGSEDCEVRMYSFRN"
     exon            complement(376845..378527)
                     /number=1
     exon            complement(378577..379011)
                     /number=2
     CDS             380366..382018
                     /codon_start=1
                     /locus_tag="AO090026000134"
                     /note="predicted protein"
                     /old_locus_tag="AO070279000048"
                     /protein_id="BAE59628.1"
                     /transl_table=1
                     /translation="MSDSESSAISNNASDLNPSPGQENSMPQLETLISHLVAAKRSLS
                     SINHVWRANEIVTAARSALEESVVVSARTGFLRRGLNNQLRLLYSVRTEVQEVSLRGR
                     SEFATVLKSLDVADARLRKTLDLLRDTIVHASFRPEGEESKTLHDFVDERGVGELHTT
                     LKRSIDRTNAAQADLESSNRAFDDELQSIKEALGNYRAATQLASSRTSASSSSPSTSN
                     DSLPSLSSIPSMLHSLEMHAQEMANLLESLVRHFDLCVTAVKHTEGGGAAARSITGDV
                     PATVHVNGRVGPNIEEGINANLNAPLDPLSNSEYQEMVSVLIKDAAEAEDVVMEIQDR
                     IGEMETVLENVLAQRDSVLSVYNATTSVFKHLSTLASTRLSGYIAEAHSFTRVWHEEY
                     EQIQSGLADLSDLNTLYDGFLEAYDGLILEVARRRQVRHRVEKVLRDAKQKLDQLYEE
                     DVNARETFRVEQGDYLPSDIWPGIGREPMRIEFRRISGGNLKGIAAEPPDQDAAAAEP
                     KQEARAVSSGDVGEDGEVIPELPKALVEEAIARFNARMRHLP"
     exon            380366..382018
                     /number=1
     CDS             complement(382579..384279)
                     /codon_start=1
                     /locus_tag="AO090026000135"
                     /note="serine/threonine protein kinase involved in cell
                     cycle control"
                     /old_locus_tag="AO070279000049"
                     /protein_id="BAE59629.1"
                     /transl_table=1
                     /translation="MASTDPSAQAPGLADGLTPSHTYVPNQGYLNEDGTTPTIAGQDP
                     ALQEDEEDEEEEYYDDIFEEDDLEAENITSSNPADLTKAYNRQRKTNELAADPNAPKW
                     TYPKSNTQKPSINTRASVDDQIKSLTRHAAKLKLDDQQSGLAARGDRGNDRADRATSE
                     QVLDPRTRMLLLQMINRNIVSEIHGCLSTGKEANVYYSMLFPDEEDASPIHRAIKVYK
                     TSILVFKDRDKYVTGEFRFRQGYSKSNNRAMVKLWAEKEMRNLRRIHAAGIPCPEPVY
                     LRLHVLVMAFLGNSKGIASPRLKDVEFDIPNPETRWRELYIDLLGYMRVMYQTCRLVH
                     ADLSEYNMLYHKKKLHIIDVSQSVEHDHPRSLEFLRMDIKNISDFFRRKSVDVLPERM
                     VFEYIITAEGPATVDQSEEMQEAIEKLFVARAEMPDEELDTAVFRQQYIPQTLEQVYD
                     IERDAEKVHAGEGEDLVYRDLLASGKSAKQPDDAESDAGSDVSGGVSVGGSGSDEDDD
                     EEKDPFDKGVPRGKRFVDKDTKRDHKQKVKEEKREKRANKMPKHMKKRLVSTSSRKKK
                     "
     exon            complement(382579..384279)
                     /number=1
     CDS             join(384652..384689,384769..384928,384979..386189,
                     386256..388153,388209..388501)
                     /codon_start=1
                     /locus_tag="AO090026000136"
                     /note="structural maintenance of chromosome protein 3
                     (sister chromatid cohesion complex Cohesin, subunit SMC3)"
                     /old_locus_tag="AO070279000050"
                     /protein_id="BAE59630.1"
                     /transl_table=1
                     /translation="MYVKQIIIQGFKSYKDQTVIEPFSPKHNVIVGRNGSGKSNFFAA
                     IRFVLGDAYTHMGREERQALLHEGSGSAVMSAYVEIIFDNSDDRFPTGKPEVVLRRTI
                     GMKKDEYTLDRKNATKNDVMNLLESAGFSRSNPYYIVPQGRVTALTNMKDSERLNLLK
                     EVAGTQVYEARRAESLKIMHETNNKRTKIDELLDFINERLSELEEEKDELRNFQEKDK
                     ERRCLEYTIYSREQQEISSYLDSLEEQRQTGVEDTDLNRDRFIQGEKEMTQIDAEIAE
                     CKQQIEFLKVDKAQLEDERREASKALAQVELQAKSLTDNQAAAQAQKSRRDEELKSVQ
                     AAIEEREAELQQLIPSFNSAKDQEDAVKAQLTEAETSRRRLYAKQSRNSRFRNKSERD
                     KWLQAEIKDNYTSISTVQGVMAQTQEDIKELENEIALLEPETERLRKQIDGRGDTIQS
                     VEQQVQAAKDERDRLMDQRKELWREEAKLDSILVNATNEVDRADRSLSQMMDHNTSRG
                     IAAVRRIKRQYNLEGVYGTLAELFDVNDRYRTAVEVTAGQSLFHYVVDTDETATKVLE
                     ILQQEKAGRVTFMPLNRLRSRPTNMPRASDTIPMIEKLQYDRAYEKAFVHVFGKTIIC
                     PNLQVAAQYARSHGVNAITPEGDRSDKRGALTGGFHDSRQSRLDAVKNLTKWRDEVET
                     KKSRGNEIRKELEHLDQLITRAVGELQKLEQQRHQVQNSSGPLRQELRSKRDLIQKKN
                     DNLEAKRRALRNIETNLAAVTDQVNAFEAELKSPFQKALTNDEEARLESLSATAQDLR
                     RQYQELSSQRSELEARKSVLEVELRENLNPRLDQLVGQDIDMADDGSQGNLKETQREM
                     KRLSKALEKLGQRLQQVDESIEQANARMAELGQRNAETRRELDELAKSIEKHQRRMEK
                     SMQKKAALTKQAAECAANIRDLGVLPDEAFTKYKNMDSNAVVKKLHKVNEGLKKYSHV
                     NKKAFEQYNSFTKQRETLTNRREELDASQKSIDDLINVLDQRKDEAIERTFKQVSREF
                     HNVFEKLVPAGRGRLIIQRKTDRAMRQADELDSEDEEARNSVENYVGVGISVSFNSKH
                     DEQQRIQQLSGGQKSLCALALVFAIQACDPAPFYLFDEIDANLDAQYRTAVAQMLQSI
                     SDATNGQFICTTFRPEMLHVAEKCYGVSFRQKASTIDVVSREEALKFVEEQKS"
     exon            384652..384689
                     /number=1
     exon            384769..384928
                     /number=2
     exon            384979..386189
                     /number=3
     exon            386256..388153
                     /number=4
     exon            388209..388501
                     /number=5
     CDS             join(390331..390658,390984..391015)
                     /codon_start=1
                     /locus_tag="AO090026000137"
                     /note="predicted protein"
                     /old_locus_tag="AO070279000051"
                     /protein_id="BAE59631.1"
                     /transl_table=1
                     /translation="MRGFGGNQRDFGAGDNGMNGFSGERQEGVDEMDVDEMDVDEMDV
                     DEMDMDEMDMDEMDVDEMDVDESNAGRDRGAWEESEDIQRGVTEGGQMSTSHRDIQCR
                     RMELIREHEYLWQALGA"
     exon            390331..390658
                     /number=1
     exon            390984..391015
                     /number=2
     CDS             join(391962..391983,393067..393842)
                     /codon_start=1
                     /locus_tag="AO090026000138"
                     /note="NADH-cytochrome b-5 reductase"
                     /old_locus_tag="AO070279000052"
                     /protein_id="BAE59632.1"
                     /transl_table=1
                     /translation="MEDEFLVEPRKVLNPTEFQNFVLKEKNEISHNVAIYRFALPRPT
                     DILGLPIGQHISLAATIEGQPKEVVRSYTPISSDNEAGYFDLLVKAYPQGNISKYLTT
                     LKIGDNMKVRGPKGAMVYTPNMCRHIGMIAGGTGITPMLQIIKAIIRNRPRNGGNDTT
                     QVDLIFANVNPEDILLKEELEQLVKEDDGFRVYYVLNNPPEGWTGGVGFVTPDMIKER
                     LPAPAQDIKIMLCGPPPMISAMKKATESLGYTKARPVSKLEDQVFCF"
     exon            391962..391983
                     /number=1
     exon            393067..393842
                     /number=2
     CDS             complement(join(394345..395103,395171..395443))
                     /codon_start=1
                     /locus_tag="AO090026000139"
                     /note="predicted protein"
                     /old_locus_tag="AO070279000053"
                     /protein_id="BAE59633.1"
                     /transl_table=1
                     /translation="MGRRRQQALAKSIQFALFRDPKTFRKTLIGRIIAFFSIFYLKLL
                     RYEPDVFRKLRNEIWEISEEQYRACFLSGKDKALPLLPMGDLGFSGSTFFSTSNSAFL
                     VKSLPRHFEHSFFRNDLFQPYYEYITSHPDSILVWITDYIYAAYTSLGTLVKTTPAHH
                     IIMENMLCGKEKDPAAEKWETYDLKPIDYFFPERDLVPDPLVSQETLSRLADEFPDKI
                     RLTQSDYDDMKRMIEADTAFLASANAVDYSLFLVRFPASSNPDVIGKKSKWRIGLAST
                     DGKWKYRAVLLDFFWAKHKLHAQAMTGVIQTFNVIGRQGPMTITTTADEYREKFLALM
                     DSIMEVYEP"
     exon            complement(394345..395103)
                     /number=1
     exon            complement(395171..395443)
                     /number=2
     CDS             join(395956..396180,396244..397541,397597..398029)
                     /codon_start=1
                     /locus_tag="AO090026000140"
                     /note="Arginyl-tRNA synthetase"
                     /old_locus_tag="AO070279000054"
                     /protein_id="BAE59634.1"
                     /transl_table=1
                     /translation="MASAADLTVAVEGLKLQSTTETSKFPNSFPSLNPVDIYREHIAE
                     KLGAATGIDSEKIYTRLQWSSTLDKGDLLLPVPALGIKGKKPQELCEELAQKFPESDL
                     VLPPTCVGIHLVFFFKPQPLTHTVVSRILKEKAAYGTNGNQGLRDPSDPSKGQKKIIV
                     EFSSPNIAKPFHAGHLRSTIIGGFLANLYTVMGWDVIKMNYLGDWGKQYGLLANGYKQ
                     FGSEEALNKDPINHLFDVYVKINNVVAQQEGPIKELKEQIKAKKEKNEDVSELEQELQ
                     KLVDASEDESARRYFKSMEDGNEEALGLWRRFRDLSIQKYRQTYARLNIDFDVYSGES
                     QIKNESMTAAYETMEKAGVSEKSEGAVIVDFTKHGAKKLGKAIIIRKDGTPLYLTRDI
                     GAITEREEAYHFDKMIYVVAMQQDLHLAQLFKITELMGHKDLASRCQHVNFGMVRGMS
                     TRKGTVKFLDDILGDVRDKMHEVMKKNEEKYQQVENPEETADILGITSVMVQDMSGKR
                     INGYDFNLDAMTSFEGDTGPYLQYAHARLCSIIRKSELNVEELGSANLDLLTETHATD
                     LARMLAQWPDVLLNTTRTLEPCTILQYLFKMTHTLSSSYEVLKVVGSEPELKKARMAL
                     YESARQVLYNGMRVVGLSPVSRYVPLS"
     exon            395956..396180
                     /number=1
     exon            396244..397541
                     /number=2
     exon            397597..398029
                     /number=3
     CDS             join(398560..398624,398723..400283)
                     /codon_start=1
                     /locus_tag="AO090026000141"
                     /note="GMP synthase"
                     /old_locus_tag="AO070279000055"
                     /protein_id="BAE59635.1"
                     /transl_table=1
                     /translation="MAETPELEPHNAFDTILTLDFGSQYTHLITRRLRELNVYSEMLP
                     CTQKLADLKFKPAGVILSGGPYSVYEEGAPHVDPAYFDLGVPILGICYGLQEIAYRLD
                     STNVIAGTSREYGLAQLKAKKVGGHVDHLFDGLEDEFNVWMSHGDKLGKLPEGFHTIA
                     TTPNSEYAGIAHETKPIYGLQLHPEVTHTQNGTKLLKNFAVNICGCKQNWTMARFVDQ
                     EIARIRKLVGPTGQVLGAVSGGVDSTVAAKLMKEAIGDRFHAVLVDTGFMRLNECEQV
                     KQTLAEHLGINLIVADASQVFMEGLKGISDPEQKRKFIGNKFIDVFEEEAKKIEDAAA
                     HSETAGKIGFFLQGTLYPDVIESISFKGPSATIKTHHNVGGLPKRMTEGQGLKLIEPL
                     RELFKDEVRDLGRQLGIAHEMVMRHPFPGPGIAIRILGEITPERVEMARKADHIFISM
                     IREAGLYDKIGQAFAALDPSRAVGVMGDKRVYENIVLLRAVETTDFMTAIAYPFEHEF
                     LTRVSTRIVNEVSGVCRVAYDYTSKPPGTIELE"
     exon            398560..398624
                     /number=1
     exon            398723..400283
                     /number=2
     CDS             401318..401851
                     /codon_start=1
                     /locus_tag="AO090026000142"
                     /note="predicted protein"
                     /old_locus_tag="AO070279000056"
                     /protein_id="BAE59636.1"
                     /transl_table=1
                     /translation="MPTQTTTTTTTAAAAASIQTCNTPTQYEIPVQDAACAVPYKDQY
                     TKLLSKCCNNAPVSAYDNDCAIYCLAVGQSVQDLTDCLYDAKVDWGDVWCFGNTSASA
                     TGSPTGSGIGVKETGSATGKETGKGKATGSGTSTGGAVEETGKSMAGVVTGREVSRVS
                     IWVVGWLVVSSVFGGFV"
     exon            401318..401851
                     /number=1
     CDS             complement(join(403251..403278,403381..403796))
                     /codon_start=1
                     /locus_tag="AO090026000143"
                     /note="predicted protein"
                     /old_locus_tag="AO070279000057"
                     /protein_id="BAE59637.1"
                     /transl_table=1
                     /translation="MDHPLAIYGFSKSQEDKDRILAETLSGGVTFNDCMLHVAAKGAP
                     FGGVGNSGMGKYHGPYGFLEFTHLRTHIDPPTWMEKLMGARYPPYTSDKLRKLYKPTK
                     APFDRQGNKLRWTRGWLYVLAFAVAGSVAARTGLFNASFLVGHIG"
     exon            complement(403251..403278)
                     /number=1
     exon            complement(403381..403796)
                     /number=2
     CDS             join(404932..404965,406931..407120,407177..407447,
                     407498..408769)
                     /codon_start=1
                     /locus_tag="AO090026000144"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070279000058"
                     /protein_id="BAE59638.1"
                     /transl_table=1
                     /translation="MSGRLRVPSPVKTPFQIPDFIHRTRMLEKVTPSTTEVPTATGPQ
                     DPTSEQQNGVRIAEAVTKSWSKNTLIQVYICMWLMYFVRALNGSLTSNLAPYITSDFS
                     NHSLLPVIQIVVSIMSAACTMPIAKLLNLWDRTIALSLMLVVSIIGLIVMACCHNITI
                     YCVAQAFITVGLTGLIFSLDVLTADTSTAQDRALAFAFTSSPYIIMAFAGAPLSASFN
                     EVNWRWAYGTIAILLPVVTVPLIIIWELAKRKAQETETLAPVHEERSLAESIHYYIIE
                     FDIIGILLLIAGFSLFLLAFALAGSQPQKWHSTHIICMIVIGGVTIIAFAAYERFFAS
                     KPLVPYNLLISRTVTFTCLLNLTYVIAADCWASYFTSFLQVVYHVSLTEAGYVVAISN
                     LISPLWLVGVGFLVRWTGRFKWLLLCAIPVYLLAIGLMIYFRSPGHSIGYICLCEVLI
                     GLGTGTIIALEQTAVTTASEHNDYASMLALLGWVGSIGGAIGNSISGAIWTNTLPQKL
                     REYLPDEMKSQWKEINDSLYVQLSYEVGSPTRVAIEKAYAVSQRNMLIAGIAFMALTI
                     VWVVGIKDVRVKGRDDKGRVLF"
     exon            404932..404965
                     /number=1
     exon            406931..407120
                     /number=2
     exon            407177..407447
                     /number=3
     exon            407498..408769
                     /number=4
     CDS             complement(join(409014..409719,409947..410072,
                     410121..410218))
                     /codon_start=1
                     /locus_tag="AO090026000145"
                     /note="predicted protein"
                     /old_locus_tag="AO070279000059"
                     /protein_id="BAE59639.1"
                     /transl_table=1
                     /translation="MKGLLFVLSAIFGITLAAPATCTPERALVRKEWRELGYAERKDY
                     IDALWCLRDRPSILPSEEFPGVRDRWDDFVAYWNWALDTENLAESPLFDGSSTSLSGN
                     GAYVPNEPMPCTPGGICFPRGTGGGCVESGPFKDLQVHLGPFNSSLAQSYGSLPVNAW
                     DYNPRCLYRSLNQALLAALNNQARIDQMQASTNIRDWLAIMSPSNPDLTSSHGGGHGA
                     VGGAMADFFASPQDPSFMLHHAFIDKLWAEWQDQDPETRRYAVNGTTVIYDPPGAPVV
                     TLDTMVEFGELCHPRKVEKIMHPLRNGYCYTYT"
     exon            complement(409014..409719)
                     /number=1
     exon            complement(409947..410072)
                     /number=2
     exon            complement(410121..410218)
                     /number=3
     CDS             complement(414436..415152)
                     /codon_start=1
                     /locus_tag="AO090026000147"
                     /note="predicted protein"
                     /old_locus_tag="AO070279000061"
                     /protein_id="BAE59640.1"
                     /transl_table=1
                     /translation="MNAEYYGTPSQNGYGNSGPPPPQGPLQGYQQSYPQQYPEPQNQY
                     PPSQYPQSYNEQLQQTAPGEAQGDERGLAGALAGGAIGGFAGHKANHGFLGAIGGAIA
                     GSIAQDAYKKHQHEGQQNIPPQGGFYPQQFPQQPYPQTGPYQQYPPQGPYPPSQFYPL
                     NQLHHNKKSVMKRQEEVEELQDKINRVAQHMQQGPSHHKMKDLRKDMEDLQKDLRKAQ
                     EDYQKELNKALDDDAKKRRH"
     exon            complement(414436..415152)
                     /number=1
     CDS             complement(join(416888..417049,417099..417143,
                     417221..417710,417762..417900,417951..418041))
                     /codon_start=1
                     /locus_tag="AO090026000148"
                     /note="predicted protein"
                     /old_locus_tag="AO070279000062"
                     /protein_id="BAE59641.1"
                     /transl_table=1
                     /translation="MITILYQVILCFLVTSESLIKLTSASDISEETFQDLQRAAKLSS
                     AAYANCDTNAYDITITKHINDIATGTQVLKYNRATLGIRQAGKPSRSFSEAPRPVSIT
                     FCSQLSWLPLLTFSVIDFVNDLDSTTVSPTIPDTHFPTGAKIMQGIHRPWLAVHNDVI
                     SEIRNLLGQYPEYSLEPMGHSLGGSLTYLAYIVLKQSIPHSNITGYALAAFPIGNQEF
                     ADLGTMQGGNMFRGNSKGDGTPNEYVNQPWNFKHYGVEYYSDGSREGTIQCQGNEDQA
                     CSAGNELNFPTVAHFHLFGVDFGLLGSKSKCN"
     exon            complement(416888..417049)
                     /number=1
     exon            complement(417099..417143)
                     /number=2
     exon            complement(417221..417710)
                     /number=3
     exon            complement(417762..417900)
                     /number=4
     exon            complement(417951..418041)
                     /number=5
     CDS             complement(join(419423..425816,425897..426233,
                     426292..426624,426782..426905))
                     /codon_start=1
                     /locus_tag="AO090026000149"
                     /note="polyketide synthase modules and related proteins"
                     /old_locus_tag="AO080561000043"
                     /protein_id="BAE59642.1"
                     /transl_table=1
                     /translation="MGLGIHLYNMAMRALAERDKKAMSIALAHNIGSILFRTIYYSCR
                     FPGDISSPSELWDFLAEERSAAGKVPKSRFNVDSFHGSKDEPSTTVALGGCFLQEDIR
                     NFDNQFFGIHNREAADMDPQQRKLLEVVFESFESAGVTLDDVSGANVGCYVASFTPDF
                     IAMQTKDVENMTRFTHLGMGATLLGNRISHVFNMKGPSCVVDTACSSSFYALHMACSA
                     LENGECDAAVVAGVNLIQTPEVHVGTSLGGVLSPASKCQTFDSSADGYARADGVGALY
                     IKRLDDAIRDKDAIRSIIRSTAVNSNGRTPGISQPSVDGQEAVIRKAYARAGLNPRET
                     AYVEVHGTGTSVGDPIEVEGLSRVFRKDQRHRPTLIGGVKPNLGHGEASSGLLSIMKA
                     SLSLERRQIPATISVKQINPKIKTEEWGVEIVTRMTDFPSECSPRRISINSFGFGGAN
                     AHGILEEPGRQTNKVSCRQAMPRRGDLTGTMNGQSDSRISNGINGFNGHNVSSSMPYL
                     LPLSANKLSSLQGRVERLSKVDFSAVSIADLAYTLGQRRSHLGLRGYVIARQATLAQD
                     FHVENFTLADSDRNLTDNKFAFVFTGQGAQWKGMARELLHFPVFADTIRQLDHELSTL
                     AYAPEWKICDVLMDDSEDCPLNLAAFAQPITTAVQIGLVNVLRSWSILPQGVIGHSSG
                     EIAAGYAAGLLTAREAIIIAYYRGYSVTSSAPEGAMAAVGLHCDDAHEWITRFDFNAN
                     LKVACINSPQSVTISGDSECIDTILASLRAEGVFARKLKTDGKAYHSHHMAVIGTMYE
                     KLLKKALSFEKQASLDLEQQDIHMYSTVVCEEVQSKAVRTAAYWRANLESPVRFSEGL
                     TFLSEMMGQCTFVELGPHAALKLPIMQTLGKSTSYLATLNRGQDSSVSLLNVVGQLFV
                     QGFKVDFSKFNHTCTHDTPRFIYDLPTYPWHYEKPPWNESRISREWRNTTHPRHELLG
                     REVPGGNKTTFGWRNLLQVENVPWLRDHKLGDTVVFPATGYLSMAVEALMQKALPVGA
                     DGAGKSVALRHVDLLKALPLPEQGSIELYTELRPLAISNIRDSKFWWEFQISSISDDG
                     PTVRAKGSIRLEQIAACGTQVPSRECRLAPQSRKLWYESIANSGLAFGPTFQHMHDIH
                     TPDPKGVLYAEARTRTLAPAIEGAQARPRYLIHPVLLDNLFQVALIACTGGFIHSMVG
                     KVPTRLGSVRISLPSSPTDEGAIRSTSKVTGQSTNKIDSALFDGQQKLVAHFKDVDVT
                     AYIGTERMEVRHPITRVTWKPDIAQVHDSATFSSALDHVLCQSDLGSFGSKANMLAAL
                     DLIVHKNPDAHILCLSTDLSLITLSFLEVLDASSIYRRFNSFSIGRLSSDGGLEVAEV
                     RNFIMPLGLRSLQYRMASSGDHFGLVILGADIAVVDRLGSHTDGETIFLAPDVDSNRK
                     HDTFSVLSSRSETAKNVHILRPAPTTNGSSTPDFDNVVFICRTPKHPADDHLAGHLSD
                     DLGVPIKPVALTDLADSPIPPNSLVISTAELERSVLAGAVPQGEFDGFKQMIEHAAWI
                     VWITGSGVHEESNPTLSLFAGFARAVVIEQPSTKIFSLELDPKTDAAGISRHVTKIVQ
                     NGKNAINDCEYIDNGSHLLISRIVPDERMNREFRTRQNGLASPMPLGSVGNAALSVRK
                     PGQLSTTQFVKRPYPSLSTLAADEVVVKVSCVGLNAKDVNALSGHVQTTDARCSLECT
                     GHIVAMGSDVRDLNIGDKVAVMYPGYFGTYETVPAWSCVQLRDDEDLRTMASVMMVFS
                     TAMYALYHRANLQPGETILIHSAAGGVGIATIQLAKLIGAEIFATVGTEEKKKYLIEH
                     FGLTPDHIFNSRDSSFASSIKSITNGRGVDVILNSLLGELLHESWDCLADFGRFVEIG
                     KRDLLDQGRLNMEMFSRGTTFTAFDMSMLAESTSPAQHRVYKGLVTRVISLLRSGDIH
                     PIEPLSVFNVSDIVQAFNHFNNAKRMGKIVISFEDQTQMIPVVHEKFSTQLDPHKSYL
                     LVGCLGGLGRSVSKWMMSRGARKFIFLGRSGIQKPAAKRLIEELEERGAQCTVIKGDI
                     TNYTDVHEAVAAAPTPLGGVIQAAMGLNEAIFKHMPREYWLNGTEAKVQGTWNLHNAL
                     SALDKEKELDFFVLTSSISGKLGTATESNYCAANNFLDAFARYRRGLGLKAVSLGLGM
                     VSEVGYLHEHPEIEDLLLRKGIRPLTEDELVQIFDFGLTHPPTSLHPNDLMPQSHILT
                     GLEDTGLQGHRKQGYEGYWQFLSDARFDVLTCALRRNAGKSAQGNSTQASVIQEAITS
                     NDREQLMDAVKVVLVKKLSNIILTPVDKIDVKQPLLDFGMDSMLAAELRQYIFGAMGV
                     DVPFLDLMDKKTSICGLATVVADKLTITSSD"
     exon            complement(419423..425816)
                     /number=1
     exon            complement(425897..426233)
                     /number=2
     exon            complement(426292..426624)
                     /number=3
     exon            complement(426782..426905)
                     /number=4
     CDS             join(430288..430455,430530..431450)
                     /codon_start=1
                     /locus_tag="AO090026000150"
                     /note="predicted protein"
                     /old_locus_tag="AO070279000065"
                     /protein_id="BAE59643.1"
                     /transl_table=1
                     /translation="MALDVPDGTPDRGKGVVILSIILMILVILATITRIMSKVIAHQN
                     WWWDDLFAILSVICELVVLSLVLVWRNIGLGYHMSVVASINPQYLITGSKYLFIAIFF
                     FDASVCLPKISAVLFYARVFRSNNRAFRINLWIIGALVAGWLISAEISTIFQCNPIAK
                     AWNTTLPGTCIKQYDWYLSTAILSTVIDFYILLLPIPMIWSLKMSLRRRIYLLICFFM
                     TYSVIVVSLGRLVAVVNLIPVMPTDLTWEFPLYLYWSVLEGSVSIVSISVPSGIALVK
                     ANIRPEGSAWGSSNGSSGKRGSYGNTTIIQHVRERPMRSYSDRDSDDHLVSDVETART
                     ANSGESDASIPLGGIKIRTDIRVMNREK"
     exon            430288..430455
                     /number=1
     exon            430530..431450
                     /number=2
     CDS             join(432473..432757,432808..433125)
                     /codon_start=1
                     /locus_tag="AO090026000151"
                     /note="predicted protein"
                     /old_locus_tag="AO070279000066"
                     /protein_id="BAE59644.1"
                     /transl_table=1
                     /translation="MDLVRTAITSSLERLKRSSSLTVSPPIMETDPLLPPYSSSPGYE
                     RERRPYRHRQGRGINTTPPIPPIQFLSALFFAGAVIASTYWAYKSYTAPERTPLEPAP
                     LLPYFASLSLILSFCSWIGYLVSILYDRDDISLLQRKLVIWISVIGKVVLGFAHAVIW
                     FEYKQFFPGTKQPNWIIMFLAMQAWWDFLLLIGYSMLRMI"
     exon            432473..432757
                     /number=1
     exon            432808..433125
                     /number=2
     CDS             complement(435255..437081)
                     /codon_start=1
                     /locus_tag="AO090026000153"
                     /note="alkyl sulfatase and related hydrolases"
                     /old_locus_tag="AO070279000068"
                     /protein_id="BAE59645.1"
                     /transl_table=1
                     /translation="MTFSPSFNDRTDFDNATRGFIHALKPCIIRNSSGRVVWNNDEYG
                     FLQDAECPATAEPKLWRQGQLNSIQGLFQVTDGIYQIRGFDLSNMTVVEGHKGVIVID
                     PLTSVECAAAALALYREHRGDRPVTGLIYSHSHVDHFGGAQGVLQQGTNTSIPIIAPE
                     GFMAEATSENIYVGDAMRRRAGYMYGMRLPKGPDGHIGCGLGMMPSSGTMSLIPPNVS
                     ICHTGEKRTVDGIRIEFQMVPETEAPAEMNFYFPEHKALCIAECATHCLHNIITLRGA
                     LVRDAKAWARYLDETAVLYGQKSNVLFAGHNWPTWGQDEIVKFISEQRDLYTYLHDQT
                     VRMMNIGLTGIEIAERFTLPPALQMAWHAQGFYGSVSHNVKGIYQRYLGWFDGNPAHL
                     WEYPAAEAGQRYIDCMGGVDEVVRKARKYASEGDSRFAVTLLGHVIAAHPEHKESRLA
                     LASVYTKLAYGCENATWRNIYLSGAQDMHSPPPPDRPEPPKREYRAALSMEQLLTLLS
                     VQLDGPKAATESFTIDLDLQEQKQSWRLILSNGALTYRIKTDHDRSIDTSGLRLTLTK
                     KELVEILNGGGGIPENSSEGDVSLLFKLMRLVGASMPPASLL"
     exon            complement(435255..437081)
                     /number=1
     CDS             join(437634..437857,437905..437950,438003..438131,
                     438180..438297,438348..438711,438762..439223,
                     439265..439397)
                     /codon_start=1
                     /locus_tag="AO090026000154"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070279000069"
                     /protein_id="BAE59646.1"
                     /transl_table=1
                     /translation="MSDAETYLDEKIHSSGSVSGLDNVEGDLGRDEVYSPREQRKILH
                     KIDRRLVTGLGLLMCVSLVDRTNLGNAMIAGQSMEEELRLYIGSRYSITLLTFFIPYV
                     LFQFPLITVIREIGPKIFLAGITFSWGIVMMGFGFIHNWTVLVGLRIVLGFLEAGLFP
                     GSVYLLSMWYTRYDLHKRYSSFYLISVIGGAFSGILSYGFVHMNGLGNLSAWRWIFVM
                     EGILTCLVGVVGFFLIVNFPNENNLSWKFLSKEETAFVVRRLNRDRRDSSEAAFNLKE
                     FLKPALDPKIWGFALIFFSATVVSYAITFFLPLILRSELKFPQAASQVLTTPPYFFAG
                     IFMYVQGWIGDKYHIRAPLIIYNCVQCIVGLAILGWVQIPGVQYFGIFLVTSASNATI
                     PATLTYQANNIRGQWKRAFCSASIVSFGGTGGVAGSLVFRSQDSPRYLPGLYACIAWA
                     RCNLLSIVVVCILSLYFYISNRRAARGKLVIEGLPEFRYTL"
     exon            437634..437857
                     /number=1
     exon            437905..437950
                     /number=2
     exon            438003..438131
                     /number=3
     exon            438180..438297
                     /number=4
     exon            438348..438711
                     /number=5
     exon            438762..439223
                     /number=6
     exon            439265..439397
                     /number=7
     CDS             complement(join(439973..439978,440031..440584,
                     440616..440673))
                     /codon_start=1
                     /locus_tag="AO090026000155"
                     /note="predicted protein"
                     /old_locus_tag="AO070279000070"
                     /protein_id="BAE59647.1"
                     /transl_table=1
                     /translation="MAKLPPNNPHAPVSLSEYQRSPFICNVTKSIQRGEMPKTTQQFT
                     HGDYTVGWICALPETDLVASAAMLDEEHPTLPAADPQDANSYLLGHIGECSEDEEGSD
                     DETKDTQDLRLWDVVVSLHSKPAEAIVQYDFGKSLQGKEVVHTGGKLNKPPGILLSAV
                     GRLQAQHALKGHGISELLIKMRSDYPASTAKFQTVLCALRWRLLA"
     exon            complement(439973..439978)
                     /number=1
     exon            complement(440031..440584)
                     /number=2
     exon            complement(440616..440673)
                     /number=3
     CDS             complement(join(441495..441547,441598..441898))
                     /codon_start=1
                     /locus_tag="AO090026000156"
                     /note="predicted protein"
                     /old_locus_tag="AO070279000071"
                     /protein_id="BAE59648.1"
                     /transl_table=1
                     /translation="MNLPTLIALLTTLTLHLTTTTTATPLSTRNVPGILKEFALTGGN
                     LILLDKAVKLYEPKKEDQGLERKQTNVEVSLIKSMNAVHATPPFKKQESSLVSNVACI
                     LFSFWIYIGFLGCRS"
     exon            complement(441495..441547)
                     /number=1
     exon            complement(441598..441898)
                     /number=2
     CDS             complement(join(442485..442727,442788..443065,
                     443126..443279,443330..443409,443456..443902,
                     443939..444225,444284..444524,444580..444760))
                     /codon_start=1
                     /locus_tag="AO090026000157"
                     /note="transporter, ABC superfamily (Breast cancer
                     resistance protein)"
                     /old_locus_tag="AO070279000072"
                     /protein_id="BAE59649.1"
                     /transl_table=1
                     /translation="METDHTKASDALDLERNDHQFLMNNTVQSFTWDNLTVTVKDRRT
                     KKPRNLIEGCSGTAHHGQLIALMGPSGCGKTTLLNVLARRTASAGAKNTGDCYINGAK
                     LDNNTFNRITSYVEQEDALIGSLTVEETLKFAADLSLPGSVSRSQRVDRIQTLLSAFG
                     IQNQASTLVGTPIRKGISGGQKRRVSVASQLITCPKILFLDEPTSGLDSTASYEVISY
                     VKKLAVANNVRLSGEGFAVKLIIIASIHQPSTTTFQLFDNLLLLSGGKTCYYGPVSDV
                     PSYFENIGCPIPSNTNPAEYLLDAVSSDFTVHEDQVEKIQTSWTQSAEYAALSKQPQS
                     PDEKDIRTMSIDELSRPGIPRITMSLLHRLFIKSYRDVVAYGIRIVMYLGTGLAIMMG
                     TVWLRLHTSQEYIQPFINAIFFGSAFMSFMAVAYVPSFLEDRATFTKERANGLYGALP
                     FVISNFIIGLPYLFLISMLFSIVSYWLSNFRPTGTAFFTWVMWLFLDLVAAESLVVFV
                     TAIFPNFVISLALVAFANGLWMSVGGFLVSPTILNPFWKYVFHYIDYQAYVFQGMMVN
                     EFSERNYSCGSGCQCMYQTDLADQCMIRGTGVLKEYGYATGRTGKWVGILIGIIAVYR
                     LFGYIALVLRRT"
     exon            complement(442485..442727)
                     /number=1
     exon            complement(442788..443065)
                     /number=2
     exon            complement(443126..443279)
                     /number=3
     exon            complement(443330..443409)
                     /number=4
     exon            complement(443456..443902)
                     /number=5
     exon            complement(443939..444225)
                     /number=6
     exon            complement(444284..444524)
                     /number=7
     exon            complement(444580..444760)
                     /number=8
     CDS             join(449093..450385,450435..451063,451114..451306)
                     /codon_start=1
                     /locus_tag="AO090026000158"
                     /note="metalloendopeptidase family - saccharolysin &
                     thimet oligopeptidase"
                     /old_locus_tag="AO070279000073"
                     /protein_id="BAE59650.1"
                     /transl_table=1
                     /translation="MTSPKQQPPTFTATPESLIQNTKHLIQHARETHNQIKRNTQPKT
                     ATFNNVILPLAHIDNNLASKTHILVFYRAVSTDPELRSASTEARSLLDSYKLETTMDD
                     GLFALVDAVFHQNEDLDTESHRLLKKIYLGFVRHGLRLSAGYQRYRFREIQSRLGWIK
                     GEFQKNLAEANITGIWFTAGELDGLPSEFLSTLMRSQAGDPKLRVTFNDSDLFQTLRY
                     AKDSETRRRLYIANENKCEQNVSLFREAILLRNEAARLLGYPSHAALRIEDKMAKCPE
                     TVTSFLGDLHARLIDNGKREVEKLKQLKKADLESQGETFHGQYFLWDHQYYHRLMLEK
                     QYSVHHDKIAEYFPLQSTITGMLEICETSFGFSFTELQTPEMTKLASHGHTLVWHEDV
                     QIFRVRNSDEAGDFIGYLYMDLFLREGKYANAANFNLIPGFTKENGTRQYPATALVCN
                     FPKPSSKAPYLLKHDEVVTLFHELGHAIHDLVSKTIYSHFHGTETEVDFGEAPSQMLE
                     NWCWTPSVLRSLSRHYSYFSSEYFDHWKRRVDGELQPQEQMPDAMIESLLRAKHVNGA
                     LFHLRQVHFAMFDMVVHDTGDHRVIEELDISAKYNSLLAEILPMDGPEGDDWGHGQTR
                     FQHLLGEYDAGYYSYLFSKVYSTDMFYTVFKADPMNSLQGRRYRYTVLEKGGSLDGLT
                     ILTDFLGREPQTDAFYKELCQT"
     exon            449093..450385
                     /number=1
     exon            450435..451063
                     /number=2
     exon            451114..451306
                     /number=3
     CDS             complement(452317..454233)
                     /codon_start=1
                     /locus_tag="AO090026000159"
                     /note="predicted protein"
                     /old_locus_tag="AO070279000074"
                     /protein_id="BAE59651.1"
                     /transl_table=1
                     /translation="MTGKVPHAAFCEEYDEDAHVIIPDTRQVANLAAKRSKLDLRSAG
                     EALVDIASDSGYSSRTAATVNSTQSGPSGRKDPVPLKIDTTPKRAELERVRSHRKDRP
                     KERPTRPSWDEKMQVGTYPAVSHHHASMQRSPSRSRRRENSQMRHFPGTCWECDQGLY
                     HGSTPVEPRAIEYPYYMSPSTTSSVHDYPPPSPQGPRYAPSAVQDVHVSHSNRPRSGR
                     SYTYHTNNNRPVSFHGMIPGMGGGVMYPPSHMGRYEHGPPPSSSAYTNTPAYAPSPYG
                     QPSPYFAAMSEYGPPDRQERSASRTRDQGRPRRGSTYGPPVVDYDPPSAYEDDESLDL
                     GPPRAPRPRLPSHSSHDRDEDYYRMPPPPVKHKPAPHVIQKRPELHRKAVTAPSVTSD
                     RHPSRSMDLSEMRDALPEYSYRRSSRETVIPARTRSIRDSRRSTSYHESSRPARVAVE
                     NSRRRRPTVYEYDYVDDDDEDEEEDGDEIEEKQRSAEEYQASRSGKVVPTPLTEDALY
                     KSKASRAESDSGSQKSRSNSSRGSDARTQNGSGSVAKPEEDNNIVMTMNGVTMSFTQE
                     SVGGKKISLRTGDAGAVELNIEGKRPKKYLTSGSDYTGSVAQRQLEDPRRARPDRRSD
                     RASRRSSRSTYSGR"
     exon            complement(452317..454233)
                     /number=1
     CDS             458463..459614
                     /codon_start=1
                     /locus_tag="AO090026000160"
                     /note="predicted protein"
                     /old_locus_tag="AO070279000075"
                     /protein_id="BAE59652.1"
                     /transl_table=1
                     /translation="MPPVIQAGDDFPSIPATDNNDMLSGIQPSPEVEALTDRSVIAPL
                     AEKPHSLVARDNPKYIPGDGAVDPDKINMQGLLALFALIGAAFVLAAIWFFFWAKNGG
                     FIWRKGDWEDYKSTVLRRKGPDGETLSNATKSTKLGGGSVVGKRYDEDGYTVSGYTDT
                     ATEITEKDGPRRKRGLKEKLLGKKHERYENEADEDVRAYRKEKPARIGGINADADGTY
                     YGSDYDTSNPPSYYQQSEMSQVRDYAYEPSRQKSKRRDFSFTPGTEEVLSQPPTENHR
                     IREPSTRRHNRRRERRHHAPPTSSSRQSSPRKRDRRSVPGHYTEPLDFSSAPSRSDYQ
                     YSNVDTEDTGTRSYHHPIPGLSKGYRRDGGRSRRRDSLSDSDGDETRYS"
     exon            458463..459614
                     /number=1
     CDS             complement(460443..461840)
                     /codon_start=1
                     /locus_tag="AO090026000161"
                     /note="predicted protein"
                     /old_locus_tag="AO070279000076"
                     /protein_id="BAE59653.1"
                     /transl_table=1
                     /translation="MPGAATHPVGVPSPTSPESPHEVNSERGSEPFNFYQIASSLGYH
                     VEAKESLSHPHEDSPIVNSPLNPSQNESSKDADAGFSLPGRSKDPQEHQIVSDGPDAA
                     LIAKILRANNRLLSLQNKVALKRSEVQELRTALRFKREEEADIRAEFIRHVTVAQGTL
                     RNVQPLLQNNEALLSATGIYSDMEAEYNRAESELERDEYMLIKAMEEFARLSQDHHSL
                     PSPDEPPFIDHDSLGDAISTISSAPEDPPDVVDYVSRVADVRMTQEHLIDLDREWLFI
                     QEKKEERESMNIPMDDESIEFLRTYEEERREICDELFHLQLDMNQLRTVCFEKGHLTH
                     EYIQGRDFVYELYPAAPTNQLEDPLKVSTEEDTSPFEPMEEKVSQTKFVNKWILHRLR
                     QSTVEIGHLKSLPEIKSLCDQGYDDRKVSQLSLKQWFEDETTISPPPPPATSDMSVQE
                     PGSVVRDTISGSHSV"
     exon            complement(460443..461840)
                     /number=1
     CDS             join(463305..463356,463461..463653,464047..464122,
                     464286..464476,464534..464837)
                     /codon_start=1
                     /locus_tag="AO090026000162"
                     /note="predicted protein"
                     /old_locus_tag="AO070279000077"
                     /protein_id="BAE59654.1"
                     /transl_table=1
                     /translation="MASERDPRREPNRRRQSGLSHEQVWQPDTPYLGRHVAKTLSARA
                     LPRSQPILPSPEYADFSRYHGSHTLPFGATNEQPPLPTTDNSFTRISPHLSHPGLPPM
                     KRLMTVFAVVWHEGMGNAAPLKGGTKSLATKSLASDRELMTVGKFGTKIYTDIRRMVV
                     FKEQAQCAWCFPVHTYGRLGVAKASVDPSKHAIIYMNGAQPKSGPNEPRMTKEPLEVT
                     PEPYQKLHAMSRLNFGKIYTVEHNQKVLPVGKISEESMAKFHLYAKRETELGY"
     exon            463305..463356
                     /number=1
     exon            463461..463653
                     /number=2
     exon            464047..464122
                     /number=3
     exon            464286..464476
                     /number=4
     exon            464534..464837
                     /number=5
     CDS             join(465723..465927,465985..466061,466127..466605,
                     466667..467723)
                     /codon_start=1
                     /locus_tag="AO090026000163"
                     /note="RNA helicase"
                     /old_locus_tag="AO070241000031"
                     /protein_id="BAE59655.1"
                     /transl_table=1
                     /translation="MKRKLDANDVPSPEAADKKEKKEEDDADFESLNLDPRLRQALIK
                     EKFTKPTLVQAKAIPLALEGKDILARAKTGSGKTAAYVLPILQTILQKKATDPSFKAT
                     TGLILVPTRELAEQVQNVVTTFAAFCGKDVRSVNLTQKVSDAVQRTMLADYPDLVVST
                     PARVVTNLGSSALSLENLTHLVIDEADLVLSYGYEEDINALAKAIPRGVQTFLMSATL
                     TDEVDTLKGLFCRSPVTLKLEDKDDQGAGVSQFVVRCAEDEKFLLTYVIFKLQLIKGK
                     VIIFVDDVDRCYRVKLFLEQFGIKSCVLNSELPINSRIHVVQEFNKGVYDILIAADEQ
                     EVIGARKSKKSKETEEAGSSDEDEGEPEDKSKRRKVSGKEKDYGISRGIDFQNVACVL
                     NFDLPSTSKSYTHRIGRTGRAGKTGMALSFVIPKDQHGKHRPTSTATSKHDESVLAKI
                     VKRQGKLGHEVKPYHFEMKQVEAFRYRMTDALRAVTRLAVQEARAREIRQELIKSEKL
                     KRHFEENPEELRQLRHDDELRSARVQPHLKHIPEYLMPAKGKKGLSSGDVGFVSFRKQ
                     NENRIRKAREKNRGKGNGRKFAGVKKKVDPLKTFNRGRK"
     exon            465723..465927
                     /number=1
     exon            465985..466061
                     /number=2
     exon            466127..466605
                     /number=3
     exon            466667..467723
                     /number=4
     CDS             complement(468320..470065)
                     /codon_start=1
                     /locus_tag="AO090026000164"
                     /note="predicted protein"
                     /old_locus_tag="AO070241000030"
                     /protein_id="BAE59656.1"
                     /transl_table=1
                     /translation="MPKKHHRSNFTKPASTAHHTLASSGLRDDRFRSSSNEQPSVNDL
                     INHLRRTQVTSSPSEDGTRAPFRTVAPRSVHPSLRNLLELPETPPPRPRPDAPRAGVG
                     GRRLRRTAGPPPPESWLLGNYSLEISEEAGLEAGAAEAERIIYRLDRLPGTMFPQRTS
                     LLHMLLKSMAMHWVWHLEYDGQFLALLPSHIKVLLLSYIAIHARDQPLRGMMHGLRPL
                     IEKHRPEGDDISQDSDLEISRLDLSGALGRWMTWKQLTGELIVSAKPSTVQRTMKEPI
                     PASWDDKLDEDDGPAIAGETIFPKAVTQGLRFENLRYLSLAHPIPSATNWNSLINLLS
                     RLSTITHLSLAHWPVPTVTPNAVNSRVRHPTQRSLTFAYGGTDTYSSFENNWAEAAGI
                     LRRLCRATYCLKWLDLEGCGDWVPALNWDGVGPDGEAYASGPEWNGSWRDVEFVRLGP
                     GWLPHIDDSELLPLPPSSSSGRTATASSSLALSPPVPRSLAFSMHAPSPDESTDSDAL
                     PWDVEVERVKYRREKELERYQEAVQAAKAVQQRVQRARKAGKGKWVHFSFGLEGLEEG
                     VLRRLLGKEYLSLLP"
     exon            complement(468320..470065)
                     /number=1
     CDS             complement(join(470294..471107,471169..471387,
                     471566..471675))
                     /codon_start=1
                     /locus_tag="AO090026000165"
                     /note="phosphate acyltransferase"
                     /old_locus_tag="AO070241000029"
                     /protein_id="BAE59657.1"
                     /transl_table=1
                     /translation="MSGDRDSGATGECPSLPWRAMSSATIFGVAALCRSFFFQPYQRV
                     RMYDAPQNGRGDLITRDKEEYTDRGRTSSMDDPIMWGFLPLRYNFGFSNWNRRWGFGS
                     HDICFQGRPLSLFFTMGQVLPTHRLAHSPYGGVAQPAVTQAIRLLSKGPFPVNAHNAR
                     PERQHWSLQNVCVDPFSDLPMAYTTNGEDSHLAPSAFSCNSYAWVHIFPEGKIHQAPN
                     KTMRYFKWGVARLILETNECPDVVPMWIEGFDQVMHESREFPRFLPRPGQDVSVTFGQ
                     KVDTDAVFGDMRRRWRDLKAKAESKAPETRDLPVGVLSDELLNGKEAVELRKEVTKRV
                     RDLVLDVRRSRGLPDEDPKEGLVETWIQEGPKREGKMDDESWVRDI"
     exon            complement(470294..471107)
                     /number=1
     exon            complement(471169..471387)
                     /number=2
     exon            complement(471566..471675)
                     /number=3
     CDS             join(471954..471994,472113..472342,472501..472553)
                     /codon_start=1
                     /locus_tag="AO090026000166"
                     /note="predicted protein"
                     /old_locus_tag="AO070241000028"
                     /protein_id="BAE59658.1"
                     /transl_table=1
                     /translation="MFKATSPLFSGLLWKIPWRISQPQKARQRKRLRSVDNVVDTISA
                     ALARNGLKARSVDRWYREMPREEEMLPKDKYTLFDKKEKTYRKGIHKLPKWTRVSQRV
                     NPPGF"
     exon            471954..471994
                     /number=1
     exon            472113..472342
                     /number=2
     exon            472501..472553
                     /number=3
     CDS             join(480666..481101,481175..481263)
                     /codon_start=1
                     /locus_tag="AO090026000168"
                     /note="predicted protein"
                     /old_locus_tag="AO070241000026"
                     /protein_id="BAE59659.1"
                     /transl_table=1
                     /translation="MVQSAARASSGSSSREYGITFECAPPSAVRPGVPFTLPVIVAVR
                     PVGAPRDSSVQQLVVNVSLRNESGTAACPGLTGTLTSSVRSRHGNTTTGFGRFNRLTI
                     AQPGRYRLRVMLGAASANGVTTRDYIDSGVIEVHAGAPAAQRPTPSQVTKLQSLIPEN
                     IDLSASDIAAWQQA"
     exon            480666..481101
                     /number=1
     exon            481175..481263
                     /number=2
     CDS             complement(join(482570..482985,483080..483197,
                     483273..483279,483301..483527))
                     /codon_start=1
                     /locus_tag="AO090026000169"
                     /note="predicted protein"
                     /old_locus_tag="AO070241000025"
                     /protein_id="BAE59660.1"
                     /transl_table=1
                     /translation="MSRTLLITGATGKQGGSVFNNLLSQDADFEILAVTGDAQSNSAQ
                     KLLKKSSKIKLVEGNLDHPEDIFRQAQKVTTYVQTPVPGLFKEDSEERQDKALVDAAL
                     NNNVKFFVYTSVDRGDMQWVILRPVAFLNNFTPDFFGSVFTTSWKIVLRGKPLQLISV
                     TDIGFFGAQAFLHPDEYKYRALSLTGDELSYDEMARIFKRVTGKDVPLTYGFLTRLLM
                     WAFKELGVMFRWFHDSGYKADVRALRKLHPGLKNFES"
     exon            complement(482570..482985)
                     /number=1
     exon            complement(483080..483197)
                     /number=2
     exon            complement(483273..483279)
                     /number=3
     exon            complement(483301..483527)
                     /number=4
     CDS             complement(489622..491052)
                     /codon_start=1
                     /locus_tag="AO090026000173"
                     /note="predicted protein"
                     /old_locus_tag="AO070241000021"
                     /protein_id="BAE59661.1"
                     /transl_table=1
                     /translation="MPASLLLLSPELLVNILQSLTSSRDLDAIVKASSQVYRVFASYK
                     QSVVSAILLQAIPQEVELEFVLAYRAQRIWKLVPEDEEQRGGYRRGRYQELFDSLNQE
                     STAILDQYKSGKGEQLHELISNRALLLDIWKFYSSFEHLLVSYGTRALSDLQHSSSVP
                     NVLLSFTEKTRLQRAFYRWEIYTCLFQISQVFGDRPLRPAPATDPAPRFAAMLRPWEV
                     EEISCVAQFYRVLLEELSDRIEEDFVTMAKEKMDARADVGGEKEEIGAMLDWFGLWWY
                     DESSKGSERSEHIDYLISRGMLAVRKLTSAPLSIVRRMVVTSDSEAQGKKSILRGLHE
                     SGSHEEREGNEEEFIKRQAADDNSDDESLGHCNFGWLWAVGNDKTKWRWDIDLPVNYE
                     LRNRGYVFWDKARLLKCKKFQSPRDPVKDAFEFPVGYQEYSDQPGIQTKLKDFLISWD
                     VVREMADEIRFRENGDDDSSVIDWRN"
     exon            complement(489622..491052)
                     /number=1
     CDS             join(492287..492663,492716..492872)
                     /codon_start=1
                     /locus_tag="AO090026000174"
                     /note="predicted protein"
                     /old_locus_tag="AO070241000020"
                     /protein_id="BAE59662.1"
                     /transl_table=1
                     /translation="MFDRGKHESRRRKIDYGSPMETTYKDYAEARRSRYPNTYRETPP
                     DERTKKDYENYSALTAESKAKNKEYLGLYKQEARRFDNYGRSDPQSFAEEKSFYKEHR
                     AGLFPEQHERLVEPSRQRHEAMMSMANARDRYLADHRYGYYDYGQRKTHEGHRDRAYN
                     NTLTARIDFDEHYKYAG"
     exon            492287..492663
                     /number=1
     exon            492716..492872
                     /number=2
     CDS             complement(join(499022..499209,499269..499401))
                     /codon_start=1
                     /locus_tag="AO090026000175"
                     /note="predicted protein"
                     /old_locus_tag="AO070241000019"
                     /protein_id="BAE59663.1"
                     /transl_table=1
                     /translation="MSFHQSAEDIEIKDNHILFARLRNEDGDLKDAEINLDEFLGNDD
                     GHFQWGGENFSHTADDVHFAIEGDDEVPVLRAVLLNGEGEPVESNVNLSERINNDDGA
                     FVFA"
     exon            complement(499022..499209)
                     /number=1
     exon            complement(499269..499401)
                     /number=2
     CDS             join(502349..502508,502554..502762,502895..503473)
                     /codon_start=1
                     /locus_tag="AO090026000177"
                     /note="predicted protein"
                     /old_locus_tag="AO070241000017"
                     /protein_id="BAE59664.1"
                     /transl_table=1
                     /translation="MPKDPIYKGLGDVLGGIPLDSIQPRDGITTKVDLATLTSYNLLP
                     KQRKTIVVPGSPSIWRPPNTPRKVKADAGKYQMDPNRHVFPKCSLEPLFRALSLTQPN
                     MKLNDIDLVTDRRNLRLLLGFVSTRQPKAVRNSLTHNRIIRYMFGDVKIIMRYEVDGC
                     TGSDKDIRTAMPISEVQRTPTGYTVLKCGQLVSPSRIIEIKTGAAGKNLVISKNTEQL
                     WFSQTPFLCAGHYDEVGNFTSITKKNHLKLGTLQKWENSHQEQLKKLATLLRVIVELA
                     KAAAWKKFALVSSENTLKVFGLTNQNDKGLPVDLHSMWE"
     exon            502349..502508
                     /number=1
     exon            502554..502762
                     /number=2
     exon            502895..503473
                     /number=3
     CDS             complement(504613..505188)
                     /codon_start=1
                     /locus_tag="AO090026000178"
                     /note="predicted protein"
                     /old_locus_tag="AO070241000016"
                     /protein_id="BAE59665.1"
                     /transl_table=1
                     /translation="MKDQNTTAPQVDIQQPQRTSIEHSLSHTTTTSSSNSSSSLPERP
                     TTSTQSQTKSNHLSLKAGRLFVSRSRSRSKSPAPSDIPTTTRTRRSDSESTYILKRDK
                     MARISIPRRSESPTQMSPPASPSSIKETHSTKRRSDAYHSRKSSDDYRRYSGTVNHYG
                     RHSNDWLFGGFSLRDTVRGGVGRLRQRDDKS"
     exon            complement(504613..505188)
                     /number=1
     CDS             complement(506900..507454)
                     /codon_start=1
                     /locus_tag="AO090026000179"
                     /note="predicted protein"
                     /old_locus_tag="AO070241000015"
                     /protein_id="BAE59666.1"
                     /transl_table=1
                     /translation="MPHLLHHRRRHSWPYCGPGPRRNVPLLRVAEQQTELEQQFLTPL
                     ASGDYIEDDAASAGIVPPKATRPHYRIWPHSKTTVEHTIPSTGRSYGSGSGSLRRMIR
                     PPLDKARSLFVLPTTTTAGQNVVISYWVPQKPVMQPAAPDRGRELSSLPKHLAVDRNH
                     RRCHSEQPRSWRRPSASLWTLTEE"
     exon            complement(506900..507454)
                     /number=1
     CDS             complement(join(508922..508995,509047..510408,
                     510478..510838,511163..511880,511931..512361))
                     /codon_start=1
                     /locus_tag="AO090026000180"
                     /note="predicted protein"
                     /old_locus_tag="AO070241000014"
                     /protein_id="BAE59667.1"
                     /transl_table=1
                     /translation="MATSPDSSAADILTLTKLAWDLYHNCYLITSDAPEAFKQLVNEL
                     ASLQGVLRALRDDVNSNASFFDDLEEGRRNTLQRCLNACSNTLQNVKEVVAKYRNLGV
                     GDGKQFWQRVKWVSQRGEIDDLKSRIMIHTCNLSLCMSSIGNSTLARIERSMADALEQ
                     KSFPSTPETLSNGQRVLRTPPIPGDDDFQLDESLRIEPLRVSPKGIPMRANSLPTVES
                     HARISASESILSGGSEWSATTVNTTSPSINDPLKRSMSHNYVVRRTGSCASESRHLRM
                     PSSESAQLGIHPALREEPFLDNRTESSGSELDNTAVTSAVATAMQQLQQVQIRESILR
                     PLRYEPRDKLHRPDPQLMRSFDALVRDELRIKRLSTSDWLRVAVWWLLKGIKDEFAHF
                     ISLDVPEYSIIQSQNLDIWEPLQPEEAAEKGSDSIIGLNNVRWATVDLEDAGDEEEKV
                     FYRTFVNAGIGSKRLRMRTKGAPYMLLLSAREGESEPKITICNQSGTLCLQRDFLPED
                     LAQMIRVWQATVSGYPGMKISEPIVIRFDTKSVSVSFQHASDLQYFINLPKAYFDAVW
                     QREPVDSDQFSETVLFRSSVEKFEQLKAPTMRPMNPPVIHKSCEVRILERSYGEAWQS
                     VRRMVISSWVAEQAPWCIELFMPMSRVQVCRGTDSGQILVKWSDTCQERSTKTDGNYH
                     PLYSYVYDDNSPNIGLGLQFRSQKQVEDFEKAILSMCSQSSFSWDQPTSSGYVYDVVD
                     PSGDQKQYKAILLIQSRLTWKYCSLYYVYRDTDYVYDHRTLRVRFPRLFYTDYISSHV
                     DRLYPADRPVSFSHCEKKVGNMTAEFDEEPLLRSFMSSLANGYELLYSRRAVSLVTKG
                     KSLFGARKSNKGETEVQLWRKGASIQMSSRWDEHVTDKWLTVSVMPGALQPAKDSTRV
                     DFSTLQYSRGSFLNMAGILAVAPKDPNMARRGGQLAINFATSKVMLLDRHDFVAALEC
                     DSVPPAYDV"
     exon            complement(508922..508995)
                     /number=1
     exon            complement(509047..510408)
                     /number=2
     exon            complement(510478..510838)
                     /number=3
     exon            complement(511163..511880)
                     /number=4
     exon            complement(511931..512361)
                     /number=5
     CDS             513728..514465
                     /codon_start=1
                     /locus_tag="AO090026000181"
                     /note="predicted protein"
                     /old_locus_tag="AO070241000013"
                     /protein_id="BAE59668.1"
                     /transl_table=1
                     /translation="MSTVAPFTLDVATCLCIAFALSFMPAAYILGRSLIPSTHMRNRV
                     LFFWHAYDALTHIFIEGSFLYECFFSYTNLPAGFNRPPYFLDQKDRVYGAAYGTRPSS
                     RLWQEYAKADFRWAAADANVISLELLTVFLGGPAALYVCYLLWKASSSRTSAAAKGSA
                     KAKLWLVAPALATAELYGGFMTFAPEWLTGSSQLETSNPVYLWFYLFFFNTLWVWVPL
                     WVLWEATKELRTAFTKAESATEARKSK"
     exon            513728..514465
                     /number=1
     CDS             complement(join(514829..515337,515411..515696))
                     /codon_start=1
                     /locus_tag="AO090026000182"
                     /note="dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /old_locus_tag="AO080561000012"
                     /protein_id="BAE59669.1"
                     /transl_table=1
                     /translation="MVSKIVLVTGANNGIGYETVKALLQSTKATYHIFLGSRSLEKGN
                     KALEALKAEVPDTKSSVDLLQLDLTDDVSIETAYETVRKSYNHIDTLVNNAGASFDGE
                     LLAGHVSLRECFTKAYDVNVAGTHVLTYTFIPLLLKSADPRLIFVAGLSHITQAAESY
                     FPTPRLPAGWPKMVDFETIGYRCSKTALNILMLDWNHKLKADGVKVWGAGPGFLATGL
                     GGLTEKVREMGGGHPSIGGDFIKDVVEGVRDSDVGKVVVRNGLAPW"
     exon            complement(514829..515337)
                     /number=1
     exon            complement(515411..515696)
                     /number=2
     CDS             complement(join(516297..516972,517089..517123))
                     /codon_start=1
                     /locus_tag="AO090026000183"
                     /note="predicted Rossmann fold nucleotide-binding protein"
                     /old_locus_tag="AO070241000011"
                     /protein_id="BAE59670.1"
                     /transl_table=1
                     /translation="MTQDKPAVVCVFCGATAGKDPVHLEAARALAYEFHKNNVQLVYG
                     GGTSGLMGEIAKTLVSLSGPKAVHGIIPRALVKVSAKNSNGKASITAMGGKTAERVVS
                     ESLDGDEIPESEYGVTTIVQDMHTRKRLMATKVMEGGPGSGFVTLAGGFGTIEEVMEM
                     TTWNQLGIHRVGVVLLNINGYWDGLLAWVRNAVKEGFISAENGSILAEASDVKEVWPK
                     LLEYRCSQDRFQLNWGEE"
     exon            complement(516297..516972)
                     /number=1
     exon            complement(517089..517123)
                     /number=2
     CDS             complement(join(518328..519661,519741..519774))
                     /codon_start=1
                     /locus_tag="AO090026000184"
                     /note="annexin"
                     /old_locus_tag="AO070241000010"
                     /protein_id="BAE59671.1"
                     /transl_table=1
                     /translation="MSYNPPYPPQSQPPYSTHGAPQGFPQPPYPQQPGYGGPPPGQYN
                     RPPPAHPGQYDRPPVAPPGQPGYPPHGHPPPGPGYHSSPPSHSPYGAPPQQFPPHGGA
                     GYPPGPQPGPYGGGPVGGYPLQHPQQPFHSAPPAQPSPGYNPGQIAPGDFHREADGLR
                     KAMKGFGTDEKSLIQILSKVDALQMAAIRQTYANYIRRDLYKDVKSETSGYFRDGLLA
                     VIDGPLMHDVTSAREAVKGIGTKEWLLNDVLVSRSNADLKAIKAAYERTFSRSLEKDV
                     QSDLSFETQNLFGMILRADRHEESFPIDPRTIEEETKSLHSATAARMRNNVQEVCGIF
                     ARSSDNELRAINQAFSARYNASLEKHIDKEFSGHMKDALLQMLRGALDPAMRDAELLE
                     DCVKGMGTKDVKLVSRVVRIHWNRAHKDQVKRAYRHRYGKDLIERVRGETSGDYQRLM
                     VALLE"
     exon            complement(518328..519661)
                     /number=1
     exon            complement(519741..519774)
                     /number=2
     CDS             complement(join(520241..522973,523179..523244))
                     /codon_start=1
                     /locus_tag="AO090026000185"
                     /note="predicted protein"
                     /old_locus_tag="AO070241000009"
                     /protein_id="BAE59672.1"
                     /transl_table=1
                     /translation="MSTESPTGGPGLGDLEKELVCSICTELLYQPLTLLDCLHTFCGS
                     CLKEWFSVQASRHRSSSSARFTCPSCRAVVRETRPNATVTTLLDMVLTANPDRARPEA
                     EKEEIAQRYKPGQPVFPTAASPGNSTSESDDEDRRLMEEARELSLRESGPRTREHRSA
                     RSTRARRGESADGDRRREDGRSRQQREEERAARRHARSALPDTSDRTRQIEHQSSLRS
                     LLSLSDTETMQEEILRQILEEGLLDDIDMDNLGPAQEEELSERIADAYRRRHRLRSRS
                     QQRNGAQEEAHASNRPRSRSQSVQRSQPASGSRDSPAHPPVSRPYLLEPLVPRSSVSG
                     HQRRLSDQGSRQRVSPIPVSSASSSEVNLRPAARSSSDMIADRPRGSQAARVRAADSA
                     PRTRRATASEQSIPNIWVASSNDRELRRQRPARQSVDSPTSISSLVRSPRTASFALRS
                     EQNLANSPTATSLAPEINSPARAEGRSRPSSSRSNGPQATTYYIEPSISCDRCGRSSI
                     QYELHKKCRLCKDGDYHICLRCYRLGRGCLDWPGFGVSAKANLDRIHASSNGLAMPSQ
                     ESQHILLSLKYNRPSDTARRATRDGREVTNENPARRLQAGLFCDICQSSADTCFWKCN
                     QCNEGDWGFCNKCVNKGKCCTHALLPICRVTPDSPSTPATPAAPGDVANGSAAPLAGA
                     ETLKVLSFSTNCDICANPIPASTLRFHCLQCNEGDYDTCANCYLKLVATAKIRKENGH
                     NGWRRCLKGHRMVVVGFEDHEEGQKRVIVRDLVGGRALKDEHLQPSSPPASPSVPRTF
                     VAGSGIVPSPELGTGDWSWKEGAERRKKASRIRAPWSSTLGDRTNSYSEPSTPTTPTP
                     NASTSPRFPPDGGIGLVVHALWPWYPENGVKDELMFPRGAEITEAENINDDWYWGCYA
                     GSTGLFPGTHVFVVGEIA"
     exon            complement(520241..522973)
                     /number=1
     exon            complement(523179..523244)
                     /number=2
     CDS             complement(join(526525..526612,526669..527171,
                     527235..527617,528135..528217,528755..528843))
                     /codon_start=1
                     /locus_tag="AO090026000187"
                     /note="predicted protein"
                     /old_locus_tag="AO070241000007"
                     /protein_id="BAE59673.1"
                     /transl_table=1
                     /translation="MPTFASTAPKDSFINVLNLRSSLSIWKNFCQPSENIPNELSRVS
                     VKICRTVFTSEVVVWYMPPSWVQRNPQPRTIIEAAQLAIQVTDIGEVRHFMPHSQIPL
                     IVHQTWSHRQIDTWPDDLRQSVEKWLQFVVEDEMAYFLWEDEGMVEFIDHFEPQAHDY
                     YSSLPLMVEKTDYFRITVATCVGGIYGDLDTVPLKPPAQWITSQDVRPWTDLETRSVY
                     NSMKPVRALFGIEADCLPTDHTCWRMGYPYSIQLTQWSFASARDHPLLHQYIENLAHQ
                     LQKIANHHGGLQTSAARTELQALDPLTLTGPEAVTRAAQEWLNTSAGLRWNALTGLHD
                     GGKAKLVDDVLILPITSFSPGRGKYGNMGSKPITDPTALVHHHGQGS"
     exon            complement(526525..526612)
                     /number=1
     exon            complement(526669..527171)
                     /number=2
     exon            complement(527235..527617)
                     /number=3
     exon            complement(528135..528217)
                     /number=4
     exon            complement(528755..528843)
                     /number=5
     CDS             536204..538306
                     /codon_start=1
                     /locus_tag="AO090026000188"
                     /note="predicted protein"
                     /old_locus_tag="AO070241000006"
                     /protein_id="BAE59674.1"
                     /transl_table=1
                     /translation="MPYTAPLKSSPFAQHIENIEPESQSCPTSPTLVDPPAGRPRLSR
                     SYSSTAYVRRHRRSPSTSKSFTLPAQENVRKSKQTIDSHATIRQSPPPRSDALIPPGA
                     MISPPESAPNSSDEETNYGHKDGLRLQELELAVRSIEQRRVSSPERETQEKKPSSSVT
                     QLTNPTKKQPHPPLSKEARKISHSRSITEHAIDLKQEEAVTSSPDESDGDDDPRAKQP
                     MVRKKSGELVRPALRPPSARRRPSSMPGTPTYAKAVHFDAQLEHIRHFLQLDKPQAVS
                     AGGSPVDDYESEAGFPFSKDQPEMTSYEWDIRLPNFPRDVSTRAHQRVRLERLFLSPD
                     KNTLVGVVAVANLAFHKHVAARFTFDQWKTISEVIAEYSDDVRRKQIHDGYDRFCFSI
                     KLDEQANLEKKTMFLCVRYYVNGQEFWDNNRAMNYQVTFLKVPTSTSDSHSLPVKPIA
                     VSRAPLPRSKTFAGSSANNQGKSASFDDLSSLNDYLSFGRNTRGAKDRPPYGIRTHDD
                     DAVAPVRRDKQSSQIFGSRYDFETSLSAAMRTKSAHDRTTLTARAKSEVSPPGGGKYS
                     PVKGRGTIVDRPLGDSHSQSRIQPQAEQSKPSSLLSSKPHRESSVYKELVDRYCFFGS
                     SNSSHNTRPIPSLDKSSPHNTQTSSSQSSPTASPKTDAATGGSSRNSSPTPHSYPYIE
                     PMQSSFLKETQRPAVIQG"
     exon            536204..538306
                     /number=1
     CDS             join(539857..539866,540089..540390)
                     /codon_start=1
                     /locus_tag="AO090026000189"
                     /note="histone H4"
                     /old_locus_tag="AO070241000005"
                     /protein_id="BAE59675.1"
                     /transl_table=1
                     /translation="MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGV
                     KRISAMIYEETRGVLKSFLESVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFG
                     G"
     exon            539857..539866
                     /number=1
     exon            540089..540390
                     /number=2
     CDS             join(541094..541129,541197..542605,542754..542772)
                     /codon_start=1
                     /locus_tag="AO090026000190"
                     /note="predicted protein"
                     /old_locus_tag="AO070241000004"
                     /protein_id="BAE59676.1"
                     /transl_table=1
                     /translation="MPEYAVSYNPELDTYSLYQRYEEPRPNKDWKTAALRGPALPALG
                     NAAAGAVGAAISNVATYPLSLIIARLQTQNQRNPKKTAKTKAKGEGEETEGQDKDTED
                     SNEEEEEEYTGILDTARKIYAKEGLGNLYTGLAQDTIKTVADSFLFFLAYGFFRQRRI
                     NARYGPARKGGKQVVLPILDELAVGVLAGAFAKLFTTPLANIVARKQTSKISASTRDI
                     AARIRAEKGIKGFWSGYSASLILTLNPSITFFLNEFLKYSLFPRDKRGKPSAATTFLL
                     AAISKSAASSITYPISMAKTRAQVTGSSTAPSTDNGGKDDSDEGLSLIPPIISNVVSI
                     ARTEGIQALYAGLPAEVLKGFFSHGFTMLAKDAVYSIIVQSYYLLLIALRRYPTPDEL
                     IERARQQAEEWAEAAREGARDLAEKVKDTDASVLDHNAGNVAVEMSSSGPVPPTLDLP
                     EGNETAELVGDYVEDEATEWRSLYHWFWEKESNNSMK"
     exon            541094..541129
                     /number=1
     exon            541197..542605
                     /number=2
     exon            542754..542772
                     /number=3
     CDS             complement(543408..548054)
                     /codon_start=1
                     /locus_tag="AO090026000191"
                     /note="predicted protein"
                     /old_locus_tag="AO070241000003"
                     /protein_id="BAE59677.1"
                     /transl_table=1
                     /translation="MASHKSESGRIPRLKDLASQSRNAPLPGNNASARVSNSSISLSS
                     ALRIARPTNIRNGANKWSSLSDTDSGHPVASSKPSRIPSTHDARSLLPPRAATHPLPS
                     VARSTPSVLNTERGPSLRVNTETPPNSLAGGHRQPVRGKPRNVLRRKAPTIGQHSGNN
                     KSITEGIKPEKLNVMIPDTTHLDQVMGGSFPLPRSQTESMKETVSPYTPQDTNVGRLP
                     EEQPHNEPKELASLRTTINTQNLPPPTPIFASASSPSTRYSGSPGMWSRTSTPTSLSS
                     YSPGIVQPAKAVPRIRQPSPSQTRLPVSLRQAQQTSQDHSGHLRTNKPPGSVPEPSAT
                     SSSKSRNHDSAAKGLTDDTSTVSGSLSSRKAIAKSCLPRKTQENTDTESASLSQENSQ
                     AVRSPEGTKAKGAQETEGNATHIPARPSREGTHRLQVEPSPVVRSNLSPDIVTSHKRR
                     PSVESSFTSERIPLSSVQSASTSVDSLPSRSSSQVPSRLSPELSRNSPRASTRETKAR
                     QKPQTPTSPPKSRRFGLFTKTSKPELEAHSSEGSRTARRGPSAGTGHEGYGKYAQRGR
                     RTSVTSSGSRTRSTSTVRSASRSVSSKGSMNSRPDMELDDFLLDRLEPVFINGGGVDG
                     ATLARTQSEQSSSGYSTSSVTSLSQKAATPKHYGYSTETLTSSTDTIGKLEKLGQESK
                     PEKNVRAAPASTHQSKACNTERLEKPISSSNVDSVKPKPRATGSGQSRPDVRSSPSSL
                     TLKTNGATSQSNKSPKKGLGLKWNFFQKSRDPKYAERETPLPPPHRVQATVSPAAVRR
                     PIAHYALVDADSDTLENIIRNVEDSPPTEEESIDTPVEIPAALNVRKPSESILLPSPP
                     KLNGEFRASTKVYFNKDQVPPSSQNLAESPEEQRTTRLASVGRIPRVVSRRDRQHRPA
                     LQSFSRPFSMADSPSIAAPVTTKQFDFSPPGLPTLEAQTGTYHGNPSSFAFDFTQPFG
                     DPMSRSVLDFITGPYSSDQFLTFYPRKDSTTTITSSSGSESLAAVTAVIPEPESALNE
                     DEVWGEYDDLIDHVLSPETARSLCPGDPEADEKFELAAMASRALQAELNGLSDRQAFP
                     TAVENPAVALTPASPTSSTGSFHLRRSKIAPTLHSSLVLSSQPSFSDIIACYHHDGSV
                     ENLHGEDQHNLSTPSLSIKQQSSFLTSPSLNPSPSFETCRQRNTILFDIAERDREGPT
                     AQTNIRSGSLMTSRWLSFGRVLFSPAHNHIKNGEEERILVVDGLGNDDWSFYCALTYP
                     NAEVYKLNDAPTPTASKHPDAWQPPSNHHTIHHASLEDRFPFPKRYFTVTVLRFPAAC
                     SEHVQDNIISECKRVLRPGGYMEMSLLDLDMVNMGIRTRKAVRNLKERTYLTDSSISL
                     KPSSDSIQRLLGRHGFDNLRRCMVRIPVAGVIVRSSASSSSTSSSNPSTLAVTATSST
                     ALSHPSNSSIGAQAKAHSKTSSNDTDLSLGDLLSDPFPSPSNDESIRKIVARVGRWWY
                     TRCYEIPVLANGDAGLSIWSDKKVLRECQKRGTGFRLLIAYAQKPSEKRRTASV"
     exon            complement(543408..548054)
                     /number=1
     CDS             complement(551134..552054)
                     /codon_start=1
                     /locus_tag="AO090026000192"
                     /note="predicted protein"
                     /old_locus_tag="AO070241000002"
                     /protein_id="BAE59678.1"
                     /transl_table=1
                     /translation="MATDYSKKTNAELVEILKSRSLPHTGKKAEMVARLQEDDNNKAQ
                     TAAPAAKADNAEDVIDWEDDDVPAADAAAAKPSTEAGAAAIAAGGQGAVSNPTEVPNQ
                     QQDTNPATTDDLTVESNGDAAPTAQGGTEAAPAEAAETTEAAPAEEKPAPDYSIGLSV
                     TDMEEELKKRKARAEKFGITEDSKTAIEEAERKLERAKRFGTAPEEPATTGVSKLDQA
                     LPSEKTRKRGRGENDQGKRGGKRRDFGGRNRNQTQTQTQNQSQNRRRGQGNRNQGQNQ
                     RSNEKPASSGLSEKDKLALEARKKRFGTAA"
     exon            complement(551134..552054)
                     /number=1
     CDS             554414..556072
                     /codon_start=1
                     /locus_tag="AO090026000193"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070241000001"
                     /protein_id="BAE59679.1"
                     /transl_table=1
                     /translation="MTASDIENDANAKVRPPGVYRSKIPYFRMLIDQGAITQDVLHFD
                     YPGSGTEEDPYVVSWIPNDSRNPQLFDFSRKLTITLIVAFSTMIVALTSSAYSGSVGS
                     IVTSFDVSTEVATLGLSLFVLGFAVGPLLWAPISEVFGRQRPFFASFLAMAAFSAGCA
                     GAQNIWSLVILRFFAGAFGSAPLTNAGGTISDMFTARQRGLALSLYAAAPFLGPALGP
                     IIGGFLSMNAGWRWVEGLLAAAGGLVWIMMALAVPETYAPLLLRERAERLSHVTGKVY
                     RSKVELDKGRVALSTLLRRSLSRPLVLLFTEPIVLLFALYIAIIYGTLYMFFAGFPIV
                     YEQGRGWNPGVGGLAFLGIMIGMIIGIIFTLPANMHFIKIQDRLGGFAPPEARLLQCM
                     VGAIAIPISQFWFAWTDYPSIHWIVSIIATAPFGFGVILIYLGVMNYLIDSYTIYAAS
                     VLAANTILRSIFGAVFPLITGYIYDGVGIHWGPSIPAFLSLLCTPAPFLFYRYGADIR
                     KRCKYSAESFHYMQKLQENATDRANTETKQPAVQANENSTSETK"
     exon            554414..556072
                     /number=1
     CDS             556954..557841
                     /codon_start=1
                     /locus_tag="AO090026000194"
                     /note="malate/L-lactate dehydrogenases"
                     /old_locus_tag="AO070181000001"
                     /protein_id="BAE59680.1"
                     /transl_table=1
                     /translation="MERIRQGVLDAKAHPVLNQITPVVAQVDGQNGFGFVAAHMGMAR
                     AIEMAREYGIGFVSVKHSNHFGMSAWIVQQALDAGMMSLVFTNSSPALPVWGGREKLM
                     GVSPLACGAPAGKEKPFILDMAPSIAARGKIYKAARRGEKIPADWALDGEGRQTEDPN
                     RALEGVMLPMGGPKGSALAVMMDVFSGVLSGSAFAGHVTGPYDPSKPADVGHFLVAIK
                     PDLFMGLDDFKERMDYLYQRVVGSEKMAGVDRIYYPGEIEQITREERVKTGIPFVQAE
                     IDSLNKEADKVGVEHLVVS"
     exon            556954..557841
                     /number=1
     CDS             complement(join(558101..558208,558259..558864))
                     /codon_start=1
                     /locus_tag="AO090026000195"
                     /note="predicted protein"
                     /old_locus_tag="AO070181000002"
                     /protein_id="BAE59681.1"
                     /transl_table=1
                     /translation="MLFINVLLVFLAILHAEASPSLPDLATTFSQISSYLDNAHVSNC
                     SVAKTELPLHALLPGPNPNLRLKYVTVGRGTQNYTCQEDSNTTAPQAVGAVATLLDVS
                     CLAAYNPALLHNFTPVVRAVDSETLPFLALLSSQLSSPATKFIVGKHEFNAAGQPVFD
                     LRLAGGSDWMATKRNASSAAPDDNTVNVPWLKLTSVNGTGVTEVYRLYTVGGQPPTNC
                     QKRKGTFQVEYSAEYWFYG"
     exon            complement(558101..558208)
                     /number=1
     exon            complement(558259..558864)
                     /number=2
     CDS             join(562154..562411,562558..563343)
                     /codon_start=1
                     /locus_tag="AO090026000198"
                     /note="predicted protein"
                     /old_locus_tag="AO070181000005"
                     /protein_id="BAE59682.1"
                     /transl_table=1
                     /translation="MRFGYALAGILISIAGANAVTHTPIVSNAEIAYHRNYLYVGGQY
                     VQDNSGGHVFTDQMYVEKLTPTRGVTKEHPIVFIHGQAQTGTTFRGRSPWFPSNGTMK
                     TYSAEILQQRFTAAKHYMLWPQAALHTQWNGTGMMGDPVFDTYYASTVEFFGSSTGQQ
                     YTMQEAGAALLDLIGRPVVLLSHSQGGLMPWIITDVRPDLVHAIVSLEPTGPPFQEAV
                     FSNTSSRPYGLTDIPLTFEPAVSDPKKDLVRQVIPSNSTTRSPCVIQAEHPEPRKLVN
                     LQKVPTMILTTESSYHAPYDWCTVKFLRQAGVSTEHLQLGEIGIHGNGHMVFMEKNSD
                     QVAGVIQKWIERQ"
     exon            562154..562411
                     /number=1
     exon            562558..563343
                     /number=2
     CDS             join(563489..563617,565448..566031,566094..566119,
                     566199..567133,567186..567349,568555..568579)
                     /codon_start=1
                     /locus_tag="AO090026000199"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070181000006"
                     /protein_id="BAE59683.1"
                     /transl_table=1
                     /translation="MLDACLSYKARLLINLQTPIIFRGHSNACSHTGSSLLISANNSQ
                     PELLHQKSIMVMAKEPAQPSTMASSQPQATTDTSSRSFLQISIVMSCLCAGTFVAALD
                     ATIVTTSLPSIAGHFHSASGYTWIGSAYILANTASVPSWGKLSDIWGRKPLLLCGNAI
                     FFAGSLICSVANTMALFLFGRVMQGLGAAALMTLVNICVCDLFSLRDRGLYFGLLSVD
                     WALASGIGPILGGVLTEKATWRWCFWINLPITGLAFLLLWLALELDNPHTPIWDGLKA
                     VDWIGSLFVIGSSIMLLLALDFGGVTHPWDSATVICLIVFSIVVLSLFVLNEWKLAKY
                     PVIPLILFQHRSGIAAFVVCFCHGFIFMGEAYYLPLYFQAVLGATPIMSGVYLLAFVI
                     ACTFSGAFTGLFIQKTGQYIPPMWLGLGLLTLGAGLLINLEATANWGKIIGFQIISGL
                     GIGMNFEGPLLALQAIVGVKNTATATATIGFVRTMSTAISVVIGGVVFQNQMVKEGPN
                     LVQSLGSELASRFGGANVTANIQLIGTLPADQREVVRQAVFGSLRTTWIMYVAFAGVS
                     LVAGFFVGAHHLSEEHEVAVLGLHGQSGDSSEDTSDDAPATRTMEMQKEIGAGY"
     exon            563489..563617
                     /number=1
     exon            565448..566031
                     /number=2
     exon            566094..566119
                     /number=3
     exon            566199..567133
                     /number=4
     exon            567186..567349
                     /number=5
     tRNA            567790..567893
                     /locus_tag="AO090026t00003"
                     /note="tRNAscan-SE"
                     /product="tRNA-Ile"
     exon            568555..568579
                     /number=6
     CDS             complement(join(569762..569877,569935..570422,
                     570496..570950))
                     /codon_start=1
                     /locus_tag="AO090026000200"
                     /note="predicted protein"
                     /old_locus_tag="AO070181000007"
                     /protein_id="BAE59684.1"
                     /transl_table=1
                     /translation="MVIENQNRQYGGMGFDSVYHHNTPQFTDPWTAAHTTSHSTPPVY
                     ATSMASNPILNHPKQEEVSRPSPLSMPYSSIPVSAPSMVTSSTYSTTPATSYPAPEVM
                     GLHHDLPRTSFEQTPAYTTASSMSSFAPASYAPISYAPLHHQDSRRISHADPRASQSQ
                     PSSAPTFGDALDASRGMVALSQDLTPRNIYAPRNGRGSGDSYGFPSAHSSGSSISSGG
                     SYPYYSASVASVESSVTDYSSTTSESYENGHLSRTLPRPSNLLTGSAPPGPQSMMSQF
                     SSKMPSNTQKKHKCKVCDKRFTRPSSLQTHMYSHTGEKPFACDVEGCGRHFSVVSNLR
                     RHKKVHKGEKEGASGDEE"
     exon            complement(569762..569877)
                     /number=1
     exon            complement(569935..570422)
                     /number=2
     exon            complement(570496..570950)
                     /number=3
     CDS             join(576506..576577,576984..577047,577162..577235,
                     577573..577764)
                     /codon_start=1
                     /locus_tag="AO090026000201"
                     /note="predicted protein"
                     /old_locus_tag="AO070228000001"
                     /protein_id="BAE59685.1"
                     /transl_table=1
                     /translation="MGGLSFLFIRPSWRLNEHAFCSDTMMTTKRNDVTSKYNRNRGEF
                     AYISCTLLHRGDGRVSSAPGETEMARSLLLVCLLWPPKTRSNLCFVKAKILERQPFGF
                     STSPLFLSESDLSPFSLILSLYHRNPEPKMD"
     exon            576506..576577
                     /number=1
     exon            576984..577047
                     /number=2
     exon            577162..577235
                     /number=3
     exon            577573..577764
                     /number=4
     CDS             complement(583741..585306)
                     /codon_start=1
                     /locus_tag="AO090026000202"
                     /note="succinate dehydrogenase/fumarate reductase,
                     flavoprotein subunit"
                     /old_locus_tag="AO070228000002"
                     /protein_id="BAE59686.1"
                     /transl_table=1
                     /translation="MALPSHCDVLVIGGGNAGFCAAISAVQSGAQKVIIIDKCPENWA
                     GGNSYFTAGAFRTTHGGLEDLLPIVNNVDTATAHKIDMSPYTAADFTNDMERVTGKRT
                     DRELSRVLVNDSNETVKWLAQNGVRFQLSFNRQAYEVNGRIKFWGGLALKTQDGGKGL
                     IQDHLRTAQKLGIDVFFSTAAEKLATDPVTRAVTSVTAVHHGQVKVIKTNAVILAAGG
                     FEANPRMRAQYLGPHWDTALVRGTPYNLGDCLEMAIRDVSAKQVGNWSGCHCVAWDAN
                     APANTGDREISNEFTKSGYPLGIMVNRQGSRFVDEGSDLRNYTYAMVGRQILHQPGHV
                     AFQIWDSRTISWLRKEEYRPEVVQHITASSISELAEKCAAEHGLEDKDQFERTIHEFN
                     NAVYESQRLNDGQQWDPAVKDGLSTQSKACTLSIPKSNWALPIDQPPFLAIKVSAGIT
                     FTFGGLEVNPETAAVVSSTTNCEIPGLYCAGEMVGGLFYDNYPGGSGLTSGAVFGRRA
                     GKAAAMASTIAVR"
     exon            complement(583741..585306)
                     /number=1
     CDS             complement(join(585691..589376,589428..589437))
                     /codon_start=1
                     /locus_tag="AO090026000203"
                     /note="splicing factor 3b, subunit 1"
                     /old_locus_tag="AO070228000003"
                     /protein_id="BAE59687.1"
                     /transl_table=1
                     /translation="MSDSDFEAVRRLQAERNAAAAGKKGSRTFDPSSQRTDNSTKASL
                     TESFDTTLYEREGADRFSGYDTSIAVNGDDEEMEDADGGHRLVGQYTATKSQMDEFAH
                     GNGVEEEDILLGREKAARIADRETDYQKRRFNRGPLTPTRADPFAANTHANVEGEGQT
                     YREVMALRELEKEEERVQKLIAEKQASGENGVAEHEATLKLEDKENTDAGSTVTVATG
                     RKRKQRWDVTSESTEAAPEAPEPQETKKKSRWDQTPSLPVPGAAEEAPKRRSRWDQAP
                     SITSATPVGNQGLATPMHPSQVGAALIPTSFGTDISGRNAPLSDEELDMMLPGEADGY
                     KILDPPPGYAPIRNPARKLMSTPAPMASATGVGGFMMQEPESARALGKQLPTEIPGVG
                     DLQFFKPEDMAYFGKLMEGGDESVMSVDELKERKIMRLLLKVKNGTPPMRKTALRQLT
                     DNARQFGAGPLFNQILPLLMEKSLEDQERHLLVKVIDRVLYKLDDLVRPYVHKILVVI
                     EPLLIDQDYYARVEGREIISNLAKAAGLATMISTMRPDIDHVDEYVRNTTARAFAVVA
                     SALGIPALLPFLRAVCRSKKSWQARHTGVKIVQQIPILMGCAILPHLKGLVDCIADNL
                     SDEQAKVRTVTALAVAALAEAANPYGIESFDEILNPLWTGARKQRGKGLAAFLKAVGY
                     IIPLMDEEYANYYTSQIMEILLREFSSPDEEMKKVVLKVVSQCASTDGVTAGYLKEHV
                     LTDFFKSFWVRRMALDRRNYRQVVDTTVDLGQKVGVGEILERVVNNLKDESEPYRKMT
                     VETVEKLIAALGAADISERLEERLIDGVLYAFQEQSIEDIVILNGFGTAVNALGTRCK
                     PYLPQIVSTILWRLNNKSATVRQQAADLISRIAMVMKQCGEDALMGKLGIVLYEYLGE
                     EYPEVLGSILGALRSIVTVVGINQMQPPIRDLLPRLTPILRNRHEKVQENTIDLVGRI
                     ADRGPESVNAREWMRICFELLDMLKAHKKGIRRAANNTFGFIAKAIGPQDVLATLLNN
                     LRVQERQSRVCTAVAIGIVAETCAPFTVLPALMNEYRVPELNVQNGVLKAMSFLFEYI
                     GEMAKDYVYAVTPLLEDALIDRDQVHRQTAASVVKHIALGVVGLGCEDAMVHLLNLVF
                     PNIFETSPHVIDRVIEAIDAIRMAVGTGVVMNYVWAGLFHPARKVRTPYWRLYNDAYV
                     QSADAMIPYYPTLEDDGLERSELSIIV"
     exon            complement(585691..589376)
                     /number=1
     exon            complement(589428..589437)
                     /number=2
     CDS             join(590681..591774,591827..592016)
                     /codon_start=1
                     /locus_tag="AO090026000204"
                     /note="FAD-dependent oxidoreductase"
                     /old_locus_tag="AO070228000004"
                     /protein_id="BAE59688.1"
                     /transl_table=1
                     /translation="MANKTSPKTDTILIIGAGVFGLSTALELSSRGYKNITVLDRYPP
                     PVPDGSSVDISRIIRSEYADPVYSQMAQEALKGWKSEYKDHYHHTGFVMLSETASNPY
                     IKKSLDIIHAQGRTLKEFVNGNGLKEMYPDLHADLSSLRAYHNPEGGWADAEGSIRHL
                     SHRCSQAGVSFVTGPRGTVLSLRTQGSRVVGVNVASGDFIPANQVILSTGAWSNLLLD
                     VTHTASASGQPVGFIQLSPEEARSIAKTPVMINLSSGIFCFPPTPGTNILKVARHSYG
                     FATSIRSVATNRTVSSPKLGSNNADKSFLPQEADKALRDGLRQLIPRFADRPWSNRRL
                     CWYTDTPEGDFVVDYHPQMDGLFVAIGGAGHGFKFLPVLGRYIADRYENCAPEALRQK
                     WRLRLPDGSGDLKIGDGSRGGPPLRMLSAEEQSKL"
     exon            590681..591774
                     /number=1
     exon            591827..592016
                     /number=2
     CDS             594160..594618
                     /codon_start=1
                     /locus_tag="AO090026000205"
                     /note="predicted protein"
                     /old_locus_tag="AO070228000005"
                     /protein_id="BAE59689.1"
                     /transl_table=1
                     /translation="MQKLHRLREGVSTSTNSQSWSNNAKLLWELLVYDRASSSQSSND
                     FFGATLSDPNARHTASRFMTPDPDFPLVGSAGISGHKTVAKEVVAYPPESVSTPPASF
                     TSGPDMHQVPSAEPFGLIKTPAEGMLNDNLFLAPESYGRAIEDWWNFTSS"
     exon            594160..594618
                     /number=1
     CDS             complement(join(595921..596219,596308..596581,
                     596693..597244,597314..597574,597625..597765))
                     /codon_start=1
                     /locus_tag="AO090026000207"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070228000007"
                     /protein_id="BAE59690.1"
                     /transl_table=1
                     /translation="MASEKEAAGGRVSSSHYDLETSKPGIEQLELIADPDDGLSEEEK
                     AKIDRRLLRKLDMRLIPWLSLLYLASFLDRTNIGNAKIDGLQEALHMTDGQYNASLTI
                     FFVSYSIFEPLTNVLLKRTLPSIFIPTIIVLWGICMTTMGLVHNFSGLMAARWFLGLA
                     EAGLFPGISYYLSCWYKRSEFGIRMAIFFSAAALAGSFGGLLAAAIAKMDRVGGKDGW
                     AWIFILEGLATVVIGVFSFWLVYDFPDKAKFLSDVDRIRVMRRLALDQQSSTAKEHEW
                     KSSYMWDSLKDHKTWLGAIIYMGADGALYAFSLFVPTIIKELILGYSSTRAQLLSVPP
                     YACAAILTVSVGYIADRTGQRGIYNILASILGIVGFAMLLGTNSPGVKYAGVFLGAMG
                     IYPCIANTIAWVSNNVEGIYKRGVTIGIMIGWGNLNGIMSSNIYRSADAPSYYPGHGT
                     VLAYLTLFLFVGSVAEYFLLRRENRKRRRGDRDHRVEGLTPEEIQQLGDKRPDFIYTI
                     "
     exon            complement(595921..596219)
                     /number=1
     exon            complement(596308..596581)
                     /number=2
     exon            complement(596693..597244)
                     /number=3
     exon            complement(597314..597574)
                     /number=4
     exon            complement(597625..597765)
                     /number=5
     CDS             complement(join(600178..600631,600669..600727))
                     /codon_start=1
                     /locus_tag="AO090026000208"
                     /note="predicted protein"
                     /old_locus_tag="AO070228000008"
                     /protein_id="BAE59691.1"
                     /transl_table=1
                     /translation="MPCTGHLALHLTALLVFPIRVHRQFHPLISNPQSITSSSTDKMA
                     DERIVLPSIAEIEASTDILSDPSRSVKVVRVRERFAVKVGTSIAPLEAENMQFVAANS
                     KIPVIKVHDHFVDPETQKRYIIMDHVPGTDLQKLAPSLPENQKKTVSKRIREAPDELR
                     RIPSKGILGT"
     exon            complement(600178..600631)
                     /number=1
     exon            complement(600669..600727)
                     /number=2
     CDS             join(601990..602214,602261..602531,602575..602600,
                     602695..603182,603209..603517,603574..603784)
                     /codon_start=1
                     /locus_tag="AO090026000209"
                     /note="synaptic vesicle transporter SV2 (major
                     facilitator superfamily)"
                     /old_locus_tag="AO070228000009"
                     /protein_id="BAE59692.1"
                     /transl_table=1
                     /translation="MNQDTTLSQMDAEKKSEEIITRKPSLAEGTVTSHQGANPPDFNQ
                     LAINNAIESIGMGRYQWQLMISCGFGFIADQMLLVSISLVMPQASKEFGPRYGTLLSA
                     TQYAGLGVGAVVYGLIADLTGRRLAWQTSIFGVSVFTAICAASPNWAALNVFVVLSAF
                     FGGGNWDIVAIDLTVLVLLLLIRKGFVDSLWIAWPLVVNFCCPAGATPETCTKANNMG
                     WRYLYIILGGLCLIMSVLRTFTLGMSESPKWLVSRGELNEAVASINTMSKVNKSTYVM
                     MVDQLRPHEHEDSKSAIKKAASMVGALFQGSKQIRSMICLVILWLLIGIAYHTPPSTA
                     RERYPVYTVFLPYYLEAHGATLGDGSTYQTYRDWSISSVVGIWGPILSAFLVQVPFLG
                     RRRSMTLTACACAAFSGAFTTVKNESQNLAFSSMINFWLNALYGIIYGYTPEVMPDAY
                     RGIGCGLTLACGRIASLSAPFIATFGDVTTSVPIWVCCAFFGVIGIVSLVLPFEPGDS
                     S"
     exon            601990..602214
                     /number=1
     exon            602261..602531
                     /number=2
     exon            602575..602600
                     /number=3
     exon            602695..603182
                     /number=4
     exon            603209..603517
                     /number=5
     exon            603574..603784
                     /number=6
     CDS             join(604434..604779,604849..605147,605242..605414,
                     605477..605726)
                     /codon_start=1
                     /locus_tag="AO090026000210"
                     /note="phenylpropionate dioxygenase and related
                     ring-hydroxylating dioxygenases, large terminal subunit"
                     /old_locus_tag="AO070228000010"
                     /protein_id="BAE59693.1"
                     /transl_table=1
                     /translation="MNRLFPFTTKSTSTPIKEKPQTKALPSSWYRSEALYALERRAIF
                     SKKWMVVTHRTRFTKTGDYVQLNVAGYGYFIIKDRTGTIRAFHNVCRHRAYPVIQSEG
                     ESGTANIISCKYHGWSYGLDGKLAKAPRYQDVEGFEKEKMGLYPIHVHIDHLGFVWVN
                     LEAGDRPSVSWEEDFEGVDQQPRLQGFDLSQYHFDHTWSMMGDYNWKTLADNYNECYH
                     CPTGHPGVNAISDLSKYYVETKAGHIQHFNADKQDTPGLGIFSTFYFPNASITVSPSF
                     WYMMRCLPVSATQTRMEYDVYRHNNASNEDFTYIDEFFKQVLREDKDLCNAAQKNLNA
                     GVFVNGELHPRAEKVRFGYIL"
     exon            604434..604779
                     /number=1
     exon            604849..605147
                     /number=2
     exon            605242..605414
                     /number=3
     exon            605477..605726
                     /number=4
     CDS             complement(606632..607741)
                     /codon_start=1
                     /locus_tag="AO090026000211"
                     /note="adenine deaminase/adenosine deaminase"
                     /old_locus_tag="AO070228000011"
                     /protein_id="BAE59694.1"
                     /transl_table=1
                     /translation="MNGLEITPFITTLPKVELHVHIEGTLTPALRWKLAHRNNIPLRY
                     PTYEALLNSYKITYNHRRELNGDNGAPTFLETYYEGCQVLCTDDDFYELAIAYFQKAK
                     DVNVRYVEPFFDTQAHTKRGIPVEAVLNGFLRAQHDGAKQLGVKSNWIFCFLRDHPVK
                     EGLEALRSALPWARTKDGKGKGLFHAVGLASNEYDRPPGLFEEGFLLAKEVGLHVTMH
                     CDVDQKDVVEHMHEGIFDVCAGAGADRIDHGLNATDAPELMAALKEKNIGLTLCPHAY
                     HRRQATEVLFPKIRKLWDEGVRFCINSDDPTYMHDVWIDGNMMKVYEYCGFTKSEMGK
                     LVRNAVEMSWADEVTKTEILDELERVLGVEEKLIS"
     exon            complement(606632..607741)
                     /number=1
     CDS             complement(join(608475..609270,609306..609489,
                     609551..610079,610134..610454,610523..610884,
                     610941..611301,611347..611424))
                     /codon_start=1
                     /locus_tag="AO090026000212"
                     /note="chitin synthase/hyaluronan synthase
                     (glycosyltransferases)"
                     /old_locus_tag="AO070228000012"
                     /protein_id="BAE59695.1"
                     /transl_table=1
                     /translation="MSSRRPNSLANTSCDSESSHCPPYQEQHPFYQEEPDEQEISLLQ
                     ENSSSHYSTPFADPVAESDSHRRYTLHDPGPMVFGAPEYEPVQSSGMKTRAGLNRYGT
                     RKINLVKGAVLSVDYPVPSAIQNAIQPEYRDAEEGFSEEFTHLRYTAATCDPDEFTLR
                     NGYNLRPAMYNRHTELLIAVTYYNEDKVLTSRTLHGVMQNIRDIVRLKKSEFWNKGGP
                     AWQKIVVCLIFDGIEPCDKNTLDVLATIGVYQDGIMKKDVDGRETVAHVFEYTTQLSV
                     TATQQLVRPHSDESTSNLPPVQFIFCLKQKNSKKINSHRWLLNAFSRILNPEVIVLLD
                     AGTKPGPKSLLSLWEAFYNDKTLGGACGEIHAMLGPRWQKCLNPLVAAQNFEYKISNI
                     LDKPLESAFGYVSVLPGAFSAYRYRAIMGRPLEQYFHGDHTLSKRLGKKGIEGMNIFK
                     KNMFLAEDRILCFELVAKAGFKWHLSYVKAAKGETDVPEGAAEFVGQRRRWLNGSFAA
                     GLYAIMHFGRIYRSGHSIIRLFFLHIQILYNICQLIMTWFSLASYWLTSSVIMDLVGT
                     PSSHNKEKGWPWGNDASPIVNTFLKYGYLWVLMLQFMLALGNRPKGLRSNSVVTLYTI
                     SFLYFALVQLYVLILSFYQVVGVFTGGMLDFNFDDGLAAFIQSFFSSSGGGIVLIALV
                     STYGIYIIASILYLDPWHILTSSWAYFLGMTTSINVLMVYAFCNWHDVSWGTKGSDKV
                     DALPSVTTQKDNNKRNFIEELDKPQADIDSQFEATVKRALAPYVEPEEDGGKTLDDSY
                     KNFRTGLVCLWVFSNLLLALMITATGVDKICLTNTSTTRTTWFFQIILWITAGLSLFR
                     FIGSLYFLGRAGVLCCVSRR"
     exon            complement(608475..609270)
                     /number=1
     exon            complement(609306..609489)
                     /number=2
     exon            complement(609551..610079)
                     /number=3
     exon            complement(610134..610454)
                     /number=4
     exon            complement(610523..610884)
                     /number=5
     exon            complement(610941..611301)
                     /number=6
     exon            complement(611347..611424)
                     /number=7
     CDS             join(613004..613449,613663..613702)
                     /codon_start=1
                     /locus_tag="AO090026000213"
                     /note="predicted protein"
                     /old_locus_tag="AO070228000013"
                     /protein_id="BAE59696.1"
                     /transl_table=1
                     /translation="MSTITTTTTTTTTAAAAAASSSCHAKLYEIPTTDAACAMPMNST
                     YHTLMTNCCGAASVISYSDCDYYCLAQNQTIGNLAECLIKGSAAGQVWCNTNENATAT
                     GTASATASATGNEKLDPIGSNGVMTSSLATMDVLMLVLVAFGGIAQPVVSWKQYCLNL
                     S"
     exon            613004..613449
                     /number=1
     exon            613663..613702
                     /number=2
     CDS             complement(614008..615099)
                     /codon_start=1
                     /locus_tag="AO090026000214"
                     /note="protocatechuate 3,4-dioxygenase beta subunit"
                     /old_locus_tag="AO070228000014"
                     /protein_id="BAE59697.1"
                     /transl_table=1
                     /translation="MQLKNAIHFTVFGCAILALAHPGHHEEHDPAPVRAYKRDVGHGL
                     ANCAGQLEASGLQARSEARRKATVQLHRRQLITRDTDAVLNKSHQVTRPVSPSMPPNE
                     IFKDTTQKACILGPTAEGETGPYWIPGERVRSEIREGQPGVPVILEQQYIDVETCQPI
                     PRLYAELWGCNATGVYSGLVADGNGNSHDLSNRNRTFLRGIQETDIDGVVTFDTLFPG
                     HYDGRTTHYHNIAHFGARRLPNNTIAGGTVGHVAQIFLDQDLIDQVESTYPYNTNNIP
                     ITLNSVDRVVSQETENSNSDPMLNYAFLGDNIEDGLFAWITVAVNLSAVHYPYYTNVY
                     TAEGAVEVEGTSDGDPRAIDGGLPQSSAA"
     exon            complement(614008..615099)
                     /number=1
     CDS             join(616531..617190,617205..617453)
                     /codon_start=1
                     /locus_tag="AO090026000216"
                     /note="ribulose-5-phosphate 4-epimerase and related
                     epimerases and aldolases"
                     /old_locus_tag="AO070228000016"
                     /protein_id="BAE59698.1"
                     /transl_table=1
                     /translation="MPPATVTEYPIHHSQAKSNTERPGAPVSGSPDLTSSWRQDVHFL
                     GDKDGKVELRSPPNFNDISDARTHLKQHLAAAFRVFARQGFDEGVAGHISLRDPGNPS
                     LFWINPLSTHFSQIRVSDLVLVGETGEVLPDGAQNPINGPAFAIHSAIHRARPDLNAA
                     CHAHSVYGKAFSCFGRPIEMLYQDALRFYNDLAVYPRYGGTVLTAEWATGSRLHWGRA
                     AVNHGMITCGRTVDEAAFLFIALDRCCHSQLLANAAVCPGFEKRYITDEQAEFGHRRS
                     GNASKMWLAFQPYYDQVVKEEPDLLL"
     exon            616531..617190
                     /number=1
     exon            617205..617453
                     /number=2
     CDS             complement(617823..619811)
                     /codon_start=1
                     /locus_tag="AO090026000217"
                     /note="predicted protein"
                     /old_locus_tag="AO070228000017"
                     /protein_id="BAE59699.1"
                     /transl_table=1
                     /translation="MPRACEFCRRRKIRCDASRPVCSTCRKSKRSCVYHNAPPKQRPS
                     AALIDSLQTEKAALEDALSRLKSAGDAERRALLDSMIVRDGRISLSDRSGGSTASSPR
                     ARSALRTEHGVEQQLLGGHAVRMRENGGDATNSVDTGHGSDSVENETDRVLPRTYKSH
                     VTSDGIFSSTSVIHVSRPVTSPEQPAASTESLRYQLIANAAMERQREHRLRRLTVIRG
                     IPADLALHLLDLHWSRQHHTFLLTYRPAFMRELEHGGPYCSDLLLYAVFACASKFSER
                     PEVRSNPVDPETAGRCFFNRCQELLLVEGLMTHSSIPTVIALVMLGSTLIARGRTSQG
                     WLYTGYAMRMVYDLGLYFDLQEPNKHNVEEIEIRRRVFWGAFVCEKLQSLYLGRPPTI
                     RLQDVHVSQDFMDTFEELEPWEPYNERSTDIITNNIGSSPVPLAYSVTTFQQLCLLSE
                     IMTQIIDKIYYVGATASKTIHQIEALDDALTAWYRGLPAHLAHEPWAKDPLEPPVRVA
                     PNRIIILTTYHSLIVLLHRPFITAPSSTSNHNSVDTIGTPAFSWKRCTAAARRITSLA
                     LSYQSIYPLHKSSYLLSYAVYVACTIHVLNTASLSVGSDGNAHAESSYLLSASLRCLD
                     ALAVPNSGAADTARIIRKLMAAKGVPESRSECLYNLLL"
     exon            complement(617823..619811)
                     /number=1
     CDS             complement(620089..620799)
                     /codon_start=1
                     /locus_tag="AO090026000218"
                     /note="demethylmenaquinone methyltransferase"
                     /old_locus_tag="AO070228000018"
                     /protein_id="BAE59700.1"
                     /transl_table=1
                     /translation="MDESTILTRLSVLDTNAVSDALDFLQLKGATYGLRPLWDCPKIV
                     GRASTVKVGPKTGTAATAHPFASVIDAVTTDDRILIIAGGLEGVSCWGDIIANASKVK
                     GIRGTIIDGVCRDIDGSRDIAYPVYGRNVTMISGRKRMVQVGAGTAVQVGGVTVRQDD
                     YVIADNCGTVFIPAEYVETTVELAEKITHRENLMIKDVRAGIPVSEVMHDAKFQAITE
                     DIASAAAGVLSSTQSPVL"
     exon            complement(620089..620799)
                     /number=1
     CDS             join(621514..621790,621839..621992,622048..622487,
                     622542..623158)
                     /codon_start=1
                     /locus_tag="AO090026000219"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070228000019"
                     /protein_id="BAE59701.1"
                     /transl_table=1
                     /translation="MQTSIATSPTEGKSYYERHGPMTAPTRTELTTFVSQVDIRLVPM
                     LCILYLISHLDRANIGNAKILGLTEELGLSGMQYNIALSLFFIPYVLLEVPSNILLKH
                     FTRPSVYLGTLIVSWGIIMTLTGVVRNFGGLLTMRLLLGIFEAGFFPGSVYLCSRWYM
                     PRDLATRVAAFFCASALSGAFSGLLAAGLNKMDGVGGYSGWRWIFLIEGLITVVLGVL
                     TFFLLVDSPEISTKWLDQDEIRYLVIQEFIKEGGKFKEEDKKTSWKDVGDMMRNWRIY
                     LLSYIMLCQSACNYGTKFTLPTITEAMGFTGTNAQLMTVPPYIAGAISAVLFSKLSDR
                     YYWRMPFVAAPLLLIVTGYAIIMGLKGRLEANIGPGYFAIIIACMGIYPTYPATASWA
                     MNNLAPSKRRAIGSAFNICMGNTGGIIGSYMYLDKEAPTYPTGFGLSLAFGGSALLVA
                     VLLELSFAYGNKRNARLTETEIREAYTDEQLLAMGDRSPFFKYTL"
     exon            621514..621790
                     /number=1
     exon            621839..621992
                     /number=2
     exon            622048..622487
                     /number=3
     exon            622542..623158
                     /number=4
     CDS             complement(623690..624850)
                     /codon_start=1
                     /locus_tag="AO090026000220"
                     /note="predicted protein"
                     /old_locus_tag="AO070228000020"
                     /protein_id="BAE59702.1"
                     /transl_table=1
                     /translation="MARIHLYSWMTLFAGTFAQLQTFSPPGQSFISYSVNIPQTTASS
                     GSGPIYIQLKSTQELQWFAWGQGSRMQGANIFAVYASHDGNNVTVSPRLGVEHVEPTY
                     NSQVQISVLAGSGISNGVMTANIRCDSCLAWPGGSENPNSSASPWVWAVKYGQLLNSD
                     SLSQPITIHDTSGVAVLDLQKATGGASDNPFLASNNSNSAGQALTIFDTGNIASRRVA
                     HAVLMILVFVIFFPSFALMLHTGAHSRIVDIHAFFQLFTLALAISGFGIGISLAKALH
                     LTGTYHPIIGMVAVPALILFQPAMGFLQHRYFHKTGKKSVFAYLHRWFGRSIIVLGIV
                     NGGLGFHLARKVTSTAPVGAIIAYSVVAGIVGLVYALVIIVLPLRKQRTSSP"
     exon            complement(623690..624850)
                     /number=1
     CDS             join(625640..625972,626020..626123,626178..626472)
                     /codon_start=1
                     /locus_tag="AO090026000221"
                     /note="predicted protein"
                     /old_locus_tag="AO070228000021"
                     /protein_id="BAE59703.1"
                     /transl_table=1
                     /translation="MAQLQYLFAFILVQLQLAGAQDSTATSNTSSSTTSTAMGTASPS
                     AVQTVDVGEHGFSFDPDTLKVAPGGKVEFHFYPGNHSVAQASFSKPCHPMNDSSFFSG
                     FIAPTTGESDTVFTVTVNDTKPIWYYCGQVGHCQAGMVGVINPPASGSDTLEAFKSAA
                     SNANGDSVPSKVQGGTLSTSSPKSSSTSTSETSTHSSTATTSASPTTTNSPSPTATNI
                     AGNLQASTDSSIVFVLALMAFGFFM"
     exon            625640..625972
                     /number=1
     exon            626020..626123
                     /number=2
     exon            626178..626472
                     /number=3
     CDS             complement(join(626975..627502,627512..627830,
                     627883..627905,627962..628043,628071..628754,
                     628804..628817))
                     /codon_start=1
                     /locus_tag="AO090026000222"
                     /note="predicted protein"
                     /old_locus_tag="AO070228000022"
                     /protein_id="BAE59704.1"
                     /transl_table=1
                     /translation="MCIEISLLKHLQQVYNALRSHTELYRSKVLQSPSSALLSVSSLP
                     PRAIASFLVHCFFKHAETSYFTVERIWLESKLDLAYTNPNSITNSDVSTMCVIFGVLA
                     FGTQHAYLESATERIGGRKSTQHGPFTGDTIGVMLYQQACLLLPDFITLSSLKSVQAC
                     LLLGIYTLPLDASGLAWIYLGIGVKLANQNGMHRKTCEDSFDLYIRETKNLVWWTLYT
                     LGSSVSHLSYYSLLSRIAIFHGRPFSIARSDVDTELPTGKSDLCSISHSISLLHTSLT
                     SEVIERLTRLFNLQQDLINWWKTLPRNDIHSDHTSHPENLRRAMHLKLDYCLGIMFAG
                     RYFIFAESSLEGNSPTSTTKLQNARPMRINSQTRHMSSILCVSAAHTVIEICRHLYNT
                     IGLARASYTEFSACHAALLVINTQCLQATDYRQHHAIREGFTMLKEMSGEAELARTEV
                     SLIEGFQHIIASMDIAGDDVAGDMASDFSTFKNWENSWRQDSFFAQNPRPDDSILMAS
                     LGLSSGSPGASSGELSLWTSLFGSDRDGPSCTQGQDDWTRL"
     exon            complement(626975..627502)
                     /number=1
     exon            complement(627512..627830)
                     /number=2
     exon            complement(627883..627905)
                     /number=3
     exon            complement(627962..628043)
                     /number=4
     exon            complement(628071..628754)
                     /number=5
     exon            complement(628804..628817)
                     /number=6
     CDS             complement(join(630237..630254,630306..630363,
                     630427..630786,630866..630891))
                     /codon_start=1
                     /locus_tag="AO090026000223"
                     /note="predicted protein"
                     /old_locus_tag="AO070228000023"
                     /protein_id="BAE59705.1"
                     /transl_table=1
                     /translation="MVNRAFSKLYADDGVRGLNRSRCEIRAYCNLKLYGICDGGYVPK
                     FYGYMLTVNPASWAPHLEAFHHDSGLPSAVLIEYLPQPLVMNSVTYSKDRMQKVAIGI
                     QQIHLALIEHNDPYPKNILIVPDDPERERRWIEEESLCVGGFGIKVASTGR"
     exon            complement(630237..630254)
                     /number=1
     exon            complement(630306..630363)
                     /number=2
     exon            complement(630427..630786)
                     /number=3
     exon            complement(630866..630891)
                     /number=4
     CDS             join(631531..631716,631775..633112)
                     /codon_start=1
                     /locus_tag="AO090026000224"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070228000024"
                     /protein_id="BAE59706.1"
                     /transl_table=1
                     /translation="MASTARAIDGSNHDDNAQVIASRTLRKVDMRLIPLLFITYMFNF
                     MDKTILSSASVFGLIDDTHLVGQQYSWVSSIFYFGYFFWEVPTNYLIPRLPVAKYMAA
                     NTFFWGAVVALTAACVNYGGLLAVRFLLGIAEATITPAFMFITTTWYTRDEIPFRTGI
                     WFSGNSIGGLAASLLAYGIGHIEHPLRPWMWMFIILGVATFLWGFVLLAFLPDSISKA
                     TFLTPQEREFMAHRAVIAGTGRTEKTHWKWEQAVECIQDPKTWHLFAIAILTQIPNGG
                     TQNFGNLVIKSFGFTSLESTLINIPSSVVSASTITITGWMAGRYRQMNCILIVGIVTL
                     SIIGSALIYARAHHVPLGAQLFGYFLLATGPGALPLAMSLVQANYRGVTKKMTMTAMM
                     FVAYCAGNIAGPQLFRASEAPTYQTSFRAILICYIISGGLAVSLRVYLQFVNKRRDRE
                     EGVQGNAGLSGAVGGKVVEERRRGNNEVSDLVRSVDLRPEDYEDVTDWKTVGFRYRL"
     exon            631531..631716
                     /number=1
     exon            631775..633112
                     /number=2
     CDS             join(635686..635763,635830..636025,636262..636473,
                     636522..638021)
                     /codon_start=1
                     /locus_tag="AO090026000225"
                     /note="vacuolar sorting protein VPS33/slp1 (Sec1 family)"
                     /old_locus_tag="AO080532000032"
                     /protein_id="BAE59707.1"
                     /transl_table=1
                     /translation="MAPYPGSDADYFKDKARRDLLTLLEGVRGKKNLVVSQDLAGPVG
                     LFVKFSLLQEYGVDRVFLLENANVDSSQRNVVFLVHAEKTRQVRTVADQIKRLQRNGN
                     VEHEFSIFWVPRRTLVSNAILEDAGIIGDVNIAELPVYFIPLEQDVLSLELEDSFSDL
                     YLHKDPGCVYLAAKALMGIQQRHGYFPRIIGKGDNARRLADLLLRMRKELDAEESSGL
                     TDLSARGLLPSADTESLIIIDREVDFGSALLTQLTYEGLIDETVGIKHNQADVDTAIV
                     GPTPVPQAQESSKAPQQTSKQGQKRKIQLDASDQLFSQLRDANFAIVGDILNKVARRL
                     ESDYESRHTAKTTTELREFVNKLPTYQLEHQSLRVHTNLAEEIMRNTRSDIFRKILEV
                     QQNNAAGADPTYQHDSVEELIARDVPLKTVLRLLCLESCMAGGLRPRDLENFKRQIIH
                     AYGHQHLLTFSALEKMELLQPRSSATAMLLPTTGTQPGSKTNYGYLRKNLRLVVEEVS
                     EKDPNDIAYVYSGFAPLSVRLVQCVLQKPYVLSLIRGGSVAASASPSPASTASPGWLG
                     FEDLVKSARGATFSIVQKGDDKAIRARQTLSGNNATKTVYVFFLGGITFTEIAALRFI
                     AEQEAPRRKIVICTTSIINGDKMMDAAIEKQDFTKTE"
     exon            635686..635763
                     /number=1
     exon            635830..636025
                     /number=2
     exon            636262..636473
                     /number=3
     exon            636522..638021
                     /number=4
     CDS             complement(join(638180..638639,638698..639411,
                     639463..639997,640192..640536,640588..641449))
                     /codon_start=1
                     /locus_tag="AO090026000226"
                     /note="predicted protein"
                     /old_locus_tag="AO070228000027"
                     /protein_id="BAE59708.1"
                     /transl_table=1
                     /translation="MDGLLTEVKTVTHDRDLSLSIAKERPVHGIERHEAISKADTDAD
                     STSADYILTVLKSKPDRAGLSDVLNVLDPSNKYVTPKVFDIRVPSPTTAQILNVLGTI
                     TVPDHWASLNARSKGSTSEDNKLRAALLRCFSSVCGISCLVTQLRSLIATARSSSQQG
                     KASGSQIQIRDLLTILSALLKPKDLILRIYMDIETLYSNATQQQLAWREFLSSIAASK
                     VLSATAEALTLAGDFDGLSTILWIGDGAQYTSWLGTNICHMVSKLDLDNQDAWKAVAS
                     LTGRALSLGYTDHLARELYTSLLVNETLRERYGSLFDTLRPMEQLAVLEATFREVEKK
                     YFLALIDQSNEAILGQRVNGVAGLCSSIIGEREHIKTQLLDWLSKGQGGSIQTTGLRR
                     ALLASFTYQKANTQVLLLAAGYLKRLDPNAIMEIGRSSAFLNTVSNRLAASSSKARFL
                     GMIIGMSISQLIEQPGKAMKFDLEEMEGDEALWYFNMVNTQDSAGPLESIVPTDSASK
                     AQQPAKSSPTSARATRKPPPRTAKIVAIEEIESENEEPEENEDLIPYEKPDEDPYDSD
                     EDPTLVQRNKPTAPVYIRDLIIYLRDTENIERFELAIRTAPSLIRRKTDFGTELAENT
                     EELALVIVGLQEQSKFPKFHEYRLQSIIALIVSQPLKMGRWFTAMFFDGDLSQVQRSA
                     VLTGLGLSAREIAGNGENDAKTLGLPTLPDASFPSKKLPTNLEALYSGNESPIASLTK
                     KLAQTSLQPLAANAADSLSGPNALKVRTFSSRMEVEKQRQQREAQRQKSTAKDLYKVL
                     AEGFFYPLKSRFEMMMLQFSSSTAPSYNPFITPNLLTLFIQTLTLTLSTMGPHTPYLP
                     TVTEDALTFLLSLHTRPASDDPTILSALLALFLTIVDLNVASGSTGEERLVTELASQV
                     IELREWAGEVFDRTPAVKRDEPREQVRTLAAGVMVKLGEVMERYQGRLMGVNSGFKY"
     exon            complement(638180..638639)
                     /number=1
     exon            complement(638698..639411)
                     /number=2
     exon            complement(639463..639997)
                     /number=3
     exon            complement(640192..640536)
                     /number=4
     exon            complement(640588..641449)
                     /number=5
     CDS             join(641816..641844,641901..642002,642121..642548,
                     642599..643350)
                     /codon_start=1
                     /locus_tag="AO090026000227"
                     /note="NEDD8-activating complex, catalytic component UBA3"
                     /old_locus_tag="AO070228000028"
                     /protein_id="BAE59709.1"
                     /transl_table=1
                     /translation="MASADSSLRWKHLHKVLTKPGPFSDEDWVPGSETISALETSKIL
                     GAGGLGCEILKNLALSGFKDIHVIDMGKSPPITFSGIPQLTLTDTIDISNLNRQFLFR
                     QADIGKPKAEVAAAFVERRVKGVKITPYVGKIQDKDEDYYMQFKIVVCGLDSIEARRW
                     INATLIGMVDPENPESLKPFIDGGTEGFKGQARVILPTLSSCIECQLDMHAPRPAVPL
                     CTIATIPRQPQHCIEWAHQIAWQEKRKDDPFDSDDLDHIGWVYNAALERAKQFHIHGV
                     TFQMTQGVVKNIIPAIASTNAVIAAATTSEALKIATSCNPYLDNYMMYAGEEGVYTYT
                     FEAEKKPDCPVCGNLARNMTVDPDMTLQEYIDTLGDRPEAQLKKPSMRTEEKTLYQRF
                     PPQLEEQTRANLQRKLRDLVEDGQEIAVSDPAYTIDFRYRLLFK"
     exon            641816..641844
                     /number=1
     exon            641901..642002
                     /number=2
     exon            642121..642548
                     /number=3
     exon            642599..643350
                     /number=4
     CDS             complement(join(643608..644579,644662..644766,
                     644825..644869))
                     /codon_start=1
                     /locus_tag="AO090026000228"
                     /note="RNA polymerase I and III, subunit RPA40/RPC40"
                     /old_locus_tag="AO070228000029"
                     /protein_id="BAE59710.1"
                     /transl_table=1
                     /translation="MAPLVPSQAELDRRRLVDINLETVSNIPSTDFPGHWPGESHEWN
                     LEKFRNEFNVEFHRNERFESSFSLIGVDASIANAFRRIVMAEVPSVAIEFVFVHNNTS
                     VIQDEVLAQRLGLIPLKGSVDGINWMRWFKKATEDDPEGSDPSDYNTIVLRLDIECTK
                     NPNADATENDPRKLYKNAHVYARDITFHPVGRQEQFFTGEDAIQPVNPDILIAKLRPG
                     QKIDLEMHCIKGIGADHAKFSPVATASYRLLPDIQILRPILGEDAKKFAKCFPKGVIG
                     LEPVTREEAAKQGSGYEGHEGETKAVVRDAFKDTVSRECLRHEEFQGKVKLGRVRDHF
                     IFNIESTGQFDSDVLFLESVKVLKLKCARWKRGLADLMR"
     exon            complement(643608..644579)
                     /number=1
     exon            complement(644662..644766)
                     /number=2
     exon            complement(644825..644869)
                     /number=3
     CDS             join(645277..645948,646015..646735,646801..646838)
                     /codon_start=1
                     /locus_tag="AO090026000229"
                     /note="NADH:ubiquinone oxidoreductase, NDUFS2/49 kDa
                     subunit"
                     /old_locus_tag="AO070228000030"
                     /protein_id="BAE59711.1"
                     /transl_table=1
                     /translation="MAASFTRLAGSAPKRLCLRPSTFTKYNAIPRSRSIATTLPRRQA
                     EPTSYQATRLIPTDPTFTSLANKEGPQEADVAAGLESESEGVGRKIRHYTVNFGPQHP
                     AAHGVLRLILEINGEEIVRADPHVGLLHRGTEKLIEYKTYMQALPYFDRLDYVSMMTN
                     EQCYSLAVEKLLNIEIPDRAKYIRTMFGEMTRILNHLMSVLSHAMDVGALTPFLWGFE
                     EREKLMEFYERVSGARLHAAYVRPGGVSQDIPLGLLDDIYQWATQFGDRIDETEELLT
                     DNRIWKARTQGVGVVSAADALNMSFTGVMLRGSGVPWDIRKSQPYDAYDKVEFDVPVG
                     VNGDCYDRYLCRMEEFRQSLRIIHQCLNQMPAGPVKVEDYKLSPPPRAAMKENMEALI
                     HHFLLFSKGYAVPPGETYSAIEAPKGEMGVFLVSDGSERPYRCKIRAPGFAHLGGFDQ
                     ISRGHLLADAVAIIGTMDLVFGEVDR"
     exon            645277..645948
                     /number=1
     exon            646015..646735
                     /number=2
     exon            646801..646838
                     /number=3
     CDS             complement(join(647712..647995,648092..648242))
                     /codon_start=1
                     /locus_tag="AO090026000230"
                     /note="ubiquitin conjugating enzyme"
                     /old_locus_tag="AO070236000001"
                     /protein_id="BAE59712.1"
                     /transl_table=1
                     /translation="MKEHLPPGISIAKSENLEEWQMDIRVLDENPLYQNQVYRLKFTF
                     SSKYPIEPPEVQFIELPSTSETPRPIPIHPHIYSNGIICLDLLSSAGWSPVQTVESVC
                     MSIQSMLTANTRDERPPGDSDFVSYNRRRPRDINFFYDDDNV"
     exon            complement(647712..647995)
                     /number=1
     exon            complement(648092..648242)
                     /number=2
     CDS             complement(join(649269..650065,650140..650296,
                     650350..650557,650635..650686,651044..651050))
                     /codon_start=1
                     /locus_tag="AO090026000231"
                     /note="Ca2+/calmodulin-dependent protein kinase, EF-Hand
                     protein superfamily"
                     /old_locus_tag="AO070236000002"
                     /protein_id="BAE59713.1"
                     /transl_table=1
                     /translation="MSFTNMLNKLSGQPESYEKKQLYKFGRTLGAGTYGIVREADCSR
                     GKVAVKIILKKNVRGNEQMVYDELEMLQALDHPNIVHFVDWFESKDKFYIVTQLATGG
                     ELFDRICDYGKFTEKDASQTIRQVLDAVNYLHERNIVHRDLKPENLLYLTRDPSSPLV
                     LADFGIAKMLDSPSEVLTSMAGSFGYAAPEVMLKQGHGKAVDMWSLGVITYTLLCGYS
                     PFRSESLSDLIEECRSGRIIFHDRYWRDVSKDAKDFILTMLQPDPSKRVTSEEALKHP
                     WLKGESASDRDLLPEIRAYIARSRLKRGIEIIKLANRIEALKMHEEDEDDIPSPADMA
                     ASAEESDKSGSAPAESSASGEAEAGTTKKRSLSKVARGAIFREVVLAKVREQKDTEER
                     ERLEREAREKTTHA"
     exon            complement(649269..650065)
                     /number=1
     exon            complement(650140..650296)
                     /number=2
     exon            complement(650350..650557)
                     /number=3
     exon            complement(650635..650686)
                     /number=4
     exon            complement(651044..651050)
                     /number=5
     CDS             655224..655955
                     /codon_start=1
                     /locus_tag="AO090026000233"
                     /note="predicted protein"
                     /old_locus_tag="AO070236000004"
                     /protein_id="BAE59714.1"
                     /transl_table=1
                     /translation="MAKLVYLAVEILLHILGYLSKSTLNCFSQVCRHFYCISNSTLYK
                     KNTAGALWQATETGNVKTLRKLLEYCPRTEGHDPLYTIWSPLGHTPMSAAVYGGSAEV
                     IQTLIDSGFDPTTKDRNGYTPLSLAALYGQTDIIAILLKTGIDPNQKDMYGRTPLSWA
                     AEYCQLYAVRILLNYGADPECQDDDYYIVEARARQEGLYLVPLFLMNHERLYKKPIPR
                     KPVEWAERNDCAAVVELLQHTYKGI"
     exon            655224..655955
                     /number=1
     CDS             join(658456..659922,660005..660364)
                     /codon_start=1
                     /locus_tag="AO090026000234"
                     /note="predicted protein"
                     /old_locus_tag="AO070236000005"
                     /protein_id="BAE59715.1"
                     /transl_table=1
                     /translation="MTGISPVADPLAILPPEIVLRILEFTPISALASLTAVSKAWHEF
                     IDVTHQEAIYTSESKTVQPPGGARDFSFLSDNTSFTKLFEGTTSWKDLCKRQTLLARN
                     WAESQPVCRESVVQIGNDPVWRFRPDFKRRFFVSTSHAGGLNVTDMDTGQLLWRLPST
                     LDSDEDAVRPYAHLEYQDGMAVFDREGDAVEVWQADLEGAARGEFRRIAVLNHDCQTR
                     GFQLSYWTLCVVSSQGRGFVYDMTQRPPKLTTRVEIEHGAIGHLDQSKDAVIYSMGPG
                     GYHAYDKTTGAFLGALQPSHCTDKYHICPPAVSSISASAALAGAMRHFPPNRTFPLGA
                     PRKDSLTPLKIAKGPLPPPSDPGHVRHGEDEWGAGMLHGNIFVGFSRAGRVFVCSNWR
                     KALQGPDSLAAHSSLIECESDGSGFDLGGWLSVRNHRLMFEIEDRIYVVALDDDNRIQ
                     DIDCTARASYSLLTSSAPQLAVPVSFMALYDDAIMTTYTPLPGDAAPQEQEAHTRLFP
                     TKAIRVVSLAPDLSNHKSSSADTAQGTTAMDSSSPEAWRSPAQTGLLQLVSMLGNELD
                     DFDDELEIMETEDDDEGWEDADETESEDHEQEHTAARAHESA"
     exon            658456..659922
                     /number=1
     exon            660005..660364
                     /number=2
     CDS             complement(join(662271..662621,662679..663809))
                     /codon_start=1
                     /locus_tag="AO090026000235"
                     /note="cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies"
                     /old_locus_tag="AO070236000006"
                     /protein_id="BAE59716.1"
                     /transl_table=1
                     /translation="MPFNILLWPVIAFFLYSLLTAIWYIYFHPLRRIPGPKSWIIFPI
                     MRHASAIRGRFDIDMRQHHAVYGPVVRFGRDEVSFITAEAWKDIYGHGHQQLPKVLSS
                     ASNMLDIISSNDTDHSRYRKALSHAFSAKGLQAQEPLLNSYVDKLIERLKGIAESNLP
                     ADMVKWYNLTTFDIIGDLAFGEPFGGLDNSEYHHWVSTIFESIKAIPFLKLKDAYPLA
                     FKAILGLIPKGIMEARKRQLEHSRITVQKRLQTSSSYNRGDFMDSMLRNRGEKDSLND
                     SELEANSNILIIAGSETTATLLSGATYWILRNPEALAKLTDEVRSVMKSEPEITAQKA
                     SAELPYMLACFDEAFRLYPPVPTGLQRRTLVPTRISGCDIPAGTKVSVHQSAAYWSST
                     NFHAPDRFIPERWLPEAKSDPSSPFYSDNRGVVQPFSTGPRNCIGRNLAYAEMRVILA
                     RVLWNFDLELCEESTQWSDQKAYTLWEKPPLMCRLKLRESFRG"
     exon            complement(662271..662621)
                     /number=1
     exon            complement(662679..663809)
                     /number=2
     CDS             complement(664669..665805)
                     /codon_start=1
                     /locus_tag="AO090026000236"
                     /note="predicted protein"
                     /old_locus_tag="AO070236000007"
                     /protein_id="BAE59717.1"
                     /transl_table=1
                     /translation="MQASKPKSVGSIDKKRARDRRAQQKLRADRLNHTHSLEAEIVLL
                     EQQCKAYEKEIQELRTENEALQSAQQRIREVVCTSELDNNETLANCDGRPPKSAKVRS
                     AIPHVCLHHTAQYPTVSGHPSGFFGYPQNESAPPIGSKVQSSNGTPLSPAKFTGLNPV
                     CDLDLSLWSRLPLNFAQEPHISENLYSCFNRPDLVQASPDEPSPVELLYGSSQNFLAD
                     RIHKATRFWPICDPERLASGLLTYNMIKWLTRPSQESFGRLLGFQRPINDQLQRPHPR
                     CIDFVMWPVLRANLVKTFHKYDLKLVFAAFTCSLRIRWPWGKSFLEPDVTNSLRVHKE
                     FYDTFTKIEGWGLSDEFQTQYPELLVGMDIGTLNYSIFDPMPAS"
     exon            complement(664669..665805)
                     /number=1
     CDS             666633..667466
                     /codon_start=1
                     /locus_tag="AO090026000237"
                     /note="predicted protein"
                     /old_locus_tag="AO070236000008"
                     /protein_id="BAE59718.1"
                     /transl_table=1
                     /translation="MLEADLCWPLWEESSVEGAFKLDAPEGNIGQAVITKVERPFLLG
                     YRPAKPNGRGVLILGGGGYVQLMVGREGIAAAKWLTSLGFHAFVLVHRFPTADTGAEA
                     PLNDARRAFKLMSESGLIPQGQGICGLSSGGHLGAALMAQYPETWTSPDLDVPQAQFA
                     IIGYGPISTNAAGRTIVANKPPLPPLEKQALYDELQPDVQLNAPAPPTFIVYSNNDPV
                     VPVVNAYRLAEGITKSGGSVELHVFADAPHGLAFDTENLPVSNWPLMCEAWLRQHSWI
                     E"
     exon            666633..667466
                     /number=1
     CDS             complement(join(668009..668793,668853..669114,
                     669185..669493))
                     /codon_start=1
                     /locus_tag="AO090026000238"
                     /note="predicted protein"
                     /old_locus_tag="AO070236000009"
                     /protein_id="BAE59719.1"
                     /transl_table=1
                     /translation="MFRFVEYASVENSSEDRQLQPSLPASNITFVNENDADIESNSPS
                     NNMPHGRNDYQQSSQHSPSQMSNSVPTSCPVGSGSPLSPLKSEYEASLFKYFMTSLSP
                     WFDYCDPSRHFYTYIASSASSNPILLYAVLTVAARHQRSHSERERLLADEYQQYCLES
                     LISALDNSEKTLDESLFASAVILRLSEEMTEPSPREIVDSHTLSAHILVRIKEGNIYT
                     SSFTDAALIVVLRQEIFVANLTQRPVGSFTDHCNIDTSLGPTSEAMWTYRIIAHAAKI
                     TDFVYGDVMFRTKDRWKDLMRYVQDWEDSRPNAFTPIYSEAENPPSSCFPKIWYCNDC
                     HVAARLYSELCRILLLASDPDASALRIGRFRRMQDNDDKIRECVRVICGVALTNPEFH
                     TTRSTAGLAIGLCGELFHDPRETKVLLELLSAAEFHLGWPCLKLKEDLRRFWGLPVVE
                     S"
     exon            complement(668009..668793)
                     /number=1
     exon            complement(668853..669114)
                     /number=2
     exon            complement(669185..669493)
                     /number=3
     CDS             join(670856..671307,671367..671530,671563..671711,
                     671724..671891,671961..672320)
                     /codon_start=1
                     /locus_tag="AO090026000239"
                     /note="predicted protein"
                     /old_locus_tag="AO070236000010"
                     /protein_id="BAE59720.1"
                     /transl_table=1
                     /translation="MSTTSLAQPRTYYKMSSIDQQKKLIKRICQKYQNSPWPSLAQLQ
                     KATSLDTPAPARGGVWIARTSFSAPTNPAIRDVLYTVIHRLKKEYHRISPVEETPVID
                     VGVEFIGPRSQVPDDAPEPDIPEEEKLRALLQECNSELTILYAHGGGLYFSSPAQYRA
                     SSIGLAKLTGARVASIKYRLTPSHTFPASILDILVAYASLLYPLADHTGRNSAGANIT
                     LGLMKLLLEVQKLPPSDATFDFHGQSVALPLPAGLAICDQCDSLPSWHCNGETDILTV
                     LQPACMPGHPTDSIWPASPPREVPYCVAATLDHELRGVDGNRVVASQAAKSGVTVIWN
                     EYEGMPHEVLIFLSALPQAQHLLQLWAAACQAFAGGKIGARELQSGAVRWLIPDCKPM
                     VLGSPVGIAPLPFEEVRKRMEYNATRPVWTGELHEHKL"
     exon            670856..671307
                     /number=1
     exon            671367..671530
                     /number=2
     exon            671563..671711
                     /number=3
     exon            671724..671891
                     /number=4
     exon            671961..672320
                     /number=5
     CDS             join(674223..674518,674575..675217,676428..676778)
                     /codon_start=1
                     /locus_tag="AO090026000240"
                     /note="predicted protein"
                     /old_locus_tag="AO070236000011"
                     /protein_id="BAE59721.1"
                     /transl_table=1
                     /translation="MAEFKIIIAGGGIAGLTLANMLERFDLDYVLLEAHSEIAPPVGA
                     SIGLFPNGLRILDQLGCYERIANLSVQHLEVAYMRDRKGDVLSALHQMFKHLERRYGY
                     GLLFFDRQKLLEILHDTIKHKDRVLLNRKVSNIDLIDGGVNVTTADGSVYTGTLVVGA
                     DGIHSKVRSLMRDLGNKLQPGYFPAKEEDNVPCYYRCSFGIAQHVPGWVAGEQNIVMG
                     NGQSQLVVSGPEGRVYWFLFDKLPQEKYGKDIPKYTQEDEADFVKQNYNLPITRKVTF
                     GHVFDKRLSSALTPLHEIVYQKWFFKRIITFGDSAHKSTVHVATMAYAWSHPNISIGR
                     AFFGLPNPFRAEWNITTISEQIATFFRYDAVTALAGYIGGNLYSIWDLRRLGYIQTRS
                     AVKAALAVIVGQFMIGPGATWAGLWSWREDVIAGLAR"
     exon            674223..674518
                     /number=1
     exon            674575..675217
                     /number=2
     exon            676428..676778
                     /number=3
     CDS             complement(join(677029..677269,677331..677466,
                     677533..677672,677736..678037,678092..678652))
                     /codon_start=1
                     /locus_tag="AO090026000241"
                     /note="predicted protein"
                     /old_locus_tag="AO070236000012"
                     /protein_id="BAE59722.1"
                     /transl_table=1
                     /translation="MIVDFAWNPEATRTKTPDPNLRFPGLALRSICVFNGLPFLSSGG
                     RQWIKAQTGEDVDLNQYQPPKRISSLRPTTTRAIHLPSKSLLFQRFQEYKSSIFSEIF
                     PFINPQFFEDTVREAYREQSSLTCSNDSAKACIFAFMAVTSMFFNSTDNHGILDSDCY
                     AHAAYDLVPGFFRDSVTMEGLQALLMLCLYSESVLGDQLGVELLFATATRFVFHLGGH
                     IFPKAVDVDEFSRRSLDLRLHIRNLFWLCYIFNQEYSLRTGLPPSLDDAHCDLTLCET
                     ATTDAQNIGLSRLYSVVAQNKTDAELLSTIRDLDQLLEDWKLSIPMDVRPSLTHRPTG
                     VSGRCMSWTQDTRGLGSSLAISVEASRSLLKIVSHSELQIHRYNLLFCLPYVTAAMIH
                     LFCDILIHPRDKACHANLELIDMARDRMLAQLWPQAPTSFKMQVQFVKGLSIEVQRLA
                     RSAIRKAAV"
     exon            complement(677029..677269)
                     /number=1
     exon            complement(677331..677466)
                     /number=2
     exon            complement(677533..677672)
                     /number=3
     exon            complement(677736..678037)
                     /number=4
     exon            complement(678092..678652)
                     /number=5
     CDS             complement(join(680648..681700,681750..681917))
                     /codon_start=1
                     /locus_tag="AO090026000242"
                     /note="predicted protein"
                     /old_locus_tag="AO070236000013"
                     /protein_id="BAE59723.1"
                     /transl_table=1
                     /translation="MASIASRSSLFESPLVPRSPQQWKGALQGVKLLYIQRQYKQCAA
                     RATELLEKAREPLHPVYKTYLYFYSAVCYEEMGRAAHKYSSTKVPLLQGALDRFDICS
                     TVLPSPIPVSSRTSEGSDFPSLGESSSPSEFSNSPSPISSLVTSITDIIDRTIQWKEE
                     DPFISDSDSCSDTDIVVVNKIADDIANHLLVPPPLTFRKSSDEILPLTAVTHDPGHTA
                     ARSERPDRARLPPPLPIKIVPRTASGKYKRTVDSPLNNRDSRLCTDDLLIDLSQKKSE
                     PATPHYSDSIRRYNSSIRSLRSQIDSSMNSIHVLIDEVEEKQHTRKMAKTIKRSASFW
                     SFSPIKGGDGCWEKAEVPKRSPGKETKQERIERLGNEGWKTVGLRSAARGWKGGEYYK
                     AYCSSILDELYLES"
     exon            complement(680648..681700)
                     /number=1
     exon            complement(681750..681917)
                     /number=2
     CDS             join(682522..683116,683235..683740)
                     /codon_start=1
                     /locus_tag="AO090026000243"
                     /note="predicted protein"
                     /old_locus_tag="AO070236000014"
                     /protein_id="BAE59724.1"
                     /transl_table=1
                     /translation="MTQRPISIFKRLQALSPKGSIMPDMPDPQPYYSYNHTTQTWSPV
                     ETDSTVEPTTTTTTTTTINTNTTPLKTFTLTTWNIDFQQPCKAERTQAGLNYLSTVLL
                     KPSDDKNNDVTPINIIFLQEMVPNDLTIIQQTKWIQDHFFITDLNHTQWRGSYGTTTL
                     IDRRCHVQRVFRVPYSTSRMQRDGLFVDLDCQEGGETGGTLRLCNTHLESLLSNPPIR
                     PMQLHLASQFMHGSGPGETDLPTPHAAILAGDLNAFAPEDLTAPNECALRDAFLVLGG
                     KDGTEESFTWGQQIPNWLREKFGCSRMDKVLFCGGLEVERLERIGAGEMVWIEYPDVS
                     DEETEDEKGEEVWITDHLGLCADFRITRLGGE"
     exon            682522..683116
                     /number=1
     exon            683235..683740
                     /number=2
     CDS             complement(join(684407..684500,685378..686012,
                     686061..686230,686285..686399,686510..686956))
                     /codon_start=1
                     /locus_tag="AO090026000244"
                     /note="serine/threonine protein kinase"
                     /old_locus_tag="AO070236000015"
                     /protein_id="BAE59725.1"
                     /transl_table=1
                     /translation="MDPPRGSKFLDPTSAMAAITKHKAEAIKLAREQGVAVQEMCRRA
                     KTDTPPYEFEELIGKGAYGRVYKGHQLPSRKVVAIKVMDIDSLDYKSVRDFRDESIKD
                     FIHETKVMKQVKDSGAKNINEIIEAISIHSQLWLVCEYCPGGSVRTLMRATGDQLDEK
                     FLIPVARELAAGLRAIHDAGIIHRDIKAANILIHEEGRLQICDFGVAGVLQSQLDKRS
                     TWIGTPHWMPPEMFSTRGEAHKYGSEIDVWAYGCTLFEIATGNPPNSNLRERMQIGRQ
                     LNRVAPKLENAKYSEGLKDIVSYVLESNPSNRPTMADVQLHAYIADTEEAYPTASLSE
                     LVRIYYQWSQRGGQRISLFHPGGAAAAEMPGTTMDSDSDWNFSTTDGFERRFSVIDLD
                     QIAASLAEMEDEISTTNMQPPRESFDDPAERAMTKEDQANFDERVRRGAEAMEGLFNE
                     EKPSYTRATPFGKITLAYQIRLCSPSHSRLPSQQRT"
     exon            complement(684407..684500)
                     /number=1
     exon            complement(685378..686012)
                     /number=2
     exon            complement(686061..686230)
                     /number=3
     exon            complement(686285..686399)
                     /number=4
     exon            complement(686510..686956)
                     /number=5
     CDS             complement(join(689458..689715,689777..690601,
                     690648..690724,690780..690947,691000..691042,
                     691105..691136,691215..691251,691322..691468))
                     /codon_start=1
                     /locus_tag="AO090026000245"
                     /note="aromatic amino acid aminotransferase and related
                     proteins"
                     /old_locus_tag="AO070236000016"
                     /protein_id="BAE59726.1"
                     /transl_table=1
                     /translation="MSPPAALDNANGSPAAPLTVEGIPALRANSAPIPKGVAPATSSD
                     MFKSPACYTKPKAKRWDHILSTEAKSRKVSTLKGAAKYLKNPGLISLGGGLPSPEYFP
                     FEELDIKVPTPPGFTPEATRESGTVVHAGKSDIREGKSLYDLEVALNYGQATGAPQLL
                     RYVTEHTELIHNPPYSDWQCCLNCGSTFGWDVALRLFCERGDYIMMEEYTFSSAQETA
                     LPQGLKVAPVKMDEEGLLPESLDEVLSNWDESARGARKPFVLYTIPTGQNPTGATQQA
                     ERRKAVYKVAQKHDVYIVEDEPYYFLQMQPYAGADGEPVPPPANHEEFIKSLIPSYLS
                     LDTDGRVLRLESFSKVLAPGSRVGWAVGSEQIIERFTRTCETSSQNPSGISQLVLYKL
                     LEEQWGHAGYLDWLINLRMSYTARRDSMMHACEKYLPRELAHWNPPAAGMFHWIEIDW
                     RKHPRLSSGKTREEIEEEVFQAAVNNGVLISRGSWFKAQGASEEKLFFRATFAAASSD
                     AIAEAISRFGTTLRQEFGLN"
     exon            complement(689458..689715)
                     /number=1
     exon            complement(689777..690601)
                     /number=2
     exon            complement(690648..690724)
                     /number=3
     exon            complement(690780..690947)
                     /number=4
     exon            complement(691000..691042)
                     /number=5
     exon            complement(691105..691136)
                     /number=6
     exon            complement(691215..691251)
                     /number=7
     exon            complement(691322..691468)
                     /number=8
     CDS             join(695498..695510,695896..696151,696258..697748,
                     697819..697918)
                     /codon_start=1
                     /locus_tag="AO090026000246"
                     /note="predicted acyl esterases"
                     /old_locus_tag="AO070236000017"
                     /protein_id="BAE59727.1"
                     /transl_table=1
                     /translation="MSDNLRYSFASLAIPRNLSAKIKMLNQYCDIQTVDTAKHSYIFA
                     QNVSIPLRTGGLLRCNVYKPRETEEGNKYPVLVTYGPYGKDVPYEQFNPKSFAEVDPA
                     HQTEHSAWETPTPQYWTDHGYIVVRVDEPGIGQSPGKVHVKSATSIDGFCDAIEWAAS
                     QPWSSGKVGLLGISYYAATQWQVAARQPKGLAAIVPWEGFSDAYNESLRHGGILSNKF
                     FSMWYERQVAPNQYGLPGRAARNWGPDTVDGDLSPEELDANRHKAVMHEQRYRDDKEI
                     SSMNFNLEDVTVPLLSVANLGGILLHLRGNVMGYLWSGSEFKYLRFIVGRHDLPFYYP
                     EEVEIQRSFLDAWLKGHDREGWTKKGALPPVDLILRKGNVGYNNPTAEKQFLRRKEKE
                     WPLARTQYTPIYLTADNGLQRDQPPQPAPKKLSYSALGKANASDMLTFQSAPFEKETE
                     ITGHIVAHLNVSVSRDNWGNSPSDLDLFLSLRHISPSGDEISYTGSTGDPVPVTKGWL
                     RVSLRRTDPQHPHHRPWLPYRNYYSTDVLPVIPGEVYPVDIELWPTNVVVETGGRLVL
                     EVSSGDTAGTGIWGHDDPIDRAEAVFKGLNHIHFGPHYANYITLPIIPNEESS"
     exon            695498..695510
                     /number=1
     exon            695896..696151
                     /number=2
     exon            696258..697748
                     /number=3
     exon            697819..697918
                     /number=4
     CDS             complement(join(699174..699231,699303..699375,
                     699447..699580,699690..699801,699871..700274,
                     700328..700414,700480..700512,700586..700830,
                     700868..700917,700984..701093,701150..701340))
                     /codon_start=1
                     /locus_tag="AO090026000247"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070236000018"
                     /protein_id="BAE59728.1"
                     /transl_table=1
                     /translation="MPREDGTTRSSDLEQGSDPSKTINERAFVETTQWDEDDPAHPFK
                     RSLAARWLTVVIVSLCSLCVACTSSIYTTTYDQILDEFHCSQEVATLGLSLFVFGMGF
                     GPLILGPLSEVRSCFLYGRRIIFLSSFTFFLIWLIPCAVAKNIQTLLISRFFNGFAGS
                     AFLSVAGGAVGDMFPRHQLAAPMMIYTASPFVGPELGPLLGGFINQYINWRWTFYTLL
                     LWAATMLVSIYLFVPETHHPAILTQKAREIRKETGNSWPLGPSENNNIPLSELLLRSI
                     VRPIMLLTLEPMCLNLCVYSALLLGILYLFFGAFQIVFESVYGFELWQRGLTFLGLLV
                     GMVLAILSDPFWRRNYQRLEKDHQNPEASGFDPEWRLPPAIAGAPLVTIGLFIFSWTT
                     YPSIHWIVPMIGSALFGAGTILVYSGIFTFLVEAYPRYAASALAANSFTRSTFAGAFP
                     LFGTQMYNTLGLNWASCLLAFLTLAMVPFPYVFYKYGARIRKKSRFSS"
     exon            complement(699174..699231)
                     /number=1
     exon            complement(699303..699375)
                     /number=2
     exon            complement(699447..699580)
                     /number=3
     exon            complement(699690..699801)
                     /number=4
     exon            complement(699871..700274)
                     /number=5
     exon            complement(700328..700414)
                     /number=6
     exon            complement(700480..700512)
                     /number=7
     exon            complement(700586..700830)
                     /number=8
     exon            complement(700868..700917)
                     /number=9
     exon            complement(700984..701093)
                     /number=10
     exon            complement(701150..701340)
                     /number=11
     CDS             701834..703039
                     /codon_start=1
                     /locus_tag="AO090026000248"
                     /note="predicted hydrolases or acyltransferases
                     (alpha/beta hydrolase superfamily)"
                     /old_locus_tag="AO070236000019"
                     /protein_id="BAE59729.1"
                     /transl_table=1
                     /translation="MLIDHFFKSNACFSYETLRAAGYSNYGGADLGEVIAITSKIRAG
                     NEDDWLVEWKKAADRAFTSAEQSASVNNTVSAHEGYLRASNYYRTAEFFCRDDYDNDE
                     TAQLVYERSETAFEEAMKLSVYRYEPIKIPYQGTTLPGYFVSPTGTGSPRRTIIFNGG
                     YDSTSSEAWFAIGAAALARGYNFLAFDGPGQGAAVRRQHLYFRPDWENVLTPVVDFAL
                     TRKEVDPNAIAIFGWSMGGYLVARGATQEHRAQAIILDDGVYDFGSAFRANQPSFVQR
                     LVQNEYDGLSNFIFGCAQSLDTGVRWALRNGKWTFGVASEAELMRTVNLYTLEGLAQK
                     IVSACLVLDAENDHFLKGQPELLCNHLKCEYEFVSLGADEGGDTHCHQGAFFRLHQVI
                     FDFLARRLA"
     exon            701834..703039
                     /number=1
     CDS             complement(join(703421..705049,705153..705275,
                     705330..705372,706436..706497))
                     /codon_start=1
                     /locus_tag="AO090026000249"
                     /note="thiamine pyrophosphate-requiring enzymes
                     [acetolactate synthase, pyruvate dehydrogenase
                     (cytochrome), glyoxylate carboligase, phosphonopyruvate
                     decarboxylase]"
                     /old_locus_tag="AO070236000020"
                     /protein_id="BAE59730.1"
                     /transl_table=1
                     /translation="MAIFAVLRFRHIIFDMIVTIKVYTASFAFFEALWEAGVTHVFAN
                     LGSDHPSILEAMVKGQKEKPDQFPKIITCPNEMVALSMADGYARLTGKPQCVIVHVDV
                     GTQGLAAAVHNASCGRAPVLIFAGLSPFTIEGEMRGSRTEYIHWIQDVPDQKQIVSQY
                     CRYSGEIRSGKNVKQMVNRALQFATSDPKGPVYLAGAREVMEEEIEPYKVNQNVWGAV
                     APSALPAEGVELIASELAAAKEPLVIVGYSGREARGVEELVKLADTFKGVRVLDTGGC
                     DMCFPSDHPAWLGMRFGIHEAIKTADVILVADCDVPWIPTQCKPSDSAKIIHVDVDPL
                     KQQMPVFYLPSMATFRAESATAFRQINEYVAANNSLKQTLNSEEQTSLGKRREEEYKK
                     IRQGIADLAVVPSGGGNTDLNVSYLISQVRETCPADTIWAIESVTLTTFVADHIAATL
                     PKSWINCGGGGLGWSGGGALGIKLATDHENGGKNKGKFVCQIVGDGTYLFSVPGSVYW
                     ISRRYNIPILTIVLNNKGWNAPRRSMLLVHPEGDGSRATNEDLNISFAPTPDYPGIAK
                     AAAGGELWAGTATTVSDLARMLPEAIKAVQNGTTAVLEAQLDGTVGKHVSKN"
     exon            complement(703421..705049)
                     /number=1
     exon            complement(705153..705275)
                     /number=2
     exon            complement(705330..705372)
                     /number=3
     exon            complement(706436..706497)
                     /number=4
     CDS             join(706753..707443,707505..707636,707689..708081,
                     708132..708406)
                     /codon_start=1
                     /locus_tag="AO090026000250"
                     /note="predicted protein"
                     /old_locus_tag="AO070236000021"
                     /protein_id="BAE59731.1"
                     /transl_table=1
                     /translation="MANCIARAETEVFLGTNFWIHSDASTLVTNAFRELSKRAGERGT
                     KVVVKMIYDRGDPRQAYENRLDVPEKKYTSEKVQLPPAEEVPNIDLQVVNYHRPIFGT
                     FHAKFMVVDRRIALLQSSNVQDNDNLEMMVRLEGPIVDAFYDTALISWGKHFDTPFPM
                     LSSPAAGAPIPSLSLMDVSHEEECQGLTLPEHTTLDQHYDLDLRDEARRVNGTLKPRP
                     GESKTRPVTRHLNTTTQPNTTGDASDVDQDTPMTPYTISPPHEACPMALVNREPWGAP
                     NHTSVYTPQNAAFLSAIQNAEHSIFIQTPNMNAEPLLEPLLEAVRRGVVVTCYLCLGY
                     NDAGQLLPFQNGTNEMISNRLYSSLKKPDERSRLRIYNYVGKDQTKPIHNKFKRRSCH
                     IKLMIIDGKVAIQGNGNLDTQSFYHSQEVNILIDSSIICHSWLETINRNQNTALYGAV
                     SPEDGCWHDASTGVVPEGSIGVNPGRFSWAKGVVGAVQRVRGAGGF"
     exon            706753..707443
                     /number=1
     exon            707505..707636
                     /number=2
     exon            707689..708081
                     /number=3
     exon            708132..708406
                     /number=4
     CDS             709473..712940
                     /codon_start=1
                     /locus_tag="AO090026000251"
                     /note="ankyrin repeat"
                     /old_locus_tag="AO070236000022"
                     /protein_id="BAE59732.1"
                     /transl_table=1
                     /translation="MKRYRPRVEDFTIGWICPLPLEYASAKSMLDELYDESEEHTTGR
                     IYNHEIVITCLPAGQMGTNAAAAVTARMVSSFPSLKVSLLVGIAGGVPSHKADIRLGD
                     VVIGQPEKSYGGVVQYDFGKTIIGGFQQRIGSLNAPSPTLLTAVSKFKSNLSASINNI
                     QDYLDTVARVKRPHSVPDVLFEASYDHARGETCNACRKDMLVRRPQREDSNVRVHFGT
                     IGSGNQLVKDGMTRDKISTKLGGVLCFEMEAAGVVNLLPCLVVRGISDYADSHKNKDF
                     QYFAASTAAACARQILLYVPPPSRGVCAQSDTILDYHRQQRQTSAALQKMYLESLRFE
                     QIDSRHRTIRMAHAKTCQWLLSCQEYKDWINPGLSGRHHGIFWIKGKPGTGKSTIMKF
                     AFSKTPRQVKDTTIISFFFNARGNSLEKTVVGMYRSLLCQLLDKLPDLCTMFDLLPTN
                     QLHSQTPTWDIETLKYLFSVAIEQLHGRSLMCFVDALDECDEDQVRDMLSFFEQLGEF
                     AVDRQQRLLVCFSSRHYPHIAVNNATELVLEDQDGHQQDISNFVHSELRAGRSKQVEQ
                     IKEEVIARSSGVFLWVVLVVQTLNKEYDRGQVHALKRRMEQIPDGLHELLKDILIRGN
                     HDMENTLLCLQWLLYTQRPLSSEELYFAILAGIESTAFLAEWTSANVNEEDVNRFILD
                     SSKGLAELTKSKSPTVQFIHESVRDFLRDEGFAKLNVGSVSPGPSHETLKNCCLNYVK
                     IGLSSVPLPGTLPPVKSSKAKRLVQKTSKLYPFLEYSVQYVLYHANAAAENGVTQMCF
                     LQDFPLSSWIMKNNLFEKHEIRRYTPAAQRMYILAEKDYGMLLETEIKLHHYEDARTE
                     RYDSPLVAAIMHSSREAVRTLLTMEANTEDILNQRNSSSRPILSMALQRSDVEMIRIL
                     LDHGAIVDQEGATGRTSLSYAATSGNEAIVKLLLDSGANVDSKCPNGRTPLSYAAKSG
                     HGGVVTLLLDRGADINSKCSYGRTPLSYSADSWRNEALAVLLDRGADLESRDVNNCTA
                     LSWAIRFSQYDVVEQLLNQGAEVESRGHHGSTPLCQAVRLQHPSAARSLIGKGANLES
                     RDDDGRAALSYAVEYGRKATVILLLDSGADVNSRDNFGRTPLSYAAERLSGLGAVTIV
                     ELLLWQGAD"
     exon            709473..712940
                     /number=1
     CDS             join(713721..714680,714733..714965,715024..715174)
                     /codon_start=1
                     /locus_tag="AO090026000252"
                     /note="predicted protein"
                     /old_locus_tag="AO070236000023"
                     /protein_id="BAE59733.1"
                     /transl_table=1
                     /translation="MQVKLFYTLALWAPILVSAQLSGSVGPLVDFKTKAKNKTCDITD
                     YGAVADGKTDVGPAILDAWGNCSTGGLIYVPPGTYSLATDLELKHGESTAFQLDGVLA
                     RGHEGSYQLILVRNCHDCEFFSGNSQGAVQGYGYEYLQDGNYGERLFRFQDVSDFSVH
                     GFAAIDSPAYYLVFDTVSNGEIYNLLVRGIADLGMTDAFDIWGQNVWVHDIEVTNGDE
                     CVTVKSPASDFLIENIYCNLSGGTAIGSLGTGTNISNIHYRNLYMNQADACYLKTHNG
                     DGIVKNIVWENVIVHRGPYPLAVNEAWGKDVGSTGVQVQNLTFRNWYGENTANSRPAI
                     RIECDEDVPCYDITLDNVNLWTEDGDYVEWSCANAYGSGACLQEAKDTGDLATYTTAV
                     TVTATPSYSATHMPGDFTTNPPSTAPFTIPPMPTSFYPGATPISTLLSLSGAGGL"
     exon            713721..714680
                     /number=1
     exon            714733..714965
                     /number=2
     exon            715024..715174
                     /number=3
     CDS             join(715548..715872,715990..717116)
                     /codon_start=1
                     /locus_tag="AO090026000253"
                     /note="uncharacterized protein involved in propionate
                     catabolism"
                     /old_locus_tag="AO070236000024"
                     /protein_id="BAE59734.1"
                     /transl_table=1
                     /translation="MTHPYDPPIQSLTTYLYNHTISNPTAYASARIALLDALGCAIET
                     ASKSTEAQKLLGPRVPGTIVPHGFRVPGTEYQLDPVKGAFDLGVLVRYLDHNDALWGR
                     EWGHPSDNIASILSVTDWLCRTNEPTHHGPPMTIYTLLTALIKAYEIQGIYAQSNAFN
                     THGTDHVILVKLASAAVVSWLLGLTESQTMATISHVWMDGHPSRIYRGAEDTIPRKGW
                     AAGDACMRAVYLALLVRAGQVGVPSVLSAVPWGFYQRDFGGKGFEFIREFGDWMVRNV
                     LYKVMPVEGHGIAAVEAVLVQRRRLLEMGFGVRDVERIEIRTTRAADLIINKRGPLRN
                     AADRDHCMQFVVALALLKGGVPEVADYQDESCWVKSQELESLRERVVVVPDDRLTADY
                     LDLEKKSIGSGLKVCLCDGTVLPEVLVEYPIGHVRNPKTSAAVRDKFVRNMRLVFSDA
                     HIARILAAVEDDEMGISEFVNLFWLQGSSGPRL"
     exon            715548..715872
                     /number=1
     exon            715990..717116
                     /number=2
     CDS             complement(join(717293..718481,718553..718793,
                     719183..719234,719617..719689,719757..719825,
                     719890..719930,719992..720006))
                     /codon_start=1
                     /locus_tag="AO090026000254"
                     /note="dehydrogenase kinase"
                     /old_locus_tag="AO070236000025"
                     /protein_id="BAE59735.1"
                     /transl_table=1
                     /translation="MPLYNVTLKKDSPPEELEKAKEQAREKGGTIKHEYTLIKGFTVE
                     YPEDHVSTLESSDHIHVEQDQEKSDQPKQAKDVYVHKISFTEWLLLKMALTNAVARIA
                     SCSVRHRICLSHNIQKARQFSVSPPPQVGTSTQHPFAYGANDEVTRLAASRRRPLTLA
                     DLLKHGRPPLSKDALLASANFTLSLLPARLASRIEALRNLPFIIVSNPHVSKIYNNYL
                     HSLSTLLPYQQRQITTLEEEKHFAEVLADLVHTHTNTIPILARGFLECRRYIDPTEVT
                     RFLDTHLRARIGTRLIAEQHLALHFASQPISDDGKLPKSTSPSNYIGVIDTALQPARI
                     VKLCEDFVGEICELKYGVRPRLTIGGQPDATFAHVPVHVEYILTELLKNAFRAVVEAG
                     NEREPVEVTIAAAPDVPRNHVRGPYSVSAGTYPSHPNSDVGFEMDSVVGTADANESIK
                     FSSPSTQSITIRIRDRGGGIPPEILPNIWSYSFTTFSDLDLQGSENGNMDALNAMSSS
                     SGHLSSIAGLGYGLPLSRAYAEYFGGSIAVQSLWGWGTDVYLTLQGVGKVG"
     exon            complement(717293..718481)
                     /number=1
     exon            complement(718553..718793)
                     /number=2
     exon            complement(719183..719234)
                     /number=3
     exon            complement(719617..719689)
                     /number=4
     exon            complement(719757..719825)
                     /number=5
     exon            complement(719890..719930)
                     /number=6
     exon            complement(719992..720006)
                     /number=7
     CDS             complement(join(720814..721815,721863..722009,
                     722060..722824,722881..723141,723258..723413,
                     725043..725258))
                     /codon_start=1
                     /locus_tag="AO090026000255"
                     /note="K+ transporter"
                     /old_locus_tag="AO070236000026"
                     /protein_id="BAE59736.1"
                     /transl_table=1
                     /translation="MVVDRRPPPAYTAPPESTVHASSEIYRAISNTASDASQRTLETS
                     FTIRPCSGQAWIVPAGHVCRLTTPKGPQQIAAPYTGMEENRDFEKGAIAQKSPESVAQ
                     ESHDDIYNVRPWNSPLDRLQSAVFGGRMLLWLAYQSIGVIYGDIGTSPLYVYSSTFSE
                     APSRQDLIGVLSIIIWSLFMMVTVKYVLVILRADNDGEGGTFSTYSLLSRYMNITNRD
                     PREASLVQMKRHLTDELERTSRHVRHRLESSSVAKRLLKVMGVLAVTMVLADGLLTPA
                     QSVLGAVQGIEVVSPNISKGTIIGVTDAILVVLFLIQPLGITKLTFAFAPIVIIWLGF
                     NAAFGIYNLAKYDAGVFIAFNPGYAFSFLARHGEEGWRMLSGTLLAFTGVEALFADIG
                     AFSRRAIQISWLGYAFPCLLLAYIGQAAYISVHPEAYSNPFFNAAPPGTVYPALVIAI
                     LAAIVASQAIITATFQLLTQVMKLSYFPQIKVIHTSDIFHGQLYIPIANWLLMVGTIL
                     IASIYNNTTSLGNAYGVCVMFVTFFDTCMVSLAAMFVWRISPFIVLFPWLIVACLDGA
                     YLSSSLMKVPTGAWFTIALATVLAILFLIWRFGKEQQWFAEAEDRFPTSHFVSKDPDG
                     QIRLTDRYGSTPLSITKGLGIFFDKAGETTPIVFSQFILKLTTMPAVIIFFHLRPIET
                     PSVPAEDRYTVSRLAIPNCYRLVVRYGYNDEIITPDLANTITQQVRRYLITRSCDQAD
                     PSTCTPDTMTNKSHTSSVKRSTTSATGESSMVDGGRYDTSLTKLEDAYNHGVIYITGK
                     EQMRIKKSKNYFRRIVLWIFLWIRENTRAKIASLGLATEKVIEVGFLKDI"
     exon            complement(720814..721815)
                     /number=1
     exon            complement(721863..722009)
                     /number=2
     exon            complement(722060..722824)
                     /number=3
     exon            complement(722881..723141)
                     /number=4
     exon            complement(723258..723413)
                     /number=5
     exon            complement(725043..725258)
                     /number=6
     CDS             join(727432..727489,727585..727655,727713..727802,
                     727866..731165)
                     /codon_start=1
                     /locus_tag="AO090026000256"
                     /note="GTP-binding protein AARP2 involved in 40S ribosome
                     biogenesis"
                     /old_locus_tag="AO070236000027"
                     /protein_id="BAE59737.1"
                     /transl_table=1
                     /translation="MENQSNRVHRPSKEKKKHDGPNPKAFAFSNPGKGNKAGARSHDI
                     KEKRLHVPLVDRVPEEAPPLVVAIVGPPGVGKTTLVKSLIRRYTKQTLSTPKGPLTVV
                     TSKRRRLTFLECPSDSLASMIDVAKIADIVLLMIDGNYGFEMETMEFLNVLSSSGMPG
                     NVFGILTHLDLFKKQSTLRMAKKRLKHRFWSELYNGAKLFYLSGVVNGRYPDREIHNL
                     SRFLSVMKNPRPLVWRNSHPYALADRFLDITPPTQIEENPKCDRTVALYGYLRGTNFS
                     AQGARVHVPGVGDLTVSGIESLPDPCPTPFMDQQMAKASGKASKRRLGEKQKLLFAPM
                     SDVGGVLVDKDAVYIDVKTSNFNKGEDESEDEDRGLGEQLVVGLQGERKLLGEADGGV
                     RLFRGGEAIEKADDEEEGAGRKHRRHARFMDGEGDHAEEDEGFESAEDDDEDELEDES
                     DDENIDVSAPADFEASFREKQEGKSRHDEGDIAFADSDSDLGSISSVEDQVLESDGEE
                     DLDEDDDDDDEDGAVRWKEKMLDNAKALHAKRPKYRVADLSRMMYDESITPLDVIRRW
                     SGKDEEEDADGEIEEDADDFFKKTNNEKEEQSEYRAIPEFDYEELERKWRDEEMIESL
                     RSRFATARLSGDGDDDDSDVDDAFDEDDEGDGDFEDLETGEVFNGISDEKEQEEGSGD
                     EGSVDLEAERERNAKKKEELRLRFEEEDREGFANSKDNSRQDGGGDEEFGEDEWYDAQ
                     KAKLQKQLDINRAEFDTLDPASRARAEGFKAGTYARIVLENVPCEFATKFNPRYPVIV
                     GGLAPTEDRFGYVQIRIKRHRWHKKILKSNDPLIFSLGWRRFQTLPMYSTSDNRTRNR
                     MLKYTPEHMHCFGTFYGPLVAPNTGFCCVQSFSNKAPGFRIAATGVVLSVDEHTDIVK
                     KLKLTGTPYKIFKNTAFIKDMFNSSLEIAKFEGTAIRTVSGIRGQVKRALSKPEGCFR
                     ATFEDKILMSDIVFLRAWYPIKPHRFYNPVTNLLDLEEDSAGDSGWKGMRLTGEVRRE
                     KGIPTPLQKDSAYRPIERQERHFNPLRVPRQLAKDLPFKSQITKMKPHKDQTYMQKRA
                     VVLGGEEKKARDLMQKLTTMRNDKQARRAAKQEERRQVYRAKVADSLEKKEAREKRER
                     DDYWRREGKKRKNTDEDGGGGGKKRK"
     exon            727432..727489
                     /number=1
     exon            727585..727655
                     /number=2
     exon            727713..727802
                     /number=3
     exon            727866..731165
                     /number=4
     CDS             complement(join(734319..735308,735367..736149))
                     /codon_start=1
                     /locus_tag="AO090026000257"
                     /note="predicted protein"
                     /old_locus_tag="AO070236000028"
                     /protein_id="BAE59738.1"
                     /transl_table=1
                     /translation="MKSLIWALPFIPLAYANGNSSSCRCQPHQSCWPSEQEWNSLNSS
                     INGNLVAVQPIAAVCHEGDWDSSACKEVMASWTNSTWRAAQPGAVQWENWESWPEHNQ
                     TCYIESPRNTPCGQGQISLYSTLAKSAFDIQETVKFAKQHNLRLAIKNSGHDFLGRAS
                     APESLQILTNGMKDIKMVDKFTPAGAPQGKDEGQAVTIAAGVSLQELYAAVAANNRTV
                     VAGSAHTVGAAGGYIQGGGHSALGPWKGMASDNALEFTIVTANGDLVVANEYQNKDLF
                     WALRGGGGGTFGVVVSVTVRTFDDAPLILVNFNITTSAGNPQYWDAVTTFHASLPKIN
                     DAKGGGYYWIAPDTELTENTSVSAITQTFIFPNQTDTAQIDRLYAPLISKLNGTTGVY
                     TQYASYPIPSVGFLFSKIFLTGNSDLAGGTGLLGSRLFSRDLLSSNNGSKKLSSALRS
                     IRVDPGSAILGHLVAGGAVADNAGKVDSALNPAWRKAITHIVIPRGWEPNATLAEQEA
                     VKKNLTDVEIPILRSVEGTDKMGAYLNEANAYESEFQSSFWGENYQRLLEVKKKWDPE
                     SLFVVRRGVGSEEWDEWGLCRAAK"
     exon            complement(734319..735308)
                     /number=1
     exon            complement(735367..736149)
                     /number=2
     CDS             complement(join(737410..737421,737538..738371,
                     738417..738482))
                     /codon_start=1
                     /locus_tag="AO090026000258"
                     /note="predicted protein"
                     /old_locus_tag="AO070304000110"
                     /protein_id="BAE59739.1"
                     /transl_table=1
                     /translation="MKNERAYLVHVIVHHLRWRGFLILPRLHKPKPHHIPPQHKPKET
                     RKTMSPQSTPFEEGAFLPGGHNTDPPLPPNDPTIGTKLNHSMLRIRDPQRSLHFYITL
                     MGMRTVFTMNTGPFTMYYLGFPSSAEDRADLSAWAAKVSDPANLTQTLGLLELFHIHG
                     TEKPVDEGGVEMANGNAPPNLGFGHLGFTVPDVGATVERLRAEGVKVVKELGVTTRES
                     IPLSEWEEKRGVGVGEIHPNYKVFFDQIAYVADPVSFFFFFFWFRIVVIEADWVFRMG
                     ILLKFFRRIGSENVRGGVLMLDTAVDE"
     exon            complement(737410..737421)
                     /number=1
     exon            complement(737538..738371)
                     /number=2
     exon            complement(738417..738482)
                     /number=3
     CDS             complement(join(738619..738960,739029..740035,
                     740220..740762,740824..740942,741050..741114))
                     /codon_start=1
                     /locus_tag="AO090026000259"
                     /note="predicted protein"
                     /old_locus_tag="AO070304000109"
                     /protein_id="BAE59740.1"
                     /transl_table=1
                     /translation="MKFSESEAAEVKTWVVRKLEDISDADADVLADYVLALIRADAPD
                     EEIRKASVEGLEDFLREHTVPFVDELFATFAPKQTAPPASSHPLSQPQIFNDANAPGS
                     GSQQQAPFNPPSGPSKGPYGPTVGNTPQSQTDSSSYGRKRNYHEGFQADQEREEAPHN
                     RNFKTPRRGRGGGRGDWMGRDNRATPGQYAPAPAGGFPVMPPTFPSFDQNDPMAAMMA
                     LQSMGFPQMPGMPPMPMPAPGGGAEYDPKSSNIVTDFQRRNTDTPHRGSDRGRGRGRG
                     GDRGGFGGRGRRSEYSAAGPNEDTSITTIVVEQIPDDKLDEASVREFFSQYGDIVELS
                     LQPHKKLALITYDSHASAKRAWSSPKVIFDNRFVKVYWHKTKADKNGDHRQGAIEVEP
                     FNQEEFERQQEAAQRAYEEKMQKRRETEEAKQALEKQREELLKKQQEEKERLMQKLGG
                     NDVSNGAAPSDGESGPSPQENVSDQTKQLRAQLAALEAEAKTLGIDPNGADSGAPSYR
                     GRGRGYLGRGGYAPRGRGYDPNHRGGYRGRGGMTRGRGGVLRLDNRPRRVAVSGVELN
                     SEKDEALRQFLIGVGEYESIQPNPEQSDSVIVAFKERYIAERFMFGPWQIPSVGEVQL
                     TWVPNPPISVAPTTPGSGMDTKTGSDEDTVMETTSTPLPPDPSAGRRDGNHEVDYDVA
                     EDDDSWGVQ"
     exon            complement(738619..738960)
                     /number=1
     exon            complement(739029..740035)
                     /number=2
     exon            complement(740220..740762)
                     /number=3
     exon            complement(740824..740942)
                     /number=4
     exon            complement(741050..741114)
                     /number=5
     CDS             complement(join(741844..741861,741920..744369,
                     744453..744510,745780..745803))
                     /codon_start=1
                     /locus_tag="AO090026000260"
                     /note="elongation factor 2"
                     /old_locus_tag="AO070304000108"
                     /protein_id="BAE59741.1"
                     /transl_table=1
                     /translation="MGSMRYGLIRSLMDKPKNIRNMSVIAHVDHGKSTLSDSLVQRAG
                     VIAAAKAGEARFMDTRADEQERGITIKSTAITLYSKFDDPEDLKEIEQGHDGNEFLIN
                     LIDSPGHVDFSAEVTAALRVTDGALVVVDSVSGSCVQTETVLRQAIAERIKPVLIINK
                     IDRSMMEQQLPKEDLYQNFCRIIETVNVTIATYEDKVLGNVMVHAEKGTVAFGSGLQG
                     WAFTVRQFAIRYAKKFGVDRKKMLERLWGDNFFNPKTKKWTTKSTDADGKPLERAFNQ
                     FCLDPIYKIIDAVTNNKRDQITTLVEKLEIKLTSEEKEYEGKLLLKTIMRKFLPAADA
                     MLEMICIHLPSPVTAQKYRAETLYEGPHDDEAFNAIKDCKAGSKEDPAPLMLYVSKMV
                     PTSDKGRFYAFGRVYSGIVRSGLQVRIQGPNYTPGKKEDLFIKKIQRTVLMMGGKTEA
                     IDDVPCGNIVGLVGVDQFLLKSGTLTTSETAHNLKVMKFSISPVVQRSVEVKNAADLP
                     KLVEGLKRLSKSDPCVLTMINESGEHVVAGAGELHLEICLKDLEEDHAGVPLKISDPV
                     VSYRESVSGKSSMTALSKSPNKHNRLYVTAEPIEEECALAIEAGKINPRDDFKTRARL
                     MADDYGWDVTDARKIWTFGPDTTGANLLVDQTKAVQYLNEIKDSVVSGFQWATREGPV
                     AEEPMRAVRFNILDVTLHADAIHRGGGQIIPTARRVLYAAQLLADPSLLEPIFNVEIQ
                     VNENAMGGIYGVLTRRRGHVYAEEQRPGTPIYTIKAYLPVNESFGFTGDLRAATGGQA
                     FPQSVFDHWAVLPGGSPLDVTTKPGQVVTEMRKRKGLKEVVPGYENYYDKL"
     exon            complement(741844..741861)
                     /number=1
     exon            complement(741920..744369)
                     /number=2
     exon            complement(744453..744510)
                     /number=3
     exon            complement(745780..745803)
                     /number=4
     CDS             complement(join(746129..755636,755773..755828))
                     /codon_start=1
                     /locus_tag="AO090026000261"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070304000107"
                     /protein_id="BAE59742.1"
                     /transl_table=1
                     /translation="MANTSLLTFGLTPDPSFNVVLFFLLYFNRLFATLLSYGIRAYTW
                     HYYRAYVDINALQISLLGGRIFFKGVRYHGVNETIFVHGGFITWRYWRRSVRRTFLYD
                     LKPNGYEPRNGVRSVADGDNDGAGDSGMKEQGGLKGADLLPCRITAKVYGLEWFIYNR
                     TPAYDAILAGFNTQGQPATFTKPQYPGSSSLDAELKDNSTRNSSVCESADPRSPQAGN
                     TPGRSRTGGETIGSHIVEGSGQEVGDGLSRLLRLLPVKLVCDKGAIVIGNENTRSVLT
                     TTFDGATGLIEVCNAGPLDLYRQSFSFEFMHPVVQMRPNPDFKQNQLSAASGLSSTGE
                     DQPGIKRKRDTIFNYQFQKRRVWHSIRDLIPYFQTSVESFHVSEKHEEAGPRTQGDVR
                     HDVRWVGLSRYLDDTNQDDHEEWNSVEYARFSTLLDSPSMTIAYYWDIPGCVKPQESP
                     QEFPPREATPDINGAPPPEWGIDVKIEGGTINYGPWADRERVGLQNIFFPNSYRNSQP
                     AEPLTTGDLRQNSVFKLRVETTDELTLRIPTREPSKDWQWKGRADAIRGASKMKKQQR
                     RRQSRAADSEKGHVGPEIRPFGWLSLRVTGDSTINYCMDMVASKVGYFNQLVLDLRDS
                     TMSSSVNHAVLWQCPQQLIKCDLSVPLTWNDPRTWEFDVESRDMELFLLRDHIFLLTD
                     LVADWASGPPAEYYTFVPFNYKLSLSFVNLRLFVNVNDMNIISNPSDLDDNRLLVIKG
                     ERLTSDVLIPLNRYKPEQNTVSFNVRLQDAGIDYLSPLWDTLHTFLQDKSAATLETMS
                     IDGSYSYYLSTSSELTDTLFLNIEGLSPKLYLFGFLIRSFMTIKENYFGEEMHFKTLE
                     EFQDLAYAKEPSETHNGINPNRKSNDLDVIVHVTVDNPCALLPENIYDRLKCLRLTAP
                     SLEIDLRFTNYYMDLEFSIAPLKVGLESHLAGKHPRISDSQLFIDGVSVHGHRLFGLP
                     PAEPTYVCNWDFKLGRVIGECSTEFISCLGPALKSFDFSFDNEENALPPLFPIALHDV
                     TFLRARIGMIHVSVLLDKTALVLSSGPVTTKFNDWTNAKFSKRMSLLVPELVIAAVDH
                     ELVGRLEGPTRPEVTPLALFETTINLRMAQRKNDIVESRRLQQEHIKVHDQRTQRTPW
                     LLFDWEEVDPDSTHLNDDDLTLPTIAIPAMPEPVIKNMNMGHLSAKRSVFSDGSSYAS
                     SEGFLVSSDASSVQRGRRKGDRSTTYTSSLVSEGQRQTSVQLPPGLRQDSHSTEEQRN
                     PSTILQNSSNPWDMPDFSLHKVNLDTSQLPSRHTSSDDIRPDDLFVTKFDPQFSPSAE
                     DQTTHTNFAIVLPNGVRGSCAPDFLFMLSSLIEGLQARHPTNIIDSLQKDVVSDIVGY
                     EKALKSPKRSTSVAIRTPVILVKLENLSEAPSKYESGFRDEYRVEIAHLKTEIRTKVE
                     REKGDLLAGIKKSSTVHAAAESLSISVEGTRADAYQERAELTCLFGDMNFWLVTKPMI
                     KSNFQARAFDTVTYTKSVEHLAYLVRRTTTMFDSVTSSLQHNSSLENKRLRLLIYFLT
                     QPAANIPDPAFLTRISYVLRVAPTHLRQHDSWKIISRIRNVYDNLPSHQKEDLASRCL
                     NNDLSLPPDARTTVLSGFDEWRAWDLAHVGKSYVMQRVWSSFVPKMESTPSPAYFSST
                     VKLLRFSIDPGPKESDFVVEDLSTALSINPQDGTLLGAEAKPTNLTIVQAYCSSISLR
                     LRWEILELVEGLLRTMSTVTLESTTPTQALYTESKESKELQVVFGADTGSINLDGINA
                     KLAFTGRGLRSSVVQKLDGIRGPDCLSALISAQACSSELSDLCKVIMSWKVGDPHLYC
                     SRVSQEKEGELENEWKIAGSSKRLRYDMREDPLSLAHIADRLIEDEVRYIHRLTSNMN
                     PSAHQSSEGISSARKPVCNKFHIAMFLGDYRLSFCILPSLTYVITGEVARTSMVPTMD
                     SKVEVDFDLKRNLHTFLSNNGNGWHSLSVLEIPPINGRVVANTSPVRMDMEVDVTIEL
                     IQLEASAVRSLLGALTKPEFSHLMSDLKQNVETLQLHLNDALALDKGPPRQKEPSNGH
                     SILYKARMTMAGTKIHASAPAISGKKYSADMDISLGMIRMRLNNGLEQRHPMEYPEFH
                     VNTSNISFDLRKQEATISRSYCNFTIDAKLQGTSMLRENGEARRVFHFSSKRLDVELF
                     PETAALVVDMATHLQERIKTLDLSHEVKRFKKLRRRANAVPRVPSIQVNDDSRSEDLF
                     SAMFSLDLNLIQVGWNMSTVPLPISGRKPDDLVFSIRRLELSNKRTNTAKLRIEDMQL
                     QMVPYLGNRRTRSLNSALLPELVFNVAYSSAGREVRLAFQAAGKSLDIRATSDFILPG
                     SMIRDSIAASSRIIREANSTLVSKSSDDNSKPRALFGNKRFRSVLVDVDFAGAIVSLQ
                     GRHTGDQQALLTATLKGSKLSEAKYGQYIQGDAVATATFRAPGVALKVQFEDNGQDNP
                     RLNAELKIDASTNVLYPSLVPLLKQMTDTVKEVMGGQEKPRRPSGAMMLQPQRLMQEA
                     PLDMNAKDSILGRCILNVGLLICKQEFSLSCQPIARVAATASFDTVYVTINTVQSDDY
                     GRFLALLVAFNSLEASVKHVYSNESTASFEVNSMVMSLMNSKHLGNSKGISAVLRISP
                     MQVALNAKQVQDFLLFREIWLPAADNIETKPAFPPQSTESQAYIVQRYQQVASASAFP
                     WNTTIAIEKLEIQLDLGSSLGKAQFAINDLWLSSKKTSDREQTLCVGFKATGIESKGR
                     MSGLIELQTFRVQTSIQWPDDTYHNKTPLIQASISFSLFQAKVSFDYQPFLIAHITMF
                     DFLMYNVCSASGNGHQRLFSILEGEQVQVFCTSLTASQTVALYQAWQRLVQDKQASYE
                     AALREVERYMRRRSSVFASKADLPAKDVARDADEKEEKAPISLQTGVAVTIKSVNIGV
                     FPSSFFDNHVLRLDAHDAQARFDVSLQEGKIHSALGLTLGQLRVALSSIVRPGPTEVE
                     ELLVGEIANRVLASSGGTILKVPRLVAQMETWQIPGTQQIDYIFRSTFEGKVDVGWNY
                     SRISFIRDMWESHSRALTSRLGKPLPPSAVRITGGLNEGGGDKKDQQQEKITAVVNVP
                     QSKYTYVALEPPVIETPQLRDMGEATPPLEWIGLQRDRLPNVTHQIIIVTLLEIAKEV
                     EDAYGKILGSS"
     exon            complement(746129..755636)
                     /number=1
     exon            complement(755773..755828)
                     /number=2
     CDS             join(756413..756507,756768..756855,756908..757912,
                     757964..758316,758373..758556)
                     /codon_start=1
                     /locus_tag="AO090026000262"
                     /note="predicted seven transmembrane receptor - rhodopsin
                     family"
                     /old_locus_tag="AO070304000106"
                     /protein_id="BAE59743.1"
                     /transl_table=1
                     /translation="MSSSGGTGSSLAKAVVIVSGVSSLVASLLSLLVPIYAAASWTSI
                     VSLKASLWLDPIRDVYEAFTIYTFFQLLINFLGGERALIIMTHGRPPVQHAWPLNHFL
                     PKLDISDPHTFLAVKRGILQYTWLKPILAIVSIIMKATDSYQEGYLGLTSGYLWTGIV
                     YNVSVTISLYSLAMFWVCLHNDLAPFRPVPKFLCVKLIIFASYWQGFFLSILQWLGAL
                     SNGVAGYTPDNLAAAIQDTLICFEMPIFAITHWYAFSWHDYADPTISSARLPVIYALR
                     DAFGIRDLIEDTKMTLRGDNYAYRLFDSGDHIMAHAESESRVRRMMHGMRYERGGKGK
                     YWIPTPGEINSRTPLLGGVESSRRGSIVDRFRSPSEVEESTLDEGDEQLFTKARALEF
                     GDWNYPVITANQAPQDQRLSSYQNPQQPNVVKKSRKHRKVRAPGSGETQPKSDSTPSK
                     SRRQRTENRAPLQRGPSSSTSQNSHRSQLVDLVVEDREAEKKERAEHQRMTGSALLEP
                     EHRYFQTPSGHPLSEQSQITPSEGPGSPSERVRQPTERDEGEGTDNDDPKTPGWSYEG
                     LEENVWGQ"
     exon            756413..756507
                     /number=1
     exon            756768..756855
                     /number=2
     exon            756908..757912
                     /number=3
     exon            757964..758316
                     /number=4
     exon            758373..758556
                     /number=5
     CDS             759771..761090
                     /codon_start=1
                     /locus_tag="AO090026000263"
                     /note="predicted protein"
                     /old_locus_tag="AO070304000105"
                     /protein_id="BAE59744.1"
                     /transl_table=1
                     /translation="MKLAVDSTLPRSSPPAWTSSTPSLELDSRLSLQRSKRASLAFKR
                     RSTAPLRISGPSEFRTVSSFATSPGGFHPDSFILLPPGQFRQFRPLELSFEASGNGLP
                     DLPEFDTFQVEEECPVLTRPPRTLRTSADISRLSRAKSHRPSSSFQLVRKPVGSGSRR
                     SSLATMEQLIDKKVTSSNPLVPHFSTRSPADNDLTASQHHSGYTRLDSANGCGLVVSK
                     PEPPKEPQASRVTIPSRTPTNTSTNLQDRPLPPIPVEDSPSSGTTQRPPTTPTDTRPP
                     TTPSENRNPNSATTTPTRSGRVTQWLFQSSNKTSPFSSSVSPWKSTFTDKNPFRIRSR
                     TLSGSTITSSLTSLTGGFKTTPSLSSNTTAAAPAPPPHIDSRLEKELDVPMSFSRPYI
                     PKHADEPDIYPTIFEGQQQHQHPQNGYDEFDHNYYTTYRRSAVGLAF"
     exon            759771..761090
                     /number=1
     CDS             join(761723..762007,762110..762535,762605..762637)
                     /codon_start=1
                     /locus_tag="AO090026000264"
                     /note="molecular chaperone of the GrpE family"
                     /old_locus_tag="AO070304000104"
                     /protein_id="BAE59745.1"
                     /transl_table=1
                     /translation="MFQRTILRQAQAARSLLSVRSTSSAPLALRRTSQFQPQSLRPLA
                     PLPGLRNYSTENKAEEDKQEKNENAESESQNTEDAVRKELEKKEKEVVDLKDKYVRSV
                     ADFLNLQERTKRDMDNARNFAIQRFAVDLLESIDNFDRALLAVPEAKLNSNEPEHKDI
                     RDLVSGLKMTQNVLMNALKKHGLERFDPSEPAEDGKTQKFDPNMHEATFMAKAEGKEN
                     GDIMYTQSKGFRLNGRVLRAAKVGVVKND"
     exon            761723..762007
                     /number=1
     exon            762110..762535
                     /number=2
     exon            762605..762637
                     /number=3
     CDS             complement(763809..765359)
                     /codon_start=1
                     /locus_tag="AO090026000265"
                     /note="Phenylalanyl-tRNA synthetase"
                     /old_locus_tag="AO070304000103"
                     /protein_id="BAE59746.1"
                     /transl_table=1
                     /translation="MRLLATGRALRATSSRWAIGRNVRIPFTHVSHISDPLRRTWSST
                     TALRTQESTNSDQTPDPRISIKKPSLTIEDKSYPTDQWTNTPDTILSHVGRRLYLDEN
                     HPLAITRKLIESQFPGPVYGNYHEKSPVVTTAQNFDVLGFPLDHPGRSRTDTYYVNEK
                     TVLRTHTSAHQQAYFQQINRNEKSRPEEVGYTVVADVYRRDAIDRSHYPVFHQMEGAM
                     LWKRPDIEPLKAAKETAAGITDDLNRIPTHDVAVEDPNPTIHAERNPLQAEHHSAEEV
                     EAIAAHLKRSLERMVIKIFTEASKAAAAANGNDSTEQEPLKVRWVEAYFPFTSPSWEL
                     EVFWQGDWLEILGCGVIKQELLINSDVPNRIGWAFGLGLERIAMLLFNIPDIRLFWSR
                     DERFLSQFKAGHISRFEPFSKHPACYKDVAFWLPSAAASGGSAAGGAVPVHENDIMEI
                     VRGVGGDLVEDVRLIDEFTHPKTGKKSMCYRINYRSLERTLTNEETNDLHNQVREKLV
                     GLLGVQLR"
     exon            complement(763809..765359)
                     /number=1
     CDS             complement(join(766086..767428,767471..768026))
                     /codon_start=1
                     /locus_tag="AO090026000266"
                     /note="predicted protein"
                     /old_locus_tag="AO070304000102"
                     /protein_id="BAE59747.1"
                     /transl_table=1
                     /translation="MLDELDNVFDEHPSLDASLEDFENPSNAHRSPVFGLPSQRSGFR
                     SEESDVEEDDMTPNGERWSPPGFRRYDYVQGSGWYRHQPYLRKVDQDRLGLKPTVGLS
                     PSQSREPSPQYEDALEDPMTGKRSNSTDTGDLTIAANIPLPIDADSPHKARSPSPRRA
                     PETSPAPEGLEFGSENNLSNCRLYLVGLPQDIRFAVRAEVQQREPFVALFNYLRSKFD
                     KITSSKSNTTISILVALLSIAFMRALFLPSVPQAIPDLVKLSGFARSFEPLIYYSENG
                     VQQIGTLQETGVAVWDLSESVRGTNMTSAPIIVRQLDELSESLKSLSLELTRFFANVD
                     SDVDSILLVMDWAKRELETLSSQPPSTLPSIMLDNLHDLLARLGTLERVTVPDGDSVG
                     GELNTPTTFGHVVTALFGQTSAQRTRSTLTRTFTEFLSVLEESINSELTHSTALFALF
                     ESIDRQFLNIQRTVVRESDAQERAEGEMLSSLWTRVLGPDAAVVRKYEKNKRLLANVR
                     SRTVANKHLLMDHRGRLLTLKVNLETLRRKLVSPLVRRNDSVSFAGAIDSSGGRSNGR
                     MLGPVEAVIEGQIRGLEGSYDYLRSVREKQKAKLMEMVYGSGRKLPTHSMLADGSDNS
                     ESDTIEGI"
     exon            complement(766086..767428)
                     /number=1
     exon            complement(767471..768026)
                     /number=2
     CDS             complement(join(769619..769643,769709..769803,
                     769858..770016,770074..770105,770478..770505))
                     /codon_start=1
                     /locus_tag="AO090026000267"
                     /note="cytochrome c"
                     /old_locus_tag="AO070304000101"
                     /protein_id="BAE59748.1"
                     /transl_table=1
                     /translation="MGKDAGFAPGDSAKGAKLFQTRCAQCHTVEKDGANKVGPKLHGL
                     FGRQTGSVDGYAYTDANKQAGVTWDENTLYSYLENPKKYIPGTKMAFGGLKKAKERND
                     LITYLKESTA"
     exon            complement(769619..769643)
                     /number=1
     exon            complement(769709..769803)
                     /number=2
     exon            complement(769858..770016)
                     /number=3
     exon            complement(770074..770105)
                     /number=4
     exon            complement(770478..770505)
                     /number=5
     CDS             join(772657..773034,773118..773513)
                     /codon_start=1
                     /locus_tag="AO090026000269"
                     /note="predicted protein"
                     /old_locus_tag="AO070304000099"
                     /protein_id="BAE59749.1"
                     /transl_table=1
                     /translation="MAPATIPQFLLPRGIPSTRAFQSLSRANATHHRIRTTTRRCASD
                     NSKPRVLEQPDKFRPPSHPARRVVQTRNGRVVGREPVNYGPKLTEKEREEQNRKQYPN
                     MFPPEGTVMYKFLTNRWIHIWIAMSVLTTLATFTFTTNFKRSSPFAHLLPSWSDLLWH
                     PVDTVSQALSVFRMHVQHTSVQTREKRHQRIEDAEKRRQYRVAHGLEEPAEEQGKTET
                     EVVDDQSPIAADAETKQGGGEYVDWEGKKRPVKKWLGIW"
     exon            772657..773034
                     /number=1
     exon            773118..773513
                     /number=2
     CDS             complement(join(773948..774559,774615..775160))
                     /codon_start=1
                     /locus_tag="AO090026000270"
                     /note="predicted protein"
                     /old_locus_tag="AO070304000098"
                     /protein_id="BAE59750.1"
                     /transl_table=1
                     /translation="MAAQRQASSASQTPHISPAELSYLYTSLALPGSPIRPDGRSATQ
                     FRPLTAETDILPGTNGSARVGFADGTQAIVGVKAEVEKTVVSADALKLPQQTQEEYVG
                     NNDGEANQGSSSGHGSWVQMSIEIPGFRDDDALPVFLSEMMREPLVESVSSEGSGNGE
                     MTGGLKGRLVINKRWHWRLYIDVLLLSQPQSYPLPLLSLTTHLALLSTKLPKLKSKGE
                     EDPFFDDDWDAAEYLYPRSTSTASATPSQQVRPPVTLLVVSVGENIIFDPDREEIAVA
                     DTVLAVSITRDSDSDNLKLVSIRTIDPPSRLTQPGVPNSENVTTLGSTAAAEEAAILN
                     PSTGEEEVPGVWRPRRGGVKRSTVARIVKLVLEKGGVGEEVLEGLEGVQVG"
     exon            complement(773948..774559)
                     /number=1
     exon            complement(774615..775160)
                     /number=2
     CDS             complement(join(776408..777808,777862..778605,
                     778661..778831))
                     /codon_start=1
                     /locus_tag="AO090026000271"
                     /note="MAPK related serine/threonine protein kinase"
                     /old_locus_tag="AO070304000097"
                     /protein_id="BAE59751.1"
                     /transl_table=1
                     /translation="MTVSYDHSSLRNAAPTSMATLEDRFEVMKEVGDGSFGSVAVARV
                     RTAGSNIARRGTMVAIKTMKKTFDSLAPCLELREVIFLRTLPAHPHLVPALDIFLDPL
                     SRKLHICMEYMDGNLYQLMKSRDHKPFDGKHVKSILYQILSGLDHIHAHHFFHRDIKP
                     ENILVSTSAPSDSAFSRYSNLVTPPSTPPTYTVKIADFGLARETHSKLPYTTYVSTRW
                     YRAPEVLLRAGEYSAPVDMWAVGAMAVEIATLKPLFPGGNEVDQVWRVCEIMGSPGNW
                     YSKSGSKLGGGEWRDGSRLAQKLGFTFPKMAPHSMESILQAPQWPTSLSHFVTWCLMW
                     DPKNRPTSTQALNHEYFADAVDPLRPKSSTARLLGRKTSDRSFKSPTRENSDSPSLTS
                     KSSWFRRSLIGRSDSDNEQSKQPVVSYSTAPETTKTKPAPSKRATWANGAPMPILPSI
                     RPVSPLSNAVTAQANSCIAGDNGKASKKIGRQLSLNSHGNHYADVHRQEAERALNGGN
                     PLVGANQKESFFSHLRKRARRLSGRNQGNVGSDNVEANAGCMPWSNRSSLALDTANAN
                     DAKQGSDLSELDKALQGVKCSLDSTALGNVPVHITSPVEGVKRQSMPQGSIRSMGDSP
                     VSTSGTGAPISSRTRRALQLSSHPVHRYETPEEEDELLDEALHSASKAARRLAQTETS
                     SDGSSNFSHQTMGNDNSRALPSPYPTPSPSAKCDGVSFGHSDTTPIRRLGLPDGKTDA
                     TSNRQWPTPPYEDGDWNHSGTTNFMTGSTYR"
     exon            complement(776408..777808)
                     /number=1
     exon            complement(777862..778605)
                     /number=2
     exon            complement(778661..778831)
                     /number=3
     CDS             join(789776..789928,790004..790576,790625..790727,
                     790784..791886)
                     /codon_start=1
                     /locus_tag="AO090026000276"
                     /note="predicted protein"
                     /old_locus_tag="AO070304000092"
                     /protein_id="BAE59752.1"
                     /transl_table=1
                     /translation="MAYDGYQNNSVPFYQPGNANQMNPNEPRASPYTPPYPSQYGHER
                     LNMPQPQPYDGRINEAVNSAFHKADTCTYLSPEILTQITANVIQQLKETGLENLQSDQ
                     YQPPHPPPRPPKQWATGAHTTYSHDFASSPAMATQDTSASSPHVPYENPAYQPRPPST
                     GYSSSPHLQPRASPAPPSERRGSPASQMSEHSQKMESRPKPPSREATVTELTTLERIW
                     GTLFEDGKPTKKLSQFLRGIAVHLIEDYEPKSSLVILPAKLQKFYEDTRVPGDYYPWK
                     YIFDDETSHVSRLFREVRAEHHLVQDENQLRERPYIPGLTPRGFETWATLMIQVNPET
                     EYKRLQKAVLNMPISNPDNRKERFPKEIPQSLFPFEKILKPELREEIKEFIKEHCSVD
                     LDKEFEKFKAHHEGSATSAAASGPSYSERERKPYQASVSTVVDSDEEELDTPSRPIER
                     QRKPYTAHPGGGKEYGDIQEPNHRHTSSFSGGSIPRDTLTSSEPRVSEYQGLDPTYVR
                     PSTAQPPSTTVRRQGSPPRGSRVGSEYRHSEGDLLGYNGSSGYGVDDIYNYRPGASTS
                     TGDILEDNRFYRDASRDEDQRLYESLRERERERDREKNKYNDYLPHRSSWDGEEGYYR
                     DALGSQGGPGYDYKTYTYK"
     exon            789776..789928
                     /number=1
     exon            790004..790576
                     /number=2
     exon            790625..790727
                     /number=3
     exon            790784..791886
                     /number=4
     CDS             complement(792223..792879)
                     /codon_start=1
                     /locus_tag="AO090026000277"
                     /note="predicted protein"
                     /old_locus_tag="AO070304000091"
                     /protein_id="BAE59753.1"
                     /transl_table=1
                     /translation="MNHPIRFVSLVGIIVARSEYPTLTILTVDDSSGAIIDVIVLKAP
                     ITDDNGDQPVRSDRGGDLQSAYATKHVAATNKTTVDTNPLVPGVVVQVKGTLSTFRGT
                     MQVQLERVAVVQDTNAEMRFLDQRSRYLVEVLSVPWSLTEEDVERLRYEADDEEERLE
                     EEQERIKRRQRRRIEREEKDQRRIQKLWEREERLRAKEALYSRDAGAKFMRDFEERKV
                     "
     exon            complement(792223..792879)
                     /number=1
     CDS             join(794081..795025,795881..796069)
                     /codon_start=1
                     /locus_tag="AO090026000278"
                     /note="predicted protein"
                     /old_locus_tag="AO070304000090"
                     /protein_id="BAE59754.1"
                     /transl_table=1
                     /translation="MHPTKTICIVGVTGNQGGSVAQRFLQDPTYHVRGLTRDPSSTKA
                     QELAAQGIEIVQANLDDTSSLKSAFAGANIIFSVTNYWEPFFRADCRQNAAELGISCR
                     KYAYDVEYQQGKNIADAAAATAETLDENGFIVSTLSQAGRCSGGKFEELYHFDAKADV
                     FPSYVQSNYPELARKMSCVQTGYFMSSYKLVPDAYFGRADDGSFEMAFPTAPDAAVPH
                     FNVNADMGNFVYAVAKMPPGKSYMAEGTTCSWTEYMRLWSKVNSVPASYRQITLEELI
                     DRTPDAEFGREVGDMFAYSTEPGYDGGDRELLHAADIRKASSSPHRTHTATPHGANHW
                     NSPFEASTLTSSGTTTAPYTSPQPTTPESSTTPSTSKPAKQAP"
     exon            794081..795025
                     /number=1
     exon            795881..796069
                     /number=2
     CDS             complement(join(798014..798082,798169..798544,
                     798598..799094))
                     /codon_start=1
                     /locus_tag="AO090026000279"
                     /note="predicted protein"
                     /old_locus_tag="AO070304000089"
                     /protein_id="BAE59755.1"
                     /transl_table=1
                     /translation="MNWSDCKPIPLWLLTTPLTLVRYFEEIHPAFPLLDEQLFMELYK
                     AGDKLSPVLVCYFFSVSLILWHHSPVLRQFPKPDVYFIWNLAVEALQQDFLAPALSTM
                     YSVLLDMGGRPIYSMLVNTINNGRAVTLAQTLGLNRDPTNWRRPKSEKSLRIRLWWAV
                     VIHDRWSSFAHGISPTITKSRYDVPIPMLEDIITDSNQSDTRIKAANSFIHLCTLTEI
                     LGEVLPLVYDLTFNPEETWKQIRRLETNLDDWEDRLPSYLRRDNNENPRVSGSSSLQL
                     SYLAVRLLLKRISLHTSTVSNQPATTSPNCVNPPKKL"
     exon            complement(798014..798082)
                     /number=1
     exon            complement(798169..798544)
                     /number=2
     exon            complement(798598..799094)
                     /number=3
     CDS             complement(800045..800713)
                     /codon_start=1
                     /locus_tag="AO090026000280"
                     /note="cytosine deaminase FCY1 and related enzymes"
                     /old_locus_tag="AO070304000088"
                     /protein_id="BAE59756.1"
                     /transl_table=1
                     /translation="MQSPHAKYLRECLSLAEKSPPRPTNFRVGAILVSRKEGDYKTED
                     DRIVSTGYTMELAGNTHAEQCCLSNYAAVHSVPEDRVWEVLPSEPDRKLVMYVTMEPC
                     GKRLSGNLPCVQRIIRTRQGDRKGIQKIYFGVKEPGTFVGGSEGCQMLTAAGIDWQVV
                     NGLEREILEVAVAGHENREEEVKAALDTVETNIDDISDDERRRQQEAQRNPKKRMMEA
                     NLLG"
     exon            complement(800045..800713)
                     /number=1
     CDS             join(801109..801253,801358..802103)
                     /codon_start=1
                     /locus_tag="AO090026000281"
                     /note="molecular chaperone (DnaJ superfamily)"
                     /old_locus_tag="AO070304000087"
                     /protein_id="BAE59757.1"
                     /transl_table=1
                     /translation="MPHEDDVPDIPDEAPLETDLYETLGVKGDATADQIKSAYRKLAL
                     KHHPDKAPEDQKEEANKKFQQIAFAYAILSDERRRRRFDLTGSTAEAVDEDDDFNWAD
                     FYREQFSSAIDVQALDKFKQEYQGSEEEEGDLLAAFEKYRGDMDKIYESVMLCNVLDD
                     DERFRAIIDKAIADGKVEQYKKYSEEPERKRQQRLKRAQKEAKEAEEAAKELEKKEEV
                     KETKAKKGKKKKTSAMDDNDLVALIQQRQASRAESFFDKLEEKYAPGKKRAAKFEEPP
                     EEAFAATAARRSAKKKKATK"
     exon            801109..801253
                     /number=1
     exon            801358..802103
                     /number=2
     CDS             join(803691..804744,804810..805567,805640..805701,
                     805755..805920)
                     /codon_start=1
                     /locus_tag="AO090026000282"
                     /note="predicted protein"
                     /old_locus_tag="AO070304000086"
                     /protein_id="BAE59758.1"
                     /transl_table=1
                     /translation="MQHYYSRKPAAMSLETALEEERRELVHEYEGRNGARSRRNHRTT
                     PTTPARSLLDIAPSPGALPPRHGSIAGIGVGVTPPSAQRSGHEPLVTTTSSTAPPPVK
                     KTSTPRRTTSAVAPPPIPQKKSSADSEDAPRRSSDPLSVTKDSKLDNTKPRQSIRWDD
                     SVTMPPSVLSQRRASQAQEKPPTKALQGRNAMAAVMSGLDIRVGLPSFTRGRSSSRNN
                     SARGTSLDSRLSPKNRWLSPSSRSPASQSTKPAAEKPKPTETESTSKQQPDRPAARRQ
                     LSDDDVRSPPPGDERLEKDMYDSENNLIETSEEEVDDSTSSDDEASSERGRKKTPDRA
                     TLIGDNETSPSTTDSKEQDSPDDKSEKSEYTHSAKQGPIPKKPEVHPRTSFDTASAVN
                     TPFGSEDEAELSDIKRAQKLGIQMSAIDSSVHNRSIRTIIRGDYTGLSEQTENGRRRQ
                     RKYLVTTDLSEESVYALEWTIGTILRDGDTMFAVCAFHEETGAPTSVQIGEGAKAMQD
                     AAAVVGSQTEETAQQSQNDSSTNLSRALLSRLGSGTDSKPGSVDSRGMSKAESERVHA
                     VEVISQTCVRLLRKTLLQVRVAVEVIHCKSPKHMITEAIDGLEPTLVIVGARGRSALK
                     GVLLGSFSNYLVMHSSVPVMVARKKLKKQSKTKKTNIRLSNNLSTPKKLAMAKVD"
     exon            803691..804744
                     /number=1
     exon            804810..805567
                     /number=2
     exon            805640..805701
                     /number=3
     exon            805755..805920
                     /number=4
     CDS             join(806544..806645,806729..806813,806887..806906,
                     806980..807015,807088..807249,807317..807633,
                     807705..807979,808028..808246,808309..808619)
                     /codon_start=1
                     /locus_tag="AO090026000283"
                     /note="vacuolar H+-ATPase V1 sector, subunit B"
                     /old_locus_tag="AO070304000085"
                     /protein_id="BAE59759.1"
                     /transl_table=1
                     /translation="MASEFVDPRMTSVKPRIRYNTIAGINGPLVILDNVKFPRYNEIV
                     SLTLPDGTERSGQVLEARGSRAVVQVFEGTPGIDVKKTKVEFSGHSLKLGVSEDMLGR
                     VFDGSGRAIDKGPKVLAEDYLDINGQPINPYSRVYPEEMISTGISAIDTMNSIARGQK
                     IPIFSASGLPHNEIAAQICRQAGLVGKPTKDVHDGHEENFSIVFAAMGVNMETSRFFT
                     RDFEENGSMERVTLFLNLANDPTIERIITPRLALTTAEYYAYQLEKHVLVIMTDLSAY
                     CDALREVSAAREEVPGRRGYPGYMYTDLSTIYERAGRVEGRNGSITQIPILTMPNDDI
                     THPIPDLTGYITEGQIFIDRQLYNKGVYPPINVLPSLSRLMKSAIGEGRTRKDHSDVS
                     NQLYAKYAIGRDAAAMKAVVGEEALSSEDKLSLEFLEKFEKTFISQSPYESRSIYDSL
                     DIAWNLLRIYPKDLLNRIPKRVLDEFYARSSRKIANKDTRDNSVPEQTQSSTGDLIET
                     "
     exon            806544..806645
                     /number=1
     exon            806729..806813
                     /number=2
     exon            806887..806906
                     /number=3
     exon            806980..807015
                     /number=4
     exon            807088..807249
                     /number=5
     exon            807317..807633
                     /number=6
     exon            807705..807979
                     /number=7
     exon            808028..808246
                     /number=8
     exon            808309..808619
                     /number=9
     CDS             complement(join(809172..810900,810972..811275,
                     811361..811496))
                     /codon_start=1
                     /locus_tag="AO090026000284"
                     /note="tryptophan synthase beta chain"
                     /old_locus_tag="AO070304000084"
                     /protein_id="BAE59760.1"
                     /transl_table=1
                     /translation="MEAIKKTFAKAKQEKRAALVAYITAGYPTVEETVDILLGLENGG
                     ADIIEMGVPFTDPIADGPTIQKANTKALENGVTVTTVLEKVREARRRGLKVPILLMGY
                     YNPMMRYGEERMLKDCREAGVNGFIMVDLPPEEAVRFREHCTSNGLSFVPLIAPATSE
                     SRMKLLCKIADSFIYVVSRMGVTGATGKLSANLPELLSRVHNWSGNVPAALGFGVSTR
                     EHFLTVQDLAEGCVIGSQIITVLGQAPAGQAAKHAEEYLSSVTGRKLERDAQGAIVRQ
                     VNVIDFVEKKEQAAISQPTAVVTDVDAPSGPGLADQLEALNGGNPSAQPQRFGEFGGQ
                     YVPESLMDCLAELERGFAEALNDPKFWEEYRSYYPYMGRPSSLHLANRLTEHVGGANI
                     WLKREDLNHTGSHKINNALGQILLARRLGKTRIIAETGAGQHGVATATVCAKFGMECV
                     VYMGAEDVRRQALNVFRMKLLGASVVAVDAGSRTLRDAVNEALRAWVVDLDTTHYIIG
                     SAIGPHPYPTIVRTFQSVIGDETKQQMMEQIGKLPDAVVACVGGGSNAVGMFYPFSKD
                     TSVKLLGVEAGGDGVDTDRHSATLSGGSKGVLHGVRTYVLQDEHGQISETHSISAGLD
                     YPGVGPELSNWKDSDRAQFVAATDAQALAGFRALAQYEGIIPALESSHAIHGAMELAK
                     TMKKGENIVLNLSGRGDKDVQSVADELPRLGPQIGWDLRF"
     exon            complement(809172..810900)
                     /number=1
     exon            complement(810972..811275)
                     /number=2
     exon            complement(811361..811496)
                     /number=3
     CDS             complement(join(812620..814418,814703..814868,
                     815600..815632))
                     /codon_start=1
                     /locus_tag="AO090026000285"
                     /note="predicted protein"
                     /old_locus_tag="AO070304000083"
                     /protein_id="BAE59761.1"
                     /transl_table=1
                     /translation="MQQADSFDLWKFDPDFQTPLILDESLDLSDTEESRFIGSLSDGL
                     LAKSEPILSMSTLQKPPQAALLGGESRQLPEVISYSPQRGSEGTRVFVQIQSPYDLHT
                     SSYATLYLVFGSKKCECVPHFLGFQGSLFQYALSVDTPPFISTGSPSFAVPLQVAMNA
                     QNECPSTTLQVGVYTYENASHPSPSDESRKRRIMSYSEEPMSGKRTTGPPIQGKEQPP
                     AYSYSPYLQSLPAMNGFVAPYHPTSSPRVAPAQYSTVNATPQSNIRAPSPLAPSWSPS
                     YVTVHGDSRAPGFAYGHGLRQQKPTSPARLSNPTLIRTSTLQQSSSLGHHTQSFNPYA
                     MYPSKAVLKLNGSLDSMTESWTKEEREAKRRLVQFTRMQSGSTIHADFNPVAPEDRAP
                     NSICISCIYWDGKDECFITSVDTIYLLESLVGVRFTVEEKNRIRRNLEGFRPLTVSKA
                     KADSEDFFKVIMGFPAPKPRNIEKDVKVFPWRILGHALKKIIGKYVSGGFFTLQIFDA
                     NADVHGSQSASYSSTAGALPTPISSTYTSNGAASDSGTEPPNAASPQSVSDTGPSTTY
                     GAHVAAAAYSPPAHHHPAHSMTGTHELRAVLPAVSQPYHPMAAPYSYPAVCQQQGDLG
                     LSAPVSRTWEINPLINAPGTNGGPTYNYLTPMSYSVQDPSH"
     exon            complement(812620..814418)
                     /number=1
     exon            complement(814703..814868)
                     /number=2
     exon            complement(815600..815632)
                     /number=3
     CDS             complement(join(826837..827037,827061..827639))
                     /codon_start=1
                     /locus_tag="AO090026000287"
                     /note="predicted protein"
                     /old_locus_tag="AO070304000081"
                     /protein_id="BAE59762.1"
                     /transl_table=1
                     /translation="MSVNIVQLYGPGLSFYLAHGKPSARMNAPVGSSGMSLRDVAVSS
                     VMRSKRSIGTLDERNTDILTSNVCQKYSATLKALHASNELLEGKARKLSNNTVLLELD
                     VMRVQRHIKAFHGELLMTWQADILTRLIEVVYERSGWKMPGGITSSSHAGMDEAKVTL
                     MYRTAARKIKKETLRRRFNLSVQYYLALQRYDEFCWSLVFSSSYLIVGCLFSKHESVS
                     LRAHVRSMVDVAKGESRSNRSVQFLGKIVSLMLRSDCRRNN"
     exon            complement(826837..827037)
                     /number=1
     exon            complement(827061..827639)
                     /number=2
     CDS             complement(join(828056..828352,828409..828850,
                     828876..829210))
                     /codon_start=1
                     /locus_tag="AO090026000288"
                     /note="NADPH:quinone reductase and related Zn-dependent
                     oxidoreductases"
                     /old_locus_tag="AO070304000080"
                     /protein_id="BAE59763.1"
                     /transl_table=1
                     /translation="MSKAIFLSQIEGKPGQVYYPLSVQNLPQPTPEGRELLVKMTAAS
                     LNHRDVFLRQHLYPGITFNVPMGADGVGVVVGAGPAVSNPERWQGKRVILNPGTGWKD
                     SPDGPEDPKGSTNKGTMQEYLTIDESEVEEAPEHLSDAEAAALPLTGLTAWRALVVKA
                     GERNSGKGAAVLLTGIGGGVALMALRFAVAKGADVYVTSSSQEKIQKAIELGAKGGVN
                     YKEEAWEKKLLTMLPPGKKAFDAIIDGAGGDSVEKAVKLLKAGGVLSVYGMTVSPKMP
                     FLMQAVLKNIDVRGSTMGSRKEFEEMVEFVKANKIHPVISRVLQTELGDIAGLDGLFQ
                     DMKEGKQFGKLVVEFGKASESKL"
     exon            complement(828056..828352)
                     /number=1
     exon            complement(828409..828850)
                     /number=2
     exon            complement(828876..829210)
                     /number=3
     CDS             join(831653..831744,831913..832348,832428..836265,
                     836330..836628)
                     /codon_start=1
                     /locus_tag="AO090026000289"
                     /note="predicted protein"
                     /old_locus_tag="AO070304000079"
                     /protein_id="BAE59764.1"
                     /transl_table=1
                     /translation="MPTPLPSSFASAAAGNTDASRRGDGTASGEWARNRMNGATQTFR
                     RPSVATNPSHSRDTSQPASATTPTAGTYTPPHMLSNYQSSALRNGATNDTRYSKDQLL
                     ELYKAQRDTGILGKNLAEYLAADWNPQVETSAANGAWGRREDSKDNPSGPGVCWDHGG
                     QMEPLSLVDMTDDEKELFSLSVNSPLKPPPTNVPKDNTGATPGGRKGSISQGHINNYN
                     TSSPSSNRPGPRRRETGDSAGNPMSPTTGGSRFFRDEPNTSTPPPSLLRRKTDFRDTS
                     STARWEEKEKESGRDVTSEAASPFNSLKRSSTNPLSAAPGTTSSPWGSASQTASFSPM
                     GAFGAFSLGTNPTEKKPGFGSLRGESRLKGLFSKDSSEDISASVKEKSSLSNLERLAG
                     EGEQRSQSPWGETLKTRTGRSETNPFQEEPRSGSAALGGSQELPSQSADPTGFAAFGM
                     TSSIPGFRELIQSHENSRNPTPSLLQGHEPTSPTNTNPYQSPHGDRGDVDDVETDGSD
                     IQTSHHPGLTGLRDTTAFGSIRRVGSGMDLPSIDRSATSSVAGNRSFSSLGGLGGLPS
                     IGGAAGWPASGAIGTPTRERSAFGGGGFGDPIFGTMGDLQSPSLSTLGGGGLFSPGIS
                     GTGSIGRSSKLGSLFPAAMQEQMQGDQARAELGSLDDGSRQLGMIPERPTVPHDLLTH
                     GEDLQQADKSGQANQPTTTSTSQTPVSAVGSIPTSMAPDAPPPSQTPGQPGSNAGSVP
                     PAQQRTMVMPDRMRWIYRDPQGNIQGPWTGLEMHDWFKAGFFSPDLQIKKLEDPEFEP
                     LAQLVRRIGNSREPFLVPQIGIPHGPDPNPGHWTGTTAGAAQPPFPGSFPSFGTTLTA
                     EQQNALERRKQEEQYLMARQKEHLAQQQAMMKQMQFQGLPPTIHPHQLQHHSSAHSLH
                     SQPSFGSIASPVGFQPSPIQGPIQQQQQQQQQSQPQPQPLAGFFDAAGPIRQNLPNVG
                     PQMLGTDLGGSQDQLPALLERLNVNRPDPFAFGSAAPFATRQPDNLFHQQQVATMLQD
                     RAQLQQEQEQFDSTQGDSLFDQQAREERLRQFHALRAQEDEFGMRTAEGLPTHPTTGP
                     SPPPEAESVQDVDLGSPTVEADQPTVADEEPVLTLSQQVQKAASAQRQQQEQQEQEQQ
                     QSQAANDAAWTAKGDPAMPQPFPPPPSASPLPAPAAQRNRQNVAESLAANSRSQTQTP
                     VEAPATSIAPWAKEVHEMPKGPSLKEIQEAEARSAAQREELAAAARRAQLLAEQERLS
                     QAQVQTPGLPSTANWASAGSPSTPASTGSVWGNSKAPAAATGGAKKTLAQIQKEEEAR
                     KQRAAAAAAAVAAQSAVAAAPSPPAPSSTGKRYADLASKAPAPAAPTTPVTTGAWTTV
                     GAGGKAKAPPAAPSGPRSTTATTPLAASPVKPKPATISTPRAVTVNTVTPANPNRAVE
                     EFTKWAKLALGKGLNSNINVDDFVQQLLFLPAEAEIISDSVYANSQTLDGRRFAEEFI
                     RRRTLADKGIVDPVAASAFAEKSSSGWSEVAKKGSSNAHREEDSSNAAFKVVAPRKKG
                     KR"
     exon            831653..831744
                     /number=1
     exon            831913..832348
                     /number=2
     exon            832428..836265
                     /number=3
     exon            836330..836628
                     /number=4
     CDS             join(837975..838236,838439..838599,838656..838714,
                     838822..838834)
                     /codon_start=1
                     /locus_tag="AO090026000290"
                     /note="predicted protein"
                     /old_locus_tag="AO070304000078"
                     /protein_id="BAE59765.1"
                     /transl_table=1
                     /translation="MLHRLEKFAEKDHPGLDFTRLARDIFEIDGPSGSHYCIAFKPQG
                     NSVRTLQETFPNAQLRKHLVKSIIHRLFFAVNWLHATCSVAHTELSGHPWLTDFGQMR
                     VVEGRINQDWWMSDLYRAPEVLLQLPWGYPVDIWSIGVMTLELLEGKNLVDPVYRVHG
                     QYVS"
     exon            837975..838236
                     /number=1
     exon            838439..838599
                     /number=2
     exon            838656..838714
                     /number=3
     exon            838822..838834
                     /number=4
     CDS             join(839592..839664,839719..840310,840399..841119)
                     /codon_start=1
                     /locus_tag="AO090026000291"
                     /note="cysteine desulfurase NFS1"
                     /old_locus_tag="AO070304000077"
                     /protein_id="BAE59766.1"
                     /transl_table=1
                     /translation="MTTPFGAPMREHFLFDTKFKNLNHGSFGTYPRAVQTALRQHQHS
                     AEARPDLFYRITRGQGIDESRRIVANLLNIPVNECVFVKNATTGVATVLRNLVFQKGD
                     TVVYFDTIYGAVEKNVHSIMESSPVTTRKVEYALPVSHEDLVKRFQDVVSRARGEGLN
                     VKVAVFDTIVSMPGVRFPFEALVEVCREEGILSLVDGAHGIGHIPLDLGALRPDFFTS
                     NLHKWLFVPRGCAVLHVPLRNQHLIRTTFPTSWGYIPPPSSGEITPTTTQGKSAFEYL
                     FEYISTTDDTPWLCVPAAMKFRTEVCGGEDRIYAYLETLAREAGDIVARALGTEVMQE
                     AGLKEGEASQLRRCGMATVRLPIAVSSSSDAGSGRGGDAVMRVQGEDGTSYLRIQASL
                     VATVSNWFRDTLFEKYETFVPVFQHGGWLWTRLCAQVYLEKGDFEWLGGVLRECCERV
                     EGEVGVSSAKI"
     exon            839592..839664
                     /number=1
     exon            839719..840310
                     /number=2
     exon            840399..841119
                     /number=3
     CDS             complement(join(841325..842732,842835..843016))
                     /codon_start=1
                     /locus_tag="AO090026000292"
                     /note="predicted metal-dependent hydrolase with the
                     TIM-barrel fold"
                     /old_locus_tag="AO070304000076"
                     /protein_id="BAE59767.1"
                     /transl_table=1
                     /translation="MKTLYKNGHLITPQSPNPTCMVTENDRIIYLGEESTARTLHPDS
                     KIHDLEGRKVLPGFIDGHMHLLLFGASLSKINLGNCTSLSDIRTTIKAAATANPTAPR
                     LFCRGWMHSMTNGEALASMLDDLDPRPIFIDSKDLHSAWCNTAALTELNVHNTPDPAG
                     GVIHRDETGKPTGLLSEAAAVNIVWPHVAKVATLEEKLGFVRAGIREYTKAGYTGVVE
                     MATDENLWNTLLALREREEANIRVAAHWIISPKEDEEEVLRQVDRAIELHGKYNVTTS
                     PDLRIAGIKVICDGVVDACTAALTEPYASNGDNCAPLWGADILKKVVRKADQAGLQCA
                     LHAIGDATVKLAIDALESEGTPGSRHRIEHLELTAPHDAKRLGALGITASVQPVHADP
                     AILRAWPRLLGKERCGRAFAYREFLDHGANLAIGTDSPTAPHLPLRNLYTATTRRSAR
                     EPESVETVNEGFRLGLLEAVVAATGGSAYSCFADGFTGRLEVGMKADFVVVDMVWEEE
                     RLLEAEVWETWFDGRRVWGRE"
     exon            complement(841325..842732)
                     /number=1
     exon            complement(842835..843016)
                     /number=2
     CDS             complement(join(843457..843691,843745..844799,
                     844873..844980))
                     /codon_start=1
                     /locus_tag="AO090026000293"
                     /note="predicted protein"
                     /old_locus_tag="AO070304000075"
                     /protein_id="BAE59768.1"
                     /transl_table=1
                     /translation="MADVGDRMFCHACGGVWLRRDHGLECPHCHSEFTEIIEIPPDTE
                     EEVPDPPTSVPEDRSAPPRNPWADHNPWDHDNMNTDTPDWGSGNGFRHHTYRSPDGRF
                     TFSSTTYTRRGSSGQQMPVDPLMPMVRGLDTIFHGLADTYRQTEYRQPNERDSSPGLW
                     RTDRQNQGFGPNGSRIYSTSFDIDMNTRSNGGVGSEFHTTGGLHPRDADGPQPMGTPL
                     RTLGEYVLSLGCGEIEKVTDLYSILELFRADFGNNGPPGGGPGVRVMTGPNPIAILST
                     LLNLDRHGDAVYSQEELDRVISQLIDQNARGTAPPPAAPNEIQSLPKKKVDQEMLGSE
                     GKAECSICMDPVELGTEVTVLPCKHWFHYNCIEMWLSQHNTCPHCRRGINIPAGPEGS
                     SDNPVVINSSPETSPRRPSGAAPEHSGQSPPRWNGPGPETGGQEQDQGQSSRNDNQGG
                     GFAGWVRSHFGGGNQ"
     exon            complement(843457..843691)
                     /number=1
     exon            complement(843745..844799)
                     /number=2
     exon            complement(844873..844980)
                     /number=3
     CDS             complement(join(845660..845989,846056..846149,
                     846205..846223,846291..846309))
                     /codon_start=1
                     /locus_tag="AO090026000294"
                     /note="membrane protein involved in organellar division"
                     /old_locus_tag="AO070304000074"
                     /protein_id="BAE59769.1"
                     /transl_table=1
                     /translation="MGSNLPYAADAESPLKPAELQVLRAQYEKEGDYVGIQTKFNFAW
                     GLIKSNARPDQQEGVRLLSEIFRAAPERRRECLYYLALGNYKLGNYGEARRYNDLLLE
                     KEPANLQAASLGTLIDERVSKEGLMGFAIVGGLALAAGLVGGMVFRGAKRR"
     exon            complement(845660..845989)
                     /number=1
     exon            complement(846056..846149)
                     /number=2
     exon            complement(846205..846223)
                     /number=3
     exon            complement(846291..846309)
                     /number=4
     CDS             join(846603..846629,846678..847075,847126..847303)
                     /codon_start=1
                     /locus_tag="AO090026000295"
                     /note="predicted protein"
                     /old_locus_tag="AO070304000073"
                     /protein_id="BAE59770.1"
                     /transl_table=1
                     /translation="MLLDENPGTLIHHTIGNFNIQPDKQAVTRINDSLSTLQQSRELR
                     MREAESSLRKLSRHLHSLNAQHEEAVAAHDSSKHAADMVELDTKKFRIAKAATELEIE
                     SERLESELEMLKERLADLEAQGLEGDEATRRERELDDATILRLKIYRSLGVDIEADDA
                     GNFNKAVIRNSRKGDVHVVNIDPKFSRFFYSNYFWSTMQG"
     exon            846603..846629
                     /number=1
     exon            846678..847075
                     /number=2
     exon            847126..847303
                     /number=3
     CDS             complement(join(847358..847408,847519..848466))
                     /codon_start=1
                     /locus_tag="AO090026000296"
                     /note="predicted protein"
                     /old_locus_tag="AO070304000072"
                     /protein_id="BAE59771.1"
                     /transl_table=1
                     /translation="MKLHRPFYSFLRLNLTSVARRQCHRQLHSFTRRLFKLPSPPPHP
                     SAHHHDLPSFLVYAERTSLSPTTTAYIGTHYEYIVQRTLRSSAFTLHRVGGRDDAGID
                     LVGTWHLPRREHPLRVIVQCKSLKTKLGPNLVRELEGTFNQSPVGWRTGDEVGILVSP
                     REATKGVRDALARSSYPLIWMMIERDGTLRQVLWNGKAEHLGLVNLGVEVRYSADEDA
                     DSSKGVVLTWDGEEIPNMGQVESHVSAVEDSWLRSWGDGFNEGQRDKSELLDAVQELF
                     PEEKPLLFGTGGCSTLTDADRVKVIQFLDSKKSAQVEAASGISRQNEIISSSPVNA"
     exon            complement(847358..847408)
                     /number=1
     exon            complement(847519..848466)
                     /number=2
     CDS             join(848731..848772,848840..849424)
                     /codon_start=1
                     /locus_tag="AO090026000297"
                     /note="predicted protein"
                     /old_locus_tag="AO070304000071"
                     /protein_id="BAE59772.1"
                     /transl_table=1
                     /translation="MADILTQLQTCLDQLATQFYATIGYLVTYHDNSPAIPPQNDPTA
                     APALAKITKNSTAPPAPAGAPAGSQASPQQQSAQIPGQQQQGGGDAGQTPGAGGGTGG
                     AGADPNLPPAPDSPRTFASRQRELARDLVIKEQQIEYLISVLPGIDSSEAEQERRIKE
                     LEKELRSAEEDREQRVRELRKLRKKLENVLGAVEVGIYGDRGAVASRR"
     exon            848731..848772
                     /number=1
     exon            848840..849424
                     /number=2
     CDS             join(851658..851961,852018..852253)
                     /codon_start=1
                     /locus_tag="AO090026000298"
                     /note="predicted protein"
                     /old_locus_tag="AO070304000070"
                     /protein_id="BAE59773.1"
                     /transl_table=1
                     /translation="MKLLSVSATYLAIPMALLVSAQRETVTQVGCYTDSANFQNKGSY
                     TYQSPGYCAKLCGKAKTPYMALHDGTECWCGTSLPDKSSLQSDDKCNTSCSGWPDDKC
                     GSDKAWSVYQLPAYTKEASETESASISISLASATPGSNSTASATKSGSVSQSASSAGA
                     TPTTSTSAATRRFKPPFFL"
     exon            851658..851961
                     /number=1
     exon            852018..852253
                     /number=2
     CDS             join(854107..854365,854439..855604)
                     /codon_start=1
                     /locus_tag="AO090026000299"
                     /note="FAD/FMN-containing dehydrogenases"
                     /old_locus_tag="AO070304000069"
                     /protein_id="BAE59774.1"
                     /transl_table=1
                     /translation="MGNTTSIAGRDCLVSALGGNAGLVAFQNQPLYQTTAVHEYNLNI
                     PVTPAAITYPETAEQIAAVVKCASQYDYKVQARSGGHSFGNYGLGGTDGAVVVDMKYF
                     NQFSMDDQTYEAVIGPGTTLGDVDVELYNNGKRAMAHGVCPTISTGGHFTMGGLGPTA
                     RQWGLALDHVEEVEVVLANSSIVRASNTQNQEVFFAVKGAAASFGIVTEFKVRTQPAP
                     GIAVQYSYTFNLGSSAEKAQFIKDWQSFVSAKNLTRQFYTNMVIFDGDIILEGLFFGS
                     KEQYEALRLEERFVPKNPGNILVLTDWLGMVGHALEDTILRLVGNTPTWFYAKSLGFT
                     PDTLIPSSGIDEFFKYIENNKAGTSTWFVTLSLEGGAINDVPADATAYGHRDVLFWVQ
                     IFMVSPTGPVSSTTYDFADGLYNVLTKAVPESEGHAYLGCPDPKMANAQQKYWRQNLP
                     RLEELKETLDPKDTFHNPQGILPA"
     exon            854107..854365
                     /number=1
     exon            854439..855604
                     /number=2
     CDS             complement(join(856038..856517,856572..856665,
                     856753..856774,856805..856829))
                     /codon_start=1
                     /locus_tag="AO090026000300"
                     /note="predicted protein"
                     /old_locus_tag="AO070304000068"
                     /protein_id="BAE59775.1"
                     /transl_table=1
                     /translation="MCDLIRDWAGSFLTSDLTPTLIRYDLGTRSLVYRERFKGFVNID
                     ANHTHKMFLTHISGTLVLFLLIIATTLATLTRYTIPIPAETLILETRQQLNDMAAAYS
                     MGTLDDRNGGYYLLDHDGEILAVAADGLCEELDNSMASARRVYEQHSRFDLYSGEVQE
                     VTLQSHDAQLRRSGENSCSHPRCYTHALCETYSDCFVCSSSHHWCY"
     exon            complement(856038..856517)
                     /number=1
     exon            complement(856572..856665)
                     /number=2
     exon            complement(856753..856774)
                     /number=3
     exon            complement(856805..856829)
                     /number=4
     CDS             join(858375..858394,858520..859205,859286..859332)
                     /codon_start=1
                     /locus_tag="AO090026000302"
                     /note="predicted protein"
                     /old_locus_tag="AO070304000066"
                     /protein_id="BAE59776.1"
                     /transl_table=1
                     /translation="MAHQEENPNNPFFEPFTLYCAMVVLLDHPALRLAGYLVLKLFDR
                     RFAAQPRKDDKLDPWTPEIERQYHDFILDGSASEFITRLNTDGKMAEEEGHTWNDPQN
                     EAYLHDHMQDLYETEVEAFHTVTDIQGKDIPQLFACLTVPSSSSSQEPSVNKYIDVSG
                     VLLQYIDGFLLTDIAVHAPREVWQSVCDEAIQIVNRIGDRGILNEDVKMRNFIVQENP
                     GRKFKGFMIDFALCNFRRIFAWKLCLQSICSI"
     exon            858375..858394
                     /number=1
     exon            858520..859205
                     /number=2
     exon            859286..859332
                     /number=3
     CDS             join(860148..860338,860429..861050)
                     /codon_start=1
                     /locus_tag="AO090026000303"
                     /note="enoyl-CoA hydratase/isomerase"
                     /old_locus_tag="AO070304000065"
                     /protein_id="BAE59777.1"
                     /transl_table=1
                     /translation="MAAPQTVTVEYNDNLAIVTLNNQEKLNALSQEDYYKLATTLREI
                     AQHDEVLVTLLIGKGRFFSAGADVTRPPPDAKKTPPRQYWLRALVLNNIDLADAFYTH
                     PKILVTALNGPVIGLSAAVIAHSDFIFATPNAYLLTPFSSLGLVTEGGASLAFVRRLG
                     ISKAKEALLSSRRIPVEELQQVGFVNQVLDAGGDEERFREMVLGEIRGRFGDHLVGSS
                     VLEIKRLLREPGDREFGSQAVQEVFGGLRRFVDGIPQAEFRKIATGEKRHKL"
     exon            860148..860338
                     /number=1
     exon            860429..861050
                     /number=2
     CDS             complement(join(862056..862458,862608..862618))
                     /codon_start=1
                     /locus_tag="AO090026000304"
                     /note="predicted protein"
                     /old_locus_tag="AO070304000064"
                     /protein_id="BAE59778.1"
                     /transl_table=1
                     /translation="MHRSNELEMSLSERRLWRRIWWTLYTRDRAMAAAYGRPISIDAD
                     LTNVDTITQDDFIESEGHQPDSVQVQFFIQYVKLCELMDLVVGRRRRAGSLTESEFAQ
                     WEIRLSRWMMQCPEQMHWAQARHSFWPAILHSIYL"
     exon            complement(862056..862458)
                     /number=1
     exon            complement(862608..862618)
                     /number=2
     CDS             complement(862697..863152)
                     /codon_start=1
                     /locus_tag="AO090026000305"
                     /note="predicted protein"
                     /old_locus_tag="AO070304000063"
                     /protein_id="BAE59779.1"
                     /transl_table=1
                     /translation="MDVYGAYKSHLDLLEDEERTVLELKGALEIPPQAVQDELIDAFF
                     SWVAPVLPVVNQRVFLSMYKDPLNPPSLLLLQAIFLAGSRAVREKNHGKELSPGAHSS
                     MVYLQRAKALYDAEFEKDHTTVVQALLLMSWYWQGTEGESVGLSKAGIS"
     exon            complement(862697..863152)
                     /number=1
     CDS             complement(863393..863911)
                     /codon_start=1
                     /locus_tag="AO090026000306"
                     /note="predicted protein"
                     /old_locus_tag="AO070304000062"
                     /protein_id="BAE59780.1"
                     /transl_table=1
                     /translation="MLVHVYLQINVGQFRQLSNDLKKFIRQIRCIPNHTPFRFANTFG
                     DALYDHRVGGEFGPFAETSDFTSYSIPEHTSSETRNAIPPVLSRPYRSFFSHAALHST
                     NILISQGRLSGIVDWECAGYFPEYWEFTKAIFGIINNEALEKIMRNAFDEDYGDELDV
                     ERTLWRDSPFGI"
     exon            complement(863393..863911)
                     /number=1
     CDS             join(865918..866092,866151..866182,866279..866884,
                     866966..867594,869087..869348)
                     /codon_start=1
                     /locus_tag="AO090026000307"
                     /note="predicted flavoprotein involved in K+ transport"
                     /old_locus_tag="AO070304000061"
                     /protein_id="BAE59781.1"
                     /transl_table=1
                     /translation="MAGSLRIRVENAYDGAPRTFYPVVVIGAGASGIAAGCRLKQKCG
                     CDQFLVFDRQSGIGGTWWRNRYPGVVLMQDRPAFFYSFSFAPNYLSKTIFPSGRDYID
                     YLYNVVERAGIADKIQLNTEVISLEWIEKDAEWEQYISQVYGQDSRGKKTEAVEIVRA
                     KVVISAVGVLAESSEWPSSVASRDTYNGQLLHSARWPDKISLDGQDVVLVGSGCSAAQ
                     IAPALLQTKVKSLTQIMRTAPWLVPRVEEPGGRDAYAKWAPRIYGMIPGLRYTEEASC
                     LAHMRALAPITYHDQLTPTYQLGCKRRIYDNDWLRGMHDPRFMLESRPWRSVADTSIT
                     VGDGDNAKTYHADTLILATGFEATQFLQPISVVGRHGLSLHGLWATRGGPHAYLGTAV
                     DGFPNFFLILGPNTFSGHTSVIMAIENSVDHAMRLIAPILDGQVESIEPKTIAVQTWL
                     TGIRRDMASTVFASCQSWYNGGGRYNSVMYPGYIDITHTIHNRRHLLSAESVPFAKET
                     LCLPPIQYSDKVIQDTFDLDSRLREVDILWNKCDMRWASTYWVGFQVANMRPRKKLHG
                     K"
     exon            865918..866092
                     /number=1
     exon            866151..866182
                     /number=2
     exon            866279..866884
                     /number=3
     exon            866966..867594
                     /number=4
     exon            869087..869348
                     /number=5
     CDS             join(871667..871955,872187..872405,872460..875254)
                     /codon_start=1
                     /locus_tag="AO090026000309"
                     /note="helicase-like transcription factor HLTF/DNA
                     helicase RAD5, DEAD-box superfamily"
                     /old_locus_tag="AO070304000059"
                     /protein_id="BAE59782.1"
                     /transl_table=1
                     /translation="MASNAAMLLDPRAHRKQLQNDGNDPEPASPSSYSRSDASLGAAY
                     KRFCFPSTSRDCPSPPQDPIFMNPSLVATESSFIHETGSQDSGHSNSSAAPAVRHGNL
                     IEDMYGVERRLNQPYKKIKTEKDLAQSGKRAIFASTGTTGLGEWVKNGEEKSNSSTPI
                     TPNVVDLTIDSSAGATDDDDLQVTGSNNLSIQRVCYGKLENAMVQAVLVPKPAAQTIF
                     GDSAHDWPSIKLGVHRQTNQGNNRIEVSDPHGKIFGAVDSKTAAVIAPLLDSPALKVN
                     VTARLDVRRRLPNEWPWAPCSALYRASINLYGLRKDAELVGKHLGQHNVWLGTPFSVE
                     QGVPVFNPHAERRRAQAAASFLPNVAARGRSTVNYEVRTAEEVNDAVMKMFDQLQSAE
                     NIPELEPPSLLSTPLLRHQKQALWFMTEKEKPRKFGPKEEDNNSLWRLEHRSNGARRY
                     REIISGIVRDDEPPQSLGGLLADMMGLGKTLSILSLVVSSLGDAHEWANMAPNSELIR
                     NLPGIRNTKTTLLVAPLSAVNNWTFQVKEHLKENAISYHVFHGQSRITDVDELSKYDL
                     VITTYSIILSELSGRGSKRNGSPGSPLTKMNMFRIVLDEAHTIREQSAAQTQAIFKLN
                     SQRKWSVTGTPIQNRLEDLFSVTKFLGLSPYDDRGQFGMHILSRFKTGDATVLASLRV
                     LVDSFTLRRVKDKIDIPTRHDKIITLNFSEKERQLHEFFRRESNVMMKVIAGEDKTAL
                     KGRMYHHILKAMVILRQVSAHGKELLDSNDRARIKGLSVHDAIDLEDGGNDTPELVDK
                     KAYEMFTLMQESSADLCAVCGKRLEDPNTDSGATDRQAPMAIILPCFDVLCPECFSGC
                     KQAFDSQTGPSIHDIKCQVCDGWIPVSYSTITPGGLKDYMMGQAQAKQSKKQAKTLGE
                     YEGPHTKTKALIAYLLETMDESKGLTDERPIKSVVFSAWTSHLDLIEIALKDNGITGF
                     TRLDGTMTLSARQKALQEFHDNNDITILLATIGAGGVGLNLTSASRVYIMEPQYNPAA
                     VAQAVDRVHRIGQTREVTTVQFLMKDSIEEKIFELAKKKQQLADMSMNQRKLDKREVQ
                     EQRMREYRSLFK"
     exon            871667..871955
                     /number=1
     exon            872187..872405
                     /number=2
     exon            872460..875254
                     /number=3
     tRNA            complement(875939..876028)
                     /locus_tag="AO090026t00004"
                     /note="tRNAscan-SE"
                     /product="tRNA-Leu"
     CDS             879558..880361
                     /codon_start=1
                     /locus_tag="AO090026000311"
                     /note="predicted protein"
                     /old_locus_tag="AO070304000057"
                     /protein_id="BAE59783.1"
                     /transl_table=1
                     /translation="MSPIASHSQRPPPSLSVDEEKFEQNSDNTIADDYVDPRVFDQRR
                     RRAFSRQYMIIVIYLLLTLGGLLLTAVDVTSTAYSTSNLMRWESSASFALESSHPSSS
                     HGHHDTSPKTYDPSFPAMKGVMKSPCGHTAGEARARGCHFDIITFCWLPDRCYDAELS
                     DSLEKLVDWKWYLDRNKTQPVPKEEALQGELDGLYVSWEYSVQHCVYMWEKMHRGLLG
                     AGKAAIDTYIGPYSHTEHCGKMILSPGGGYAMSDINTRIRVKFPNCGIK"
     exon            879558..880361
                     /number=1
     CDS             join(881227..881900,881967..881994,882029..882061)
                     /codon_start=1
                     /locus_tag="AO090026000312"
                     /note="predicted protein"
                     /old_locus_tag="AO070304000056"
                     /protein_id="BAE59784.1"
                     /transl_table=1
                     /translation="MLLLEMREKTFYLQAPYRDYPPEATSGIVNLSFVWWINRLFMTG
                     YRKLMGNRDLYDLEPGLASGLAGERLKREWENHGLFISNTCCNYRMCNMLTSLKAREK
                     QALSPLCICPLFLDGVSRRGVASTLSDWIQLRSAFSDHGGGPACRATDDYRDPKPWLW
                     PHWGHLPGLSGYSGRLLLCYTYSASLIAIAGFECPLQTALLAGVHVIPRIDAEDGETR
                     GGAVAGKRSRAKILPLLGYIRLMNFD"
     exon            881227..881900
                     /number=1
     exon            881967..881994
                     /number=2
     exon            882029..882061
                     /number=3
     CDS             join(882768..883384,883413..883552,883558..884312,
                     884384..884646,884703..884959,884999..885066,
                     885130..885180,885280..885413,885500..885584)
                     /codon_start=1
                     /locus_tag="AO090026000313"
                     /note="multidrug resistance-associated
                     protein/mitoxantrone resistance protein, ABC superfamily"
                     /old_locus_tag="AO070304000055"
                     /protein_id="BAE59785.1"
                     /transl_table=1
                     /translation="MRSKHGSEATTNYGESITALSIITLVTTPAEKLLAVLPQLAAAT
                     SCFQRIHEYITSDPVKDGRLGHNKALMLNSAISPANADEKEFAPRTDDEEQGVAIKLD
                     NVTVLPSPKAIPVALKNVSFKVTRGNLLAVTGSVGSGKTTLLKTILGELGCQSGTVCV
                     QSKRISLYSQDPWLLNTKIKKSITGLANHQVYEKWYEAVIRSCCLDRQDIALLDDILS
                     ALDMQTREMIIARLLSDDGIFRQLGTTVVLTTHNPLLPTSMLCPRFLTLDIFLAQLLK
                     VADSVISLSADGQVELQTTGRDAIPYAAIPHGREDTDAREGGLNEKTWDKAADSSDDP
                     VNEVKDEDRARQIGDLSVYYYYARIVGPFLCTMFLLAHAFLAFAENFPRVWLSKWTEA
                     GGGQLSLYLSVYITLALAASMLVLGCIWIIFLELMPKSAIRLHWRLLNAVIRAPLSFF
                     STTDSGMTLNRFSQDMTLVDLALPISLMSLGQSFFECIATVGLIATGSAYMALALLSL
                     FITSWTTFETSLGVIARVKSFVETTPSEFRDGEIPESPVSWPEEGAIHIQGLSLSYPN
                     GTPVLHDISICIEPGERIGICGRTGSGKSSLILSLLRLINPSHGSITIDGINIESISP
                     SAIREALITVPQDPFTFLGTMRYNADIMGASNDEEIISALKQVGIWEAIESRGGEQHL
                     FCLARAILKKRTRQGECQVLKDAFEGCTVVSVAHRLDTIINFDRIAVLDAGHLVEFDT
                     PQRHLAKDGLFCRMASAFKEQGPIQLYWGYLCKAKQSLYVSVPDFSGQI"
     exon            882768..883384
                     /number=1
     exon            883413..883552
                     /number=2
     exon            883558..884312
                     /number=3
     exon            884384..884646
                     /number=4
     exon            884703..884959
                     /number=5
     exon            884999..885066
                     /number=6
     exon            885130..885180
                     /number=7
     exon            885280..885413
                     /number=8
     exon            885500..885584
                     /number=9
     CDS             complement(join(886099..886953,887006..888499))
                     /codon_start=1
                     /locus_tag="AO090026000314"
                     /note="phosphatidylinositol 4-kinase"
                     /old_locus_tag="AO070304000054"
                     /protein_id="BAE59786.1"
                     /transl_table=1
                     /translation="MPKNRPATSGYARLAQEEEDRANDLYDYSDDDDQNDSLGTISHS
                     APRYAPISSRAQMDASILSSPPGHRRRPSGYHRRGRRNSGVDIKAINARLERWAEEIA
                     SKFKIHKVKGKTLEEEKLEIYHSVFQPPNGVRPISAEELESDEIEGAARRAREEFEDV
                     VESVHSAIRMGMHPRMISQGSSGSYFARNGEGKVVGVFKPKDEEPYASRNPKWTKWIH
                     RNLFPCFFGRACLIPNLSYVSEAAAYVLDSRLRTNLVPYTDIVWLSSKSFYYDFWDRR
                     KAWMGKRPLPPKAGSFQVFLKGYKDANLFLRDHPWPDQTNTGFRAEDAPKRKKRPWNE
                     ACRPSGMQSDDEDDDYENGDIQTPSPREESRERRFYWTEGLKQSFREELEKLVILDYI
                     MRNTDRGLDNWMIKIDWKTEEVSIVADPPKPNGTQQDDDDDHLPPARPVSVNSERTGS
                     ARLPYRRHEAMVAVSRTGTPLNSSEPQASIQIGAIDNSLSWPWKHPDAWRSFPFGWLF
                     LPVSLIGQPFSQKTRDHFLPLLTSTSWWSGTQMALRRVFSQDDDFKESMFARQIAVMK
                     GQAWNVVETLKQPDHGPLELTRRARVCVWDDLVDVPVAIPLRGPSTEAQKRKVKSYEN
                     YDYDPDHEEMDIGASMSLGTGPENDLLGLGSSPNELPNPNRFELSRGRSHQPSTRRIP
                     NGSPATIGDYRVSQDGIDSMIHGRSMDQSWPSLPPRPGNKHQKHSSISSARGQAQLIW
                     SSDDLEGDLGYAAAEGMEGNQRKVIVERLEAVKSKNPVFTWC"
     exon            complement(886099..886953)
                     /number=1
     exon            complement(887006..888499)
                     /number=2
     CDS             join(891442..891672,891778..892488)
                     /codon_start=1
                     /locus_tag="AO090026000315"
                     /note="GATA-4/5/6 transcription factors"
                     /old_locus_tag="AO070304000053"
                     /protein_id="BAE59787.1"
                     /transl_table=1
                     /translation="MATTLADQKRPQLQPVCQNCGTSTTPLWRRDELGSVLCNACGLF
                     LKLHGRPRPISLKTDVIKSRNRVKTAGQGPKRKSSSAVDANGLSTSRSEAGTPPLGSH
                     GYRRASRKMSPGHSDRSNSPVSRTETPGLPSMQQQQLPPQHNSNIAPQHMFDSVTLGD
                     HGLTNGLSSGQLRQQSPTSTSAAVDRHNESPQTIEGLLAANTSLKTRVRELEFVNDLF
                     RGRVTELEQSDAAARRSEMIARDSESRLKRALEDAQRREEDLKRRVSELERHIGEASN
                     GNLEGDESSGEPMAKRMRLSDVVDQPSTSPTKSPKSV"
     exon            891442..891672
                     /number=1
     exon            891778..892488
                     /number=2
     CDS             complement(join(893662..894027,894206..894337,
                     894440..895080,895117..895225,895256..895552,
                     895651..895731))
                     /codon_start=1
                     /locus_tag="AO090026000316"
                     /note="predicted protein"
                     /old_locus_tag="AO070304000052"
                     /protein_id="BAE59788.1"
                     /transl_table=1
                     /translation="MAESTHKTKRIISVVAGTLVALACGTNYAYSAWAPQFAERMKIS
                     ATQSNFIVSCLVSLGKADVYRTDVSQGVAGNLGMYASGVPLGLLTDARGPRLTTFIGA
                     VALGVGYYPIYIGLSVWLLPALDDPMSTERARSVLACYPFSHSLLASEVAPPSRLQSR
                     QVYPSNLAATNFPDHRGTATAFPLAAFGLSAFFWSNVSSFIFKDDTGRFLLLLALGTF
                     FFNFVSIPLLRLMPPAKAYTALSRDRSPGVESTRLHRTKSSDLRYVPEESDEAGMQSS
                     TAFESHSPMHVRSQSGASINSHSANHNPDLDETSSLVSKSTPRQSREDDHEEEDDALL
                     DVGVGSPHPDIRGLAMLPKVEFWQLFLTMALLSGIGLMTIKYTNPHRPKHCGNTTTIV
                     LAPDSSKRDKSCMCPSYHLAISSADSPVLIVVSGFTGVAYGFLFGVFPSLVAHTFGIG
                     GLSQNWGVMTLAPVLSGNVFNLLYGSIYDRHSVVGPDGDRDCPDGLGCYRTAYYTTFF
                     SGVAGVIVCLWSILRERRVHGAIRKKIEHDRLA"
     exon            complement(893662..894027)
                     /number=1
     exon            complement(894206..894337)
                     /number=2
     exon            complement(894440..895080)
                     /number=3
     exon            complement(895117..895225)
                     /number=4
     exon            complement(895256..895552)
                     /number=5
     exon            complement(895651..895731)
                     /number=6
     CDS             join(896469..896519,896572..896651,896722..897310,
                     897367..898092)
                     /codon_start=1
                     /locus_tag="AO090026000317"
                     /note="tumor differentially expressed (TDE) protein"
                     /old_locus_tag="AO070304000051"
                     /protein_id="BAE59789.1"
                     /transl_table=1
                     /translation="MGALLSLPLLAVPSASTLLTLATSCCGAATCSAVCSACGKFQNS
                     MATRIAYAFILLINSIVSWIMLTPWALKKLQHLTLDYMEITCDGKACHGWVAVHRINF
                     GLGLFHLVLALFLLGVRSSKDGRAVLQNGFWGPKIILWIAFVVVSFFIPQSFFFVYGR
                     YIAFICAMLFLLLGLILLVDLAHSWAEICLQKIEDSDSRLWRGLLIGSTIGMYIASIV
                     MTVLMYYFFARSGCAMNQAAITVNLIVFLIISFVSIQPIVQESNPRAGLAQAAMVTVY
                     CTYLTMSAVSMEPDDRQCNPLVRARGTRTASIVLGAILTMATIAYTTTRAATQGLALG
                     SKGGHNYSPLGTDDNEHGLVTQQPTSRREMRAEVLRAAVASGSLPASALDDDSDDESD
                     DYNTKDDERGSTQYNYSLFHVIFFLATTWVATLLTQGLETEVENTDDFAAVGRTYWAS
                     WVKIISAWVCYAIYLWTLIAPVVMPDRFGVY"
     exon            896469..896519
                     /number=1
     exon            896572..896651
                     /number=2
     exon            896722..897310
                     /number=3
     exon            897367..898092
                     /number=4
     CDS             join(898638..898670,898733..898829,898919..899005,
                     899114..900196,900668..901958,902146..902155)
                     /codon_start=1
                     /locus_tag="AO090026000318"
                     /note="DNA mismatch repair protein - MLH2/PMS1/Pms2
                     family"
                     /old_locus_tag="AO070304000050"
                     /protein_id="BAE59790.1"
                     /transl_table=1
                     /translation="MATIKAIEARSVHQIQSGQVIVDLCSVAKELVENSLDAGATSIE
                     VRFKNNGLDLIEVQDNGSGISPENYENVALKHYTSKLSSYEDLSRLQTFGFRGEALSS
                     LCALSEFHVVTAQANQAPKANRLDFEHSGKLKKTQIVAGQKGTTVSVEGLFKRLPVRR
                     RELEKNIKREYGKVLNLLHAYACVSKGVRFNVKNTVAKTRNVVVFSTNGNQTTKENIA
                     NVYGAKTLLALIPLDLTLEFEPSAAGKRAAVDEERESNKIFVRGHISRPVSGEGRQTP
                     DRQMFFVNSRPCGLPQIAKAFNEVYKSFNVSQSPFVFADFHMDTNAYDVNVSPDKRTI
                     LLHDAGALIESLKTSLTQLFESSDQTVPQSQVNNARQSTTKLQSGKLQDILTLKSSSG
                     GAEAAEDEGPEVDESQVNGRNRLNPQHRMRSFLSDLGSSPGARKRRIHTPSRPSIFGK
                     HMRGFAAPGAQVEHSASSEAEEEEDECEEEVEEEEAEDVEDEEEEIEDEEPGGGSRSH
                     VLSDQDSVQSHDEALPEAEVKDEPAMSQQDTAPVEKTLSDEEKKKHEEAEVQRLIRQA
                     EEKAALPQESNINRANKLNKGAAHRDSTVNLVSTIDGSLSRIQLQMDKLQERLRLHGS
                     NAVHSQDNEAENSLETAEERLSLTVSKDDFGKMRIAGQFNLGFILATRSSTGVSDSAP
                     PSSKDELFIIDQHASDEKFNFERLQAETVVQNQRLVQPKQLDLTAVEEEIVIENQSAL
                     EKNGFVVEVDDSGNEPIGRRCKLVSLPLSKEVVFGVRDLEELIVLLSEMPASSTAGPM
                     YVPRPSKVRKMFAMRACRSSIMIGKNLSQKQMTRVVRNMGTIDKPWNCPHGRPTMRHL
                     MSLGQWNENV"
     exon            898638..898670
                     /number=1
     exon            898733..898829
                     /number=2
     exon            898919..899005
                     /number=3
     exon            899114..900196
                     /number=4
     exon            900668..901958
                     /number=5
     exon            902146..902155
                     /number=6
     CDS             complement(903171..906881)
                     /codon_start=1
                     /locus_tag="AO090026000319"
                     /note="ankyrin"
                     /old_locus_tag="AO070304000049"
                     /protein_id="BAE59791.1"
                     /transl_table=1
                     /translation="MSDANPTVQAACASNSLESLKNAIPTASTEELNSALCDSCASGN
                     VSFAEALLECPRTDVNAVKDGMTALFIAVSHCYLDVVKLLVDHGADARLKSLAESTSS
                     SHSNTEPIFTPLHGFLRPRRERQKSDPLPSEIFPELLSLLLRAGCDLNARGPAGETVL
                     HQSVHLNLPYTKLLIESGADVNVVNDSGSTPLHLLDLQKSEDIFQLFLDRGAKLDVKR
                     VFDGRSPLQCFAAGGQLGDLSLFRPHVSSWGETDAKGDTLLHLAVRSHRSGSQTILEL
                     LKLGLRVDQRNLKGKLPLHMVDGPMEWFEEAVDILLAAGADIEGKDNQGFTLLAYTMQ
                     RAVDHERKITCLIKRGANVNTQDYKGNGVIHYKRGNGHRGIEALEFLLSIGIDPNMAN
                     YEGNTVLHRLVADFASFSDESEIYFIQKLLDAGLSPTQANFKGQTPLHLLCHQVSEYM
                     FLPTVAGDKRAIDLVLDAGLIRALEIADHDGIRPIHLAASCSETLVARLIDLGADTTA
                     VTGDGRNLLHIASTARQVNIVGLLLEHYTSINQLSLVNKRCKNGRPPLHDACRSGRLE
                     TVSLLLEFGADVNAEVEAKFSRGKTPLLVCCEYAKEEQRWPVHLELPALDGRVSAAGI
                     LSKDEKRPNLPQLMDKKSRNPIRRLEVTSENDTTNVTGVLRALVAHGATLTYEPSRMP
                     PMAEAVFSGSEELVSELGRLMKQHGLEPMRFPDFEHMYLTLTSRHLPDILGVCFSEFV
                     SDHTVARLLLLRQYNALAEGLEKHADAAHVQIALPGILVNLAKWGYTDLFKRLGDLMA
                     DPSWINGGVNRFKKRLMPYLLIAAERKVPNLDVIKVIVEHFKADINLQFQPGIEIRPN
                     LPFQSTIWLRRAYKPGESALHYFAKGGQWWHTKAVRYLLQHGADPNLQSTNGSTPLLN
                     AVHKSLSESHQRKEIIKILLEAGADPNIPSHNGCSPLSLATYDINIFRLLLENGASLE
                     NCISRVMFTTLDNLNLDMLSLLLERSIDCNTTTLQKEGNIWYTQRFHDDRNLTNFTLH
                     PLHYLSMPKFNESNTRDRAIKLIQYLLQQGADPFRACSDETTILHHIFEHGGTIQPFL
                     EIPDLDLERRDAQGRTLLLAASRCENLGTDSFAVMYPLLEPVPKYIRIVAYPEGDITR
                     AMTLYNRGADITAVDHAGNNTLHYLVAGSCDNFAGQKQYRQTVETFVRKAPKLLHQVN
                     KEGKTPVHIARSAEQKWALEAIRNAGVEIEEA"
     exon            complement(903171..906881)
                     /number=1
     CDS             join(907330..907878,907932..908454,908534..909102)
                     /codon_start=1
                     /locus_tag="AO090026000320"
                     /note="predicted protein"
                     /old_locus_tag="AO070304000048"
                     /protein_id="BAE59792.1"
                     /transl_table=1
                     /translation="MSQYKYSLLTPRPETIRMLRLLPSEDNTAQIQCQLVNYTLPTPG
                     TEDYPYEALSYVWGSENTPQYIIIDGQTLSVTENLYTALLYLRERQLERLLWIDAICI
                     NQGDEDEKAQQIQFMPMIYGQASQVIVWLGETADQSDKALETIRLAADDEPSEDKPTD
                     IQQEMNHTAIVRLLERPWFRRIWVLQEVHAAQDILLICGDVKIHGYTFSSGLKGLSLS
                     LKARPDLQSLVGSIVYLMRGAIFRPGTTSSRGTLSLGELVDMYHARAATKKHDKVYAL
                     LGMSSDSPLLPDYKLPWSTVFQQVITYIFSEKASIRIWPHRDLALIQSRGHILGQVIE
                     VKSDESQHDRTHSAHSEYYATTSAKPIQKGDIVCLLEGASKPSIIRPYKGYLSIIVTS
                     ATPLQEEEDVRWDEIAETLRSRHDPIRDMSLIWNWETSHTNPGKLQELEIPMESNDTT
                     PGILGLDSEETKRFDDLTLIVRDTLVKMDMGFAATRLLNYLQESKLPLSEKFDLAAAI
                     SRAWGYSAMKELGIDIIGETMPVAELDQEGTDLWDQIE"
     exon            907330..907878
                     /number=1
     exon            907932..908454
                     /number=2
     exon            908534..909102
                     /number=3
     CDS             complement(join(910189..910286,910343..911616,
                     911670..915281,915344..915642))
                     /codon_start=1
                     /locus_tag="AO090026000321"
                     /note="chitin synthase/hyaluronan synthase
                     (glycosyltransferases)"
                     /old_locus_tag="AO070304000047"
                     /protein_id="BAE59793.1"
                     /transl_table=1
                     /translation="MSNRYSVYSSHSAAFSTGGRAPQAGGQVSTTTLLNALHAHYTTG
                     QPYQLDAGTSLVVNTLLTATQSSPEGHTGPTIDHELAVRAWEHARRRAEDGCIVLCSA
                     HHSAPSILEPFLAALPLSTPSIAFTALAALRPFLTAVTTFNPSYSLYSALSACYNLTL
                     KGDITGLSLALSTSGINVRKGFLDIPSEPGYRAFDVFYYLLTSASTPAEREFLDLRDA
                     SSYALLRKSGTYTPPSYLPTADDAAAAEDFRSALKAIGIKGASQRGLLSVLAGLLKLG
                     NAAGFLVDQEDLEEACEDVGGLLGIDPEVLLHKCSTDDREVLISGIYEALVDWVIGKA
                     NEAIASQLQASLDDSSRGSGQAAQWTDDDTVSITVVDLPRPALGKAVAMRGIFDDTLG
                     INAEMKDDGVVVPPAGPAVLNDMTAAIAQVEVDLGITTGPTWREREYELDKKHEVLEK
                     VGLEVEMDSFLRQILFTAESEGITLGKKGRFDLATTLGSSRVWHHISIHPTDDLPENL
                     SPGVPTAAWSAGAVSRQLREWRLAEWANRRLKQIDFTADFDIEEFIGRYFRLGCGEGK
                     DGVENWLVERGWINGDAVVGHQRIWVRENAWWEAETMLDLKPEEPPAASPFMYGGGML
                     DPGVPHYAVPPIAESTSLLGSRDNLLNRQSTLVPSVAGGAKSIAPSAPHTLHTGGDYG
                     LGTKGDDKKYDSHPYYDDEGRYLGELDPEYADPKHIEKKEITLGRRIWTGFVWALTFW
                     IPSFVLRFVGRMKRPDVRMAWREKLVLVFLILLFNAIVCFYIIAFGNLLCPNKDKVWN
                     EKEVSYHQGNNDFYVSIHGKVYDISKFWKIQHSDTSIETTTSNMEPFMGENLDAYFPP
                     PLTRLCGDFVTDESITLRNNDTNAVLYSNAKHSCGPLQQTDPNTALHKITWYEDVFLP
                     KIDEYYKGSLVWKRSEVSKQADSSSRYWVIKDESIYDLTDYFYTLKQMNNIDSYNFLP
                     SSITELFKNYPGTDVTDKWPNSENATKAQTCLDYVFYKGKVDFRDSARCQVNNYILLA
                     FTCLICAVILVKFLAALQLGSKRRPAPQDKFVICLVPAYTEGEDSLRKGLDSLTALQY
                     DNKRKLIYVICDGMIVGGGNDRPTPKIVLDILGVDPKIDPPALPFKSIGQGSDQLNYG
                     KVYSGLYEYEGNVVPYIVVVKVGKESEQSKSKPGNRGKRDSQIQIMNFLNRVHHRAPM
                     SPLELEIFHQINNVIGVDPELYEYCLMVDADTSVREDSLNRLVAACANDARIAGICGE
                     TSLQNEERSWWTMIQVYEYYISHHLSKAFESLFGSVTCLPGCFCMYRLRTADKGRPLI
                     ISDKVIKEYADNDVDTLHKKNLLSLGEDRYLTTLMTKHFPTMSYKFIPDAYASTAAPE
                     TFSVLLSQRRRWINSTVHNLVELAALKDLCGFCCFSMRFVVLVDLLGTIILPATCVYL
                     GYLIYSVASGGPIPIISIAILAGVYGLQAIIFIVKRQWQHIGWMIIYICAYPIYSFVL
                     PMYSFWKQDDFSWGNTRVVLGEKGNKRVVAVEDEPFDPRSIPLQRWDDYALANNLPGR
                     RGDYNMSQEKFYGGQYGDMGMEMDDMHSQYSSVKPASTILTGFPGAGRNGSPYMPPQS
                     PAPFGGNTPGNRHSHLSSFSRYTDMPLQPGHQSRNLSVGNLSQFQDPSNRHSVGLMQS
                     TDNLLGVPRPNSRSPVGGYTSRPQSAFDFRGSGGPDEMAITDAIRSCLAEVDLDTVTK
                     KQVRALVEQRLQATLTGDKRAFLDRQIDQELANM"
     exon            complement(910189..910286)
                     /number=1
     exon            complement(910343..911616)
                     /number=2
     exon            complement(911670..915281)
                     /number=3
     exon            complement(915344..915642)
                     /number=4
     CDS             join(919288..919400,919461..919649,919711..924950,
                     925015..925046)
                     /codon_start=1
                     /locus_tag="AO090026000323"
                     /note="chitin synthase/hyaluronan synthase
                     (glycosyltransferases)"
                     /old_locus_tag="AO070304000045"
                     /protein_id="BAE59794.1"
                     /transl_table=1
                     /translation="MVGPSPAGTVPSHAQSSLPSLPAHLQSDTHLTAHLASRFHVGLP
                     TARLSSQALISLNTYTSSSKGPDGGKEGSAMGEAEDLARRAFTRLGARGENQAIVFLG
                     ESGAGKTTLRAHVLSSFLSFSSTPLSSKLSYASFIFDTLTTTKSLTTLTASKAGLFLE
                     LQYDGSSSVNPTLIGGKIIDHRLERSRIASVPTGERSFHVLYYLLAGTSAAEKSHLGF
                     DNSIHVSTNAGKLSSASIGHKRWRYLGHPTQLKVGINDAEGFQHFKTALRKLEFPRSE
                     IAEICQILAVILHIGQLDFASGQATLTSAEESGGYSHEGGETVTVVKNKDVLSSVAAF
                     LGLGVDELENSFSYRTKTIHRERVTVMLDPKGARQNADELARTIYSLLVAYILENVNQ
                     RICAAEDSVANTVSIVDFPGFSQACSTGSTLDQLLSNAATESLYNFCLQSFFDRKADM
                     LEREEVVVPATSYFDNTDAVRGLLKHGNGLLSILDDQTRRGRTEAQFAESLKKRFENK
                     NPAIVVGSSGSTHGTGYVSQQARSAFTVKHFAGEVDYSISGLLEENGEVISGDLMNLM
                     KSTRSDFVRELFGQEALQTVTHPKEKTAIMQAQVSSKPLRMPSMARRKASPASRLTFD
                     APTAEEPEDNESYGGSTAKSSGRRKSAMSMTGMQGAAGQFLSSLEIVNKCLSSPSLNP
                     YFIFCLKPNDRRIANQFDSKCVRAQVQTFGIAEISQRLRNADFSVFLPFEEFLGLAEV
                     GNVVVGSDKEKSEVVLDEKRWPGNEARVGSTGVFLSERCWADLAKVGERVVPVYHADG
                     SDEGGDGLLHPRTAGYGDSKVRLLNPADQSLGNFIYGDESKQGYFGSRDIDGRSDTGG
                     SGLNSGDMFHNLETREQMLEKGNEKKMEEVDEVPVSGSRKRWMAIVWLLTFYIPDFAI
                     RLFGRMKRKDVRTAWREKFAINLIIWFSCAVAIFFIVAFPGLVCPTQHVYSAAELESH
                     NGKNGHDSYIAIRGVVFDLDKFMPRHYPDIVPQSSLKKYAGMDATGLFPVQVSALCQG
                     KDGSIDPTVLLDYTPTNISGSATTISTGDLNAKYHDFRYYTNDSRPDWFAEQMKELRA
                     TYLKGYIGYTPQYISTLAKKSQNIGSIDGKVYDLTTYISGGRRVAAPTGKEVPANVDR
                     EFMDPLVVSLFQDLPGQDLSKHWEQLQIDAGMRDRMQMCLDNLFFVGKVDTRNSAQCQ
                     FARYFILAISILICAVVIFKFAAALQFGKKNVPENLDKFIICQVPAYTEDEESLRRAM
                     DSMARMQYDDKRKLLVVICDGMIIGQGNDRPTPRIVLDILGVPESVDPEPLSFESLGE
                     GMKQHNMGKIYSGLYEVQGHIVPFLVVVKVGKPSEVSRPGNRGKRDSQMVLMRFLNRV
                     HYNLPMSPMELEMYHQIRNIIGVNPTFYEFILQVDADTVVAPDSGTRFVASCLADTRI
                     IGICGETGLTNAKHSAVTMIQVYEYFISHNLIKAFESLFGSVTCLPGCFTMYRIRSAE
                     TAKPLFVSKEVVEAYSEIRVDTLHMKNLLHLGEDRYLTTLLLKHHPSFKTKFLFAAKA
                     WTIAPESFSVFLSQRRRWINSTVHNLIELIPLQQLCGFCCFSMRFIVFVDLLSTCIQP
                     VSLAYIIYLIVWLARDSSTIPWTSFVLIAAIYGLQALIFIFRRKWEMIGWMIVYLLAM
                     PIFSVALPFYSFWHMDDFSWGNTRVITGEKGRKVVISDEGKFDPASIPKKRWEEYQAE
                     LWEAQTSRDDRSEVSGFSYGTKSYHPAQSEYGFPGARPMSQFDLPRYGSRMSLAPSEM
                     MSRHMDMEMEDLSHLPSDDAILAEIREILRTADLMTVTKKSIKQELERRFGVNLDAKR
                     PYINSATEAVLSGAL"
     exon            919288..919400
                     /number=1
     exon            919461..919649
                     /number=2
     exon            919711..924950
                     /number=3
     exon            925015..925046
                     /number=4
     CDS             complement(join(925564..929103,929265..929687))
                     /codon_start=1
                     /locus_tag="AO090026000324"
                     /note="microtubule-associated protein dynactin
                     DCTN1/Glued"
                     /old_locus_tag="AO070304000044"
                     /protein_id="BAE59795.1"
                     /transl_table=1
                     /translation="MADLTPGHVVTLTDGRQATVRFAGATHFAAGDWIGIELDEPTGK
                     NDGAVQGERYFDCEFGYGMFVRPTAIAAIIGPPTKETKPAAKGTANAPQTRGRAQTGS
                     GLGIKKPSALQAANTKRHSGSSASPSPAAKPASQRLGLKGRPSIGAKSTSMGPPPPPS
                     ASRPSRPSISGASNRTVRPGLQGTTTAPAGVAKRPALRPTASKTSEEQERGSPQSEDI
                     DTADNYAEGDEMESEEPTAKPSRLASGSSRAGAARPGFSQTSSPRQAQSTALSRELEE
                     LKTKLRVMEKKRTEDREKLKALETLQQERDKFESIIQKLQAKYQPQQLEISDLRKKLR
                     ESEAQLEEIERIQAEHDSILEMATLDREMAEETADAFRHEVETLKLRVEELQLEAEVL
                     REENEELGQTMSPEEKSSHGWLQMERTNERLREALIRLRDMTQQQESELKDQIKELQQ
                     DLEEYESIKSQYESTKEKLLVAENNVEDLKQQLETALGAEEMIEELADKNMHYQEEIN
                     ELNAAIEDLEALKEINDELEYNHIETEKQMQEEIDYKDSLFNEQCRKVAQQDEVIEDL
                     EYTLARFRELVSTLQGDLEDMRASQQITEAEATDLTTRSRAMMDLNLKLQASVSKAQT
                     KTIDIELERLDAQEAAQHLSILKLYLPEYFEGEKNGILALLRFKRVSFKSSLMISTVR
                     ERFPEQTSDPAAVEDGFTAHDVLEKLMWIGAICDRFINYITNCSAESFDRTKATLFEM
                     EPVERTVNFWIESVRKNELNMKKCGIELQRSIALLSHLAEVHLPTSLETFADELCMRS
                     SLTQSYIDHAASLISRLRTLLQSKITVLEGEDEEPNFLFSKMETLVTQARGLKVAMGK
                     IYKALEDLRSRSLALSQDVAGPFKETEEAAKNLSELARHLGENIALIVSDESRTEPLT
                     LEEATKSMSQVSTLYAQPSESGSECSDTMSFIANRLRSLGGNLEELDSISTDLSITSE
                     FERLPSPWIARASELKSNKAVSPDADEEIRRLKNEIHEASTALGVKDKTIEEQALKVE
                     LVESRMQEASKKASMVKELETKIETMRTKETELEGMVEKQRKELQALETEREEIKARL
                     DRVKRASGTTGITTTEGVVVDNALSLATMRENEALRAEVESLQAAVRFLREENRRGNM
                     LDPYSVQRSAEMYSWLDVPLTQANGNAQHDKIQQTASESRDVFSHLLKLTKESNICDL
                     KSTMSQENGNRASWRPSKTKLRYQVLQQRENFEHWTEWRDDIVNQEREQDRLVNTKKE
                     RLARDRARRHAPKNSVFGGFPQGLGHGMMGRAWEILGMQQDHRKLADRPVEPSITPSF
                     "
     exon            complement(925564..929103)
                     /number=1
     exon            complement(929265..929687)
                     /number=2
     CDS             complement(join(930092..930258,930317..930815,
                     930975..931049))
                     /codon_start=1
                     /locus_tag="AO090026000325"
                     /note="haloacid dehalogenase-like hydrolase"
                     /old_locus_tag="AO070304000043"
                     /protein_id="BAE59796.1"
                     /transl_table=1
                     /translation="MSPSNDATSAGSDPRPVFFFDIDNCKLIREWYLQFTHMEAGLTK
                     YRSITDQFFVKHLSLNGEDAHMLHKKYYTEYGLAIEGLTRHHKIDPLQFNSEVDDALP
                     LDRILKPDPQLRKLLEDIDRSKVRLWLLTNAYVTHGKRVVKLLGVDDQFEGITFCDYG
                     QLPLVCKPTQEMYAKAEREANVPSTAERYFVDDSGLNCKHAAARGWQTAHLVEPGLPL
                     PDAPVSQYMIRNLEELRTCFPHLFKTSN"
     exon            complement(930092..930258)
                     /number=1
     exon            complement(930317..930815)
                     /number=2
     exon            complement(930975..931049)
                     /number=3
     CDS             931583..934063
                     /codon_start=1
                     /locus_tag="AO090026000326"
                     /note="predicted protein"
                     /old_locus_tag="AO070304000042"
                     /protein_id="BAE59797.1"
                     /transl_table=1
                     /translation="MTAAQLPTGSIPTGLPTNEEVQEYEKILKISDDIFTGTHPRLKV
                     PQQFVRKPASRNPPTSTQAQVKTSERPGSSTWNAPQTVSAPSKPASALSTNTGDGLSG
                     TTAPSRIVPKHTSEIDPIFLTKSDDLVRAELQLQRQRVERTLREQLEQKRQESRQKAS
                     IQDAKPDFDVSDVLNKAFEIVKPSPSVDGRGAGEPSDSENSFYSSRAPDSPQQGDQQK
                     PSPAPPSNSDEPVTEAPAENYSDELQRLEALNRTESDQDMQDTYPVADHGIPYQKQPR
                     PAAADSVAHKYQEAQPTDAFEEPEYSPPAPGVPPMERGENYDPQRGYPSGPRRRGPDA
                     RQPDRPRYAPGSNSPRDDIRVVRNHITSPAAPRPSRVSPLANAKVPSVYQHKEPRPVY
                     GTEHQASPDAPPQQLMPRKRRRLHEERDRSRAVAYRMQTGAPDGTYIKEEPVSPPPFT
                     DTSPAYRSRPAQERPIYIDIASPRYTPVIERREPPMRDTAYDVDAYDIRGDSGMPRTV
                     SRLSTRRPIRDDQDLRRVASLHQARQPEYPREYVDQASPHAMRASSYAVVERPPPRYY
                     DEIATPPARRYIAVGDSPTSPRYQETYYDEEPPSRMMAPPTRRIVVDEQGNQYYETVP
                     APRMQAMPPPTSRMPAPRSEVYDDHPPVRYTSVRAPSVVEDPYGGRRYVQDMPPPQST
                     YRRVTDYARPAPSEHRPYVAPFDEREPLPRSASVQVTDYSMRRPHYIEEAEVPRERIV
                     RVPSVRPPTARYEEPREVIQRVESVRPAGRDVSIYMDDDPRRPREYIERPVYLSTRPV
                     AREEHYYDNGEPERVVLDGGVHRVPHRY"
     exon            931583..934063
                     /number=1
     CDS             join(938645..939172,939245..939526,939658..940119,
                     940168..940492,940546..941972)
                     /codon_start=1
                     /locus_tag="AO090026000327"
                     /note="predicted protein"
                     /old_locus_tag="AO070304000041"
                     /protein_id="BAE59798.1"
                     /transl_table=1
                     /translation="MHKISNFTGQARHGWERMTPTFGMSRPHSDMASHSLRRPHGAPP
                     MTPPTGIDPTVNLSFNVPFSSTLGGPDVDDVLHASPGALQRWTFPEGTLEGTPVHNLP
                     VHTSNVEALRRLCRQITESSNGRIEAVVFGSEPKSVASLQRRPQGLVTNVCITGEGET
                     VRKMRARILNETPILLRCATVDVDMHLIMDGSTKGIRPSVLEHLDTLSAYTGTDIFLL
                     SPKLRDNDSAVVSSYGYASDNGLDQRFRVSIYGDMESAEHAKTRVLIMIDQILKRHVD
                     AMKLELTMHTLVCGRTRKNIKLIEAATGTAIYFPPPFPRIFGYTPPGAHRRSEDEVYI
                     TGDTQEQIARAKQKLRELVMGVKIYVKDVIVNSNKIDNILLDRLDKVRKVMEMNGSYV
                     LFPQLGSQRGLVRIQGTEVLHVERTVREIMALAGQFYSASWWIIMPDPSQGTFRAPSP
                     ADVRTMLSDICTNSAAEVSFDNLTFTINGSDDAVKAAMMVVNQIPFVQRSQYQMRVKI
                     ELANEHKEFVSGKKNGKINKIMGQSNVQIIFDGFNEYNFYIDVCGNQYESTKNGLDLV
                     EQEMPASISFHVPDQYHKRIIGIGGQHIQRIMKKYSVFVKFSNAMDRGGMGKEDDDIK
                     VDNVICRTPARNAQSLDLVKQEIMDMVEKVDAEYVSERVVINRLYHRELLARMTEIDE
                     LEKKWNCKIEFPSTELASDVVTISGPEYQVPQAVDALLGMVPESHELLFQSSHELREY
                     FKSVEFRSDVCAKLKEQYEVDTTVDLSADFPSSETSSTGSVSPTLPPEDRVVLGYTRN
                     NAGGLKDAIDFLISRLVAHGLDANTVKGAIPRPKSDSFEESLPFFDSKLLQHAPVPLV
                     TDSPTRPNFSDETSERGSIFERLRKPGSISSFSSFIGRKNHSASPGSFFKHASSNASK
                     ASLVSMESRDSGYRNPWNDSGVNLPEDDLPVLGSSHSHSSSNGWPARFDTKFPFGTAP
                     GDMTPKHDPRASFDSGRPSTSNSTSGYPAPIGPPR"
     exon            938645..939172
                     /number=1
     exon            939245..939526
                     /number=2
     exon            939658..940119
                     /number=3
     exon            940168..940492
                     /number=4
     exon            940546..941972
                     /number=5
     CDS             945742..946602
                     /codon_start=1
                     /locus_tag="AO090026000329"
                     /note="predicted protein"
                     /old_locus_tag="AO070304000039"
                     /protein_id="BAE59799.1"
                     /transl_table=1
                     /translation="MSGLTTSPPGSIPASPSSVNQVSRSSRPALTLDLSNLPTMSQPT
                     KPTNTLIITELSNILIFQPASLATLRAQLESIAPLNSFSPLPSLRRLICSFYTEEDAL
                     SVRKLLDGQLLEHNVRPRVYFGEPTPILDEESRRPKLLEAPHADKLFFISPPPSPPHG
                     WVMRNEEPPNKEVHASDLATALAKLKTEQSGVYEGISQTCEPGTPMSMTSDKRTGSWP
                     ASMSGQRSRSSTLIYHPEDHGGSPNLPAVMVEDTSIMVDDLEMDMSPIEMPIRKAPPK
                     TSRPPVELMC"
     exon            945742..946602
                     /number=1
     CDS             complement(join(946953..947078,947143..947411,
                     947465..947530,947595..947692,947743..947976,
                     948026..948354,948430..948458,948557..948658,
                     948733..948777,948843..948894))
                     /codon_start=1
                     /locus_tag="AO090026000330"
                     /note="Arginyl-tRNA-protein transferase"
                     /old_locus_tag="AO070304000038"
                     /protein_id="BAE59800.1"
                     /transl_table=1
                     /translation="MHACTPFSFIAAAVGSIGYQRNSCGYCKSDNGSPSNMYPLQARR
                     TILALYQYVPPIMRNSSTVGGDEIMLSALYDEPSSRERTNAKRSIAGTNSSWDRNTSE
                     GQLICAQKHGSESIDYDPNMRTGLTSNIFREKRHRKCNFDLLTAVHEAEYSNVKRPID
                     PKTKRYLEPAHRFEVNIEGDSVSQAKYELFLKYQTKVHKEDVSTWQQKDFKRFLCSGL
                     KRSPADPKSTEKKLGSWHQCYRLDGKLIAVAVLDLMPSGVSSVYIFYDPDYEQWEFGK
                     LSALREIALSIEGSYQYYYMGYYIHSCQKMRYKGSFKPQYILDPESYTWDPLDGELAK
                     KLDERPYVSLSRDRRLAAEGTPESAGTEADAEINDDEVSLFDLRMPGVLSLEEVEPLD
                     LDHWLLLVHGSFVHMIDLVGWETMPMDNPQSVKGIIAELAAVLGPKIVKESAVVLFD"
     exon            complement(946953..947078)
                     /number=1
     exon            complement(947143..947411)
                     /number=2
     exon            complement(947465..947530)
                     /number=3
     exon            complement(947595..947692)
                     /number=4
     exon            complement(947743..947976)
                     /number=5
     exon            complement(948026..948354)
                     /number=6
     exon            complement(948430..948458)
                     /number=7
     exon            complement(948557..948658)
                     /number=8
     exon            complement(948733..948777)
                     /number=9
     exon            complement(948843..948894)
                     /number=10
     CDS             join(953240..953291,953439..953866)
                     /codon_start=1
                     /locus_tag="AO090026000332"
                     /note="diadenosine and diphosphoinositol polyphosphate
                     phosphohydrolase"
                     /old_locus_tag="AO070304000036"
                     /protein_id="BAE59801.1"
                     /transl_table=1
                     /translation="MVDQTRSMESRTGRKNQRYGSKGERLVAGVVPLSTDKSQVLMIQ
                     SAGRGGWVLPKGGWETDEETAQQAACREAWEEGGIICTVLRDLGMIPDMRPSTLLTSH
                     APKASYQFFEVIVDREEAQWPEMHKRKRQWVSYAQAAAALASRPELLEALNRSSMKR"
     exon            953240..953291
                     /number=1
     exon            953439..953866
                     /number=2
     CDS             join(954975..955028,955111..955679,955748..956128,
                     956454..956478)
                     /codon_start=1
                     /locus_tag="AO090026000333"
                     /note="RNA polymerase II, subunit POLR2C/RPB3"
                     /old_locus_tag="AO070304000035"
                     /protein_id="BAE59802.1"
                     /transl_table=1
                     /translation="MDYEMDIEPTGPQVTVREAEPYRVDFKLSSVDLAFANSLRRAML
                     AEVPTIAIDLVEVEKNTSVLPDEFLAHRLGLIPLNSKNCDQDVEYTRDCECEDHCARC
                     SVTLTLHARCTGDDIMRVYARDLVVSGERANEWVGNPVITDPEGNGPLICKLRRGQEL
                     KMTCIAKKGIAKEHAKWMPTAAVGFEYDPHNNLKHVDYWYEEDPIKEWPVSHNAAWEH
                     AAPPDQPFDYDAQPNNFYIDVESVGVLEPDMIIQQGITVLQRKLASVISALSGTGDGD
                     HNGVMGGEDEDMMGVRSPDAYEPPEGIDGGFTAYANGGASAWGASAATPYGATPYGGG
                     GSNRSYGA"
     exon            954975..955028
                     /number=1
     exon            955111..955679
                     /number=2
     exon            955748..956128
                     /number=3
     exon            956454..956478
                     /number=4
     CDS             join(957343..957478,957716..957768,957837..958541)
                     /codon_start=1
                     /locus_tag="AO090026000334"
                     /note="mitochondrial oxoglutarate/malate carrier proteins"
                     /old_locus_tag="AO070304000034"
                     /protein_id="BAE59803.1"
                     /transl_table=1
                     /translation="MASSAKLEVSQPPRAAVPVKKVHYPFWFGGSASCFAAAVTHPLD
                     LGTFGHVIKSDGILGLYRGLSAALLRQMTYSTTRFGIYEELKSRFTSPDAPASTLTLV
                     GMACTSGFLGGIAGNPADVMNVRMQSDAALPVEQRRNYRHAFHGLVQMTRHEGPASLF
                     RGVWPNSTRAVLMTASQLASYDTFKRLCIDRFGMSDNLGTHFTASFLAGFVATTVCSP
                     VDVIKTRVMTASPAESRGHSIVGLLRDITRKEGFAWAFRGWVPSFIRLGPHTIATFIF
                     LEEHKKLYRLLKGVSEEKHTA"
     exon            957343..957478
                     /number=1
     exon            957716..957768
                     /number=2
     exon            957837..958541
                     /number=3
     CDS             complement(join(961140..961280,961336..961656))
                     /codon_start=1
                     /locus_tag="AO090026000336"
                     /note="predicted protein"
                     /old_locus_tag="AO070304000032"
                     /protein_id="BAE59804.1"
                     /transl_table=1
                     /translation="MSEAARLKCTVYVGGLDQAVTVQTLAEAFVPFGEVVDITLPKPD
                     VPNSNELHRGFGYVEFEVPEDAKEAIDNMDGSELYGRTIKVAAAKPQKDSNEGLGSKT
                     AIWEQEGYLAKYAVDEEDKLAAEQAQAATNDRPHDPMQGLEELDVAGPKPE"
     exon            complement(961140..961280)
                     /number=1
     exon            complement(961336..961656)
                     /number=2
     CDS             join(962145..962353,962417..962533,962592..962721,
                     962761..963024,963048..963134,963194..965918,
                     965967..966265,966325..966369)
                     /codon_start=1
                     /locus_tag="AO090026000337"
                     /note="vesicle coat complex COPII, subunit SEC31"
                     /old_locus_tag="AO070304000031"
                     /protein_id="BAE59805.1"
                     /transl_table=1
                     /translation="MVRLREIPRTATFAWSPGAASPLIATGTRAGAVDVDFSNETCLE
                     LWDLGLDRQSTGEELQPIAKFDTDSGFNDLAWTPSEDNTRGIIAGALESGSLDLWDAD
                     KLINGSSDDAVISRTSKHSGAIKALQFNPRHSNLLATGGAKGEVFDQIRILYISDLNN
                     VANPYRLGTAARADDIECLDWNKKVAHILVTGSSAGFVTVWDVKTKKESLTLNNMGRK
                     AVSAVAWDPEKVRCFCPSPWNLPTKLVTATPLESDPMIYVWDLRNSHAPERVLKGHES
                     GVLSLSWCSHDPDLLLSSGKDNRTLCWNPQTGHAYGEFPVVTNWTFQTRWNPHNPNFF
                     ATASFDGKIAVQTVQNTSTDTAQAIADQNQALDGEDFFAKAQTQPQVSSFSLPKAPKW
                     LERPCGATFGFGGRVVSVNLVEKGQRASKIKITPFEVDEAVGQSTETFENALKEGDLR
                     SICETRAANAATEEEKADWKVIQALISENPRKGLAEYLGFQDQSADEAADKLANLGLG
                     KEETNGESPKESRGPGAKKHKRLQSMFDASPEADNFLSDLAASKGAKTNNPFHIFNGS
                     ETEADKGITRALLLGDFEKALDVSLKEDRLSDAFMIAICGGQKCIAKAQEHYFSKQTE
                     SPNYVRLLASIVGKNLWDVVYNADLSNWKEVMAALCTFAEEKEFADLCDALGDRLEEQ
                     IRASDDKSLRKDASFCFLAGSKLEKVVAIWIEELRENEQKALETAANDTSFSIHVRAL
                     QGLIEKVTIFRQVTKFQDTERTKESDWKLSNLYDKYIEYADVVATHGRLQVAQKYLDL
                     VPEKHPEAEVARNRIKLATRQPTAQKTQQTTTGRGTPLNKPLPTTNAYQPQRTFSPVA
                     TAAAPSPYAPPAPTTNAYAPPAAATNPYAPPAAATNPYAPPAPASNPYAPPGAAAPPQ
                     PTNPYAPASGGSYAPTGYQPTPAPSYGAKPLGGSVPPPPRASNQSPATVTTYTTATNL
                     PAWNDLPEGFAKAPTPRRGTPAGAAAPISSPFPNQSPSIAQGPPPPGAPPTQRTPSVP
                     PPPKGTAPPPRVTSPPSAIPPGPTPPPNPYASLPQSPPQLNPGTMGVPAPIPRGPSPY
                     NAPPSMPPPTNRYAPSPAAQAANPQLQARGPVPPPPQAAASPYAPQPPAASQYAPSTP
                     PLQQGPPPASTSRPGTASSQKVTPAPATPKYPPGDRSHIPEDAMPIYEILSADMQRIK
                     GRAPTSFKQQVEDADRRLNLLFDHLNNGDLLKPNTVSDMADLARAIQARDYEAARAIH
                     VDILTNRTDECGQWMVGVKRLISMSKATP"
     exon            962145..962353
                     /number=1
     exon            962417..962533
                     /number=2
     exon            962592..962721
                     /number=3
     exon            962761..963024
                     /number=4
     exon            963048..963134
                     /number=5
     exon            963194..965918
                     /number=6
     exon            965967..966265
                     /number=7
     exon            966325..966369
                     /number=8
     CDS             complement(967741..968970)
                     /codon_start=1
                     /locus_tag="AO090026000338"
                     /note="predicted protein"
                     /old_locus_tag="AO070304000030"
                     /protein_id="BAE59806.1"
                     /transl_table=1
                     /translation="MAETKPKTPSIPQWQQPSATNSASASPPSSDDTSRSDLLQQATK
                     FLEDESLRDAPLDRKVSFLESKGLRQDEIDGLLGVSRNSEATSSTAATEGDNKTTESS
                     TPDDTPSGSTSSSPSTSTSQSSSSPATTINNRQSSSARDVPPIITYPEFLVNQPKPPP
                     LVSFRSLLYTVYGAAGLGAGIYGASEYLVKPMLANLTSARHELAETAKDNLKKLNEKL
                     EQNVSTIPPQLTARRAQSTGFSSDDETESVTSDPGELFHRDVAVQTTEDFNLEKSSSL
                     AANTADTESFDPSAAVNTHVKRLEVIRSSLQEFSEIDKQSSTCDDTVRSSLNELHHYL
                     DGLLYSKAGYGPGTGYGVYSTPGFDSSGNAAGLGKGEEDAISNFKSEIRGVKGALLSA
                     RNFPASRGPRISSGISR"
     exon            complement(967741..968970)
                     /number=1
     CDS             join(970245..971025,971084..971190,971288..971554)
                     /codon_start=1
                     /locus_tag="AO090026000339"
                     /note="predicted protein"
                     /old_locus_tag="AO070304000029"
                     /protein_id="BAE59807.1"
                     /transl_table=1
                     /translation="MSLRRSLRSRPVRDDPPDLDSNASPRTPTRVTRAVASSSVSVFR
                     SPSDSPEESRRSIRLTVKMPSSKLREVTSSSTRNGATRRSVNVFTENPIVTGPRTSRP
                     KKKLVEVDTSDEDLDDQEEDEVDDEDAPGEDDEDADADGDLDMDDAPPQPPVSKRHAK
                     SAASTSKAVKSVEAKEMELDAEDDEDDEELSDPESDAEGEPDDQEESGIGNANGGEED
                     LDEDEEDEEELDSDDDTPTADPARMTKRQRGNLGNDFLQLPMEPQVKKHLTAEERAMR
                     RAEMARRRKNLSEKRNEEEKMDTINRLLRKQAPKRRGRIPAAEAAETASAEQQMQEFE
                     RLDPTMVRWISGREGSKMIVSEEWLGTPAGRVFAEPPLESTGPRKLVEEV"
     exon            970245..971025
                     /number=1
     exon            971084..971190
                     /number=2
     exon            971288..971554
                     /number=3
     CDS             972974..979714
                     /codon_start=1
                     /locus_tag="AO090026000340"
                     /note="predicted protein"
                     /old_locus_tag="AO070304000028"
                     /protein_id="BAE59808.1"
                     /transl_table=1
                     /translation="MESWRERGFVPDSDEDDGLGSPEKVNQDLESSDDELGASPTPDT
                     LDTTRQGPQDEDTEEEEHHGPQSGIVSDLRPVTSSQDLDDVSVQANEEAKSTAKEVPD
                     KEARNIAEGPLSEDGDVTRRRKPHPSPTLSATPRPSPRPSPPATPLREQPKDIWDVPS
                     SSPDELQLDHLISRRSVGLTSKVPDTGEQQENNENADPSPLSSPLSSLHSLALGENDQ
                     DDQENTENPPPESNVEALLPPLEIPEDILREMSQPARRSLRQRNPIQLHPYLLEDAKY
                     QTLMKARGIKPVRIAQYQQAMRAAAEGQSQSFDSTLPPSSSPTAEFEYAPSSPAERNS
                     TSAARATQDLHGGQPQSPNQNLSENEIRGPKRRKVLRPDDHRNSSRHQSRPKVVINNR
                     TSPINLNNSLAWDIPPSPPRSGSNSSPQAPWNPTEFRFPRGFTPPTLNTPSTVRRRRG
                     QDATTTGNGPVDRELADARSIASHHSHSASENDGEDEEDEGEEPEEDVREFQRRIKGV
                     LPASWLRLDQQRQKDTQLSSTQRHRDKNSRTENAKGVAKKITKRTGPSTSSNPVEHLA
                     SLWHLADSDGSDADEDDDNDGQSNARQILANLVGFDDSFLAEDMGEDIPEDNRIDYMF
                     PSATRETSAPRSQKGGQKRQRPESHFTRSDSHAKRPRLQKQARLTDPIYRREKKRQSS
                     RTPPKLGILDAPDVASRPRNEQPQFLRVAARKARSRQDRGRRSPSNKVIKMSSALDTE
                     DANTSLREWRAGRIRQSKLPRPHAKPPRRPPLADLSSNMKIGAGNHVSGEINKDHPII
                     AGPATQQGDTNVVQSQMPAPEAPPPTTAPPISEKPMQRIQYGNNWFVRRNVVVSSLKR
                     NDPRPVGLEMASLNVSRAPSFQRSLSLLNQNTWQKRLPDTVDRNIILNRFLVDSGQAS
                     VHAKARGSTFTRESNDASVSLPKRPVQIKRKLKKRIPMRLDVSTTEGTNQLILSTDLD
                     PPRAQGKDAHPSKGVSDGLSGFQRSYSTDFSITPLCLGTFFHESSFIGSGEFNRSLEI
                     GKRDLDQNAGIFTANVRGRTFRWGPWNDAVSSELGIAFDDMLEEMEKSDTMSTEAATD
                     NAPNLTYTIYRTLVKYITEALTFIDPIDRTGFITRAHALISKVNDNLTSMVSPTGRGT
                     EYRTRIASYNVVFANLTYQVACHTLVNDSVTEEVLELMRSASRQAFAVISSEVGKINI
                     RKFLGNNKVCEQRDKGVRDEYPAVEAYIIVRQVLYSTETLKGFFEELIADSLLAISDQ
                     SNTKNIDRLESGWHWLFTTLPLGEIDALGIARIGSRFSETCNNWKIVKQLLCPVLESY
                     EPNTSASISYNTYCRALFHRCFHLINGWGWRDCKLILDTLYDFFARNTLYNLKQEENY
                     TSPSFLDELDHNPSLDVTPSDPCFHIFLKIIASGLRSLSKRYDKKKVRNFAWRLLPNH
                     GRVYPKEQPIHQADLDALRNHHDLLCTLYFAVPDGCRPRLEAIKNLVHPANSHRETCN
                     ISIRSWARLVRFKLSTDEDVSGLEAFADWHSYFVSEFIKQHMLARREIEAQNTKDNQF
                     SHQLIERTISQNQRQIESLLKTALNSLQNAIQSAPTLEHAHRLISKSPISVVLGLFDP
                     RLARVNTTVSEALQLLKAYVQKCSSASATGSANPPAPVDEDSQEYGDWADIEAMYGDE
                     FSLATHPQGIEYMEKVLHPAVSQLVSNSFGEDHCPEDAILLNVVDCWTSIAQVLVKNG
                     FRHWDNYLSLYDGDSWAVLRKTAQTRKFTPKFLASCIEKDARFMCECKMQVLGMWMSS
                     LVERVSMLKFQHSLTEALLNCDSNNTLLQNLPFSADRKDGRYSITLEQLSQRRLSLIS
                     SLLSNMRAHVQDLEITASRALSTEKQEYRELIQTMMSSMKANYQELGSSAASAQGAYV
                     DFVHRVVGFLQQHTRDICPVDPFFTDPTSFPLPSTDPTYIVARLKGYEPKLSSEKVAK
                     TLIMFVQGISERAAIDGQQVYLVDQLQTSIAHTYEAGDPVKPTLRATLLQSVFPAYLQ
                     TAFSNPGAWLLSQPIIQTISHTFKELLFHIDATDTDCVASVVGIFGSVFQSSYHALHS
                     IVDNANMLKEPPVVITVASFIEMITSSLRVVDYIDRSTDVGDNIISQIHAFRQFILFS
                     TSFLHDQLLIIDPENIPHPSNIFTTENTPTNAPKFFQEIRISATRELRTYINESWSRH
                     QGKYYFTRRGGHHPQEVNLEPSMAANLENFPLAILDDAARNFLDTLRALDSFDTFH"
     exon            972974..979714
                     /number=1
     CDS             complement(980300..981520)
                     /codon_start=1
                     /locus_tag="AO090026000341"
                     /note="predicted protein"
                     /old_locus_tag="AO070304000027"
                     /protein_id="BAE59809.1"
                     /transl_table=1
                     /translation="MATEARDSAIREAKLYVREIVRNDWTFHPSTDAGAPASATPTPP
                     EQEVTAWRLRTYDSSASELEPLSSPTIASPPSGYDSAQIESPILSPEGDERTERRRKR
                     RRQMEEEMRWNEGLRTWVERRDAWTCAKSREEIIARRQLKQAQAQAEGTIINEDQGAS
                     SGSAFSRPASSSSRDEENLAAKTEASLSVAEKEESGPSSVSAQPQQGEDHKESTETGA
                     TEPEIALQQTATDDATGTVANATTPAPAPATAAATATASSKAHQGSEDPYVPVVPSLI
                     STSNPIRASITPAMYPSIYSKVVVQGLTPTVPINLADVTKAMVQGWKADGQWPPKPAT
                     TNLVLQDTATVPKTAEDGQPSSPESKRRSGVVGAVRKVLHFSGFHPHPFHRRSSHSAQ
                     GDVSGAVNTETAGK"
     exon            complement(980300..981520)
                     /number=1
     CDS             complement(982101..984965)
                     /codon_start=1
                     /locus_tag="AO090026000342"
                     /note="AAA+-type ATPase"
                     /old_locus_tag="AO070304000026"
                     /protein_id="BAE59810.1"
                     /transl_table=1
                     /translation="MQRGRLLSSVARPCRFIARRRYPAVVCSTPRRFHLSRGWQSSAP
                     PDPEDARSSSPASVTSDIPTLNAEHTVPGHDASSIASPSAERAGKKESSPYGSAVRRA
                     LRNRKSLKEWAAPAATIPCWFYERNTVANGGESHAASDFPQQVKISKPEPETVRETTD
                     GMAHGGSGDGEPSESSGVPDTGERYALTEALWEELCASAKAGLRLPPAKYAKEPSARK
                     SHLVLQYPGADGILFLDAVVKRLAQELGADVVTLNAQDIAQLCSEQDLEDVGTTSPIR
                     SLGYDVYRPTAPEPWQDDSMGEGDDEAEVEISPRSLRSGLKGPRFITIESSREAGDIP
                     LPGILGLKSLVSAFNGPVDGSGASSNPTDRAEDRRLQLINELISSASGPKRKSTTEVS
                     LDKPTESRASENKPPVRDVIVQIQDYGEIQATREGARFIYLLQKAIQDRRRDGSRVLF
                     VGTASQDAASESDASRLMQNAFDDQFSQMLVITPAMGLEAAEKIFTDDRKRRTLDINI
                     RHIQDMLRTRLDNTSTLEDDIFRNRAWPLDASVVKESGLDERYWPYSQVHWATTLALG
                     SLGSDELFGFQHIQKGIEMMQRTDRIKNDWMQEKAPKTKHTETGNDRERLLSSLRKTC
                     NSHEKKLLNGVVDAKSIRTTFSDVHVPPETIDALKTLTSLSLIRPEAFTYGVLATDKI
                     PGLLLYGPPGTGKTLLAKAVARESGATVLEVSGSEVYDMYVGEGEKNVKAIFTLAKKL
                     SPCVVFIDEADAIFCSRTGASSRTSHRELINQFLREWDGMNDLSAFIMVATNRPFDLD
                     DAVLRRLPRRLLVDLPLEQDRLAILKIHLKEENLDSSVDLAELARRTQLYSGSDLKNL
                     SVAAALACVREENDLAAQHQGDEPYQYPERRTLTWKHFERGMEEISASISEDMSSLSA
                     IRKFDEQYGDRKSRRKKSPGWGFTPASTEEASSDAARVRT"
     exon            complement(982101..984965)
                     /number=1
     tRNA            complement(988138..988226)
                     /locus_tag="AO090026t00005"
                     /note="tRNAscan-SE"
                     /product="tRNA-Asp"
     CDS             join(991172..991478,991597..992510,992571..992858,
                     992913..993179,993236..993769)
                     /codon_start=1
                     /locus_tag="AO090026000343"
                     /note="predicted protein"
                     /old_locus_tag="AO070304000025"
                     /protein_id="BAE59811.1"
                     /transl_table=1
                     /translation="MMMAQPFPAHQGIPQHPGIPPGHPLAPGQHPNAHPGAGMVQQVH
                     PGVSAPGGPQVTQGGPMMGGMPPGAGTTAPGGPVQAHALSHLNPAQAHLFQQPHFAQQ
                     FANNPQLMHQQQQQQLLRQRMLFQQQQQQQQQRHGGLPVSMPNGTQPLNAAQLAAMQN
                     PGMRPVISQMQLQQMPHGQPQNIQQQQHFLAMQAQQAQQAQQQQAQQAHQAQQQVQQQ
                     TPQPGQQTPQQRPAPQPQNVHDAQSVTPQPQPMPPPHQGSATPQPTPQQHLPTSQPPQ
                     QPAVPQPQPTPNPPPQQLPQSQQPGQQGQQGQQQQPQQPQQQTQQQPQQPPQPQQPQS
                     QPQPQPQQGQQGQQQGQQQQQGQQQQGPPMTAQEAQLKAQQQQNAMMMQQRMNMKGAT
                     ILCLNTFAEQLSNFTSRGEAHDLLYWQSFVDKFYSPSGVLRQGVWNPQTGSKQFEIAT
                     PALARYYLTQFTSGIRHIQMVVENARERDSPNGGHIVESQKTSFIYWFVNDTQIFTNG
                     KLRAHFDMNNKIEMLDIEVTSYTEYLPRSQLQALEAADQKQSPKVSKNMGKRAQQKQA
                     QQPAFTLPESMVTANGVPFAVMSFLEVAETISQMQLLFQYSQQNPQLSAPEALRNLVN
                     SLPTQTPTPGFMPAPMNPAMQPGQNPRGPNMNVPNQFASPAMAHLGLPGAQGSPHLGG
                     SAHPSPAQSHLAGPPGMVPQGQMQPNVGQGTSASASPNVSHKRRRASTVKMENDDGAP
                     EVNGTAPPGPKTVKASPRVGGKRQKGTAN"
     exon            991172..991478
                     /number=1
     exon            991597..992510
                     /number=2
     exon            992571..992858
                     /number=3
     exon            992913..993179
                     /number=4
     exon            993236..993769
                     /number=5
     CDS             join(994902..995074,995167..995226,995377..995920)
                     /codon_start=1
                     /locus_tag="AO090026000344"
                     /note="Ni2+-binding GTPase involved in regulation of
                     expression and maturation of urease and hydrogenase"
                     /old_locus_tag="AO070304000024"
                     /protein_id="BAE59812.1"
                     /transl_table=1
                     /translation="MSHSHSHDQGISHSHDDFGGHGHSHEILDGPGSYVNREMPLIEG
                     RDWRDRAFTIGIGGPVGSGKTALMLALCQALRDDEDAEFLNRHKALASKRIRAIETGG
                     CPHAAVREDISANLLALQSLHKQFQTDLLLIESGGDNLAANYSRELADFIIYVIDVAG
                     GDKVPRKGGPGITGSDLLVVNKCDLAHIVGADLDVMDRDARKMREGGPTVFAEVKNGK
                     NVQNIIDLIISAWKGSGAYELSLERWNAGATRGSGSVDEQ"
     exon            994902..995074
                     /number=1
     exon            995167..995226
                     /number=2
     exon            995377..995920
                     /number=3
     CDS             complement(join(996206..997180,997239..997874))
                     /codon_start=1
                     /locus_tag="AO090026000345"
                     /note="WD40-repeat-containing subunit of the 18S rRNA
                     processing complex"
                     /old_locus_tag="AO070304000023"
                     /protein_id="BAE59813.1"
                     /transl_table=1
                     /translation="MADNPSTKAVAPANKKRKESKALIEARQKYGRGKAIPMQTVRDK
                     KLRANLRAVENKFKQAALKAKDAEILLEHEAGFLEPETELERTYKVRQDDIKEGVGIE
                     TAKKGFELRLNDFGPYRADYTRNGRDLLLAGRKGHVATMDWRSGRLGCELNLGETVRD
                     ARWLHNNQFFAVAQKKYVYIYDQAGTEIHCLSKHLEPLFLEFLPYHFLLASAQMSGHL
                     KYTDTSTGQMVAELPTRMGAPTSLAQNPWNAIIHVGHQNGTVSLWSPNSQTALVKALV
                     HRGPVRSMAMDRSGRYMVSTGQDMKMNVWDIRMYREVHSYSCYQPGASVAISDRGLTA
                     VGWGTQVSVWRGLFDAAAADQGKVKSPYMAWGGDGQRIENVRWCPFEDVLGVTHDQGF
                     ASIIVPGAGEPNFDALEANPYENKRQRQEAEVQGLLNKLQPDMISLDPTFIGKLDTIS
                     DKKNREERDLDRRPEDVMEKLKNRGRGRNSALRKYLRKKGRRNVIDDKIVKAEMLRKE
                     HQARARDKLRTEREDLGPALARFAKKEI"
     exon            complement(996206..997180)
                     /number=1
     exon            complement(997239..997874)
                     /number=2
     CDS             join(998271..998364,998432..998901,998954..1000774)
                     /codon_start=1
                     /locus_tag="AO090026000346"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070304000022"
                     /protein_id="BAE59814.1"
                     /transl_table=1
                     /translation="MQHHHRSTTKTSHKPFKTKHASKGALKEKAKGKVERGERGTRKT
                     PHQQLMSKLDRRNQARQKQQVKHQEKAQATSIFSGQSGAPRHVAIVPLSADIDVAAII
                     RSLNESVDVSCEVSHDTISRVRIDRFRQSVQYIPAKFDLMNALDVCRMADFVVVALSS
                     EVEVQEQGELILRSIEGQGISNVLAVVQGLDKINPPKKRPQVASSLKSFINHFFPSVE
                     KVLSVDSRQECSNAIRSLCTATPKGIRWRDERSWMLIENVAWPETNSEVVDDVVVTGV
                     VRGRGLKADRLVHIPGWGDFQIDSITAAPLPQARGKRDDAMNVDESESSQVLDTPTED
                     IDDLAVVAPEEIEMEDDDMEIPEEERRGVLLDEHHYFSDDDSHIPAKPKKLPKGTSEY
                     QSAWFLDDVSVSGSDLSDGEDEEMAMDTAGAPEDGIFPDNHDAMTEAGATEYPQSEMF
                     VDPSPEDEERELEEYRASRRKEAKEDLEFPDEIELHPNVLARERLARFRGLKNFKTSP
                     WETREDRPHEPEDWRRLLQIIDYKGTKNRTVREALIGGVNPGIRVDVHLRAVSTSLRN
                     KPQPLCLFSLLRHEHKNTVVNVNMTLTSNIEEPLKSKEELIVQCGPRRLVVNPIFSSN
                     DNTPNNVHKFDRFLHPGRSAIATWIGPLTWGAVPVLVFKNKTVQDPEVMDGDEQPDVE
                     QLELIATGTVVAPDTSRVVAKRAILTGHPYKIHKRVVTVRYMFFNPEDISWFKALQLW
                     TRRGRSGFIKESLGTHGYFKATFDAKINPQDSIGISLYKRVFPRKARALEEVTA"
     exon            998271..998364
                     /number=1
     exon            998432..998901
                     /number=2
     exon            998954..1000774
                     /number=3
     CDS             complement(join(1001227..1001466,1001521..1001695,
                     1001756..1002062,1002142..1002265,1002329..1002361))
                     /codon_start=1
                     /locus_tag="AO090026000347"
                     /note="protein required for fusion of vesicles in
                     vesicular transport, alpha-SNAP"
                     /old_locus_tag="AO070304000021"
                     /protein_id="BAE59815.1"
                     /transl_table=1
                     /translation="MAQDPRVLLQKADKALQGASSGFSFFGGRSEKYENAADLYTQAG
                     NAFRVQKQNKEAGLAFEKAASIQTQNLNEPDDAANSLQEAFKVYRKSDPEDAARVLSS
                     AIQHYVLKGNFRRAATQQQYLAEVYEVELGDQKKALEAYEKAAEWFDSDNAEALANKH
                     YLKAADLAALEGDYYKAIEHYERIGRSSISNNLMKWSVKDYFLKAGICHLATNDLVAT
                     NRALENYRDIDNTFVSTREHQLLIDLVQTIEQGDQEAFADKLYQFDQLSKLDKWKTTL
                     LLRIKNNIEEQAEDFS"
     exon            complement(1001227..1001466)
                     /number=1
     exon            complement(1001521..1001695)
                     /number=2
     exon            complement(1001756..1002062)
                     /number=3
     exon            complement(1002142..1002265)
                     /number=4
     exon            complement(1002329..1002361)
                     /number=5
     CDS             1002727..1003317
                     /codon_start=1
                     /locus_tag="AO090026000348"
                     /note="predicted protein"
                     /old_locus_tag="AO070304000020"
                     /protein_id="BAE59816.1"
                     /transl_table=1
                     /translation="MLCLRSTASQLSRRISPRTSRLSNLAEVRRIRFYSPKPEQVDVD
                     ALLAKPSWSVRSLLPDQTAKQSSPTVTPAQLHHLLRLSALPLPSTKEEEAKMLETLES
                     QIHFVKEIQRADVTGVEPLQSIRDESLEALKENTIGLEQLKDALAKERVVGRNKRIQR
                     VESERNDRPDGDAWDGNALGYASKTKGKFFVVETGN"
     exon            1002727..1003317
                     /number=1
     CDS             join(1003336..1003374,1003886..1005637)
                     /codon_start=1
                     /locus_tag="AO090026000349"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070304000019"
                     /protein_id="BAE59817.1"
                     /transl_table=1
                     /translation="MNRGFLCSALGMLDLKAEATSLTSFDDWRDSVILRIGEVVNKSE
                     GDDDDDDDEQHASTSSQASQQQAPVVPEDQGSLKKLRDVYPPVETPLLQLPEAKRLLI
                     LHSLLLLLLSLEHYNARSRVLMLYVASSLHLDVKILNGDEVKVARILLDTAIELSKNA
                     ETQNHGKKSDSSRKWKVGIASVAGAALIGITGGLAAPLVAAGLGTVLGGIGLGATAAA
                     GYLGALAGSGVIVGGLFGAYGGRMTGRMVDKYAREVEDFAFLPVRGSRHRPQDEKEAA
                     KQDHRLRVTIGITGWVTEEDNFVVPWRVIGADSEVFGLRWETEPLMNLGNAMDLLVTS
                     AAWAAGEQVLKKTFFASLLSAVVLPLGLLKVARVADNPFSVAKVRADKAGEVLADALI
                     NKVQGERSVTLIGYSLGSRVIFSCLQSLAKRGAYGLVDSAILMGSATPSNAQHWRRMR
                     NVVSGRLVNVYSENDAVLALLYRTSSLQLGVAGLQPVEDVAGVENLDASDIISGHLRY
                     QFLVGHILSRIGLESIDVREVEREEAALAAKDQRQEQERIRNERRAGIQGSDSAHQKL
                     ESGELKDEENRLQKQVEERNHERLHLRHNE"
     exon            1003336..1003374
                     /number=1
     exon            1003886..1005637
                     /number=2
     CDS             1008802..1009311
                     /codon_start=1
                     /locus_tag="AO090026000351"
                     /note="predicted protein"
                     /old_locus_tag="AO070304000017"
                     /protein_id="BAE59818.1"
                     /transl_table=1
                     /translation="MASQINLEGNNWWAEIDVSGVNSSLEHNFDPIADGNNHEKKTRF
                     AAITKKIIELGIMEVSIVPKDRTEERICYPFWIGQYPTGREPTKEEAKKKMVEHLDKE
                     WKAPSETLDILEEFWRRSREWLAQRAESRQEGLYREDTPAPFETPPTPRIRQLEDNEL
                     PEDTTDCWL"
     exon            1008802..1009311
                     /number=1
     CDS             complement(join(1012925..1013076,1013335..1013539))
                     /codon_start=1
                     /locus_tag="AO090026000352"
                     /note="predicted protein"
                     /old_locus_tag="AO070304000016"
                     /protein_id="BAE59819.1"
                     /transl_table=1
                     /translation="MLLADVPQSSMLQQYLVDGMILGALIHIGDLFTKSPEYQERMST
                     RHILKITSQTALEMKETVVQNGETLIHKSRFFTRSKRDDSKIIFSYLVGLLQKIVEDV
                     EIREPKSKIIHQGADY"
     exon            complement(1012925..1013076)
                     /number=1
     exon            complement(1013335..1013539)
                     /number=2
     CDS             1015212..1015874
                     /codon_start=1
                     /locus_tag="AO090026000354"
                     /note="predicted protein"
                     /old_locus_tag="AO070304000014"
                     /protein_id="BAE59820.1"
                     /transl_table=1
                     /translation="MNTPQKHGTDKSTQVMWYIKLKSTVRYKWVIKVLDDKEIYNCFL
                     VECLRRAKEGEGKRTKEPTDHSPGIYSIQIGETYPDKPPSKEEADQKLVDDIQARLDA
                     FYRKNPHMKTKTVKWYVEVTTEDAPWTEWKGKIRLNSPEYFRFLENCLRITKRGEAKV
                     TTDDNSSKDDTYSLLLGKFCDHQFPDHQQASLRLEREIYDAIAKHNTSGWRYVPPALG
                     FR"
     exon            1015212..1015874
                     /number=1
     CDS             complement(join(1016256..1018013,1018067..1018258,
                     1018317..1018487))
                     /codon_start=1
                     /locus_tag="AO090026000355"
                     /note="predicted protein"
                     /old_locus_tag="AO070304000013"
                     /protein_id="BAE59821.1"
                     /transl_table=1
                     /translation="MGESPPFLYGTPSAYRFDGPTDRPFNPKAVTQASWTRPPSKPKP
                     KGPLVNFNRHPDSYCNIPSGKSKWTPMHPNTKNRVIYGRKVQLGLRILQLIGALGSLF
                     CAIVIKNAAAALIWIVRVGPAVAILHTLYGIYHLCRSITRPAGTQASYMLFCGTFDLG
                     LVPFYVFAAYLGFNQYTDNAYHWSTLLSPDFEVSTKIAQATFLLSVINGGLHAISLGI
                     SIFLGLIFRKITRLPPDLNPLEDNLTARPHKRNKSEITKKHTSSSTLDSTMSGETLIG
                     APRTMSFMHTRAKSSEGGSSTSPLDARENRLSQMTMAYDHDELPVPLMPFGRQADTAE
                     HMMYQLPDQDEDILTRPTTRISYASPVRERSPDVPSRSQCASPASENWIAFPSRSASP
                     VEEGQKENLLHRDPSSVYSRTTNTPASGNSGPLDWFNNQRIGWELEDTIREDVRGEYE
                     SVPIREYYGNDDENHYLPQRDRFYDNAEEDISDHPIHIFEDHSEVRESSESLRVNPLA
                     LNPPTPQPAFVETPDDATQNGRMVLVDIPNLSPNPTASPPPVDSPEKSGRFYGELESK
                     TGLSIPRNVSNHDEDTRGLGRKKSKLMKRRSQKMNTYGALKQHDDAINVNENGLVVPP
                     QSPMTVESDRKGRVVSNSGADIGPNVSGGSALSYGNYIAGLGVGRRRDVSGKVAEEGR
                     GGMNKATDEKQTIRAAGWARFAGL"
     exon            complement(1016256..1018013)
                     /number=1
     exon            complement(1018067..1018258)
                     /number=2
     exon            complement(1018317..1018487)
                     /number=3
     CDS             join(1018866..1019171,1019252..1019686,1019747..1020619)
                     /codon_start=1
                     /locus_tag="AO090026000356"
                     /note="ferredoxin/adrenodoxin reductase"
                     /old_locus_tag="AO070304000012"
                     /protein_id="BAE59822.1"
                     /transl_table=1
                     /translation="MNLQRVPYICSQCTVQISRSPLRRSPHRLLPQPVWQRRHNSQSV
                     QTNQPFRVAVVGSGPAGFYAAYRLLAKVDDAVVDMYEKLPVPFGLVRYGVAPDHPEVK
                     NCEEKFTEVAASPRFNFIGNIELGEDLPLQALKPHYDAILFSYGAPKDKELGIPGEKA
                     CRNVYSAREFVGWYNGLPEHRDLAPDLTSGENAVIIGQGNVALDVARILLSDVDTLRK
                     TDITDYAVEALAKSKIKRVHVVGRRGPMQAAFTIKELRELLQLPGVSFDPVRKELFPP
                     DDVMNALPRAQKRLIQLLAKGSSNDPATSAKSWSLDFLLSPECLNWSPIHPYRLSHVK
                     FSRNELDPADPYITSAKVSPKYLSNGQRAQVNIPANTFFRSVGYKSLPLPGLEDLGIQ
                     FDTKRGVIPNDGFGRVTSPTNTGDNEQLPDGSVISHLPGLYCAGWVKRGPTGVIATTM
                     TDAFTTADVVAADLSSHRGKGSLLNGPGHSTGLGWEGVRPEAEKRGLRATTWEDWQRI
                     DAAERERGQQIGKIRSKFGRVEEMLEVVQ"
     exon            1018866..1019171
                     /number=1
     exon            1019252..1019686
                     /number=2
     exon            1019747..1020619
                     /number=3
     CDS             complement(1020857..1021327)
                     /codon_start=1
                     /locus_tag="AO090026000357"
                     /note="predicted protein"
                     /old_locus_tag="AO070304000011"
                     /protein_id="BAE59823.1"
                     /transl_table=1
                     /translation="MKSFTAISLLALFSSALAAPVEQSTDASTAATISVSYDQKYDVS
                     GSSLTTVSCSDGVYGLISQGYSTFGSLPGFPNIGGAPTVAGWNSPNCGKCYQLHYAAG
                     NVDKSIYVTAIDAAPGGFNIGLQAMNTLTNGLAEQLGRVNVDYTEVPRSNCGFP"
     exon            complement(1020857..1021327)
                     /number=1
     CDS             1024454..1025749
                     /codon_start=1
                     /locus_tag="AO090026000360"
                     /note="predicted protein"
                     /old_locus_tag="AO070304000008"
                     /protein_id="BAE59824.1"
                     /transl_table=1
                     /translation="MLHLLNGEDAQTHLTKRQNATQQPLTGGDRAGFIAMGVVALCSF
                     IASFCLLSFLTYRFIFWKRYYKRPLAANQYVVLIYNLLLIDIQQATAFVLCLYWVSRG
                     HVDYPSAACVLQGWWIQIGDPGSGLFIMAIAMHTGAVVLRGRQLPHRTFVCCVIGLWA
                     FIIVLGLIPVGLFGSKTFVISEAGWVSCNSQQKQGQREYVLTFLIFQCWLGPEHETER
                     LWVHYLWIFLAEFGTVVFYGMLFFHLRRRMKQAAMLRQGHQESLKRLNRVVIYMVIYP
                     IVYLVLSLPLAAGRMSTARHIVQSRGYFAVAGSLMALSGLVDVVVYTLTRRHLLLDTE
                     ISTSDKMYAYSNSNAYQTHITTTTRENKKPRMGSRLRRGLQTINDTINDGDSTEDLRK
                     DGDMEMADLGHGVYQETTIEISHEPADPDEFHGNKRNSG"
     exon            1024454..1025749
                     /number=1
     CDS             complement(join(1029741..1029923,1029978..1030534,
                     1032497..1032641))
                     /codon_start=1
                     /locus_tag="AO090026000361"
                     /note="membrane component of ER protein translocation
                     complex"
                     /old_locus_tag="AO070304000007"
                     /protein_id="BAE59825.1"
                     /transl_table=1
                     /translation="MRLDSQPCLTIHARHRSHSSLEAEIGYSKAPKRSSPEIPGKHLC
                     HRCNVKRAIRALESPAYAKAAAKKNSLLPPVTDRASAENVFKLLPLSLLALRVSKVDP
                     HAGHNHAKPKNRVKGLWTVKIEQHQETDPMMHYVWLYEGPQWKQKAMAAAVVAGIFAV
                     VLFPLWPMVMRQGVWYLSVGMMGLLGLFFAMSIFRLILFCVTVFAVPPGLWLFPNLFE
                     DVGFIDSFKPLWGWQESKKKKKSKKSSGDASKSAKSPVSQPADSAPSATTTATAAPDT
                     SSAVKRDLAPRVEEVTDE"
     exon            complement(1029741..1029923)
                     /number=1
     exon            complement(1029978..1030534)
                     /number=2
     exon            complement(1032497..1032641)
                     /number=3
     CDS             complement(1034211..1036604)
                     /codon_start=1
                     /locus_tag="AO090026000362"
                     /note="predicted protein"
                     /old_locus_tag="AO070304000006"
                     /protein_id="BAE59826.1"
                     /transl_table=1
                     /translation="MTVNTEPPKSSVSERRGQTLAPLQTNFSRPSARPTVVATRPNRP
                     RPEYQNDGEAGERVPLQTPVKRQSSKSGLRSIFSREKLPHKESTDSKLSEIEERQDPA
                     AQAAPDLAVPISPTLATPKTAFSTPTVMTSPIVDPHRSKASKSRQKTSEDKPAAGEIG
                     WKPPPLFQAYPQAIKHDNLPTPSLSAESILRIQATTSAKQSSTQNESPQAENPAARKK
                     EAKEKKKHMRSLSETIGKSDWSPKIYVLVTTGYILQYAGSGKYDRLPEKMLQLGPKSV
                     AFASDAIPGKHWVLQISQINDENNATSTDTHRHLFSRFGFHRSHARRLTRSLLLVFNT
                     PEEMSSWLLAVRAQIEARGGKKYVSERAVDDDTEHQLESKPSTRQLVKKDPNRFSQAY
                     LHPQPVIGVDDKEFSDQSRRSSYISYNRRSIVTQATPESRSESMSTTQTEVTSPVSGQ
                     TRFYSMGMKPEANGASSPPNGSAISTVLSPLDGPPRSPTFSNSTKRESVYPSNAPTIA
                     ETSDLSEPQQTVPDPILRSASPPAPNFSVPSFSKRFTARMGQGQIQQVPRFPSTRRDE
                     TDPDEANPISAFPSPPQSPIKSISSVAMSESHEQVVPFRDSPQRRSLRISNSEDSLGD
                     SRNLDPKLQHASRISKITGATSTASQSSRPPSIIEHEPARSQIPQSPPEAGYQASRRE
                     QQRHRVSVFPTVTPNRPSTGPMLRRKSMPGLSVGPPALPPPDCPLPKIPSPIEPSLPE
                     IAEQFPDPRVCISPPPSKGSRLRRKSLASAAPRPAHMPLPPATQSLGSRHPRTVNGI"
     exon            complement(1034211..1036604)
                     /number=1
     CDS             complement(join(1039718..1040007,1040066..1040192,
                     1040254..1040711,1042106..1042154))
                     /codon_start=1
                     /locus_tag="AO090026000363"
                     /note="dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /old_locus_tag="AO070304000005"
                     /protein_id="BAE59827.1"
                     /transl_table=1
                     /translation="MSVIDWGVVAPWTRCSFVLTGASEGGLGGATALALASARPSHLV
                     LLARTENKVRTVISTIKEISPETQPAFVHIELEDLDSVRRAAADVLSLTSKIDVLINN
                     AGVMAIPWSKSKSGLEKTLAINHIGHFLLTKLLMPSILAAGPGSRIVNVTSAAYRMAP
                     FFFDDWNFSDGQTYHPLAAYGQSKTANILFTVGLAQRYKEHGILSFAAHPGYIPGTSL
                     LLHGPDLDPSAMDEVARKNTGFPFGPDPPKSLEQGISTTLVAALSPELTDASGAYMED
                     CQVCEAREYARDPKLADRLWSLSEELASEAF"
     exon            complement(1039718..1040007)
                     /number=1
     exon            complement(1040066..1040192)
                     /number=2
     exon            complement(1040254..1040711)
                     /number=3
     exon            complement(1042106..1042154)
                     /number=4
     CDS             join(1042328..1042477,1042590..1042652,1042715..1042891)
                     /codon_start=1
                     /locus_tag="AO090026000364"
                     /note="predicted protein"
                     /old_locus_tag="AO070304000004"
                     /protein_id="BAE59828.1"
                     /transl_table=1
                     /translation="MAAAPKFARGMNKGQLQPELNSLLEQGWALDEDGMGVKKTYYFK
                     TYFKAVSFVNVVASQSAAKKHHPTITVRIGSVDIHWTTHQPRGLTDKDLTMAQHCDEA
                     AELMGAVEKDQGKKCGPSSPTPSSPGL"
     exon            1042328..1042477
                     /number=1
     exon            1042590..1042652
                     /number=2
     exon            1042715..1042891
                     /number=3
     CDS             complement(join(1044494..1044849,1044907..1046380))
                     /codon_start=1
                     /locus_tag="AO090026000365"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070304000003"
                     /protein_id="BAE59829.1"
                     /transl_table=1
                     /translation="MAPLSDQAINRDEKLHESGASSSSQVDGGFEKEAEPPLHKPQLG
                     LANDPAAAGTTFHQLENTALDGGKIELTEEECYDQLGYSFPSWRKWMIISVIFLVQVS
                     MNFNTSLYSNALGGISEEFGVSMQAARCGAMIFLVLYAFGCELWAPWSEELGRKPILQ
                     ASLFLVNVWQLPVALAPNFASIMVGRALGGLSSAGGSVTLGMIADLWEADDQQYAVAC
                     VVFSSVGGSVLGPVVGGFVEAYLPWRWNIWIQLIFGGFVQIAHFLLVPETRTTILMDR
                     IAKKKRESGENPNLYGPNELIPYRERFSMREILVTWVRPFKMFLTEPIVLTLSLLSGF
                     SDALIFMFIQSFGLVYAQWNFSTVALGLSFLPILVGYFIAWASFVPAIRRNVYERRMR
                     PDDEHTQYESRLWWLLYTAPCLPIGLIGFAWTSLPQTHWIGTMVFSAIVGIANYSIYM
                     ATIDYMVCAYGPYSASATGGNGWARDFLAGVLTIPATPFYQNIGGKYHLEYASTILFC
                     ISFVLVIAVYVIYWKGPTLRKRSPFAQQLSDARVEMQTHGRRLSKIPSGSRANSFARS
                     QQNLRIRQNLGSRQGSYIGSRPASHANSRVNSRVNSRRNSVNQ"
     exon            complement(1044494..1044849)
                     /number=1
     exon            complement(1044907..1046380)
                     /number=2
     CDS             complement(join(1052456..1052625,1053339..1053455,
                     1053519..1053765,1053818..1054326,1054388..1054562))
                     /codon_start=1
                     /locus_tag="AO090026000367"
                     /note="predicted inosine-uridine preferring nucleoside
                     hydrolase"
                     /old_locus_tag="AO070304000001"
                     /protein_id="BAE59830.1"
                     /transl_table=1
                     /translation="MWPTRSLSSLFFLSLALGSPVSQTEKRYAILDNDWGAVSFLPFL
                     IALKNDVQVLGLVSDTANSWQRQCAYHALANLEVGNLSCIPVYAGATYPLINTPERFQ
                     AWESVHGKLPWEGAFALENATAEALGNDPTSGDPNRIVKPAFIEGFPTTKINHSTSAA
                     NFMVEMVHKYPHQVSIYSAGALTNVALAVRMDSDFASLAKELVIMGGYVDVNMYQVTG
                     DYLQADINSDINLMVDPEAAKIALNAEFPEIVIAGNVANQVQSTQEYLDEVYTVKNEY
                     TKLFHDHYGTEFPFWDETAAALMVDRSLATNTTTAYIDVDISYGSPNYGNIHVYQAML
                     KPPGVRNITYVNRIDGKPEWISIHFLHQRQYHSLNSSTYTVNKPSPTFLNKYICFARI
                     SSCFGFTLGQELS"
     exon            complement(1052456..1052625)
                     /number=1
     exon            complement(1053339..1053455)
                     /number=2
     exon            complement(1053519..1053765)
                     /number=3
     exon            complement(1053818..1054326)
                     /number=4
     exon            complement(1054388..1054562)
                     /number=5
     CDS             complement(join(1055975..1058312,1058366..1058637,
                     1058696..1059235))
                     /codon_start=1
                     /locus_tag="AO090026000368"
                     /note="WD40 repeat protein"
                     /old_locus_tag="AO070308000001"
                     /protein_id="BAE59831.1"
                     /transl_table=1
                     /translation="MAHNSLNVKGKAVGAASSLRITPTNSPGLRPPRTPNKSPQHQAT
                     LSLQTVIGTTTTTPHGFSSHDQSKSFAICAGSAAILAELDEAGNVNQRFFRARPSASS
                     VHPVTSFYHQSTPPSTPDTRARPLSGVKPTAHSAIPNGSPANELAESNSSRAWSSRER
                     VKAVTSVSISPNGRFLAVGETGYGPRVLIYSTAKDAPSDVPLSILTEHTFGVRGLAFS
                     SDSQYLATLGDTNDGFLFVWSVSLKSGAAKLHLTNKCTSSIRDMCFMGQTLITVGVRH
                     VKVWRLPEARPASPTKTRHNMESAPSSPSFAPRALSGRNCLLGSLAESTFTSVASISD
                     REAVIGTDTGALCFLSDAEGSQKLTLVENVGFSITSLMLDSDRSCVWAGGRGRRMQRF
                     PFEVLRSSAAPLSPGLSEASSEEHKCKGPAITCMGSLTTHMVTVDTTRAIHIYPFDAM
                     EDEQSHVETTMPAHRDAVLGIGRLKVPNDLEADFFTWSCRGTINFWDTHGKCRDSRVI
                     PLEEVPGVDEESSNELRVVRTSDGTNVFVSGDKLGVLRVLERQSWKCLDQVRAHGAEV
                     TDIALSAAFDSCLIASCGRDRMVQLFQITEHRLKLVQTMDDHVGAVGKVLFINDGENL
                     LSCSADRTVLIRERVTREADDGISIAYMISKVITLKSSPVSMALSADDADVLVISTAD
                     RCIHQYEIPSGRHLNSIRAVDSDSNDAVVMGALTVAGEILGHSPKLLIGVASTDKSIR
                     VYDLDRGVLLTGEFGHTEGVSDVQLLERNPDPSSRTVVRTLISSGIDGVVMMWNISVQ
                     PLQAQEITRTTSKEDDEGAKEMTLTRPPIRKILSKNELAEFRHEHGTGASTPTREQSP
                     PLIRKLSKLSLAPSSTKNGDTTPATPTPASARPSSRLERSRRTPSPPSPKSTPAKKTS
                     HLSHNNHRSPLDIRSRTRYGGKTEFGSLNMSTEQVCRTLRAYRKKLNGTKENLPSQKD
                     LERELGLTLRALHSRTKGCDGTETETDSSGKENENLNTGVTSVRNLDIQVPPSPPNLS
                     QKQSTPSSRSHSTEGDVEG"
     exon            complement(1055975..1058312)
                     /number=1
     exon            complement(1058366..1058637)
                     /number=2
     exon            complement(1058696..1059235)
                     /number=3
     CDS             1061012..1061866
                     /codon_start=1
                     /locus_tag="AO090026000369"
                     /note="predicted protein"
                     /old_locus_tag="AO070308000002"
                     /protein_id="BAE59832.1"
                     /transl_table=1
                     /translation="MAVFCASSARLALPTLLRNIYRSEFASELHSSRPVSLRQVSYSH
                     NRFNNGRSFASLSRLLASQSGSHMNPQPSSQPIITESSSEQLDAAEDGSIVGAPTKDA
                     AVNRDRRDPDKPTRKTKKAKFASSQTEPDATSAKSSRDKKHVRSDRASPDYKPKKKKE
                     PWQIQKDALKKKFKEGWNPSKKLSPDALEGIRHLHAVAPDKFTTPVLAEQFQVSPEAI
                     RRILKSKWRPSETEMEDRRKRWEKRHDRIWSHLSELGLRPKTKRTEALDDSNILYGKG
                     EEGNKPSE"
     exon            1061012..1061866
                     /number=1
     CDS             join(1062711..1063248,1063317..1064390,1064451..1065334)
                     /codon_start=1
                     /locus_tag="AO090026000370"
                     /note="predicted protein"
                     /old_locus_tag="AO070308000003"
                     /protein_id="BAE59833.1"
                     /transl_table=1
                     /translation="MPSDIQVFVKWKDQTIFAGEDVECTITFKNVAEGNVESNNGRQL
                     SPQRKPSRPGSSTPHSDSFFSLKSPRNLFSNPNRRSSTTFSRRSPSHRVSSSLSSPLV
                     GSHSFPPPATPRNGPPPGHKHKRSISILSIDSEGGGDRTPKTSSPFTRSRPARGHGRS
                     ASLQVVPKRFEGYDDIFPKGGRHTTRGVPPPESPMNVSPQSLRVDVDAAARASRSRSG
                     TMSPIKSAESPRGPARRPQLPPMDFKFPPPASDTSNHRSGASPTIPAGEHSNAVTVAK
                     PNGKESSALAAPGHLPQLTKIMSTSSLSGSHRSSGEFYSVGNNSSETLQSEYTNYSMT
                     VPRTPVSRHGRHMSSVDSAAWLPNGQTLLMGYAQISASFTVDGSLINQSAFEEVKRKG
                     VVGDQGNAAGMSNGRSAASSDKNRKGGGFWGAFKWNAIEESINGLLSNNELDGLRDMR
                     GVTSSRSIPLLSTSQSLLFVDLRLAPGEEQSYSFSFTLPRGLPASHKGKAIKISYNLV
                     IGTQRPSVRNEPQRVNRITIPFRVFSGVDGQGDILGHDLMNPYVLLRDEARVQKVGPS
                     PPPSTKSKSISGTTWNSAPEFLGYVDDILEQRSQGALLQPPETPLEKRPSHDLSLGPL
                     SCKDAIDLAILRSNQALNSSRSPNRFEIARNGHRIAVVVLNRPAHRLGETIIATVNFA
                     GTALPCYAVRATLETSEKVTGSLAVRSGASIRRATRKVHASFFENTLYSTRVVFSPAI
                     PISATPTILTTGVNHEWELRFEFVTPNMHADSGVGPSGATLLETVHEDDRGRIMNALE
                     NIGCESFEITIPITVYGETVRERLPEENEGYSI"
     exon            1062711..1063248
                     /number=1
     exon            1063317..1064390
                     /number=2
     exon            1064451..1065334
                     /number=3
     CDS             join(1066127..1066149,1066369..1066532,1066604..1066882,
                     1066931..1067172)
                     /codon_start=1
                     /locus_tag="AO090026000371"
                     /note="cell cycle-associated protein Mob1-1"
                     /old_locus_tag="AO070308000004"
                     /protein_id="BAE59834.1"
                     /transl_table=1
                     /translation="MASFITTINARTRAPFKPRSAAKGTSSYQLRQFAEATLGSGSLR
                     KAVMLPEGEDLNEWLAVNVVDFYNQINLLYGSITEFCSPQSCPEMKATDECVTFLGIV
                     RITADTRDRFEYLWQDSEHFKRPTKMSAPEYIEHLMSWVQSNIDNEQMFPSRLGVPFP
                     KAFTSLIRQIFKRLYRVYAHIYCHHYPVIVHLGLEPHLNTSFKHYVLFIDEHRLASGK
                     DFWGPLGDLVESMLRSD"
     exon            1066127..1066149
                     /number=1
     exon            1066369..1066532
                     /number=2
     exon            1066604..1066882
                     /number=3
     exon            1066931..1067172
                     /number=4
     CDS             join(1067586..1067750,1067949..1068260,1068346..1068435,
                     1068493..1068606)
                     /codon_start=1
                     /locus_tag="AO090026000372"
                     /note="mitochondrial F1F0-ATP synthase, subunit OSCP/ATP5"
                     /old_locus_tag="AO070308000005"
                     /protein_id="BAE59835.1"
                     /transl_table=1
                     /translation="MMPTRFARAGLRATQQFSVPRTAAVNGLRTYATPAQEVKPPVSL
                     YGVDGTYATALFTASAKSANLEQTSKALSALGEVLKADRKLTGLISAPTLTASDKSQI
                     VQELQKLTGDKGDIVKNFLETLAENNRLGLLEGVCEKFATLMGAHRGEIDLNITSAQE
                     LDKKTLNRLEKAVSQSHFSQGKKLKVVTKVNPDLVGGLVVEIGDRTIDLSVSSKIAKL
                     NKALTDAL"
     exon            1067586..1067750
                     /number=1
     exon            1067949..1068260
                     /number=2
     exon            1068346..1068435
                     /number=3
     exon            1068493..1068606
                     /number=4
     CDS             complement(join(1069765..1070110,1070167..1070952,
                     1071003..1071099,1071152..1072598,1072657..1072756,
                     1072807..1072924,1073230..1073353))
                     /codon_start=1
                     /locus_tag="AO090026000373"
                     /note="glucosidase I"
                     /old_locus_tag="AO070308000006"
                     /protein_id="BAE59836.1"
                     /transl_table=1
                     /translation="MVLIDKHTYTSREEERLKEDRDRIRYWKKWGPYVAERQWATDFS
                     HEHARSRTYRWGEDGIAGVSDTHTLQNVAFAFWNEKDDFLKERLFGLSNPQGNHGESI
                     KEAHFHLDNTPTHSYMKYLYKYPQKKFPYEDLRDENARRSRLDREYQILDTGAFDDNR
                     YWDIFIETAKEDDDEEELLFRVIAYNRGPEPAPLHIIPHVWFRNTWSWGYEDQSHKPS
                     IEKVAPLTAKSYHKKLGERYVRFSPSPAAGSNQEDVLPKMLFTENETNNELLWKSEND
                     QPYVKDAFHRYIVNNERDAINPENKGTKFAAWYAFNEGEGIPPGECAVVRFRLSRKNQ
                     TFVDEEELDDTIEQRIGEADDFYYHISPLPMSDDLRNIQRQAFAGMMWTKQYYHFVWD
                     QWANGDPAMIPPPPGRKHVRNQQWKHLYMDDILSMPDSWEYPFFAAWDTAFHCIPLAM
                     IDPEFAKKQLDLLTREWYMHPNGQLAAYEWNFGDVNPPVHAWATFRVFKIERKMYGRQ
                     DLDFLERVFQKLLLNFTWWVNRKDSEGKNVFEGGFLGLDNIGLFNRSEPLPTGGVLEQ
                     ADSTGWMAFYCLCMLNMALELAKHRRIYEDIASKFFEHFILISDAMTFKSGGQETSLW
                     NEEDGFYYDAISYGEPWTQQLPVRSLVGLIPLYGVLTLEPELINQFPSFKRRLEWFIE
                     NKQDVAERNIASMKRRGKGERLLLALVSKDRLEKILKRMLDETEFLSEHGIRSMSKYH
                     GEHPYSMTVNGQEFRVNYVPGDSDSALFGGNSNWRGPVWLCVNFLLVESLLRFYMFYG
                     DKFQVECPTGSGEYMHLGQVAEEIQHRLQHLFARNDEGRRAVHDNSDLLDFDEHWKDY
                     MWFHEFFDGDTGRGLGASHQCGWTGLIAKIIHDTGINCRIPQTPRSPFAAASHYFDDI
                     FSRSRPRGSRRPSVRRSSTSRSIGNRSDFESAFGDTTGAESVVDDEEKDRGVDDHVSH
                     FVESQLERVRSRLSMGAYEDEFETQADRKPNGH"
     exon            complement(1069765..1070110)
                     /number=1
     exon            complement(1070167..1070952)
                     /number=2
     exon            complement(1071003..1071099)
                     /number=3
     exon            complement(1071152..1072598)
                     /number=4
     exon            complement(1072657..1072756)
                     /number=5
     exon            complement(1072807..1072924)
                     /number=6
     exon            complement(1073230..1073353)
                     /number=7
     CDS             complement(join(1075383..1076174,1076315..1076446))
                     /codon_start=1
                     /locus_tag="AO090026000374"
                     /note="predicted protein"
                     /old_locus_tag="AO070308000007"
                     /protein_id="BAE59837.1"
                     /transl_table=1
                     /translation="MGQFGQVVWRGFPCALTIGSLICLVIVGLGCTRAHKAENLYFLR
                     FIQALDEVNNTTGLNDFYSIGLWSYCTGNITDNGTYKTTYCSKPRGGFWFDPIDTWGL
                     NGTNTNDFLPGKLKKSLNMYRNVSLWMAIIYLIAVIATVLEIMTGLMAVGGNRLVSCF
                     AWLLAGVSLLFTTAMSITSTTIFATLAATVKTVLKPHGITGHMGRHIYAATWLAVVLS
                     FLASALWLLDYCCCSRRRTTPRPIAADHQQSYGYSSVPLNGVTAPRHTPYPPAMVFAS
                     PPNLQGSYQHPMHQTPTHSTPEDACEPYRHG"
     exon            complement(1075383..1076174)
                     /number=1
     exon            complement(1076315..1076446)
                     /number=2
     CDS             join(1077142..1078329,1078407..1078727)
                     /codon_start=1
                     /locus_tag="AO090026000375"
                     /note="predicted protein"
                     /old_locus_tag="AO070308000008"
                     /protein_id="BAE59838.1"
                     /transl_table=1
                     /translation="MNITSCSPAAIQSPTVFGAEILSLSASWVTNYTLNVPAGFNYNH
                     GDVDVRNAQFCNITVTYTHPGYNDQITVETWLPPRTKWNGRLQATGGGGWQAGRFVLS
                     QFFMSGAIGEGYAATTTDAGLGDAVGPSSWALQSPGNVDYVAFNNLGSRSLNDQAIIG
                     KSLVNSFCGRAPDYAYWSGCSQGGRQGLMLAQRYPTAYDGIVASAPAQSWTKFVSALY
                     YPLLMRQWHGVNPLACELDFLTTEAVAACDAKDGIVDGLISNLTACEYSPYTSVNKTF
                     TCSALNKTMALSPGAALIADAAWSGPQTADGERLWYGVNPGADISQFGSVPGVNSSQS
                     DMWFNLFVAKNASFDTIHMSPKVYEEFFHLGTQEYASTINAADPDLTAFRKAGGKLLT
                     YHGVADESIPTKGTEFYYKSVQNQFPDVQDFFRYFESPGLGHCSGGKGGQPTTIFDAL
                     RRRVENGTAPETLPVEYARPEGEPLHRIVCPYPAQAKYMGGDISSVESFRCV"
     exon            1077142..1078329
                     /number=1
     exon            1078407..1078727
                     /number=2
     CDS             complement(1079279..1079902)
                     /codon_start=1
                     /locus_tag="AO090026000376"
                     /note="predicted protein"
                     /old_locus_tag="AO070308000009"
                     /protein_id="BAE59839.1"
                     /transl_table=1
                     /translation="MSTDFYTEAEHHLNLAVREVSTLVTQIQPNNSASLYVSTIFIFL
                     SSLVKGPQTGEYMAFRDDGNPGHLSLFLGVPSILELCQTDIHPSVFAIHGGEEEQQHP
                     SPETPLNTNTQHNPETPTHYEDHLAAFRELLSTLIPTSDPRASSYQQSLNQLHFSLHA
                     VLGPLGLGCRLSRWSLLGCIDFRMRLSMICNEESHLLLSSLPSLPCC"
     exon            complement(1079279..1079902)
                     /number=1
     CDS             complement(1081838..1085053)
                     /codon_start=1
                     /locus_tag="AO090026000378"
                     /note="non-ribosomal peptide synthetase modules and
                     related proteins"
                     /old_locus_tag="AO070308000011"
                     /protein_id="BAE59840.1"
                     /transl_table=1
                     /translation="MAKDQSMSRTASLCQEITVPKTIPVCIQDVFYRRVLEQHDAPAV
                     CAWDGELTYGELDDKSSSLARILAQKGIHRGSFVPLCFDRSLWTAVAMLAVLKAGGVF
                     CFLEPKYPLARLEHMCRHINAKMVLSGESRSELARKLGEHLAVNEDLLATSPSDQELV
                     DVAPNQAAYVAFTSGSTGKPKGILVSHQALVAGILYNDKPMYLNRTSRVLSFASFAFD
                     VSFLEHFWALFVGGCMCIPSESDRENNLLEAIENLQVNWAFLTPSVARVLNPTKLPSL
                     RHLIMGGEPITQTDIDMWSPHVHLIGVYGPAECAGCTTIQSDYGKVESAANIGFPYAV
                     TCWIVDENNHNVLVPTGSIGELVVQGPSLSEGYVNDPEQSAKSYITNPLWLSGSKEAE
                     QQLYKTGDLVRRLSDGSLHFISRKDTQVKINGQRIELGEVEHHTRAVLGGNREVIVEA
                     VKAGRPSSSLVAFIVTDNIPQSSTELFLAPDAGFKDRINTTKSLLRERLPDYMVPETY
                     ISINHLPSTVTGKADRKRLREQFTLLTRAQIKAYFGLEDKVKVMPLTETELKMQRLWA
                     KVLNLDLHEIARDDDWVSLGGDSLGAMQLASLARSEQFFLTVPEIFRHKTISMLCQNI
                     KTDVSETIEEMKPFALLCDHKLESDRILQTIADQCQVSQNSIEDAYPITSLQLDASII
                     PIQWGLNYTLRLEFKLPPTVDPAQLTLAWEMTVASNPVLRTRIVELTKDHYIQAVIRS
                     KIPLENLDSSNMARYEPAVDVWGIGKPLVRVGLQANRFVMLIHHAIYDGQSLPLVFRD
                     ISNAYQGQKLALIHFAPFVRWSKSLDAPKRQFWIDKFAGFDGRVFPPVLDPSLDPVES
                     RELTGHLNIVHDAFTATNKIRVTLAIVISWHHGTNDVVFGGVFARRSAPIPDIIDSAV
                     PTTAMLPDRIKLDPDETLRYNLERDQDNILSLMLHEGIDDRDIEQLSPECEAVACKYG
                     TLLAVQPDLATAYPEMFRERDMQYYGPICALNALMQCYLSPESATISLRLSESTMDGV
                     YHWGRFLDEFEAVFHFIQKNPDVKLCDLRRQLDIPNPRSPA"
     exon            complement(1081838..1085053)
                     /number=1
     CDS             complement(1085982..1086518)
                     /codon_start=1
                     /locus_tag="AO090026000379"
                     /note="predicted protein"
                     /old_locus_tag="AO070308000012"
                     /protein_id="BAE59841.1"
                     /transl_table=1
                     /translation="MSEFIPTWKQPSHPETLQVIKGATPYTASARSLVALPAGALFSK
                     ITTAIPAPKKTYTSVQTGPGLNIELMSDLVYCNHSCSPSLEFDMSTFEVRVSRDRPLS
                     VGDELTFFYPSTEWDMVQPFNCFCGSQNCLGLIAGSQDMEASVLSRYWLNPHVKDLLA
                     GKQMTVAPESTEEISLKA"
     exon            complement(1085982..1086518)
                     /number=1
     CDS             join(1087331..1087568,1087651..1088592,1088673..1088770)
                     /codon_start=1
                     /locus_tag="AO090026000380"
                     /note="ornithine decarboxylase"
                     /old_locus_tag="AO070308000013"
                     /protein_id="BAE59842.1"
                     /transl_table=1
                     /translation="MPYATEETSSVAWFPEGNLCHSKTCGPRTNGIVLEAMKGKLSQP
                     SEWDRSEPFCVMDLGYVYNEYQRWTSLLPDVKPFYAVKCNPDTHIIKVLNAMNSGFDC
                     ASRNEMELVMSQGVAPERIIFANPCKKISDLEYAQQSGVRKMTFDNEAELQKIRQRFP
                     DAQLILRCLASDPSATYSLGSKFGASSATSVKLLQCAKSWGLSVVGVSFHIGSNAKDP
                     TAFDKAIQNSREVFDAGLRTGHDMHLLDIGGGFSAHNFDAMASSIRQCIGKYFCGIDV
                     EIVAEPGRYFAAGALTLACGIIGRRDAAANDEDKENRHMLYLNDGVYGTFICNIFEPG
                     PQPKVLRASGDFYPLDSEDEYERYTIWGPTCDGTDCVAESVALPKSLAIDDWLYFPEM
                     GAYSTCLSTGFNGFHSDRETIYMSSDPAADIYL"
     exon            1087331..1087568
                     /number=1
     exon            1087651..1088592
                     /number=2
     exon            1088673..1088770
                     /number=3
     CDS             join(1089703..1089988,1090053..1090078,1090169..1090419,
                     1090479..1091016)
                     /codon_start=1
                     /locus_tag="AO090026000381"
                     /note="predicted protein"
                     /old_locus_tag="AO070308000014"
                     /protein_id="BAE59843.1"
                     /transl_table=1
                     /translation="MEGLRRHSVMLDCKLWKDDPIYFFKTLPPYISKYAQRADDASIQ
                     AQIDVFGKDDVGAMPGALGPRGNFAAVTFAESFPDRVAMLAYLNEVLSFYECFEKQLT
                     EMLDATLYANPVPKDPKYDNPVWQANYKNTMTKWPKILENLDPKLGPKCVKSLVALVE
                     GTDMEPKMAHYKTMKEYALDRTNYIAWPVACDNAEFGSQLDLTQDQLDSVRDIFLPLW
                     THSCYVYDYYHYDKEAEIHSTYGKGRSMINSIPLLNRLKGLSVEEAKAWLKQRCFELE
                     KEYLQRKEDYFSENPVEAVPVDLRRWFLSQEDLATGFAIWCATTYHNHPPFGEGYAAP
                     YEKRRKEGALWFEKVTESDQLMTGGFEVRYAN"
     exon            1089703..1089988
                     /number=1
     exon            1090053..1090078
                     /number=2
     exon            1090169..1090419
                     /number=3
     exon            1090479..1091016
                     /number=4
     CDS             complement(1092326..1093498)
                     /codon_start=1
                     /locus_tag="AO090026000382"
                     /note="predicted protein"
                     /old_locus_tag="AO070308000015"
                     /protein_id="BAE59844.1"
                     /transl_table=1
                     /translation="MPGKQFPLKEYIAALAKFLDTIEYQDDNFSHEQRVESLRYVYQH
                     TAKHFDQPIEKAAVTVSPKRLQAVMRTSTLVTVYCWVKCPLDVMVGVSIYFAYIIMLD
                     DSSDTPTTEMKTFCEDLIKGRPQKHLFWQRMNAHLTNFLRYYDGFCAITIFRSTLDFF
                     QGCWIEQNNFGGFPGSSYFPHFLRRLNGLGGISSATLFPRSEFDEGTVFEEIVTAIAQ
                     IEPQLTLCNDLISFYKEYDSPRDQINLVSNLAHCNGVSWEIAFEELTRDTILYCEQLV
                     TVFKGKDPKVEATVRAFVHGYVIWHLCDPRFRMQEVYEQAGQSEADLKFRHFYEQATS
                     IGVIDFKLWASPSRLSSDKRKHEQAFGDDPQNGKTRVLESIGQANASEAVALAPLA"
     exon            complement(1092326..1093498)
                     /number=1
     CDS             join(1094103..1094337,1094399..1095249,1095366..1095476,
                     1095538..1095704,1095786..1095957)
                     /codon_start=1
                     /locus_tag="AO090026000383"
                     /note="cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies"
                     /old_locus_tag="AO070308000016"
                     /protein_id="BAE59845.1"
                     /transl_table=1
                     /translation="MLDTISESRPNGLATLGVVVATFATYLALKALYNLYLHPLRKFP
                     GPKLAAIGPYYEFYYDVMKDGMFLWEMERMHQVYGPIVRVNANEIHIRDPHYYSTVYA
                     GNHRSTDKYHDAVAAFSVPQASLATIHHKVHRLRRSILNPYFSKAAVTRLESAINERI
                     ERMCSRLEETMHYGQVVDLDAGFAALTADIVTTYFYGQNFDYLGNEGFKFQVRDAILG
                     LIQFYHFTRFFPWIANTIKKLPIPIMRLIHPGAAYLVSSQEEIKDSIRASLDKGNKAD
                     AKSVIVQALEDPTIPPQERTLDRLGDEGTTIIFAGTETTARALSVGMFHILNNKTILK
                     KLREELDTLPGVSSGVYSHVQLECLPYLTGAVQESLRLSHGPAIRLPRVANDKALKYG
                     DYIIPPGTPVSLCTVLVHQDPCIFPDPHRFDPERWVKASKEGVNLDKFIAAFTKGTRQ
                     CLGINLAYAEIYLTFAKLIRTFNMEIYDTTVDDLTVHHIRLTGAPKQGTGEVKVKVTE
                     KIL"
     exon            1094103..1094337
                     /number=1
     exon            1094399..1095249
                     /number=2
     exon            1095366..1095476
                     /number=3
     exon            1095538..1095704
                     /number=4
     exon            1095786..1095957
                     /number=5
     CDS             join(1096818..1097070,1097124..1097466,1097500..1098547)
                     /codon_start=1
                     /locus_tag="AO090026000384"
                     /note="predicted protein"
                     /old_locus_tag="AO080532000185"
                     /protein_id="BAE59846.1"
                     /transl_table=1
                     /translation="MDFGGILLHLEARSMATVLIAGLLVYWVGSAIFLAVVHPLAKFP
                     GPKLAAASDWWLVYHEWFLGKSLTDILFDLHQNYGTINVPYGGLQDLWLDMDRIAYVV
                     QSLTWESALEANSLVKLHFSSMQAYSDIYNVKSKWDKDPEVYKAIVDTSSAFGLRNYH
                     EAKERRDLIWPFYSRQSVQRMQKAINRQIGYRELFRTRTFLVDQLDKQNQEGKLSNMS
                     MAFRCLAQDIMADICLGKSFGTLEERDFGSPLIHALDEGLESYVLMKSFPTLRNILYS
                     ISAMVTLPGEAEFATYGTIVADHVTRGIQQPDTIPPNTMLGFLVPTSSNTAKEAPQPK
                     LSQGHMTEELQTFVIGAGETVASAMVQGLSGILQSPDLYKNVYEEIVQVWPETDGPVP
                     PIEVLEKLPLLTAVIKEALRLTHGVVTPLARVISAGGACIDGHHVPGGTSVGTSHVFI
                     HMSSDYYDAPDEFRPERWLGSSSDKHLVAFSKGPRGCMGINLAWCQLYLVLATLVRTV
                     QMEYPADLNDIKIKWKDCFQPLYYGRPLQVRCTRAEGHS"
     exon            1096818..1097070
                     /number=1
     exon            1097124..1097466
                     /number=2
     exon            1097500..1098547
                     /number=3
     CDS             complement(join(1098802..1098829,1098914..1099417,
                     1099484..1099578,1099648..1099972,1100061..1100165,
                     1100259..1100413))
                     /codon_start=1
                     /locus_tag="AO090026000385"
                     /note="predicted nucleoside-diphosphate-sugar epimerases"
                     /old_locus_tag="AO070308000019"
                     /protein_id="BAE59847.1"
                     /transl_table=1
                     /translation="MTLNSTSSLTFSSPPILSARLAATPLLSAAQLVGTGHKTQILRC
                     RSSHRILFMKEALVFQAIALVIAIVVGVSVEAPILPALPYIYVSPPVTMRYLITGATG
                     GLGGHILEYFIAQIPFSDFAASSSSPENRSRFESRGVNFRHLDYENPTTLNRALHDVE
                     NLLFISTNANVIDVEKVKRQHRNVVEAARKANVKHVWYTSLPFGGLTNDSEVSVQRAH
                     LATEKMLKESGLTFTCIREGIYVEGFPLFLNWYPETTLLTLPRDGEIAFTSRVELAVC
                     TARLMIQGGFENRIVLLTAGETITAKELVSVINETTGRRVELRYVSPDEFVDAGPRND
                     RGGKSRAFFETLVSLWESAASGELRTMDGLMAEILGRVPIPPRDAVRQLLVENRDHTW
                     HQITISVFLFG"
     exon            complement(1098802..1098829)
                     /number=1
     exon            complement(1098914..1099417)
                     /number=2
     exon            complement(1099484..1099578)
                     /number=3
     exon            complement(1099648..1099972)
                     /number=4
     exon            complement(1100061..1100165)
                     /number=5
     exon            complement(1100259..1100413)
                     /number=6
     CDS             1102148..1103401
                     /codon_start=1
                     /locus_tag="AO090026000386"
                     /note="predicted protein"
                     /old_locus_tag="AO070308000020"
                     /protein_id="BAE59848.1"
                     /transl_table=1
                     /translation="MAEVTFPHHWRDYRWRHGGNVVTVRFHGEGLNKRSNLERCCDDI
                     LRAAEEEGVQMVKGASLGFSTTRIFVADAFFENTDPFLRISVGVQSEDIETVARAVLS
                     GIKRYCMSAVPVNLDVGQRLYDAKFYKAMASMLEVRARYAKDRVVFMEGEWLVPILKA
                     LGAREEDFDALQQVSHHLGKDPTVDYRTIRNGLFYFNFENKTIQRFQKQRFTLTVQEN
                     YKRHDSGLPRDFPEVRGDLQYNTVLQALMVAKAFIMNKVDVEPRAHLDYSSPNFLCNV
                     FNIRTFTEKNILGEPTLEGVHADGADHTMTTFLGCTNMRSDSGITFIHDQKEITGIPA
                     TEAQPSLIKHRFQHRHFLDSLLFADNEAKHSLTSVFQEDVSKRATRDMLLFLTRKPKL
                     AGHSSGSVDAMEPHKTLPINVPLWL"
     exon            1102148..1103401
                     /number=1
     CDS             join(1107065..1107406,1107473..1108408)
                     /codon_start=1
                     /locus_tag="AO090026000388"
                     /note="predicted protein"
                     /old_locus_tag="AO070308000022"
                     /protein_id="BAE59849.1"
                     /transl_table=1
                     /translation="MGDAVKILKEANSPFAIRGGGHMPIANAANINSSGVLLSSFGLT
                     QLSLSDDQSTVNVGPGNRWSNIYDYLEPNGLTVVGGRLGHVGVPGYILGGGVSYFSNE
                     FGWASANVASVTVVLADGAVVQVTPENEYSDLFWALRGGSNSFALVTNFELKTIKAPK
                     VMIGMVSYGSDVAEKFIDAIHSFTVDGSKDPKAATIPMAEYIPALGAASYSAILFYNG
                     ENESPAALESFLGSDLKATTSTFSSRSMSDWSKELDPALSLLKGSKQRFYVLNIHASN
                     KQAISIVHDTFMEVAREDLPVGVLVAALAFPAVTEKFITASTVNGGDPQSLDVNGAPY
                     IWVEESITSAAIVSDNDVDAFYEKVNGQIVKNLQAAGIEMAKFIYLNDANPSQDVFST
                     FPPENLERLRSIRSKYDPDRVFTDLMPGGFKVA"
     exon            1107065..1107406
                     /number=1
     exon            1107473..1108408
                     /number=2
     CDS             1112020..1114797
                     /codon_start=1
                     /locus_tag="AO090026000390"
                     /note="predicted protein"
                     /old_locus_tag="AO070308000024"
                     /protein_id="BAE59850.1"
                     /transl_table=1
                     /translation="MPPLSAYTPFESLLFFQSLAALDSRPTSFVSISDVLRNNPFIRQ
                     NGTFDAGRLAPEALEELYTTLMRDGETSADIISSLEPNGHHVESNGTNPKKRKITSPR
                     PDGLVDKGMSHAAIIPDLVSHLYARYKELVTREIRNEEARYKEIKDEIERLQKEERET
                     PKESVPTPVIQKPTPQAPEPKLEPEPEPMDVDAKEERPAQIQPKDANKPSIELVPGND
                     TKQYRVELQSKEEDIAKQPPVSTPHPAPVEEQRVPVQPVVPPQGRPVSTQVQSQLPPP
                     RPSQQQPACRQLMPQTTPKPPQPQALNGKPAATPKQPPLAPRDTPVNQTPTNILAVQK
                     PMPPSATPVPGIGSVPSPPATSSQAPQNTNAPAVSPAHQKPISTAKPAGKEGPPKTPA
                     TTAPRPPPQPSFQQWSLNPPPQTPRPASSQPIPEPSGQTTTGRPFPSHPPQPLPEPET
                     KAAYQTPQPTTVPSTPQPISTVAQSPAPSGYGTGYETPAGAAQALFYSETRSARPRLT
                     IATPGNLTPWKKTPRLSIPVSPRSPERPRREDVSPISEKAPSLMGSREATPEEPVPPP
                     RKRGRNEGKGSGRGRESELAGAEVDGKGGLKPKVEKQTGKGRDRSATSSRSRGRSVLS
                     RDEESESVYPGKIKHEMPSTPAGISEAAEPEPRPSSGRKGTAASEDRPGRGRPKRKRG
                     ASEALEAEALPPEINHISRIDPNQSTSYVLCARNFPRTGAPIMNDVTTHKHASIFTKP
                     LTERDAPGYRDLIYRPQDLKSIKSSIHQGSKAVAAATEAANTPAADGESPAPNGGTPS
                     KNAVLMLQKTEDVIPPKGIVNSAQLEKELIRMFTNAVMFNPLPQRGFGPAFPMTSDSG
                     SRESTQVPELDEGGIINDTIEMFEDVEQAVTRWRAAERTADELASKSILSLRRGSASD
                     LNTDSADEVKG"
     exon            1112020..1114797
                     /number=1
     CDS             complement(join(1115065..1116224,1116287..1116437))
                     /codon_start=1
                     /locus_tag="AO090026000391"
                     /note="diphthamide biosynthesis protein"
                     /old_locus_tag="AO070308000025"
                     /protein_id="BAE59851.1"
                     /transl_table=1
                     /translation="MEETTANGSPVNSTLRQPKKRFVGRRTADAQAQKEQSSSQNDVE
                     STSIQKAAPRRTPRTLNQVPPEILEDPEIQAAIDLLPKNYSFEIPKTIHRIRSSGAKR
                     IALQFPEGLLIFATTISDIITQFCPGTETLIMGDVTYGACCIDDYTARALGCDLLVHY
                     AHSCLIPVDVTQIKTLYIFVDISIDTSHLIATLERNFQPGKTIATVGTIQFNATLHGL
                     KPVLERAGYKVIIPQITPLSKGEILGCTSPQLSSEEIDLLLYLGDGRFHLESAMIHNP
                     SIPAYRYDPYSRILSRETYVHDEMHTLRRDAINTAKSAKKWGLILGSLGRQGNPNTMA
                     MIENHLNERGIPFVNLLLSEIFPGKLASMSDVECWVQIACPRLSIDWGYAFPRPLLTP
                     YEALIALGVRESWDTANKGVYPMDFYAKEGLGRTKPSQAIPGTA"
     exon            complement(1115065..1116224)
                     /number=1
     exon            complement(1116287..1116437)
                     /number=2
     CDS             join(1116774..1117028,1117126..1117923)
                     /codon_start=1
                     /locus_tag="AO090026000392"
                     /note="isopropylmalate/homocitrate/citramalate synthases"
                     /old_locus_tag="AO070308000026"
                     /protein_id="BAE59852.1"
                     /transl_table=1
                     /translation="MIKFRPRLSLFTALRAAPPTRRFATEARLTSDHVRIVEVGARDG
                     LQNEKKSIPLETKLQLIEKLSKTGVTTIEAGSFVPAKWVPQMASTAEICEKLLTSPPQ
                     SQNAIAYNYLVPNIKGLENLVKIMDIAGAPAENTKSSTSTEISLFAAATEAFSKANTN
                     CTIAESLERIRPIVELAKTKNIRVRGYVSVALGCPYEGPDVPPSKVADITATLLEMGA
                     DEVSVADTTGMGTAPRTMELLQALKAAGIANNDLALHFHDTYGQALVNTVVGLEHGIR
                     IFDSSVGRLGGCPYSKGATGNISTEDLVHTLHSLGMHTGINLEEMAKIGGWISGELDR
                     FNESRAGKATLARIQE"
     exon            1116774..1117028
                     /number=1
     exon            1117126..1117923
                     /number=2
     CDS             complement(1118534..1118986)
                     /codon_start=1
                     /locus_tag="AO090026000393"
                     /note="predicted protein"
                     /old_locus_tag="AO070308000027"
                     /protein_id="BAE59853.1"
                     /transl_table=1
                     /translation="MAFSLASRRVLNPVKTLRISTRAFSSHPVLRSSDDKPAFAFGGG
                     PAPPRLPKEEQEIFEELQKKSTGAFSTPRTTPQINQSPHSEPANENPEFKASGNGEEL
                     HPDLRGGLQPEFEGERNPKTGEVGGPKNEPLRWGAEGDWSYGGRVTDF"
     exon            complement(1118534..1118986)
                     /number=1
     CDS             join(1119336..1119464,1119518..1119751,1119818..1120885)
                     /codon_start=1
                     /locus_tag="AO090026000394"
                     /note="acetylornithine aminotransferase"
                     /old_locus_tag="AO070308000028"
                     /protein_id="BAE59854.1"
                     /transl_table=1
                     /translation="MASVRVASRRLPLARKLVPAIESPLQRRFASAATGPNVKTQAKT
                     SLPNPDPAADSATMAFVEERAPFMVPTYVRPAPMMVKGQGCYLWDMENRRYLDLTAGI
                     AVNSLGHCDPEVAQIIAEQAETLIHASNLYHNAWTGALSKLLISKTRESGAMRDASQV
                     FISNSGTEANEAAIKFARKVGKSLDPSGAKHEFVSFHNSFHGRTMGALSATPNPKYQT
                     PFSPMIPGFKYGNYNDVEQLQTLITDKTCGVIVEPIQGEGGVNVATPEFLAALRKRCD
                     EVGAVLIFDEIQCGLSRTGTFWAHAHPSLAPASGEAAHPDILTSAKALGNGVPIGATI
                     VSGKTVAEHIKAGDHGTTFGGNPLVCRVAHHIVERLATPELQNSVEIKSAELISGLKA
                     LQKKYPNVISEIRGRGLILGAQLSQDFTSKASDLITAARERGLLIITAGDGCLRFVPP
                     LTITEDQIKTALKILEQALDAVITKA"
     exon            1119336..1119464
                     /number=1
     exon            1119518..1119751
                     /number=2
     exon            1119818..1120885
                     /number=3
     CDS             join(1121822..1122100,1123789..1123895,1123956..1126197)
                     /codon_start=1
                     /locus_tag="AO090026000395"
                     /note="predicted protein"
                     /old_locus_tag="AO070308000029"
                     /protein_id="BAE59855.1"
                     /transl_table=1
                     /translation="MLLVALSPDYTDGGTISTKIAGIILASVSSGGGELSFLGLTHFY
                     GPFSLAAWGSGTGAAGLVGAGAYALATTSFGLSVKTTLLASACLPAVMVQPLMETPDH
                     VLGRPSTKFRKIQVLAVFLFWTTYLLRGNKHGPPVVRNVSSRLSAKLSVWQTTVGVFL
                     WLYLCRNFAKIVGLECPEPLANLYSRSFFRATWITTALDAGFWTAMKVKPKWLRDIAS
                     LAFTVYYLFAAEQADEKVRRVRATLTVEHLRVSWNKGTTPYLWALASLVRPRLTKYPP
                     RAIRIPRPPQSSYTEPTNAWLYFDGPLSALRDQTCIILDIPGGGYVAMSPRASEDRLL
                     AWAGKTKVPILSLDYKKAPEYPYPYALNECYDVYHTIITTRGRCVGLSGNVRPRVVLS
                     GDSAGGNLAVGTTLMALQSGSSDAPRWQGDHMLPRPDGLVLAYPALNMRVESWMTEEQ
                     MSLIQDKSARRTNENVLRQKNMDYQRLTPFTSPGPSTEDLLRDSSSDLDLEADDVAQG
                     ASKKLEEKLKADNLATQTAAVAQSHHPKQIRTRLAVSSMISYVHDRILTPEMMRAMII
                     LYIGPHNRPDFSTDFLLSPVLAPEALLARFPKTYIVTGERDPLVDDTVIFAGRLRQAK
                     LHQFRERQELGLEKSHRTFNEKDHVEVSLLPGISHGFLQMAGFFPDSWKHINKCATWI
                     QDLFEAAERRKSSSSLLQSLQDSAQYYQVPKSGASSGSPRNHKRSLTGESSGDEDRPL
                     EMSLGRMTPLNPDNSTDNSSSQMRGKPSNGTSHVHLQGSTPNGSDIQSTSGSQGKNAS
                     RGRRSQPKGLSRRRRDAPTKLTMPPAHDYISDAMQTPPPKRRDRSIGSLPSEEDLLDR
                     RMNGLAGGLMGIGEGARTP"
     exon            1121822..1122100
                     /number=1
     exon            1123789..1123895
                     /number=2
     exon            1123956..1126197
                     /number=3
     CDS             join(1128945..1129066,1129134..1130255,1130323..1130401,
                     1130467..1130595)
                     /codon_start=1
                     /locus_tag="AO090026000396"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070308000030"
                     /protein_id="BAE59856.1"
                     /transl_table=1
                     /translation="MQEHKVVSSASSGVTKTVQHHVDFDGPNDPLNPLNWPSKKKVYI
                     CAILGLSTMIVAFASSIFAPAIPVVMLLYGVSKEVATLGVSLYVFGFAAGPLVFGPFS
                     ELKGRYVPLVLSMFGFTIFSFATAVSKDVQSLFILRFFTGFFGSGPLTLAGPAFADMF
                     SPQQRGVPIVMFCLMVFIGPLAGPFTGGFIIMNHSLGWRWTAYIPGILGAAALVVMTL
                     FLEETFQPVILTRKAEHLRRETGDWSLHSEQEEIHLDLRSIIRDNLSLPLKMLVKEPI
                     VLCMCIFGAFVYGLLYLFLTAYPYVFQITRGMNPGVGGLPYIGVIIGTLFGAAATAAT
                     QPWVLRKLKQNNGEMMPEWRLPVAIPGAVLFTGGLFWLGWSGYKGNVHWIVPTASGLF
                     TGFGLLTMFLPSLAYLVEASGDKSASAIAAHTFLRSAAGGAFPLFATQMFDGLGVEWA
                     CTLLGCVGALLIPIPLLLYIFGARIRARSGLSA"
     exon            1128945..1129066
                     /number=1
     exon            1129134..1130255
                     /number=2
     exon            1130323..1130401
                     /number=3
     exon            1130467..1130595
                     /number=4
     CDS             join(1134935..1135149,1135209..1135483,1135547..1136283)
                     /codon_start=1
                     /locus_tag="AO090026000400"
                     /note="predicted protein"
                     /old_locus_tag="AO070308000034"
                     /protein_id="BAE59857.1"
                     /transl_table=1
                     /translation="MKESDLLKSTPSIGNKEYDSYSWELLEDHPLRSHPTECIPGLSS
                     YVAKYLAILKRRWTERIFPIVCLILMFLIVIQFLAALPYGLTYIVFRSGIEEQKGFVQ
                     WPTEFSREPSTCILYNPQARDAIQYAIDAGCSGVKVDLQAQESELLVDSLVSDREAPG
                     TLGTSTDETSPIGLFDEDPARPFTLFLELHTSVQAAWPHLVSQLMPLKQKGYLSYRNG
                     TRVVPRPVTIVLTGLEGLDFGDVVGSDHDNILDSMMFDTSLEQLVKEDYGPTLRVTQS
                     SRGVGGSNSAQTEADTDNLKQSHESSYQLVTATANFTRSIGFPRRGGRFSPQQIERVR
                     AQVRAAHRRGLRARYEGTSDYPPPVRRMIWRILVREGADIIEIDGRGCEIPWWRRFFV
                     TGSMECRGRKGDTGNV"
     exon            1134935..1135149
                     /number=1
     exon            1135209..1135483
                     /number=2
     exon            1135547..1136283
                     /number=3
     CDS             1139743..1141254
                     /codon_start=1
                     /locus_tag="AO090026000402"
                     /note="predicted protein"
                     /old_locus_tag="AO070308000036"
                     /protein_id="BAE59858.1"
                     /transl_table=1
                     /translation="MLGSDADRPARDVGSSSIFSRIPVSSAPFSSAPPPSAPSAMSPP
                     TAPARPSPLEYSSFRRSHTPEKSFSKAQPGRPYRSSSGGMSQPSVAEQTKFGGLSRVP
                     PSSQYPDKPSSAHHSPQVSSAEPSYNETRRFSFSAPAPRPNSQPQHLEAPQRPAGYSP
                     LARSAAAPGGGDGFGGAHQRQASYMGQESQHNRFGGIYVDRHLEEQAHRERERAIAHE
                     QESKAAHPQSRYGPYGERDPAAARQQSAATWELGRSQPPSPEAKRFPAPEPGSGFGFG
                     AIQSYTKSLGSQLGGSRQPPLSIQPRQGQPTPPPHEQPPYLSKLQTEQRLFSSTPSAG
                     PSSLARSASSDDQRRKGSDELLQHRTLLGVGLDAKRGGRASPLPQAVQGAQAQILGPA
                     GEAGIKSELGRVFSGIGSGVGGVTATTGSGPSTPMVASPFKRDSVTAKSANSETTTDE
                     TKIGRPTSANGKRPKRSRDEDGRAETEAGTDGRLAASARGSRRGRHVHHHHHQ"
     exon            1139743..1141254
                     /number=1
     CDS             1141492..1142406
                     /codon_start=1
                     /locus_tag="AO090026000403"
                     /note="predicted protein"
                     /old_locus_tag="AO070308000037"
                     /protein_id="BAE59859.1"
                     /transl_table=1
                     /translation="MGHHHHHHHHHHHHTPRPAAANPPAVTPMREPRTVVTIEPVLSS
                     VAHLPRHHLGSTLYAPRLGVPTEKATLESAKFGYTTTPLPLPRFEGKENCTFTIRVPR
                     FRIDSSHREEICARRALWGTGIYTDDSDPVAAAIHSGFMRGAWGEDVDTDMLDLEIKD
                     AYQHAPKTAQDVGLPDGDRPRVPPVPPSDKDLHIILLILPRLERYDSSVLFGLKSRPW
                     DGTHDGMSFKVLRTEWVDEGVGRGEERGGEARRKRLRNMMQTGRICTGPGVLKLEHLR
                     NGIQITRQKTKVMESQEPQPAAPVQTVS"
     exon            1141492..1142406
                     /number=1
     CDS             join(1143682..1143718,1143806..1145468,1145528..1145660)
                     /codon_start=1
                     /locus_tag="AO090026000404"
                     /note="carnitine O-acyltransferase CRAT"
                     /old_locus_tag="AO070308000038"
                     /protein_id="BAE59860.1"
                     /transl_table=1
                     /translation="MAPRRKASSVPEGYVEDLSKGKMLRFEDSLPRLPVPTLEETARR
                     YLKSVHAVVSEAEYENTKKAVEAFVRPGGEGQTLQERLLARAADPKNKNWLTEWWNHA
                     AYLGYRDPVVPYVSYFYSYKDDRARRNPAKRAASVATAALEFKRQVDDGSLEPEYMRA
                     APIAMSSFEYMFNCCRIPADGADYPQKFPAKENQHIVVVRKNQFFKVPLVVDGKPLNV
                     SELEKQFERIYQIAQKSPAVGTLTAANRDLWTDARKKLLAAHPANEQALRDIESSGFL
                     ICLDDATPVTLEERARQYWHGDGANRWYDKPLQFIINDNGTAGFMGEHSMMDGSPTSR
                     LNDHLNNLIFNNKIDLSEQPVRSGLSDPRPINFHLNDEVLEAIDAATKEHRQQISAHE
                     LKVQAYQGYGKGLIKKFKCSPDAYVQMIIQLAYFKMYGKNRPTYESASTRKFQEGRTE
                     TIRSVSDDSVAFCKAQSDPSVPREEVVRLFRTALASHSKYTAEASDGRGVDRHLFGLK
                     KVLKEGEKLPALYEDPAYSYSSSWYLSTSQLSSEFFNGYGWSQVIDDGFGIAYMINEN
                     SLNFNIVCKRIGAERMSYYLNEAASDLRDLLMPDLAAQTEKAKL"
     exon            1143682..1143718
                     /number=1
     exon            1143806..1145468
                     /number=2
     exon            1145528..1145660
                     /number=3
     CDS             1146542..1147801
                     /codon_start=1
                     /locus_tag="AO090026000405"
                     /note="predicted protein"
                     /old_locus_tag="AO070308000039"
                     /protein_id="BAE59861.1"
                     /transl_table=1
                     /translation="MCRMLVQPVHLDRKIEPDFTVDLFVFLDIRFLGPKYRVVIELVI
                     DKEKNCLMVKSLSSVNSCNLMRITVRGLHKKRTNVPIRYLIRFSGYPAYNVRSRVFFG
                     LPFSGFYVALPWRTQSGQYFPRDGRQNIFPSWSWAATQGEVELLYPKSGAILRLKDHF
                     AGPLAMWAVPDVDTGKPRIIRYQSGGSGPSFLTRSSTLLSAVMAYKAGCYPGDPHPEL
                     ETDRTWKQYDELLHKLWPSYDDFFNDALVLLHPDHAQHDLLINHISKRFEHIGKAGMA
                     YIYTQSLRVRAVLSHQSRGYFPNGTMELQTELGDSIGWLFPRTIAYGRLFDLQNPSPE
                     IFFDALALSLGAICLTGFDGHEVNEVCCYDCEGVPMKFQSHFIGSVVDLMIVDTRDGV
                     STRIALGRAFLRIWANASPKSQSFILV"
     exon            1146542..1147801
                     /number=1
     CDS             complement(join(1148045..1148733,1148798..1149541,
                     1150270..1150342))
                     /codon_start=1
                     /locus_tag="AO090026000406"
                     /note="cytochrome P450 CYP4/CYP19/CYP26 subfamilies"
                     /old_locus_tag="AO070308000040"
                     /protein_id="BAE59862.1"
                     /transl_table=1
                     /translation="MTQLRIVEVGSRNSEGIDKDFSDSKVREPPGPKGLPIVGNFFEV
                     YPDHLGNHQRLFEQYGPIIKTTSLGRTTYQTNDPVLSSIVFAESDFFTKKINEAHPLY
                     ALKQPSAGVFLGDTETPEWKVAHKFLPPALGPKAVRHYAPTMQETVEDAFKVFDEFDK
                     QGEAWNVYQYMLKLGSQAVGKLTLGLDFQHFTSPDANLHEMVNLIAELLSLNKKVTSK
                     GDWYAKLPFGDPQKLKQIKVRIIEMVEESIRSAERGGVVDLPLQDAALQASNMVDYAV
                     RATDNKGEKLPKTSLVWALTVATGAGFTTTSSLLSWLIYGLVTYPDMQERLLQELIDH
                     DIDENTQLTADITDRLTFLDKYIKETQRRHNPSFQPGRTAKVDLILPGGYKIPQDSVI
                     IPALHHIHNNPELWDNPQKFNPDRWDTEEVKNRHKAAYIPFAMGPRMCIGFNFALQEI
                     KVFLPKLIYRYKFTREGDGHIEYDPMFQLIRPNNLYVRAERRVKWPPKTEN"
     exon            complement(1148045..1148733)
                     /number=1
     exon            complement(1148798..1149541)
                     /number=2
     exon            complement(1150270..1150342)
                     /number=3
     CDS             join(1152670..1152811,1152894..1153084,1153269..1153343)
                     /codon_start=1
                     /locus_tag="AO090026000408"
                     /note="predicted protein"
                     /old_locus_tag="AO070308000042"
                     /protein_id="BAE59863.1"
                     /transl_table=1
                     /translation="MQLPVSLGLLTVLISSVTARYYDWGEYHPKAYCTAHIYYCGKTL
                     LTVGNYRDQIKDVLRSEGYPLDDWHINNVLLYCRKGTSDELGFERMPKYQCYDGGDGR
                     SDYVDDVGPVSPYSSSNGKASVQVEQTVIDVVN"
     exon            1152670..1152811
                     /number=1
     exon            1152894..1153084
                     /number=2
     exon            1153269..1153343
                     /number=3
     CDS             complement(join(1154964..1154977,1155009..1155147,
                     1155274..1155330,1155398..1155547))
                     /codon_start=1
                     /locus_tag="AO090026000409"
                     /note="predicted protein"
                     /old_locus_tag="AO070308000043"
                     /protein_id="BAE59864.1"
                     /transl_table=1
                     /translation="MSWYEIGNKNGYNEGYYAGREAALKELKNQEGIDKTKRACLDEL
                     LHRDPQNTYYSSNVIRDFLADFYKALTAPSGHITLQELCQQWRPNDEETFKKLEARFK
                     EAEVTGDQKLSLAGILT"
     exon            complement(1154964..1154977)
                     /number=1
     exon            complement(1155009..1155147)
                     /number=2
     exon            complement(1155274..1155330)
                     /number=3
     exon            complement(1155398..1155547)
                     /number=4
     CDS             complement(join(1160221..1161045,1161606..1161614))
                     /codon_start=1
                     /locus_tag="AO090026000410"
                     /note="NADH-cytochrome b-5 reductase"
                     /old_locus_tag="AO070308000044"
                     /protein_id="BAE59865.1"
                     /transl_table=1
                     /translation="MEKSGFMRYPSRIKSRGLKKQNPHLAKGFLEPKDYKNLPLIRKD
                     QLAPNVYRFVFELPGPRDVIGLPIGQHVAIKANVNGAAVSRSYTPTSNNLDLGRLELV
                     IKCYPDGILTGQYLANLKVGDKVQFRGPKGAMKYHSGLCKKIGMIAGGTGITPMYQLI
                     RAICEDDTDTTEVSLIYANRTEEDILLRSELEAFARKYPKNFKLWYMLDHPPKNWAYG
                     NGYVTPEVMAAKLPGPAPDTKIMLCGPPGMVNASKKALTAAGFQAPGAVGKMTDQIFC
                     F"
     exon            complement(1160221..1161045)
                     /number=1
     exon            complement(1161606..1161614)
                     /number=2
     CDS             join(1162514..1162622,1162659..1163294,1163350..1163971,
                     1163992..1164457)
                     /codon_start=1
                     /locus_tag="AO090026000411"
                     /note="3-hydroxyacyl-CoA dehydrogenase"
                     /old_locus_tag="AO070308000045"
                     /protein_id="BAE59866.1"
                     /transl_table=1
                     /translation="MQLTWQPPQNYRSRPVVVLGAGVLGRRIGMQLNQNARCIWASAG
                     YEVRIRDPSEQQRADGLAYIEENVDSYAQKTGQKPGKYSAHQDMEDAVSNAWLVIEAV
                     PEKLELKIATFAELEALAPEDCILASNSSSYKSSEMIEKVSDATKARILNMHYYMPPG
                     CMIVELMTDGYTDEGVFPFMVERSKEAATLPYVARKQSTGFIFNRLWAAVKREVLTIL
                     AEGVSVPEEIDSMWTEMFIKPRNLPCKTMDQVGLDTVAFIEGHYVQERGLSPEKTVDF
                     LKRNYLDDGKLGNKSPKGGLYSPVEDKKDIVDDKTTAPELLVLDIGLSAANPTTTSGE
                     VLKLSSDGKIQKVLVPNQSLPDGIAVDTTTSRMFWTCMGVPGKDDGAVYSANLDGSSI
                     QTVVPQGRVNTPKQITIDAEAQKVYFCDREGCRVWRCGYDGSDLEAVVDRSDSKDAKD
                     NAVSDCSWPGQVLLDTEGPSKSGKGRIFCANIATPEGQSGASRDDIQLVLGDLPEPID
                     LELDEKSNTLYWTDRGEVPLGNALFKAQLDESGLPVPIKSDKKYEMLTKHLKEAIGLK
                     LDLGNGHIYLTDLGGNIYRCNLDGSHKEKIHSDDYRAFTGIALL"
     exon            1162514..1162622
                     /number=1
     exon            1162659..1163294
                     /number=2
     exon            1163350..1163971
                     /number=3
     exon            1163992..1164457
                     /number=4
     CDS             complement(join(1164613..1164976,1165032..1165214,
                     1165265..1165545))
                     /codon_start=1
                     /locus_tag="AO090026000412"
                     /note="predicted protein"
                     /old_locus_tag="AO070308000046"
                     /protein_id="BAE59867.1"
                     /transl_table=1
                     /translation="MLSDMTGLPEAVASAYIPTDLPRLADCWVTMIHLSKLLGDVLSL
                     SYRPLGPHPSLQQVEATETEILLFQFPDNSDADRSRLATFYMYHLQLHYQALLITFYR
                     PYITKVPEGLPVAQQQAWRSQIRNKMDAAALQTNSIVDNLAREKLLEFGGPMTPPLLV
                     PAMQVHLLNCKSSDGFIRRLGLNKLELCMMILEQMQHTYPSASIFRGIFLGAIRQVFP
                     DYMVQPSKPGTAAPEYPILQDAPLDDPAASMVISDDVIGALMDEASTYNFWETFSWM"
     exon            complement(1164613..1164976)
                     /number=1
     exon            complement(1165032..1165214)
                     /number=2
     exon            complement(1165265..1165545)
                     /number=3
     CDS             complement(join(1170280..1171203,1171279..1171446))
                     /codon_start=1
                     /locus_tag="AO090026000414"
                     /note="predicted protein"
                     /old_locus_tag="AO070308000048"
                     /protein_id="BAE59868.1"
                     /transl_table=1
                     /translation="MDWDKLLFNAAVFVAGVFMLDYGADKFIDHTVIIGQRLGVSQTL
                     IAVLTAGAEYEELAVVVAAVLQKQSPLALGNVMGSTISNILGAFSLGLLLHPGPIAFD
                     QSAKVYTALLLSITTAFYILTYFNMLNKITGGVLVAIFLMYIICTCYAIHKGAMEPPE
                     ASDSDSDSDDDASDDEHSYSTSRPQDSRVQDESETSPLLTHEEALVAKKSAPRSLFYH
                     ISQLVMGLLTLTISGYLLSRSASVIADCFHLSGTVVGLTVVSFATTLPEKMVAIISGS
                     RGHSGIVVASTAGSNIFLLTLCAGVIALAGLSADKSDHVLLFELLFTWISSVMLFLAV
                     FVRADRAVGALFLVMYVAFLILEFTVYRR"
     exon            complement(1170280..1171203)
                     /number=1
     exon            complement(1171279..1171446)
                     /number=2
     CDS             complement(1172776..1173450)
                     /codon_start=1
                     /locus_tag="AO090026000415"
                     /note="predicted protein"
                     /old_locus_tag="AO070308000049"
                     /protein_id="BAE59869.1"
                     /transl_table=1
                     /translation="MYDSSGGSKDLLLECRQVRGAFGGACANCKSMARRGAFTPELFN
                     RGPTVDDWACEIRERGELYKITWTHWEVARGSCHSRWQQPGVYLARSRAKLLYALESG
                     KLGPEGEEVNMLAKVRRYIELLRTMSFRDFPTEDKSKALLAFKKASQRAIQNSQVLVS
                     TNNNVGDCMIASNFGLNAQGIIVTRDEDTKECETSAWIPLTELLHGDRVTESSVVMMR
                     NSLDQQ"
     exon            complement(1172776..1173450)
                     /number=1
     CDS             join(1174256..1174334,1174423..1174551,1174853..1174903,
                     1175081..1175130,1175273..1175331,1175430..1175621,
                     1175882..1176014)
                     /codon_start=1
                     /locus_tag="AO090026000416"
                     /note="predicted protein"
                     /old_locus_tag="AO070308000050"
                     /protein_id="BAE59870.1"
                     /transl_table=1
                     /translation="MAQSFSPRSASLMAFSAHRRQSSLSESHKLNPKPDQWPTQQGSI
                     LVHLRRVGRKYGCSVEERPGLLRLLAIHCVVPLYSQFVVDSEYSVAKDRTASRKSWSS
                     SLLREIHSSSTVENTVFCSFLSSSSFTFPVFPNCAEKRQPAAMKRLAMYFASRKPSFR
                     LSITCWRHPAANKVCPDRRASAAHGKRPPMSQINHYSPDKYRFIFRGKLKHRFFEYEG
                     APVFCNVEIAFG"
     exon            1174256..1174334
                     /number=1
     exon            1174423..1174551
                     /number=2
     exon            1174853..1174903
                     /number=3
     exon            1175081..1175130
                     /number=4
     exon            1175273..1175331
                     /number=5
     exon            1175430..1175621
                     /number=6
     exon            1175882..1176014
                     /number=7
     CDS             complement(join(1176594..1176642,1178426..1178622,
                     1178685..1179442,1179639..1179792,1180077..1180099,
                     1180217..1180349))
                     /codon_start=1
                     /locus_tag="AO090026000417"
                     /note="predicted protein"
                     /old_locus_tag="AO070308000051"
                     /protein_id="BAE59871.1"
                     /transl_table=1
                     /translation="MAEGDAPKKDSTAKDNSRNSPASKGENAAAGTHASPKKRRKVNH
                     ACVYCRRSERPCTRCIKRNIGHLCHDEPREPSKRARSEHEHSVGDDESVQNNDFSNVL
                     QVLGYNDWLGGQSQFQDMHTFHPSYMFNAPEVTNEYNLLGDFLSNSLLDDGSMFQNDD
                     LQGIYSDPTLIGSMATLGGGPNAALLQQSQPPPLTQTQPSQGESIQGPISGAVNDKAR
                     ETYYMTAADPSGSDPPEERMNKLLKAKYDAGLLRPFNYVKGYARLNQYMEKNLQQASR
                     QKILRQLDKFRPKFRERMQSLTDIELILVEMWFERSLMEYDRVFASMAIPACCWRRTG
                     EIFRGNKEMAELIGVPIETLRDGKLAIHEIIVEDQLVSYWEKFGAIAFDNTQKAMLTS
                     CTLKSPDSNAPGDGIPCCFSFTIRRDPHNIDGPMSLLSRRFSLRF"
     exon            complement(1176594..1176642)
                     /number=1
     exon            complement(1178426..1178622)
                     /number=2
     exon            complement(1178685..1179442)
                     /number=3
     exon            complement(1179639..1179792)
                     /number=4
     exon            complement(1180077..1180099)
                     /number=5
     exon            complement(1180217..1180349)
                     /number=6
     CDS             complement(1183221..1184618)
                     /codon_start=1
                     /locus_tag="AO090026000419"
                     /note="predicted protein"
                     /old_locus_tag="AO070308000053"
                     /protein_id="BAE59872.1"
                     /transl_table=1
                     /translation="MNMNAPQARSGRDSPQPGPFGCMYSRSLTQIPQSDRIYLADSFL
                     SPMDTPYEPAPAPPPGPALLDDNESNMLDNFFTTMNSNHFTNDFWLQGQQNKSLGPPN
                     FEWSDELPPTFEGSTTSLSQPSLPHRGLDKSGMDILPNHSNSDIFAAASMLYQNGMNG
                     AGLVAPFAHHPFSSFSNMDYNNTHMNGRVKPHQPQSVPSKQSNTLTGARAPLAYHTSE
                     MLFDVRDPISAEQQATAKVRPLHWGSDVSFMDQGYVAPPDQPNVEEQTQELLRHLESL
                     EPQSSAANTRAPSPERITGHHSAHWTGPDATGPLSDLRREYRDSMEDLSQPKKRQRTL
                     IKEEEDENSEDDTKPRSRRSKSTSYGKNRRMSTETIRKSKVQQGAKPARENLTEEQKR
                     SNHILSEQKRRNLIRQGFDDLCTLVPGLKGGGFSKSAMLTQAADWLEEILRGNEILKA
                     QLADMKAVNGLVMPR"
     exon            complement(1183221..1184618)
                     /number=1
     CDS             join(1186057..1186112,1186145..1186349,1186501..1187682,
                     1187844..1187966)
                     /codon_start=1
                     /locus_tag="AO090026000420"
                     /note="predicted protein"
                     /old_locus_tag="AO070308000054"
                     /protein_id="BAE59873.1"
                     /transl_table=1
                     /translation="MDSTGLTGKGRNINQLLKPRRMRSRTLVHVTFSGVLLRLLTGLL
                     LVYPHSILRAYIIGYLSSTTPRVISSLRQVWRNDSNYQQKRRVLIRALTSAIRLESFP
                     TFCASLVGGSTVFPLVIFRLAELLSQRLGFKCSQSGSAKFLRLSRLVCAFLSAWLGFG
                     LLNRKPIRLQGDERTLAHIGNNEATGEQQGCPNTIPNRPQFSGRTMDLTLFSFTRAMD
                     LVACIIWARWRRWRSARGRWSRAESLAPKLADSGVFAASAAVVMWAWFYLPERLPKSY
                     GKWIGEVAKVDSRLIEALRRARRGVFVYGKDTGQAPLLESMCKDYGWPIEWGDPSKTI
                     PIPCEMVHMSCGPNCEKHAVSRFARTFGFACATYIPLQIVFRLRRLKSVLSLRRAVSD
                     ALRSSAFLASFVSIFYYSVCLARTRIGPKIFPRDVVTPMMWDSGLCVGAGCLMCGWSI
                     LVESPSKRQELALFVAPRAAATVLPRFYDKQYQYRERITFAVSAALLLTCLQERPGMV
                     RGVFGRIATSVLK"
     exon            1186057..1186112
                     /number=1
     exon            1186145..1186349
                     /number=2
     exon            1186501..1187682
                     /number=3
     exon            1187844..1187966
                     /number=4
     CDS             join(1188451..1188502,1188581..1188641,1188692..1188761,
                     1188825..1189266,1189323..1189372)
                     /codon_start=1
                     /locus_tag="AO090026000421"
                     /note="cytochrome oxidase assembly factor COX11"
                     /old_locus_tag="AO070308000055"
                     /protein_id="BAE59874.1"
                     /transl_table=1
                     /translation="MYGRIISPWARYTLPGTGQNASAPFNTPQAQKRNASTLYYTASL
                     ILGTVALAYGSVPLYKMICQQTGWGGQPILTHRGGDADTASRVTPVTDARRLRITFNG
                     SVSDVLPWKFTPQQREVRVLPGETALAFYTATNKGPSDIIGVATYSVTPGQVAPYFSK
                     IQCFCFEEQKLNAGESVDMPVFFYIDPDFTKDPQMKGIDTITLSYTFFKARYDDNGVL
                     KPIPTN"
     exon            1188451..1188502
                     /number=1
     exon            1188581..1188641
                     /number=2
     exon            1188692..1188761
                     /number=3
     exon            1188825..1189266
                     /number=4
     exon            1189323..1189372
                     /number=5
     CDS             join(1189999..1190085,1190150..1190772,1190829..1190997,
                     1191052..1191150,1191207..1191262,1191317..1191341)
                     /codon_start=1
                     /locus_tag="AO090026000422"
                     /note="replication factor C, subunit RFC3"
                     /old_locus_tag="AO070308000056"
                     /protein_id="BAE59875.1"
                     /transl_table=1
                     /translation="MALLVDKLRPRSLEALSYHHELSARLKSLAQSGDFPHLLMYGPS
                     GAGKKTRTIATLKELYGAGVEKIKIDARVYQTTSNRKLEFNIVSSVYHLEITPSDVGN
                     YDRVVVQELLKEIAQTQQVDLSAKQRFKVVVINEADHLSRDAQAALRRTMEKYSPNLR
                     LILLANSTSNIIAPIRSRTLLVRVAAPTEDQICSVLSAAGKREGWPEAPGLNKKIAKE
                     SGRNLRRALLMFEAIYAQSEKVTENTPIPPPDWEVLISITADEILAERSPARLLQVRA
                     RLYDLLTHCIPPTTILKTLTFKLIAKVDDALKPDVIKWSAFYEHRVTQGSKVIFHLEA
                     FVAKFMRIYESYLMGMDF"
     exon            1189999..1190085
                     /number=1
     exon            1190150..1190772
                     /number=2
     exon            1190829..1190997
                     /number=3
     exon            1191052..1191150
                     /number=4
     exon            1191207..1191262
                     /number=5
     exon            1191317..1191341
                     /number=6
     CDS             complement(join(1192424..1192596,1192665..1193129,
                     1193198..1193255))
                     /codon_start=1
                     /locus_tag="AO090026000423"
                     /note="mitochondrial ribosomal protein L16"
                     /old_locus_tag="AO070308000057"
                     /protein_id="BAE59876.1"
                     /transl_table=1
                     /translation="MASTMKMFSGPQLALFRPTCLSTTFTASPLSRCFSTTSPALDWL
                     TPKFMETSKSPKGRPHVATGGSSRGTTVVWGDYGLRMKDHDRRLPASSLKIAEETIKR
                     RLRGMNYTLYKRVSANIGVYTKGNEQRMGKGKGKFDYWTAKVGVSRIVFELKGDIHEK
                     VAREAFRLAGHKLPGLWEFCKKGDPPVVGLTKLGNGVTLESLKRPRRSPALGAANMST
                     PPSSTSSSPSASQ"
     exon            complement(1192424..1192596)
                     /number=1
     exon            complement(1192665..1193129)
                     /number=2
     exon            complement(1193198..1193255)
                     /number=3
     CDS             join(1193599..1193744,1194008..1196412,1196466..1197079)
                     /codon_start=1
                     /locus_tag="AO090026000424"
                     /note="replication factor C, subunit RFC1 (large subunit)"
                     /old_locus_tag="AO070308000058"
                     /protein_id="BAE59877.1"
                     /transl_table=1
                     /translation="MPADIRSFFGGKPSSSQGSSASLAKPPAKKEVRKAPLPNLPFQL
                     LKFALKPDEPQGEVTTTSDYFASSKKRGRPAKTSTATPIKEPQPPNDTISEEGKASKS
                     PRANKQTEKKEALKRPTRESKRNATTVLDDERLGGDDIFATEFGKPGKGDDDYVEDEH
                     SEKDSDLEELAVKPATAASSRPGRKKPASKLAPDDDDVVMEDAPKQPKRATKSAASQP
                     GRKRKSEALGKEEDDEPQEGPKKVTSPSKASSTARAPKKPKGSPSKKDQPESKEIQSI
                     FDSIPTVRPPSPPPESGDKKKFNPFAARARSPAAAGTAEIPVGAENCLAGLSFVFTGV
                     LDTLGREEGQNLVKKYGGKVTGAPSSKTSYVVLGGDAGPKKLKTIRDHNLKTINEEGL
                     FELIRRLPANGGDGKAAEKYEEKRKAEDKKIRAMAAEIEQEEKRKAKATSTAAAKASA
                     GSQAPSSSQSPRPEDELWTTKYAPTSMNMICGNKTAVEKLQSWLRDWHKNAKGNFSKP
                     GKDGTGIYRAVMIHGPPGIGKTTAAHLVAKLEGYDIVETNASDTRSKKLVETGLLGVL
                     DTTSLQGYFAADGQKVHREKKNMVLIMDEVDGMSAGDRGGVGALAAIAKKTHIPLILI
                     CNERRLPKMKPFDHVTYELPFRRPTAEQIRARLSTICFREGLKIPPPVLDSLIEGTHA
                     DIRQIINMLSTVKLDQQNLDFEKGREMSKAWEKHVILKPWDIVSKILSAQMFSPSSKA
                     TLNDKIELYFNDHEFSYLMLQENYLRTRPALSGNYQGKEQKLKLLELADNAASSISDG
                     DLVDRMIHGTQQQWSLMPTHAVFSFVRPASFAYGNMTERAGFTSWLGQNSKQGKLWRC
                     TREIQGHMRLRASGDRDEIRQQYLPLIWDKLVRRLMKDGKEGVEDVIDFMDSYFLTRD
                     DWDALVELGLGPMDQSMVKLDTQTKATFTRLYNQRSHPLPFMKASSVAAPKKMPKEKP
                     DIEDAIDESDDEVLEDDTKEDDESEELDLKKDKYVRVPKKPAAKSAAKGGSGKGKKAK
                     KATDDDFIDDDEKPLKGRGRKAKA"
     exon            1193599..1193744
                     /number=1
     exon            1194008..1196412
                     /number=2
     exon            1196466..1197079
                     /number=3
     CDS             join(1197684..1197706,1197799..1198278,1198347..1200372)
                     /codon_start=1
                     /locus_tag="AO090026000425"
                     /note="stress-activated MAP kinase-interacting protein,
                     Sin1p"
                     /old_locus_tag="AO070308000059"
                     /protein_id="BAE59878.1"
                     /transl_table=1
                     /translation="MSLLHNEDFTIWQLRTSYLSTIKDGIGDRLINVNNSVLNTPGFR
                     AAGWSSASTNPSAQSVAAHIRRTYSPPIPTTAAVTSEYYQLGVSRDANEAQRFGLGED
                     GEEDEGGMVTGKSSTEVIGRRPHGRAGKRTHRKERQQNDSYKQRDAEEDDSSDLSDES
                     DDDVDSQRASQQIKFPKLPIRTRAGSSPIRSTDRQEGPQLMVTSPSHPTMGMHYRTGS
                     LGTAVSVNERPRRDTTTTASSDMSSDNEMGSLASRKQIQFSGQDQVIELASNRRRGAG
                     NRNLGGLDEHPEDSGAESEDSALSSDFDATAGSASLLVGVGITGSLDSSSPMMMHKLP
                     NGTGPQTASPRKAKTPAPELQDLPPPRPISTVQPVSLLSKALNARKRAPTNPVEKFAV
                     LSGKGLTDALNIKLYLPFSSDPEEPIDLPIARESKLAEQPAPVTVVEAIGLALWRYSE
                     EGRQPAIERNKLTVNRWALRMVEDGEVEYDFPALGRTSQIMDFTSNNNRATGARGRGR
                     GKQYDEFALVEASDSEFEENERQFPMESQAVLPEDTNDAASALNVPSAQPTSQNKAPR
                     PNPILGQPFSSALNDNTLTPADRPAVPTSHATPRLGVSKTLKIRFINIEGSTQVTTLN
                     TSTDSYIAEILDSVCKRWGLDKGNYLLKVMGSNTIAPLDRTVEALGNLTELDLVRRRF
                     GPQSLTGSPGSSSPNAPLQIDSGTVPSSKKAKKGGPRMLHPLAQQQDLIGGYYRRYHV
                     FRKQSMSFTASNHKILTFDNDYMHIMPGDTAKTGSDTKTRSISFNDVVGCKVSRRHPK
                     NFRVVVLRGNDANEQKRYDFEARNALEAMEIVDEIKKNMAHYRI"
     exon            1197684..1197706
                     /number=1
     exon            1197799..1198278
                     /number=2
     exon            1198347..1200372
                     /number=3
     CDS             join(1202196..1202933,1202999..1203252,1203319..1203693,
                     1203755..1203782)
                     /codon_start=1
                     /locus_tag="AO090026000426"
                     /note="cAMP-dependent protein kinase catalytic subunit
                     (PKA)"
                     /old_locus_tag="AO070308000060"
                     /protein_id="BAE59879.1"
                     /transl_table=1
                     /translation="MPSLGGLLKKRRTKDSQTLSKELEAGSSPTAAQTQTSPNQHHHS
                     HQSHPTPTATSPDVAYTSAQPHQSSHDHHNCSSGTNQSHPEGQPSSMQSAVTQSPPAH
                     HHHGHHHTNSHNVASIQNIIHSSHQSGQSVGGGSQQSQTRTTKGKYSLEDFSLQRTLG
                     TGSFGRVHLVQSKHNHRFYAVKVLKKAQVVKMKQIEHTNDERRMLNRVRHPFLITLWG
                     TWQDSRNLYMVMDFVEGGELFSLLRKSQRFPNPVAKFYAAEVTLALEYLHSHQIIYRD
                     LKPENLLLDRHGHLKITDFGFAKEVPDITWTLCGTPDYLAPEVVSSKGYNKSVDWWSL
                     GILIFEMLCGFTPFWDSGSPVKIYENILRGRVKYPPYLHPDAVDLLSQLITADLTKRL
                     GNLHGGPEDVKNHPWFAEVTWDRLARKDIDAPYVPPIRGGQGDASQYDRYPEEQEAYG
                     QSGEDIHGHLFPDF"
     exon            1202196..1202933
                     /number=1
     exon            1202999..1203252
                     /number=2
     exon            1203319..1203693
                     /number=3
     exon            1203755..1203782
                     /number=4
     CDS             join(1205675..1205776,1205948..1206018,1206075..1206156,
                     1206211..1206471,1206520..1206948)
                     /codon_start=1
                     /locus_tag="AO090026000428"
                     /note="lectin VIP36, involved in the transport of
                     glycoproteins carrying high mannose-type glycans"
                     /old_locus_tag="AO070308000062"
                     /protein_id="BAE59880.1"
                     /transl_table=1
                     /translation="MLLPRLSSLLCLAGLATMPVANAYDGDENIKSIPPYLDSDFQSR
                     WFDFGGDTIIRADKYIRLTADRPSQQGWIFSRVPLTATNWEIEVEFKIHGNGNLHGDG
                     FAMWLTKQRATQGPVFGSTDNFEGLGIFFDTYKNNRPGTSFPYVMAMMGDGQTSYDQA
                     HDGKANELAGCSARGLRGASIPTKARLTYFQDKSLTLDLQYKSEDSWTNCFTLTAPET
                     NIAIPSVAYLGFSGETGELSDNHDIVSVKSQNLYSVGPSSRSSRGPSADSGRVKKTKK
                     RKGSWSGFLFKTVLFFVAVAGCYVGFTMYRNKQRYSRF"
     exon            1205675..1205776
                     /number=1
     exon            1205948..1206018
                     /number=2
     exon            1206075..1206156
                     /number=3
     exon            1206211..1206471
                     /number=4
     exon            1206520..1206948
                     /number=5
     CDS             complement(1207972..1208940)
                     /codon_start=1
                     /locus_tag="AO090026000429"
                     /note="predicted protein"
                     /old_locus_tag="AO070308000063"
                     /protein_id="BAE59881.1"
                     /transl_table=1
                     /translation="MDPLEPNPTQDPDKQPKPGKFRFKTSKSKSSSRRDDTASTHHHS
                     SHRHTSHRHRSKRHHRRRSASPTPIHSDQQQPGLNADAAFRESLFDALGDDEGASYWE
                     SVYGQPIHNYAVPNVPKGPNGELEQMDEEEYASYVRTKMWERTREGMLAEQERLRAEK
                     ARQKRRDERREEDMREKMRFERAMEESLRRGKERRRVKAWGRVWEEYVRSWGEVDRAV
                     EQVRDTGDCGRGGGEGTKLRNLIFWPVESGKRGDVSRETVEEFMRHAPGEDLLAVLKA
                     ERVRWHPDKIQHRYGALGIDEMVMRSVTEVFQIIDRLWSEMKGKQS"
     exon            complement(1207972..1208940)
                     /number=1
     CDS             1209822..1211054
                     /codon_start=1
                     /locus_tag="AO090026000430"
                     /note="predicted protein"
                     /old_locus_tag="AO070308000064"
                     /protein_id="BAE59882.1"
                     /transl_table=1
                     /translation="MALVSYSDSEGSDSEPETTTKPTTQTTTTKPTTTAAPKPKLVDS
                     SNPRKIRVALDLKPEEKNDNDDGPARKKAKIGGGGAFAGFNSFLPAPKRAAAPAAAEK
                     KGSVGAGRKVFSLKTGATPGFDRGLDEESRNEWAMEQAGSSTPGGRGDDDDGTIPKAG
                     SLRDDGGEGGLQMKKPEEVKLKGNPMMFKPLSVARGTQKKRKVVSSKPVETAAEVSQG
                     VKESVSEQSKPAASASAPVQPPAPKPKVSLFSLGSSEFAASVVPGPQAQSATYEPLVY
                     TADTDAPEAGPEVEREPQVPAVASEPATTQTLDNIADDLNLSRSQRRHLFGRNADASK
                     SRILHFNTDKEYIANQEMAHQTDMAALQHNPVRAIAPGKHTLQQLVNAASSQREALEE
                     SFASGRRNKKEAGSRYGW"
     exon            1209822..1211054
                     /number=1
     CDS             complement(1211288..1226029)
                     /codon_start=1
                     /locus_tag="AO090026000431"
                     /note="AAA ATPase containing von Willebrand factor type A
                     (vWA) domain"
                     /old_locus_tag="AO070308000065"
                     /protein_id="BAE59883.1"
                     /transl_table=1
                     /translation="METRPAYERALEESQLFEQLPNEVAELIRTSSGTQYLNALAVGA
                     LRSKCTEGFFCLYEPIFVDLAARWLASDFHNNQVDIISAFSRILPFAPFLASFASQYA
                     SSRAGPLSALAATDEAMLLQLDDTTLRTLLLSVFRLLSYDLETFSSTISPSRLQSLFQ
                     HSDHSIRYLAIRCFALYMHAADAATEKMVQTYIGTDVVEGEWEGIVIDYRCLGLWEER
                     RWGTLEKQARIARSDRLIEDSLSQVEKLREYFTPRTAEVCGVLIPRLNEMSTPASSIV
                     KAPTAVRNLRRIATALTTSNPLLLVGLPNSGKTSLVNDVAATMGQSESMVTLHLNEQT
                     DAKSLLGMYSTSPATGSFAWQPGVLTKAAREGRWILIEDLDRAPSEVIGLILPIIEKG
                     ELTIASRKERIKCAEGFKIIATMKSSYNIAGEEVAPSTTILGSRLWQRVHIEPLSIDE
                     IQEVITQKFPILESRVPTIMNVYQRLCSSFHGSLAIKSSQGRTPGLRDLIKLCSRMHR
                     RLQRLGAKTGYEAMPEGAEDEIFLDVVDIFLSYIPERSLAESLALVAAEALQISPQRA
                     QFCLSERVPAYSDQGNKLVLGREVCRKIKVPSGSVSRSSTRFASTRAALKLMEQAAAA
                     IQMAEPMLLVGETGIGKTTVIQQLATLMRQKLTVVNLSQQSESSDLLGGFKPVNIRTM
                     AVPMLDEFNAVFELTFSAKKNQKFLSSVAKSVAAGNWARLVHLWHEAVRLADGVFKSS
                     NGPSQEGEEQPTKKRKLDSPKYQHLRQRWERFAGQLNDFEAQVAQGDAKFAFAFVQGK
                     IVRALRNGEWVLLDEINLASPDTLENIASLLHHGTEGSPSVLLSEAGDVERVFGHPDF
                     RIFGAMNPATDAGKKDLPPGLRSRFTELYVHSPDSDRDDLLALIQKYLGDLTLGDMRI
                     APDLAQLYLETKKLSNENKLTDGAGQRPHFSIRTLVRALIYVIDHAHVYGLRRAVFEG
                     FSMSFLTVLSQESERLLLPLLERHLFSNAKNARALLGQTPKPPTDGYDYVQFKHYWMR
                     RGHLVPEEQPHYIITPFIEKNLKNLVRASSTRRFPILLQGPTSAGKTSMIEYLAKVSG
                     NKFVRINNHEHTDLQEYLGSYVSSDDGTLRYQEGVLVEALRNGYWIVLDELNLAPSDV
                     LEALNRLLDDNRELFIPETQEVVHPHPNFMLFATQNPAGLYGGRKVLSRAFRNRFLEL
                     HFDDIPESELEFILKERSQIAPSFCARIVSVYRKLSLLRQANRLFEQKNSFATLRDLF
                     RWALRRADDREQLAINGFMLLAERVRNPQERAAVKGVIEEVMRVRIDEDVVYSASELE
                     KRAPHLPAGVVWTKAMRRLFILVSVALENNEPVLLVGETGCGKTQLCQAVAEAYKRQL
                     LIVNAHVNLETGDLIGAQRPVRNRGAIEHQLLSDLQAVLNETEPSRPLEEMRQVFGTL
                     TADQLQACDSELVQRIQTNIARLNALFEWSDGSLITAMKTGQYFLLDEISLADDSVLE
                     RLNSVLEPHRSILLAEKGPINSMVVADAGFQFLSTMNPGGDYGKRELSAALRNRMTEI
                     WAPQLSEDEDILPILQRKLELNSEHITKAMLEFAKWFKCTFQNSSTTSLSLRDLLAWV
                     EFVNKCRTADPLFAVVQGAAMVFIDTLGANPAAMLATALHDLQGNRRLCLDKLHELFD
                     VDASSIYLQKSTIEIENGALRVGPFALEINGSTEPDPQFILDAPTTIANSVRIARGLQ
                     LSKPILLEGSPGVGKTTLVTALAKALGKPLTRINLSEQTDLTDLFGSDVPVEGGDVGQ
                     FTWRDAPFLQAMQRGDWVLLDEMNLASQSVLEGLNACLDHRQTVYIAELDQSFKRHPD
                     FVLFAAQNPHHQGGGRKGLPASFVNRFTVVYADSFTDTDLKRICAKLFPGSPSWQTNR
                     LVDFVSLLNKAITHERRLGAVGGPWEVNLRDIQRWLQLADRGTLQVSANSFLDVIISQ
                     RFRSQDDRDLVTRLYKQVFSEVPAPNKSYYHNLTPEYMQVGLGIMQRDLYLQRTQQSQ
                     IRILPRDLSILESLMLCIEQSWPSILVGPSGCGKTTLIRKLAAVNGASLIELALSADT
                     DTMDLIGGFEQIDYRREVSSLVHDVSLFLQQQILSMNSAGTALYETPIALEIYENLQS
                     PDASLENICTFLTMLSQTYPQTAFDDMLLRAQDLLETTKQSDRMKVGFEWTEGVLTQA
                     VQHGYWVILDNANLCNPSVLDRLNSLTEPNGALILNEQRTEDGSARIITPHPNFRLFL
                     TMDSRHGELSRAMRNRCVEICFLPQEDETTVATSAPAYTCESFLYRLRPLWNLDPSAS
                     ANDVSRLLCEICLDHLSVMDLAYLQQSLKYFLPYHGKSVGDIVSSAMHRYVSVIHGNS
                     HWKPIECTKKTIELSRASFAIQGPSQPLHPLVNEPLVSLLGSEVPYTSLVTLAHLQES
                     KLDLQLLKQGLLQADESGKLLKPSQMSRLERSLASTRIPSLMKDATQPIGSFLSDCGQ
                     AMYDIIQNLDQDTLQNPHLANALRTVLNFCMDIFRLTAARDIDEGEFQVYLQIGRELC
                     AALSSSFEPLKQLAVALSQALSRFQESWALKTGLSMQRLWESWRPATPATGGQLKSIL
                     DLESVASEFTNIATKTHLDLSQLSQMRSSLVNAQQSIVLHGADEGQLVQNLRQTVSEL
                     ASVVQRSDITAAPYFSNEFETLCQYHDIFTLKHNNKAGDNVIKSILPLLAGRDARPLN
                     VSAFQTQVPEILHRLALYSGSERSSTFGSAISGTFSLSLLEKLTNVGVTILGQMDSLE
                     VEKQTLSKALALSSWEIAMDQHKVLRQVSSTLTMELVLAHKEFFEPQSMEKLVTILRT
                     VEEQGYCANPGLLNIRLEKSLPSDHYFKTFAEQSLPSLVASLATNPVQNNDKSIQDTG
                     AAVVQLAAILLRLYVPDKPFDPSLGLVVQRQRHSQRSLELTDKANAITSFERVFSGQT
                     SNIRHDLIQGELRDLGSAPPPSSVTRPQVSELSILHGEFTSVIKSVLERLPKDILGAT
                     SQDLSESQSLVNLLRDNIRQLSRRLSTHYRSYDDIVVSVVRFLQLLDLGLYLMSGRSQ
                     QSSYVQAVEAISGSTPFLGGVHHPLSDLYHQNSNIDPRHAIDMWFHELSSLRVAENAD
                     PGIIHTQVGRSALSRLFQQFHGLWKAKLREDQEEEAKKASLYQYRGSWEDSEEIDENE
                     LRELFPTYEEETVDDGRKPTRLDPKNISIRLASLHAKLFQPENPGRVLTTYVKQSAQL
                     LASLWSEGGSSVPQVHPRDQLSGVLLLLEDAVNKENDSRNTYNFYVDANPDEGRKLVS
                     LTVATEARFLQIQSAWPEHAVLADVILCCKEILQFKHAEPVAKFLTKVEKLHSLVHEW
                     QLVASKEYSAAGVYDEITNLIINWRRLELSTWARLLDLEKEKCVQDVSQWWFVAYEAI
                     IGAPVQLAESGQTDLSEHTQEVIATLENFFRSTTLGQYSERLQFVKNFRSLLSLYVQD
                     FPCLKQLVFALDNFMQHYTQFEPPVHKLLKERRSTLEKDIKEQIQLASWKDTNIVALR
                     ESAKRSHHKLFKLVRKYREILAQPVQHILEQDMPDDSEEPGSIDQALILPSASFPEAL
                     ALCQKENKIWQSRPPRFRDPDGTVSNMTHMYVSISTEFDVSEDLDGFMKYFLESIKEF
                     RSQTPKTLTEENKDDVQHLKVQKRRFYADTLRRLLEMGVKRNASTSLIETQASVAQVL
                     ASSPALEVGSVTTTVVRSSDLYFHRFLDILPRVRQAAHDYSEDLSNVEVSRSSGSVEH
                     LLHLVRKQRAAISPAMSSVESLQSTLVKISNLWKSNPTLVLKSRPQFSNEVRVTARAV
                     AWLTPILGLAMTVVELHSKFSGVNSSNIVDGLRSWREVFTMLQKSLDSLPELPHGVTS
                     QLHVDTLKEASFSFDKLNTDLTGWAEGRPDLSFVLMQITPWAHINVEQAEALQPKNTL
                     AIEEFDGSLLTAIDKILISLQKLKEVPSLIVSPGSLSRSDEFFSRALKAVHLPDITSS
                     LESVLDKLQGLKTRSNSGLAPAVALVASLLPIMNKYRNICKDLVDRYLTVHRETCKMS
                     YLLAKSFTQIASEGFCTPAEASTEESKSGKLESGTGLGEGQGAEDISNDIGDDEDLSE
                     LAQQEQTEEPNEDMDESGDAVNMDQEELIGETGEHKKEDDEEDASGDEEDDNIDEEVG
                     SVDDLEETAVDEKMWDGAHDEEQKETENQEGKGQSESDEQTAAQERKEKEGEKGEGKN
                     EEDQEEEEEEEEEAPDDEGEAVGREEMDVTDPHAKEQDALDLPEEMQLDGDEMDKDEG
                     DESDDGLDDGLDDDLPPAEDEQPFDGKEEENVENPDLDQSAEEQEGDQGDEEAAPEDE
                     EMKEAEADETNEPGVEEPEEAQQDDFLTQRDENEEAGEEVAPSEAVNGGLGADQDQNM
                     DKGASGNAEQESGSADQSDDKQQKTGAANEGEDNERHRDAGGGDDGNRNDPQLQAFKK
                     MGDILEQWHRRQKEIMEASQQEEGESDQPLPQDTDMADADFEHLADQDDVADTQALGQ
                     ANEEQTQALDQNKGVESDAKHGDNEPLPDASDEPQDTLENKMQDEMQLDAASESKDQT
                     GGALIPGSSHTQERTVDAAGQQEAIEELDEVDAQLAAIHLSSSLPPLTPRDEAQRLWS
                     HYESVTNDLSLSLTEQLRLILAPTMATKLRGDFRTGKRLNIKRIIPYIASQYKRDKIW
                     MRRSIPSKRNYQIMLAVDDSKSMLESGSGQLAFETLALVAKSLSMLEAGDLCVLGFGN
                     EDHVRVAHEFGKPFSAEAGTQVFQHFSYQQTGTNVRKLIADSIALFREARWKQSPGSG
                     NADLWQLELIISDGICEDHETIQRLVRQAQEERIMIVFIIVDAVKGSSILDLTQASFE
                     PDTESGTGEMKLKMKRYLEGFPFPYYLVVRDVRELPAVLATALKQWFAEVVDVSS"
     exon            complement(1211288..1226029)
                     /number=1
     CDS             join(1226471..1227235,1227286..1227438,1227492..1227606,
                     1227654..1227745,1227803..1229275)
                     /codon_start=1
                     /locus_tag="AO090026000432"
                     /note="Cl- channel CLC-3 and related proteins (CLC
                     superfamily)"
                     /old_locus_tag="AO070308000066"
                     /protein_id="BAE59884.1"
                     /transl_table=1
                     /translation="MSRKVPIFWAIHAILIGDIYSISFKRKQKQRSGFSLSNLFSNNT
                     TEFVAGDAGFTSSNTRNGQLHESVSSSRDRPMSNNGNATAQKEGGLLDWYVEGPGRRV
                     GYDDLTAIDWIFEYTKERQRKRHLYSHGQGAVGYVLKFLDASNVWIVLIATGILVGII
                     AAFIDVASDWLGDLKTGYCKNGAGGGKFYLNKSFCCWGHDGKLFFAPRLYPEVSLLNY
                     GLDISNCLDWTPWGKALGVASSGGVFTVEYLFYVLYSVLFAVCATVLVRTYALYARHS
                     GIPEIKTILGGFVIRHFMGPWTLAIKSLGLCLSVASGLWLGKEGPLVHVACCCASVIM
                     KPFESLNHNEARKREVLSAAAAAGISVAFGAPIGGVLFSLEQLSYYFPDKTMWQSFVC
                     AMVAAVTLQALNPFRTGNIVLYEVTYTRGWHRFEMIPFVILGILGGLYGAFLIRLNMK
                     IAQWRRSRSWSRPIAEVVLVALLSALINYPNLFMRSQNSELVHSLFAECGNGGEDLFG
                     LCKTGAASVTTIVLLLMAAILGFFLASMTFGLDLPAGIILPSVAIGALYGRALGTTFK
                     MWQEAYPKVFLFGNCEPDIPCVTPGLYAIVGAASALGGATRMTVSIVVIMFELTGALT
                     YVIPIMIAVMLSKWCGDIFGKRGIYESWIELNEYPFLDQRDDTTPPDVPAHKVMTAVD
                     DLTVITAVGHTIDSLRHLLLTTSYRGYPVVTDTSNPTLLGYISRNELSFALKYSKSPT
                     DRELSGETQVFFAHQPFADPVETLDLRPWMDQTPITLNSGTTFSLVLQMFQRLGLRYI
                     LLSDKGVLQGLLTKKDVWSVLNGPEFRKGGFSRENVVRPVNTAEEVGLLESDDVTSMA
                     SSLERRQSL"
     exon            1226471..1227235
                     /number=1
     exon            1227286..1227438
                     /number=2
     exon            1227492..1227606
                     /number=3
     exon            1227654..1227745
                     /number=4
     exon            1227803..1229275
                     /number=5
     CDS             join(1229929..1230087,1230149..1230697)
                     /codon_start=1
                     /locus_tag="AO090026000433"
                     /note="predicted protein"
                     /old_locus_tag="AO070308000067"
                     /protein_id="BAE59885.1"
                     /transl_table=1
                     /translation="MMVDPFEVRMRFTAQLQHLNASITSSQKAAHYALKYRDMDEDLH
                     SCILEQLERNNMNNRANIMYFIEQFCEMATKEDHAPYVRMIQRDILRVVDAVAPPDGT
                     GAANVKHVRRVLSGLQNKEILSAETVAEIIAGLKDRETHPAHLDLEADEGVEAKAGTP
                     RGSRGSVRVDKRQIEQRIEEDRERNKRLRESMWTVSGDDGDEHGKFWDETSDIGEDDF
                     LAANEEFIERRQMVGAK"
     exon            1229929..1230087
                     /number=1
     exon            1230149..1230697
                     /number=2
     CDS             join(1231221..1231681,1231739..1232237)
                     /codon_start=1
                     /locus_tag="AO090026000434"
                     /note="predicted protein"
                     /old_locus_tag="AO070308000068"
                     /protein_id="BAE59886.1"
                     /transl_table=1
                     /translation="MVTTRRRKISDIVPKEEPEINGQQEVNGRRKSGPAGSGKMETQR
                     NKRRKRASLEAAEGESGTPEEPSEDTQETDSKQEEEKSAPAPKKHFRFDSEEPEVPLD
                     TQIEETAETQQAKEDSGDDSSDDDEAPEAVDNSAQLSKVKAQAKKMEQAKQLEEELKR
                     EKRRQLDELRKSQAKVSKKKDKPVDDLLSESTVTLQGSNTQDARRSALPALLPDDILN
                     AAPVTRPPTPPAEGINIAHKKPTKFRFLEKSEKRPKDVKMGDVTIRVLGDIPQKKAKS
                     ALPPKASKSGRISKQTWLDRSRSTGHVNGLRRTAGGSSGFVRK"
     exon            1231221..1231681
                     /number=1
     exon            1231739..1232237
                     /number=2
     CDS             join(1233022..1234507,1234572..1234648)
                     /codon_start=1
                     /locus_tag="AO090026000435"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070308000069"
                     /protein_id="BAE59887.1"
                     /transl_table=1
                     /translation="MASTAETTPLLPQHQQQPATSNTSPRANRRTVTFNPLTTVSTYH
                     DTTSTNAPVKTLYSGPSSFPSSQETPQRPTGLSALNSKLRRRNSHGAPYSAAPSMPAA
                     PKVGPQRTTKKAQKLKLLPDPITEEAAEGEFPSDVYSQIARIKEPTARSHAARLGKSD
                     RERLPRVTAYCTANSYRLDGAVRFLKSRSKTRGANPKLYDECVYSPFDYQYEEKQRST
                     SENNVGMNNVGMRETFQRPSTERRFSDSVVEIEDNTKSRREDLIDLRDSQAHQSENAI
                     AETQSETPDFDTTIHTPEVFLFDYGTVVIWGMSPAQESRFLSDVSKFATSILSPEDTQ
                     VENFNFYYAREYQARIYNDFISLREPRNHMIKLAISHALAQSVKTSLFEDLVSETISN
                     TAPLPAQIAQTGSVNLTRRQINMQVGELFILRINIHLQGSVLDSPELMWAEPQLEPVY
                     QAVRSYLEMDQRVSLLNERLDVIADLLAVLKDQLTHRHGEYLEWIVIVLIAAEILVAA
                     INIVVDLYAGVD"
     exon            1233022..1234507
                     /number=1
     exon            1234572..1234648
                     /number=2
     CDS             complement(join(1235178..1235534,1235604..1235987))
                     /codon_start=1
                     /locus_tag="AO090026000436"
                     /note="predicted protein"
                     /old_locus_tag="AO070308000070"
                     /protein_id="BAE59888.1"
                     /transl_table=1
                     /translation="MEPSTNQSTSIESSNPPSVELAYKRKCVALKKRLNEIENENDLM
                     RVRNRRGWQYIHKMRLESCILLERLAKVTGMAEEAQAGVNPELRARAAAMLSNAAVLD
                     PGEKEGGGGAYYADDTEGSSDEQPPTPQERPLRVKRSRKSNVGDGADDDAAPSANNAP
                     ESSSAAGSASLPRLAPAPSQEDMTSSFRIQAGNGSAQDKENNTGSGSDRGGSQNPESG
                     SREPGQGEVSVEPTTPMDMDTKESKEDS"
     exon            complement(1235178..1235534)
                     /number=1
     exon            complement(1235604..1235987)
                     /number=2
     CDS             complement(join(1236609..1236660,1236720..1236843,
                     1236908..1237558,1237712..1237802))
                     /codon_start=1
                     /locus_tag="AO090026000437"
                     /note="mitochondrial phosphate carrier protein"
                     /old_locus_tag="AO070308000071"
                     /protein_id="BAE59889.1"
                     /transl_table=1
                     /translation="MAMQERKLPMGKIEPNTGKYFVNCALGGIIGPTHTSVTPLDLVK
                     CRRQVDPKIYTSNISAWRSIFAKEGLRGVFFGWSPTFIGYSFQGAGKYGFYEYFKYLY
                     GDQMFPNMNRTVVYLGASASAEFLADMALCPFEAIKVRMQTTLPPYAQTMREGWSKIV
                     AQEGFGGLYKGLYPLWARQIPYTMTKFATFEETVNAIYKTLGKPKESCSGLQQTGISF
                     LGGYIAGIFCAIVSHPADVMVSKLNADRQAGESAMKAVSRIYGNIGFSGLWNGLPVRI
                     VMLGTLTGFQWLIYDSFKVFLGLPTTGGH"
     exon            complement(1236609..1236660)
                     /number=1
     exon            complement(1236720..1236843)
                     /number=2
     exon            complement(1236908..1237558)
                     /number=3
     exon            complement(1237712..1237802)
                     /number=4
     CDS             complement(1238567..1239130)
                     /codon_start=1
                     /locus_tag="AO090026000438"
                     /note="predicted protein"
                     /old_locus_tag="AO070308000072"
                     /protein_id="BAE59890.1"
                     /transl_table=1
                     /translation="MASWSQHLPDHWLPLVVYTATGGPLMTYQNASIAAIWTYYRAAR
                     ISLQRHLLDLRQTLASLVGDNQACDVHRDAALEEIQEMTTDTCRSIPFSLGDIDALGQ
                     TIPTSAEGRPPIRALYGYLMLWPLWYVLTFGMGTAAQMEQIRSALGRVGSVLGIKLAL
                     MLAQQGSMSQHATALTPNPYRFVPSTS"
     exon            complement(1238567..1239130)
                     /number=1
     CDS             complement(join(1241230..1241412,1241467..1242178,
                     1242241..1242881,1242979..1243398))
                     /codon_start=1
                     /locus_tag="AO090026000440"
                     /note="Cdc4 and related F-box and WD-40 proteins"
                     /old_locus_tag="AO070308000074"
                     /protein_id="BAE59891.1"
                     /transl_table=1
                     /translation="MSPRSVPEQLATAHTRTCSATDSVASLSSTHSRSLSSNKTITSI
                     PPNLLPSAPASPPTPAPSPTPHQRPPTWQSADEDDDAFLLNARIHFSSLSNFKRQKFL
                     EGILSLCDSQHLSFVSSYVSPRLRKDPFLVFPTELCLRVLSFIDDPKTLARASQVSRR
                     WRELLNDDITWKNLCEKHAYASRKSSEDDRDFVDPFHTQHLHTISGTNSLAGSRSSLT
                     SSHQSRDGHPGLTRSLSGDWLASASLSSRKRRVRPLSYRTHFKQKYMVESAWNKGGRC
                     TQRHITPDQGVVTSLHLTPKYIVVALDNAKIHIYDTNGDNQKTLQGHVMGVWAMVPWD
                     DILVSGGCDREVRVWNMATGAGIYLLRGHTSTVRCLKMSDRKTAISGSRDTTLRIWDL
                     ASGTCRNVLVGHQASVRCLAIHGDLVVSGSYDTTARIWSISEGRCLRTLSGHFSQIYA
                     IAFDGRRIATGSLDTSVRIWDPHSGQCHAILQGHTSLVGQLQMRGDTLVTGGSDGSVR
                     VWSLTKMTPIHRLAAHDNSVTSLQFDSSRIVSGGSDGRVKVWSLQTGQLLRELSSPAE
                     AVWRVAFEEEKAVIMASRSGRTVMEVWTFSPPPEEDTDEIVPQSSSSTPGMLPVQDDS
                     RQRAYHSDTPTIPLGNDDDQIMPDAPS"
     exon            complement(1241230..1241412)
                     /number=1
     exon            complement(1241467..1242178)
                     /number=2
     exon            complement(1242241..1242881)
                     /number=3
     exon            complement(1242979..1243398)
                     /number=4
     CDS             complement(join(1245307..1245490,1245553..1246512,
                     1246579..1246628))
                     /codon_start=1
                     /locus_tag="AO090026000441"
                     /note="ZIP-like zinc transporter proteins"
                     /old_locus_tag="AO070308000075"
                     /protein_id="BAE59892.1"
                     /transl_table=1
                     /translation="MEGLFTLLALSIVMAITSFVVGSLPLAFTLSSSQLRLISSLGMG
                     VLVGTSLIVIIPEGVETLYSANLPNDRKALSSRSTGAITWQHQNIPTVATAMIHTSEE
                     INSIKVPVSSSSDTSTLLPVSDSTPYVTRREQKGKEEASDEDKKANDDEGSSPHAWIG
                     IALISGFILMYLIDKLPEFAAPAKQQRTPYHISLDNLGSGLRRNSSPSREGGLLDAGN
                     SPRSSHSFATTTGLVIHAAADGIALGASSSDTGLSFIIFLAIMVHKAPASFGLTSVLL
                     KQGLSSRAARAHLLVFSLAAPLGALATFLFVQVMGSGSSSDLTATQWRTGVLLLFSAG
                     TFLYVAMHTMQENNPSAVSRETQGNGYGDSRDIPSKSNKSMRDLIASVVGMILPLFLQ
                     LGHAH"
     exon            complement(1245307..1245490)
                     /number=1
     exon            complement(1245553..1246512)
                     /number=2
     exon            complement(1246579..1246628)
                     /number=3
     CDS             complement(1248746..1249750)
                     /codon_start=1
                     /locus_tag="AO090026000443"
                     /note="3-hydroxyacyl-CoA dehydrogenase"
                     /old_locus_tag="AO070308000077"
                     /protein_id="BAE59893.1"
                     /transl_table=1
                     /translation="MSVTDPQRITLIGLGTIGMSMAALHLSRENVTVDVFDTRPDFDQ
                     YLFNTLPHFLDQGPSSANFKSQPSTSAVASLIASGRLNVHTSLETACTSATIVQEQGP
                     ENLEFKQTLWAQVESFAPPSAHLWTSTSGIAASAQQQRIYDKSRLLVVHPFNPPHIMP
                     LLEIVPSPDTSPERLEFAREYFSVPGSKHRPVVLQKEIPGFVGNRLAFALLREACYLV
                     QENVVSAKDLDTIMKASLGPRWAGNGVFESYQQGGGEGGIQAFLNKLGGTMQAVWDNL
                     GKVNVLGNEETSWKEKVVSQVNEAYGTLTPGQVREKEERLKDFVAIQTKKYGHDVPEA
                     "
     exon            complement(1248746..1249750)
                     /number=1
     CDS             join(1250458..1250476,1250553..1250828,1250895..1251159,
                     1251231..1252206)
                     /codon_start=1
                     /locus_tag="AO090026000444"
                     /note="histone acetyltransferase type b catalytic subunit"
                     /old_locus_tag="AO070308000078"
                     /protein_id="BAE59894.1"
                     /transl_table=1
                     /translation="MASEGDWTCDANDAVQITLVQPGEQKPKTLSSFHPQFTYPIFGD
                     DETIFGYKGLIIRLRFAAHDLRPHIHISYDEKFKTVGDTSAVDLIKTLSPFIPEEAFS
                     TLPDYENAVQEDKDAKDFVPPGKLVHNYVTRGRTYEIWAASLADPQVRRLLDRAQVFV
                     SLFIEAGTPLETEDPEWTLERWTVYFVYEKVKPPTPTASQYSIVGYATTYRWWFYQRD
                     SPEKGTVTNDPFPGPEIRPAQLPARLRIAQFLILPPHQGSGHGTHLYTTIHTACFNDS
                     TIVELTVEDPNEAFDALRDTADFHILRPEFLKHNVNINPDPYAELSKKQRPRRVPTSA
                     LIPTKLLHDIRSTYKIASTQFAHVLEMFLLGEIPTKNRHAGGANMSRLLVKKYNATDP
                     NERRYYWWRMLVKQRLFKRSRDILIQLEMSDRIEKLEETVTNVEEGYEALIKVFTARE
                     EALMAKQEESGESPETAVLEDSVASSSDSSTRDQRTKRKFTVEDEDEEEEGESEVSKR
                     PKV"
     exon            1250458..1250476
                     /number=1
     exon            1250553..1250828
                     /number=2
     exon            1250895..1251159
                     /number=3
     exon            1251231..1252206
                     /number=4
     CDS             join(1252523..1252561,1254163..1254354,1254405..1254575)
                     /codon_start=1
                     /locus_tag="AO090026000445"
                     /note="small nuclear ribonucleoprotein (snRNP)"
                     /old_locus_tag="AO070308000079"
                     /protein_id="BAE59895.1"
                     /transl_table=1
                     /translation="MSCNLGINFFSGRLPLGLLTAAQGHPMLVELKNGETLNGHLANC
                     DNWMNLILKEVVQTSPEGDRFFRLPEVYIRGNNIKYLRIPEEIIEMVKEQPQNQPSNR
                     NRGGHSHRGDRGDRGGRGGRGRGRGRGRGGN"
     exon            1252523..1252561
                     /number=1
     exon            1254163..1254354
                     /number=2
     exon            1254405..1254575
                     /number=3
     CDS             join(1254955..1255605,1255684..1257114)
                     /codon_start=1
                     /locus_tag="AO090026000446"
                     /note="predicted protein"
                     /old_locus_tag="AO070308000080"
                     /protein_id="BAE59896.1"
                     /transl_table=1
                     /translation="MPRQTLIVDGLWYCLCPSFSLNTFKRPGNPLIKGKRAPKPGQYS
                     AFLAGPVSTSRKCLSSASVRKVGGIAPSKGDGSLGDGYSESMDQHKTPAQLDENHKLG
                     LDAATSPKEEKPGTEYTRKRPPGVPETLEHKSTSFLEQKLQELTTSTPRVLSTSQILR
                     ILIRDRHVRPEVRHYRALLRANSDAERGSPEVVRQLLGEMEANGFTLDSGTLHTALQA
                     IAVHPDYLLRQELVRTLRDRWLPLSPDGWHYVVAGLVREHQFELALDHIAHMERKDMP
                     VEGWLHSMLIYYLCEFEEFDEVARLMRSRVDQGYDMTTDLWLYVLDVASAAVHHETTR
                     FVWDQMVELRYVYPSYGVCSNVLTVASRTGDTDLAASVARFLIETDVPLSLEDYEKIT
                     EAHVMSGNLYAGFEVLCEMHKAKIALESSSTAAILTYMIQSRTSPQKAWCMLKQLKAL
                     KYEIPLRCALVVLEMCEHEAINDPFVVDDGLTLYKQLYALCSEKADVSVYNSLISMCR
                     RAKNTDAGMFVVKEMATLGVVPNATTFEHLIIMCLDAGNFESAYMYFQDLLARDATPS
                     EDARAEIRDLCTGSSDQYAVQLRYHPQIRDALVRRQADDFEPTQIRAGLIKKVPSDSP
                     PEYANRFRPGPRKTITKEERRAESKEKRKQKRRRLAIARAREEEGWEDYEPGGLIPED
                     QVKADANSPSS"
     exon            1254955..1255605
                     /number=1
     exon            1255684..1257114
                     /number=2
     CDS             1258298..1258714
                     /codon_start=1
                     /locus_tag="AO090026000447"
                     /note="predicted protein"
                     /old_locus_tag="AO070308000081"
                     /protein_id="BAE59897.1"
                     /transl_table=1
                     /translation="MQLSSVFTVALSALNFASALPLHRLNTSPALTWQVADFNTGCSP
                     GGCVYNFNITGVASQNTPGFHTHCSGTNVQDDFAFCDDKHVKAKVVSQLYPVWTIHVQ
                     HAWFQGEAEFYAVGHANVTSTQKNFTIPVTEVYGVA"
     exon            1258298..1258714
                     /number=1
     CDS             complement(join(1260801..1260885,1261743..1264210))
                     /codon_start=1
                     /locus_tag="AO090026000448"
                     /note="predicted protein"
                     /old_locus_tag="AO070308000082"
                     /protein_id="BAE59898.1"
                     /transl_table=1
                     /translation="MGAAKALRLRWTVPPAVLIALGSGALYTTSGQTLYYKNSVQQTD
                     QTARFSTSTTYRVDDRSAKPSSASSQKSTWDLSSEHSSDHGDPNSIWTNILHKFDGVK
                     QTVGSTDWIEIDSLKNYIIPDWTRLLPATVQKLQRELSMAPGSLADDIWKEAHDPDIN
                     PEILQDARVRVGSDLCREELEFRRKRREHGVKALASYLEIPEEDIHPDDVPVIAMCGS
                     GGGLRALVAGTGSYLAVQEAGLWDCVTYTAGVSGSCWLQTLYHSSITGRNFQKLVDHL
                     KHRLSVHIAFPPKALNALTTAPTNKYLLSGLVEKLKGDPGADFGLVDIYGMLLAARLL
                     VPKGELGVSDRDLKLSNQRYNLTDGAHPLPIYTAVRHEIPVLESLEEDHNKKQPTRET
                     LMKEAQDESWFQWFEFTPYEFFCEELGAGIPTWALGRHFNGGFNSIPEGHYPIPELRV
                     PGLMGVWGSAFCATLSHYYKEIRPLVRGITGFAGIDSLIQGKNKDLVRVHPIDPATIP
                     NYVLGMKDVLPPSCPESIFRSSHLRLMDAGMSNNLPIYPLLRPGRDVDIIVAFDASAD
                     IKQENWLSVVDGYARQRGVKGWPLGAGWPKEDMKLKETEEKLREAQNISEAELNSKIR
                     EAQDNDKNTASNGQTPSTDPGQNPSNGDTDLDYCNVWVGTTQERVSDEEPPPSKRLFQ
                     PRNKDHKESDFHLMRPDAGIAVVYFPLIPNPDAPELPPSSSLKKSPAPAQQKETKSSA
                     NVSDPAKPLTPHPGSINPDVDDFLSTWNFVYSPEQIDSVVGLAKANFAQGEEQVKRVV
                     RAVYERKKSDRLRREEEEARRRMEGFRRWKSPDYFEPVESSNPFSGGAFNPI"
     exon            complement(1260801..1260885)
                     /number=1
     exon            complement(1261743..1264210)
                     /number=2
     CDS             join(1264682..1264965,1265023..1265240,1265301..1266694)
                     /codon_start=1
                     /locus_tag="AO090026000449"
                     /note="exocyst component protein and related proteins"
                     /old_locus_tag="AO070308000083"
                     /protein_id="BAE59899.1"
                     /transl_table=1
                     /translation="MVAPRNTAYAEESAEVEVLYANLEKLKVLTKKIQGSLVRLETGG
                     NVVKHAIGPIYSNTQSLQITNNNIDKVNDAIDRLRQPLDAKSREEGIIRSGPQNVELS
                     QYLAAIKRVEKALIDLNSTNLRSNQKAISDFNALLSTGTARLQDLLRSKLSDDVSPIE
                     PLHYLTKELPFPSIPEETVTELGPICAAINSAAIHGPQHGDGGNPALKIYAAVRAPYI
                     TSSLQNLAIASLNTVKRRADDGPYRQGTNGIGIYSNALENFIYAEHDIISRIFTGDQR
                     GLALQATCQSALAEYSKTLRELNQYIKANLMTDCFLAFEIIEIVTAMSYRVDSKTGEL
                     KSMFIEALRPIRDTAKSSLSELLEETKRKAASIQVLPPDGGSVPLVNEVMSSLVTLTA
                     YSGPLASILTSLGDGNWRSTSNASGAAPLDVSPDSSTLLSHFILDMIEALMIALESRG
                     RAFHRTKAVQGVFLSNVFCNVDRAIRSNVELARYLGSPDSIARIDTFRKRATSTYLDS
                     WKETSQYLLDVQYTSRGAGASTRPTSGGIVDSSAIVKSLSSKDKDAIKDKFKAFNTSF
                     DDLVSRHKALYMEREVRGVLSREVQTVLEPLYARFWDRYHEIDKGRGKYVKYDKGSLS
                     AQLAALG"
     exon            1264682..1264965
                     /number=1
     exon            1265023..1265240
                     /number=2
     exon            1265301..1266694
                     /number=3
     CDS             join(1267094..1267142,1267204..1267290,1267347..1268074,
                     1268128..1268365,1268414..1268492,1268548..1268554,
                     1268614..1268671,1268736..1268986)
                     /codon_start=1
                     /locus_tag="AO090026000450"
                     /note="adenylosuccinate lyase"
                     /old_locus_tag="AO070308000084"
                     /protein_id="BAE59900.1"
                     /transl_table=1
                     /translation="MSANDVYQTPLNSRYASDEMKYLFSPRNRFSTWRKLWLWLAESE
                     KELGLSISDDAIEQMKAHLTIQDEEFKVAAEEEKRRRHDVMAHVHAYGQVAPAAAGII
                     HWGATSCYCTDNADLIFLRDGLDILIPKLAVVIDKLSAFAQQYKDLPCLGFTHGQPAQ
                     LVTVGKRACLWIQDLLMDLRNLERARDDLRFRGVKGTTGTQASFLQIFDGDHSKVEQL
                     DELVTQKAGFDSAFIISSQTYSRKIDVDVGNALGSFGSTCERIGIDIRHLAMLKEVEE
                     PFEKDQIGSSAMAYKRNPMRSERLCSLGRHLQNLPKDALDTYSAQWFERSLVRQYSFS
                     EELFPNNHQDDSAIRRISIPELYLSADACLILLNNVTSGFVVYPEVIKRRVNDELPFM
                     ATENIIMACVKKGLSRQDAHEEIRVLSHQAADNVKKHGKDNDLLERIRRTEFFNPILG
                     ELDTLLEPSTFVGRAPQQVEKFTSTEVKKALEPYAAAVAKAETSTLSV"
     exon            1267094..1267142
                     /number=1
     exon            1267204..1267290
                     /number=2
     exon            1267347..1268074
                     /number=3
     exon            1268128..1268365
                     /number=4
     exon            1268414..1268492
                     /number=5
     exon            1268548..1268554
                     /number=6
     exon            1268614..1268671
                     /number=7
     exon            1268736..1268986
                     /number=8
     CDS             complement(join(1270142..1270168,1270229..1270653,
                     1270739..1271044,1271167..1271348,1271425..1271732))
                     /codon_start=1
                     /locus_tag="AO090026000451"
                     /note="predicted protein"
                     /old_locus_tag="AO070308000085"
                     /protein_id="BAE59901.1"
                     /transl_table=1
                     /translation="MPAMSRRRTSHSEPMASSSANEAFAYPFTSMQQGNQPQRRGPIE
                     GPNGRRLVRRVTWRSSTYKLMASLWVLGVFYIVWLIRDIFFLPFTSSQPSMIVKGTSQ
                     DLLERYVGHQECGISSLALYEPPKTEGQGALSHSYCQTRDSLLSAMSDGGRHGFDEAY
                     ISKGCFYRWYSNAEVCQILQKFGALVFVGDESLADIYAGFNILLQGNLATGALRESEM
                     TKEQIEKCRCASQFTSASCLPLRITSSEQVEKQNDNKISPGSNACSSSIPHTFVTATS
                     SPASKSAQERFRQLINRAGSQGKPVPVIQSLSLSTSYSLEIAANSMDEWLALAQSSKR
                     DMPSLWIGPTAPGHQKHFESNIHASSWQYTLDTFEAARTRGMETLGMYNATLQADSWD
                     GMHYGEKEALIQAMMVINWLAML"
     exon            complement(1270142..1270168)
                     /number=1
     exon            complement(1270229..1270653)
                     /number=2
     exon            complement(1270739..1271044)
                     /number=3
     exon            complement(1271167..1271348)
                     /number=4
     exon            complement(1271425..1271732)
                     /number=5
     CDS             join(1275775..1275886,1275981..1276129,1276314..1277218,
                     1277281..1277344)
                     /codon_start=1
                     /locus_tag="AO090026000452"
                     /note="dehydrogenase kinase"
                     /old_locus_tag="AO070308000086"
                     /protein_id="BAE59902.1"
                     /transl_table=1
                     /translation="MWKPSERLMETIRHYASFPATGVSLRQMVQFGDRPSTGTLFRAS
                     QFLSEELPIRLAHRVQDLGELPDGLSEMPSIKKVQDWYAQSFEILSETTQNPSIKEGQ
                     YRSSPTSALNHNGNGKAAATAARRYFVPSDDQGNWPPELNDYNERFAKTLQHIKRRHD
                     SVVTTVAQGILEWKRKRQRLQIDSTVQSFLDRFYMSRIGIRMLIGQHIALTEQTHVRH
                     PNYVGIICTKTNVREVALEAIDNARFVCEDYYGLFEAPKVQLVCKDDLNFMYVPGHLS
                     HMLFETLKNSLRAVVETHGADKEAFPVTKVIIAEGKEDITIKVSDEGGGIPRSSIPLV
                     WTYMYTTVEQTPNLDPDFDKSDFKAPMAGFGYGLPISRLYARYFGGDLKLISMEGYGT
                     DVYLHLNRLSSSSEPLQ"
     exon            1275775..1275886
                     /number=1
     exon            1275981..1276129
                     /number=2
     exon            1276314..1277218
                     /number=3
     exon            1277281..1277344
                     /number=4
     CDS             complement(1278219..1278668)
                     /codon_start=1
                     /locus_tag="AO090026000453"
                     /note="predicted protein"
                     /old_locus_tag="AO070308000087"
                     /protein_id="BAE59903.1"
                     /transl_table=1
                     /translation="MTCLHSNYKQTLPQARRRFLSKLIAPEDPEVAASIRSDLFIVQN
                     PSSPAPNNQPLLVHRSVVDVHETDDAGWRRPADAGGSSSAFSSPASSSKNKGRLSTPD
                     RTREKGKASTASSSVSGSAGREQQLRERERRRRWSGAEREDYGVSSP"
     exon            complement(1278219..1278668)
                     /number=1
     CDS             complement(join(1280512..1280563,1280619..1281096,
                     1281153..1281675,1281728..1281829,1281882..1282062,
                     1282119..1282756))
                     /codon_start=1
                     /locus_tag="AO090026000455"
                     /note="predicted protein"
                     /old_locus_tag="AO070308000089"
                     /protein_id="BAE59904.1"
                     /transl_table=1
                     /translation="MSDNPMSQSARDTPHIRLNSGQHDPFSDPDENGPPVPSHGGIGR
                     ALTPGMSNSTSTGTFLTMQTGMGSPTPQDSTDFLLPPRPQRHREQYDGFQSPDLSGQS
                     SRRTSWSSEGGSESRGYFYPRYEDMRSPSHGEGDGDDVNTQTVTEKFNIMPSEGLLLF
                     PEDVEKDDYLHNPDPNDKERDCDIWNRRGIVNGGGLVLLTLGLLMLFIGYPVLTAVRG
                     MEKGSASVCKAGDTLCLDVGERSTLKNVRTGLIDPDTPASAMTKKSADGKEWKLVFSD
                     EFNTPGRTFYDGDDAFLQAVDIWYGVTQDLEWYDPDAVTTKDGVLELRFDAFPNHEMK
                     YRSGMVQSWNKLCFTGGRLEASISLPGNGEVSGFWPGFWAMGNLGRPGYAATTEGMWP
                     YSYYDGCDAGITPNQSSTDGLSWLPGMRLPACSCDSAEHPTPGKSRSAPEIDVIEASV
                     AALNGDAATMVGSVSQSLQMAPFDIWYMPDYEYAAVYDPKITEINSYRGGPYQQAMSG
                     LSNLNNDWYNGTQYQVYAFDYTPGARGNITWYVGQDKTWTLDGRALGPNGNIGQRVIP
                     LEPMSIIMNLGMAYSFAPVDDNIKKFLPGYMRFDYLRIYQDPDNISLTCDPPGYETTE
                     YIAKHPKAYQNVNKTTWTDAGYEWPKNSFMHEC"
     exon            complement(1280512..1280563)
                     /number=1
     exon            complement(1280619..1281096)
                     /number=2
     exon            complement(1281153..1281675)
                     /number=3
     exon            complement(1281728..1281829)
                     /number=4
     exon            complement(1281882..1282062)
                     /number=5
     exon            complement(1282119..1282756)
                     /number=6
     CDS             complement(join(1287337..1287611,1287711..1287948))
                     /codon_start=1
                     /locus_tag="AO090026000457"
                     /note="predicted protein"
                     /old_locus_tag="AO070308000091"
                     /protein_id="BAE59905.1"
                     /transl_table=1
                     /translation="MSDDAYMSFLNKANADLDTARAQQAQDSPTVRTETVETGVSVPA
                     PLTSVDAYYISETDEPFEPVALRWDGASRGIFPDASHLSNLISPNADLSSSITTLSPS
                     SFDPRNQYPSALRAVRAAAAESSGGDESAVDVKVFRVEVGPSRIEYYILAVDAEKSLV
                     VGLRTKAVET"
     exon            complement(1287337..1287611)
                     /number=1
     exon            complement(1287711..1287948)
                     /number=2
     CDS             complement(join(1288633..1288888,1288951..1289624,
                     1289697..1289853,1289924..1289981,1290077..1290108,
                     1290184..1290185))
                     /codon_start=1
                     /locus_tag="AO090026000458"
                     /note="60S ribosomal protein L3 and related proteins"
                     /old_locus_tag="AO070308000092"
                     /protein_id="BAE59906.1"
                     /transl_table=1
                     /translation="MSHRKYEAPRHGSLAYLPRKRAARHRGKVKSFPKDDPKKPVHLT
                     ASMGYKAGMTTVVRDLDRPGAKMHKKEVVEAVTVIETPPLVAIGVVGYIETPRGLRSL
                     TTVWAEHLSDEVKRRFYKNWYKSKKKAFTKYAKQHAEESGASITRELERIKKYCTVVR
                     VLAHTQIRKTPLKQKKAHLMEIQVNGGSVADKVDFARNLFEKTIEIDSIFEKDEVIDV
                     IAVTKGHGFQGVTSRWGTKKLPRKTHKGLRKVACIGAWHPSHVQWTVARAGQMGYHHR
                     TSCNHKVYRIGKGSDEANASTDFDISKKQITPMGGFVRYGEVKNDFVMVKGSVPGVKK
                     RVMTLRKTLYPQTSRKATEKIELKWVDTSSEFGHGAFQTPEEKRAFLGTLKKDLVTSA
                     "
     exon            complement(1288633..1288888)
                     /number=1
     exon            complement(1288951..1289624)
                     /number=2
     exon            complement(1289697..1289853)
                     /number=3
     exon            complement(1289924..1289981)
                     /number=4
     exon            complement(1290077..1290108)
                     /number=5
     exon            complement(1290184..1290185)
                     /number=6
     CDS             complement(join(1291123..1292595,1292652..1292896,
                     1292961..1293117,1293171..1293263,1293321..1293500,
                     1293562..1293644,1293701..1293904,1293983..1294157))
                     /codon_start=1
                     /locus_tag="AO090026000459"
                     /note="TPR repeat"
                     /old_locus_tag="AO070308000093"
                     /protein_id="BAE59907.1"
                     /transl_table=1
                     /translation="MAHTQPSPTGGVTPHHGHLAAHPQVNGHMPLQSQGQKGPPMSTA
                     QKIAALNEQVWLQIGGLTELMGDLDGAMNAYEQALRHNQWSIPAMNAISCILRTKEQF
                     PKAIEYLQNILKLDPTSGETWGSLGHCHLMMDNLQEAYTSYQQALYHLRDPKEPKLWY
                     GIGILYDRYGSLDHAEEAFSQVMRMAPDFEKANEIYFRLGIIYKQQQKFNQSLECFKY
                     IVTDPPRPLTEEDIWFQIGHVHEQQKDFDSAQQAYRRVLDRDPNHAKVLQQLGWLYHQ
                     QSNSYASQEKAIEYLEKSVSADNTDAQSWYLLGRCYMSQAKYPKAYEAYQQAVYRDGR
                     NPTFWCSIGVLYYQINQYRDALDAYSRAIRLNPYISEVWYDLGTLYESCNNQISDALD
                     AYGRAADLDPTNVHIKARLQLLQSQLSGSNQTNAPAPQPQDVHPQAYQTGVGGPPAPQ
                     WGAPAPTGGPPPQPPAPPRQIADWNRGINELQSQAQAQAQAANGFDHRDAVRAPAAIQ
                     QPSPRQEPGRGFPDAVRPPPTAARSPKTALAGPGVYAPTHALPQIANPPPAPSHERVP
                     SGASGFPSATRGPLPPAPAGPPPAPGAPNGAPTPGGPLPPYHRPFTPPAEIRPIRDER
                     PSSPGSTYPHQQFHHGPSVPPVQGAGSTGIAGGAPAPPSAITAAEAAAREREDRPASA
                     MKRGREWEAESAPVKKIANEESRARLDEQLPRRVTPPNRMPSPGEMQRRSSSEVRRED
                     QRRINESYHPSEAAHHPPTLPSIQHMPPHASGSGLPPMAEGSTPAANGPQPGPSAPVQ
                     VKEEPARGEQPPAHEPAARKMDVDENYDDDGDDDKRASTAVKGSPSASGSGNANNATN
                     GSQTSQSKPESTA"
     exon            complement(1291123..1292595)
                     /number=1
     exon            complement(1292652..1292896)
                     /number=2
     exon            complement(1292961..1293117)
                     /number=3
     exon            complement(1293171..1293263)
                     /number=4
     exon            complement(1293321..1293500)
                     /number=5
     exon            complement(1293562..1293644)
                     /number=6
     exon            complement(1293701..1293904)
                     /number=7
     exon            complement(1293983..1294157)
                     /number=8
     CDS             join(1303552..1303886,1303944..1304109,1304176..1304664)
                     /codon_start=1
                     /locus_tag="AO090026000461"
                     /note="predicted protein"