LOCUS       AP007158               18709 bp    DNA     linear   PLN 16-DEC-2016
DEFINITION  Aspergillus oryzae RIB40 DNA, 47Q_0172.
ACCESSION   AP007158
VERSION     AP007158.1
DBLINK      BioProject:PRJNA20809
            BioSample:SAMD00067075
KEYWORDS    .
SOURCE      Aspergillus oryzae RIB40
  ORGANISM  Aspergillus oryzae RIB40
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Eurotiomycetes; Eurotiomycetidae; Eurotiales; Aspergillaceae;
            Aspergillus.
REFERENCE   1  (bases 1 to 18709)
  AUTHORS   Sawano,T., Tanaka,T., Machida,M. and Yamada,O.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-JUN-2004) to the DDBJ/EMBL/GenBank databases.
            Contact:Toshihiko Sawano
            National Institute of Technology and Evaluation, Genome Analysis
            Center, Department Of Biotechnology; 2-49-10 Nishihara,
            Shibuya-ku, Tokyo 151-0066, Japan
REFERENCE   2
  AUTHORS   Machida,M., Asai,K., Sano,M., Tanaka,T., Kumagai,T., Terai,G.,
            Kusumoto,K., Arima,T., Akita,O., Kashiwagi,Y., Abe,K., Gomi,K.,
            Horiuchi,H., Kitamoto,K., Kobayashi,T., Takeuchi,M., Denning,D.W.,
            Galagan,J.E., Nierman,W.C., Yu,J., Archer,D.B., Bennett,J.W.,
            Bhatnagar,D., Cleveland,T.E., Fedorova,N.D., Gotoh,O.,
            Horikawa,H., Hosoyama,A., Ichinomiya,M., Igarashi,R., Iwashita,K.,
            Juvvadi,P.R., Kato,M., Kato,Y., Kin,T., Kokubun,A., Maeda,H.,
            Maeyama,N., Maruyama,J., Nagasaki,H., Nakajima,T., Oda,K.,
            Okada,K., Paulsen,I., Sakamoto,K., Sawano,T., Takahashi,M.,
            Takase,K., Terabayashi,Y., Wortman,J., Yamada,O., Yamagata,Y.,
            Anazawa,H., Hata,Y., Koide,Y., Komori,T., Koyama,Y., Minetoki,T.,
            Suharnan,S., Tanaka,A., Isono,K., Kuhara,S., Ogasawara,N. and
            Kikuchi,H.
  TITLE     Genome sequencing and analysis of Aspergillus oryzae
  JOURNAL   Nature 438, 1157-1161 (2005)
COMMENT     URL:http://www.bio.nite.go.jp/dogan/Top
FEATURES             Location/Qualifiers
     source          1..18709
                     /db_xref="taxon:510516"
                     /mol_type="genomic DNA"
                     /note="47Q_0172"
                     /note="phrap>=30:58-18647"
                     /organism="Aspergillus oryzae RIB40"
                     /strain="RIB 40"
     CDS             join(1934..1971,2162..2217,2359..2515,2595..2829)
                     /codon_start=1
                     /locus_tag="AO090672000001"
                     /note="predicted protein"
                     /old_locus_tag="AO070189000001"
                     /protein_id="BAE59494.1"
                     /transl_table=1
                     /translation="MYTTPVTSEMVPCLLLIPLMLSYLLGISICFVTRSHKVNDRDHS
                     VLHDGIAVSQENLPRYFAKSGPVDADPRKTKKDGGGKGNWGQPGDEVYDYNCKLTNAR
                     RYSNSSTQGLADYKTKFETIEPEPVFEESFHGVQNEERPVDGNKVLNVDGATSLGKTL
                     V"
     exon            1934..1971
                     /number=1
     exon            2162..2217
                     /number=2
     exon            2359..2515
                     /number=3
     exon            2595..2829
                     /number=4
     CDS             complement(join(3124..3470,3528..6894,7016..7078))
                     /codon_start=1
                     /locus_tag="AO090672000002"
                     /note="nuclear pore complex, Nup133 component (sc Nup133)"
                     /old_locus_tag="AO070189000002"
                     /protein_id="BAE59495.1"
                     /transl_table=1
                     /translation="MPIRGSKKSERRGEADGTIVLIRFADYNQASLAYFLAIDIVNTN
                     TDSYKCFFGAGNCYALAMTNSHAIIWPYSIATSSPSPADVFTISIPEPCREPNGPVPL
                     GILLSSVTAGLPGLMIITPDTGRIIYWETVSCAASLGLARQKQKTIQGSIPNLLSGEH
                     ITDLVNGEPSGVIVTLSSGRVAHITVRDPQGKPTVTVNFLRNTSGLSRIGFFGGIRNV
                     LGGGFARKDLAAVRAGESHQRGQRDIIIATSGGLFEIWDTHWNNGIILKRQFDITNDL
                     CHHLGTGDSNSSDDSNIEILDFSLMPAEYSVRELQASTSVPSWHLSLLVTQSEMGSQS
                     MSLVQVNLAEEVHILSTHPIDLHGVSTALDSKPRLYLPKPGDTAFVLMGHSVVLLSLS
                     LGKDQSAQHQQPRVFQDSISFRSGKAFEILGSGAEDKRDENSCPACLIMVRDFGIIRI
                     TALPHHNSPPTAECVRITAKQKIEQAIFYGTMLGNPLNLNNKSSLDFSVMDIEQAALE
                     ICRELLQSRSKFIPTTAISLEQNLRSRAKALDDLACLLMQQNKLLGEQIWWELLWGAE
                     KLAAQRAMWKIEEGSRKLKGKGSTFLTHVINSMSDKFKTRVEKQDGEVDPVRNWFLHD
                     TFQMEHVVPWIFNAIKPKKGHSSRQGRKMSEQILEASELSLAVLETAFRFRDEHASRY
                     GIRDGYLEDGVLVTGFKGLPEFWTSQNFSYVETGHLLDLELDSCRAWIQQATSVTEAP
                     ESLTVKRIAGNSARQLCVLGQMHYERVRWLSAQEDPKLVDEGIATEQAHVKQRKWRLF
                     KLAGIGRLDDAITLAEKFRDMSALVELIIELQDQTKGEILPSSRNDASDTISCESDHL
                     NKKISLYFEKFGESWANAFFSRQISMRQSGILFAMKKFQPFITQFLRKDAAYSRLGWI
                     NDVIGENDYNAAAQSLEKLAIEGESDLWSHRVELSLAKLAKLATLEETNIPSHSGFHN
                     DIRHLEDLSEIDAVQELIYAYISPALQGAIDQRAEVDLAIDHFGKNIAGDRPSLHELL
                     SETLTKVVTRQIIDIHQLVDILTLIDSDKASEYGQSELSGKEFYLALRVIRLGIYAQQ
                     DSLNYITMQKLVWRRCMIKDNWVATGRAAESMDNGSEPFIYDTALFRTMGLCLRDRYD
                     EDASYASLYIPSSPQDVFLNRSDSELLSTRYRLEQRTRIIHDLERENEILHENVEKGR
                     LDFWFKNLLTSAEESASIPIPPTFTSEESNNNNQQVKRSPQPREGSSKARLSWL"
     exon            complement(3124..3470)
                     /number=1
     exon            complement(3528..6894)
                     /number=2
     exon            complement(7016..7078)
                     /number=3
     CDS             join(7185..7349,7876..8952)
                     /codon_start=1
                     /locus_tag="AO090672000003"
                     /note="(acyl-carrier-protein) S-malonyltransferase"
                     /old_locus_tag="AO070189000003"
                     /protein_id="BAE59496.1"
                     /transl_table=1
                     /translation="MSELTWRKLDRCLLAFGGLTGSSELVRWRLRGFRKEDADEIAAF
                     GKNIVGTTQNKVAILANGLLGHGVQRVGMVSSWINNFPDIAGSFLDEMDSVLGFRLSR
                     VISEGPNSELNKTENSQPAIMATSILILRILEQKFGFDTKSRVDVTLGHSLGEFSALV
                     TGGYIDFGDALKLVRRRAEIMAQCTRRASTESGEDYGMVALVCEPDHLNGLLATIHEF
                     LGLASNGMRDDLSYGMPPIEKVMVANVNSKNQIVLSGSIERIRTLLIQLRQFGGHDPR
                     AVRLNSESPFHSPIMMPAAEYMVRALDKIKLNFPAHMPCVSNVSGLPFRSADELRRLL
                     SQQCVDTVRWWDSIRYLDQERGVKRWVGIGPGKVGRNLVGKEVGKVMTKGGGVWAICD
                     TRELEDIVRSLEQTEFEASCD"
     exon            7185..7349
                     /number=1
     exon            7876..8952
                     /number=2
     CDS             complement(join(9538..9564,9627..9923,9972..10016))
                     /codon_start=1
                     /locus_tag="AO090672000004"
                     /note="predicted protein"
                     /old_locus_tag="AO070189000004"
                     /protein_id="BAE59497.1"
                     /transl_table=1
                     /translation="MSGPKIACIGIIGKADNPLHISLFPPYLNSTVEFSFLLNSCLDI
                     FEIRQKQTSVDQDLGLLHAVDEKLAAYGWLTTTGVKLLVIIDLIGQPVPNSMGKQKGS
                     PRTGSKDPDLKPKSKLTMNY"
     exon            complement(9538..9564)
                     /number=1
     exon            complement(9627..9923)
                     /number=2
     exon            complement(9972..10016)
                     /number=3
     CDS             join(10569..10611,10663..10855,10909..11264,11334..11428)
                     /codon_start=1
                     /locus_tag="AO090672000005"
                     /note="NADH-ubiquinone oxidoreductase, NUFS7/PSST/20 kDa
                     subunit"
                     /old_locus_tag="AO070189000005"
                     /protein_id="BAE59498.1"
                     /transl_table=1
                     /translation="MLPLSARALPGALHARPRLVSSIPRIQLVAHLSTTPNQSATALE
                     HKGHSGQPLTASGKIRKEVPLPSQEKKEGAMQYVLTTLDQVANWARQSSLWPMTFGLA
                     CCAVEMMHLSTPRYDQDRLGIIFRASPRQSDVMIVAGTLTNKMAPALRQVYDQMPDPR
                     WVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDVYVPGCPPTSEALMYGIFQLQKKMRH
                     TRITRMWYRR"
     exon            10569..10611
                     /number=1
     exon            10663..10855
                     /number=2
     exon            10909..11264
                     /number=3
     exon            11334..11428
                     /number=4
     CDS             complement(join(11740..11927,11977..12221,12289..12727,
                     12782..12836))
                     /codon_start=1
                     /locus_tag="AO090672000006"
                     /note="reductases with broad range of substrate
                     specificities"
                     /old_locus_tag="AO070189000006"
                     /protein_id="BAE59499.1"
                     /transl_table=1
                     /translation="MQDYTERAARGTESQFQTGHQIPVQHQKKPGLQEELEDPKPVST
                     YIPTEEGGYTTYKAAGKLVGKRAIITGGDSGIGRAVALLFAMEGASSLIVYLPEEEKD
                     AQETKRRVQGTGHDCHCLAVDVRKKENCRKVVDTAVQCMGGIDILVNNAGFQNMIGDI
                     SGLEEDQWERTFDTNIHPFFYLSKYALPHMKSGSTIINCGSVNAYIGRPDLLDYTATK
                     GAIVAFTRGLSNQQVGRGIRVNCVCPGPIWTPLIPSTMTSSAMDQFSSVPMGRPGQPS
                     EVATCFVFLASQDSSYISGQSLHPNGGVVVNG"
     exon            complement(11740..11927)
                     /number=1
     exon            complement(11977..12221)
                     /number=2
     exon            complement(12289..12727)
                     /number=3
     exon            complement(12782..12836)
                     /number=4
     CDS             14684..16807
                     /codon_start=1
                     /locus_tag="AO090672000008"
                     /note="U3 small nucleolar ribonucleoprotein (snoRNP)
                     subunit - Mpp10p"
                     /old_locus_tag="AO070189000008"
                     /protein_id="BAE59500.1"
                     /transl_table=1
                     /translation="MADFAKDPALNAALSAPWAFLCPTSELNDTIVGSAKFFLDSLAL
                     SISDAQSARQRQNRKRKRCEANLDQNTEVLQLKQLFVEGFGSDQIWEQALRILDSAGQ
                     EIQRDCTLSNRHAGHSLSDEGITSFEGSDFAAESSENSELESHLEGTRDLSDVDEEVS
                     MALDLDQGDSIHDALDSRSIDETLGEESESSETGSDGEQPGTYTEDPFGLNDGFFSID
                     DFNKQSELWERQDARGGPDDESESDEEVDWHADPLATGNISASLNKTPPSNETDRGVK
                     DQSMGDDDDDDNDTSDEEGPTFNNVNLQDGLDSDTDDAYPGTAQGADWINTSDIKYSD
                     FFAPPPRKSTTKRSRPLPKTQPVAAINNNDIDRAMADVRRDLFEDDASIENSDISDGE
                     LGEPETQKSTHEKQRARIADEIRRLEAANVAKKEWMLAGEAKAAERPVNSLIEEDLEV
                     ERIGKPVPVVTAEVSEDIEGLVKRRILAREFDEVIRRRPGITDSQVARKSRFELEDSK
                     AQQSLAELYETDHLRATDPNYVDPKNQKLLREHNEISNLWKEISSQLDTLSNWHYKPK
                     TPHAHINVVTDAATIMMEDAQPTAGGAVGSAATLAPQEIYTPGADGKASGEVVLRNGL
                     SVSKEEMTREEKSRLRRQHKKQKKTTTNDKNRQSGKAAERQQIVSDLKKGDVKLVGKQ
                     GEVTDIHGQKLTGTGPRSGADALKL"
     exon            14684..16807
                     /number=1
     CDS             complement(join(16937..17390,17455..17711))
                     /codon_start=1
                     /locus_tag="AO090672000009"
                     /note="putative N2,N2-dimethylguanosine tRNA
                     methyltransferase"
                     /old_locus_tag="AO070189000009"
                     /protein_id="BAE59501.1"
                     /transl_table=1
                     /translation="MMEASNSPDQQSVLSESILVSESLVPARDLKGVGHAEISFDGLL
                     KDPLIIKEDLKEGCGGQLWPAGMVLARYLLLQHRSDFNNKTIVELGAGGGLVGLAVAR
                     GCDIGSSSVYITDQAPMLPLMETNIKLNNVSSRVAATVLNWGESLPDCIPKHPAIVLA
                     ADCVYFEPAFPLLISTLKNLLGPESICYFCFKRRRRADSRFLKLAKKLFHIVEVCDDP
                     MAETYKRENIFLYSIRSK"
     exon            complement(16937..17390)
                     /number=1
     exon            complement(17455..17711)
                     /number=2
BASE COUNT         5256 a         4009 c         4092 g         5352 t
ORIGIN      
        1 tttatttatt taatttaaat tctataaagt atatctagat tttatttaaa tataagcctt
       61 taaaactcta tcctatactt tttctagata aaagattaga aattgattag actctattta
      121 aaagacatat taaaaagatc taatagacta ttttataaaa gattatagat tatttaattc
      181 tatctatatt ttatagactt tagactatat attaaatata tagctgatat acaaaatatt
      241 aatataggga ttctatagaa ctattttata gattaatatc ttttgaattg attaagaaaa
      301 tcgagtttaa gtttgttaca tttttctaat tttttcgggc gtaatcagac ttttgaccca
      361 ctagtttatt atataaacta gcagtttatt aatagcttac ttatatagaa catagttgcc
      421 taagacaatt gctattatat attggggggt ccttttaata tgaccgttat ttaatttata
      481 ttttcagtta aattctataa ctattaaata atctgtttaa aatgaaatag aaatattttt
      541 atgtttaata atcttatttt ttgtaataat taaatatatt ttaatacata agtatattaa
      601 tttatactcc ttaaataatt tatataataa aaatagattt tgtttaaaaa aatctatttt
      661 tatttcaata aattatttaa tttgattttt aaatttattt ctaatttcta ttaatattct
      721 agtctagatt aaataaataa ttttctaata ataataaata cttaatattt ttaattatat
      781 ctaataaatt taataaaaat agtaatagta atttaatatt aatactttta ttatctacta
      841 aattataaag cttattaatt aattaatcat agaatataat ttttttaaaa ttgaaagaat
      901 tattataatc tatctcattt tctactataa aatgatagaa aagatagtag aatagaccac
      961 ccattaatta cttagataga ttaacaaaat aataacttcc tctacatata ccatcagtgt
     1021 atttggcaca acacctaagc tcgctgaggt aaatataact actaaatata tgaattgata
     1081 gaacgtaaca taccagctaa taagcagctt catcactacc ttctatactg cattgcgaca
     1141 gaatagtata acaagttaca accacaacaa ctaggatttt catacaaagc caagtgcttt
     1201 gtactgctct cagcctctga cattgacata tacaagcttc aggctggctg gcaggcggta
     1261 ggtaggcacc ctgtgcgctg attagactcc tttatattct acatctgtat gatctaggtc
     1321 tttacagtta tcaccagtgg acaatactct ttgcagcagg ttatacctaa ccaagatagt
     1381 taactggtcg cagagtcctt agacaaaagc cccgggtgta gttttactcc gtagacgacc
     1441 tgaacctcaa ttgaaggaaa aatataatca tacaaactga tattacactg ccctctccag
     1501 ctagggtcgc ctcttagcac tcactagtac agcagtactg gtgaagggat tggtaacaat
     1561 attgtggggc ggcaataagg cctcgaacta aatggcctct ttaccccaca tgaaatgata
     1621 ctagtaggca attgcgaacc ccgcatctgt attgagcaac gatgaggtca tgagtccccc
     1681 gtcttggctt agcttgctca ctgcccagtg gacaaaacag ctcaagaacg tatatgtact
     1741 atgtatagta ggcatcgaga attggaccat tccccattac acgcgtgact gctggcatag
     1801 tgtgtgctac ccatgcgata tttaatattt accatagcta gcagcaacca acctagcaag
     1861 agcccactga tcgtataccg tcatacctaa tattcatgaa tggtgacctt cgtgtcatat
     1921 aggccattaa ggtatgtaca cgactcctgt tacttctgaa atggttcctt ggtaagacct
     1981 cagagtgcat ggaacttgtg cttggatgtg gttgtatgca gcaggatttg ataatctcct
     2041 ggatactcat tgcattttca aacactgttc atgattcatt ttcttgtatc tccttgaact
     2101 atgattcccc ccgaggaagg agggccattg tatcaagtca tcccacgatt gctctctgca
     2161 gtttgctctt gattccgcta atgctatcct atctcctagg aatctcgatt tgtttcggtg
     2221 agcgtgttga cacctggaac atagacgatc atttttacaa gtgagtaacc atagccctac
     2281 cttctaacct cgttggagac ccaggtcccc atactctttg ttagaaacca cctacctata
     2341 tcgctgatcc atattcagtg acgcgctctc acaaagtaaa cgatcgtgac cactccgtac
     2401 ttcatgatgg aatagctgta tcccaagaga atcttcctcg ctactttgca aaatctggcc
     2461 ccgttgatgc tgatccccgg aagacaaaaa aagatggcgg gggaaaggga aactggtgag
     2521 catttctctt ttagcccacc cctgccagtc gagttttgac actacaccgg atgactcgct
     2581 aaatgtgtac tcaggggcca accgggcgac gaagtctatg actataattg caaactcaca
     2641 aacgctcggc gctattccaa tagtagcact caaggattag cggattataa aaccaagttt
     2701 gagacgattg agccagagcc tgtgttcgag gaaagcttcc atggtgtgca aaatgaagaa
     2761 agacctgtgg atggaaacaa agtgctcaac gttgacggag ccactagcct cggtaagaca
     2821 ctggtatagc agggtcatgg actgtgtccc atatgagcgc tgggactgct gtaactattt
     2881 tcatcgaagc ctgatagtgc gtgggagatt tcaaactcgt tgtcaacgag agcagataat
     2941 gtattcagat tgtcttatct tagtatgtga tggatgatta aattagcaga catacaaggg
     3001 ccgtgataac caaattctgc cactgtactc ggtcaaatta catacaataa ccgtaagaca
     3061 caacagtcta gtttgcttag catcgtgcaa cctgtgagcc taggtagtgg agccaatcag
     3121 aggtcaaagc caacttagcc gcgccttact agacccttcc cttggctgcg gggaccgctt
     3181 cacttgctgg ttgttgttgt tggattcttc tgaagtaaaa gtcggaggga ttgggatgga
     3241 tgcagactct tctgcagagg tgagaagatt cttgaaccaa aaatcaagcc ttcctttttc
     3301 cacattttca tgtaggattt cattctccct ctcaagatca tgtatgattc gtgtccgttg
     3361 ctccagacga tagcgtgtcg agagaagttc agagtccgat ctgtttagaa acacatcttg
     3421 tggagaactt ggaatgtata gggatgcgta gctagcgtct tcgtcgtatc ctgctagtgg
     3481 tgttagttca ttcagcgacc acaagtgtcc ttaaagcggg tacttactgt ctctaagaca
     3541 taaacccata gtgcggaaaa gggccgtgtc gtaaataaag ggctcgcttc cattgtccat
     3601 gctctcggcc gcccttcctg tagccaccca attgtctttt atcatacacc gtcgccacac
     3661 tagcttctgc atagtgatat agttgagtga atcttgctga gcataaattc caagacgaat
     3721 gacacgcaag gcaaggtaga actctttccc ggataattct gattggccat attctgatgc
     3781 tttgtcggaa tctatcaatg tcaatatatc gaccaattgg tgaatatcaa tgatttgcct
     3841 ggtgacaact ttggtgaggg tttcactaag tagttcatgt agagaaggcc tatctccagc
     3901 aatgtttttt ccaaagtggt caatggctag gtcaacctca gctctttgat caattgcacc
     3961 ctgcaacgcc ggggaaatat aggcgtaaat gagttcttgg acggcgtcta tttcagagag
     4021 atcttccaga tgccgtatat cgttgtggaa acctgaatgg ctcggtatgt tggtctcctc
     4081 caatgttgct agtttggcaa gcttcgctag ggaaagttcg acacgatgac tccataaatc
     4141 ggattccccc tctattgcga gtttctctag cgactgagcg gcggcgttgt agtcattttc
     4201 accaatcaca tcattaatcc aacccagccg cgaataggct gcatccttgc gcaagaactg
     4261 agtgataaaa ggttggaatt tcttcatggc gaacagtatt cccgactgac gcatcgatat
     4321 ctgccgggaa aagaatgcat ttgcccatga ttcaccgaat ttctcaaaat aaagagatat
     4381 ttttttgttg agatgatcag attcacagct gatagtatct gacgcatcgt ttcgggagct
     4441 tgggagaatc tcgccctttg tttgatcttg aagttcaatg attagttcta ctaatgcact
     4501 catatctcga aatttttccg ccaacgtaat ggcatcgtct aatcttccaa tacctgcaag
     4561 tttgaagagt cgccatttgc gttgtttaac atgggcctgc tcagtagcga tgccctcatc
     4621 gaccagtttt gggtcctcct gggcagaaag ccaccggact cgctcataat gcatttggcc
     4681 taggacacag agttgtctgg cactgttgcc cgcaattctt ttcactgtta ggctctcagg
     4741 ggcttcggtg acagacgttg cttgttgaat ccaagccctg caactatcga gttctagatc
     4801 caacaaatgg cccgtttcaa cgtaactaaa attttgagac gtccagaatt ccggtagacc
     4861 tttaaagccg gtgaccagta cgccgtcttc gagatatccg tcacgaatac cataccgact
     4921 agcgtgctca tcacggaatc tgaatgcggt ctccaagact gccaaagaaa gctcacttgc
     4981 ttccagtatt tgttctgaca tctttcgtcc ctgtctggac gagtgtcctt tctttggctt
     5041 aatggcattg aaaatccatg gaacaacatg ctccatctgg aatgtatcat ggagaaacca
     5101 attgcggacg ggatcaactt cgccgtcttg cttctcgact cgtgttttaa atttgtcact
     5161 catcgaattg ataacgtggg taagaaaggt cgatcccttg ccctttaatt tcctagagcc
     5221 ttcttctatc ttccacatag ccctctgagc cgcaagtttc tccgcgcccc ataataactc
     5281 ccaccaaatt tgttcaccca ataacttatt ttgctgcatc aaaaggcatg ccagatcatc
     5341 caaagctttc gctctcgatc gtagattctg ttctaaggat attgctgtcg ttgggataaa
     5401 ctttgaccta gattggagca attctctgca aatttccaac gcggcttgct cgatatccat
     5461 gacagagaaa tccaggctac tcttgttgtt caagttcagt ggatttccaa gcatggtacc
     5521 atagaatatg gcttgctcga tcttttgttt agcagtgatt cgaacacatt cagcggtggg
     5581 gggcgagttg tggtgcggta aagctgtaat gcggatgata ccaaaatcac ggaccattat
     5641 tagacatgcg ggacacgagt tctcatccct tttgtcctca gcgccgctgc ctagaatttc
     5701 aaaggccttt cctgaacgga agctgataga gtcctggaac acgcgtggtt gttgatgttg
     5761 cgcggactgg tctttgccta aactcaacga taagagtaca acagagtgac ccattaaaac
     5821 gaatgccgta tcaccgggct tgggaagata caatctcggt tttgaatcaa gagccgtcga
     5881 gaccccatgc aaatcaatag gatgggtaga caagatatgg acttcctcgg ctagattgac
     5941 ttgcacaaga gacatgcttt gcgagcccat ctcagactga gttacaagga gcgataaatg
     6001 ccaggacggt accgacgtgc tagcttgtag ctcacgaaca ctgtattcag ccggcatgag
     6061 tgagaagtcc aagatctcga tgttggagtc atcagagctg ttagaatctc ccgtaccaag
     6121 atgatggcat aggtcatttg ttatatcaaa ctgtctcttc aatataatcc cgttattcca
     6181 atgtgtatcc cagatttcaa agagcccgcc tgacgtagcg atgataatgt ctcgctgtcc
     6241 acgttgatga gattcaccag ctctgacggc agctaggtct ttccttgcaa agcctccacc
     6301 caagacgttt ctaataccac cgaaaaaccc aatcctacta agcccagacg tatttcgcag
     6361 gaaattgaca gtcactgttg gctttccttg tggatcccga acggtgatat gagcaaccct
     6421 cccagacgat aatgtgacga tgacaccaga aggctcgcca ttcacgagat ctgtaatgtg
     6481 ttcacccgag agtagattag gtatagatcc ctggatggtc ttctgcttct gcctggccag
     6541 gcccagtgat gcagcacatg agacagtttc ccagtatata atccttcctg tatcaggagt
     6601 gatgatcatc aatcctggaa gcccagctgt tacactggat agtagaattc caagaggaac
     6661 tggcccattt ggctccctgc agggttcggg tatggaaata gtaaacacat cggcgggcga
     6721 gggtgaggaa gttgcaattg aatatggcca gataattgca tgggagttcg tcatggctag
     6781 ggcgtagcaa ttgcctgcac caaagaagca tttataagaa tctgtgttcg tgttaacaat
     6841 gtcaatggcg agaaaataag caagacttgc ctgattgtag tccgcgaatc tgatctggca
     6901 aggccggtaa ttgcacaaca ttgtaaaagt cagttttgga ctatgtgtga tagcgtcagc
     6961 gactcatctt tttaactcat gtaggagagc catagtttaa ccaaacacaa cttacgagga
     7021 caatggtccc atcagcctcg cctcgcctct ctgacttctt tgaacctctg attggcatgc
     7081 tctcctggaa aatagcattg tctgcggttt ggggcacaaa gtcttgggaa gcagtagttg
     7141 ttgaacctcc atgttcgtgc agctcgcttg ggtcctctga agggatgtct gaactaacat
     7201 ggcgcaaact ggaccgttgc cttttggctt ttggggggtt gacgggttca tcagagcttg
     7261 tacgttggcg tcttcgagga tttcgcaagg aggatgccga cgagatcgcg gcttttggca
     7321 agaacattgt cggaactact cagaacaagg tgaatatagc cccagaaaat tgtgttgtat
     7381 ctaagccatt aagaaaccga gaattaacga aacaggacag gtataccaaa taaataagtt
     7441 caatctcacg tattgatagg tagtatcatt ggcagagata atttgttgat tgattatgta
     7501 ggcggtcagc gctttccagt ctgtacggat cacgtggtat acagttatga tactagctgt
     7561 tgcttagata tatccttggt caacatagtt gagagctatt taactgggtc tctcctatgc
     7621 atcacgatgc ttacatatta tactattagt gtttccatga cgcccctgag ggttacactt
     7681 ctcaacaact tttaagatgc tctttacttc tggctcaaat tatactttgt atataaaaag
     7741 taccttgcat catgtgccat gccggtcatt gttcatcctc aaatgccaaa gaagatggta
     7801 tagtgtttcc agaaaggcta ctttacgcac agctcttttc tttccgggtc cgaaccagcc
     7861 agcctcctat cacaggttgc cattttggct aacggtttgt taggtcatgg agtacagcgc
     7921 gtaggaatgg tgtcttcatg gatcaataac tttccagaca tcgctgggag cttcctggat
     7981 gaaatggata gtgtattggg gtttcggctt tctcgtgtta tttctgaagg accgaactcg
     8041 gagctgaata agaccgagaa ttctcaacct gctattatgg cgacgtcaat attgatccta
     8101 cgaatcttag aacaaaagtt tggcttcgac acgaaatctc gtgtggatgt cacccttggt
     8161 catagcctgg gggagttctc cgcactagtt actgggggct atattgattt cggcgacgct
     8221 cttaaactag ttcgacggcg ggcagaaata atggcccaat gcactcgaag agcctccacg
     8281 gaatctggcg aggattacgg aatggtggca cttgtctgcg aacctgatca tcttaacggt
     8341 ttgctcgcaa caatccatga attcctaggc cttgcatcaa atggtatgag agatgattta
     8401 agttatggga tgccgcctat tgagaaagtg atggtggcaa atgtcaactc taaaaatcaa
     8461 atagtgctga gcggaagtat tgaaaggata agaacactcc ttatccaact tcgccagttt
     8521 ggaggtcacg atccacgtgc agtgagattg aacagtgaaa gcccattcca cagtcccata
     8581 atgatgcctg cggcagaata tatggtccgt gctcttgaca aaatcaaact caacttccca
     8641 gcacatatgc cgtgtgtttc aaatgtttcc ggtctcccgt tccgctcggc agatgaacta
     8701 aggaggctac tttcacaaca gtgtgttgat actgtgcgat ggtgggacag tatcaggtat
     8761 ttagatcaag agaggggtgt aaaacgttgg gttggcattg ggcctgggaa agtcggcagg
     8821 aatctggttg gaaaggaggt cggtaaggta atgactaaag gaggtggtgt ttgggcaatc
     8881 tgtgatactc gcgagcttga agatatagtc aggagtctcg aacagactga atttgaagct
     8941 tcgtgcgatt aacctgtcac aggtacaggt atgcttagac cggtggtttc tatgttgtca
     9001 attgattatc ttgatagcac ttacgcaagc agcgatagca tagcaagggc gataaaatac
     9061 ttttcaattg tctcataaat tagcggtctc agaagttcat ctgtgtcacc gccacaaaca
     9121 tgacattgac gccttgccgc ttcttgccat ttcaagatta acaagcgtgg actaagtaaa
     9181 ccaggccaat aaagttaaaa acggcacata atctgcctca ctgactatta aaggttatgt
     9241 caaacactac tggatattta taacccgcaa atgatcatga gccacagtta ctcctttcac
     9301 gtacctagag agttggtctc taccataagc ttgggccacc ggatcgtttc aaagtatagt
     9361 cgcatctagc acccatgttt caccaatatt cctgacctcc gcaatgaatt catggtctgt
     9421 gatttgcaaa gaattcgatg tgggggcagc agctttgatt gtagggacat gatcatccgg
     9481 agaatagaac gggttttgca aaagccgaat ataagctgtc tgcaaggctc ggaaaaccta
     9541 atagttcatt gttaatttgg acttctgtta atgtgttgaa gacaagagaa gaatattcga
     9601 catagaccat ccgacacagg acttaccggt ttcaggtctg gatctttgga accagtcctc
     9661 ggagatcctt tttgtttccc catgctgttt ggaactggtt gtccgatcaa atcaataatg
     9721 accagtaatt ttactccagt agttgttagc caaccatatg ccgctagttt ttcatccacg
     9781 gcgtgcaaga ggcctaggtc ttggtcgact gaagtttgct tctgtcgtat ctcaaagata
     9841 tcgagacaag agttcaatag gaacgagaat tcaacagtag aattcagata aggagggaaa
     9901 agcgaaatat gcaaagggtt atccttctag agcattagca agccatcttg aacgagccat
     9961 atttatcgta cagcttttcc aattataccg atgcaagcaa ttttcggtcc tgacattctg
    10021 gagatatatc tgtatctaga atgatctacg gcggtacggg attgtgttta tttctgaagg
    10081 cattcgagtt taggaaaact tcacctgcgt aaatttggct cctcacctgt aaaaggaggt
    10141 ggagaagtgc tgtatatagg tcgaatgaac atgttacata caacttaaat gtagtatagg
    10201 tgggtaaggg gtagaacatg tagtgtagat aagataaaat gggtacaaga cggtattaaa
    10261 atgacccaat gatgtagttt agaatttaac ttacctacct gatagacacc tagtttgata
    10321 cctcttacag tactgtacgt gaaataacct gcaaatgcac tatttactgg tacattcctt
    10381 gtattatgac agtaaagtaa aggctagtgt accactagtg cagaaccgtg agtccggagc
    10441 cgcaacgctt gccttctggt atcataatta ccaccagcaa gcgacatttg aagtcgttcc
    10501 aacatctttc ggttctcaac ccaaggatct tctcaaggaa cctcataacg aacccagtta
    10561 cagctgccat gcttccttta tcagcgcgcg cccttccggg tgccctccat ggtgagcaat
    10621 tctccgctcg cgagtctttt gagctccgct cacgttaggc agcacgacca cgcttggtct
    10681 catcgattcc tcgaatccaa ctagttgcac atctgtcaac tacccccaat caatcggcca
    10741 cagcgcttga gcacaaagga cattcgggtc agccgctgac tgcttctgga aagatacgga
    10801 aggaggtacc tctaccgagc caggagaaga aggagggtgc gatgcaatat gtgctgtttg
    10861 tctccccaag ggattggaac tgttatacgt gcctaacgtt gttcttagga ctaccttgga
    10921 ccaagttgcg aattgggcac gtcagagctc tctttggcct atgacttttg gtcttgcctg
    10981 ctgcgctgtc gagatgatgc atctgtctac cccgagatat gatcaagacc gcctagggat
    11041 tatctttcga gcctctcctc gccagtcaga tgttatgatc gtcgctggca cgttaacgaa
    11101 caagatggca cccgctctta ggcaggttta tgatcagatg cccgacccac gttgggttgt
    11161 tagcatgggc agctgtgcaa atggtggtgg ctactatcat tacagctact ccgttgttcg
    11221 tgggtgcgat agaatcgtcc ctgttgatgt atatgttcct ggatgttcgt ttgcacccat
    11281 ggctatgatt tcccttcatg atttgtgaat atttgctgac cgctaattcg aaggcccacc
    11341 gacctccgag gcattgatgt acggaatttt ccaactccag aagaaaatga ggcacaccag
    11401 aatcacacgc atgtggtaca ggcgctaggt ctttggtata tgttttatcg tcctattcga
    11461 tcccaagggc tcaatttagg tagatgtaaa attaaagtca ttttctatgt tagtcaataa
    11521 ggcaggctag ttactattca tatcttgaga ctattgcttt actagctaaa gctcttttac
    11581 tgcttatgtc atattatggt atgttatgga ggtaccgttt aactacatag atgagtgggt
    11641 gaacctgtct tatatcttaa acagccgaag gccagctaaa gctgaaagga gactgcttcg
    11701 tatcgagggc taacccctca gccaagcgcc cttacctggc tacccattaa caacaacacc
    11761 tccattggga tgcaatgatt gtcccgagat atagctgctg tcttggctcg ctaggaagac
    11821 gaaacaagtc gccacttcac tgggttgtcc cggacggccc attggcacac tgctgaattg
    11881 gtccattgca gagctagtca tagttgatgg gatcagaggt gtccaaacta ggtagcggtc
    11941 agttgtcgtg caattgttag atggggttga gcttacttgg gccaggacaa acacaattca
    12001 cccgtatacc tcttccaact tgttgattag acaagcccct ggtgaatgca acgattgcac
    12061 ccttggttgc agtgtagtca aggaggtcag gtcgaccgat gtatgcattg acagacccac
    12121 agtttattat agttgagcca ctcttcatgt gcggaagcgc gtacttcgaa agatagaaga
    12181 atggatggat gttggtatcg aatgtacgct cccattgatc cctattggtt atatatcagt
    12241 cctgatggtt ttaacatcgg gtgcagcgaa agggagcttt ccactcactc ttcaaggcca
    12301 ctaatgtccc caatcatgtt ctggaatccc gcattattca ccaggatgtc tatgccaccc
    12361 atacattgca cggcggtatc aaccactttt cgacaattct ccttcttgcg cacatccaca
    12421 gccaagcagt gacagtcatg tcctgtgcct tggacccttc tttttgtctc ttgtgcgtct
    12481 ttttcttctt cgggtaagta gacgatcaag ctagatgctc cttccattgc aaacaataag
    12541 gcaacggcgc ggccgatgcc agagtcacca cctgtgatga tggctctttt cccaacaagc
    12601 tttcccgctg ccttatatgt cgtataaccg ccttcttcgg tcggtatgta ggttgatact
    12661 ggctttgggt cctccagctc ttcttgtagc ccgggtttct tctgatgttg aacgggaatt
    12721 tgatggcctg ggataatcga tgagtatcta gtccgatata ctgtgcgaag aacagaccta
    12781 cctgtttgaa actgggattc agtaccgcga gcggctcttt ctgtgtaatc ttgcatgatt
    12841 taggttgtta cttggcagta gctggttaag taaggcgcga aggtacagaa ggagagcttg
    12901 ctaactaacg acgtttagag tgacccaagt ctataattga gtatatctgt ggctactatg
    12961 cagcataaat atccccgaaa ctactatatc gtcatgctaa caccttcgtc agagtgacgt
    13021 ctcctcgacg tacatagcaa gtctgcaacc aaccctcctc ttttcgtctt cactgtttga
    13081 aacctctctg cttatgtgtt tactccgaag ctacacatct ttcaattttc attctcactg
    13141 caaggttata gttgtcatga acgagggttt gaaggagact gttcttgctg catttgacag
    13201 tggcgcccga accaagctaa aaccattcca caaccaagta catcaacaca gtatactgca
    13261 gtgcccatgg tactttttat gggaatcttt cccttcgaca ttcttgactg caattccatg
    13321 ctttaaacca agcaccagcc agctcaattg ccgcgtagta cttttatggt gtcactcttc
    13381 catggtgtta ctccgagcaa agagtgtgtc aagtaaagta gcattatggg atggtgattt
    13441 atttttgctc tgccataaaa gtattgccca cctcggcttg acatcggtat cactttatgg
    13501 aaatattaga tgactactga ataggtatga tgcctgttag gtacggagta ccccaagtag
    13561 taggtggttt cgcatccggg aacggtatgt attgtactat acatacacca tcatgattct
    13621 atcctagtac agtgggatgc aaaaagtttg aaaccatccg cttgaccgcc ctacataccg
    13681 ccatatacta accttaccaa attcaatatt tgaacctaca cacgtctatc tacacattga
    13741 aatatagccc ctaggaagga gatagatgcc agttactaag ttaggtgatc tgtaaactaa
    13801 gtattcaggc ccaggtatgg tttttgcgaa gtttctgccg cgcaaaataa taaaattaag
    13861 aaggcggtta gaccaggaaa taaatggata gtttcaaaac tttttgcatc ccactgtatg
    13921 tctgtacttc catactacga gtgtcgtaat gagaacgact ctttttctgg actaggtcac
    13981 cctttctttg atgattaatt ttttttacat agcctattgc caataggcta tcggcaaggg
    14041 tggcctgatg atatacttaa atctaatcca aaaagttaat ttaatggatc tcctattacc
    14101 aagatctgta aagatgtacg gagtactatg tactccgttg tttaaaattg tttctgtgac
    14161 tggtggccaa ttgtatagat aattgaacaa tgattattta tctatagatc taatagtata
    14221 gggatctttg atagactacc ctacagtaac gatatatcta tgcggtggcc ctaaattcaa
    14281 tgtcgttgtc tatatttagt ctagctagta cagtatgaac cccctgaagg cggctaaagt
    14341 agggcgccac gtcttaatac tactgtatga aatacacacg gtatatacct accgttaacg
    14401 caaatcttaa actcgggcca cctttgtcta ccttagagcg tatggtacat gcgaatgcgg
    14461 taggcggtca gataaatagt tttcttttcc ttttttcctt tcttttttcc ttgtccctcg
    14521 tacttctgat agtgaaagta tgatcaagat tgaatggatc tgtattttta ccaaaagacc
    14581 taaatcgttt tcatctcctt ctacattgaa tacatacgct ccatatccac ccaactgaac
    14641 tacttacata tcattttttt gtcttgtgga ccgtcgcagt accatggctg attttgcaaa
    14701 ggatcctgct ctcaacgcag cattatctgc accatgggcg tttctctgcc ctacatcaga
    14761 attaaacgat accatagtag gatcggcaaa attcttcctg gactctcttg ctctttcgat
    14821 tagtgacgcg cagtccgccc gccaacgaca aaataggaaa cgcaaaagat gcgaggcaaa
    14881 cctagaccaa aacaccgaag tattgcagtt aaagcagttg ttcgttgagg gatttggctc
    14941 cgatcagatc tgggagcaag cacttaggat tcttgactct gctggacagg aaatccaacg
    15001 cgactgtaca ttaagtaatc gacatgctgg ccactcttta tcagatgaag gtattacatc
    15061 tttcgaaggc tcggattttg cggctgaaag ttccgagaac agcgagctag agagtcatct
    15121 agagggtacc agggacctgt cagatgtcga tgaggaagtc agtatggcgt tggatctaga
    15181 tcagggcgac tcgatacatg atgcattgga ctcccggagt attgacgaga ctttgggcga
    15241 ggaaagcgaa tccagtgaaa ctggtagtga cggagaacaa cccggcactt acacagagga
    15301 cccttttggg ttgaatgatg ggttcttctc aattgacgat ttcaacaaac aatcagaact
    15361 gtgggaaaga caagacgctc ggggcggccc agatgatgaa tctgaaagtg acgaggaagt
    15421 tgactggcat gccgatcccc tcgccactgg gaacattagc gcttctttga ataaaacacc
    15481 accgtcaaat gagaccgaca ggggtgtcaa ggatcaaagt atgggtgatg atgatgatga
    15541 tgataatgac acaagtgatg aggaaggacc aacattcaac aatgtcaatc ttcaggatgg
    15601 actagattca gatacagatg atgcatatcc tggtactgca caaggggcgg attggatcaa
    15661 tactagtgat atcaagtatt ctgacttttt tgcgccgcca ccccgcaagt ctacgaccaa
    15721 aaggtcacgt ccgctcccaa aaacccaacc agttgctgcg attaataata acgatataga
    15781 ccgtgcaatg gccgatgtac ggcgcgattt atttgaggat gatgcttcaa ttgagaacag
    15841 tgatatatcc gatggtgaac taggtgaacc tgaaacccaa aaatctacac acgagaaaca
    15901 acgcgcacga atcgccgatg agattcgtcg cctggaagct gccaacgttg caaagaaaga
    15961 atggatgctt gctggtgaag ctaaagccgc agagagaccc gtgaactcgc ttattgagga
    16021 agatcttgaa gtggaaagga ttggaaagcc tgtacctgtg gttactgcgg aggtctccga
    16081 agacatcgaa ggccttgtta agcgtcggat ccttgccagg gaatttgatg aagttatccg
    16141 ccgccgccct ggtatcactg atagccaagt tgcgagaaag agtcgctttg agcttgagga
    16201 ttctaaagct caacagagcc ttgcagagct atatgagact gatcacctcc gagctactga
    16261 tcctaactat gtggatccta agaatcagaa gcttctgcgc gaacacaatg agatcagtaa
    16321 tctatggaaa gaaataagct cacaattgga taccctctcg aactggcact ataagcccaa
    16381 aaccccacac gcacacatca acgttgttac cgatgcggca actattatga tggaggatgc
    16441 gcaaccaaca gccggaggtg ctgttggtag tgcagcaact cttgcccccc aggagatcta
    16501 tacacctggg gctgacggca aggcttctgg ggaagtagtt ttgaggaacg gattgtcagt
    16561 ttccaaagag gaaatgaccc gtgaagagaa gtcaagatta cggcgacaac acaagaagca
    16621 aaagaaaact accaccaacg ataaaaaccg acagtcagga aaggcagctg agaggcaaca
    16681 aattgtgtcg gatttgaaaa agggtgacgt gaaattggtt ggaaagcaag gagaagtcac
    16741 ggatatccat ggccaaaaac taaccggaac gggtccaagg agtggtgcgg atgcactaaa
    16801 gctgtagttg aacttgattt atttgatttg ctgatgttat cgatctattg ccgacgtata
    16861 tctctacctc atatgaactt cttcctcgcc tcaattcagt tacctgtcac tcttcatctc
    16921 catagacagg cgtgccctat ttcgaacgta ttgaatagag gaaaatgttt tctcgcttgt
    16981 aagtctccgc catcgggtca tcgcaaactt cgactatgtg gaatagcttc tttgccaatt
    17041 tcaaaaatcg agaatctgct cgtctacgtc tcttgaagca gaaatagcaa atagattctg
    17101 ggcctaggag gtttttcaga gttgatatca gcaaaggaaa ggccggctca aaatagacac
    17161 agtccgcggc aagtacgata gcggggtgtt tcggaataca gtctggaaga gattcccccc
    17221 agtttagcac cgtagctgca acacgagagg aaacattgtt cagcttaata ttagtctcca
    17281 ttaatgggag cattggtgct tgatccgtaa tgtatactga tgacgacccg atgtcgcaac
    17341 cgcgcgcaac agcaagcccc acaagacctc cgccagctcc caactcgaca ctaacgatgc
    17401 cagttagtac cataaacccc ttaggattca ctaaaacttg gatgccggac gaacattgtc
    17461 ttattgttaa agtcagatcg gtgctgaagt aacaaatatc ttgctaggac catgcctgcc
    17521 ggccatagct ggcctccgca cccttccttc agatcttcct tgattattag ggggtctttc
    17581 agtaggccgt caaatgaaat ttcagcatgg ccaactcctt tgagatccct tgctggaaca
    17641 agcgactcgc taacaaggat agattcactg agcactgatt gttggtcggg agaattggaa
    17701 gcttccatca tgctcaatgt ggaagaatca caattatgta gggctagtag caggactgca
    17761 ctcacacaag agctgtgctc ttttcctctt ccggtctttg aacgaataat atcgtttcta
    17821 gcaggcaata cagaaaaaaa ggaagaacca gtgagagaaa tgaattaaat agagagaagt
    17881 gaggtataag agtgagtacc caaaaatgaa aatgtctgtt cttatgaaaa ttgaaaaagt
    17941 atagcttaat taaagagtat tttttgtagt gggttagggc aggaaagcac caaacagatt
    18001 gaatacatca atactcaatg ttgctccgta atagcaggat atccctaatg tcgaggtgaa
    18061 aaaaacatgt ttctcaaaga aggcaagggt gaaaagtaag aataaaataa tggcgtgcgt
    18121 atttgccgtg tgcaaaaatt acattcagtt cttggcacat tttttggaac ttttcgcgca
    18181 ctatcttcaa aagtagatat ttccaaacgc ttataactca gccaattctt tattattatt
    18241 ataaatttgg attgaaatta tatatttagt attattaaaa gtagcggaag atctactttt
    18301 aaagtatgtt aaatagaatt aaaaaactta gattagataa gaatatagag tgtttatatt
    18361 gtaaatttct tattgtctaa aatcaatttt cctttatgat acagactttt taatatatta
    18421 tcttgtatat tttaatttaa agatgatata ttcaagattg gttgatttac aagtatttaa
    18481 aaatagtcat ttttatagat gttgtgcaag cagcaaaaag ttgaagaaaa tgtgccaaaa
    18541 actgaaggca attttataca cactaaatgt accggtacat atactgagta agttacctat
    18601 catgttaggt aaatgttacg cccggggctt cgtcgtcaag tctgagacca gttagcggac
    18661 cacgtttcga gggttactaa cctgaagtcg ttctttgacc tccgtcgct
//