LOCUS       AP007157             2661830 bp    DNA     linear   PLN 16-DEC-2016
DEFINITION  Aspergillus oryzae RIB40 DNA, SC023.
ACCESSION   AP007157
VERSION     AP007157.1
DBLINK      BioProject:PRJNA20809
            BioSample:SAMD00067075
KEYWORDS    .
SOURCE      Aspergillus oryzae RIB40
  ORGANISM  Aspergillus oryzae RIB40
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Eurotiomycetes; Eurotiomycetidae; Eurotiales; Aspergillaceae;
            Aspergillus.
REFERENCE   1  (bases 1 to 2661830)
  AUTHORS   Sawano,T., Tanaka,T., Machida,M. and Yamada,O.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-JUN-2004) to the DDBJ/EMBL/GenBank databases.
            Contact:Toshihiko Sawano
            National Institute of Technology and Evaluation, Genome Analysis
            Center, Department Of Biotechnology; 2-49-10 Nishihara,
            Shibuya-ku, Tokyo 151-0066, Japan
REFERENCE   2
  AUTHORS   Machida,M., Asai,K., Sano,M., Tanaka,T., Kumagai,T., Terai,G.,
            Kusumoto,K., Arima,T., Akita,O., Kashiwagi,Y., Abe,K., Gomi,K.,
            Horiuchi,H., Kitamoto,K., Kobayashi,T., Takeuchi,M., Denning,D.W.,
            Galagan,J.E., Nierman,W.C., Yu,J., Archer,D.B., Bennett,J.W.,
            Bhatnagar,D., Cleveland,T.E., Fedorova,N.D., Gotoh,O.,
            Horikawa,H., Hosoyama,A., Ichinomiya,M., Igarashi,R., Iwashita,K.,
            Juvvadi,P.R., Kato,M., Kato,Y., Kin,T., Kokubun,A., Maeda,H.,
            Maeyama,N., Maruyama,J., Nagasaki,H., Nakajima,T., Oda,K.,
            Okada,K., Paulsen,I., Sakamoto,K., Sawano,T., Takahashi,M.,
            Takase,K., Terabayashi,Y., Wortman,J., Yamada,O., Yamagata,Y.,
            Anazawa,H., Hata,Y., Koide,Y., Komori,T., Koyama,Y., Minetoki,T.,
            Suharnan,S., Tanaka,A., Isono,K., Kuhara,S., Ogasawara,N. and
            Kikuchi,H.
  TITLE     Genome sequencing and analysis of Aspergillus oryzae
  JOURNAL   Nature 438, 1157-1161 (2005)
COMMENT     URL:http://www.bio.nite.go.jp/dogan/Top
FEATURES             Location/Qualifiers
     source          1..2661830
                     /db_xref="taxon:510516"
                     /mol_type="genomic DNA"
                     /note="SC023"
                     /note="phrap>=30:1-2661775"
                     /organism="Aspergillus oryzae RIB40"
                     /strain="RIB 40"
     repeat_region   1..23
                     /note="III left telomeric region"
                     /rpt_family="Telomeric Region"
     CDS             1943..3463
                     /codon_start=1
                     /locus_tag="AO090023000001"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000116"
                     /protein_id="BAE58593.1"
                     /transl_table=1
                     /translation="MSSGLSLERACAVALGIVASASLVAAGPCDIYSSGGTPCVAAHS
                     TTRALYSAYTGALYQVKRGSDGSTTDIAPLSAGGVADAAIQDSFCANTTCLITIIYDQ
                     SGRGNHLTQAPPGGFNGPESNGYDNLASAVGAPVTLNGKKAYGVFMSPGTGYRNNAAS
                     GTATGDKAEGMYAVLDGTHYNSACCFDYGNAEVSNTDTGNGHMEAIYYGDNTVWGSGA
                     GSGPWIMADLENGLFSGLSSTNNAGDPSISYRFVTAVVKGEANQWSIRGANAASGSLS
                     TYYSGARPSASGYNPMSKEGAIILGIGGDNSNGAQGTFYEGVMTSGYPSDATENSVQA
                     DIVAAKYAIASLTSGPALTVGSSISLQVTTAGYTTRYLAHDGSTVNTQVVSSSSTTAL
                     RQQASWTVRTGLANSACLSFESVDTPGSYIRHYNFALLLNANDGTKQFYEDATFCPQA
                     GLNGQGNSIRSWSYPTRYFRHYENVLYVASNGGVQTFDATTSFNDDVSWVVSTGFA"
     exon            1943..3463
                     /number=1
     CDS             complement(join(4189..4457,4544..4893,4962..4966))
                     /codon_start=1
                     /locus_tag="AO090023000002"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000115"
                     /protein_id="BAE58594.1"
                     /transl_table=1
                     /translation="MGQFLKPPRIEMASIQLPPVQTPVAITDQFIAQQTESLVLKERI
                     LSLSGDSFDVKLVTGEPIFRIKGKPLSISGRKSVFDMADNHLFDIVKERLHIHSTYVV
                     QALDGSKLLEVKSSFSLIGSNATVIFTPSTTEGLVSLNMKGNWRSRKAAIVDAATGAV
                     VAQIDRKRFNARQIFFHQQTYVVMVAPGVDLALITALCVCFDEKNND"
     exon            complement(4189..4457)
                     /number=1
     exon            complement(4544..4893)
                     /number=2
     exon            complement(4962..4966)
                     /number=3
     CDS             complement(6228..6920)
                     /codon_start=1
                     /locus_tag="AO090023000003"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000114"
                     /protein_id="BAE58595.1"
                     /transl_table=1
                     /translation="MTKYKPLQEEDSSDGCEHFEAHYKAPHIPKQRPTLAFRVRYTFP
                     ILLATFGFLDLTYRTYTLIQSRRPISCNCGETVEEAIANSCKYDSIAAAWLPPACRND
                     ELLAQFETSGPNPDGSWMYYADKNKTRTLSLEEVSMLPKTGSHFFTTHQWHLVHCAYY
                     WKKMFLAAEMGTVIEARYNNLAHINHCEMMFLKRDALDTIVTEAGVSLHSDRMVVAKK
                     HGHEGDKQEKGY"
     exon            complement(6228..6920)
                     /number=1
     CDS             complement(join(7651..7922,7973..8039))
                     /codon_start=1
                     /locus_tag="AO090023000004"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000113"
                     /protein_id="BAE58596.1"
                     /transl_table=1
                     /translation="MQFNMIVALLAIGAPLAYTSPIVGQDNEAIPFYEKRADNSEAIP
                     FYEKRAGDNEAIPFYQRRADSSEAIPFYEKREEESEVIPFYQRRADNSEAIPFYEKRA
                     EESEAIPFYQ"
     exon            complement(7651..7922)
                     /number=1
     exon            complement(7973..8039)
                     /number=2
     CDS             complement(join(11234..11320,11383..11519,11573..12875,
                     12918..13011,13061..13102,13150..13237,13295..13442,
                     13483..13811,13877..13940))
                     /codon_start=1
                     /locus_tag="AO090023000006"
                     /note="vacuolar sorting protein VPS1, dynamin, and
                     related proteins"
                     /old_locus_tag="AO070298000111"
                     /protein_id="BAE58597.1"
                     /transl_table=1
                     /translation="MAKKKAPMLTNVDDMDNEGRVRLTPPQRHPIPADTVELVVVGDQ
                     SSGKSSLLEGLTGFSFPIASDLCTRYVTQIVLRRTKPEDSGTRITIIPGPSASDGHRE
                     NLLSFERSSQEEDLDSSEIADIFNEASGRAARHMGVPGPNTTDPEHFDKRFSDDILKI
                     EISGLQQRHLSVVDVPGLFHNPTQYQTLEDRAIIRGLIEKYITDKRTIILAVMDARNN
                     LANQEVFNMARSADPQGSRTVGIITKCDAVQEGDEENDKVIRIAQNEVEKLHHGWFAV
                     RNRSTKEIQNGVTIEGRHHIESHFFSTEHPWTKLSKDRVGIKCLKLFLGGLLYSHIKG
                     EFPGMVKEIEDLSQETQKELELLGPSRQTTVDQRRYLTQIGTLYERHVGNALSGNYDP
                     TWDSNSPLKLRMHIHSLNELFAKDMAHYGHLKIFQTVSGEVDGSFDRSAGDQQNIYEW
                     IRTLYRDSRGAELPGTVNPAVLENMFRQQSSPWERIAQDYVEKASSKISDFIRMSLEK
                     IVGDDEVRASLMSQIVRRQTTTSTRAMEILSTILSDERGGILQTVNHYFADTLAETRQ
                     ERVMARLRSLDLEGVPMNVTDVLSGIHLSNEQQAVNDIHDILKAYYKLALKRFCDTVI
                     LQVTERCLLGQDAAIRLLSPDLAGGMTDRELADVAEENFATSTIRNDLLSRIQRYQRA
                     LDIVRQVGGSTFRTPCVYHYDMMASGIIQHYARASVDIYLNLLPFMLFGNSYLRLLMY
                     HVILVFSISAIWLGNSPRFYLFQ"
     exon            complement(11234..11320)
                     /number=1
     exon            complement(11383..11519)
                     /number=2
     exon            complement(11573..12875)
                     /number=3
     exon            complement(12918..13011)
                     /number=4
     exon            complement(13061..13102)
                     /number=5
     exon            complement(13150..13237)
                     /number=6
     exon            complement(13295..13442)
                     /number=7
     exon            complement(13483..13811)
                     /number=8
     exon            complement(13877..13940)
                     /number=9
     CDS             complement(join(16001..16065,16158..16934,17634..17747,
                     19695..19716))
                     /codon_start=1
                     /locus_tag="AO090023000007"
                     /note="ATPases of the AAA+ class"
                     /old_locus_tag="AO070298000110"
                     /protein_id="BAE58598.1"
                     /transl_table=1
                     /translation="MSSLVAIIEFTLNRVFLGSPGTGKTTVAKLYGQILVDLGYLSNG
                     EDTIGCEAIINKLEDYRLTVKHLRELEIDPRQHVPFNFLFRGPPGTGKTSTARKMGQV
                     YYDLGLLSSAEVIESSATDLVGQYIGHTGPKTQELLEKSLGKVLLIDEAYRLAEGQFA
                     KEAMDEIVDCITKPNFFQKLIIILAGYDQDINRLININPGLTSRFPEELEFASITPDD
                     CIKLLTKLLQKQKSDFGLKINGFDLDALESPRPEFTKKLRSRFTRLTQTANWANARDI
                     QTISKSIFGVAIKSMRDKKIAICEDLVISSRSAARYASANHNIQPACSL"
     exon            complement(16001..16065)
                     /number=1
     exon            complement(16158..16934)
                     /number=2
     exon            complement(17634..17747)
                     /number=3
     exon            complement(19695..19716)
                     /number=4
     CDS             complement(join(21131..21160,21235..22662))
                     /codon_start=1
                     /locus_tag="AO090023000008"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000109"
                     /protein_id="BAE58599.1"
                     /transl_table=1
                     /translation="MTSRTDRLAKFFDFVLSGKRPVATVDNFTLLLEAIFEKKNHAAC
                     VERIVASPAARNAIHAGVRFNTKPDFLNRHTALFLQYLSDPSIKTLCNGQHLRDIVEV
                     MIEPRTLWNAFMKAFQANALTEPAVQAFTWLVIECLTHASANEADMVDDAQTVVSSGS
                     LLKSTSPETRAYGHKLKLVLELKASNTFIEKSDYVPGGRHDNDHVDFRQIAIYPTNDE
                     SCSVEKPFYRRADEILQLPIEKRVAGHLDNQFRLLREDMLSDIREELQAVKGRKKRRT
                     VTTLKGLSVKEIFNGTERRMTPCGLVITCLQGLEALKARDKEGRKAFLKNDRGYLRHQ
                     SFGCLLRGKEIVSFATVDRQIDYLLEDEPKIVLRIIGDDAVRKTLSYFKLYSDLMFLF
                     VDTAVFAYEPILKRLQEKAELPLAEDLLNYQRDSEISSSNIIEERLIKDLDHGVRTLQ
                     DVLTSEKPINLDSSQMQAFVSGLTQKELESRSSAL"
     exon            complement(21131..21160)
                     /number=1
     exon            complement(21235..22662)
                     /number=2
     CDS             complement(26595..27755)
                     /codon_start=1
                     /locus_tag="AO090023000010"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000107"
                     /protein_id="BAE58600.1"
                     /transl_table=1
                     /translation="MASIRIADIHRPDLTNSEKIGPSITDVEHLSSYNWIESSTPTIA
                     VPGCPPLWSPAKTPKKVAKDSGLIYIAQNAVRHPESPLEPLFRSLYIENPLYNIRLVD
                     LITDRNNIRKLLSFINPNLSKNGLEPFTIGVEVTNNTAIFCRMEAETCMFIGPHEFRG
                     YGHEFEKAFTTTQVSASTGHHRIISYNLGDLKFIVRYETDAYVDELSGVQSRNVELEN
                     GSLLSMMKTMSLSQLESRSRLPAESKLVMKEEGKQVSIQSTLEIKTRVAHKPINIQEV
                     LPQLWVSQTPNLVRAYHKGGLFEPPEVEAVTREITKWEEDHASDLRGLVILIKEIIRV
                     ARENDGNAVIKYDGRSDNLEVWRRNGSKMLPDDLYSKLDNKMESVQAIGSDS"
     exon            complement(26595..27755)
                     /number=1
     CDS             complement(29813..31114)
                     /codon_start=1
                     /locus_tag="AO090023000011"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000106"
                     /protein_id="BAE58601.1"
                     /transl_table=1
                     /translation="MGEVFDVAVIGAGMAGIVAARDLSKNGHKVVLVEARDRLGGRTY
                     MDHACGGILELGGGYVHWTQPHVWCELQRHGISVNPPMEEGMHYWLADGAVHTGSAAD
                     FYKTALPLLERLFADSRDRFPMPCNPTAIDNTEIEKESIEDRINSLNLSSYERDVLEG
                     VLSGVVHSYKDHGIAQLLHAVATYFGNFSAFFETAGTWSIQGGTKRLIDAIMAETSAK
                     LLTSTPVSSIADKGSRVIIGTRHGKEIHARKAIVALPLNTIGDVQITPRLPDMARSMI
                     ARKNPTMAGKLWIRVRGEIKPFSIYAPAGKYPLNAARTEKYFDGDTLVLCMCSDDASI
                     CCEDRVGVQAALRRFIPSIEVVDFAYHSWVGDEFSKGGWMMNRPGFFTTGATELRRPH
                     GNIHFAGSDVSASEPGSIEGALSSGAQAARDVFIKLNKQRL"
     exon            complement(29813..31114)
                     /number=1
     CDS             join(32362..32526,33811..34360,34423..34670,34731..35055,
                     35116..35300)
                     /codon_start=1
                     /locus_tag="AO090023000012"
                     /note="monocarboxylate transporter"
                     /old_locus_tag="AO070298000105"
                     /protein_id="BAE58602.1"
                     /transl_table=1
                     /translation="MVQRSPAGKLEAIVARLLPRSVAHQIIRRGSNDCGFVPMGPFMA
                     HFGVQNQAFLSEVELSFAESQHIELARNGNEAHGSRTDRAIQNDADFPDGGVNAWRTA
                     LGGFLAFIASIGFMSGGSVFQSYYITTALSSSSASDIAWIGSVQLWGCFFFGIWAGRL
                     SDKYGPALPLGLGTVFMVFGIMMASISKKYYQFLLSQGFCVALGMGWIFTPALAVQSQ
                     WFLRRRGFVVGAVMSGQNVGGIIWPVLTNKLLIDNGMSLGWTLRIIGFIQLGLMTAAT
                     LLVKPRFPRTSNIDGFPIRQYFTHKRTIAFTIALVIMDLGIYIPWFYITPFTMTYGAS
                     ASLAFYNAAILNGGAFVGCHALGIVADSGLGFFNCLTVTTFASAVVAFAWIGARNVGG
                     IIVWTVAYGILSGALQAIFSPCLSLLAPTPEVTGSWNGIAITIGSFAVLGTGPIAGKL
                     LGDEDGTGYVLMQLFTGICLALAGVFYLATRVLVSRDRWI"
     exon            32362..32526
                     /number=1
     exon            33811..34360
                     /number=2
     exon            34423..34670
                     /number=3
     exon            34731..35055
                     /number=4
     exon            35116..35300
                     /number=5
     CDS             37175..38521
                     /codon_start=1
                     /locus_tag="AO090023000013"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000104"
                     /protein_id="BAE58603.1"
                     /transl_table=1
                     /translation="MTDSTNLKPVVFIGAAGEMCRVAVERFAKASNAQLVLADLNTTV
                     IESLAASFPSGRATTQKLDLFDEAALANLISGAGLVVLGAGPYSKTSQPVVKACIKAK
                     VPYLDFDDDVESTQDALNLNQEAKKAGVPLYIGCGASPGLSNVMVMDATSELDTVNSI
                     DICWLVGDEASVGKAVLQHLMHIAAGPCLTWVDSKPTVNESWVGTTYAPMYAEDGERL
                     LHETAHPEPVTLPRLFPHASRIQCFGSLDPKPLNGIARGLGSAVRTKALSLDDAVDFL
                     YNLASKPPLEGGLGGAFEACKGHLRGGDITLKELFGVISHSVGPLRYALWGMLEQIWN
                     GECTTAEVVTYIMNAITGTKIENRGNTLVRATGMRGGVPTVITKRNPKNGKDSYLCQS
                     MGTVTGTSTAAFMVMALEDGRKRSGVFCPEDWAKPDVFYRALERVGVPRDEIIESI"
     exon            37175..38521
                     /number=1
     CDS             complement(join(38934..39501,39571..39578))
                     /codon_start=1
                     /locus_tag="AO090023000014"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000103"
                     /protein_id="BAE58604.1"
                     /transl_table=1
                     /translation="MDGNLAAYVFCRGPYSSDHRESSQARLEFFCPGHNGKASAVFKT
                     SQDPALIIPATNTEKTLHLSYRALHNVVVKAQIRLAALGIAPGSTVALAIRNRIEFVI
                     IFLALIRQGATTSPLNPDCSVRESSEILGYMTPTYTIVAANHYSATSDKNIIEGSELQ
                     SVPVAQARWDRTICESLLLYTRVHPISLSIF"
     exon            complement(38934..39501)
                     /number=1
     exon            complement(39571..39578)
                     /number=2
     CDS             41238..42632
                     /codon_start=1
                     /locus_tag="AO090023000015"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000102"
                     /protein_id="BAE58605.1"
                     /transl_table=1
                     /translation="MGFGNLPREILSLVISLLIERASPCLDPHDNLQHVCNARLVCRL
                     WNTLARPFVFENVRLAYTDGEYQAWNDMLDSEAVRQAVRCAYIRSAPDDDHPLGIWNA
                     YTDCGYNGLLSAIGRISELDRMKSLHLRFSRHCAGVETDDPRDEVVEDIRRRQEILES
                     VFKTIQRRSSNKCSASTMRSLTIENLQNAPLPEFTSSELFRSVTKDLDALHLMVANEY
                     DEAGPDWDTYRIERQVFEPYLHHQWLVPLSDHLVCLTLSFQMGWGTIPGYFDGRGLHF
                     PRLKTLNLGNFVIGHHNQFDWVLTQSSLMSLRLDRCSIVSHITTHEDNIEKWHVRTND
                     WYEYPLGSFGIDGPYVIYGFSGTWEVIFDSIRTGLPQLTDFCYHYDDDPVFPVPPGAL
                     SVSLSNKRYTTFDDFWHDADEGSGGQDFGDSEWGYPDKRYVNRSEETKMGDSRALNAL
                     LQEIRQRQQALRLG"
     exon            41238..42632
                     /number=1
     CDS             join(43863..43918,44450..44893,45328..46717)
                     /codon_start=1
                     /locus_tag="AO090023000016"
                     /note="carboxylesterase type B"
                     /old_locus_tag="AO070298000101"
                     /protein_id="BAE58606.1"
                     /transl_table=1
                     /translation="MHNSDSYDFVLANAALMVLSHRVSPWVASYMISVTSMESPRVLR
                     RIIMSFLNKAPAEYLSLVRSVLDSPDVEAGVENGLIQDSPGAEAPSLNAAHLLAMDIF
                     AHWLVLVMLLDGVWWIGDIGQWELSQVLSLTKTQNVLGWSVDTRETWWPESMYLVKRE
                     LNSNVLHGTVQGTVNSTYPHVRQFWGIPFAQSPVGNLRWLPPHSLPDNATLNYINATA
                     PPPACPQSTSASNVFAKYEPEIMIVGGTSEDCLTLSIWAPNNGKDLSDLPVIIWLFGG
                     EWRIGGTDVPAWNPSSWVERSQEHIVVAVQYRVNVFGFPASRALQDQNLGILDQRAGV
                     EWVQKNIAQFGGNPERMILWGESAGAGSADILNFAYPDEPIVQGFAADSGSVFLTLNT
                     RSTDAAGTNFSTVASYFDCSGSAQHELDCLRQVPASEITAYLATSNGSSLTFAPFIDN
                     EVVFGNYTERYLQNRLSNKPVLFGSNLDEGTLWYNASNTAAAQDMTLSYFQCPVPYSV
                     AHRQSLGLTTYRYQYRGNFTNISPEVGLGAYHTSELPLIFGTSGIYGPDSHFEKAVSV
                     KMQDLWVAFAKDPEDGLVHQGWPKAASTDGKVMILADSDSHTVSTVMADRAIDDACHG
                     YYSSY"
     exon            43863..43918
                     /number=1
     exon            44450..44893
                     /number=2
     exon            45328..46717
                     /number=3
     CDS             join(47536..47675,47730..48006)
                     /codon_start=1
                     /locus_tag="AO090023000017"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000100"
                     /protein_id="BAE58607.1"
                     /transl_table=1
                     /translation="MVSTSALRSVAAVMIALAIPASAAPQPVSKRSTSELSLTAQLRL
                     ADTAIERYQLLPKDEDFVFNFTASEVPVATSQIFPALVGTGASFSIGELPGIFSEHCP
                     GSEVALIHDHSMQHELPPSSPSCHGALCPYIRACTV"
     exon            47536..47675
                     /number=1
     exon            47730..48006
                     /number=2
     CDS             join(48481..48511,48613..48647,48671..48885,49123..49240,
                     49483..49631,49745..49868)
                     /codon_start=1
                     /locus_tag="AO090023000018"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000099"
                     /protein_id="BAE58608.1"
                     /transl_table=1
                     /translation="MYGLGTIHGEAGPCLRMSMFTPVVHGCVGNNQGHVVTQPVASKH
                     GAYGTGKGLGAKANTDLIDKRNPGKIVTQRLHSVSRQSHTPTCPGISPQQIRQPLASP
                     HDHSRAIPRTKRSTRGFHRGTIATSQLRWGDVLRKTQDSAPCEKFHHPRIEGYIEEAE
                     EDWWYNKLCDEELEVMDIRTLNGLVKGAMGILEGAVRMDLHRDGVGSTDEEDRDEAGG
                     TDDQH"
     exon            48481..48511
                     /number=1
     exon            48613..48647
                     /number=2
     exon            48671..48885
                     /number=3
     exon            49123..49240
                     /number=4
     exon            49483..49631
                     /number=5
     exon            49745..49868
                     /number=6
     CDS             join(50819..50923,50970..52601)
                     /codon_start=1
                     /locus_tag="AO090023000019"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070298000098"
                     /protein_id="BAE58609.1"
                     /transl_table=1
                     /translation="MQANRAPRQFVLCFDGTGNKFSGNESDSNVLKIFRMLDRSGGDQ
                     FHYYQPGIGTYVTSTSLSNTGRIHKIRSAYLKAKDAAIGSTLAEHVMGGYKFLMRYYR
                     PGDDIYFFGFSRGAYVARFLAEMLDEIGLLEPGNEELLRFAWKTFAKWQQRRHNAEEK
                     DNLSRYMEAFRETFSQPVSQIRFLGLFDTVNSVPRFENAWMQRSKFPYTARTKAKVIR
                     HAVSIDERRAKFRQDLIGEVRPPCPTGPTSRRQQVRDHLARHHLYLPHGPVHHHRHHD
                     KGQQKGTMGAHGAQNAEKAANGGRKHTVYRPPARRLRDDHSAQSVASAAASCSSLSLE
                     AEEDEEQDIEEVWFPGCHADIGGGWKLEDGETYALSHAPLVWMVEKAHEAGVKFSVKK
                     RKDFNCWHDPGCKAQGREQDRVSPENHMSNPAPIVIAPDDTDEKPDLSHFEHVLRRSS
                     TDGKLHDCLQFRKGLPWTSVLSWKVMEYMPFRRMDLQDDGSWKPIRWPLPRGEVRDIP
                     NDAKIHVSAINRLKFNPEYRPGNLIIGGGGRGVKIAPKECGIEDWEVAAHHGCPIQET
                     YLRKQISHIAAA"
     exon            50819..50923
                     /number=1
     exon            50970..52601
                     /number=2
     CDS             join(55159..55731,55792..56100)
                     /codon_start=1
                     /locus_tag="AO090023000021"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000096"
                     /protein_id="BAE58610.1"
                     /transl_table=1
                     /translation="MRISDIKSSDWDTTASEYSKVPLEGPLLIPCKRMIDALQNALSF
                     SSATTILDIGCGPGTAISLLIEDYGHHIPPGTRLVATDYSAGMVAETRARRDSKIRAG
                     GDNANCWDRLDTLVVDAQDLSPFPSNSVSHIMGSLVYFMLPDPMKGLIEAHRVLQAGG
                     VFACTSWAKVEWMELLVQAAQKVRPVVKDNNSTQPRETSLIPTHWKDAAGVREELEAA
                     GFRDVHTEYVEFNWAVEDNSRFAEMMCTSSNPGSKMVLGDLIAEEQYHVRKEYAKILE
                     ENRNVCKGVAVLGVGRK"
     exon            55159..55731
                     /number=1
     exon            55792..56100
                     /number=2
     CDS             join(59624..59654,59710..59777,59790..59844,59879..59889,
                     59933..60065,60122..60475,60593..60702)
                     /codon_start=1
                     /locus_tag="AO090023000022"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000095"
                     /protein_id="BAE58611.1"
                     /transl_table=1
                     /translation="MELNLVAIDALTPTDYKFEGWMGLGRKSVQDNICEPRPWEETAV
                     DIKITYSADKYGPTLYPCCVGHENVGIAVRVGSNVENGVKVGDRVGVVAQNDSRLAPW
                     AHVYFKALDGGKFYGGYGLYHRSPSHFVIKIPEALPSASAAPMLCAGITTYSLLRHYG
                     CGPGKKIGIIGVGGLGLYAIMFTKPPEADKVIAISRKADKKGDPLGLVADACIATDKI
                     QREPLTDYHSLLKTDGRFVQLGIPDNGSLSLQPRH"
     exon            59624..59654
                     /number=1
     exon            59710..59777
                     /number=2
     exon            59790..59844
                     /number=3
     exon            59879..59889
                     /number=4
     exon            59933..60065
                     /number=5
     exon            60122..60475
                     /number=6
     exon            60593..60702
                     /number=7
     CDS             complement(join(62698..62943,63000..64197,64253..64323,
                     64374..64447,64508..64568))
                     /codon_start=1
                     /locus_tag="AO090023000023"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070298000094"
                     /protein_id="BAE58612.1"
                     /transl_table=1
                     /translation="MTSESRGIDPAWPPGTVRIEGAFGSDQGSNIILQPKPSHDPNDP
                     LNWSTWRKHLNFSLVSYYVIMVFALIDVATVTWGPVNAELGFSFEILNDSYAAGCGAL
                     CIGSVIIIPFALKYGRRPVYVFSTAFQCAISVWTARMMNVADLMLVNILSCVVGALAE
                     VLVQMTVADIYFVHQRGLMNGIYVWIMTVGTSLSPLAGGYIVDSQGWRWVWWWMVILF
                     GAGFVAFLFLYEETKFVATPTEQVPPSMSPEKAPNRKGNFEHHENVTKDEENPQEDSK
                     IRVEPEIGYWIDPSIRKKTYLQRLALWTISPSSLANFARHSYEPFVMLFTIPAIFFMA
                     VVYGAMTAAVTVTVTTLSSWMTIPPYNFTAAQIGLMGLPSFIGTSFGILLAGPLSDKL
                     IVLLARRNNGIYEPKMRLWLSLAFKIFVPAGLIMFGVGLDRGLPWPVPAIGLGLASFG
                     STPPSSVSLTYLTDAYTDIVAGSLVGVTFIRNLISTVFVFALAPWIASSGLTGFYITF
                     IVILTVILLGNILFLIYGKKLRVLGARRYLYFAGNQIDLRE"
     exon            complement(62698..62943)
                     /number=1
     exon            complement(63000..64197)
                     /number=2
     exon            complement(64253..64323)
                     /number=3
     exon            complement(64374..64447)
                     /number=4
     exon            complement(64508..64568)
                     /number=5
     CDS             complement(join(65612..65869,65928..65999))
                     /codon_start=1
                     /locus_tag="AO090023000024"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000093"
                     /protein_id="BAE58613.1"
                     /transl_table=1
                     /translation="MKTFLPLVSLLMGVGMTSAAPALKVAAERDVNPESAHSFKINAY
                     SSPPSDGQVNDALHRREVTPEGANLFIIHSYGNPSEHKVDDALERRNEDSVDGARIFN
                     AIESYGS"
     exon            complement(65612..65869)
                     /number=1
     exon            complement(65928..65999)
                     /number=2
     CDS             complement(join(68686..68731,69036..69122,69485..70662))
                     /codon_start=1
                     /locus_tag="AO090023000025"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000092"
                     /protein_id="BAE58614.1"
                     /transl_table=1
                     /translation="MSAVGDDIPLSEGGQLLLERIEADSTEPLWVLCWGGTNVLASVL
                     LKIQNTKSEAVAAALRSKLRVYTISDQDDTGVWIRHRYPDIFYICSVHGWNMYGMAAW
                     CGISGDGWYGFDKGGPDPSKISKEWIRENIQIGPLGSTYPDYMFIPEGDTPTFLYLIQ
                     NGLGVPERPEWGSWGGRYIATDISAKGLRNGHYSDTVDEAVGLDGKTHKSNHATIWRW
                     RDAFQNDFAARMQWTLSPELSKANHPPVIILNGSKGLEPLHFELEAGSTFELDASETY
                     DPDTNDSLTFTWYQYKDPSATQWSVHHEVGQLQFEPLNSTGSKVEVTVPPPEKCCLEL
                     ISREALPRGQLLHIVLEVKDNGTPPLTSYRRVTVQTLNEKLLGGGGGAEAIGDVMRDM
                     MIHGYSPICVAVTAVPCDSNWDAGYPNSSSLFHAVSVWLVGRPR"
     exon            complement(68686..68731)
                     /number=1
     exon            complement(69036..69122)
                     /number=2
     exon            complement(69485..70662)
                     /number=3
     CDS             join(71757..72222,72286..72388,72455..72874,72885..73440)
                     /codon_start=1
                     /locus_tag="AO090023000026"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070298000091"
                     /protein_id="BAE58615.1"
                     /transl_table=1
                     /translation="MLGSFKQSALYQELNARLVFIGCFVSLGAMGFGFDNSWWGGALG
                     LDQFNKKYGAYDPSTGGYSLPSEKQSAGTGTGSAGIILGCLAAPWLCSHLGRKPTLLV
                     MSGLLAVGTVLEASAITSFWQLVVGRIVVYSGIGVASNVVPMYQSECAPTKVRGAFLT
                     AYSIWNTFGGFMGTLVVFLCQNIKSEWAYLTVILCQLFVPVGIVLGYAFLPETPRYLV
                     YRGRLEEAEASMKVLFGPDYNAKEEIQLLQLQLEEQREFHKATSLLDCFRGVNLRRTV
                     VAMGTQILQQAQGISFINNFIVTFMEQLGFPDPLKSNVIVQSCGLVANLISLYTSGRR
                     INMLVGALLMAAMMMGVGGASAHGTDNLSLMTQNGCVAMLILWYVFYGLSWGPGVWIL
                     SGEIGTGQLRERTLLLASLGSFVTSVPINFVNPYVQAAIGGRVTFIYGSFSVAAIAFV
                     YFLLPETKDRSLEELDEMFQNKVPTREFYTYVCTGLGAQITQLENKDDHGDMKVKQVE
                     HVEAAL"
     exon            71757..72222
                     /number=1
     exon            72286..72388
                     /number=2
     exon            72455..72874
                     /number=3
     exon            72885..73440
                     /number=4
     CDS             join(76026..76523,76585..77193)
                     /codon_start=1
                     /locus_tag="AO090023000027"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000090"
                     /protein_id="BAE58616.1"
                     /transl_table=1
                     /translation="MWVLKAAIVSGLLLPPTLANRLYLPPVYHNGSVEVENFSVPGNL
                     DGFKMKTPANTTSFDFWYFDAFSRNTSAAINIVFFNTGDFAANPHPLTVQISGTFDNG
                     TQFSGEALASEGAFITNDESGITGNWLGSGASFYGTNLEKPNVEYVVKLNSPSIGVRG
                     TFKLKSRAPPHYPCNPNVDGLNTLLLPHLHWSNAVPDAQANIDLTINGTEFKVTDGVG
                     YHDKNWGDASVITSPKYWDWGHASLGPYSLVWYDLLDYNNTEHVYAYISKNGNLMHNN
                     CAEKAVEVRQWGANATYPPTSGIATNEGLTARFDLGGGQAFVANLTKEVIIHDQIVYA
                     RALGSVTGGIEGQEQYQGRGAYEEYVYGLLYGKS"
     exon            76026..76523
                     /number=1
     exon            76585..77193
                     /number=2
     CDS             complement(join(78438..79090,79136..79286))
                     /codon_start=1
                     /locus_tag="AO090023000028"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000089"
                     /protein_id="BAE58617.1"
                     /transl_table=1
                     /translation="MSEYSFYHYNPSVAAAVIALICYGASTGFHIFQLWKLRSWFFTT
                     FVVGAISIFPVMTVGYVFRTASAKDKTAIGPYIGQNVCILLPPSLYAATIYMIYSRIV
                     LFSRSLELSIISPHKVTKIFVIGDVIAFLMQASGGGMMAIPSMSSLGQKVTIVGLFVQ
                     LVFFGGFFTLSVIFHQRVQKLKCVRVLSMPYGPLLYTLFGVSLLIIVRCLFRIVEFCQ
                     GNAGYLASHEVFMYVFDTLLMFVVQTVFHFLHPANVLRERAYREVEMRG"
     exon            complement(78438..79090)
                     /number=1
     exon            complement(79136..79286)
                     /number=2
     CDS             complement(join(81682..81942,81998..82369))
                     /codon_start=1
                     /locus_tag="AO090023000029"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000088"
                     /protein_id="BAE58618.1"
                     /transl_table=1
                     /translation="MYKVSIATPTVQFGGNIRVTYRFVPLLKGLTVKSIRSGVIETHT
                     VLRPYASRSREVLTDAFDPPTWEEMDISTDDRCWYQCSRMLHLPKSTRQCLQSVATTV
                     LKVGHSIQFSITLLNPDGHLSSIRLSLPIVIIFYPSTSASLQMLSDIATWDEEENTLP
                     HYSDHVRDSKLVEICPGNPSTPAGPGSNEKPPDYSVSHDVSDIPSYWDTI"
     exon            complement(81682..81942)
                     /number=1
     exon            complement(81998..82369)
                     /number=2
     CDS             join(84797..86241,86299..87020,87132..87160)
                     /codon_start=1
                     /locus_tag="AO090023000031"
                     /note="predicted membrane protein"
                     /old_locus_tag="AO070298000086"
                     /protein_id="BAE58619.1"
                     /transl_table=1
                     /translation="MEDIVELLKQPLAFTSVTLGKKAQQPDVDRLHKTHAQIIQEYRK
                     MEPGLAFLPLDFSVGRWGPEEVASFKEPMRQVVAAILLLLEFHIGRIHGEVRTEDILR
                     EHAEQTKNGDITDEKQPRKVGAQQLSQLVELLEGLRSSGNQQLPQEIVDELVHTSAMA
                     IDACLEGLTATRECIHMVNCRRWVRRAPPTEREDLYQRSRTALENLRKAHSGFLRDMT
                     ELLIGHFAPTTNGESRDQRKIGALVVGMVFEEHVCITITRTQALLDRVSTAFHDSKGT
                     KLWWPTSLRYAASWAFRKKAKAPTTTTVVEDDPDEAEDLTKAAQEKLRISRGYRPKNR
                     SPLGRAILGTYHWFTSNEGLFALRMVVVTIALGIPGVIPHTAGFYYREKGLWGLIMAQ
                     TGLLVYMSEFTFSTLGRLVGTVAGGVLGLLAWYIGSANGPGNPYGLSAVMAVMLAILM
                     WIRLYLPPNLVQGGIMGGATFMLVVAYSYDDTHIPSYGNPGVGYTVFWRRLLLVLIGV
                     GAATIVQLFPRPPSAARHICKTLSHTVRTLSDHYALLLSCWGRSRHDGRVLAEPISLQ
                     LTEGLVMLDGPIDMLRFDFSSSRFDSESLGRVKRLCHIMNRTLGQLLLLSGTLPNEFQ
                     HRLAQQTALLDHQCIGEIMAVLGMCEQALKTGDALPEILPTPLVRRAFDYWQSHPAEI
                     DFSPETVRDENYRRFCVALSAYLKFLGTIDELVLVIKGVLDYTGSRVRV"
     exon            84797..86241
                     /number=1
     exon            86299..87020
                     /number=2
     exon            87132..87160
                     /number=3
     CDS             complement(join(87403..87730,87783..87874))
                     /codon_start=1
                     /locus_tag="AO090023000032"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000085"
                     /protein_id="BAE58620.1"
                     /transl_table=1
                     /translation="MPADAYGQYVDIKIEDGMKYDLRIENAHLDSGQFYRQGDQGDIM
                     TADDIDDMIIRHNGGIREVCSCGETDSMSGTQGTIDLIDDVKDTRICTLAWSAPMQSG
                     RKNRFSMLNHDPRYKVDIGKWQESGTMGTVNVAIKDE"
     exon            complement(87403..87730)
                     /number=1
     exon            complement(87783..87874)
                     /number=2
     CDS             88577..89245
                     /codon_start=1
                     /locus_tag="AO090023000033"
                     /note="pyridoxamine-phosphate oxidase"
                     /old_locus_tag="AO070298000084"
                     /protein_id="BAE58621.1"
                     /transl_table=1
                     /translation="MAKQDNIRTQLRNLPVLEGPFAEVNFANFPDTPQDAFRMWLDEA
                     IRAGVKEPHAMTLATVDEQGYPDARVLILKNMDERGWHFAVKADSPKAQQLEANGYAA
                     LTFYWPQVGRQIRVRGTAIQLPDAECREDFAERPFKSKVSAMASKQSQVLQDREELTR
                     RIAEVECTASSGQEDGFRKWRVYAVAPMAVEFWQGSNDRLHYRLRYVPDKEQSHWQRD
                     QLWP"
     exon            88577..89245
                     /number=1
     CDS             89925..90947
                     /codon_start=1
                     /locus_tag="AO090023000034"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000083"
                     /protein_id="BAE58622.1"
                     /transl_table=1
                     /translation="MAAPSPRNLSAQQLADISPIGTAVLNSRDEILFLNRRFRELMTC
                     QSRRAFDGWSQSIARGDYDRVAAVYDNALKANKALRIEYRTCDEPCQWRLLMLTPFGE
                     EELRGLPLGPGGGSYCTITDITEEKRAEISQKKIAEEAQRRKEQQERFIDMISHEVRN
                     PLSAILHCTEDILEAVQQKDRRNIRVEDIAQAAETISLCVAHQKKIVDDVLTFSKLDA
                     EMFTLLPQRVQPRQHLAMSLMMFRPELRKHNIDFEYKLDHSYADCGVDWVVADLDRMS
                     QVLVNLVCNAIKFTAKAGDEKKISVFMGASKVRPTSYPPNVVFFSSDESALRLNATNR
                     IWPKKM"
     exon            89925..90947
                     /number=1
     CDS             complement(92047..93000)
                     /codon_start=1
                     /locus_tag="AO090023000035"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000082"
                     /protein_id="BAE58623.1"
                     /transl_table=1
                     /translation="MAIINIDIVPHGGYTTAILYRLTTTHFARSDASPYRSKPVLPIS
                     FQLSFVRATQVGPATLSVQEVKLGARTSTIQVTLSQDAASTGPQTKVVGYITVSPVET
                     DQKGPVVNGNSILHPNPPSGSKPDGGIDFAALAETGRDGEWTRFPTIPAMAVSQHTEL
                     YGALPASTVQERIKTTVDQWARFRPGGQVPARWTNEALMCLLDLFPMALDRLGAMATS
                     AWTSTNDPEDRQDRSPGPFWFPTVSFNVDLKKSIPNEGAAWLHSRVVTQTLRAGRADL
                     SVEIFDENGELIAISSQVCMVVGFDRNLKNGKRARPAQGKL"
     exon            complement(92047..93000)
                     /number=1
     CDS             join(93970..94149,94208..94405,94480..94990,95045..95187,
                     95231..95248)
                     /codon_start=1
                     /locus_tag="AO090023000036"
                     /note="fumarylacetoacetase"
                     /old_locus_tag="AO070298000081"
                     /protein_id="BAE58624.1"
                     /transl_table=1
                     /translation="MKATTPFPIENLPYGVISTPSEPTPRCATAFEDYAIDLNELQRD
                     GFFDSIPGMIDGAFSKPALNVFASTPQSTQVEVRARLVRFLPSASEADKEKYFIRLSQ
                     VTNHLPMETANFSDFYCSLEHARNCSEIMGLEVNPNWYYIPSVYNGRTSSLRVSGQPI
                     RRPWGVISGPGASSQATWSRSKRLDFELEMGVFLAKPLPAGQILDIRNAKEHVFGFVI
                     LNDWSARDIQGFEMAPLGPFHSKGFGTTISPWIVTIEALSPVECPVSIPQSPPPLPHL
                     AWKGDSSNATWDIELSARILRKGKTYHITSTNLKDLYWTPYQQLTHLASAGEGLSTGD
                     IFGTGTISNDINYVN"
     exon            93970..94149
                     /number=1
     exon            94208..94405
                     /number=2
     exon            94480..94990
                     /number=3
     exon            95045..95187
                     /number=4
     exon            95231..95248
                     /number=5
     CDS             join(95868..96361,96413..96563,96609..96832,96888..96984,
                     97050..97574)
                     /codon_start=1
                     /locus_tag="AO090023000037"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070298000080"
                     /protein_id="BAE58625.1"
                     /transl_table=1
                     /translation="MDSRGKEAVGNVQRAVVEDTKVVLKATDERILWDEKQSRAVVRK
                     FDLRLLSLFTVINLFSFIDRVNIGNARLLGLEKDLGLSGLRFNIALMCLFVSYCVVEL
                     PSNILCKIVGGHIYIPTLVVCFGIITMLTSLVEQKGGLYACRFLLGVFEGGISPGLVV
                     MLALFYRRHELGVRTSIYISASSASGAFGGLLAIGLSRIPDWGLIHTWRNIFFFEGLV
                     SVILAVVAFISIPSGPETARFLTESQKQVAVDRMRIDSAGTTEHSRTTFRHVVQGLTT
                     PPIVFCALGFFFGNTCAQSFSLFSPSIISAMGYTKELAQLLSVGPYAAACVISIVVGY
                     VSDRYHSRGWVIFATVPFGIAGMGMLEFLPTSMPGAKYGALYLAAPGIYAFLPLWLAW
                     AVNNAATPTVKAASAGLVFTVGSLGGILAPCVYLPGDAPNYHAGHAIMFAFLFGSWVI
                     CIGMIIYIKWENRAREMGKRDNVLEGLGLEEQLELSSRHPAFRYAV"
     exon            95868..96361
                     /number=1
     exon            96413..96563
                     /number=2
     exon            96609..96832
                     /number=3
     exon            96888..96984
                     /number=4
     exon            97050..97574
                     /number=5
     CDS             join(98486..98621,98677..100043)
                     /codon_start=1
                     /locus_tag="AO090023000038"
                     /note="purple acid phosphatase"
                     /old_locus_tag="AO070298000079"
                     /protein_id="BAE58626.1"
                     /transl_table=1
                     /translation="MLNLQSFGIVLPLLAGTALAAVSYPPIPEDLTTPYQQRLAIYGP
                     NAISVGWNTYEKLNQSCVQYGTSKDKLDAQACSSTSSTYATSRTYSNAVVLTGLTPAT
                     TYYYKIVSTNSTVDQFLSPRSPGDTTPFNLDVVIDLGVFGQDGYTITSNNAKKSSIPS
                     IDPALNHTTIGRLAETVDDYEFIIHPGDFAYADDWYLKPKNLLDGKDAYQAILEQFYD
                     QLAPISGRKPYLVSPGNHEAACGEIPYTTGLCPLGQRNFTAYMHRYDETMPSAFTSSS
                     TNTTAQRLATKAQSLAQPPFWYSFEYGMAHIVMINTETDFPSAPDGQDGSAKLDSGPF
                     GQDGQQLAFLEADLASVDRTVTPWVIVAGHRPWYSTGSSSNICEPCQEAFEALFYKYG
                     VDLGVFGHVHNSQRFLPVYNNTADPNGMNDPAAPMYIVAGGAGNIEGLSSVGSKPSYT
                     EFVYADDYSYSTLRILDAHNLQVDFIHSSTGEVLDSSKLYKSHKEQFVVQ"
     exon            98486..98621
                     /number=1
     exon            98677..100043
                     /number=2
     CDS             complement(join(100408..101461,101513..101642,
                     101694..101853,101918..102202))
                     /codon_start=1
                     /locus_tag="AO090023000039"
                     /note="permeases of the major facilitator superfamily"
                     /old_locus_tag="AO070298000078"
                     /protein_id="BAE58627.1"
                     /transl_table=1
                     /translation="MTEAEKSDIEGSTEKIDTDVRENEYPSITKVIVVILALYLAVFL
                     VALDQTIIGVAIPKITDQFKSIEDIAWYGSAYFLTSTALQPSYGRIYKIFSVKWGFLI
                     AVLIFEIGSLICAVAPSSTVLIVGRAVAGIGVAGIFSGALVIISMTVPLPERPLVFGM
                     FGMVWGIASIAGPLLGGAFTDGVSWRWCFYINLPIGGLSIAVIIFILRVPKKSEFSGT
                     PVLDRIKQLDLIGASLLIPAIVCLLLALQWGGNKYPWNSSRVIGLFVGFGLMIIIFTF
                     SQIKLGDRATLPPGILKRRSVLSATMFALFFGGAFFLLVYYVPIFFQSVKGSSAMKSG
                     IQLLPLMLATVISSVLVGAFVTAAGYYTPFLIGGTAIAAIGTGLITTYSVDISTGKWI
                     GYQILVGAGVGAGFQIPMTAVQTVLPPEDIPVGTAAVMFFQTLGGALFIAVGQSVFQN
                     GLIDGIREFAPTVDPRAIVGAGATEMRHVLAALGQLDQLDAVIRAYMSGLRDAYRVSL
                     ALALVALVASCFLEWKSVKKTGQESKNDVAVPAL"
     exon            complement(100408..101461)
                     /number=1
     exon            complement(101513..101642)
                     /number=2
     exon            complement(101694..101853)
                     /number=3
     exon            complement(101918..102202)
                     /number=4
     CDS             complement(join(103341..105075,105140..105219))
                     /codon_start=1
                     /locus_tag="AO090023000040"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000077"
                     /protein_id="BAE58628.1"
                     /transl_table=1
                     /translation="MAEAFAYYRGAGWSAKIKSRTGCTTCKTRKVKCDETKPQCVRCK
                     GTGRRCTYAVNQTHTRIACPPTPSIGSNYALCDVVNHEWQERRAFEYYFYRAGPAIGG
                     YLDHRFWKGIVPELCRSEPAVWDAVIAISALFEDPDPFIGPPMVLKDNKLVGEHTKAV
                     SWYSRSMARVRQRVTHNDFNPHVALITCVLYICIEALQGHTVEALQLYEQGAHLIMTL
                     RQTSTMAYYEDVLQEIIKPIFFRLGAAAMISGGYPVRESFRPVTMLGNSSFATLAAAQ
                     TVMVDLVTEAFLLGNEAARYHGFQGCDSNIESSLKEQQGALTLRLDSWQRAFAHLQDR
                     EMGKPPNSSNIGAVSTLLTYHVVASIMTSTCLADNEMVYDAQMDRFREIVKHATSALD
                     AFNVVDSTQPPFTFETGIGLPVFYTAVKCRDRFLRRKALSLLRRAPPVQAFFKCAAWA
                     ALAETIIHIEEDLVPESHSRIPSAPTSEDKVLASDSPVSVSYNLPHAPCAHQITSAQV
                     VALQHDRVPLGGLENNRSDSSMCVGHIPDHRRVREFGVFLAEANSSCPANSSDRYSEP
                     TTQSHEQIFLRFTRRRRNGTTAQPRVAECFLPMKYGEC"
     exon            complement(103341..105075)
                     /number=1
     exon            complement(105140..105219)
                     /number=2
     CDS             join(108647..108665,108761..108879,108999..109330,
                     109446..109541,109627..109885)
                     /codon_start=1
                     /locus_tag="AO090023000042"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000075"
                     /protein_id="BAE58629.1"
                     /transl_table=1
                     /translation="MLDSCLDLIQVIWYAVTKITSDGFEHAGYGYHISQLPLSVLSRF
                     RKLALLMLYYRLLQATHPLYVYIIYAVGFIIAGYSLALPLALIFGCSPIQKSWDITIT
                     TGSCINTAGVYLATAITNTISDVILLLLPIPVVWGLRLPVIQKVGVLCMFGVGFLTTS
                     ISIVRLATLMPLVTSQDQTRDIALAAIFIDIEANTIIICGSFPYLRQFLRYHAPRWMD
                     YSLSSRRKSSSTESPSAQMRKPGLTQLQDDIERAINNTDGMTSVEGNLERGPREVL"
     exon            108647..108665
                     /number=1
     exon            108761..108879
                     /number=2
     exon            108999..109330
                     /number=3
     exon            109446..109541
                     /number=4
     exon            109627..109885
                     /number=5
     CDS             112857..113705
                     /codon_start=1
                     /locus_tag="AO090023000043"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000074"
                     /protein_id="BAE58630.1"
                     /transl_table=1
                     /translation="MKSKSKTLYHLRPKLDEILNDTAPVPYTLGTFIAFLAQNHCLEV
                     LEFILEAKRYRKTYDWLQDHGKACGEDGAHEERLRTVWDRIIDTYIESGAPREINVPN
                     ETREELLEYTKTNDSIPPPSLLDNAVQHMHELLRESILIPFLRSCSGTSHVQPLSVPC
                     LSGTERLSPSPRASDDTARRRSKLSGLIPSSPADMYSSDGSEPPTRCISRDTSSQGPP
                     GSSSSEIAREITGGQDWDVLPNGVGTEMWHANTAPERKRRSPESPKKRWPRLHGFTKH
                     FRRSSD"
     exon            112857..113705
                     /number=1
     CDS             115046..115717
                     /codon_start=1
                     /locus_tag="AO090023000044"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000073"
                     /protein_id="BAE58631.1"
                     /transl_table=1
                     /translation="MAPHAIVFDLLTALLDSWSLWAEAANNDRKASYRWRTRYLELTF
                     GCGAYRPYEDLVYESAKDAGLPASAPKALIHNWDQMRPWPETKQVLLQLKEKGYRLGV
                     VSNCSAELGRRAVALCGVEFDAFVTAEEAGFYKPHPKAYGTILSALGVEPRDALFVAG
                     SNGDVVGAAAAGMDVVWHNQIGLPRLPGSKPRLEGSSLHVVLDHLRQVESTPSSSTSS
                     RSSRL"
     exon            115046..115717
                     /number=1
     CDS             complement(join(116142..116234,116333..117206,
                     117277..117401,117462..117649,117710..117944))
                     /codon_start=1
                     /locus_tag="AO090023000045"
                     /note="cytochrome P450 CYP2 subfamily"
                     /old_locus_tag="AO070298000072"
                     /protein_id="BAE58632.1"
                     /transl_table=1
                     /translation="MVLAGEDLVAMFTVTHVILALGAYVALRFAYQIVYYRFFHPLSV
                     FPGPFWGSVTRLWIAWHNLRETEVPTVYALTKKYGPVVRITPTLLLVSDPTKLPDIYH
                     RNADKTGHYITGSFGETESLFNIRSHKTHAAFRKHIAGPYSFSNVTRMEPLVDARIDD
                     WLNKLDETFASTGAKFDFAWWAVYVAYDVISEIGFGAPFGFIEQGKDVGGLIQGFHDG
                     LPAFGLLARLHPFTSWMKTTFMKKYLVAKPEDNTGIGVLMRFRDRLIEQRLREIAEGK
                     DVGRVDLLQTFIDARTEDGKPLDMDYLKAEVLLVLLAGADTTGTVFQSLVNHLLVNQE
                     VYERMMEEIDTASRKGLIPETIPQYDAIQEHLPYYVACVRETLRLNPPAPNIFPRYVS
                     EPGIELFGKFAPAGTEVTGNPWIMHRDTALFGEDAEEFRPERWLDPEKAKLYNKYIFT
                     FGYGTRVCLGRDIAMEELFKGPLQPSARFEVKGGIGYWRDMWVSINRRPAVKPL"
     exon            complement(116142..116234)
                     /number=1
     exon            complement(116333..117206)
                     /number=2
     exon            complement(117277..117401)
                     /number=3
     exon            complement(117462..117649)
                     /number=4
     exon            complement(117710..117944)
                     /number=5
     CDS             join(120308..120434,120488..120507,120558..120594,
                     120646..120713,120767..121137,121205..121670)
                     /codon_start=1
                     /locus_tag="AO090023000046"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000071"
                     /protein_id="BAE58633.1"
                     /transl_table=1
                     /translation="MADSKGPTVTAVAVFFAIWTFIIICLRLFSRIFVLQKMGYDDYL
                     IVCACLTSWAFSGVTVVSVKYGLGSHIADVDPNKMETYSLMVWISSMCYLATLGFVKS
                     SVCQFYTRLGDRLLTRLSVCMLGVIVTQASSFVLVAAFQCRPIEKAWKSTLPGTCVNI
                     NVFYLANAALNILTDIMTYTLPLRVIFKLQVPVKQKVALGFILCIGLFACVSSIIRIT
                     YIPAMLSDPDSTWVIAEAMYWSVIEINAGIFASSIPSFKPIASRFIPRLIGEYSRDKG
                     YSGWSGSHDARKFSGFSKVPEQNIGLDFMDPRQPDGDNMIGTQIGYGGTQSQERIIPQ
                     GKIYAHTEIETNVEVSQDRSCRTISHSP"
     exon            120308..120434
                     /number=1
     exon            120488..120507
                     /number=2
     exon            120558..120594
                     /number=3
     exon            120646..120713
                     /number=4
     exon            120767..121137
                     /number=5
     exon            121205..121670
                     /number=6
     CDS             122651..124372
                     /codon_start=1
                     /locus_tag="AO090023000047"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000070"
                     /protein_id="BAE58634.1"
                     /transl_table=1
                     /translation="MRSALNILAGAATLTVAQAASLSDVCTNSHVKSALPSIDLINGL
                     VIDPSSITTNAVYNASTPGGDYFPAASAYDFCNVTLTYAHPGRNDRVHLKLWMPAPDQ
                     FQNRWLSTGGGGFAINHDEQQLPGGVQYGAAAGITDGGFGSFYTQFDQVFLLANGTIN
                     YEALYMFGYQAHHELSVIGKALTKNFYGTGDAKLYAYWQGCSEGGREGFSQVQRFQEF
                     DGAVIGAPALRYGQQQANHLYGNLVEHTLKYYPPPCELEKIVNLTITACDRLDGRSDG
                     VVSRTDLCKLHFNINSTIGAPYSCPASTTTTGTTPAQNGTVSALGAAAARKMLDGLRT
                     LDSRRAYIFYQPSATFDDAQTKYNPETKQFELEVSAYAAEWIPRFLQLQNYTLSSLEN
                     VTYDTLKDWMELGWQRYEDVLQTTWPDLTPFQSAGGKVLHYHGESDPSIPAGSSVHYH
                     ESVRKTMYPNMSFNESNQALNEWNRLFLVPGAAHCASSTDQPNGPFPQATLKTLIEWV
                     ENSIVPETLNGTVLDGDHKGEQQQICAWPLRPLWTENGTVMNCVYDQASLDTWDYEFD
                     AYRIPLY"
     exon            122651..124372
                     /number=1
     CDS             124739..126106
                     /codon_start=1
                     /locus_tag="AO090023000048"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000069"
                     /protein_id="BAE58635.1"
                     /transl_table=1
                     /translation="MPSRGPKATGELIIVHQESRKSRTRARAHLAHNGIRKRIQKQRG
                     QDHDSPAPPGSRAVAASSIPAPVALSGFSMVEYLISTNIFPDLNSTWGVSPAVCPGPA
                     NLSHTLSRASDVLECIFRANLAFHWLDLNLWTNPEKKRNMKVAALTYRGQALALAQKE
                     LLHRRIPSSTNRDTKRQPVHPANREICFGIVLRMLHLDYRFARCDVQAHFVACRQLLR
                     DSSDGSLTEDQQSLEALASTIRNPHLHHLMITFECINRTPNSVIWDDADLSFLTRNLY
                     QFVNRIQAGDEVSTENRTLDESIPTTLPRVSPSTILWRCLTKRPTSIPSNIYRDVCES
                     SAQIAALLLICSVFLDYEDDSERTDTSIPYQCVEELENALFALGEENAVSSALNSAWL
                     LAGGLGLPLTHRRARLWSVSGMLYALKRSFSLDLTVTASGHVVNAQYVKQVCLDFLGR
                     PWIRS"
     exon            124739..126106
                     /number=1
     CDS             join(126663..126768,127840..128026,128083..128300,
                     128350..128402,128462..128804,128853..129126,
                     129180..129302,129352..129907)
                     /codon_start=1
                     /locus_tag="AO090023000049"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070298000068"
                     /protein_id="BAE58636.1"
                     /transl_table=1
                     /translation="MAKTMKTFFAGRETNQAVVRDMVVKELWPLSSRKPKPEGSRSLP
                     VPIMKDPRDEGYEPIFDSSETVAEAREGRAHGVAEIEALATVWSTKALHIGYALVFLI
                     FFTNSFQQETTGSLSPYVYSKFANHSLISRTNVLTNVVGGVAKLPCAMLIDVWGRPKG
                     FGIMTGLCTLGLFLMAICGNVETYVTAQVIYWVGYNGMDYVLHIFLSDTTDLVNRSFV
                     YGMASTPYVVTTFAGPAAAQLMYEIGGLWWGFGIFVVLTPLVTAPFLWLLWTSLRKAY
                     TEGLIRKAHSRRTWARSVKHYFIEFDTIGLSLVTVAFVLMLLPLAPASHASNDSMSLA
                     DRSRSPDTTASFFLGVLAFMAFVLWERFCAPVCFLPFNRLKDRTLLGACFLAASLFAS
                     FYCWDLYLASYLQVTFNTRIRETGYIYNIYTIGTCLWSVPLGLIIRKVDRLKWIALAA
                     MPLIFLGTGLMIHFRSPQSHIGYVVLCEVFKALAGGTLVICQQMAAMATGGHESVAVS
                     FALVGLFTKLGGGIGSAISGAIWTSTVPFYLEKYLPTGKKHKAWELYGSIEEVLSYPI
                     GTPERDATIQAYGVAQRRMLIAGLSILPLAVASILLWRDIRLKKVSQVRGTVF"
     exon            126663..126768
                     /number=1
     exon            127840..128026
                     /number=2
     exon            128083..128300
                     /number=3
     exon            128350..128402
                     /number=4
     exon            128462..128804
                     /number=5
     exon            128853..129126
                     /number=6
     exon            129180..129302
                     /number=7
     exon            129352..129907
                     /number=8
     CDS             complement(130013..130996)
                     /codon_start=1
                     /locus_tag="AO090023000050"
                     /note="iron/ascorbate family oxidoreductases"
                     /old_locus_tag="AO070298000067"
                     /protein_id="BAE58637.1"
                     /transl_table=1
                     /translation="MPTKYVDRPIPQISLANFDQRIDEITADLVHAAENVGFFTIVDH
                     GISIDEIETMFATTERFFNLPDDVKATVPWNPNNVGWEKKSQVRPSTGQPDTKESYQL
                     QFGENMTNLWIGDAHLPGFRTTSLTFMHRVQGVSEQLMRCFARGLGFPEEYFIKCHDV
                     SRHNEQTTMRLLHYFALPEKSDGNTYHRAGAHADWDFLTLLFQKDGQSGLEICPGREA
                     VTEFGIGDEWTRVEARTGEIVCNIGDLLMSWSDDRFKSTFHRVKAPLEPGDYYGDRYS
                     IAYFNQPCKDALIQGPKKKYPMLTGEQFNTRAMQRNFAALQEKLKTMEASA"
     exon            complement(130013..130996)
                     /number=1
     CDS             complement(131655..132167)
                     /codon_start=1
                     /locus_tag="AO090023000051"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000066"
                     /protein_id="BAE58638.1"
                     /transl_table=1
                     /translation="MASAVIIDPYCLLRAAPLATSTGSLVLATSELIFYSGLVQPPIR
                     KKSDSILADYWRYIFPRGVSLVLVLNFTTIGTSLCNILWTNPCSRPLPVSRTTFYWAG
                     LIGAIGHLAFVPFVAPPIQRILNNTDPDPEAEASKEMDTWLGVHRIRMLVADIPAWLA
                     YVGAAMLIDP"
     exon            complement(131655..132167)
                     /number=1
     CDS             join(134149..134301,134352..134891)
                     /codon_start=1
                     /locus_tag="AO090023000052"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000065"
                     /protein_id="BAE58639.1"
                     /transl_table=1
                     /translation="MKLANLALSATAGLSLKATSETVQGFDISNHQATVDFKAAYNDG
                     ARFVMIKATEGTTFTDKVFSSHYQGATDAGLIRGGYHFALPDSSSGAEQAEFFLKNGG
                     GWSKDGITLPGMLDIEYNPYGATCYDKSAEDMVAWIKDFVDTYQKATGVYPLIYSTAD
                     WWKTCTGNAGGFGSTCPLVLAAYSDSAPSTIPGDWATYTIWQNSDSYKHGGDSDIFNG
                     GYEQLQKIAKAE"
     exon            134149..134301
                     /number=1
     exon            134352..134891
                     /number=2
     CDS             join(136458..136488,137945..138286,138342..138558,
                     138607..138791,138844..139247,139297..139506,
                     139559..139699,139751..139881,139932..140232)
                     /codon_start=1
                     /locus_tag="AO090023000053"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000064"
                     /protein_id="BAE58640.1"
                     /transl_table=1
                     /translation="MPKTSCPVLSSVINMYFAGSSLVLLLATHALAAVPAALHQNKAR
                     QATPYAVKEPPLTTPWTDKAGTDPWPEYPRPQLERSEWKNLNGIWQYQDAQSLAALDS
                     PPFGQPLAHEVLVPSCLESGLSGIQGKDTLYSWFTTQFTVPQSFKDQNVLVNFAAVDY
                     EATVFVNGKKAGFHRGGYFHFAFDITEFVNRDGENELLVFVHDPTDSGDDVIPIGKQR
                     LVPAHIFYTPCSGIWQSVWIEAAPANHITRLDLAADMNGKVTVTANTATTSGSPVEVK
                     VYDGDEEVGSGQGTSDQTFDFVVDGVELWSPDSPKLYNVTVTMGDEEVHSYVGFRTIA
                     KGKVDGVVRPLLNGEFIFMFGTLDQGYWPDGLYTPPTREAMVYDLKFLKDLGFNMVRK
                     HIKVEPALFYRACDELGLLVIQDMPSARPLSRPDPCATSDIIPNASQQEEFSRQLEVL
                     VNQFKSYPSIIAWVIYNEGWGQITSYYPEFELTDRVKELDPSRLVDSTSGWIDHGAGD
                     FSDNHHYANPQCGTPFYSLSSSPHDPSRIGFQGEFGGIGHNVSIENLWNVQEAINHIN
                     ETYEIDETLEAWNYRGHILLTEFEDQVRRFECSGGVWTQTTDVEGEVNGLMTYDRRVK
                     RVDEEQWKNDIQALYDAAAKRGAPSRRKM"
     exon            136458..136488
                     /number=1
     exon            137945..138286
                     /number=2
     exon            138342..138558
                     /number=3
     exon            138607..138791
                     /number=4
     exon            138844..139247
                     /number=5
     exon            139297..139506
                     /number=6
     exon            139559..139699
                     /number=7
     exon            139751..139881
                     /number=8
     exon            139932..140232
                     /number=9
     CDS             complement(join(141014..141774,141832..142217,
                     142276..142476,142557..142858))
                     /codon_start=1
                     /locus_tag="AO090023000054"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070298000063"
                     /protein_id="BAE58641.1"
                     /transl_table=1
                     /translation="MLVGNIYVIAGIAVVGGALFGFDISSMSAQLNENSYKCYFNQGP
                     QGPPFTDDADCSGPESLVQGGITASMSAGSWLGALISGPLSDRIGRKTSIMAGCSLWI
                     IGSTIMCASQNIGMLIVGRIFNGLCVGIESAQVPVYISEISPPSKRGRFVGVQQWAIT
                     WGILIMFYISYGCSYIGDRSAFGYSTAAWRIPWGLQMIPAVFLFLGMMILPESPRWLA
                     RKDRWEECQTILAKVHCKGDMSHPFVALEMQDIREMCDFERQFKNVTYFDLFKPRMLN
                     RTIIGLFMQIWSQLTGMNVMMYYITYVFSMAGYSGDSNLLASSIQYIINVLMTLPALI
                     WLDRWGRRPTLLIGAVLMGTFMYANGAIMAVHGEVVPGGIDGVAQQSMRLHGAAAKGL
                     IACTYLFVASYAPTWGPVSWTYPPELYPMRLRGKGVALSTSGNWAFNTALGLFTPPAF
                     ANIRWQTYIIFGVFNTAMFIHVYFFFPETAGKTLEETEAMFEDPNGIKYIGTPAWKTR
                     VTTGRIEQLERGDVEGLESKAQQEPAAREVEVTQPEQKTAS"
     exon            complement(141014..141774)
                     /number=1
     exon            complement(141832..142217)
                     /number=2
     exon            complement(142276..142476)
                     /number=3
     exon            complement(142557..142858)
                     /number=4
     CDS             146186..148174
                     /codon_start=1
                     /locus_tag="AO090023000055"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000062"
                     /protein_id="BAE58642.1"
                     /transl_table=1
                     /translation="MSWDLKKRKLQALWSHINTRSKKVPAWVMNARFPLTVCVLCIGS
                     QFFTARHGSSSQAKGWRPFTLRPIYLTFLACLMFLMLLILEGLRRYTVLYGGLVFLEA
                     TEEVSSAQSFAYNYIPIIVALILVTLWSLVDFDVLRLEPYFQLARPEGVPASVLFINY
                     NFGQTFVTPFTSAKRGHWVALLVSIVTVLIRMFLPALQSTLLELREVTVISNEQMKTW
                     PELVDLGTQANWIAAQERSSFDSANSAVASSTNSLQKSRSPDFAVPPVQIPTNDRRES
                     TVWKVNQTIYWSQLACHDLATNDALPVTINQTDVEHPILSWNVTGLPLVNGTNQDCSL
                     DFQYDSIFYPETDFLQVRYWEPVWTTDTFDSGDVRKAFRPRGCDPFDLYGVLLSVNAT
                     TAPADAISSLGSQYTSSATMFACDIEYHKATAEICMHANSSITSVRVIANTTTNLTNQ
                     EFNIDEFQGLLSHRAPYTSDVLFMQYNDTMGDLTVTELAVISQDVDDLEPMPVLDTAT
                     VMEQGEFEEKTKRVVIQAFVLTMGRLFNPDIPPATVSAVRFAHSVTIAVVSFAATLSE
                     AILFLCTVVALALLYFYQRRPNILQSDPGSIGAMCSMVTDLFSPSNILGNAQSDFHQL
                     STRQLRMRLRNFRLYWQEGPMGRRVELVSVDGENHGKY"
     exon            146186..148174
                     /number=1
     CDS             complement(join(149644..149841,150645..150854,
                     150910..151610,151685..151862))
                     /codon_start=1
                     /locus_tag="AO090023000056"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000061"
                     /protein_id="BAE58643.1"
                     /transl_table=1
                     /translation="MFRSALFLLLAPLALSHTTFTTLYVDEVNQGDGTCVRMNRDANT
                     VTYPIEPLTSKDIACGKDGEKAVSRVCPAKANSLLTFEFRAWADGAKPGSIDISHKGP
                     CAVYMKKVDDATADNNAAGDGWFKIWHTGYDESTEKWCTEKLIDNNGFLSVRVPSDIE
                     QGYYLVRTELLALHAASETPADPQFYVNCAQIFVQGGGSAKPETVSIGEGFYSLESPG
                     VKYNIYEKPLQLPYPIPGPAVYESKGVEERSVCPAQKRAVTAQNKGLKPAGCILQRDN
                     WCGFEVPDYSDENGCWASSKKCWDQSQVCYDTALPTGVSACDIWMTKCNSIDDACNSG
                     DFNGPPNKGKVLTPEPKTLGGSTQVFKRDVIPALEASPRISPSKVAQHPTIGNPRNHG
                     SNGSRNPWPFEPTSSRPKHDQHDQRVQRDDRQRNGQ"
     exon            complement(149644..149841)
                     /number=1
     exon            complement(150645..150854)
                     /number=2
     exon            complement(150910..151610)
                     /number=3
     exon            complement(151685..151862)
                     /number=4
     CDS             join(158669..158774,159225..159400,159488..159838)
                     /codon_start=1
                     /locus_tag="AO090023000058"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000059"
                     /protein_id="BAE58644.1"
                     /transl_table=1
                     /translation="MKAIAALALVGGAIAAPTKTVESRQLPGMGSLPGLENGVTQNAG
                     CQELTFIFARGTSEMGNMGSVVGPPVAKQLASLTGNKVTVQGVDYPADAAGNANMGAS
                     GGPKMAELIQQAKKQCPNTKVVVGGYSQGAMVVHNAASKVGADAISGAVLFGDPFKTQ
                     GVGQLASNKVKEFCASGDPVCLNGMNFMAHLSYGSNAQEAAQFLVQAAGL"
     exon            158669..158774
                     /number=1
     exon            159225..159400
                     /number=2
     exon            159488..159838
                     /number=3
     CDS             complement(join(160082..160586,160644..160879,
                     160932..161277,161337..161440,161491..161781))
                     /codon_start=1
                     /locus_tag="AO090023000059"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000058"
                     /protein_id="BAE58645.1"
                     /transl_table=1
                     /translation="MRVSSVILPLAGTLLVEASSSSPGCSALKGSVNSSIFYPNTDVY
                     EYEAQNFWSNTEIMSPGCVFRPQSSAQLGEGVKALVDAQAKFAVRGGGHMGIRGSNNI
                     DNGVLIVMSNLTTLELSDDKSIVSVGPSHRWEDVYAYLADYDLSAPGGRLGPVGVPGL
                     LLAGGVNFYGNQVGWSCNSVVNYEVVLADGSVVQANKTSYSDLFWALKGGSSNFGLVT
                     RFDLETVKSTKVWAGSYTVSSEYVDQFLEAAATYAANISDPKTHIVPALVPGDSLLAS
                     VILFYDSEDTSYPDIFKPFTDIPAVASTLGFKTVSEFAAETGAMVVPHINDVFVAGTV
                     VGTTYAELLQGISIINTTFFEQLPKLYDQIPADNISTIQLDWQPIGADWMKASEDRGG
                     NALGLDSSKIYLCYAEVVEWIGSSYDDIVAQWVEETTYAINNATQKAGLYDAFNYIGD
                     AAGFQSIFPGYGEENVSKLQTIAKKYDPNQVFQTLMPGGFKIY"
     exon            complement(160082..160586)
                     /number=1
     exon            complement(160644..160879)
                     /number=2
     exon            complement(160932..161277)
                     /number=3
     exon            complement(161337..161440)
                     /number=4
     exon            complement(161491..161781)
                     /number=5
     CDS             complement(join(162265..162307,162430..162939,
                     162992..163066,163133..163379,163483..163588))
                     /codon_start=1
                     /locus_tag="AO090023000060"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000057"
                     /protein_id="BAE58646.1"
                     /transl_table=1
                     /translation="MARRWWLTVANSVKLGSGKTHVGRTSAIFITMVYEISVLVFYMR
                     IFPSRNFHRAVWSIVFIAAGYSVASVLANVLSCKPVDKAWYPTKTGHCMNRPVFYFAN
                     AGLGIFTDFATVIVPIPWLRRLQMPLRQKIAVSCILAMGCFVGVVSCIRLSTLYTLLK
                     SPDLTCKCRHGPATDILSLIRPTGSTTDALIWCTIELNLGITGGCITAVRPFVRRYFP
                     RLLGLSYGNGYKYGDSSRKYGHPLGSVPRANAPDFSNARSNQYSTLTTATTVMPAADN
                     GSEEHILQYPEMPAKSADGIGIVRTVEFDVENSSARSGGTTNDYEAMRHY"
     exon            complement(162265..162307)
                     /number=1
     exon            complement(162430..162939)
                     /number=2
     exon            complement(162992..163066)
                     /number=3
     exon            complement(163133..163379)
                     /number=4
     exon            complement(163483..163588)
                     /number=5
     CDS             complement(join(166707..166949,167012..167387,
                     167448..168184,168247..168360))
                     /codon_start=1
                     /locus_tag="AO090023000061"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000056"
                     /protein_id="BAE58647.1"
                     /transl_table=1
                     /translation="MTESIKESISHLETVADERGVTGSQDMKEPNVDPNHPQNWSTGA
                     KLCTYLTVCFYTFLGNVNGSNFTVATKAVIKEFHVSQTQAGELVCFNVFLLGLGNVFW
                     VPLMRVFGKRPVYLLSMLSLAMMNVWSSRASSYGELLASRTLSGFAAAAADATVPAVV
                     SDMIPPQDRGHYLMFFHLALTAGLFIGPLINAYLVQEEDWRWMCYFLAIATAATFVTA
                     IFTVRETTYVQRNAFAPKRKLWQWMSLTVGYNPDASFIRTVSDIVCNIAYPQLLWAAF
                     AIGISVGWNIVVQLTASRTFTAAPYNWPAGSLGLLSLSGFIGSVLAFWLGGRLIDIIS
                     TRYTNRQGGPRLPEYRLPAIIIPGVIGPSGILIFGLCIAYQTHWIGAAFGYAMQAFGV
                     AAISNVAVTYSLDCYRPITGEALVIIFTVRNTIGMLLSLYAADWIERQGPAPVFGEMM
                     AIQVASILLAIPLFIWGKRLRAVTSQYGPMKRFQDQVET"
     exon            complement(166707..166949)
                     /number=1
     exon            complement(167012..167387)
                     /number=2
     exon            complement(167448..168184)
                     /number=3
     exon            complement(168247..168360)
                     /number=4
     CDS             join(169729..169899,169952..170081,170142..170268,
                     170315..171074)
                     /codon_start=1
                     /locus_tag="AO090023000062"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000055"
                     /protein_id="BAE58648.1"
                     /transl_table=1
                     /translation="MTTLLSDLTSTLNSALANLPAPENIKDEERVQLLGAIGQLQSAL
                     ETPVQIIQKHCFAHYGIAGIRVAQGMGIFDAFVTSNGAEMTLAELSSKTKGDVELLKR
                     IMRFLCSHNICKETNTETYQPSQIAMLYGTGSVPGDMIKHFHTNMQITSKLFDYFEEK
                     GYKNPSDAYDAPFQLAYQTNEHYFEWLSKRPATQSVFNSVMTESKRHYGVEWFEIFPV
                     LDKLQVPPERVAFVDVGGGVGHDVIALKTRFPQLPGKYIVQDLPQVIDDIKEPLGEGI
                     SAVKIDMFEGQPIQGAKAYHLRTVLHDWPDKPALEALRHIRKAMASDSILLINEHVMP
                     EGANVPALSATLDIHMMEVFSSLERTEKQWVDLLEKAEFKVTQVWRSDADFRTAVFEA
                     TLA"
     exon            169729..169899
                     /number=1
     exon            169952..170081
                     /number=2
     exon            170142..170268
                     /number=3
     exon            170315..171074
                     /number=4
     CDS             complement(join(171410..171433,171492..172950,
                     173015..173129,173187..173352))
                     /codon_start=1
                     /locus_tag="AO090023000063"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000054"
                     /protein_id="BAE58649.1"
                     /transl_table=1
                     /translation="MHFSWWGTTLVGAKRQCFSLSIRRLDFEPLSAIPDTQPRCFDLS
                     SITPSNGITRICVQCVKYTCSLDNQGALLFLVTLASFCVTLFFFSFSLALLPWLPWRH
                     QYPDSAEPNGNDPRRAAAPVGKHKIGLSRCNVAALTVHRYSARHIKCDESPGTVCQNC
                     TSTGRICEGYDMCRLPHKRTVVCLPDIANRLCWVMNSDEKRCFSYFHHHSISNLTSFF
                     DSPLWQRLVKQLSHIEPAVYHAANMLGAVQEDSEENSMRLAGVNLHRPRHRFALEQSA
                     RSFALLHKRHASHDPQFKEVTLVCCLLFTLSELLLGQYDTALQHLRSGLQILNEAATY
                     MHCLSAIDQSLVEAFVRLDAQSSHFGKDGPLLHLKKAGEEKWSHSDTMSLPRNVHEAR
                     RELNHVLSKGIPFLSECWSLSSTEIKLHYNSMCLTQQSLLASLTQHKQRLELFCEQSY
                     AKLSPKEQRGVDIIRLHYLAQILSIKTCFFNGPTPGYLTPEYVSLLSAHEALMAKFPE
                     RSTTTLDNGIIPGLYVVASKCPDYRVRLRAIKALQSWPHCEGLINSNIAASLAFESLK
                     RELMQGNKDELSLINMLHTGQ"
     exon            complement(171410..171433)
                     /number=1
     exon            complement(171492..172950)
                     /number=2
     exon            complement(173015..173129)
                     /number=3
     exon            complement(173187..173352)
                     /number=4
     CDS             complement(join(174261..175486,175539..175553,
                     175605..175764))
                     /codon_start=1
                     /locus_tag="AO090023000064"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070298000053"
                     /protein_id="BAE58650.1"
                     /transl_table=1
                     /translation="MSKEIDPCGCNDTEPTRELVLCFDGTGNTFRADGSETNILKIFR
                     MLDRTKDNRYCYYQPGIGTDVTAGSFASLAYQPFTNLPTKRIVDQALATSFNEHVISG
                     YRFLARRWVPGSRIYLFGFSRGAYTARFLNEMLDYAGLISADNEETIPFVWEAFIRYK
                     FADAGKERDDAEASLRLSRETMCRSPGLVHFLGLFDTVNSVAEFNRDVSKDNDIQPSP
                     KIMRHAVSIDEKRIKFQPVLFDPPPIGGMKARTHHVSTWAANGEAIISGLPHPVVKGD
                     FEEVYFAGDHSDVGGGWPSLKTKASQIPLMWMVQEAIMADLTFDPIQLKKHGCFDPRI
                     EDYDPDIVQAAEQAEIHDSLGYDFGRGLEVLFWRMMEYMPFKRPKVSPDGEVHETRWH
                     GRGFRRPLPPAAKIHSSVLHRLHYDPEYKPYNLGMGNKGTAKEQDDEQREIGQWRRIA
                     HGKLCEYWVKLPRNGK"
     exon            complement(174261..175486)
                     /number=1
     exon            complement(175539..175553)
                     /number=2
     exon            complement(175605..175764)
                     /number=3
     CDS             complement(join(177769..178019,178106..178169,
                     178260..178306,178371..178422))
                     /codon_start=1
                     /locus_tag="AO090023000065"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000052"
                     /protein_id="BAE58651.1"
                     /transl_table=1
                     /translation="MTLAGSCMCGAIAYTSDSEPLVKALCHCVDCQKWTGGPFTSNVI
                     VPRDSFKVTKGEPSFYDVTGASGKNNRHFFCGKCGSSLFTELELMADKTVIKAGTLDG
                     GEANLRNKVDVEFYTKDRVSYLCAVQGAKQETLLG"
     exon            complement(177769..178019)
                     /number=1
     exon            complement(178106..178169)
                     /number=2
     exon            complement(178260..178306)
                     /number=3
     exon            complement(178371..178422)
                     /number=4
     CDS             complement(179396..180157)
                     /codon_start=1
                     /locus_tag="AO090023000066"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000051"
                     /protein_id="BAE58652.1"
                     /transl_table=1
                     /translation="MSNAPNTAGNERFNAEAANWDNNPSVQEATRLAYETLRPLIENL
                     SEKQATTGTGLDVLEVGCGTGLLSVRVAPLVREIVAVDTADGMIEMLKAKTTLPGSPR
                     NIVPICKLLEDPEDPVLPPSDEKHPSAGRRKFDLALSHLVLHHIPDLRPFLQMLLGCL
                     KPGGRIALTDFEDFGPEAIKFHPKSKLEGVERHGIPRQWIEDLLKEVGFEQVKVWVGW
                     KLDKDVEGWEDDNGSHDGGKKTMQFPFLVCEGVRP"
     exon            complement(179396..180157)
                     /number=1
     CDS             complement(join(180363..181238,181295..181704,
                     181744..181786))
                     /codon_start=1
                     /locus_tag="AO090023000067"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000050"
                     /protein_id="BAE58653.1"
                     /transl_table=1
                     /translation="MDRAPASAKPRRSIVRGHMHQRCAAGLPPKDSFSNARQGTAELK
                     ECHVRQTRAKFRSAAQALYLNLCPLMHQSGILRKTAMFLATRQLLLVGTAASFLLLLW
                     YTQRIFVSRTVSLPAPTLTPTPTPVPTPAERVSTTPKPPVQSAGNSTLGFQSILALST
                     GPSWRTRGLLAAASLTGLDIQIPPQPPVNPNLVDAFEHMGPDNVQHPSHGASIAWLAH
                     LDLIKHTIQANLDTVLIIEDDVDWDVSIRSQMVQIAESVRNLTHIDTLDQDMEPYGRE
                     WEVLWIGHCGEYWEEQFETVLYDDPTACPHSDYFGWAKQYIERLPDRQRAVYRSVNPV
                     CSFAYALSREGSRKILEVLGGAQDEAFDVSMMHACKAGQLKCISVVPEVVHQYFPAQS
                     FGVKSAVDVGNGQEPGPEEAEFEHVMGSTENILESARCRALWGQRCLRKQ"
     exon            complement(180363..181238)
                     /number=1
     exon            complement(181295..181704)
                     /number=2
     exon            complement(181744..181786)
                     /number=3
     CDS             complement(182163..182651)
                     /codon_start=1
                     /locus_tag="AO090023000068"
                     /note="cytosine/adenosine deaminases"
                     /old_locus_tag="AO070298000049"
                     /protein_id="BAE58654.1"
                     /transl_table=1
                     /translation="MVSESDINYLRRCVDLAREALEAGDSPFGSVLVDAAGKVIYEDR
                     NRTVTEADVTWHPEFTIVKWAQKNLTPTERAAATVYTSGEHCPMCAAAHANAGLGRIV
                     YASSTAQFVQWRMEMGIKPGPVAPLSINQVAPDLLVDGPALGLDEEVRGLHQRKQARS
                     VS"
     exon            complement(182163..182651)
                     /number=1
     CDS             join(185094..186100,186281..186302)
                     /codon_start=1
                     /locus_tag="AO090023000069"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000048"
                     /protein_id="BAE58655.1"
                     /transl_table=1
                     /translation="MDSPLGEREFHVGFCFPTWTEEQRSILSFWRVLFYNELKVEGLK
                     GHLEWSTLDLSELLHHGPYQHFTTDIAKFQAITALRFISEQTTPEGSEEELSKGAEQL
                     GPFQLPRLPEGKEFGWTCQPPPSLWAVTQGWNPDDPRLLEPRAFIRSKTSLRILASYS
                     ESDDEELLLTPLESEEPESEESEIYESESDEDDSDDGWGVGRGGCLLRIPSSSSEESV
                     TLEENPSRDPEITSPVPLIQDFGQFPTGEECQKLHGQTIGVQFWNRMRRRSNAGPGQY
                     IRSGAYLKYGFAIWEQQRMIDMGLWSTQARADASDCLRRWYSFLSEEDLNYHDSRRRR
                     IDGSPPGS"
     exon            185094..186100
                     /number=1
     exon            186281..186302
                     /number=2
     CDS             complement(join(187444..187828,187883..188209,
                     188274..188428,188484..188555))
                     /codon_start=1
                     /locus_tag="AO090023000070"
                     /note="geranylgeranyl pyrophosphate synthase/Polyprenyl
                     synthetase"
                     /old_locus_tag="AO070298000047"
                     /protein_id="BAE58656.1"
                     /transl_table=1
                     /translation="MGSLPTPPLEYVGYNLAEPKSSEQIICGPLDYLLSSGGKNIRHK
                     LMLAFNEWLQIPPEKAEIISEIVNLLHTASLLIDDIQDSSKLRRGKPVAHSIFGVAQT
                     INSANYAYFLAQQKLSSLHSTRANDVFVEELLNLHRGQGMDLHWRDTLTCPTEEQYIG
                     MVLDKTGGLFRLAVKLMQLESNQTCDCIPLTNTLGTIFQIRDDILNLSGGEYTKNKGF
                     CEDITEGKFSFPIIHSINSDPRNMQLMNILRQRSEDNSLKAYAVDYITSTRSFTYSYQ
                     KLNSLIAEAKSMVEELDAQMGPSRGMCAFLEMLNLN"
     exon            complement(187444..187828)
                     /number=1
     exon            complement(187883..188209)
                     /number=2
     exon            complement(188274..188428)
                     /number=3
     exon            complement(188484..188555)
                     /number=4
     CDS             complement(189440..190249)
                     /codon_start=1
                     /locus_tag="AO090023000071"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000046"
                     /protein_id="BAE58657.1"
                     /transl_table=1
                     /translation="MGQTASAPKPGTQIQVIGAGLPRTGTASFSAALTILLDGPVYHG
                     GTQLTRGSPSELKSWIHILRAWLEDDKRTVLSIVKSRLEGYAAITDAPGCQLLPELLE
                     LYPDAKVICTVRDPIAWEKSMNQIHSFARLSFLKILLLPLPGMRHFVDFTWLLRQQWG
                     NLYADGRRFSSVKEVSDTLPQRAIYSKHVAWLQENVPADRLVFFDVREGWEPLCKALG
                     KDVPTDIPFPHVNDSEEIARTAKYHIRRALIRWVGIFAITGIAITGFMRRW"
     exon            complement(189440..190249)
                     /number=1
     CDS             complement(join(191351..191525,191581..191747,
                     191803..191910,191973..192829,192878..193118))
                     /codon_start=1
                     /locus_tag="AO090023000072"
                     /note="cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies"
                     /old_locus_tag="AO070298000045"
                     /protein_id="BAE58658.1"
                     /transl_table=1
                     /translation="MGVISVVTFLASAKEHFIISILLLFPIALILRTIYRLYIDPLHH
                     IPGPKLAAISHLYEFYHDVVRGGLFIWEIEKMHQEYGPIVRINPREVHIKDPYFYDEL
                     YAPAHGWRDKDAKSVEIFSSPNALVSTVDHHTHRMRRKLLTSFFSRRSIERIEPVIHE
                     SLSKFLDSLITAYEEDSVVELIDRLQALTGHVITQYAYGEDYGLHEPQNIGKGIVKVV
                     QEGTEQIHLHRFFPLIQRFLRLIPSFFMTQLFPARAAMYDLLHGVRKKSIEVLQQKDV
                     CTPTERTTMFHALTAPEVPPEERTLQRLEDEGLVLFAAGTETTATTLGVAIFHILSDP
                     MVLTKLRKELEQVMPTPEGLATWRELEKLPYLNGVIHEALRFSGLAMRQQRVSPTEVI
                     KYKDYAIPPGTPVSMLQYFLHTDPALFSDPEKFYPERWMLAAERKESLSRFLVTFGKG
                     TRSCIGMNLAYAELHTALAAIVRRFDLELYETTAEDIRFVRDKLLPRAKNGPWRVRVK
                     VVGIRKD"
     exon            complement(191351..191525)
                     /number=1
     exon            complement(191581..191747)
                     /number=2
     exon            complement(191803..191910)
                     /number=3
     exon            complement(191973..192829)
                     /number=4
     exon            complement(192878..193118)
                     /number=5
     CDS             join(193802..194608,194663..194768,194823..195109,
                     195162..196763)
                     /codon_start=1
                     /locus_tag="AO090023000073"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000044"
                     /protein_id="BAE58659.1"
                     /transl_table=1
                     /translation="MKDNPVGVLVDMKERSLFKSFDKSYHPTYGLGTMSGNIYDTAWI
                     AMVRKPIEGKSVWAFPTAFQALLQQQSHCGSWGGTTSELDSIASTLAALLALQRHAED
                     SYDADRQDLNSRILKAKAFLDAALKGLNGLLRTCTLPVSLELRLPAILDLLEAEGHTF
                     DFDRTYLNKIQSKKLSKINLDTIFSGPQSSLLHSLEALVGKIDFKGLAHYKVLGSMLA
                     SPSATAAYLMYNPVWDDEAEEYIQRAISNGAGHGSGLVAAGYPTTVFEWAWVTTNLIR
                     HGIEPSSRLKEVGKQIESEIELHGVVGFVPKACPDADDTAKALAALALQGAQYSPQVL
                     VDRFEREKHFTTYLYETHTSISTNANVLTALVLLSADDRYQPQIEKCIRYLCDAWFQC
                     DRMVKDKWNISPYYPTMLMCEALMSYIQRWSEGHLAALPDDLMKFQLPITLFQSLIRT
                     LRTQNQDGSWGSSNSAEETAYAVLILKSVAPFSFTNMISAEIKDAINRGVQFILTKGQ
                     RSQTDDQLWLDKTLYAIPTVSDSYIMAALQAEDTIDKLAEIPHMLANVSTAMVLKMTE
                     YFSRLPSQMETPKWVIQASVIEAILFGYRLKTLDVFSTGGALGEKYIKYGACFWTLAN
                     NSSPEYLLSTWVVYSMIELSIGIFQEDELMEKSLVNLPDFTTDMIADYIDELCNETAL
                     CKDSSLHGHSSRTNISDVNEETLTRLKSIRENIGTWFRFVLDDNLKANTSPYHRRDLQ
                     KELEMSTLAATQQAKAHRSLNNRLPHSGTECATVSTGQTFYTWLHTSAVHDVKSAVVS
                     KSLVCKIGNGGDVFPTAREKYLAEKLWRQISVEGRLWNDFGSIERDRLASNLNSVNFP
                     EFSSPQSLLLDGDVGTQLLQLAEYEHKCTLSCLNDLTQILDSTGRQTISLYLQMYYRC
                     CVIYSETCVKYAFGSTTAT"
     exon            193802..194608
                     /number=1
     exon            194663..194768
                     /number=2
     exon            194823..195109
                     /number=3
     exon            195162..196763
                     /number=4
     CDS             join(199151..199253,199455..199673,199701..200140,
                     200226..200402)
                     /codon_start=1
                     /locus_tag="AO090023000074"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000043"
                     /protein_id="BAE58660.1"
                     /transl_table=1
                     /translation="MSIDDITLDNINATILIGNLCGSDGDSSGEALYFAGLNIPRQIQ
                     DCDQFQLPMSELDFHNLAPGQPVGKDSRITRPGLWGYMVILARIFGQIQHLHRRIADG
                     TLDNSASEFETFIQGLPSGLQLTKENMETHSTLGVGQAFVALHLGYHHYATLLYFPYL
                     GSQMTHILDQKLFATRCKYHAAAFSDLLRSSNETKGCQAVYFIVAHMTVTSSSALLHT
                     LLFGQEDELFNTKKRLYYNFQILLRLKSYWRGVGMMACMLSMDRIYTMDKWIVKFLLQ
                     HALPIEGNPGPPATSQLAERDRFANDALSMLRPQGS"
     exon            199151..199253
                     /number=1
     exon            199455..199673
                     /number=2
     exon            199701..200140
                     /number=3
     exon            200226..200402
                     /number=4
     CDS             complement(join(200428..200860,200921..201315,
                     201432..201726,201778..201919,201981..202061,
                     202124..202192,202246..202408))
                     /codon_start=1
                     /locus_tag="AO090023000075"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070298000042"
                     /protein_id="BAE58661.1"
                     /transl_table=1
                     /translation="MGSVKNLDQEADVSIEHAEIASSHAPPAYEISRVTWWKLHGLRK
                     LYAMMPLLFLGSTINGYDGSLLNGLQTMSPWQTYFDNPTGSTLGLFTAIQNIGGVCAL
                     FFASYVADLLGRRIGVAVGLVVIFIGTIIQVVPPVNSGMFIAGRFLVGLGSNISQGSA
                     PLLITELAHPQHRGTLTTMYNTLWYIGSIVAAWTVFGTIKYNSEASWRIPVGMQAAMP
                     AIQFVGIWFLPESPRWLCAKNRPDEAFNILVKYHGNGDQTDQLCAFEFYEIQETLRLE
                     EENSRNGWQTLIKTPGNRKRLLLIVLVSFFSQCSGNGLVSYYLHSILNSVGIESSHDQ
                     AVINGGLQLWSFLVAIGFSSFLVDVLGRRMLFMIAAVGMLVSFSIWTGCSAVYANTGD
                     TGAGSAVIAMIFLFYGVAGFAWPGLTVAYCAEILPFQIRAKGMAVAFACTSAASVFNQ
                     YVNPIGLERLQWKFYFVYIAILVVECLCIWFLFVETKGPTLEEIAALFDGDDANVGRS
                     VEGVTHQRAANTEKISA"
     exon            complement(200428..200860)
                     /number=1
     exon            complement(200921..201315)
                     /number=2
     exon            complement(201432..201726)
                     /number=3
     exon            complement(201778..201919)
                     /number=4
     exon            complement(201981..202061)
                     /number=5
     exon            complement(202124..202192)
                     /number=6
     exon            complement(202246..202408)
                     /number=7
     CDS             join(203103..203418,203515..204878)
                     /codon_start=1
                     /locus_tag="AO090023000076"
                     /note="beta-galactosidase"
                     /old_locus_tag="AO070298000041"
                     /protein_id="BAE58662.1"
                     /transl_table=1
                     /translation="MSLPNTIYPHLRPTDNGKQLIVNGRPFLSLAGELQNSSMTSAKY
                     MDTVWQKLADTHINTVLGCITWEMIEPTEGQFTFTELDRVILGARKHGLRLVLLWFGS
                     FKNAWVKTNPKRFPRAKLRKAGGVLQTADVLSIFHDEAPKSDANAFSHLMRHLREFDG
                     SHSTVIMVQVENETGLLGDSRDGSSTAEERFSQPVPEDLLTFLARDWDSLHPDLRSNL
                     VHFKAQSQPHGSWVDAFGRGPHTDELFMAYHYAHYLNQVATAGKKEYPIPLYTNVWQN
                     YVGEDGDNDFPIVAGGGGLPGDYPSGGGTINVLDIWQQFAPALDFIAPDVYLNDYAQS
                     CRKYRHRNQPLFIPEQRRDEYGVRRIWTAYGSYQAIGVSPFGIDTLEPSTNPFTKHYA
                     LLDSVSQIVLDAQRRPGSSVGFFFDELAENGSDPSKPVVRHYAGLEITIERCFVFGKP
                     GPGSGMVIHLGGVKFLLIGWGFQVRATSLSPTATFTGILRFEEKFVVNRDTGELKTLR
                     VLNGDETRSGIFAMMPNEDPDYGGFPICVTIPARTMIAEVEFYSIDDETAV"
     exon            203103..203418
                     /number=1
     exon            203515..204878
                     /number=2
     CDS             205940..206491
                     /codon_start=1
                     /locus_tag="AO090023000077"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000040"
                     /protein_id="BAE58663.1"
                     /transl_table=1
                     /translation="MTTTICPATPDEIPAIVDFIIAARADMFSMLDPSLHLQKAQREL
                     ASFQQSYLEHPNGAFFTARVDGRLVATIGYVAYDQRFPQLDFGHERVVEVLRMYVHPD
                     WRRIGLASKLFAALEQRARQEGIRRMYLHTHPFLPGSIRFWERQGFSIVHIDDDPIWR
                     TTHMSRFLAADEPQQTDLLSTAA"
     exon            205940..206491
                     /number=1
     CDS             join(207206..207485,207581..207978)
                     /codon_start=1
                     /locus_tag="AO090023000078"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000039"
                     /protein_id="BAE58664.1"
                     /transl_table=1
                     /translation="MGLIKGVLKLTTYGGLASAGAFFYTTRNDVFVPMSPTDPIFQSA
                     AYRKFNPEQNPTTHDLCVRKVPLSDINPTLLEKKGKLAEAFCAGVWSGWGYAFQRAYL
                     ARKYQGPETANHLWERPELKASTYDVGTLITDHFEVIEKTPERIVVRCGDSPRKQDVR
                     ESDGLFEMSAVVKPEEGVAEFALKSCFYKGKGKADSQPMPPHILWLHKQYTKLWAETA
                     IRNVLRQ"
     exon            207206..207485
                     /number=1
     exon            207581..207978
                     /number=2
     CDS             join(208856..208976,209038..209264)
                     /codon_start=1
                     /locus_tag="AO090023000079"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000038"
                     /protein_id="BAE58665.1"
                     /transl_table=1
                     /translation="MIKTILCALAILAAIAPLTTAEKIKCNNATAYCGATLINRGGYL
                     TQISEILKNHDEDAGGLLLQHGLFWCKEDGKLHDAYKKCKRNKCRANQRYYPESGDEC
                     KGEWRGSILPDMK"
     exon            208856..208976
                     /number=1
     exon            209038..209264
                     /number=2
     CDS             join(209780..210076,210138..210268,210325..210535,
                     210589..211560)
                     /codon_start=1
                     /locus_tag="AO090023000080"
                     /note="carboxylesterase type B"
                     /old_locus_tag="AO070298000037"
                     /protein_id="BAE58666.1"
                     /transl_table=1
                     /translation="MAYSILQIALATLLGYFVLVDAAIIQQTRAEAHPPKAKVQNGTY
                     VGVHNDHYNIDYFLGIPFAQPPIGILRLAPPVSLNSSFSGTRNATNLQPVCVQFQLTA
                     ENKPQTATIDCAISEDCLTLNVYRPSNCGDQKLPVLVWIYGGGYTQGSNSDPRYNLTF
                     IVNKSVKMGKPIIAVAINYRLNGFGFLGGPVIQEQGLTNLGLRDQRLALHWIQENTAG
                     FGGDKSKVTIWGQSAGAGSAGSQLLAYGGRNDSLFRAAIADSDGPLAFKSPSNATQLQ
                     TWESILNLTGCSTASDSMACLRGVSSANLSYAVNASRVTFMPITDGGFVETHSSAQLL
                     NGQFVQVPLLTGTNTDEGTNFVGSPSHIGALPTIAYPNDTSFLDYIGQSITNTTASAA
                     ALAALSVLYPDIPAIGVPHSHKGRLNSTFGSQYARVATFAGDFMAHRDRRLSAQMWFK
                     YNVPVYTYRFNQWPIGGLPDTTGTTHFTEIPLVQDHEVQDGYLAPWYPAGGEFTSMDS
                     DFYALARLMNKAPIPPLVTFFRCYLKTP"
     exon            209780..210076
                     /number=1
     exon            210138..210268
                     /number=2
     exon            210325..210535
                     /number=3
     exon            210589..211560
                     /number=4
     CDS             complement(join(214047..214378,214443..214882,
                     214941..215064,215116..215245,215326..215508))
                     /codon_start=1
                     /locus_tag="AO090023000081"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000036"
                     /protein_id="BAE58667.1"
                     /transl_table=1
                     /translation="MEPQLQTPHLLSLVEEIKDAALKECSSSRSATSHYRFLGLIDQL
                     KYTVETPTETVLRLIYQPPQNAALRTVIDLNIFPLLLEHPINGLSATELSEYTGAERA
                     LIIRLMRVMAALGLCASIEPEVYLPTDKTIAMTQPIGRDGVPCIYDLTVPTLSKLPEY
                     FREHHYLMPKEYTRSPMRWAVGQSQFEWLAQRKHHQALFNSYMSSRRQGKPSWFDVYP
                     VERLTHGALEHDDAVFLVDVGGNQGHDLIRFREKFPDVTGRLVLQDLPKVIASAPAGE
                     QVEAMAYSFLDPQPVKGARAYYFRAIFHDWPDYICHKILVNTISAMNAEYSRILIADF
                     VLPDTGAALLQASIDIQMMSIGSGMERSERQWRELLGAAGLEITGIWSGSPGMESIIE
                     AVPIRAASRL"
     exon            complement(214047..214378)
                     /number=1
     exon            complement(214443..214882)
                     /number=2
     exon            complement(214941..215064)
                     /number=3
     exon            complement(215116..215245)
                     /number=4
     exon            complement(215326..215508)
                     /number=5
     CDS             join(218910..219176,219232..219986,220041..221052,
                     221102..222235)
                     /codon_start=1
                     /locus_tag="AO090023000082"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000035"
                     /protein_id="BAE58668.1"
                     /transl_table=1
                     /translation="MGIPQYKESSDDAAANITDSEQLIARFGRLHVLDDLIRLRAADP
                     VQLPILAYPKPSNDDGISYEYFTGQDLDCMVDQTVSTLIDCGFKPPRNDGAVVALFTL
                     SDLNMVVTFFALSRLGYTVMMVSPRLSAAACVSLLDMVGCDTILYGQTPSIRATMGEI
                     LRLKLVACRPIIQRPSLDAPQETDVLVLHRTRNPEVQKQKIALILHSSGSTGLPKPLY
                     LSHKAIMTHPMRGPGLTSFNSLPWYHLHGLSTALQAMYMRKTAYMWDASLPLTASSVT
                     SALEAAKPESVQGVPYLLQLLIDSPKGLDALRQCKLVTYGGAPCPDELGDRLVAEKVH
                     FGGSFGLTEAGLVAESLSRPSGDPFWNYVKFFENLRPFIWMKPVGTDLYECVYLAGHP
                     ALTASNSDEPPGSYHSRDVFTPHPTIPDRWKYVTRLDDRLTLVNGEKVLPLPIEGSIK
                     QSPLIQEAVVIGVGKSVPGLLIFRSDEARSFTDEQYLDLIWPTVEDANSRAEQFSQIS
                     RDMITILPVGSICPRTDKGSMIRAQVYAKYADVIEEAYSKLEQTTDGTLKLDQSNTVA
                     HVMRVCREELGFPISSPDSDFFSEGVDSLKAIHLRRLILGDFKITDSKTIGQNVVFET
                     GSVSRLAEYIQAVQSGQDTEVEDEVSLMPGLIEKYSTFRMHTPNPSIVSNSRSVILTG
                     ATGSIGAHTLFKLLNDDTVSAVYCLTRREQPKEEILDALAKKGLEVMPFRTKKIIALN
                     SALDKPDLGVGKEMLAEMQRSVSLIIHTAWPVNFNLPLANFEPHIQGVYNLIQFSLSV
                     HLPAPAVVLFCSSISTALGAPTSAIDEAPLDDLNSALEMGYGRSKLIGENIVSNARKS
                     GARSFSLRIGQVSGHSKKGLWNDSEAIPLMIRSALTLKALPQLDTSCSWIPVDKLACS
                     VLEIAKACSVNTLEDSGGDATTNQHIDDTIYNLSNPRAFTWSDLLDALRRSGFDFQTV
                     PFHSWLQMLRDSESRGEETINPAVKLADHYEAMYGEEAPPPKTFVTEKAERDSNTLRN
                     GRLRIIQDGILNRYAQDWLRRWKTT"
     exon            218910..219176
                     /number=1
     exon            219232..219986
                     /number=2
     exon            220041..221052
                     /number=3
     exon            221102..222235
                     /number=4
     CDS             complement(222803..224806)
                     /codon_start=1
                     /locus_tag="AO090023000083"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000034"
                     /protein_id="BAE58669.1"
                     /transl_table=1
                     /translation="MSSSSFVWTVGSIALSSLITPTIADGSGSRYQLTEAWQGEKFLD
                     HFKFFSGSDPTNGFVTYANQSYAESSGLIEVTESGSFYMGVDYKTKLSPNGPGRDSVR
                     IESKEYYDEGLYIIDLQHMPGSVCGTWPAFWSVGPNWPYDGEIDIIEGVNKHEANEIV
                     LHTSGSCSLSSENDMSGTMTSSECGESSGTIGCVVKGQDGTSGAPFNEKNGGVYAMEW
                     TSSFVKIWYFARSEIPQSITEGNPDTTAFGTPMAHLQGTCDFGERFKSQKFILDTTFC
                     GDWAGGVFGDSGCPVSDPSNPIQSCVNYVAENPAAFKEAYWEINYIKLFQTGTGHSTA
                     SVASQAETATAVASNTVDSIPSVTSTAIPETTAPAPETVSAEAPATSSAVPEPANPQT
                     SVAGAETTAAPAPSPETTAAPASPSLDDSDGADAVSETTIYVTETTTICGASTQKGTI
                     QTIGGGETEVSPASSTVESAATPAAPTPTSQKPVASLPGTTVNGGTPVPTDVSPETPA
                     EETAGESGAPTPSAEQPEQPQPAATSIETGTVPPAVSNPAPTEQGTPEGASPVDATES
                     RHDSDEPAPTSAAPIRSPSPSSWTISSSSRVASSSSFASTTSSASRTTSATKEATAPT
                     ETDSGASTGTNPESPVFTAGASKSVGISGLTGIVCGIAMAMLA"
     exon            complement(222803..224806)
                     /number=1
     CDS             complement(join(227460..227598,227677..227924))
                     /codon_start=1
                     /locus_tag="AO090023000085"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000032"
                     /protein_id="BAE58670.1"
                     /transl_table=1
                     /translation="MFLLTTGHMLPPTSLHFGSLFAETRPDPEQVLSRALELATEIAE
                     NVSLLAWHLNHALMWRNPGTAEGTHIVDSTVIYHMFDGRDMEEGTRSFLEKRKPHFTA
                     TLEDAPPNYPWWTEIDTGRRVRASKL"
     exon            complement(227460..227598)
                     /number=1
     exon            complement(227677..227924)
                     /number=2
     CDS             complement(join(228065..228161,228192..228595))
                     /codon_start=1
                     /locus_tag="AO090023000086"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000031"
                     /protein_id="BAE58671.1"
                     /transl_table=1
                     /translation="MYVILTIEPDISLRIVVMEETVRLATARMIPAPPPVDIPKSYET
                     LLLTDVKVSHHPEGAPVATPVVVVTLNRPDKNNAFSTHLMDAFEKLYPLFDVHERVKV
                     VVLTATGKIFCAGADLKEPYKPAKERPLDFRDPHTKHAVAVAWPSPSTDAANPPSPPS
                     KDPPSA"
     exon            complement(228065..228161)
                     /number=1
     exon            complement(228192..228595)
                     /number=2
     CDS             complement(228673..229461)
                     /codon_start=1
                     /locus_tag="AO090023000087"
                     /note="17 beta-hydroxysteroid dehydrogenase type 3,
                     HSD17B3"
                     /old_locus_tag="AO070298000030"
                     /protein_id="BAE58672.1"
                     /transl_table=1
                     /translation="MSHNPKNNPVLAVVGVGPGIGEAVSRHFASKGFSVALIARTEDK
                     LRKIQDSINESYPNSAKYYVTDVRDESSVIKTFDSIKEDLGPVHVLIYNAGSRRIRPR
                     TILETSSSEEFENFTRINMFGAFFAAKCVLPDMLAAGTGTIIFTGATGSIRGSPGLSS
                     FSPGKFGLRALSQIITREFQSKGVHAAHLIVDGPVQSDIIGGWLRKKWEREGEEEKLK
                     EMHRYVMQPSDLAEIYWFLYTQPRSTWTQELDVRAEREGMFSKL"
     exon            complement(228673..229461)
                     /number=1
     CDS             complement(join(229908..230049,230112..230358,
                     230478..230556,230608..230654,230711..230906,
                     231053..231091))
                     /codon_start=1
                     /locus_tag="AO090023000088"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000029"
                     /protein_id="BAE58673.1"
                     /transl_table=1
                     /translation="METIKLDIAAPLSSGRIIENTNAGVEMFFCDGFFRHKYLNDITN
                     GEKKRVQSLPDLVSYEHLLAHEWTHVDLLGSSIQVMDLEVRNLDLGVQSRRVFGAQWA
                     SVLAWYGPSLPRINVKYNDNGFDPKYAPDNTTNALGGPENISGPGLGIMNPEKNQTTE
                     QKNCHAAANDPREVFCDYLGEPYSDWLKDREKPFTSEGGCELTKQCWSSFGDYAIDPG
                     CVCKCDGEKTPLSDPKCAGFRGGPPGSHSHA"
     exon            complement(229908..230049)
                     /number=1
     exon            complement(230112..230358)
                     /number=2
     exon            complement(230478..230556)
                     /number=3
     exon            complement(230608..230654)
                     /number=4
     exon            complement(230711..230906)
                     /number=5
     exon            complement(231053..231091)
                     /number=6
     CDS             complement(join(231152..231163,231324..231620))
                     /codon_start=1
                     /locus_tag="AO090023000089"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000028"
                     /protein_id="BAE58674.1"
                     /transl_table=1
                     /translation="MASNLMFRMLQVPLFAFLLSLCLVFPTAHGWRNITDITNAYQGI
                     YWWTALVECPAERFDILVESTRMMLELTKRTTKPMDTPGWQRFFAADPPGVEGWAVLD
                     "
     exon            complement(231152..231163)
                     /number=1
     exon            complement(231324..231620)
                     /number=2
     CDS             complement(join(234613..235226,235293..235436,
                     235493..235783,235850..236031,236103..236272,
                     236356..236561,236636..236897,236975..237283))
                     /codon_start=1
                     /locus_tag="AO090023000092"
                     /note="predicted membrane protein"
                     /old_locus_tag="AO070298000025"
                     /protein_id="BAE58675.1"
                     /transl_table=1
                     /translation="MSGYARPAGSQPIEMTDMREVHRSGENETRQRASSISTDEDEEE
                     NDALPTDPFEPFGDVEPATGNILTFRALIVGCLCGTLVNASNLYLGLKAGWTDSANIF
                     GSIIGFAILQPLTSYLTSLGYQSQLFGPQENNIVQTAATAAGGLSNVFVSAIPALYQL
                     GLLTTPSKDFARLVAITAAGGYFGLLSAAPLRKFFIFQVARELRLIFPSSAATAITIR
                     GMHLAASGAYEARQKMRTLAYSFIFAMLLRVVSQYAIGILWDWHIFTWIASTGFMADT
                     AMAIESWGWFIEWTPAFIGSGMLVGMNVAASFVLGSILAWGVIGPYLVSHGLAFGKEA
                     ASADGLVSYFSLSAEYADAQHPSPRYWLLWPGVVCMIAAAFTELFCQWRVIWIAARGF
                     WQTLKTRRQKEYTYTTIGGEKNLANEDDIRLWMWLPGLVVIIVVTCFITSVQFEMSVA
                     ETLLALTLAFLLSLLAIHASGATDTVPLSSLSKVSQVVLGGITQGSASIASAQRLNLL
                     GGALTNIGANQACDLMGDFRVGFLLGTSPRLQYAAQMIGTLVAALVAPTMFLIFASAY
                     PCILSAEDTAGDGGDYQCEFPAPSVAAWRAIVLAVTRPESPIPRSSWVFSIAMAVLAS
                     VMVLVKNLFNSTWNRIQPYYPNMMIMAMAFTLPSTQYGTAMFIGAVIASVWKRKWPDG
                     FEKYAYAVAAGAMAGEGIGGVINAILSGIGLDGGNFGTTVGTP"
     exon            complement(234613..235226)
                     /number=1
     exon            complement(235293..235436)
                     /number=2
     exon            complement(235493..235783)
                     /number=3
     exon            complement(235850..236031)
                     /number=4
     exon            complement(236103..236272)
                     /number=5
     exon            complement(236356..236561)
                     /number=6
     exon            complement(236636..236897)
                     /number=7
     exon            complement(236975..237283)
                     /number=8
     CDS             complement(join(238172..238427,238482..238669))
                     /codon_start=1
                     /locus_tag="AO090023000094"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000023"
                     /protein_id="BAE58676.1"
                     /transl_table=1
                     /translation="MKATTICSFLLATGTALAMPAKRAKQTITISELFASQTDQNGYV
                     TFKLDDPNYNDVTGANVIWRRPGNPIEGARTSDAAYYVQFPGGVNDISVFILQLQRVN
                     STEKVSFTLNDNGSGHAPGTKWHCNSTESGTQTVKKCNYDGVISL"
     exon            complement(238172..238427)
                     /number=1
     exon            complement(238482..238669)
                     /number=2
     CDS             240361..241809
                     /codon_start=1
                     /locus_tag="AO090023000095"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000022"
                     /protein_id="BAE58677.1"
                     /transl_table=1
                     /translation="MARNSIIRVLFVWITTIIYLFGSILAEPVQYCKYGYKGKEEDGD
                     VDFCMAVSMHENRSSNAYDMYLSMTVTRASDLGWTAIGTGSVMAGSLMTIVYGEPLTG
                     EPPVVSIRTAAAHHQPKPITQEQAGGADVRVLQAEWRAINEDGTLTTLSSSSYAYVAE
                     VSLVCYSCNLWPAKGSGSSKISATATSLPWIWAWNEDQEISALSDDAHLNGHRHRRGN
                     GGWGEFYVDMARSLSTVENPPPVPSIQPGVRTLGTSDTPTDRSKKSTLFSRGTIHGFL
                     MGMAFLVIFPLGVLAMRSQSSKSFKYHWIIQLIASLCTGAGAIIGIVMSRGSFNSPHQ
                     VAGLLVSGILGLQGFLGWRHHVLFLRVRHRTWISHAHIWTGRLIMIVGWANFLSGMIF
                     VATGQFWIILVSAVIVGEIVGLTFWVWTCNRRKSRKSTLETAEPDVPWRGERDGEYFA
                     VGEDETEMNEMGEHDKHESSPYDPMLPRHGSH"
     exon            240361..241809
                     /number=1
     CDS             complement(join(242178..242743,242808..243219))
                     /codon_start=1
                     /locus_tag="AO090023000096"
                     /note="flavonol reductase/cinnamoyl-CoA reductase"
                     /old_locus_tag="AO070298000021"
                     /protein_id="BAE58678.1"
                     /transl_table=1
                     /translation="MALTLITGATGFIGSQVALRVLQAGYRARLAIRREEQADKLRRI
                     FADYEKQLEFVVVPDITVSGCFDEALQGVEYVLHLASPLPKPGSGDLVTPARRGTVVI
                     LESAAKVPSIKKVVVTGSVLSLVSLGELKDGLVVREDNEINYTLPPDSTIPTLPPMAQ
                     NHASKLAAHKATLDFHSTNSPAFDIITLHPVFVYGRSLVQETADQLSGSCGGLFQSLF
                     SETPSFPQFNGVHVDDVADAHVKVLDDGVKGFRSYLLAAETRSWGDVRRFLEGRYPGV
                     GFGLKGGDDGVGYRVDAGRAERELGIVFRGLERMVGDVVDQQFELRGGI"
     exon            complement(242178..242743)
                     /number=1
     exon            complement(242808..243219)
                     /number=2
     CDS             244011..244886
                     /codon_start=1
                     /locus_tag="AO090023000097"
                     /note="Zn-dependent hydrolases, including glyoxylases"
                     /old_locus_tag="AO070298000020"
                     /protein_id="BAE58679.1"
                     /transl_table=1
                     /translation="MSSLRAAVYIAPPTPFKTPGKGSGGGLWSPISCTLVYSATEAVL
                     VDTPITIKQTQDLIAWIDRIAPKRKLSYIYITHGHGDHFFGLPLLLQRFPEAKPVATA
                     ATVQHMKQQVEEKNYQTQWESRFPGEIARPFVLAQPLPESNEFKLQDRWLFQAIEVGH
                     SDTYDSTALWVPDLRLAVCGDVVYGQVHQMLFEANTTAKREEWIRAVEKIEALDPLYV
                     VPGHCQEGEVLGRWHLANTKQYIRDFAKVLEKKPKSPREIVEAMTKLYPDRYNTGALI
                     MGAMGYFQALKESRI"
     exon            244011..244886
                     /number=1
     CDS             complement(join(245427..245518,245573..246494,
                     246572..247033))
                     /codon_start=1
                     /locus_tag="AO090023000098"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000019"
                     /protein_id="BAE58680.1"
                     /transl_table=1
                     /translation="MDGGMQLQTYEGFGDPDVPLLPWDEIYQKVLLSPRFRPSLLESS
                     LATSQLTSLLSASSYPIPEPYYPHGQFPPEGYSAPLPSPNDFLFPGSSADRERVMNLD
                     RRTPPNDTQRPTQNAQKTTKRQLNESTGAPTSKKRGRPRKTLDTRMGEDPEEIRLAQR
                     AYRSRKEANITSLKGRISQLEATLEKMSSAVVSFSDNLVQSGALSSHPDIASHLRDTV
                     QTCLALAKEASKDGEPESPDTSSHGEETTSSSAGPDGTPTDQYTSPSTHAEQTTPPES
                     GPSKPISPPLSEPLEPSAMDIPLFIEQLHLACVYQGYLVLSNPSVPMSRIERPFRFLF
                     TLMDRPHLTAAFEALLHAKLSQKRLEECYAGVPFFKLGGAGTHYVRSTGQPQEGERPL
                     CRYQQWTTIHDPLARFSPDIRKEMEGDWFDMQDLAGYLREKGVLLFSSAPSETDRKSS
                     RTAINVTRFTQTLISRGICLGRTPGFRRSDVDNALRASVWT"
     exon            complement(245427..245518)
                     /number=1
     exon            complement(245573..246494)
                     /number=2
     exon            complement(246572..247033)
                     /number=3
     CDS             complement(join(247705..247790,247844..247934,
                     247991..248183,248230..248403,248452..248477,
                     248533..248824,248881..249174,249233..249339))
                     /codon_start=1
                     /locus_tag="AO090023000099"
                     /note="phosphoserine aminotransferase"
                     /old_locus_tag="AO070298000018"
                     /protein_id="BAE58681.1"
                     /transl_table=1
                     /translation="MKREDITYMGAGPAALPTDVLAQAAEALQNYEQTGLGIAEHSHR
                     SEIAANILNTMKANLTSFLDVPSNYEILMMQGGGSGQFDATVYNIVSAWVEKQRQKIV
                     NELGEASEDDVVRELRKKVESELRLDYLVTGSWSSKASQEAIRLLGPEYVNIASDSRK
                     VNDGKFGKIADESTWKLSPKPTMVYMCDNETVDGVEYPNFPKVLEPTGSEEEPFVVGD
                     FSSNILSRRIPIKNYSIVFFGAQKNLGCAGVTGVIIRKDLLVSCPPTILRKLGLPIAP
                     TILDYCVTAKNNSLYNTLPIFDVYLAGQVLKKLLATFPDKVDGQQAEAQKKADMIYEA
                     ADAYPEVYKVVPDKSVRSRMNVCFRVIKGGNVDEAEKAFLKGAVERGITGLKGHRSVG
                     GIRASNYNAIPVSGAEKLVAYLKEYAQA"
     exon            complement(247705..247790)
                     /number=1
     exon            complement(247844..247934)
                     /number=2
     exon            complement(247991..248183)
                     /number=3
     exon            complement(248230..248403)
                     /number=4
     exon            complement(248452..248477)
                     /number=5
     exon            complement(248533..248824)
                     /number=6
     exon            complement(248881..249174)
                     /number=7
     exon            complement(249233..249339)
                     /number=8
     CDS             join(250122..250368,250418..250668)
                     /codon_start=1
                     /locus_tag="AO090023000100"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000017"
                     /protein_id="BAE58682.1"
                     /transl_table=1
                     /translation="MDYWGMPAVRTNLQPFTFGIDISSCQAAIPGDGNDVICMTYTYD
                     MAAFIVRLLDEEDWPEFSVIVGSQTTYNQLLQLAEELRGKKFQVVYDSVDKIKEGDVT
                     IPPMPSDTGYSVEELKETTALVSRLTISGVFDLPRENRLNARFPDTETTKLKAFLEKA
                     WGNSQ"
     exon            250122..250368
                     /number=1
     exon            250418..250668
                     /number=2
     tRNA            254713..254827
                     /locus_tag="AO090023t00001"
                     /note="tRNAscan-SE"
                     /product="tRNA-Leu"
     tRNA            complement(255695..255809)
                     /locus_tag="AO090023t00002"
                     /note="tRNAscan-SE"
                     /product="tRNA-Leu"
     tRNA            complement(256665..256779)
                     /locus_tag="AO090023t00003"
                     /note="tRNAscan-SE"
                     /product="tRNA-Leu"
     CDS             join(257589..257637,257676..257686,257729..257755,
                     257855..257992,258034..258123,258244..258533,
                     258557..258647,258696..258945,259025..259170)
                     /codon_start=1
                     /locus_tag="AO090023000103"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000014"
                     /protein_id="BAE58683.1"
                     /transl_table=1
                     /translation="MEAAWNLHQGCRIYKFSLTHDSTNGLVGINRQDYSLLAHLFIAG
                     HLIECSTYVTGGNFSGFKSLPDPSIDFRFPVKGKDEIVTEGTYKAQLLYKIQGPIYYN
                     PDVPKSGGHQAEVHYFLCGLDIAGKAKLLENQIRHLLDESKYQTLVFRTTGSCPSNPS
                     SQDAATVDVCIFAQSRDEEALSVSNFLRPCIDTIMQSYPGATFAKPYYEYFVSIFPQE
                     RIRHISHIPFRDTSLSYETAAPFDLGVLAHTIRCPLGYVVHARSGDKGSDTNGGFFVR
                     HADKWNWLRNLLSTDEIRELLGQDDTDKKIFRFELPNIWVVYFLLKDHLDRGMSSSSY
                     YDVLGKNVAEFLRCRYVDIPDKFLARGRI"
     exon            257589..257637
                     /number=1
     exon            257676..257686
                     /number=2
     exon            257729..257755
                     /number=3
     exon            257855..257992
                     /number=4
     exon            258034..258123
                     /number=5
     exon            258244..258533
                     /number=6
     exon            258557..258647
                     /number=7
     exon            258696..258945
                     /number=8
     exon            259025..259170
                     /number=9
     tRNA            complement(261661..261775)
                     /locus_tag="AO090023t00004"
                     /note="tRNAscan-SE"
                     /product="tRNA-Leu"
     CDS             complement(join(264049..265564,265627..265848,
                     265903..266582,266641..266748,266831..266839))
                     /codon_start=1
                     /locus_tag="AO090023000105"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000012"
                     /protein_id="BAE58684.1"
                     /transl_table=1
                     /translation="MDFWSRLIGGSRSLSTKTYRASSPTERLTAFKRTCNTLQQIWRS
                     TNSPSGDQSATTHARNCIDRLNSVLSDESRGPAPHPCLAYAASSQIFVTVTKLALSSY
                     DDGMLRSATVFFNTLIDSEVDGVVDNRLFARALVDLVRRADKHSEDVEGRLVELLFGV
                     ANNIRLQPDILPAWFAPRSEDQDREQQTNTGAEFAGATRKDDFPLFYLLVEYVHHGGR
                     AGDFARTGLLYLIETASRSKNLERWLIESDLATLMATGLGALYSQLGSLSFDATSDEK
                     MPHIVALSDHAKQETALPPALGATVDSFMSYLLFWQDTIDHCKSAEVNGTLLDHFQVL
                     FLEQLLYPSLLESSDVEGGSTAAVLTYLYRILESINQDDLVHRILHFLLASPSDMETS
                     PTLKVNMSVSRRKSLDVLAAFSEEAAKPSPSLFNLRDLALLGLQSANRQTVLATLRLM
                     AVILQRHHTFARSLIRTVPGQYAGQRTVGQLNAELEQLTEMATSIVEDPTLNDSFEDY
                     LKDASLILESHLYIPPAETGLEDDRPLEIRQEDPIVQELLNCVETFFTNSVIVNLALT
                     EVLMSIASSHLISLDSWLLVDPSKYVYDDQTTAQDGPMEILDQIKLAYQEPSLSSSET
                     PTLTSALQKLVQKIQQWRKDVPDFDILVAARRDLLHHDDPAKDTGRLQQPFEASTRLP
                     SERRPLKMPLDSDIGSPRGRSSLVQDLPGTPASRQAAVGSPLRGSSLRSPDSRESSSP
                     RMTAAEELRKRLSKPFQVDHPHKATMAGEEPEPAADAIVEEEAESAIADEEPRSATLG
                     HVLTNVVILYEFLLEVSATVQARSTLFGEAGYPGVGWSAPLDEELM"
     exon            complement(264049..265564)
                     /number=1
     exon            complement(265627..265848)
                     /number=2
     exon            complement(265903..266582)
                     /number=3
     exon            complement(266641..266748)
                     /number=4
     exon            complement(266831..266839)
                     /number=5
     CDS             complement(join(267852..268111,268190..268697))
                     /codon_start=1
                     /locus_tag="AO090023000106"
                     /note="class 2 transcription repressor NC2, alpha subunit
                     (DRAP1)"
                     /old_locus_tag="AO070298000011"
                     /protein_id="BAE58685.1"
                     /transl_table=1
                     /translation="MTDQDNSYRPRSPDFSTLQSPIPSIPQPIYSFANPLVHHRASYD
                     ASRYFTPQYHPVPPPPPRQASQQYIPPFADPIVDPDMARRSSRIARAAEVVPMPETKY
                     VEPTYVEPSYVEPPYVEPTPVLPEEPPQPNPTAGVEVKTKFPVARIKRIMQADEDVGK
                     VAQVTPIAVSKALELFMISLVTKAAKEAKDRNSKRVTASHLKQAVVKDEVLDFLADII
                     AKVPDQPAGRKHDDDGSDQNEQPKRKRGGRRPKDDSD"
     exon            complement(267852..268111)
                     /number=1
     exon            complement(268190..268697)
                     /number=2
     CDS             join(271124..271167,271242..271351,271423..272142,
                     272213..273245,273303..274413)
                     /codon_start=1
                     /locus_tag="AO090023000107"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000010"
                     /protein_id="BAE58686.1"
                     /transl_table=1
                     /translation="MAATDQPSGLMDIASSLTQDEIPFKLRCAICNKLAVNAFRLPCC
                     DQAICESYQVSLPETCPVCAHTPLSSDLCKPNKALRTTLKAFLRTEEKKREKERQSAT
                     PAATNDATSVQGTPAQQETPAVSDIPETKQEEALPEVAPTVEAPSEEPLVGGDPSEAV
                     TEQTDGNHEVPLESQPPGEVICIPHNCKKGAQILTSWPRQDEQTETVLADGTENPDAM
                     QQNGSGEGEDADDAKLAQESEQDMTQDPGSGQMLPNGMPFGMAPGMFPMGWNNNNGDF
                     NPMSQFMGNGMFNPMGMAGMMDPMVANQGMFGGYGMNMNGMNSGMNFDAGQGMYGGWD
                     GSQNNMWNGGQDKFNPNAFANGMGPQYGVPSGFGGYNMSQPNGVHPQMQQQQFPNQDF
                     QSGYYGPGYGRGNFRGRGRGFYPGGRGRGGFTGPMQANYPPNANYPAFNSPNFNQDMS
                     SQLQEGVSAEMSSGDPNGTEATNANDENAPGGHLDGTKDPSLNENAADVGDNGEASSA
                     KGPTMEDTTGPEESGLRGIPTIDSLDQANAAQGMHNGPMMPGPMGPGFGRGYMRGPFT
                     GGRGGPFAGPPFMPGSGMPAPRGPGVEGAPAAPRAMREGLPNTSVLRQRNFQGPGRGS
                     VLSVRPSDASQSTTPAPQEDHRPRSTSRSKSRARSASRSKSRSRSRARSQSPGRRHNR
                     PRSASIENGAEDSERRRERPRRPRREDKYDEQSQAEDEHRTRSPSVDSRRSSRRDRER
                     DRRSGRRSHRSHRHRSQSPSRNGDSRGADRLALIPEEKDPGSRSRTPVISEAQESSSR
                     TYRSGKDRTSRRDDERERDRDSRRRDRERDRDRDHYREKERDRDRERDRDRERDRDGA
                     RDRHRDRDRDRDRDRKRSRRDRTESPVDSDYSSRHHSRRIKRSREDEIRDKDRTRDKP
                     PSSSTKTSEPEKDPHTLEREARNRERLLKEQQRREAMHADRDVGKPSRRRDSRQERTA
                     AGGRRLTYKYEDDESDAARAARVEKEREASRWA"
     exon            271124..271167
                     /number=1
     exon            271242..271351
                     /number=2
     exon            271423..272142
                     /number=3
     exon            272213..273245
                     /number=4
     exon            273303..274413
                     /number=5
     CDS             complement(join(275238..275513,275571..276279,
                     276328..276789,276848..276951,277009..277057,
                     277111..277253,277323..277382,277440..277468,
                     277922..278012,278391..278585))
                     /codon_start=1
                     /locus_tag="AO090023000108"
                     /note="actin-binding protein Coronin, contains WD40
                     repeats"
                     /old_locus_tag="AO070298000009"
                     /protein_id="BAE58687.1"
                     /transl_table=1
                     /translation="MPDRELVLAELISLSPAAGMRVRAGARDCDWECVSHVGDSSLSC
                     RASLPSSHYPSCTKNKQLLVPAYRIHLIPYPPPSTTNRVCHKKPSVTTVLYRHVFGRN
                     TRKEQCYDNLRVSANAWDSNLVKVNPKYLSVNWAAGGGGAFAVIPLEERGKLPEKIPL
                     FRGHTAAVLDTDWNPFNDDLIASGSDDGKALLWRVPENFTLRPDVDLDHVQDIAPVGK
                     LSGHPKKIGHVLFNPAAENVLATSSGDFTVKIWDIEAGAAKLTLNVGDMVYSQSWSAN
                     GSLLVTTSRDKKLRIWDARQERPAHEVQGHSGAKNSRVVWLGEHDRIATTGFSRMSDR
                     QLALWDMRAPAEPINGFKVLDSISGVCMPFWDDGTQCLYLAGRGDGNIRYFELENDKF
                     EYLAEYKSADPQRGIAFMPKRGVNMHENEVARAFKTVGDTYIEPISFIVPRRAETFQD
                     DIYPPTVGLTPAMSPSEWFAGKEAIPPKISMASLYEGEGLKEITGVQDKPTETLGAPA
                     AQAEPAPKPAEPTPVKKAPEPEPTPVHKPAPSMKEQGASMAAMVNKFADEEDAEPAAE
                     ESSFDEAPKPVEREARTVESASPVKTSAWHQREESRSQTASKPSTPVPAQNNDRSPAA
                     STPVDTSSGFNIPEFTNTAASALHGEIQKLTHMVGPLLNEVHEQKQQIESLTKTIESL
                     ETNQEKQIQSLNEKIVALEARLS"
     exon            complement(275238..275513)
                     /number=1
     exon            complement(275571..276279)
                     /number=2
     exon            complement(276328..276789)
                     /number=3
     exon            complement(276848..276951)
                     /number=4
     exon            complement(277009..277057)
                     /number=5
     exon            complement(277111..277253)
                     /number=6
     exon            complement(277323..277382)
                     /number=7
     exon            complement(277440..277468)
                     /number=8
     exon            complement(277922..278012)
                     /number=9
     exon            complement(278391..278585)
                     /number=10
     CDS             join(278913..279146,279323..279556)
                     /codon_start=1
                     /locus_tag="AO090023000109"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000008"
                     /protein_id="BAE58688.1"
                     /transl_table=1
                     /translation="MVIQLPGQQHRWIPIMRKTQAFWGRERVGDNFTLIPLISQFSQT
                     RHYQEAYMHMSHKVGRELSGILLKNMKGPCDLITRKPPPVPQFLTKDSMITSFNCSTG
                     AEWDQETREKTMEEFFNAFVSRVSQAGQESFGLKETVELYKSRGNHPGSTNRL"
     exon            278913..279146
                     /number=1
     exon            279323..279556
                     /number=2
     CDS             join(279720..281147,281199..281375)
                     /codon_start=1
                     /locus_tag="AO090023000110"
                     /note="kinesin (KAR3 subfamily)"
                     /old_locus_tag="AO070298000007"
                     /protein_id="BAE58689.1"
                     /transl_table=1
                     /translation="MDEFSSRQRLEVETVRADSKKKLDTIVAQHEDQLCELKRRFERE
                     LDDEKASRLREINQLTSQTALDTQRSQIELDRKDREIASLQNDVQALQQEIERERKST
                     QGLRQNLDTASSNSVTLESSIRALKARIEFLESGREEQSQAFERLNQQMMDALAETNA
                     TKDKLRKEETLRRKLHNQVQELKGNIRVFCRVRPSLETEPQTGIAQIQYPDASEECKE
                     INVLGLEEKSSLGAVTKKNNNFAFDRVFGPSTQNAEVFDEISQLVQSALDGYNVCIFC
                     YGQTGSGKTYTMSSLDGMIPRAVHQIYETATSLKEKGWRYTMEGNFVEVYNENLNDLL
                     GKAEELDKKKHEIRHDMQRGKTIITDVTTVRLDSPEMVENILKRAAANRSVAATKANE
                     RSSRSHSVFILKLIGENDITGERSEGTLNLVDLAGSERLSHSGATGERLRETQNINRS
                     LSCLGDVIAALGQGKDGGHIPYRNSKLTYLLQFSLGGNSKTLMFVMVSPLQAHLAETL
                     TSLKFATKVHNTHIGTAKRQARVRDC"
     exon            279720..281147
                     /number=1
     exon            281199..281375
                     /number=2
     CDS             complement(join(282324..283143,283470..283590,
                     283977..284004))
                     /codon_start=1
                     /locus_tag="AO090023000111"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000006"
                     /protein_id="BAE58690.1"
                     /transl_table=1
                     /translation="MGPRDSTEHALRTSSMIATLPRTHSTLHPSSCNSLINALSAGLV
                     PAERESFLPWGTVQEKIYHLDNKAVTKERDNLLQEVQEIVSTGQTRYNMLEFPAPYAL
                     AKYLLEQLLLDRKDNQHYSTLIIRPSNIGPALRHPHRFYGFDLKIPLHSYVQSLLRTD
                     NHGIEHLCSIADPKCIIDEVPVDIVANVSLLHLASGTTDIVHATSQLYVPYSLSKVAS
                     LVASNMSQTTSMSICQRGGVVLSPKHAEAFFQMLARFNRGWEFSCARSECLRQTITSG
                     PLSLRLDWHDPEEFMRVRIRMLVHKFQKLLFNTSRGPDSALYGECV"
     exon            complement(282324..283143)
                     /number=1
     exon            complement(283470..283590)
                     /number=2
     exon            complement(283977..284004)
                     /number=3
     CDS             join(285999..286004,286058..286150,286213..286357,
                     286416..286603)
                     /codon_start=1
                     /locus_tag="AO090023000113"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000004"
                     /protein_id="BAE58691.1"
                     /transl_table=1
                     /translation="MKFISVVALLAPVVLAAPQARDDSGWIGLIKEQCPNMSEQCVGI
                     AMEAHKPLSDIGQITQAMPACTPAYVECINLIAGDASDVSTFPQDVTQGELATCLQRI
                     APDHIKYFLDNDRAYTPIPYNQNCALRELHRVAHVELGPLA"
     exon            285999..286004
                     /number=1
     exon            286058..286150
                     /number=2
     exon            286213..286357
                     /number=3
     exon            286416..286603
                     /number=4
     CDS             complement(join(287496..288954,289392..289444))
                     /codon_start=1
                     /locus_tag="AO090023000114"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000003"
                     /protein_id="BAE58692.1"
                     /transl_table=1
                     /translation="MRALTKCISFFSHIKITFHHLAPISGSIDPDDSDPLAAAWRELC
                     EETSLTASDLSFWRTGKPFTFSDPSIGREWTVHPFAFRLKDPAEGGQGEEAIRTDWEH
                     EEWQWYDPRTVLEDESLNTVPRLQDSLRRVWFEGITNERAGRALATGLERLRADHESG
                     AHELTAIALTIFRDFIVYTQNHLDAEWWEMIRMAAWHLIKNGRESMGAATQNAILSVL
                     AEIEEIMEQKTGTEQKWDRILALIDFHLRNRADTAQQVKQSFISYLQSHFSSGGAQKD
                     RLTMLTISSSSTIRDSILEAYDALGIQTLELRVLESRPLFEGASLASSILSTFKSQSK
                     SPDKHLHITMYTDASAALAAKDADIVLLGADRISATRGVSNKTGSLPLVLSAKHVTPD
                     VRIVVLSDMEKVNGFAGVIDDELTEGNDPFEVASAWSSDGVKGIQVLEKGVRESKSEQ
                     ENSSVTVENTYFEWVPLDMVDAFICEEGILEKDSIQEKSRKLGERADRYFGNL"
     exon            complement(287496..288954)
                     /number=1
     exon            complement(289392..289444)
                     /number=2
     CDS             join(289615..289857,289925..290086,290137..290322)
                     /codon_start=1
                     /locus_tag="AO090023000115"
                     /note="predicted protein"
                     /old_locus_tag="AO070298000002"
                     /protein_id="BAE58693.1"
                     /transl_table=1
                     /translation="MTSTLQRTLYNSTYRPRLNLSLSQFSRPNLYCSSSIHFFQSPPR
                     AMPTYPGSCYCRDIEYELSLASPDDARTSLCHCKSCKKAFGTNYGLTAKIPKDALRLI
                     KGAPKEHVADNGSGSLIHREFCSNCGSFICEYGDAVKDQFRYLCVGSLDDPEALPPKG
                     EFFCSSRANWMPEIPGRSSMSFSAMCMVANELRRIS"
     exon            289615..289857
                     /number=1
     exon            289925..290086
                     /number=2
     exon            290137..290322
                     /number=3
     CDS             complement(290424..291110)
                     /codon_start=1
                     /locus_tag="AO090023000116"
                     /note="predicted panthothenate kinase/uridine
                     kinase-related protein"
                     /old_locus_tag="AO070298000001"
                     /protein_id="BAE58694.1"
                     /transl_table=1
                     /translation="MEEEYTRIADIIRHRAKTHDKKRYLVAIAGVPGSGKTTTATAIA
                     QRLNSGQTRIQTELVSMDGFHLSRATLDQLPNREEAYIRRGAPWTFDAARFIAFVHQL
                     RQWTDTFSDETIYAPAFHHETKDPVEDGVMISSDASIVIIEGNYLLLDEPDWRDVARL
                     VDYRVFVDTDLQEARDRVAKRHVSAGIEKTIEDGYRRVDSNDYLNALTIRDKLIQPDM
                     VVRSITEVSS"
     exon            complement(290424..291110)
                     /number=1
     tRNA            295299..295379
                     /locus_tag="AO090023t00005"
                     /note="tRNAscan-SE"
                     /product="tRNA-Ser"
     tRNA            complement(296218..296298)
                     /locus_tag="AO090023t00006"
                     /note="tRNAscan-SE"
                     /product="tRNA-Ser"
     CDS             complement(join(296572..296823,296919..297632))
                     /codon_start=1
                     /locus_tag="AO090023000117"
                     /note="predicted protein"
                     /old_locus_tag="AO070275000001"
                     /protein_id="BAE58695.1"
                     /transl_table=1
                     /translation="MVHIRLASVALLHSLLLTYGLAEDTKLSESLVGCDEVSCPKENA
                     HDRCTVGEKTFLGIGLSRIPNVPSTLEGLSLIKGVNISEGGEGKRKFNSAYYLGTPSE
                     LDVNDLSGCVVAFNDPPEKQFDGPVKTGKDRNITEVQAARGTCPDIIEQECIDTLTER
                     ARSVTNATSNGGVCATLERELRRNAFEECRDLGGKGRGLGNFTVTSFGNLSTVRNSTD
                     CWPVKPKSDDLALITENTAVGNNTAASMYQEAWKITPVLTVFIGKGNNSLVEKASSQM
                     TCLKVVTEENPEEAENGSESSASMLSTNPRVAGIAVLIAAAWVAL"
     exon            complement(296572..296823)
                     /number=1
     exon            complement(296919..297632)
                     /number=2
     CDS             join(298972..299350,299411..299674,299758..299789)
                     /codon_start=1
                     /locus_tag="AO090023000118"
                     /note="predicted protein"
                     /old_locus_tag="AO070275000002"
                     /protein_id="BAE58696.1"
                     /transl_table=1
                     /translation="MSSAMRIAIAGAGGLARYISEEFPKHGHSAIILTRSEKEYFRNR
                     LNITQVITDYSVPSIVTALRDCEILISVILSYAREFIDIHLNLIKACRLSPKCKRFIP
                     SGFFGDIENYPDLPPLYSEIREPILNYIVPKGNLYLMDIGEAFPIDIIRNRIVIPGTG
                     KDAVDVTSTRDLAIALALLAIAPVWKPYVYVSGTKRCWNDLALLIQERYPAMREDLCA
                     FGCCVS"
     exon            298972..299350
                     /number=1
     exon            299411..299674
                     /number=2
     exon            299758..299789
                     /number=3
     CDS             complement(300029..300901)
                     /codon_start=1
                     /locus_tag="AO090023000119"
                     /note="SAM-dependent methyltransferases"
                     /old_locus_tag="AO070275000003"
                     /protein_id="BAE58697.1"
                     /transl_table=1
                     /translation="MSSIPTQNIYDDPKFFKAYSTLPRSQHGFDAAPEWPVLQEMVLK
                     NNKSGHSGIENEHVLDLGCGYGWFTRWARENGAKYVKGMDVSTKMIERAKESEQDLRE
                     KGSIPPSYGTLCYEVGDIETVSFSASEIDSYDLVYSSLTFHYIEDFSKLLQQIRLCLK
                     KGSPKDDSRKGGRLIFSVEHPICTAPVNPQPDWKVLPIEDGDGVGRKIWPLNSYSDEG
                     PRMTSWLGVDGVRKYHRTVETYVTALLQNGYVLTGLKDWVPSEHDVEEHPEWKDERHR
                     PYFLLISAEIHSDY"
     exon            complement(300029..300901)
                     /number=1
     CDS             complement(join(301228..302898,302996..303023,
                     303076..303485))
                     /codon_start=1
                     /locus_tag="AO090023000120"
                     /note="predicted protein"
                     /old_locus_tag="AO070275000004"
                     /protein_id="BAE58698.1"
                     /transl_table=1
                     /translation="MKRSTPDNLESGDNLKSYSCLTCRQRKVKCDRCTPCSNCVKAEK
                     QCSFIPPVRGKRKRTKPPRESLHAKLRRYEELLKSCGAKFEPSGDFDDSESETASQPD
                     VQMDEDAAPPSQRINLEETKPKLIIDRGTSRYFDSAPWSSLGNGDGGLFFEPEQINKP
                     ENLANLHLSLQTLSKLKDIYLDRVDPMIKILHLPTFWISATDRLSDPQSMPTDLEAMM
                     FAFYLATISTLKEDECQHLFGVRRSVMHSRYRMAARQALMNAGFLSTSSPTTLAAYAL
                     FMVSCNYQAFLIFSSHKKTCIRKSYKCDTLFVLSGVAIRLARKMGLHRDSSALGLSPF
                     ESEMRRRLWWHLAYVDFRLADVLGTKPSLDLSCSDNQMPLNVEDEDLHPDMVDPPLER
                     RGITTTTPCLIKYVIMESLRKFSTSCPSELRWEALSSPDVTIMKKDSIIGHIEDQLEM
                     KYLRYCDPSNSLHTFVSIMIRSSICKMKLFAHNPRQFANNPIKVPQDERNIFFDNAMK
                     LLEYVIFMQEGSHGLGKYKWHFGTSVLWNVILYVLIEIRHRKTGSDVDKAWRLIGTVF
                     SYYPQVFDESPGPVYIALGKWTLEVWDDHVAALKADGLPEPLTPDYINAIGHCRRPAI
                     ESPSRAKVQAVAPAPATWETVAQDRIHSPNHEGNHAEGGALDIYDLPNLLSFEMDPNE
                     WIQWEQLVAEQGSFAQGDSM"
     exon            complement(301228..302898)
                     /number=1
     exon            complement(302996..303023)
                     /number=2
     exon            complement(303076..303485)
                     /number=3
     CDS             join(303700..303849,303907..304188,304249..304584,
                     304649..304829,304885..305567)
                     /codon_start=1
                     /locus_tag="AO090023000121"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070275000005"
                     /protein_id="BAE58699.1"
                     /transl_table=1
                     /translation="MIRTSPNGEEQPPTSREDCKSNADDIVYPTGLRLALLLMSIFIG
                     MFLVSLDRLIVSTAIPQITNEFSSAGDIGWYGTAYLLTNCAFQLVFGKIYTVFSVKPT
                     FLTSVLLFEAGSALCGAAPTSVAFILGRAIAGLGGGGILSGVIVVIVYAVPLHKRPKY
                     QGIFGAVFAISSVTGPLVGGAFTTDVTWRWCFYINLPLGGIVMVLVSILLQVPDCSDI
                     KMPLKDKLRQLNVLGLVALIPGVVCLCLALQWGGTTYAWSEGCVVALLVLALALLVTF
                     ALIQIWKPENAIVPPRTFKQRSIASGFWVSSCLGAHMNLFVYYLPIWFQAIKGISAVD
                     SGIHLLPMLIPVVVASIITGQLVSRIGYYTPFMIFGVCLTAIGTGLLTTLGINTSAGK
                     RIGFQIIYGYGIGSCSQAPNMAAQTVLPRRDVAIGASLMFFGQQLFGAVLTSVGQNVL
                     FNQLAHHLSGIPGVSPKLIQNIGATEFLNRVPAEDYAVAQEAYNDSLRKCFQVGLIMA
                     CLSVLGALSMEWCSVKKNLPSKERDGQQASEEGKC"
     exon            303700..303849
                     /number=1
     exon            303907..304188
                     /number=2
     exon            304249..304584
                     /number=3
     exon            304649..304829
                     /number=4
     exon            304885..305567
                     /number=5
     CDS             complement(join(305967..306019,306073..306373,
                     306433..306628,306697..306821,306877..306916,
                     306986..307170,307840..308049))
                     /codon_start=1
                     /locus_tag="AO090023000122"
                     /note="predicted alpha/beta hydrolase"
                     /old_locus_tag="AO070275000006"
                     /protein_id="BAE58700.1"
                     /transl_table=1
                     /translation="MLFRETEGLKGFFGETSRLSQVLRNSGSGCASIMHLNLTNSSFG
                     IVSGSILYFISEKPGKTGWRTRPSFRARNYIRYIHTPTRTRTSRIPLAYELHTSKHAN
                     RTQSDSTTRNPIIFLHGFLGSKRENRGVGKILAQDLSQHVFCLDLRNHGDSGHHPKHD
                     YMEMAIDVEHFITTHGLNNATLIGHSMGAKTALTLALQSPDLISKVVAIDNCPIHLDL
                     TEEFPRYLKAMEEVQDARVKSHQEGDKILSKYEDSPSVRLWLLSNFVRERDSPHLKLR
                     VPLDVLTTAIGPLGDFPHKGKFVQFPKPALFLRALQSHYIPESSFPVISSFFPRSRIV
                     NIDCGHWIVQERPEEFRQAVVQFLREKDEVDSLDL"
     exon            complement(305967..306019)
                     /number=1
     exon            complement(306073..306373)
                     /number=2
     exon            complement(306433..306628)
                     /number=3
     exon            complement(306697..306821)
                     /number=4
     exon            complement(306877..306916)
                     /number=5
     exon            complement(306986..307170)
                     /number=6
     exon            complement(307840..308049)
                     /number=7
     CDS             join(311997..313022,313081..313254)
                     /codon_start=1
                     /locus_tag="AO090023000123"
                     /note="branched chain aminotransferase BCAT1, pyridoxal
                     phosphate enzymes type IV superfamily"
                     /old_locus_tag="AO070275000007"
                     /protein_id="BAE58701.1"
                     /transl_table=1
                     /translation="MAPSAIESQKTKPEAPVVTEKQAGQPLDASKLIYTYTTNPRDVP
                     DETTAHSGDETICTDHMVVATWKASTGWSAPELKPYGPLNLMPTASCLHYATECFEGL
                     KVYRGYDGKLRVFRPDRNAARLNMSASRISLPQADADEITKLIFALLEVDGAKWLPKE
                     RAGNFLYLRPTLIGTQPTIGLVKSKQAILYIILSYMPRQDTPPGGMRLLTSPEDMVRS
                     WVGGFGYAKVGANYGPSVLATQDAMQRGFHQILWLYGDQGECTEAGGSNFFVVWHRKD
                     GKKEIITAPLDDRLILDGVTRRSCLELAKERLSDEFEVTERKYTIGELIEAEAEGRLL
                     ESFAAGTAWFITPVSAIQHREHDIPIPTGPDGGPGEVTGKIKGWLSDIMYGRAEHEWG
                     IVVSERE"
     exon            311997..313022
                     /number=1
     exon            313081..313254
                     /number=2
     CDS             join(313939..313969,314035..314272,314328..315075)
                     /codon_start=1
                     /locus_tag="AO090023000124"
                     /note="predicted protein"
                     /old_locus_tag="AO070275000008"
                     /protein_id="BAE58702.1"
                     /transl_table=1
                     /translation="MEKFTQFRDRGSGIAPFLPIPPQPAGFQLPLRVFLFFFRLPLFI
                     FVCVSYFLVLQWLPIGSLGKKASLWCILGVPSIWWIDLQVDGVRKGSLSKQHQARLPG
                     PGSVIASSFTSPIDAVYLAAIFDPVFTASYPNSRKVEQISLFQAILRAFAIPQANPPP
                     KARLVDLATLVKKNPGRPIVTFPECTTTNARGILPPSPSLLSVAPKTKIYPVSLRYTP
                     ADVVTPLPGSYVSFLWTLLSKPTHCIRVRIAEGVVSGVDGEGGFTTRKSTYDTNYLDT
                     LDKDSTYGSLDTEDAELTRAEKALLDNVADSLARLGRVKRVGLGVPEKKDFVRMWTKT
                     RRTW"
     exon            313939..313969
                     /number=1
     exon            314035..314272
                     /number=2
     exon            314328..315075
                     /number=3
     CDS             join(315904..316084,316202..316307,316367..317351)
                     /codon_start=1
                     /locus_tag="AO090023000125"
                     /note="predicted protein"
                     /old_locus_tag="AO070275000009"
                     /protein_id="BAE58703.1"
                     /transl_table=1
                     /translation="MASDSKLKARSSVINLEQQMREYVTNVTHSSVDLYGTMLRKLDH
                     MITSMDEGLFRDKEDMGTEKEVKATSTGPSFFSKTYLYHNSRLPAHLPPVQILPQTYA
                     LIRLAAQYSSSAYKKPVELTTTSNPYVSANIRQGTKAMVIKPLASDDLKSIVVAIRGT
                     QSFRDWAVNMKTLPTAPENFLDDPENLCHAGFLTVAQRMVPSVAAYLRDLLTEDPNRA
                     SYSLTLTGHSAGGAVASLLYCHLLSTSVSSELKHLASFFGSIHCVTFGAPPVSIRPLF
                     PTKSPASLGSMFYAFINEGDPVPRAEKPYITSLLNLYMSPAPFSLGTSRTYPFVSRKD
                     KPAIWRVPPATLHLAGNVVLLRHQSQDPVLNLPHGANTIQKDEIEACQIPSEIIHDVI
                     FGDPIKHWMGLYQERIEHLTRRSQEPPPYQP"
     exon            315904..316084
                     /number=1
     exon            316202..316307
                     /number=2
     exon            316367..317351
                     /number=3
     CDS             join(319447..319576,319640..320130)
                     /codon_start=1
                     /locus_tag="AO090023000126"
                     /note="predicted protein"
                     /old_locus_tag="AO070275000010"
                     /protein_id="BAE58704.1"
                     /transl_table=1
                     /translation="MHRMYMRHLQARLIQTAITLHFDHGNARPKEEIQTLESTLRKYV
                     QAVQDHEYMARYAGQRNDPFIASSERIHDNYLLMREMTRYGKTASDMEAFKEGAIPTG
                     PWETGEGGAQPIGATRTETLKRGLWSRIAGALVGGAFLVGPMWLLALKQELYLQLGVT
                     TGCVSVFGLLMAWYLSSLEAVFAASVTYAAVLMVFIGVMIQEKGGK"
     exon            319447..319576
                     /number=1
     exon            319640..320130
                     /number=2
     CDS             complement(join(320582..320630,320695..321013,
                     321075..322480,322551..322624))
                     /codon_start=1
                     /locus_tag="AO090023000127"
                     /note="dihydroxy-acid dehydratase"
                     /old_locus_tag="AO070275000011"
                     /protein_id="BAE58705.1"
                     /transl_table=1
                     /translation="MLLSQTRGRMPSALRSLSRRSAVNVRPLSTTLPKQKASSSEDDN
                     ALNKVSRHVTQPISQGASQAMLYATGLTEEDMNKAQVGISSVWYSGNPCNMHLLDLNH
                     RVKQGVEQAGLIGMQFNTVGVSDAISMGTKGMRYSLQSRDLIADSIETVMGGQWYDAN
                     ISIPGCDKNMPGVLMAMGRVNRPSIMLYGGTIKPGCAATQNNAEIDIVSAFQAYGQFL
                     SGDITEPQRFDIIRNACPGGGACGGMYTANTMATAIETIGMTLPGSSSNPAESRAKDL
                     ECLAVGGAIKKLLKEDIRPRDIMTRQAFENAMVVVNITGGSTNAVLHLIAIADSVGIK
                     LDIEDFQSVSDRIPFLADLKPSGKYVMADMHKIGGTPALLKFLLKEGLIDGSGMTVTG
                     ETLAKNLEKVPDFPEDQKIIRPLSNPIKETGHIQILKGSLAPGGSVGKITGKEGTSFT
                     GKARVFDDEDDFIAALERGEIKKEDKTVVVIRYTGPKGGPGMPEMLKPSSALMGYGLG
                     QSVALITDGRFSGGSHGFLIGHIVPEAAVGGPIGLVKDGDVIVIDAEKRVLDLEVDQE
                     TLAERRKQWEADKEAGKLPPTGLTMRGTLGKYARTVKDASHGCITDALD"
     exon            complement(320582..320630)
                     /number=1
     exon            complement(320695..321013)
                     /number=2
     exon            complement(321075..322480)
                     /number=3
     exon            complement(322551..322624)
                     /number=4
     CDS             complement(join(323444..323991,324052..325514,
                     325601..325744,327232..327341))
                     /codon_start=1
                     /locus_tag="AO090023000128"
                     /note="serine/threonine protein kinase"
                     /old_locus_tag="AO070275000012"
                     /protein_id="BAE58706.1"
                     /transl_table=1
                     /translation="MKQVTEDNPSQFQSNQIQGTINGVKFAPSSGLTQTLRPEGLFLT
                     KFSLVNLEFNPRDLLGSGYPPSSSDNCALGPLCAATAVPFRSALFAKQPILLHEASAT
                     TASGNNGISSVSSVSSGVEGICSPVSLNGEFSPNIKDEMIHQFHPGAPQPLPSLQIRT
                     DLPRTAQLSPSKESDPFMHHSISSSSLPRRTSSLRGFLERPSSGGGSLSPASLLSSPQ
                     LMAMGDITPLPSPISGVSPWKISRRNSQSLSRTPSLLSRNGSSLSLRLSDSSQVLGPS
                     ECRSRSKQRGMAEMLGADKHSETPSKPRPDGAPKHARNRSLSEYVPPTKAIPIKPRPI
                     AVSGSGVSQGIFSSSSTDSKSNNLHREQHLAVHRGIAIPAIRPPTPPRSSRSTSDGDV
                     EPVILSPQSMDGSDEIYSVRSIRSQQPRKYRKLRELGQGTFSQVCLAVRMELQDDMDT
                     GYSSSLQGVNAATQKLVAVKVIEHGPAGGADEERLEVSLKREVDILKSVNHPSLVQLK
                     AFGSDEKRALLVLDYCPGGDLFDVATSGPRPMSPELIRRIFSELVAAVRYLHANFIVH
                     RDIKLENVLVTLPPAAMEEITDWRTYDRAVVTLTDLGLSRRIPQPPESPLLQTRCGSE
                     DYAAPEILMGQPYDGRSTDGWALGVLLYAMMENRLPFDALPGTRGDPAKLRARTPHRI
                     ARCEWSWYRYADNDGEWDPQKGKDLEGARECVEGLLKRNTKRKSLDEIASLEWVAKAI
                     DVPGGLKRGDKEVP"
     exon            complement(323444..323991)
                     /number=1
     exon            complement(324052..325514)
                     /number=2
     exon            complement(325601..325744)
                     /number=3
     exon            complement(327232..327341)
                     /number=4
     CDS             join(331674..331760,331832..332607,332687..333038,
                     333095..333264,333318..333474)
                     /codon_start=1
                     /locus_tag="AO090023000129"
                     /note="cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies"
                     /old_locus_tag="AO070275000013"
                     /protein_id="BAE58707.1"
                     /transl_table=1
                     /translation="MALAAEYFSHALSQPYGSSFWVAVAASLVFICYITCDTVYNLCL
                     SPLSSFPGPRLWAVSNIPRQLSILGGRSHLKMLALHHRYGPVVRVGPSELSFNSPQGF
                     RDIYGFRRGQPQFQKDPKMYGSPLTGISNSIGGHVDSDTHSRHRRLLSHSFSERSLRE
                     QEGIVVYYVDLFIQRLRERTSVNKIHRAEEDLKSWFNFTTFDIIGDLMFAETFDCLKD
                     SQLHPWIALMFNNVKGIAFLGVLNEYSLFRKMQGALLPKALKQKMLENHKLCAQKADR
                     RLQKGASRPDFVSMQTQSCKHMGPLLFFFFMAANTDSITIAGSETTASLLSGCLFYLC
                     KHKYIMDQLNKEIRTTFSKDEEITSSKCFNLSYLNAVLKESLRLYPPVAASLLRLVPK
                     GGCTIDGHFVPEDVTVSTHHYASYRDAANFTFPEQFIPERWLGTDNRFDSDRKDVVQP
                     FSLGPRDCLGKNLAHMEMRLILSKLLFNFDIHLTPESENWGQQKMFIVWDKPALMVRL
                     TDRFA"
     exon            331674..331760
                     /number=1
     exon            331832..332607
                     /number=2
     exon            332687..333038
                     /number=3
     exon            333095..333264
                     /number=4
     exon            333318..333474
                     /number=5
     tRNA            333760..333833
                     /locus_tag="AO090023t00007"
                     /note="tRNAscan-SE"
                     /product="tRNA-Ile"
     CDS             join(335168..335616,335820..335844)
                     /codon_start=1
                     /locus_tag="AO090023000130"
                     /note="predicted protein"
                     /old_locus_tag="AO070275000014"
                     /protein_id="BAE58708.1"
                     /transl_table=1
                     /translation="MSVTSTATTTAASATSTCHQKLYEIPVKDAACAMPMQGNNSAIM
                     SSCCSSASVVSYSDCDYYCLAQGQNVGDLAECLLKASEPGEVWCNTNANATATGSVPT
                     TGAGTIVATASATGSSATGTKSSTGGTSTSTTNAAGAKKSVGVLALLLRVYILNP"
     exon            335168..335616
                     /number=1
     exon            335820..335844
                     /number=2
     CDS             complement(335945..337498)
                     /codon_start=1
                     /locus_tag="AO090023000131"
                     /note="predicted protein"
                     /old_locus_tag="AO070275000015"
                     /protein_id="BAE58709.1"
                     /transl_table=1
                     /translation="MCAFLSFFKQNAFHVHLSDNLYNNVDQYSAQQSMDLYAAFRLWS
                     DDPALAGLNKRANESYTKEQFDNIQQQCARRGVTIIPEIEAPGHALVISQWRPELALD
                     DLSMLNITHPNTIPTIKSIWKTFLPWFHSKTVHIGADEYDKDLVADYTSFVNTMQDYI
                     FKESGKSMRIWGTFIPSQGANVSTDVSIQHWEFFEDNPYFDYIQNGYNVLNSDDAFYI
                     VGKWSGSYPSTLNKTRVFHGNPAGGAYAPNIFDTKNSTNNPPRNDPHVLGHIAALWND
                     YGPNSTTVLETYYSWRDTLPALADKQWGGSILEDEYDAIFDKIHAAIPGQNLDRQVKS
                     HTDTILHYKFDKDTETVIDHSGNGYDGIIRGCHVQNSTLVLSNGCYVDTPLGSKGRDY
                     TLSFWVNPASQTPGTLFTGPDSTLLSGNGSISNVTLISGGNPYSLNYSLPLDTWTQVN
                     LIGKGNQTLLRVSDSGAESTSMEFLARLGINGESQVWAPIGIEAPLARIGEGFNGMMR
                     EVVLRGSAD"
     exon            complement(335945..337498)
                     /number=1
     CDS             complement(join(337555..338088,338165..338182))
                     /codon_start=1
                     /locus_tag="AO090023000132"
                     /note="predicted protein"
                     /old_locus_tag="AO070275000016"
                     /protein_id="BAE58710.1"
                     /transl_table=1
                     /translation="MFWGQLTAGYSRLVTIPTIPFTETSDTYSLARLTSIVVDARYAN
                     AVDNDGATQIPPTLQQFAETFQNDLQSTLGIDIPLTSSMTAAPNSIFFTLTNETGFHD
                     AAGRNTSEAYTLTINEDGVEIAGASPLGAWWGSRSLIQAAVVSGHTLPQGSAVDAPGW
                     TTRGIMVCASLAELLPRVVTYFN"
     exon            complement(337555..338088)
                     /number=1
     exon            complement(338165..338182)
                     /number=2
     CDS             complement(339615..340259)
                     /codon_start=1
                     /locus_tag="AO090023000133"
                     /note="mitochondrial import inner membrane translocase,
                     subunit TIM23"
                     /old_locus_tag="AO070275000017"
                     /protein_id="BAE58711.1"
                     /transl_table=1
                     /translation="MSFWDSLSGRKQSKGPEFDPSTAQDATSFLSEVAIPDPTSLHPL
                     AGLNQDTLDYITLEDSALDETPGSRSLLPSRGWSDDLCYGAGTTYLAGLTIGGAWGLA
                     EGMKKVPATAPPKIRLNGVLNAITRRGPFLGNSAGVVAMVYNGFNSGIGYVRGKHDSA
                     NSVVAGALSGMLFKSTRGLKPMMISGGIVASIAGGWAVCGIHSFLMLEVSLTRP"
     exon            complement(339615..340259)
                     /number=1
     CDS             join(340639..340793,340846..342840,342894..343130,
                     343170..343404,343461..343771,343832..344352,
                     344407..344547,344600..345225,345281..346108)
                     /codon_start=1
                     /locus_tag="AO090023000134"
                     /note="cell cycle-associated protein"
                     /old_locus_tag="AO070275000018"
                     /protein_id="BAE58712.1"
                     /transl_table=1
                     /translation="MDSQAGSSVPGDAGYQKMEAISQDIQLLPEATLKEISKGLLVKF
                     VLSCEDIDKVNRVWQSLLKTFSTASTSNTHTVASCNALSAFLDTALTSKYEGTRKLAF
                     ANETWTAVFDIYMARYKDSNPKGMRQILECLVNLFNKNPQGTDKDVIRSNITETTIPS
                     IILGEPRSRLKASFVSLETLLRKSAISPIEFISMVERWLLENRERWISLLQEDCKALS
                     IDITRLLGSAPSSESKQIVAEILLFRLLTQAKTAELAASSGDLMAAFFLKVKSSGMSD
                     PSTQEISQNLSSIWVAPVRHLALQKLGNLELMSNYTLQPLFKLDPVGFRAFLDGLHLK
                     NLLAGDMSEAPLPELTLLFASLQMAKKVGLVHEDSKWRRCYELVGVNLTMLLDYIPKA
                     GSSTNDAQNALVLKSEMIGQFLFHREHSIRIAALSLLITAPATTKPVSSATIRAILKG
                     LPSMHSESADPYARGEILSLIRKLIPRLKGGILSEHESLAEANVSNSKRHPPKFARDD
                     SETQKCLKEYLDLLKDDLRPTASYPRHIMALKTLIHLLESGLDARYAGHIAAKQVGNV
                     TKWRLNMDIFEPSLLRLLVDLLLDPYEEVRATSLTLLNLFPQDVLLSGYLRSRSNGKH
                     EKPQLVDALNRAEQLASNTSRADHADTVARLYHIFFTAADDSSSKVAGSWWETKQGVV
                     DTLLKKLEEKLSLAGGLFNSSMRDAPLHGYVSALRYIVLTPDFHVLISNAQTGYEAWR
                     AVHSRIVAVCDKIWIEVKPVLCIDSPEGHTDEPIDDLNVGPKDILSYSWRALRESSSS
                     LLLYATLANRTYGPTGELGLTKSDFEMIGVASFTQLAELRHRGAFSTVSQTFATCCLR
                     CGQSSDPEIASLPHNWYQEARKIIFETASKLTRRSAGLPALATGILSSNPGGQLFQEV
                     IKELLEISHLPVQQDDDNQEMELPQVHALNCLKEIFTNTKVAAHTEPFIMPALNLSAE
                     QLGSPVWNLRNSGLMLFRALLTRMCRRGTGLGFGGNSGSEPGGRISFQKYPGLIQLLS
                     DLLSSSNARNNAEQGDHAMVTERVFPALELIAEKVPNVYDTDDAMLLELVREQLKSPV
                     WGIREHAARVYASLLNRPDILKDIQTLLDTERDLKSQDYLHGKALSIKYALRRFGSAS
                     VSFWNEHIHEVSAALRQIFATLFPIAESPFVANTLLEILGESVEKSFESGMEEKMLMT
                     ICYTYDSYGFQDILEYLFDSSNPNHNSLSKTRASSMLRRSLPWVGVLQMFVTGELDEL
                     APFVKTVSTFDPNAGVWLLQRIQDTIGAKDKYRKTLLQLYPSIILGDYPEDVKGSAIS
                     SLASILEDLLDFHHDNFKDVELPWEELDQHINSKPNGEVWNRDRSDAGIRLQGCLLAA
                     KVISNQAQISETDIRRWATKLRFAMEEETEYTTRDAAVTSLTAFARALRSKGKAPLVD
                     KVYLEIYLILHDMLSDDDEDLRDMAAGTASWVLSYSSVAPSKAVALSPLNAGQLLADF
                     MVDNYPESQLLSTKAIHYITGQEPKLSGSVEPTKLATVEAQLAELRKESTTLFEEERQ
                     NLFIEEIREVDIWSRRLLGLREAAFNERIVKETSKWVSDGLSYVADIMANESGMDGLV
                     GWASKPETFTLGVRLISLAAVLVSEEFAAPGYLFEDRNSLREKLQRLLDNGEKSLLHE
                     NWVARIQDALGIEG"
     exon            340639..340793
                     /number=1
     exon            340846..342840
                     /number=2
     exon            342894..343130
                     /number=3
     exon            343170..343404
                     /number=4
     exon            343461..343771
                     /number=5
     exon            343832..344352
                     /number=6
     exon            344407..344547
                     /number=7
     exon            344600..345225
                     /number=8
     exon            345281..346108
                     /number=9
     CDS             join(346501..347020,347045..347373)
                     /codon_start=1
                     /locus_tag="AO090023000135"
                     /note="predicted protein"
                     /old_locus_tag="AO070275000019"
                     /protein_id="BAE58713.1"
                     /transl_table=1
                     /translation="MNNNIIIAIIVLILLGITGLVYLYSIRWRSQAKAQLFVARAKAR
                     KRRISESQAQLQPQATTPIQVTVVRGPSRAPSRRPSPRPSASQRPPPPPPTRAASTTS
                     RQGQRGRGRQNERQDNRRGSGSGPSRNQSRVSKNKSKKQKGQQQTGQIVNGGNAVGSG
                     GGDQPAQQECSNQGLAEQDNAQYTGPQDEPSQPGPIDDEWRASSEAVAGSSGGPTSPN
                     DDWPNTGDNEGPQEATQSEWKANDAMEQRDNGGQQEASQGTWHPNDAMEQRPGQQEMD
                     LGNQSW"
     exon            346501..347020
                     /number=1
     exon            347045..347373
                     /number=2
     CDS             complement(join(347991..348652,348732..348972))
                     /codon_start=1
                     /locus_tag="AO090023000136"
                     /note="SAM-dependent methyltransferases"
                     /old_locus_tag="AO070275000020"
                     /protein_id="BAE58714.1"
                     /transl_table=1
                     /translation="MSTQLEAASIARVSLHDPAHFSIQHSQTSHRLALLQHWNIPTGS
                     NVLELGCGQGDCTTVLANAVGELGRVVAVDPAELDYGAPYTLGQAQGHISQGPLGKRI
                     TWVQQSPLDYLSSLSSPSSTSSLPASDPKAFDATVLAHCLWYFGSPSLVLSTFRVLKQ
                     HSKRLLLAEWSLVATHPSSQPHVLAALTQAALECRKPKGSISNVRTVLGPKQLTELAL
                     AAGWHLESETRVPGSEGLLDGQWEVSACLSPSFGWEVEEQVSGERERAVVLALRDACE
                     ASLEGIPGGREGVRAMDVWVANFV"
     exon            complement(347991..348652)
                     /number=1
     exon            complement(348732..348972)
                     /number=2
     CDS             complement(join(349186..349550,349780..349801))
                     /codon_start=1
                     /locus_tag="AO090023000137"
                     /note="predicted protein"
                     /old_locus_tag="AO070275000021"
                     /protein_id="BAE58715.1"
                     /transl_table=1
                     /translation="MRSRLSSECVLSLPFEEVFNLQNGVSAEASILSYHITPTLVAAT
                     FQKAIEAILDMQLYPPCGEGTPKDRSLSPHADSTWKQHIDTIMKGLVSLDATIGGALA
                     SGLAIQNLMQIHGDIISDCWSCDFET"
     exon            complement(349186..349550)
                     /number=1
     exon            complement(349780..349801)
                     /number=2
     CDS             complement(350789..351199)
                     /codon_start=1
                     /locus_tag="AO090023000138"
                     /note="predicted protein"
                     /old_locus_tag="AO070275000022"
                     /protein_id="BAE58716.1"
                     /transl_table=1
                     /translation="MEFPDIIADTARPGRHHDEIVTSPVTHGSDTIKRPVLLNSQLSV
                     GSSPSSPVYLLNSKLDAKILEECLARIHDTIVTGCASRFIGYECNLYKPGHRYQLEED
                     GGDSPQDQKPVQLDPLSTENLLRPPLQYLNRICP"
     exon            complement(350789..351199)
                     /number=1
     CDS             complement(352369..352836)
                     /codon_start=1
                     /locus_tag="AO090023000139"
                     /note="predicted protein"
                     /old_locus_tag="AO070275000023"
                     /protein_id="BAE58717.1"
                     /transl_table=1
                     /translation="MANNPTIVIVPGSWHCPKHYKYLIDGLAKFNYEAVGVTLPSVNS
                     SPPHASWDQDAQAVREVILKSLDNGNDVIAVAHSFGGVAMSEAVKGLGKEAREKQGLK
                     GGVVRLIYMCAMALPEGQTHVGQIQPQTPEEEELERQRQELQAKYGGMRFTEV"
     exon            complement(352369..352836)
                     /number=1
     CDS             complement(356161..357504)
                     /codon_start=1
                     /locus_tag="AO090023000140"
                     /note="sulfide:quinone oxidoreductase/flavo-binding
                     protein"
                     /old_locus_tag="AO070275000024"
                     /protein_id="BAE58718.1"
                     /transl_table=1
                     /translation="MFRTRVTSAACAAAQKAPAARNFARASPVSSASRNHKVVVVGGG
                     TAGLSISHQLLHSGKFTQDDIAVIDPAEWHHYQPGWTLVGGGLKTKEELRRPMNSLVD
                     PKLKFYNDSVSTFSPEENLVTLGNGDKVNYEQLVVVPGININYGSIEGLPEALESPDS
                     LVSTIYGYNTCDKVFRTVQKLEKGVALFTQPAGVIKCAGAPQKVMWLALDHWKRAGLY
                     DPSNPSSSAINISFATALPAMFGVPKYSATLEALRKERGVEGLFQHDLVAIEGNTATF
                     ARLDGQEKVKKQFDLLHVVPKMGPHAFVKNSPLANEAGFVDVDDSTLRHKKFSNVWSA
                     GDGSSLPTAKTAAAITSQSPILVRGLLSTMEGKEPEGNYDGYTSCPLLTEYGKVLLAE
                     FKYGGQPKETFGNLFGIDQATPRRAFYHLKKDFFPWVYYQSMVKGQWGGPKGWVN"
     exon            complement(356161..357504)
                     /number=1
     CDS             join(357873..358662,358717..359126)
                     /codon_start=1
                     /locus_tag="AO090023000141"
                     /note="Zn-dependent hydrolases, including glyoxylases"
                     /old_locus_tag="AO070275000025"
                     /protein_id="BAE58719.1"
                     /transl_table=1
                     /translation="MNSLRASQAALGSLEPMANSIQATTLRRPLRSLCQHANMRASYT
                     TKTYYLPISADFRRASLKNKLDERRTLSCNNSPSSRSITTKIPQAVARGRASYSTEAT
                     AAGEPTIHAVFETKTGTWQYVVADPSTLAAVIIDPVLDYDPASQAVTTFAADSLLSLV
                     KEKGYKIDRILETHAHADHLTAASYLQSRLTQEHGHKPSIGIGKRIGQVQRLFGRRYA
                     VPPDEYSVVFDTLFDDDEKFKIGNLVATAMHLPGHTPDHLGYKIGDNVFCGDSLFHAD
                     IGTARCDFPGGSAHSLFNSGRKLLSLPDHVKIWTGHDYPPEGRATPIPWLSVQDHKSQ
                     NKHLRDGITEEEFVSLRQERDAKLAEPRLLHQSLQINIRAGQLPKPTEAGHRMLHVPL
                     KLGDVKW"
     exon            357873..358662
                     /number=1
     exon            358717..359126
                     /number=2
     CDS             360539..363079
                     /codon_start=1
                     /locus_tag="AO090023000142"
                     /note="dimethylglycine dehydrogenase precursor"
                     /old_locus_tag="AO070275000026"
                     /protein_id="BAE58720.1"
                     /transl_table=1
                     /translation="MEDPTQRVIIIGAGIVGTNIADELVSRGWKDITVVEQGPLHMPG
                     GSTSHAPGLVFQTTPSKTMTNLARYTVEKLLSLDCFNQVGGLEVATTPERLQELKRKH
                     GYASSWGIEARLIDAEECLKIYPLLNKEKVLGGLHIPSDGLALAARATQLLIERTRNA
                     GVRYLESTPVTGIERSGRRVTGVRIPNGVIPADIIISCAGFWGVEVGAMVGVPIPLLP
                     LAHQYAKTTAVPALAGRAVNDLPNGLNAERPILRHQDHDLYFREHGGQYGIGYYGHRP
                     MPVVAGSLGLTPKHVDEKNMPSRLEFTREDFDPAWKETQELLPALRDTEIDDGFNGIF
                     SFTPDGGPLIGQAPNVEGFYVAEAVWVTHSAGVARAVAEVLTTGRSQIDLSECELSRF
                     EEIQLSRDYVSETSQQNFVEIYDILHPMQPKESPRNLRVSPFYNRERELGAFFLELGG
                     WERPFWYESNSELLKYLPAQWQPVERDAWSARFYSPIAAVEAWKTRNAVAMYDMTSFH
                     RFEVSGPGSVDLLQRLTTGDITAKPGTITYTLLLNDHGGIRSDIFVSRLSEDAFQIGA
                     NTAIDLEYLVREGRRQEQHTPSRWVQVREITGSTCCIGLWGPRAWEVISTITTDDFSN
                     AGLPYLGVKSATIAGIPVTAFRKSYVGELGWEIQTSSQYGQRLWDAIWQAGKCHGLIA
                     AGRAAFNALRLEKGYRTFGSDMTTEHNPYEAGVASAIKTDKKENYVGKAAIQRLSKQA
                     PTRRLRCLAVNDGRSMVLGKEPVFLNGKATGYVTSAAFGFTVRKPVAYAWLPASVTEG
                     QTVEIEYFGRRIPATVTAEPLYDPQNSRLHADGSLVVPELQKPLKSLL"
     exon            360539..363079
                     /number=1
     CDS             complement(join(366304..366412,366739..367115))
                     /codon_start=1
                     /locus_tag="AO090023000143"
                     /note="predicted protein"
                     /old_locus_tag="AO070275000027"
                     /protein_id="BAE58721.1"
                     /transl_table=1
                     /translation="MPETIIISSSSQGSQTTLKPTTIFTGEVYFDTLHTDETTSMANV
                     TFTPCARTHWHTHPGGQFLKVVAGSGWICDKGSEPRRIKMGDLIWAPPGTTHWHGADD
                     GSIMTHFVVGLGKTIWLDPVTDEDCREIGDLASPTYYLGLGVMSTGPGTRLLVLIPHT
                     R"
     exon            complement(366304..366412)
                     /number=1
     exon            complement(366739..367115)
                     /number=2
     CDS             join(368414..368552,368741..368961,369063..369317)
                     /codon_start=1
                     /locus_tag="AO090023000144"
                     /note="predicted protein"
                     /old_locus_tag="AO070275000028"
                     /protein_id="BAE58722.1"
                     /transl_table=1
                     /translation="MQIPSLVCGHQHVHPVIEANQSKPRTRMSGRCGYEKQPFLAQFR
                     RISTLAAAVYGLLLKSSTKRLSVRAVLLCQSPEYSLTKSDIDEFLSSSCGRDTCEWLC
                     ICTSVDENYKGPAMKAVHIDLEHESMLYDDSLRELPIRQLSSKLVGLHTFKEHRFRIV
                     PERAGEDTDDVGQLFSSCLVLMHLKDIYERCYGDDSGDDERYSE"
     exon            368414..368552
                     /number=1
     exon            368741..368961
                     /number=2
     exon            369063..369317
                     /number=3
     CDS             join(370151..370392,370416..370476)
                     /codon_start=1
                     /locus_tag="AO090023000145"
                     /note="predicted protein"
                     /old_locus_tag="AO070275000029"
                     /protein_id="BAE58723.1"
                     /transl_table=1
                     /translation="MEYCEQLPNTVNVLFFLRVELEVGFRDLNWTSQPAVRGDLFPIS
                     SKHNKRLSKEEKVSPFPYTGYQTNRLLLKDSPVTRCSIYALSRSLSSSGSHSALLH"
     exon            370151..370392
                     /number=1
     exon            370416..370476
                     /number=2
     CDS             complement(join(370926..371321,371374..371525,
                     371578..371719))
                     /codon_start=1
                     /locus_tag="AO090023000146"
                     /note="predicted protein"
                     /old_locus_tag="AO070275000030"
                     /protein_id="BAE58724.1"
                     /transl_table=1
                     /translation="MYTGYAVLLISRVPRCDEQKELSKRFERFDLQELIRTALDVSDG
                     SRYCTRVLKCLEGLHNKAFIFTMDHGVEVFAKLPNPSAGPARYTTASEVATYDMLREV
                     FKVPVSRIFAWPADATNNPVGAEYIIQEKVHGVRLGSLWNQWRRKAKLDLIKQVVDME
                     IKLTTMAFPWHSCIYYKNDLLSLTGDAKALTVDSVAPEALEHFAIGPLTSAELWTGVR
                     KDMRLDRGPCG"
     exon            complement(370926..371321)
                     /number=1
     exon            complement(371374..371525)
                     /number=2
     exon            complement(371578..371719)
                     /number=3
     CDS             373831..374673
                     /codon_start=1
                     /locus_tag="AO090023000147"
                     /note="predicted protein"
                     /old_locus_tag="AO070275000031"
                     /protein_id="BAE58725.1"
                     /transl_table=1
                     /translation="MSSPANNPRVPRGPVEAEIVFYKDPADGSAPFNYVEEPPEGQPQ
                     RNYSEAVHKVHITDIRGQEDQFTLDRDAFQVLRDIPSQTTYETFNSDDAIKQLYYPEV
                     EKLLLEKVPGAHKIIIFDHTIRRADPEASRQPVRQAHGDQTKWSAAQRVRRHVPDPEE
                     AEKLLQGRYRIINVWRPINGAVESFPLAFASAATLGDRDFAKIEHRYPHFSGEIMGVR
                     HNPKAEWKYLSGVDDDERLLLKCSDTEEGMAERVPHTAFVDPRTAPDAKGRESIEVRT
                     IVFG"
     exon            373831..374673
                     /number=1
     CDS             complement(376343..377014)
                     /codon_start=1
                     /locus_tag="AO090023000149"
                     /note="glutathione S-transferase"
                     /old_locus_tag="AO070275000033"
                     /protein_id="BAE58726.1"
                     /transl_table=1
                     /translation="MQPIILYSHPYGPNPWKVAIILEELNLPYETLFVSFQDVKKEPF
                     IKLNPNGRLPAIEDPNKNITLWESGAIVEYLVDNYDTENELSYTDFATKYETKAWLHF
                     QVSGQGPYYGQAGWFNRAHPERLPSVIERYGNEMRRVTGVLDSVLKNREWLVGDKCTY
                     VDLCFMPWQRWVSKYATDAENVDRDFPHAAAWFKKLSERPSVKKVFADQDRAIEESIK
                     NQTGL"
     exon            complement(376343..377014)
                     /number=1
     CDS             join(377846..378281,378287..378771,378811..379080)
                     /codon_start=1
                     /locus_tag="AO090023000150"
                     /note="cystathionine beta-lyases/cystathionine
                     gamma-synthases"
                     /old_locus_tag="AO070275000034"
                     /protein_id="BAE58727.1"
                     /transl_table=1
                     /translation="MSNDSLATQALHADNGLDGKSDIALPIHLSTTFRYVYNTDQDES
                     LRGPAVCHSTAFPHQPCTNTRARILISSWFGTFCYSRDRVPTRTRLETVLSALIHGPT
                     LTYASGLAAVHAYLVFLKPKRIAIGDGYYGSLQVANLHQQLTGYPGLRPTGRSRSRDV
                     IHLETPIKPTGEALSIRRFADEAHKRGAYLIIDSTLRPPGLQDPFALGADIIMHSGTK
                     YFGGHYDLLCGTLSIQPAREESWFKTLHEQRTILGSVLGSMEVWLGLRSLRTLELRVR
                     RQSENATALVLWLYECLKSEFDYVVKKIVAALRERIPHEFGPVFRTEMKTEEMSRRLS
                     GLMRLFQHATNLGGVESQIEWRRLLDVSAKPTLLRVSIGVEYLEDLKRDLFQGFEVLR
                     HEIG"
     exon            377846..378281
                     /number=1
     exon            378287..378771
                     /number=2
     exon            378811..379080
                     /number=3
     CDS             complement(join(380086..380888,380944..381000,
                     381052..381350,381397..381500))
                     /codon_start=1
                     /locus_tag="AO090023000151"
                     /note="alpha-D-galactosidase (melibiase)"
                     /old_locus_tag="AO070275000035"
                     /protein_id="BAE58728.1"
                     /transl_table=1
                     /translation="MLPKIFYLSLLPAALGHPHLQPRLDNGLARTPQMGWNTYNHYSC
                     SPNETIVRSNAQALVDLGLASLGYRYVTTDCGWTVADRLSDGSLTWNETLFPKGFPAL
                     GKYLHDLDLLFGVYQDSGIKLCGSPPDNVGSLYHEDQDARTFASWEVDSLKYDNCYSD
                     AATGYPNVNYEPSTSPQPRFANMSRALAAQNRSMVFQVCEWGIDFPARWAPALGHSWR
                     IGNDIIPHWRAIYRTLNQAVPQTSFAGPGQWPDLDMLFVGNDILSIPEEQTHFSLWAI
                     LKSPLTIGAALKDDNTSINDESLQILKQEEVIGYNQDSLGVSASLRRRWTEEGYEVWS
                     GPLSGGRTVAALINWKDEARELTLDLPDIGLQFAGTVKNIWDGTTAQNVKTSYTAKVQ
                     SHGTILLELQDTTASGQYPTDTFATSTE"
     exon            complement(380086..380888)
                     /number=1
     exon            complement(380944..381000)
                     /number=2
     exon            complement(381052..381350)
                     /number=3
     exon            complement(381397..381500)
                     /number=4
     tRNA            384574..384647
                     /locus_tag="AO090023t00008"
                     /note="tRNAscan-SE"
                     /product="tRNA-Ile"
     CDS             386019..387056
                     /codon_start=1
                     /locus_tag="AO090023000153"
                     /note="flavonol reductase/cinnamoyl-CoA reductase"
                     /old_locus_tag="AO070275000037"
                     /protein_id="BAE58729.1"
                     /transl_table=1
                     /translation="MQPSKTILVTGASGFVAAHIIEAFISAGYDVRGTVRSEATAEKV
                     RRTFPRYGEQLSFAIVPDIVKDGAFDEAVKGVDGIMHTACPGATETDSNERDIVQPAI
                     SGTINILKSAQKHGLQVKRIVITSSFASMIDMSKGTWPGHTYSEKDWNPMTYEQAVSE
                     GTSSVQAYLAAKKVAERAAWDFVRDENTSFDLVTILPPMIYGPNINATHVSQLNITSA
                     DIYRFMSPDSKPSDPIPDNGFWSWVDVRDVAQAHLKAYEVPEAGGERFFICAGNYSYQ
                     QIADILREKVPEVKDRVPIGKPGSGFGGVELYTPDAGKSQRILGLRYRGLEESAVDSA
                     YAFLELEKHSN"
     exon            386019..387056
                     /number=1
     CDS             complement(join(387794..388716,388782..388874,
                     388934..389265,390456..390565))
                     /codon_start=1
                     /locus_tag="AO090023000154"
                     /note="monocarboxylate transporter"
                     /old_locus_tag="AO070275000038"
                     /protein_id="BAE58730.1"
                     /transl_table=1
                     /translation="MSLATDSEFYMGLTCKDDAEGVAMQGMGLIAYLLLHSKREKGDM
                     DDNNLTYSLSQTAPNSTVDKTARSHADRTEEDTAVGFPDGGWRAWSVVLGSWCAMVPS
                     FGLLNTMGVLEAWLANDQLKEYSKASIGWIFGLYSFFLYFGSVQVGPVFDAYGLRPLL
                     IPGCIGLVGSLMVFSVASEYYQFMLGFSVLGGISSSMVFTPSIACIAHWFHRRRALAT
                     GIAATAGGFGGIIFPIMIWNLSEVVGFQWGIRITGFICSFFCILYVLFLRTRLPPKKL
                     GGGKVDIRALREIPFSLLTVAIFLIDFALLIPLTYLTSYAESHNMKESLAFQLVSILN
                     AASILGRVVPGYFADRYGRFNVMIGTTLVCTIFTLALWLPAGSNPAAIVAYAVLFGFW
                     SGSAISLAPVCVAQISSTEDFGKRYGTTYSLVSVGALFAIPIAGEILKAQSSGGEEED
                     YSGLVLFCGLVYACACLFFVLARGVCTGWRLKTVF"
     exon            complement(387794..388716)
                     /number=1
     exon            complement(388782..388874)
                     /number=2
     exon            complement(388934..389265)
                     /number=3
     exon            complement(390456..390565)
                     /number=4
     CDS             complement(join(390909..390926,391005..391316))
                     /codon_start=1
                     /locus_tag="AO090023000155"
                     /note="predicted protein"
                     /old_locus_tag="AO070275000039"
                     /protein_id="BAE58731.1"
                     /transl_table=1
                     /translation="MRRAYARLYAQAALSIAEKEIDDLVSPNNLTSYAEDDRLHNELP
                     FQLYPVLALVALSIYEYCQCGNVSRMRTRANQAITTAMDLGLHRLDTNASEAHRRAWW
                     SASYKYQ"
     exon            complement(390909..390926)
                     /number=1
     exon            complement(391005..391316)
                     /number=2
     CDS             complement(395101..395886)
                     /codon_start=1
                     /locus_tag="AO090023000156"
                     /note="predicted protein"
                     /old_locus_tag="AO070275000040"
                     /protein_id="BAE58732.1"
                     /transl_table=1
                     /translation="MSTPLSTSSPDGTEFTIVALSYRGYWTSSGRATQSGIELDAQAF
                     LDWVSETYTAPETDLEVILWGHSLGSAIASSATATYLSRHHGDQSSVSKGGTHLPVNI
                     AGLILEAPSSSIKDMLISLYPQKWLPYRYLWPFSWNHWSCTTAMERIARWRDQNEEQS
                     DAIIQRAKSGAPMLPRSRHNCISLESFRSPPPILLLSAESDEVIPPHVADGLESDGKR
                     LKLELERKDVRGALHTEAPVKVDGREALVNFIFRCTSERARVA"
     exon            complement(395101..395886)
                     /number=1
     CDS             complement(397104..398042)
                     /codon_start=1
                     /locus_tag="AO090023000157"
                     /note="predicted protein"
                     /old_locus_tag="AO070275000041"
                     /protein_id="BAE58733.1"
                     /transl_table=1
                     /translation="MLSYIIPFCIYLYFSLAVLASPTTRLRDVYHFPNGTWLENIAVR
                     SNGNILVTAYNLAQLWEINPFNGNNSHHARLVHQFQNPGTITGITEIDQDIFVTIASN
                     SLWKVDLSTTEPVVNPINITIPAGTLNGMATLNDSSLAISDSSLGLIWRVDIEQGTYD
                     IMIRDNTTATSTALGPNLGVNGIRILDGYLYYGNSPQRSFYRVRVHESGNTVGQPETI
                     AQGVLADDFAVTSSGAYLAGLTDNVITKVSLNGEAHVVAGTRNSTAVMTATSAAVGRT
                     RMDGNVLYITTGGETQEPVNNTDHKGGKIVALKLDI"
     exon            complement(397104..398042)
                     /number=1
     CDS             complement(join(400393..400593,400634..401206))
                     /codon_start=1
                     /locus_tag="AO090023000158"
                     /note="predicted protein"
                     /old_locus_tag="AO070275000042"
                     /protein_id="BAE58734.1"
                     /transl_table=1
                     /translation="MIKSIILQAIMVLSTLTSVHGANSSGCGKQPTLVNGVHKINDRE
                     YILKVPDNYNANKPHHLIFGLHWRGGNMNSVVNGESVEPWYGLETRAQGSAILVAPNG
                     RNAGWANINGEDVALIDAIIKQVEDDLCIDQSSRFATGFSWGGGMSYALACARAKEFR
                     AVSVLSGGVISGCEGGHDPIAYLGIHGISDPFAANNGCQQTYVGKPGLGSHSSVQTDF
                     KGCSRPVSFIAYDGGHDAAPLGVGNPLAPDATWKFFMAA"
     exon            complement(400393..400593)
                     /number=1
     exon            complement(400634..401206)
                     /number=2
     CDS             join(403258..403777,403828..403870,403931..404219)
                     /codon_start=1
                     /locus_tag="AO090023000159"
                     /note="predicted protein"
                     /old_locus_tag="AO070275000043"
                     /protein_id="BAE58735.1"
                     /transl_table=1
                     /translation="MKLSFLALAAIAPFVSAHYFFDTLIVDGKESSPNQYVRSNTRPA
                     KYNPTKWVNTRDDMTPDMPDFRCNKGSFTFAGQTGTAEVKAGSKLAMKLGVGATMKHP
                     GPALVYMSKAPSTAKTYQGDGDWFKIYEEGICDKNKDVKSDAWCSYDKDRVEFTIPKD
                     LADGEYLIRAEHIGVHGAHAGEAEFYYECAQVKVVGGGNGTPGPTVKFPGAYKKTDPS
                     FTYSVWGGYKDYPMPGPQVWTGSSGSKHFSKVVDVNATGATSSQGNAATFDGSFTRRE
                     HARDFSY"
     exon            403258..403777
                     /number=1
     exon            403828..403870
                     /number=2
     exon            403931..404219
                     /number=3
     CDS             complement(join(404680..404873,404933..405101,
                     405153..405443))
                     /codon_start=1
                     /locus_tag="AO090023000160"
                     /note="predicted protein"
                     /old_locus_tag="AO070275000044"
                     /protein_id="BAE58736.1"
                     /transl_table=1
                     /translation="MVKVEDPSILEESAKDEYKDPLPQKIGPDGRTIYLSRNNYGPTL
                     KTTGIITITDFDLFVNGDRPNNGCIQAEIYRAPEVNLDAWFTYSADIWSLGVMLWDLL
                     EGKKLFKDVDPLHDQEYNEPNHLAYITSLLGPPPEDILARGRRAGLFYTADGTLRIEA
                     RVPATFKFENLIRNIHGDDKRMFIEFVSKMIKWRPEERSTAKELLEDPWLYADFDDD"
     exon            complement(404680..404873)
                     /number=1
     exon            complement(404933..405101)
                     /number=2
     exon            complement(405153..405443)
                     /number=3
     CDS             complement(join(406605..407063,407145..407561,
                     407620..407835))
                     /codon_start=1
                     /locus_tag="AO090023000161"
                     /note="predicted protein"
                     /old_locus_tag="AO070275000045"
                     /protein_id="BAE58737.1"
                     /transl_table=1
                     /translation="MQLLQSSVIAATVGAALVAAVPVELKARDSCTFTSAADAKSGKT
                     SCSTITLSNIEVPAGETLDLTGLNDGTTVIFSGETTFGYKEWEGPLISVSGTNIKVQQ
                     ASGAKIDGDGSRWWDGKGGNGGKTKPKFFYAHKLDSSSITGLQIYNTPVQGFSIQSDN
                     LNITDVTIDNSAGTAEGHNTDAFDVGSSTYINIDGATVYNQDDCLAINSGSHITFTNG
                     YCDGGHGLSIGSVGGRSDNTVEDVTISNSKVVNSQNGVRIKTVYDATGTVSNVKFEDI
                     TLSGITKYGLIVEQDYENGSPTGTPTNGIKVSDITFDKVTGTVESDATDIYILCGSGS
                     CTDWTWSGVSITGGKTSSKCENVSTGASC"
     exon            complement(406605..407063)
                     /number=1
     exon            complement(407145..407561)
                     /number=2
     exon            complement(407620..407835)
                     /number=3
     CDS             complement(join(409671..409797,409849..409920,
                     409973..410262,410317..410674,410738..410978,
                     411054..411063))
                     /codon_start=1
                     /locus_tag="AO090023000162"
                     /note="predicted protein"
                     /old_locus_tag="AO070275000046"
                     /protein_id="BAE58738.1"
                     /transl_table=1
                     /translation="MVASAQSSPAPNIWLVVYTTTVVDLVHYSQELPTTFAFLISRLI
                     IVRMRTRWIFTVALLVAPLALGSIPATKLIIDTDLFSDVDDAAALLVPCDHPMATPIG
                     VMINYPSSYSALAASSILGYYGYSDVPVALKQPFSNDTFLDTWSYQLGEYASKVAYNW
                     RHTASMPWGDVSSAWDPVELYRKLLSEAGDHSVTIASIGFLDNLSELLSSPGDTYSSL
                     SGHGLVKAKVKELVIMGGAYPCGYEYNFYGSNASATAHVVNTWPGPMTFSGGELGATV
                     YSGARLTVEGPVSDPVNAAYRWYTGYNISRSSWDPLTVLYAIDGLSNINEWLPDSPLY
                     PQKYLKLRMSEEEAGELLDNIYLDTATRAAR"
     exon            complement(409671..409797)
                     /number=1
     exon            complement(409849..409920)
                     /number=2
     exon            complement(409973..410262)
                     /number=3
     exon            complement(410317..410674)
                     /number=4
     exon            complement(410738..410978)
                     /number=5
     exon            complement(411054..411063)
                     /number=6
     CDS             complement(join(411725..412387,412814..413162,
                     413202..413461,413940..414131,414714..414845))
                     /codon_start=1
                     /locus_tag="AO090023000163"
                     /note="Cysteinyl-tRNA synthetase"
                     /old_locus_tag="AO070275000047"
                     /protein_id="BAE58739.1"
                     /transl_table=1
                     /translation="MAELKASIAGTAGKSPPATIRGDSTSLTPGSHRNQNCHSYRCGL
                     TPFIALDPKGRKVTWYACGPTVYDDAHLGHARNYASTDIIRRILKDYFKFDVEFVMNI
                     TDVDDKLRGSTVPGDAYEIFTKLTKKYEEHFMRDMRDLNVLDPDEITRVTEYGQEIAD
                     FVEKIVTNDFGYVTLDGSVYFDIKSFEKAGHPYARDGEGTLSHAVEKRSPDDFAIWKA
                     SRPGEPSWKSQWGQGRPGWHIECSAMASSRLGSQNDIHSGGIDLAFPHHDNELAQSEA
                     YWSEKKQQWVNYFLHMGHLSIQGSKMSKSLKNFATSCGIGWEGTDIPEPAKQFLYPLS
                     AMRDALREATKSQGEVTHQQLKAITAETIVDERLVSQASRPYFQVFRDFHARISPSNS
                     EDTPTSSKELLSLCDRLRDVELFDLGIYLEDRENKPALVRPVTRDLLQSREEHARKML
                     LKQQEKEKQEKLAKERLEKGRLSHLDMFRTSEFSAWDEDGMPTKDAVGEPINKSRSKK
                     LRKGWERQKKAHEAWVASQRTDS"
     exon            complement(411725..412387)
                     /number=1
     exon            complement(412814..413162)
                     /number=2
     exon            complement(413202..413461)
                     /number=3
     exon            complement(413940..414131)
                     /number=4
     exon            complement(414714..414845)
                     /number=5
     CDS             join(415013..415103,415152..415432,415486..415752,
                     415809..416864,416951..417064,417128..417223)
                     /codon_start=1
                     /locus_tag="AO090023000164"
                     /note="membrane coat complex Retromer, subunit VPS5/SNX1,
                     Sorting nexins, and related PX domain-containing proteins"
                     /old_locus_tag="AO070275000048"
                     /protein_id="BAE58740.1"
                     /transl_table=1
                     /translation="MWNDEDNNPYGAFDPEARLSESLHSANLSPTLYEREYTPPSPSS
                     KASTQDPTDDYLSHPQDFSDEENEGYDSQPASHGYYRKSTYDSRIEQILYENPEMPIL
                     ITDAGKNHEGGGSFIVYTIRTGDLEVRRRYSEFASLRQTLVNLHPTLIIPPIPEKHTM
                     ADYAAKPTKAKEDTAIIELRKRMLAVFLNRCRRMKEVREDGVWWRFLDPNVSWSEVLH
                     SHPASSVPKNNLKAPPLDPANPTAAHAWLPLPSSSAKLKGTSGPTASAAPPPVDTPSP
                     DVLGRFPPESRKLSEQELDPYFINFEASTRELELLLQGNIEKVNRRTVSHLSSLSADL
                     MELGARYNGFSLSEQSPTVAAAIERIGQAADTSYIETEELSNALSASFAEPMRESAQF
                     ASVVRSVLRYRVLKRVQEEMTRDELAKKKTLLDSLERSELEAKRIEQYLNRTSAQGSG
                     TRSQRSLSTSSATSGPGSHGADVRPSGQEDTTSIDSDFPPTHGESIGSQASLPAASPS
                     RRPETSSSPAHRKSASGTFMTNKLFGRISHAVHGFVDVDPERTRRDQIGKTKESLLQL
                     EQALEVSEKDVKDASTGVLQDLKRFQKDKEADLRRYMVAYARCHLDWARKNLETWTEA
                     KDEVDKIVVR"
     exon            415013..415103
                     /number=1
     exon            415152..415432
                     /number=2
     exon            415486..415752
                     /number=3
     exon            415809..416864
                     /number=4
     exon            416951..417064
                     /number=5
     exon            417128..417223
                     /number=6
     CDS             join(418613..419412,419511..419689,419947..420029)
                     /codon_start=1
                     /locus_tag="AO090023000165"
                     /note="beta-xylosidase"
                     /old_locus_tag="AO070275000049"
                     /protein_id="BAE58741.1"
                     /transl_table=1
                     /translation="MVLVATLFSLFTVSLCRSIPRSSPSSSPYTQATDLKIHDPTVIN
                     ANGAYYAYGVGEHIVIHQAPGLAGPWKQIGSVLDKDSIIPKGDRAKPWAPTTIEVKGT
                     FYCYYSVSNAGCRDSAIGVATSQSPGPGGWTDHGAIVQSGTGQGSDEHPFNEVNAIDP
                     AVLVTGDKGHLVFGSYWSGIWQVPLNEDFSSVGNTTGLNAHHLAKHPKTERVNSQDQN
                     PDPLCRDSSGRRPVEGAYISYHAPYYYLWLSWGQCCDYDPNNLPPSGEEYSIRVGRSE
                     SPHGPFVDKQGKELTQGGGELIYGSNNDVYAPGGQGVITVETGDILYYHYSLYRYSTH
                     SLYTFANLDFNQGCTLFIQ"
     exon            418613..419412
                     /number=1
     exon            419511..419689
                     /number=2
     exon            419947..420029
                     /number=3
     CDS             join(421888..422523,422563..422967)
                     /codon_start=1
                     /locus_tag="AO090023000166"
                     /note="predicted protein"
                     /old_locus_tag="AO070275000050"
                     /protein_id="BAE58742.1"
                     /transl_table=1
                     /translation="MSVHFGFPPSSLFMLDQAQTKPTIPTRQLAKLGISPAIYSITLH
                     PEFSLIAIFLYTTVVLFLNGINRRRHGQPWAINHTRWFRHAVIVHDVPLALCSAWMFF
                     RVVRTFRNAWPKRHDAFYTVLVADLFCRGGQILPHQETIQEFVFVGWASYISKFYEVL
                     DTVIILAKGRQASLLQIYHHAGVILVAWASIRFEYPPALMLFSFNAGVHALMDTDQKL
                     QYTYFALVSIHVAVPRSAKAAITSIQIVQFFIELIVCPSYLFVYYDVPADYTRYNDYR
                     KMGDSLDAPASRDAGLNGQSYCNTRTVSCMNKASHTSVTWLEILFILSLTWMFLQFFR
                     STYLQAGKKEAL"
     exon            421888..422523
                     /number=1
     exon            422563..422967
                     /number=2
     CDS             join(423437..423543,423599..424133)
                     /codon_start=1
                     /locus_tag="AO090023000167"
                     /note="predicted protein"
                     /old_locus_tag="AO070275000051"
                     /protein_id="BAE58743.1"
                     /transl_table=1
                     /translation="MTTGHRELGPYGRACATCARAKCKCIPRAGGSSCERCHRLNKKC
                     IQPVRQRKLKPLSKRVQLEHKLDGLMTLLASAGQSQPQPQPLSDSVRDMNTNIVTSGT
                     EPPYSDSGLLGTVMSGPGLDQGSEEEACLASFRTEKLPVFPVVHIPDTMSAKDFKQQS
                     PFLWRCIATIQCKHPSRQSELCMSIREVAAKRLLVDCAKNLDLLQGVLMYLTW"
     exon            423437..423543
                     /number=1
     exon            423599..424133
                     /number=2
     CDS             join(425780..425980,426047..426123,426198..426249,
                     426299..426497,426548..426619,426686..427192,
                     427252..427412,427476..427868)
                     /codon_start=1
                     /locus_tag="AO090023000168"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070275000052"
                     /protein_id="BAE58744.1"
                     /transl_table=1
                     /translation="MSDGNQPSTLDEHLKPQAKPEDELSESLAVPEKHEPEWLEGVPL
                     VMAVSGTTLVVFLMLLDISIVSTAIPQITNQFHSLDDVAWYGSAYTIASASLQPLTGK
                     FYNYFQLKWTFLSFFAFFEIGSLICGVANSSKMLIIGRAVAGMGSSGMLNGAMNILAA
                     AVPMHKRPTLMGIIMGIAQLGLVSGPLIGGAFTTSSTWRWCFYINLPIGALVGALLIF
                     ARIPEQKPKEKASQVVRSMLLYKFDWIGFVLFAPACIQLLLALQYGGNQYPWDSVTVI
                     GLFCGTIATLLVFIAWERHMGRDAMIPGYLLRDRIVVCCCMFFMMVFGMTMILSYYLP
                     IYFQSVRGKSALVSGVNLLPNILCQLVMAVISGVLTGKLGYYLPWGVFGAMLNSIGSG
                     LLSNLTPDTSVPDWAGYQSLVGFGRGAATQVPMVAIQNQVTADEVSTALALMTCSQTL
                     GGAIFLAVGQVIFAQALRVKIPQHAPAVDPETVIGAGATGFRDVVSLQDLPGVLTAYA
                     KSVDRVFYLGVGLSVAQFVFAWGVGLKNVKKDKGKVGGEVADDKP"
     exon            425780..425980
                     /number=1
     exon            426047..426123
                     /number=2
     exon            426198..426249
                     /number=3
     exon            426299..426497
                     /number=4
     exon            426548..426619
                     /number=5
     exon            426686..427192
                     /number=6
     exon            427252..427412
                     /number=7
     exon            427476..427868
                     /number=8
     CDS             join(428533..428548,428612..428701,429065..429622,
                     429682..429881,429933..430445)
                     /codon_start=1
                     /locus_tag="AO090023000169"
                     /note="monocarboxylate transporter"
                     /old_locus_tag="AO070275000053"
                     /protein_id="BAE58745.1"
                     /transl_table=1
                     /translation="MSKSQSNILQVVGVAAYVGSDGPGQSGAIMLKAIDTVNREKKNN
                     PQLINAPVSDTSGVLPPPDGGLHAWAQVVSGHFVVALTWGYAASFGVFRNHYKSTIPQ
                     TPSDISWIGGVQVFCIYFISTLSGRATDAGMARLVVGVGAALLLLGTFMTSLATKYWQ
                     IFLAQGICTGIGQGLMWLPSITLISTYFVRLRVFAVTAAATGTSTGGMIFPAMIQHLT
                     PKIGFPWAVRCMGFVVLFMVIVTLALLRPRLPPRKSGPLVEWGAFKEPAYMLFIFGVF
                     LLYWTLYFAFFYIQVYATEELGLSEEAGVNLIIVTNALGIPICPAFGYLADRYIGPLN
                     CLIPWVALCGILMFCWAAVHTVAELYVFAVFYGLASAAAMDLFAGTVPSLTKDLDKIG
                     TRVGMALSIMSVGPLTGPSVAGALIARTGGGYLASQMWAGATLIVAALALVGARFIIS
                     GPHLQAKL"
     exon            428533..428548
                     /number=1
     exon            428612..428701
                     /number=2
     exon            429065..429622
                     /number=3
     exon            429682..429881
                     /number=4
     exon            429933..430445
                     /number=5
     CDS             complement(433545..434087)
                     /codon_start=1
                     /locus_tag="AO090023000172"
                     /note="predicted protein"
                     /old_locus_tag="AO070275000056"
                     /protein_id="BAE58746.1"
                     /transl_table=1
                     /translation="MNPFKTPPQLNPHPKFLTPTPFKPKGPTVSPPTTPETHRDNLSD
                     ILSDSDISILDLGPSLSARNTSCYQAPSTTNTTLARDTKQTSYLTAPTTGHGHGPIMA
                     QDMNTRHTPTSPSLKDTTQGADITPKKLKMRTGSVRGALRTFSSPLLSPLRSGTGKVG
                     RPGVNRAKTSFRGVGGALER"
     exon            complement(433545..434087)
                     /number=1
     CDS             complement(join(434806..434816,436242..436337,
                     436389..438431,438495..439851))
                     /codon_start=1
                     /locus_tag="AO090023000173"
                     /note="ubiquitin C-terminal hydrolase"
                     /old_locus_tag="AO070275000057"
                     /protein_id="BAE58747.1"
                     /transl_table=1
                     /translation="MDLAPTGKESQSDKMDTTGTEDDDSTTNDVSGSDNVYPTPSSMS
                     TYTAPTATRAHSKAQPSTTSERPSYDDQVAKVTCFMMQPLKEGQKGYVVSMAWLKRVL
                     SRSSTHADKTDKTATEGEVGPVDNSDLVLVTDPANASFKDEKGEPFVPLRPGLQMSED
                     FEIVPQEGWDLIMQWYGLADQSPAIVRYAHNTSIGGESENIQYEINPPIFTILKLSSL
                     SGGTTPQSLKEKNMKPVRILASRHSNFQKWLKEAKTLANIDMSTKVRVWRILGGLGSA
                     TASAAMTPAASRSASPAPAASIVANAGNNLVIDLNTFLSLSEGAQRELFEDAKDQTAN
                     PNYNGRMTLDLAGLGGSDVVVLEERIPGGEWVSEASKQTLNRLGVPSGSLKNGASSKL
                     KNKSPTASGRSSPVPEPVRGRRKDGKPRGCTGLSNLGNTCYMNSALQCVRSVEELTYY
                     FLNDVYKQDLNPSNPLAHNGDVAKAYANLLRMIYDEAGQSSFAPRQLKHTIGRYGPAF
                     SGYGQQDSQEFLLFLLDGLQEDLNRILKKPYIEKPDSTDEMVHDKAALTEFADKCWDI
                     YKARNDSVITDLFAGMYKSTLVCPACDKVSIIFDPFNNLTLQLPIENLWGKEVFYFGL
                     QKKPVRFDVEIDKNSSVKSLKELVAKKQGTDPERLIMAEIFKRKFYRMFDNTSFIAEC
                     QISGNDEIAFFEVESVPTNYNPDKPQKSYFSFSRSDQEEIPSIDSPKADRILVPIFNR
                     VERSKSKRDLFGVPSYIVVTREEAYDFDAIYGKVLGRAATMTTRDFLNEEVLGEEQQE
                     ATQEDSDTVVMNDDDAQSADSKIKTSSVDGEDGMVDVSMRDADSASQNGAPLSGSSIP
                     ARFRDLFELKIMKGNEPVPLGWSSVEDNKEYPKMSFRIKTKPVTPPEESDETSDPADS
                     KAAESGSASGSDADNSAEVSRTPAPVARVQIRPLVRPGEGLVVDWNEDVYDALFGGSK
                     KDRDPLRGIPTWQDVERVNDPELNKRRQLRQTRKKRGVSLEECLDEFNKEEILSENDA
                     WYCPRCKEHRRASKKFQLWRTPDILVMHLKRFSASRGFRDKLDVLVDFPVEGLDMSGR
                     VEAPEEGKSLVYDLFAVDNHYGGLGGGHYTAYAKNFFTGQWNEYNDSSVSRPIDPQSV
                     VTSAAYLLFYRRRSDRPLGGLL"
     exon            complement(434806..434816)
                     /number=1
     exon            complement(436242..436337)
                     /number=2
     exon            complement(436389..438431)
                     /number=3
     exon            complement(438495..439851)
                     /number=4
     CDS             complement(441279..442331)
                     /codon_start=1
                     /locus_tag="AO090023000174"
                     /note="predicted protein"
                     /old_locus_tag="AO070275000058"
                     /protein_id="BAE58748.1"
                     /transl_table=1
                     /translation="MAYTVERLEWVKRLFLKPRRSRGFPKTSDSPRYSLRERSRFSTQ
                     TVTSTWIDDDNDDNYDPKARYTRRRKRSSRPHDVVSDTPEQQKSLVVVFPIKSDRGRA
                     FLSSLLANHNDHGEPTSPEIPSNEVIDGDLNHPVTRVIRTSLAHPVIFNHEPPEDGSS
                     PCHWCDNFTYGLLGLGRRTVEVLDFGDGRYIEIGGGQVAEGHEPSRMCVVCALERVHV
                     IRCVAHRIVPLKGYDVDTFDLTGAYNSLVPKPGQAPKKINPWCSLCPNPAFFGCGALQ
                     AVNKFQEPVDASSQDAIGCGLLLCEKCEGLMRLYQGDLARVVMKNEETDAAFGTRADA
                     MYLLPGNDMYRSYIGS"
     exon            complement(441279..442331)
                     /number=1
     CDS             join(443355..443400,443641..443921)
                     /codon_start=1
                     /locus_tag="AO090023000175"
                     /note="predicted protein"
                     /old_locus_tag="AO070275000059"
                     /protein_id="BAE58749.1"
                     /transl_table=1
                     /translation="MVSPFSKSLLSGVQAVNFVIDGLFIVIIIIKDRHAYCSFALCMR
                     TGTKFEARMSTFRPTMGPVATTLFVVFRHHGDTEPDHWGQSCEKDAVVLNSADLSVMG
                     LGTSTT"
     exon            443355..443400
                     /number=1
     exon            443641..443921
                     /number=2
     CDS             complement(join(447311..448079,448181..448341))
                     /codon_start=1
                     /locus_tag="AO090023000176"
                     /note="predicted protein"
                     /old_locus_tag="AO070275000060"
                     /protein_id="BAE58750.1"
                     /transl_table=1
                     /translation="MRLCDLPHFPTEDTLYAMSGLGFVDIAGDDLYSANAITKHLATM
                     PSAQHGALHFTTEALLGAAFLMKKLKADNFEYPFKELETPYQYAYHSMGQEELAKQHT
                     YSIMAAEGRMDSFNHFMVGKFMKTNTAPDRLKAFGYDLQSVLNEAGNGVPATMVDIGG
                     GRGELLLDIKAAYPDLQASDLVVQEFNQDIIEIPGITLATWNYKEDTPQPIKGALVYH
                     LAHILHNLSDLEAARLLQKISEAMGSHSRILIHEFAKNANYAKMHSAMIALYAGRERS
                     AVEWRQMAALAGLKVTFEAYPEFGEGLIEMRKL"
     exon            complement(447311..448079)
                     /number=1
     exon            complement(448181..448341)
                     /number=2
     CDS             complement(join(448407..448705,448762..448840,
                     448900..448920))
                     /codon_start=1
                     /locus_tag="AO090023000177"
                     /note="predicted protein"
                     /old_locus_tag="AO070275000061"
                     /protein_id="BAE58751.1"
                     /transl_table=1
                     /translation="MFRLLYTPHDDLNPVVGNSIWIDCDPCLSSVGHAPKCLPFHPGQ
                     LLQAQLLRFVSKSSFSPITMLTSDVKVAALGFVPVAVHFDLFDTLAKIEGPASGEDVL
                     VAYRSSKGDKAEDNVPCVSHIFSTLKSSHL"
     exon            complement(448407..448705)
                     /number=1
     exon            complement(448762..448840)
                     /number=2
     exon            complement(448900..448920)
                     /number=3
     CDS             join(449887..450016,450195..450509,450519..450550)
                     /codon_start=1
                     /locus_tag="AO090023000179"
                     /note="predicted protein"
                     /old_locus_tag="AO070275000063"
                     /protein_id="BAE58752.1"
                     /transl_table=1
                     /translation="MVLGATLSNDYGTFTAFRSLQGLFGTVPQVVGLPIIHDMYRPEG
                     PFIGPALAGYIGAGSNWKVSFGILTVFYGISTILIFVFGYETYFVKGRQCQRNSRLQS
                     ILGIKNHNLPVGRTLGYWTKLLAIYIFKLPLLLTGIATMVNFCWPIGFCSHLFIEI"
     exon            449887..450016
                     /number=1
     exon            450195..450509
                     /number=2
     exon            450519..450550
                     /number=3
     CDS             join(450871..450980,451043..451292)
                     /codon_start=1
                     /locus_tag="AO090023000180"
                     /note="predicted protein"
                     /old_locus_tag="AO070275000064"
                     /protein_id="BAE58753.1"
                     /transl_table=1
                     /translation="MACGLLTYGFTLNYGKHWIGLAFGWGMVVAGMIASTVSITAYNL
                     EKYPDQSTVVSAIINAWRTASGFSVGYFQPAWIARNGISAVFGTQVAVVVAVLILTIT
                     PVIIIEGRKTKAQVAHA"
     exon            450871..450980
                     /number=1
     exon            451043..451292
                     /number=2
     CDS             join(451761..452026,452080..452282,452338..453032)
                     /codon_start=1
                     /locus_tag="AO090023000181"
                     /note="predicted protein"
                     /old_locus_tag="AO070275000065"
                     /protein_id="BAE58754.1"
                     /transl_table=1
                     /translation="MSADSNSPRAIALRYISNSRFHRRYTLPATADHDSLTFTYADIG
                     STPSSANPNPQTILFMPGMFATRYLGVFIHAIAEKLGVRVLVVDRPGMGNSTDVPLDQ
                     RLSIWIELVPRLLAHLEIEHVALVSHCAGTIYLLNTLFHCRELLHPERPFVAFLAPWV
                     DPSHSHVTSMQMAQYVPVKAFNVWNLIPKFLLLKAGPAFTSSEAAITKTSNVISSGSG
                     FSSGGENYTELERNRRQIEYEYGLSRDVQAEIDSLIFQFMFEESTVGANSEALQCLRK
                     GSDSSNTWGKCENYEAYVKELVDLEGRRHRRTGQEKLKVRAYFAGNDSMIGKAGQDYV
                     EECWARDTREFKDALDFESRTFTQLEHDSLVQSAEVLKSIFLHVGGVMPNDTE"
     exon            451761..452026
                     /number=1
     exon            452080..452282
                     /number=2
     exon            452338..453032
                     /number=3
     CDS             join(453415..453766,453834..453958)
                     /codon_start=1
                     /locus_tag="AO090023000182"
                     /note="predicted protein"
                     /old_locus_tag="AO070275000066"
                     /protein_id="BAE58755.1"
                     /transl_table=1
                     /translation="MWVKIDRKGLCFTIRVKRNVIPTFVDNKAFVCNPKPVVGKAFGS
                     IETVKIPGAVLVRDCGVHNPNPLVRDSPVNEISNPPKKPKRDRGHNSTNKNTPDDDSY
                     PLYEEPYRLDNHYPCPPVVLTVWSPTLRAPATTFLGISLILEHLEDWGSCGSGDKD"
     exon            453415..453766
                     /number=1
     exon            453834..453958
                     /number=2
     CDS             complement(join(454934..455133,455185..455479))
                     /codon_start=1
                     /locus_tag="AO090023000183"
                     /note="predicted protein"
                     /old_locus_tag="AO070275000067"
                     /protein_id="BAE58756.1"
                     /transl_table=1
                     /translation="MSGYTQTKLPQVQVLERDNSPRQHITIDIPEPTYQQPSQRSPVL
                     GTALQDIDLERGNGFEPLTMNEAKLAPKKKRYIFGIPDNPFEDSESDNEWMRHIDEDE
                     AKPETNNFQQASEQRRIICCHNTSGLTRKRSSVSCTELSIVIVIMVVAGLIILLPNLL
                     GRAK"
     exon            complement(454934..455133)
                     /number=1
     exon            complement(455185..455479)
                     /number=2
     tRNA            complement(456169..456242)
                     /locus_tag="AO090023t00009"
                     /note="tRNAscan-SE"
                     /product="tRNA-Val"
     CDS             complement(join(457519..457624,457751..458004))
                     /codon_start=1
                     /locus_tag="AO090023000184"
                     /note="predicted protein"
                     /old_locus_tag="AO070275000068"
                     /protein_id="BAE58757.1"
                     /transl_table=1
                     /translation="MLWLCDALTVFNSIMEDEDYKLEKLPWRLQHVLLRQNNDKLLHS
                     VNVDESLKGTPEKYVSKDEDYWDSDLHDTEEKEVPWHLLKHGNLNSSGVCIYKHSTAL
                     HPASLFGYVRMAELLDL"
     exon            complement(457519..457624)
                     /number=1
     exon            complement(457751..458004)
                     /number=2
     tRNA            complement(458163..458236)
                     /locus_tag="AO090023t00010"
                     /note="tRNAscan-SE"
                     /product="tRNA-Val"
     tRNA            458976..459049
                     /locus_tag="AO090023t00011"
                     /note="tRNAscan-SE"
                     /product="tRNA-Val"
     CDS             complement(join(459234..459256,460192..460559,
                     460617..461407,461460..462050,462103..462480))
                     /codon_start=1
                     /locus_tag="AO090023000185"
                     /note="vacuolar sorting protein VPS1, dynamin, and
                     related proteins"
                     /old_locus_tag="AO070275000069"
                     /protein_id="BAE58758.1"
                     /transl_table=1
                     /translation="MEKEASENSMLADPALLDKIDKLFACNVGQHIALPQLVVVGDQS
                     SGKSSVLEGLTQLPFPRDSGLCTRFATQIIFRRDRGLSTRKVSASIIPASDSDPDRPA
                     RLRAWHTESIGSLEPSHFSTVMQEVHEFMGVAGNCALSTFSKDVLCLEISGPEEDHLS
                     VIDVPGIFKNTTAGLTSKSDIAVVRDMVETYMKNPRSIMLTVVPANVDIATQEIIEMA
                     REYDAEGERSIGVLTKPDLVDRGAEDKVLDLVAGNKLFLRHGWIVVRNLNQQELTDRE
                     TDRDEAEEAFSRQAPWSTIAKDKFGIKSLRSRLQEIVTENARREFPLVRSEISKRLKE
                     AKSFLKALGNERETPEQQAGFLLDIMNKFQEITSQALSTNYGENDIFDEHMDLRLATR
                     IVTRDTAFAKDLERYGHEYNFDTSGTESPDSSNTKSTTAPSDDSGDMNEFLTRKTSSI
                     PELKDVVTQQTWESFPSDSDIYEWLKELYQSSRGFEIGTFSASLLATSMKKQSAKWPD
                     FAKGYISDVITIVHGFIVKALEIACVDKRVFNHLLSIMMDNLLDKYQRALTQVDFLLH
                     VERNQAPKTLNHYFNENLQRFRQERQCSKLKSKVINNSYGGEVIRLEDLTVLNHMSNT
                     EYTVHDIHDILESYYKVARKRFVDNICMQAADYHLVTGPETPFKLFSSSLVNRLSRDE
                     LKDIAGEDASTVRQRINLKKTIRELEEGSGIDKG"
     exon            complement(459234..459256)
                     /number=1
     tRNA            459859..459932
                     /locus_tag="AO090023t00012"
                     /note="tRNAscan-SE"
                     /product="tRNA-Val"
     exon            complement(460192..460559)
                     /number=2
     exon            complement(460617..461407)
                     /number=3
     exon            complement(461460..462050)
                     /number=4
     exon            complement(462103..462480)
                     /number=5
     CDS             complement(join(462990..463568,463627..463968,
                     464036..464549,464616..464800))
                     /codon_start=1
                     /locus_tag="AO090023000186"
                     /note="carboxylesterase type B"
                     /old_locus_tag="AO070275000070"
                     /protein_id="BAE58759.1"
                     /transl_table=1
                     /translation="MSAPQVSHQTLNAEFKGTARKIGETDIHQFRGIKYANIPARFER
                     AEPVDNFNGASVDATQYGPRCPQAAVDVRHLLRIPEDFEIPDEPEDEFECLNLDITCP
                     PLSANSAPLPVLIWIHGTDLMTLTSAFGHSRLTIIQVVLKLSPSVREHPRSAVSNLSL
                     QCYLMSSIDLVTDPAKIVADSIEAKQPIIVVSINYRLNIFSFGDGKERNLALKDQRLG
                     IDWVRKNIAAFGGNPDNITLSGESAGAVYVHAHLVTGPPVKRAVLASGSLYLSSPLPV
                     ERGNGLIQALQTKVKELGQPSLREASVSTLVQALKECNVNTMWIQEEPELENWETKPE
                     QVDELMIGDTEYESVIWRNGVETLDGETITAAFEQEKEWGTKLRKLYQVVADRPTACK
                     LGALDLVNDIRYTLPVEVISEKLAAANKRVYRYVFDQANPWQASSRAHHAVDLLYLFA
                     GVDLSFNPTAEIVGQETRKRWIRFVSGSSPWSSERRFAFGPVGDCKEISEAQFAGRRR
                     VNHLKVLKEAGVGAYMPIATALTAGKISLLN"
     exon            complement(462990..463568)
                     /number=1
     exon            complement(463627..463968)
                     /number=2
     exon            complement(464036..464549)
                     /number=3
     exon            complement(464616..464800)
                     /number=4
     CDS             complement(join(465165..466456,466519..466578,
                     466648..466705,466768..466788,466855..466962))
                     /codon_start=1
                     /locus_tag="AO090023000187"
                     /note="vesicular amine transporter"
                     /old_locus_tag="AO070275000071"
                     /protein_id="BAE58760.1"
                     /transl_table=1
                     /translation="MRLWPSGDGTSEPPVFLEWRSSKSFIIFVVVFAVFTDILLYGLI
                     VPVTPTALHERVGLSEDNEQSWTSILLALYGAALLAFSPIAGYIADRIESRWWPLIIG
                     LIALGAATALLCVGTHIGLWIAGRLFQGASAAVVWAVGCALLVDTVGKDELGQALGYI
                     GMGMTLGVMGGPLLGGVIYEHGGYYAVFALAFALIGLDILFRIIMIEKKYAAKWLPPA
                     EVSSDGENLNNEAASQGTTESAGPSTRKSDHNREGHPQAVAPALSESSQIIEKSNDQG
                     LNKCNHSTTTGPHPARAILTLLASHRMLVTIWAYFILSLALTSLDSVLPLYVQDTFHW
                     GQTGQGLIFVPLSIPHLIDPIVGFLNDKFPNARRYLAAGALFATVPVIVCFRFVTEDS
                     MRQKVLLCALLALLGACLAFLMPPILVEASYVVQEKEEKNPNIFGKGGAMALSYGILN
                     AAFAAGSIVGPFFAGFIRESAGWATMSWALALLTGVSAVPVLLFLGGFFFKSQKNVEP
                     RSAA"
     exon            complement(465165..466456)
                     /number=1
     exon            complement(466519..466578)
                     /number=2
     exon            complement(466648..466705)
                     /number=3
     exon            complement(466768..466788)
                     /number=4
     exon            complement(466855..466962)
                     /number=5
     CDS             complement(join(469566..469681,469731..470140,
                     470200..470286,470340..470372,470429..470673,
                     470722..470756,470818..470927,470983..471131))
                     /codon_start=1
                     /locus_tag="AO090023000188"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070275000072"
                     /protein_id="BAE58761.1"
                     /transl_table=1
                     /translation="MSKPDPEKSVNHEEEFLVEWSKDDPSNPRNLSPARRWLIVLIVS
                     MGSLCVTCTSSIYTTTYHQMTKEFGCSTLVATVGVAIFVWGLAVGPLVLGPLSELYGR
                     RIIYLTSFTLFLIWLIPCAVATNIQTMIIARFFNGLSGSAFLSVAGGTVGDVFHRHEL
                     AAPMMLYTASPFVGPELGPLIGGFINDFSHWRWTFYVLLMWAGTLLALIFFLVPETFH
                     PVLLGRKAKEMRRATGDNRWQTKRQAVHRPLSQMILQSIYRPLMLLALEPMCLNLCIF
                     SAILLGIIYLFFGAFDQVFTNVYGMTLWQCGCCFLGMFVGMMLAVMSDPIWRRVYARL
                     ESKHRQRTDNTEKFLPEWRLPPAIAGAPAVTIGLFIFAWTIYPDVHWIAPIIGSALFG
                     FG"
     exon            complement(469566..469681)
                     /number=1
     exon            complement(469731..470140)
                     /number=2
     exon            complement(470200..470286)
                     /number=3
     exon            complement(470340..470372)
                     /number=4
     exon            complement(470429..470673)
                     /number=5
     exon            complement(470722..470756)
                     /number=6
     exon            complement(470818..470927)
                     /number=7
     exon            complement(470983..471131)
                     /number=8
     CDS             complement(join(472501..473171,473240..473483,
                     473556..474019,474079..474229,475214..475264))
                     /codon_start=1
                     /locus_tag="AO090023000189"
                     /note="cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies"
                     /old_locus_tag="AO070275000073"
                     /protein_id="BAE58762.1"
                     /transl_table=1
                     /translation="MQVGGLRSRVSVLVAIQLVSLIVYRIYFHPLSKIPGPLLPKITD
                     WYPAWCVWRGSSHTALWEGHRRYGSIGRCGPNSVSVCSQTGLMEIYSTKANVCKDESY
                     VVMSVGSHAPNTFSFIDKKTHAFRRKILFQAFTDNALNGVQDQILSHISEFCAMLNPP
                     PSNGAGQSSVWGPSVDIAPLCDYLAFDVISDLSYGRSFGMLKSDRYRYVPKLTRRLAR
                     RNATCMTQSKLWRYKLDRLFFAGFLKALRDFGLWIRHQGKERIRLGNNGPRKDCFHYL
                     LSGSDPKTGQGLTERELRVELLLLIVAGSDTVATSLSAVLFNLAHNQQALQKATAEIR
                     SCFEREEDIRLGTRLKSCSYLHACISESLRISPAVSNMPPRRVLPGGITVDGYYIPEG
                     TIIGTPIYALHHNEEYFPRPFKYEPERWLENEANGENPSTDDGLKRARAAFCPFSIGP
                     RSCVAKNLAWAELTLTLARVLFSYDVRLPPDHCEVEPDCCSSVPRDQSPEYKLRTWIV
                     SAREGPSLQFRPRNVKVP"
     exon            complement(472501..473171)
                     /number=1
     exon            complement(473240..473483)
                     /number=2
     exon            complement(473556..474019)
                     /number=3
     exon            complement(474079..474229)
                     /number=4
     exon            complement(475214..475264)
                     /number=5
     CDS             complement(join(475673..476083,476145..476381))
                     /codon_start=1
                     /locus_tag="AO090023000190"
                     /note="predicted protein"
                     /old_locus_tag="AO070275000074"
                     /protein_id="BAE58763.1"
                     /transl_table=1
                     /translation="MYENTLWDQGIGYIGWLMYLSKFYEVVDTLIILAKGKESSTLQT
                     YHHAGVMICAWSGIRYKCPAAIVGVFLNSGVHTLMYTYFALAAAAIPVAIRVKRALTS
                     IQIIQFILGLGLSCSYLFAAYDVVLSEHNDIENSRPAGFSSQMENVQFTTKTPATLTT
                     NVGSQGMATYTTTHCIPDSGKAFAILLSSAYLLPLTYLFGRFFVRTYLTQHKKAT"
     exon            complement(475673..476083)
                     /number=1
     exon            complement(476145..476381)
                     /number=2
     CDS             complement(join(477849..478490,478541..479290,
                     479343..479612))
                     /codon_start=1
                     /locus_tag="AO090023000191"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070275000075"
                     /protein_id="BAE58764.1"
                     /transl_table=1
                     /translation="MASTDAPPPYSIYNSTPTHKTEASSFECIGSGGGNLESQRWVVQ
                     PEDSSGGEENEPLWRPSFVDWLNILMLLLLSMMITIDGTILVSILPSLTASLKMSAAD
                     AFWCGTGYLLPCAIMQPYFTALSGFVQRRYQMLLALGLFTVGTIICCLSNNFAQIIAG
                     RVIQGIGAGGIMSGTFILLADLIPLKERPMYCGLLILFGAVGAVIGPFLGGLFIDHLN
                     WRWAFYINFPFLFVIFGQLIFLPLPPKQTWDSTHRLKSIDWGGGILFLASAGSFLIGI
                     SWGGVQYPWNSWKTYVPIVLGGLGLIANLFWERYMTSNPILHIHLFRSIRSIAAYMLV
                     FLYGFLSLGELYCIPIYFQSAKLRSATSASITLIPITAAILPAAAVTGILITRFGYIH
                     WPLWLSWIITAIATGCLISWDTSTTTVQWVFNLIAVGVGQGITLSSLNSCVQVLADPK
                     DTSHAFAMYAFIRTVGMCVGVPVGGTIFSNRLKYHAHNLGLPDAIGRNVEGGIEVFKN
                     MTATAEQVEAFKLAYARAFRNVAEVLTGLAVLGLIISMFVRRVRL"
     exon            complement(477849..478490)
                     /number=1
     exon            complement(478541..479290)
                     /number=2
     exon            complement(479343..479612)
                     /number=3
     CDS             480458..482071
                     /codon_start=1
                     /locus_tag="AO090023000192"
                     /note="cytochrome P450 CYP4/CYP19/CYP26 subfamilies"
                     /old_locus_tag="AO070275000076"
                     /protein_id="BAE58765.1"
                     /transl_table=1
                     /translation="MALFTFRLLPLVCTASIAIYVLSRFMHFETKSTGALTYSITFII
                     YLLYWLYIYPYHLSPLRHVPTVPGCPLWGHVFEIFNAEIGAVQQKWHKTHGPIVRYFY
                     PFGKEILSVVDNSALKHILVEASYNYEKTASNRKFLSRLFGEGILTAGGKVHAQQRKA
                     LNPAFSISAIKALAPAFWDYSCSMSSYWEQDIKESSDDSVSLDISDWASRATLDIIVA
                     VGFGAKIDTLHNSTAPLIEAFRTVFRFDAVAKLLAVLHILFPIVRYLPIKENREVDAA
                     KRTLFEFASGLIQEKEANINSTGNNILSQLVRGDRKPQAAGEDIFSRVICDQIATFLG
                     VGQDTSATWLSWTLHLLSKHQHMQVKLREEIRSHFPFLFRGATHEKIDFTEVDVDRLP
                     YLNNVCRESLRFIPPIPFVSREAARDERLGEYFIPKGTVIHIPINTIHRMPEYWGPNS
                     NAFDPDRWNCLPASYTNNAFLPFTQGPRGCIGRKFADTEVKTILCCLLSKFQFSPDPA
                     VQDPEELKRYRIVQKSQYGIRLKVSKLDG"
     exon            480458..482071
                     /number=1
     CDS             complement(484158..484757)
                     /codon_start=1
                     /locus_tag="AO090023000193"
                     /note="predicted protein"
                     /old_locus_tag="AO070275000077"
                     /protein_id="BAE58766.1"
                     /transl_table=1
                     /translation="MPNLKENCVEKLTTAMNNVLSSQPDVAQRILSEYGISRGMSDDE
                     ALPAVLDYINDICFFAPVLTLTRGWRGNSHVYYFNEGNPWEGPWKGRATHILDVAYLT
                     QNFQEFMTPSQQRVATAFAEDFFKFCHGIHPWPAVTDGDIATNFTARVYGPSSEGHDS
                     RLVSEPYKGESHRRSILFDCNHAVSLDELAGVFGVFRTM"
     exon            complement(484158..484757)
                     /number=1
     CDS             complement(join(484914..485061,485115..485205,
                     485257..485432,485492..485770,485842..486011))
                     /codon_start=1
                     /locus_tag="AO090023000194"
                     /note="carboxylesterase type B"
                     /old_locus_tag="AO070275000078"
                     /protein_id="BAE58767.1"
                     /transl_table=1
                     /translation="MATTTVQTKHLGQIRGKVAEGVTQFLGIKYATLEDRLADAQLVE
                     KRDGDTLDATKDGPTAISPSFGCDVELAAIQHKLPAKELTQSGIDCLNLNIAVPEGTT
                     ASSKLPVFFFIHGGGLQIGANSWPQLEFKRFVKLSADKNLPVIAVSINYRLGVFGFLT
                     SDELRKAGYKANNGLRDQRVALEWVRRHIEDFGGDPDNVTAAGESAGAASVTYHLKSE
                     VALFKRAIAMSGSYLFTQALPKCEHRGEDPISAGKASPRADCLIASLNSGCPRSGRLL
                     GGIDRYTCSNS"
     exon            complement(484914..485061)
                     /number=1
     exon            complement(485115..485205)
                     /number=2
     exon            complement(485257..485432)
                     /number=3
     exon            complement(485492..485770)
                     /number=4
     exon            complement(485842..486011)
                     /number=5
     CDS             complement(join(489252..489353,489412..490029,
                     490092..490193))
                     /codon_start=1
                     /locus_tag="AO090023000195"
                     /note="predicted protein"
                     /old_locus_tag="AO070188000007"
                     /protein_id="BAE58768.1"
                     /transl_table=1
                     /translation="MSSSTPKERADNIGSDSEEEDVFHDARFPAEEEAQLLEESHSIK
                     AEANKLFTAACYDQAISCYDRALASCPNYLDYEVAVLRSNMAACYLKLEDWKASVDSA
                     TACLDCLEKVVPSATERTDAPQEKQQESGSTDSVVEITCDDEEAEQEELKRLQKVNER
                     KNDVMRIRAKALMRRARAKSQLSGWGNLQGAEEDYKLLASMDNLSLDDRRIVQKALRE
                     LPDKIAKAREKEMAEMMGKLKDLGNGILKPFGLSTDNFKFTQDPNTGGYSMNFQS"
     exon            complement(489252..489353)
                     /number=1
     exon            complement(489412..490029)
                     /number=2
     exon            complement(490092..490193)
                     /number=3
     CDS             join(490505..490524,490581..490740,490846..491547)
                     /codon_start=1
                     /locus_tag="AO090023000196"
                     /note="predicted haloacid-halidohydrolase and related
                     hydrolases"
                     /old_locus_tag="AO070188000006"
                     /protein_id="BAE58769.1"
                     /transl_table=1
                     /translation="MTNSTPSLPPVRACLFDMDGLLIDSEDKYTAITNSILHEYGKPS
                     LPWSIKAQLQGRPQPEAFKIFYDWAQLPISPEEYAAKQAALQSKYFPESQPLPGVREL
                     LNKLLSTQKTDKPVYIALATSSHSRNYKLKSDHLQDLFAAFPESQRVLGDDPRIGKGR
                     GKPLPDIYLLALETINSNLRQKGEKEITPEECLVFEDAVPGVEAGRRAGMRVVWCPHP
                     GLLGAYKGREAEVLAGLTGEHKEEEKSTAEHEADELVAGRLGRSSGKPGQLNDGLGDL
                     VPTLEDFPYEKYGIQPA"
     exon            490505..490524
                     /number=1
     exon            490581..490740
                     /number=2
     exon            490846..491547
                     /number=3
     CDS             complement(492174..492764)
                     /codon_start=1
                     /locus_tag="AO090023000197"
                     /note="predicted protein"
                     /old_locus_tag="AO070188000005"
                     /protein_id="BAE58770.1"
                     /transl_table=1
                     /translation="MLHKTICKHLLDPLYVYHFVDDPVQAEKRVVANRLLNKRKGEVM
                     NAGKQVLGTRKPGAKKRSGKAAKAVTPPTDEAPSDTPASSSTGVEVGTLTPDGLSRMV
                     KAEQMSSSPMLSIGTPTPTYTAAAQQYSSTPMMGNVAMSHLHNRRMTAPTSHPRPIMM
                     NPNMPYHTRGSSNNFGTSRKRPMGDYEASSPEKRQR"
     exon            complement(492174..492764)
                     /number=1
     CDS             complement(join(493426..493462,493602..493703,
                     493841..493929,495115..495236,495293..496275,
                     496338..496507))
                     /codon_start=1
                     /locus_tag="AO090023000198"
                     /note="guanine nucleotide-binding protein"
                     /old_locus_tag="AO070188000004"
                     /protein_id="BAE58771.1"
                     /transl_table=1
                     /translation="MTASSVTSSAPICVASTQRGDEAGDASLDSHSQRTPSTACCTDE
                     SASDTNYVKSVEWTPDGTTLLTNSADHHIRTYILLVYVIILTSCRANNSLRPPDLLEE
                     RPSPHPLSPYSVLPSAEPTYATAIYPYYSLQDPSTTLFLSSVRDHPIRLASTLSPTLL
                     ATYSLVHPTTEAFITPHSIIYPHALGGTHFITGSDSLICLFDVSRPGNDGPVSWMPTI
                     PSKRKQTVGGGVGMKGIISAMAINSTGDGILAAGTFSRQVGLYDSNGTGQSLGTFSIA
                     KTDASRRIGGRGITQLLWSPCGRYLYIAERKSDGVMIYDIRVTGQLLGWLEGRKAITN
                     QRMKVDIVSTNQGTSHEIWAGGTDGFMRVWRDPTHTAGGQEPEWEWKIHDDSVSSTVL
                     HPMGNVVATCSGQRHYLDDEDSSSAGQLDNSVKQLLHLDQPHTSNPALNADLGYNGFL
                     TSNDTGAHSMPTRSRSTAMMPMTGMHAGNRISRTGGGAEHYDRQCKLRQF"
     exon            complement(493426..493462)
                     /number=1
     exon            complement(493602..493703)
                     /number=2
     exon            complement(493841..493929)
                     /number=3
     exon            complement(495115..495236)
                     /number=4
     exon            complement(495293..496275)
                     /number=5
     exon            complement(496338..496507)
                     /number=6
     CDS             join(497256..497320,497414..497464,497592..498008,
                     498073..499015)
                     /codon_start=1
                     /locus_tag="AO090023000199"
                     /note="predicted protein"
                     /old_locus_tag="AO070188000003"
                     /protein_id="BAE58772.1"
                     /transl_table=1
                     /translation="MFSAKPAGGGLSINTNSANSLLSRSSTLLFHFTARTFPLGGANT
                     QTTSSTTTPGTTSTTSGLFGNLGSSTAQSKPATGLFGNATSGTTQQNQSSGTNMFSGL
                     GGQQTNTGGGGLFGNSTATTSQPQSGGLFSGTANANTAQSGTTGGGLFGGASTAQTQS
                     KPLFGGMGTSNNTGGSLFGGANQNNTQQQQQAQKPTLSLFGNQNTTTQQPAQPTAAAG
                     TVVPGVKVDLSNLLPTTKYESCADEIKKELEVFDNYVLTQIKMCNEVGNMIPSIAAQG
                     ETIPNDVEFVQGKLETMQHALENDASDIDQLRSLVARDAAEAQVGFRAIDTLKLPLQF
                     QPAAGSGWWSVQDQKLSDRQSLRSTRKNTLALPDDVEGDSSTTVNGVPVNLVDYFSQR
                     SDEMGTVLERYKQNLKEIEDHLHGVEATLERQIHEFVTSRSRDGAAAGTPKSVLNDLA
                     VVLGDVEAGILGVASRLGGVTEQVQEVVLGPPSLGEGRLNL"
     exon            497256..497320
                     /number=1
     exon            497414..497464
                     /number=2
     exon            497592..498008
                     /number=3
     exon            498073..499015
                     /number=4
     CDS             join(500034..500483,500536..501096,501148..501327)
                     /codon_start=1
                     /locus_tag="AO090023000200"
                     /note="probable taurine catabolism dioxygenase"
                     /old_locus_tag="AO070188000002"
                     /protein_id="BAE58773.1"
                     /transl_table=1
                     /translation="MAPSLEDPILAPALDHVILPKKEVNGDNKFHYTPGRTVVERHDN
                     YAYEDLLPSFPDIHWDPLEEIPYEDRGLRGDPKFRNLLRDATDVFDYTPKIGTEIHGV
                     NLAKLDEAQKDDLARLVAVRGVVFFRDQKDLDIDAQRELGRHFGRLHKHATTSVPRKQ
                     GLEDVHVVYSGDNSGDQRALFTPSFLWHSDVTYEVQPPSYTMLKVLTGPPRGGGGDTL
                     WTSQYAAYDALSSHMQTYLKGLTAIHSADMQASDSRALGRPVRREPVTTEHPLIRTNP
                     VTGWNSLFFNPGFVTKIVGIPKTESDAIIKYLTDVIATTQEMHARFQWNKDDLAIWDN
                     RTTNHTASYGFAPHRRHAVRVAAQAERPYLDPAGKSQEEEHIALYNLPPVNKDGARQS
                     NYND"
     exon            500034..500483
                     /number=1
     exon            500536..501096
                     /number=2
     exon            501148..501327
                     /number=3
     CDS             501670..502302
                     /codon_start=1
                     /locus_tag="AO090023000201"
                     /note="predicted protein"
                     /old_locus_tag="AO070188000001"
                     /protein_id="BAE58774.1"
                     /transl_table=1
                     /translation="METPKDPSLLEYARFYGIARDFTAVDPITNIDETASETPLPRDA
                     LSEFQDYIYETQRNVEDNLRKEKLNVRKESARLLASVIQDARAEKLDINWDELLPKFS
                     QVDELKVQLPILDNDSISDTLRYTSPLRYDENKIEIRPLDEPCQKLKDEDITADLLTK
                     ADQVLKDIMPEKLKCSRESMLLIQKARDCGGLHFADLESLLNEMIISGQV"
     exon            501670..502302
                     /number=1
     CDS             complement(507721..509403)
                     /codon_start=1
                     /locus_tag="AO090023000202"
                     /note="predicted protein"
                     /old_locus_tag="AO080608000001"
                     /protein_id="BAE58775.1"
                     /transl_table=1
                     /translation="MPDSYSDIEIRIVQACTIAQGQKKPNISALARQFNVPYQRLRAR
                     IHGRANLSSRPISTKTLDDSQEKALIRWIRQLDNLYSPPTAGMIEQSANQILQRNITD
                     GQSRTVDKNWVYRFIKRLPEEFKLIQQKPKDKKRLDAEDIGVLQHWYDCLEAFIKNIP
                     PKNIYNFDETGFQLRQGKTQKVVTTMPLRAARGNPSKEVGELISAIECIAADGFTLPP
                     YFIFKGTYHLERWYDADIPEEYRISLSPKGYTTDKISFDWIQHFHRHTKHRISTKKEV
                     RLLFFDGHESHLTYEFLQFCGLHYIIPYCFPPHTTHLVQPLDGQPFQVYKHFYRKRNN
                     ELAQRGAEMDDKSDFLKEIHSIRTMTFKQRTIRDAFEKRGLYPLDSEKVMKSLREALE
                     TAPELEIITTPSPPPSSSSPPSTIRGLRRSISKAQSFINNSPELDQSFVRRLDRVFQS
                     SLETTELAAQLKDDLQQHLRYRKPQDRRKSQKRVKYHGPLTVYDAKRRIADRTEVERL
                     QGLRQIRKTGALEYDKPPQPTNTGDLPSTEAGQVDREGPRLPYWIDTQGDVV"
     exon            complement(507721..509403)
                     /number=1
     CDS             join(510032..510273,510325..510877,510935..511252)
                     /codon_start=1
                     /locus_tag="AO090023000203"
                     /note="predicted protein"
                     /old_locus_tag="AO070264000045"
                     /protein_id="BAE58776.1"
                     /transl_table=1
                     /translation="MSQSEQPSHSSTPRSFTSQTASAEELLKSQTVGLVHLSDFRKRR
                     AEVLEQKEREAHDKSLGRFTSGNSRSATPSGGDVTDSASTRSDGPPKKKKKKKPLAKS
                     KLSFGDDEEEGDNTGEDSAASIPRSASRTPVDNSSLPPSRRITPNPNAPPPPKAMTKA
                     ALKAEAEARDALRKEFLAMQEAVKNTEILIPFIFYDGTNIPAGTVKVKKGDPVWLFLD
                     RCRKVGAELGVGGNSGASKGRKDNRREWARVSVDDLMLVKGNVIVPHHYELYYFIANR
                     VPSFSSAGGLLFDYSNKPPETAPTNDDPLLGSNTDQLEGADKDPASTKVVDRRWYERN
                     KHIYPASLWREYEPGPEFEEKMRTTRRDASGNTFFF"
     exon            510032..510273
                     /number=1
     exon            510325..510877
                     /number=2
     exon            510935..511252
                     /number=3
     CDS             join(511575..511639,511691..512140,512147..512612)
                     /codon_start=1
                     /locus_tag="AO090023000204"
                     /note="predicted protein"
                     /old_locus_tag="AO070264000044"
                     /protein_id="BAE58777.1"
                     /transl_table=1
                     /translation="MSVEGTSGCYDLFVRRTPPLELHIFCPTCASTLGLSSATNGERH
                     CPACQTILVNPDDVVITALNPTEDYKTSVLSGLDPNTIMECAGRALLFWTYQTTQEMC
                     VVLAAARHYCVLTANSYYQEFLAKTLTDRYTGLNTQMDKVIHNANTEISTLQTRLSGS
                     CRPTHLPELSPEPDMQATHEQLQKKNQELVDLYREKCKKFSQITNLYNLLKSRAMRSH
                     MQTAASDSVSQALNSLGASRNDPSASASNRPLGPLMPMQTPSHRQKNIFPVDQEGVEQ
                     LHRYQRSGTGSSKGTKKRTDTSAMPPPSLPGNPRHREYVIVALMHCLIFM"
     exon            511575..511639
                     /number=1
     exon            511691..512140
                     /number=2
     exon            512147..512612
                     /number=3
     CDS             complement(join(514253..515266,515325..515765))
                     /codon_start=1
                     /locus_tag="AO090023000205"
                     /note="ATP-citrate lyase"
                     /old_locus_tag="AO070264000043"
                     /protein_id="BAE58778.1"
                     /transl_table=1
                     /translation="MSAKSILEADGKAILNYHLTRAPVIKPTPLPPSSTHNPPARLAS
                     LYFPEDRAVKDVLDQAEVTYPWLLASGAKFVAKPDQLIKRRGKSGLLALNKTWAEARE
                     WIEARAAKDVQVETVTGVLRQFLVEPFVPHPQETEYYINIHSVREGDWILFTHEGGVD
                     VGDVDAKAEKLLIPVNLKNYPSNEEIAATLLKKVPSGVHNVLVDFISRLYAVYVDCQF
                     TYLEINPLVVIPNADATSAEVHFLDLAAKLDQTAEFECGTKWAIARSPANLGIAVAPQ
                     EGKVNIDAGPPMEFPAPFGREMSKEEKFIAELDAKTGASLKLTVLNPKGRVWTLVAGG
                     GASVVYADAIASAGFVSELANYGEYSGAPTETQTYNYAHTVLDLMLRAPIHPDGKVLF
                     IGGGIANFTNVASTFKGVIRALREVAPVLNEHKVQIWVRRAGPNYQEGLRNIKSVGEE
                     LGLNMHVYGPEMHVSGIVPLALLGKKSDVKEFSA"
     exon            complement(514253..515266)
                     /number=1
     exon            complement(515325..515765)
                     /number=2
     CDS             join(518376..518515,518570..518876,518927..520022,
                     520087..520514)
                     /codon_start=1
                     /locus_tag="AO090023000206"
                     /note="ATP-citrate lyase"
                     /old_locus_tag="AO070264000042"
                     /protein_id="BAE58779.1"
                     /transl_table=1
                     /translation="MSSTAPLVNTANGGSANDNITRFAPPSRVLSPLNHALFHNKTRC
                     FVYGMQPKAVQGMLDFDFICKRSTPSVAGIIYTFGGQFVSKMYWGTSETLLPVYQDVS
                     KAMAKHPDVDTVVNFASSRSVYSSTMELMNCPQIKSIAIIAEGVPERRAREILVTAKE
                     KGITIIGPATVGGIKPGAFKIGNTGGMMDNIVASKLYRKGSVGYVSKSGGMSNELNNI
                     VSQNTDGVYEGVAIGGDRYPGTTFIDHLLRYQNEPECKILVLLGEVGGVEEYRVIEAV
                     KNGTITKPIVAWAIGTCASMFKTEVQFGHAGASANSDLETAVAKNKAMREAGIHVPET
                     FEDMPGVLKQVYDQEVSKGNIQPQPEPVPPKIPIDYSWAQELGLVRKPAAFISTISDD
                     RGQELLYAGMPISDVFREDIGIGGVMSLLWFRRRLPAYASKFLEMVLMLTADHGPAVS
                     GAMNTIITTRAGKDLISALVSGLLTIGSRFGGALDGAAEEFTKAFDKGLSPRDFVDTM
                     RKENKLIPGIGHRVKSRNNPDLRVELVKEFAKKHFPSTKLLDYAIAVETVTTSKKDNL
                     ILNVDGCVAVCFVDLMRNSGAFSPEEVEDYMKMGVLNGLFVLGRSIGLIAHYLDQKRL
                     RTGLYRHPWDDITYLLPALQKGGSEGRVEVNI"
     exon            518376..518515
                     /number=1
     exon            518570..518876
                     /number=2
     exon            518927..520022
                     /number=3
     exon            520087..520514
                     /number=4
     CDS             complement(join(520680..520769,522335..522982,
                     523048..523148,523209..523497))
                     /codon_start=1
                     /locus_tag="AO090023000207"
                     /note="predicted GTPase"
                     /old_locus_tag="AO070264000041"
                     /protein_id="BAE58780.1"
                     /transl_table=1
                     /translation="MPFAQLVIGPPGAGKSTYCNGMHQFLGAIGRKCSIVNLDPANDK
                     TSYPCALDVRDLVTLEEVMSEDHLGPNGGILYALEELEENFDWLEEGMKELGDDYVLF
                     DCPGQVEIFTHHSSLRNIFFKLQKMGYRLIVIHLIDSYNLTLPSMYISALILSLRAML
                     QMDLPHLNVLTKIDNLSNYAPLPFNLDYYTEVQDLSYLLPHLEAESSRLSHDKFGALN
                     QAIIDLVEDFGLVAFETLAVEDKKSMMSLLHVIDRASGYVFGPAEGANDTVWQVAVRD
                     GLGTMDVRDVQERWLDAKDEHDELERQQLEAEAKARDEAAGPTKPSAGYEDDDEYDDL
                     GRGFIPDGGVKVVLPFLPLHRIHQPYQLVMPHVRTTDCEVK"
     exon            complement(520680..520769)
                     /number=1
     exon            complement(522335..522982)
                     /number=2
     exon            complement(523048..523148)
                     /number=3
     exon            complement(523209..523497)
                     /number=4
     CDS             join(523724..523733,523787..524042,524122..524920)
                     /codon_start=1
                     /locus_tag="AO090023000208"
                     /note="mitotic spindle checkpoint protein BUB3, WD repeat
                     superfamily"
                     /old_locus_tag="AO070264000040"
                     /protein_id="BAE58781.1"
                     /transl_table=1
                     /translation="MASNQFIVASPPTDAISALKFSPDPNSTRIVVSSWDKNVYLYEL
                     RDENGNVGEGKLLQKFEHRAPVLDVCFGATEDEIYTAGLDWDVRKIDIATSTQTVLSS
                     HEAGVRSVVYSKEHQLVISASWDSTLHVHRIDAPDSIPSIIPLPSKPFSVSLTATKLV
                     VAMASRALHIYDLKALSLLTAQLDGTVPNKVEVEPWQRRESSLKFMTRCVACMPDDAG
                     YASSSIEGRVAVEWFDPSPESQARKYAFKCHRQTADDVDVVYPVNTLAFHPVHGTFAS
                     GGGDGVVALWDGIAKRRIRQYQKYQSSVAAVDFSGNGKYLAIAVSPGFEDGKDDVVEG
                     TVKIYVRELGETEAKGKGAK"
     exon            523724..523733
                     /number=1
     exon            523787..524042
                     /number=2
     exon            524122..524920
                     /number=3
     CDS             complement(join(525088..525545,525607..525985))
                     /codon_start=1
                     /locus_tag="AO090023000209"
                     /note="ribose 5-phosphate isomerase"
                     /old_locus_tag="AO070264000039"
                     /protein_id="BAE58782.1"
                     /transl_table=1
                     /translation="MADLIESAKRAAGQAAVKNHYPKDAKYVGIGSGSTIVYVVEAIK
                     ESGVDTSQTKYVPTGYLSKQLIVSNGLTAVDFDSLPEGTVLDIAFDGADEVDDDLNLI
                     KGGGACLFQEKIVALQAKEFVCVADSRKLQSRLLSNWKYIPIEVAPIAASRVLGELRE
                     LGSISPALRLNTTAPEGAPKPTPLKTDQAFNIIDAPFKSLLTKADIAAGQDGTGKDGV
                     WEVEALSRAIKQIPGVLDVGIFSGETGPQAQARGGTGGQKPIAAYFGMPDGSVSVRKA
                     SA"
     exon            complement(525088..525545)
                     /number=1
     exon            complement(525607..525985)
                     /number=2
     CDS             join(528258..528647,528691..529992)
                     /codon_start=1
                     /locus_tag="AO090023000210"
                     /note="NEDD8-activating complex, APP-BP1/UBA5 component"
                     /old_locus_tag="AO070264000038"
                     /protein_id="BAE58783.1"
                     /transl_table=1
                     /translation="MTDAFPSALTGPSSKERKYDRQLRLWAASGQKALEESRVLLVNS
                     DGPWSNQSTGVSGVVGVETLKNLVLPGIGGFTIVDPATVTEADLGVNFFLEEQSLGKP
                     RAAETCRLLKELNPDVEGSFQSKVWDSGSITELLRQDPGFLAQHRLVLVSGPMKRPSL
                     DALCKAASELNIPVLYTRSVGFYSSFSLQLPPLFPIVETHPDPETTQDLRLLNPWPEL
                     AEAASRIDDLETLDDHQHGHVPYLLLLLHYLEKWKEAHNGNVPSNYKEKSEFREMVRS
                     SARTCNPEGGEENYDEAVAAVLKSLNPFSLRSSTREIFEMEECKNPRADSADFWIIAS
                     AVREFFQQHNVLPLPGSLPDMKAQSADYVSLQNIYKSKAKKDVEEVTNIVRRIESQIG
                     SRSGDIPEKDIEIFCKNAAHIKVIRGRSIPEIDGEAQTLKAIRNSISIPDSLIPVFIA
                     FQALDNVVTDLQERRIPSGSIDDEVAWGAQIDRVLSALTADDQSTIDEDARERISEAI
                     QELRRTEGGELHNISSLTGGLVAQEALKVITRQYVPLDNTCIFDGVRSRSEMYTL"
     exon            528258..528647
                     /number=1
     exon            528691..529992
                     /number=2
     CDS             complement(join(531153..531233,531375..531805,
                     531957..532023,532118..532279,532360..532548))
                     /codon_start=1
                     /locus_tag="AO090023000212"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070264000036"
                     /protein_id="BAE58784.1"
                     /transl_table=1
                     /translation="MATTKNSVVIEQRPSNDESSRATRSRVWDNPILSKLCKSRERLV
                     VLKIDFLLLTWAFVSGLTKDMDQSATTQAYVSGMKESLSLYGNELVEFTTFFSIGYAI
                     AIVPSQLTQTKIRPSHICRKECKDCICTEILFGGFRVHTPEELGTRLAIFGVSGTAGN
                     MFLGILQAALYKNLDGAGGLQGWQWLFIVTGCITMAWGMLGLFIIPDSPSITRALWLT
                     KTERKIAVDRMASYGIKTNELVNRQVVLKKIRALLKSPLSWLYIAAYLQYAWSQRCNS
                     YFLLYLKHLHCQPHPLGRIRNLNRHQCRSQLSE"
     exon            complement(531153..531233)
                     /number=1
     exon            complement(531375..531805)
                     /number=2
     exon            complement(531957..532023)
                     /number=3
     exon            complement(532118..532279)
                     /number=4
     exon            complement(532360..532548)
                     /number=5
     CDS             join(533233..533508,533594..533668,533733..533800,
                     533854..534436)
                     /codon_start=1
                     /locus_tag="AO090023000213"
                     /note="probable taurine catabolism dioxygenase"
                     /old_locus_tag="AO070264000035"
                     /protein_id="BAE58785.1"
                     /transl_table=1
                     /translation="MPNDASAPLYPAYLPVRPEGFTPTLKVPLQDIPEAGCRADPSLP
                     EIYTKDSQLKSITPRIGTEIRGVQLSQLSTDGLDQLALLAAQRGVLVFRDQDFADIGT
                     GRQRDIAAHYGPLHQHPTMGYPQGTSPEFQVVYADEKVGNLRTLLGTRTSYDLWHIDQ
                     TFTPNTPGVTFFWVLETPASGGGDTAFTSLTAAYQALSPTFREGLHRLKLLHTSASVG
                     EVARIGQERALKDAVQTEHPLVIGHPVTHDPVLFVNPAIARQVVGYKPEESENLLSFL
                     HNHIRSLDFSCRVSWEKGTVVVWDQVCLVSSCFSLKTMLTCASESSCTLSCARLRGW"
     exon            533233..533508
                     /number=1
     exon            533594..533668
                     /number=2
     exon            533733..533800
                     /number=3
     exon            533854..534436
                     /number=4
     CDS             join(535697..536393,536454..536590,536657..538492)
                     /codon_start=1
                     /locus_tag="AO090023000214"
                     /note="predicted protein"
                     /old_locus_tag="AO070264000034"
                     /protein_id="BAE58786.1"
                     /transl_table=1
                     /translation="MVKTENYRSNQGVFFRKNFPEPFMEAIVWALLNYMRSTDGSSIL
                     GKRPCSEESKEEPLFCVDLEADEQDSDQPSVGEPEPIDITIEKWREEMIHPRERIILT
                     RYSPNFNPQEKYWQFQLISEALKKAEMASVDGQIENLGDLSTEQNIAWEPTLGHSVDG
                     LDPSVNSQIDHFDPMKIAATADLEASIAAEIDASDFESSMLIIPTEESLERFEKHRKI
                     LDNLEYQINNHEEAFALKFWQPVAVARLLDIRSNTKVRGAILGDSVGLGKTWVAIAVM
                     LKIWEDYNQSVKKAIGEGNEPPPGKPFLVVMPPSLIMQWCAEITRVTDKLQVVLYYGS
                     KTSKEGIRPVKTILHKEHELFDGSPANGRKVVITSYQTFSNRHGSAAAKAWCRRTHQV
                     YMEDIPTPPNGFPHLLDGCFSDVIVDEGHTLRNSDTSQSRAVHWLKASFYLLLTATPI
                     YNSREDVRGYIPLLFRPPSQGDMHMLKELGGDIFKLPPEDPARNVCCTKMAVEEYILD
                     NNVPPMVAGERLRVIFGQIMVRRTLSSRMESFGSRMIGSDIPPTHRRVCTTVYSRKEH
                     DMYTRLSAIHYDGLFMEDPRDPTKIVWNMAKLRKLCLLTSWLGFDHLEHALHAPKIPK
                     ACKDLKQGTLGAVFARTIVEEMKPQFQESIYQSIETIVETRRTWVLEFLLKGSPKMRA
                     MLPVLRDQVIVHGEKAMVWTQFPAEQIYVAAILKEANIDAEVFHAGLTRDERMNLVER
                     FTQKHDECMVLICAYNVNAAGMNLQNLCRNVHILTMGLSKSVVNQAIGRVSRLGQERM
                     TFVYEYRLRSSFDEDLVSRSERKALPGLVADLGEGFSFPSISEGEEGLTNRWVLRAGE
                     LYQLAPGELIRKEDITESRPILEELMRSMEDTI"
     exon            535697..536393
                     /number=1
     exon            536454..536590
                     /number=2
     exon            536657..538492
                     /number=3
     CDS             join(539142..539549,539606..542041)
                     /codon_start=1
                     /locus_tag="AO090023000215"
                     /note="predicted protein"
                     /old_locus_tag="AO070264000033"
                     /protein_id="BAE58787.1"
                     /transl_table=1
                     /translation="MSVLQGTMNVPMTTSTAQALNTTIPAAATSALSSSARELLAAPF
                     RRFSALSSHVNRLVGLPSMATYLRGSELAGPAGGAVVEATQTAAEAAREGVVEAAAQA
                     DSSYHLTDIFQAVIKFSGFFSYLTSRWSLACFTVALVLNRITIYASTRRHLHLDWSRR
                     LALRIIPILLFISQIHSLLRTIRCQTSTEYSLIRYGTPGKRLLFDHAGGGGFLYSLGS
                     TLLPWETDEQSCSAMNMGRPASSSDISYGSFVLLWPVFLRLCLSHFVETLSCALQGRA
                     VVTEAGMSIFEHSLAFAEAESTISQTLGLGLFGLPKQSASKDDLGESAQSTLHLLSRT
                     QVLERMNVTPELLLIALISCCNSLTSNVLDVFGKQSRYRLFNTAFWGLCFMSTMAWGL
                     VKGSSVGSENVVLKFPTVCIVGFVPHLLILSGIITCAVIYMLALLITAFSLPVDTPQP
                     LSLRERFTLAHENMQGATQFHNIRFNRHEDFYTTLLRIGYTALTAASEAVFLNEGKGV
                     VARSMTWLEEDRLAEIESSRQRRSLRDPVSHTSDIPFGGGESVDFDIPEAPSDWESGY
                     GREKKIEKPKNGSRSLRTQTDPGGVGAFRGMVRWYHGFAFFRGIFYLLLRWTAYGLDK
                     LLSKIGISARPQWLKTIVRSRKSRPQELKNKQTESLDFWILTDTGELVLPADHEFDVE
                     TEMRKRERSGATLWEQSDEQRLDDKLYGWWKAGGSWGDRDLSSDYSPPENDIDDTTSV
                     VSMSTTADSEWEDESDGRRTPTRDNPFPSGFSRESTTVQESMVDISSFARLLDPRDQE
                     SRQEARILAAHLAAGQEGRILTRRRFQQQIEHERAQVLLSSRLSQEIRSEKRKPTMEE
                     ESEILEKLILSRRSSASVRADEQSWESGASGLGPSGPPCVICQTNPRSVITWPCRCLC
                     VCEECRVSLAMNNFGSCVTCRQDVGGFVRLWVP"
     exon            539142..539549
                     /number=1
     exon            539606..542041
                     /number=2
     CDS             complement(join(542520..542812,542988..543126,
                     543182..543262))
                     /codon_start=1
                     /locus_tag="AO090023000216"
                     /note="predicted protein"
                     /old_locus_tag="AO070264000032"
                     /protein_id="BAE58788.1"
                     /transl_table=1
                     /translation="MQLIHHMIILFASLAAAQTLPNIPPCAASCLVNALQGDGCPSLT
                     DFACHCQKPELVPKVSPCVAQACPLAEQSCTGTRASPTGSMTIPTVSSHASSSPKPSS
                     SALSSSHVSSSPGASTHTGGAGGGAGGASSSGRASSSATPPLKTNGAAQVTGGLAGVA
                     IAAVAAYYHL"
     exon            complement(542520..542812)
                     /number=1
     exon            complement(542988..543126)
                     /number=2
     exon            complement(543182..543262)
                     /number=3
     CDS             complement(join(544690..544833,544919..544986,
                     545061..545424))
                     /codon_start=1
                     /locus_tag="AO090023000217"
                     /note="predicted protein"
                     /old_locus_tag="AO070264000031"
                     /protein_id="BAE58789.1"
                     /transl_table=1
                     /translation="MPPTRRRGGRATATRSNQATLSFGSKSRVTKPSATPTQTQKTKD
                     LEPVIASISEKVPEPEQVSVTPTEPSQPHVAELAVRQQAQAEIEQPLSKEDEKAIKIT
                     EKDLQQYWRKEEEKRRGPRFHQQDLTLHEKILRHFDLSSQFGPCIGIARLKRWRRANS
                     LNLNPPIEVLAVLLKHKDDIKQRAYVDELLS"
     exon            complement(544690..544833)
                     /number=1
     exon            complement(544919..544986)
                     /number=2
     exon            complement(545061..545424)
                     /number=3
     CDS             join(547233..547310,547372..548256,548320..548562)
                     /codon_start=1
                     /locus_tag="AO090023000218"
                     /note="predicted protein"
                     /old_locus_tag="AO070264000030"
                     /protein_id="BAE58790.1"
                     /transl_table=1
                     /translation="MAAFVRVSGPPNGNFLIGYPGISATMPRIEGKVEIRPSVGITAP
                     VNISLVTIYLQRRETIHPSADSVTKKHLAPPRKETTDLVGKEMLLFRCPAGREYEEVI
                     SMDLPFVLFIPFGRGGQDASRRVPPASLQLPSRTAETYYEIVVTVQQGHSDQRKHMFP
                     VPIARYDTLSTFGMYNRPEAAERVSDHLVTLGISLPRWSYGPLDPVSVYVKLSPNPDW
                     MSKARKVTISKITIGIDEEIIYNHQGDEPQRKVKTLTKRTEHIGMKLPPSGFLTNLGL
                     VFPAKDMRDAEGILPRGKPAFPMYAVSGFTTTASLYKIEYYLTVKAHLTSARDIVIRQ
                     PIVVCPLDHAGCKEEMEAIEQAARDAVHVNPDNPMLPLPSIIRPSDPNALRHLGVAIV
                     GNQKKPLID"
     exon            547233..547310
                     /number=1
     exon            547372..548256
                     /number=2
     exon            548320..548562
                     /number=3
     CDS             join(549876..549991,550057..550844,550899..551359)
                     /codon_start=1
                     /locus_tag="AO090023000219"
                     /note="predicted tRNA-splicing endonuclease subunit"
                     /old_locus_tag="AO070264000029"
                     /protein_id="BAE58791.1"
                     /transl_table=1
                     /translation="MADTDEAAIHLPSHDSAAHIDTDLSDETQDFRMLSNLSFLADTS
                     QATLPKRGEKDFEPNPTLYQADILDASRQAMHNALAHPRLHNPKNQIIGIYAPDGPAP
                     PRSVATPKTLDTIAENDTPAQTAEAEESQSKKPAGTGTNVHPDSCVYVTNPKGQFFKN
                     MGRADRWGRIWLLPEEALYMLERGSLDVRWPRSATGCEDDGETEDSGIPMSLQAAYAC
                     FIGHGGLMVDRFSVYSGLRRLGYTLIRAPGWYDEAEEEFEDPESTKRQGPGLAGIYGR
                     FMDWLHSSTTTAVGPVAGLGIHRNYNDIYRKLSIIPFYDPTAPLPQNPQTKPPFRVVF
                     HVYKPSTPFRKSAPPAPDFRVAVVNARTHTTVPTLAQLGTLLESTPLDPPKGEKMERN
                     LYMRLRHGYRNVVLAVVDQGVVSYLRVADAAFGKEKLYNRPAPSGNKRGANPRNPRPK
                     PKGR"
     exon            549876..549991
                     /number=1
     exon            550057..550844
                     /number=2
     exon            550899..551359
                     /number=3
     CDS             complement(join(551962..552149,552254..552377))
                     /codon_start=1
                     /locus_tag="AO090023000220"
                     /note="predicted protein"
                     /old_locus_tag="AO070264000028"
                     /protein_id="BAE58792.1"
                     /transl_table=1
                     /translation="MASSATDSEFVTLVSGDGFEFVLPRSAACVSGTIRRMLEPSSKF
                     AEALTGRCILENISGIVLEKVCEYFCYNEKNKNQSNVPDMEIPPELCLELLMAADYLD
                     T"
     exon            complement(551962..552149)
                     /number=1
     exon            complement(552254..552377)
                     /number=2
     CDS             join(552838..553278,553370..553912)
                     /codon_start=1
                     /locus_tag="AO090023000221"
                     /note="dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /old_locus_tag="AO070264000027"
                     /protein_id="BAE58793.1"
                     /transl_table=1
                     /translation="MSISHLPYPRPQYTRRILNTALSTAYNAPPRSQRRPLSSQTPST
                     SARLTGRTCMITGGTSGIGFAIANRFLQEGAERIILVGRSYERLLKAATRLQVNDEGA
                     RNQEAADETVRKSQGTLVESSDRISLLVGDVSEAGSWLRELEKAMQPVDILINAAGIS
                     NSNILPKTSPEEVSQTLRTNLEGAIFTSRALLRASLRNRLKGRTGETRPPSKCIINIS
                     SLLALKGGTGAVSYAASKAGLLGLTRSLTVEATGSLRNVVVRSNAIVPGYIETPMIAD
                     FSEGQNERLKESIPLGRFGAPEEIADAAVFLAGNEYANNCVINLDGGLSAV"
     exon            552838..553278
                     /number=1
     exon            553370..553912
                     /number=2
     CDS             complement(join(554313..554586,554655..554998,
                     555054..555166,555224..555399,555456..555735,
                     555794..555858,555911..556035,556100..556336,
                     556477..556647,557302..557436))
                     /codon_start=1
                     /locus_tag="AO090023000222"
                     /note="SMT3/SUMO-activating complex, catalytic component
                     UBA2"
                     /old_locus_tag="AO070264000026"
                     /protein_id="BAE58794.1"
                     /transl_table=1
                     /translation="MVRSVSEHESRLSCEWTNLLYNACLYTVLPPQIPSNVLFPSREA
                     TSRVLLVGAGGIGCELLKNLLLSGFGEIHIIDLDTIDLSNLNRQFLFRFEHIKKSKAL
                     VAKEVAQKFQPSAKLEAYHANIKDSRFNVDWFATFDVVFNALDNLDARRHVNRMCLAA
                     DVPLIESGTTGFNGQVQVIKKGQTECYDCNSKEVSKSFPVCTIRSTPSQPIHCIVWAK
                     SYLFPELFGTSEDETPELDSTEDVNNAEEIANLRKEAQALKEIRESMGSPEFAHKVFT
                     KVFKEDIDRLRGMEDMWKMRKAPEPLDFEKIQEETSTIEPTISCNDQKVWTLAEDLVV
                     FKDSLDRLSKRLKTLLDTTKSDVKPILVFDKDDVDTLDFVTASANLRATIFGIEPKSK
                     FDTKQMAGNIIPAIATTNAMTAGLCVLQAFKVLKDDYAHAKMIFLERSGARAINSDSL
                     KPPNPNCPVCSVAQARVKIDPERATINDLVQDVLRLQLGYGEELSVSNELGTIYDPDL
                     EDNLTKKLSELGVSNESLITIIDEEDEQPRVNLELVVVTEKPESSTGEQKPITLVKVP
                     EIPRKPRAPTPTVGEHVNGSSDPNKRKRNAEEAGLTNGEDRSKRVASMSVADGDGSNP
                     IVLDETEGGAILIDD"
     exon            complement(554313..554586)
                     /number=1
     exon            complement(554655..554998)
                     /number=2
     exon            complement(555054..555166)
                     /number=3
     exon            complement(555224..555399)
                     /number=4
     exon            complement(555456..555735)
                     /number=5
     exon            complement(555794..555858)
                     /number=6
     exon            complement(555911..556035)
                     /number=7
     exon            complement(556100..556336)
                     /number=8
     exon            complement(556477..556647)
                     /number=9
     exon            complement(557302..557436)
                     /number=10
     CDS             join(558567..558984,559057..559211,559274..559505,
                     559588..560033)
                     /codon_start=1
                     /locus_tag="AO090023000223"
                     /note="cobyrinic acid a,c-diamide synthase"
                     /old_locus_tag="AO070264000025"
                     /protein_id="BAE58795.1"
                     /transl_table=1
                     /translation="MSDDEADPELLALLRKSLGLGGGAANPRAAETKVLENAQYVFDN
                     AIDVALNPSKTKEAAETIWRLMQKKEYSTQTWSEHELHPKAKDESTVDFIFAMDLLNF
                     SFWSERPEEKRFAIEYRGKKWTGYWSLVAALQRALDEEIPITSPYFWVNEDECSESML
                     KHVFRSVSDEEIPLLQERLQCLREAGRVLCEDFDGSFVNCIYNANYSAASLVNLMAES
                     FPCFRDETSFQGRRVRLYKRAQILVADLWACFNGEGLGEFHDIDKITMFADYRIPQIL
                     NHLGCLMYSPPLESHIRDLKPIPSGSTWEVELRATSIWCVELIRREIVKNHPDAKPII
                     KPTQPNGHAVGVDRRQSLTTSALDEQRKCTTQKHITQISPAKPASSGVNAILIDFFLY
                     DSMKELEKDGKEQVPHHRTRSIWY"
     exon            558567..558984
                     /number=1
     exon            559057..559211
                     /number=2
     exon            559274..559505
                     /number=3
     exon            559588..560033
                     /number=4
     CDS             join(560902..561278,561341..561539)
                     /codon_start=1
                     /locus_tag="AO090023000224"
                     /note="predicted protein"
                     /old_locus_tag="AO070264000024"
                     /protein_id="BAE58796.1"
                     /transl_table=1
                     /translation="MYRNLILLLATYLVTLAASQTITPENTLTNPDPGAVLPRSGFQI
                     LPKRAPPKKTPPKVSPLQQECKDIKIKEGPSVSKGHSAQQLLTASCNVPGTNKKQYSE
                     LSLDRCLGWHKNNDGSGRLVAQKHGAGLSKAGGECSTCRYLNSNPNMLCYCAKVRDNE
                     KTYMNPVTATWTGPVFYNLCKCSMSHIWTVF"
     exon            560902..561278
                     /number=1
     exon            561341..561539
                     /number=2
     CDS             complement(join(561944..563126,563207..563391))
                     /codon_start=1
                     /locus_tag="AO090023000225"
                     /note="predicted protein"
                     /old_locus_tag="AO070264000023"
                     /protein_id="BAE58797.1"
                     /transl_table=1
                     /translation="MNNRPVEQALGILLPTHADDLPQELRSLALSLVAQSRSFSTSLR
                     PEEEIARPYACAEIACRRLTRALKLPPLMGHPPCPPRAYKKLYAFLDRSLSNSVAGVK
                     RAGSNSISETPSRTGSASSTPAKNTKRTRTPPKTATTPHKLQNTANKPTPLKKAITHE
                     GSGSRSETPQKSKVRTNGLPGSTIIPDAPAWVMTSIRSVCKTLSTPAPRTSTWSRPPI
                     SRTLPPHIFAGVSSILYFISRISAKDDDDFDEETLEFVEPILIVKDKENDEDYKEVVN
                     ALVVAVYFLALARRRSSLSEGEGETKKLDKKTFSEMRQTALVSIGLPSTERRHREDVD
                     QWIALIMQQHWANGKEWFENIPQAGELDGDDAYLSDEDGFGEDGERAKSAKRQKTTKS
                     GRSLAKHSSRKGLLPGLGTMMQDRVDWLSDDRKEDYLEWKAAVLARIEQIQKSAAQHI
                     GALPV"
     exon            complement(561944..563126)
                     /number=1
     exon            complement(563207..563391)
                     /number=2
     CDS             join(563633..563644,563716..563781,563869..564432)
                     /codon_start=1
                     /locus_tag="AO090023000226"
                     /note="similar to cyclophilin-type peptidyl-prolyl
                     cis-trans isomerase"
                     /old_locus_tag="AO070264000022"
                     /protein_id="BAE58798.1"
                     /transl_table=1
                     /translation="MSVTLHTTQGDLKVELFCEAVPKTVENFLALCACGAYNNTPFHR
                     LIPGFMIQGGDISLGPAAHQSQESTKPMLPFDDIPKGGTSINHPGALNQEIHLPALRH
                     NTRGILSMAARPVKDRTAPGSQGAMGATINGSQFFITFAPAPHLDGNSTVFGKVLNLT
                     AQDEGGDVLTKLEKANVKVDKKGRVVQPKEGEESEYEALRINRVTIHANPLAK"
     exon            563633..563644
                     /number=1
     exon            563716..563781
                     /number=2
     exon            563869..564432
                     /number=3
     CDS             complement(join(565195..566463,566520..566657))
                     /codon_start=1
                     /locus_tag="AO090023000227"
                     /note="C4-type Zn-finger protein"
                     /old_locus_tag="AO070264000021"
                     /protein_id="BAE58799.1"
                     /transl_table=1
                     /translation="MSVEDKPVQQEAPVESQFQKPGDLVERDEDTGVMSLESLCMNCH
                     ENGTTRLLLLRVPYFRDIILESFECPHCHFKDNSVKSAGQIQEKGAKYTLTVQGENDL
                     QRQVVRSDTSIFKVESLGIEMPKGESQFTTVEGVIQKIYESLSSEQPLRKAQAPELHD
                     ALVPIIENLQKILNRDGFPFTVSLDDPTGNSWIAPTINDTGNNYKRRDYPRTHEQNEE
                     LGISADPNAVEHEASGEWEDSEIVDGQVYSLPTECPGCTKPGFVNMKKVNIPYFKEVI
                     IWSTSCEHCGYRTSEVKTGGEVPEKGKRITLRVENEVDLSRDILKSDTCALHSEELEV
                     TVQPGTLGGRFTTVEGLLTEIRDQLHGQIFDVDDASGAGGDSMASDTKEKWTRFFSRL
                     DAAINGDMKFVITLEDPMANSYVQDLCAPAVDHQITTEEYTRTEEEEEELGLKDMKLE
                     GYEEDTEKKEEDNTEQKS"
     exon            complement(565195..566463)
                     /number=1
     exon            complement(566520..566657)
                     /number=2
     CDS             complement(join(569666..570088,570135..570473,
                     570529..572883))
                     /codon_start=1
                     /locus_tag="AO090023000228"
                     /note="TATA-binding protein-interacting protein"
                     /old_locus_tag="AO070264000020"
                     /protein_id="BAE58800.1"
                     /transl_table=1
                     /translation="MSSFSQDDEHDPQADELRETALVTLEALISSCGQRMQPYLQNTI
                     KSALRFLKYDPNVAEMEEDEEMGGTQDDGSEDDGTEEPDLDDDEFEDFEEEGGYSDVD
                     DMSWKVRRCAAKLLFTVISTYGRGRALDESSLYQQIAPALIARFSKEREESVKLEVVS
                     TMTALVRKTGEDVMIITSNGFLESVGGSKNSRKRRRQDSDASMIDFEPSIGTSSAAGT
                     PVIAPSSPKSGPQADLARSVPLVVQSLVKMWKQASVPLKQAIIVLLKNLALVRYGGLA
                     DYLQQIEDPIADVLKSSSPAGTSSTAAGATASAGTLQIETLSLIAAVAETHTSDALLP
                     FLIALIPGVIGAVNDRNYKVSSEALGAVEQIVKALTPPRVSASSQDLASQLEKLYDVV
                     HSRITDTSADLEVRQRAIHVFGVLLARTSGEKGSAFISLDRRPKGLAVLVDRLKNETT
                     RLAAVRAVDDVAVLCDRKTDVTAAWVGEVTTELGAQLRKSDRVLRGASLEALRSLAMN
                     SKTRVHYDGKTMKELEDCLLPLINAEDFHFLAPALIILAKLIPGNAELLVNEALVSAL
                     CSIVLSSLVGTVLKALLLLVKVVGEEGAGAVLMKKLLRDVGINGDTSVVGRAIGTLLV
                     HGGSKLGVKMDDFLKELQTAQDAQRKCLALAILGEIGLRMGHECSLTPELFITHFDSK
                     SDKVRLAAATALGNAAAGNVKTYLPTIMSGLEKPNHQSYLLLHSVKELLQHPEIVRPD
                     VAPSALKLWQALLNVSEEEDNRAVGAECVGRLALIDPVAYIPHFQECLSNSDPTIRGV
                     VISAFRYTLSDSRDTYNDVLRPLIVPLLVNMLSDRDLENHRLALTTLNSAIHNKMDII
                     LPHLNELLPAVFGDTQIKPELIREVQMGPFKHRVDDGLELRKKQSAYETLYASLDTTF
                     SLSHISEFFERILAGIDDEQDIRTICNLMTSKLINLAPEETQRSLDALSERYSVVLSF
                     KPKDNAVKQELEKAQEASMGVLKITRELSKAFPNAETSGEHHKWKAYMEWVRKTFSSQ
                     LKSLESEF"
     exon            complement(569666..570088)
                     /number=1
     exon            complement(570135..570473)
                     /number=2
     exon            complement(570529..572883)
                     /number=3
     CDS             complement(573162..573725)
                     /codon_start=1
                     /locus_tag="AO090023000229"
                     /note="predicted protein"
                     /old_locus_tag="AO070264000019"
                     /protein_id="BAE58801.1"
                     /transl_table=1
                     /translation="MPFSDHATRLGFLKDAASSLDSLSPSTAAHLMTVHNKIFYDESR
                     PLNQRQQEASCGACGSIRAPESTKTIHIKKKIIKRSSAASDGAIVYKCLRCRRRTVKP
                     SRKEPVRPNASSKMAAAIDSTPPTALTAVQQPDSTETKHTSKTADNASSKKRAKARKQ
                     GGLQALLASKQQSRASSSLDLFDFLQQ"
     exon            complement(573162..573725)
                     /number=1
     CDS             join(574170..574220,574308..574409,574460..575020,
                     575489..576550)
                     /codon_start=1
                     /locus_tag="AO090023000230"
                     /note="RNA lariat debranching enzyme"
                     /old_locus_tag="AO070264000018"
                     /protein_id="BAE58802.1"
                     /transl_table=1
                     /translation="MAPELNSASIRVAFEGCGHGCLHDIYASVEKAATLKGWDGVDLL
                     IIGGDFQAVRNSHDMACMSVPQKFKKLGDFHEYYSGKRTAPYLTIFIGGNHEAGNHLF
                     ELYYGGWVAPNIYYMGAANVIRCGPLRIAGMSGIWKAYDYRKPHFERLPYNRDEIQSI
                     YHIRELDVRKLLQIRTQVDLSLSHDWPKQIENYGDYNTLFRVKKGFRQDSQTGRLGNL
                     AAKFVLDRLRPAHWFSAHLHGVVPEVQHNLTWRRVDIGEDGVGRQVVGVERDACAETA
                     VNKKQKLQHETKPVKNSDEIDLDLDSDPGEDAAADTAPEVESRAMDQSTSAANINKSP
                     TDSIVKPAEGVEKDTGDISEEVRSQLPAGFARPPPQAYAVNGPLPESISNKTTHFLAL
                     DKCLPNREFLQLVEFSTISDLEGAQCERPYRLQYDKEWLAITRVFANDLQLGDATAKP
                     AADKGDTVYEPQIIEEEKWVEEHIVKPGKMGIPENFVPTAPPYDSAVPITTEEMPPEY
                     NNPQTAQFCELIGIENKFHLSDEEREARMAAGPRPVESRQNFSRYPRRDGGHGHGRGR
                     GGGRGGRGGGRPWGRGRGRGRAAPY"
     exon            574170..574220
                     /number=1
     exon            574308..574409
                     /number=2
     exon            574460..575020
                     /number=3
     exon            575489..576550
                     /number=4
     CDS             complement(join(576837..579639,579693..579868))
                     /codon_start=1
                     /locus_tag="AO090023000231"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070264000017"
                     /protein_id="BAE58803.1"
                     /transl_table=1
                     /translation="MSVLSDIICDERRSIQPVIRGRILSDIISAASDLASNAEHLSQD
                     KKQRYRDVVAKVVEETPSPVLLSTLSSFLQSDTAPWFKSIVSSQISRVPLRQDGVLQT
                     ILFLASQLAPSLGQESQDQTSNGPHFTVQAIMQSSRLLSSVPQGLDPVDYFSIIGPQL
                     LALIDGDDPDLRKTAAYVVGNGILCKRAYGAPGTIGHSIFLEPLFKTLTAGLDDSSRN
                     WMMSSSASGEDLPNRVLVPESLLVLAVDRLRSLVLQPPNPSLVKRVVYPILVPLWGLA
                     CGTSEQQRNSLHEKIMEVLQTYFAISVGEQPLKKLVDNLLWDGGSTWTYSVVPTHGLS
                     LIKRETAKSDRLNIVRLLDTLASRAKLFVGLLGADPSSEERTGDIFLYVSESWLVSTP
                     VNERSFNKPQLGLANEAESMERKLVSAKLAETLLDNFKDILSRRPLRVLELIKQIIDG
                     EFNRASTRKKRDGDLGTGKVSLSSLANIVPAEENTEQGNAEESDSTESLPAVFSLLST
                     VLASPEFSASEDTLPVLETLKSRLDQLIPYLPPSLAKPGTTSSMLLEIHMTSPTEQSQ
                     KRPYAEVSDFETHRRALTNLNSDLPPVQAEGFSLLSDLVKKSSPVLDIPSTLTLLLSI
                     ITDPSEAAANDEFIYLNAIKLIGTLASRHPRTVVKTLVDRYTDRNETTNLDQRLKIGE
                     SLLRTVQDLGQSLTGETAKVLGDGMIAVAGRRSQKPETQKRRKQQLEKEKRQKEREER
                     RNKEPAMPSGWKISSPSPAAKLQEDEEEGSESESPEQAAHSANIIAAWAAGASADDEP
                     DDLRARASALSILATAVQTNIAGLGPSVASSAVDLALATLTLEQEPESAILRRASVVL
                     LLDILKALDTTRETRGSQALGFGFSLADDSAGGMSWKDENASSRGPSTIGNIPHMLRT
                     LAFVESRETDTIVRGHIRVLIESLEAWVEKSLLWGIGAHGREGENEPRLELGDRIAGL
                     QIDPLAGRQESGRPRIEEIE"
     exon            complement(576837..579639)
                     /number=1
     exon            complement(579693..579868)
                     /number=2
     CDS             join(583170..583616,583665..584171,584216..584890)
                     /codon_start=1
                     /locus_tag="AO090023000232"
                     /note="predicted protein"
                     /old_locus_tag="AO070264000016"
                     /protein_id="BAE58804.1"
                     /transl_table=1
                     /translation="MGDAACTAFATRLRQFLTEDPNTAHVARTQYTPESSLLEGEAHW
                     PSLAQARLLVKIAFNQLSRVYHLFLRKSTLEQLESLYRLPNLRDDPALTCKFFSLFAL
                     GEVYSSRSISSPTSRVPGTRYYVRAMGIIPILPERPGMIHIESLLLLSLYSYFLNRRH
                     SAYTLIGSAMRLGLILGLNHNIPARQCTDPTEREHRVRLWWAIYIFDRMYTSKIGLPL
                     QIRDDDIYVDLPTAVNSPDAEEQFSDTAYLVYSIRLARIIGQIVEKIYTRKPHQESFL
                     QREQQLLLALQDWVQSLPAHIKLPAVETPQKHVVSLHLQFNQIKCVILATRPILLHAL
                     FQQRAHRENHEDTPQPVITLSEACIHAARHSHTLITEEWVNGSLPMYGYFYAQYLFSS
                     AIILVMSGLLPSIGTTADLEFLETAIEILRRMKYHGNLAAAEFYENLKRVKQCLPTGS
                     GSISIPHDGWGYTPEKSRLSVGGAANVDQILDPNSIATVPVAGLTTEMAFLEPTMQDF
                     LDRTNNEMDLINPGAFSIDESTGIDAWPTTFWTS"
     exon            583170..583616
                     /number=1
     exon            583665..584171
                     /number=2
     exon            584216..584890
                     /number=3
     CDS             complement(585544..586302)
                     /codon_start=1
                     /locus_tag="AO090023000233"
                     /note="predicted protein"
                     /old_locus_tag="AO070264000015"
                     /protein_id="BAE58805.1"
                     /transl_table=1
                     /translation="MINSDLFFPETKYQRPATTLGAKAVTIDVPTPTTNNEKHNANAS
                     IRAPNDTEVQVPDTNSQNGKGRPSKNQFKLFQKPDPRWKSFLIRDILSPIRACFYPII
                     FWAGLNVAGPANLLLFFNLTESAVLAAPPYNFSGAVGYSNFAFFVGGTIGLVTAGPFS
                     DWVADKATRRNRGIREAEMRLPALIPFFITTAIGNVIGGLGYQRQWSWPTMLVFGNGL
                     TGLSVPTVPTIAVAYAVDCYKPMAGEIYGRCYGC"
     exon            complement(585544..586302)
                     /number=1
     CDS             complement(join(588193..589351,589412..590201,
                     590712..591434,592698..593424))
                     /codon_start=1
                     /locus_tag="AO090023000234"
                     /note="protein phosphatase 1, regulatory subunit, and
                     related proteins"
                     /old_locus_tag="AO070264000014"
                     /protein_id="BAE58806.1"
                     /transl_table=1
                     /translation="MDARSPLRSVSNASTQSSQQGTVQVRPKKGKTKEGTPEWRRKLV
                     RGELPSGEQRDLFAPMGLEGVFKPPTPGSEKTQHEAIPRMKQRDDLWDFGDPSDKDPG
                     TSPQGSSQAQNIGESHAANTPNDVDRPLGPSTQLQSNANVSDSPEGSPNATLEMPKDP
                     EEPPSNLNDSSFVTQDDTQMRSATGLEDLRNEGITPITFSRTNTVEGNGTSEVIRSAL
                     KQVTSKLQKLSLPPYERPDSRASDKTRKGSITTQDFLNEATKIMDIIRSKGRNVGGLS
                     SVEESEAEDKNESESYEDESTREEFSRPPSREGVDMRKLREQQETNPRILSHLKKFQE
                     HDDLELGDNASVASLSFDNQQDSPFQVENDKEFVGQDDGAAINQTSDNMQPDDDIFEQ
                     RERKSSAPTSGEDDDLPDLLTFNTQISAKSLSARSVPTGSSQSSHAKGVLSSDIVSHL
                     IPEQVNGLTYDRHKHQWIRERPEVSLEKPKGEDKTQTAANHTYTSEHASSRHAISRID
                     ETNEEQGDSLSLVRRGNDAVSTPLKSHPENSLMCLRDMDHDTNYSFHLSPLPDFTVHQ
                     IDPSLQLELSYVAQRTHPRSLRQVHGTFALATEELVKHITEAEPFEPYWEHVRRLVLR
                     QKGLITLHKLCDFCPRLEDLDVSSNSIGQLSGVPPTLRTLRISHNCLSNLTAWGHLVN
                     LQYLDVSGNELESLDGFSSLIHLRELKAEDNNIRNIEGIFELDGLLSLKLRNNSLTTV
                     DFEDSELVRLEELDLSHNQLMSIQNIESLSALSNLDLSFNQLARVAPSAPMPYLSSLR
                     LSSNQLHSLDVTAFPSLTLLYLDHNYLFTVSGLEHCAGLDVFSAREQMNTGDHNGGFF
                     DVDLGLVKDVRKVFLSCNKLSLQCLSPSNPLSGLQLLDVASCSIQSLPADFALSFPNI
                     RVLNLNFNFLAGINELAGLNCLSRLTIASNCIVRLRRLCQVLSRIGRTNKNKVSTLQK
                     VDVRGNPLTVRFYPPAVTGSGRVGDTKNLKVEDEPSQRDQAGLDIQSVLAEFGHAENS
                     ERSIIHDQDEEPIAEKDIEINDPYTLPPADPQADQKYLSHLDEPTRLRRRVFELMLYA
                     GTGGSLKFLDGLQLRPTLEPGSDMDHAWNKLEKLGVLKRKAITG"
     exon            complement(588193..589351)
                     /number=1
     exon            complement(589412..590201)
                     /number=2
     exon            complement(590712..591434)
                     /number=3
     exon            complement(592698..593424)
                     /number=4
     CDS             595146..597245
                     /codon_start=1
                     /locus_tag="AO090023000235"
                     /note="predicted protein"
                     /old_locus_tag="AO070264000013"
                     /protein_id="BAE58807.1"
                     /transl_table=1
                     /translation="MPPRRPVSPLNLETCSPPTSDLCNDGLLGSDDELNDEERAAQRR
                     RIEKLAESYLQGKPLFILSASLRGRFDEDWVNPWKTNRRRAIPPGRSTIRPPKEPEIP
                     ASPVINETNSRRRRTYQEPQEIRDSRPPTVAPESDIHVSGRSRHASVRLDRSGDKRNR
                     RSISPNTPRRSIPWARPVDSTAQLQSLSTSRHTNETWLKKDRKQISFQNVDPPTSPTT
                     TLSSRYSIKSRASRDARMNSQSTSFEHKDGPYSERSTSSSPAQDGPDPEPLDVSRVPN
                     SIASSPAKEQRLPDLGRERTTSGAVSQGPSFCVLAPSSHLPQFEYRRKKPRVSNEAGS
                     SKSPIAGEPDAEEEPRAADFTKGTQRPEQDALSPQHMHSAHANRHGLSEADKDPRGIF
                     ISTSTTKAIGNISVSQSAKFRSISTVNKGNTSERLPSAQQVRANPTMTDITSLHSIAV
                     PRSNSEYDDDTIPDPQFSTQAALLHAQRSFQNDLDSPEHDIPSPDRQHASKSSDLSSP
                     IAKDITPFHRLSTPNRARGSSEVQAPMTAGQWQSTQCMIDAVTPFTFSTEKKPNRRTM
                     SPVKHLTGRKKLKTASFKLSSPPSSASSEAHYEQDNNYIHSSPVPRRSPGHETQHSVL
                     PMTLTGTTPPTAQEGQRGFPGADSFNLAEAIADAGSWLQQSFDLNRDLRLCETSKSAA
                     TSSAGTRRSAIGVDGKK"
     exon            595146..597245
                     /number=1
     CDS             complement(join(597587..598171,598228..598557))
                     /codon_start=1
                     /locus_tag="AO090023000236"
                     /note="predicted phosphoglycerate mutase"
                     /old_locus_tag="AO070264000012"
                     /protein_id="BAE58808.1"
                     /transl_table=1
                     /translation="MEHPKATPSHYKFKLMPEFFVNYHEIARQSPNSKVTTQPSLGLI
                     DQPYSETTNTQPDAEPKKPWERFAAYIRELNTENPDRVTYKVLYLTRHGLGVHNVFEA
                     KVGKEAWNSYWSHLDGDGTVSWVDAKLTEAGIQQAETLSQFWTDAVATENVPLPESLY
                     TSPLARCLETARLVFSKPMGQFREQFQPVVKELLRERLTDHTCDKRSTRTWIEGHYPS
                     YLIEPGFSEEDLLWKPDRWESVEKHVARKQKVLEEIFAQDSSSFISMTVHSYAISAIL
                     RACGYEEFRVREGSTIALLVRGERVGLS"
     exon            complement(597587..598171)
                     /number=1
     exon            complement(598228..598557)
                     /number=2
     CDS             complement(join(599405..599506,599562..599629,
                     599661..599734,599795..600108))
                     /codon_start=1
                     /locus_tag="AO090023000237"
                     /note="predicted protein"
                     /old_locus_tag="AO070264000011"
                     /protein_id="BAE58809.1"
                     /transl_table=1
                     /translation="MARKRKSSPPSRRSPIRWTAQEDGILIKTVHACTIRGEDQSLPS
                     DNKRARKDTIAWKLVAQSLPGRTNRDCRKRWFKIDRRWSQGPWAPDEETQLREAVAIY
                     GPEWDEVSFSVKTRNPDRACLLKRDTQKCLEHWEKTLYPFAANQSREPTDDMKLPEVV
                     AHSGHLSSYTQEGLAGRPILEFKDW"
     exon            complement(599405..599506)
                     /number=1
     exon            complement(599562..599629)
                     /number=2
     exon            complement(599661..599734)
                     /number=3
     exon            complement(599795..600108)
                     /number=4
     CDS             join(602035..602264,602332..603007)
                     /codon_start=1
                     /locus_tag="AO090023000238"
                     /note="predicted protein"
                     /old_locus_tag="AO070264000010"
                     /protein_id="BAE58810.1"
                     /transl_table=1
                     /translation="MADRQAVQQNLNGLLSKLDDPDPDMRYMSLNDLLGILNSPTSAY
                     LAHDQFSSSRLADGLLNALDDQHGDVQNQALKCLGPLVNRLPSESLTTILEKLSNLTA
                     SQTIDTSVPNTALRVIVTALPRSQAGQPPTPDVSVAYSSVSKILIPRLTGPTPSQSGR
                     RGSVIKGMLEKDPSKGFSSDAIDVLIQVVTCFGPLLKEAELTALQKSVMSIIDNDTAG
                     TVVTKRALAAISALVPHFSEAQFASFVDELVKKFNNPRISVVHRRHLIATVGSVARSS
                     PTKFGPHLPTLAPFVFATLGEVIAT"
     exon            602035..602264
                     /number=1
     exon            602332..603007
                     /number=2
     CDS             join(604180..604393,604442..605579,606270..606555)
                     /codon_start=1
                     /locus_tag="AO090023000239"
                     /note="predicted xylanase/chitin deacetylase"
                     /old_locus_tag="AO070264000009"
                     /protein_id="BAE58811.1"
                     /transl_table=1
                     /translation="MHFSPLTIIVSAIACSATYVTLQPSSKLEGNDLIPGLDRNHASP
                     ALVERNFLARCGQGFGKCSDDACCSTAGYCGKTKAHCRSPDCQIDYGHCDAHMTPDGP
                     PTSGIPRPKIGKVQYGPKAVRSCVGAGNIALTFDDGPNKYTEDLLDLLDKYDAKVTFF
                     ITGNNNAKGPIDTPGMPWASMIERMYQSGHQIASHTWSHQDLSKITPEQRRIQILWNE
                     VALRNILGGFPTYMRPPYSSCTEESGCLKDIGNLGYHVILYDIDTEDYRHDSPNAIQG
                     SKDIFDKNLARGKASDKSWLVIAHDVHEQTVYNLTEHMLKKASKDGYNVVTVGECLGD
                     PEENWYRMDESSELTILRKTKPLATAKQAISRDGRCGGNVTCLGSKFGTCCGKNGYCG
                     TSPKHCGFGCQPNAGHCQKARHTSTVHRHEKRPATSDASSLLQPGLNVADLLLIAAIA
                     GVSWLSTVFLSTVVFAVLSTATVTACFSCSTCISDGFPILSRGSSSITGSEVFFRLRP
                     RFLGCGAGSVCTVVLSDGVWSLFVGTAGCAVSLLGVR"
     exon            604180..604393
                     /number=1
     exon            604442..605579
                     /number=2
     exon            606270..606555
                     /number=3
     CDS             complement(join(608358..608741,608794..609192,
                     609249..609752,609801..610136,610191..610424,
                     610471..611103,611160..611456,611519..611587,
                     611644..611658))
                     /codon_start=1
                     /locus_tag="AO090023000240"
                     /note="vacuolar assembly/sorting protein PEP5/VPS11"
                     /old_locus_tag="AO070264000008"
                     /protein_id="BAE58812.1"
                     /transl_table=1
                     /translation="MALTSWKAFNFFDVSSVKLPEESSSIFSSDISSLCTGSSNLFLG
                     STDGFVHLISPSFKLLRSFKASEGGPITHIKQIEGTSLLVTIADDASSEPALKVWALD
                     KTEKKTGAPKCLSTTPVQNARRPFPISAFTAVPDLSQVAVGFANGSVAIIRGDLIHDR
                     GARQRIVFESEEPITGLEIHSGPTTILYISTTNRILALVIAGRGQGQPARVLEDTGCA
                     LGCMALDKDNGDVLVAREDAIYTYGPHGRGPSYAFDSPKNSINIFKDYVALVCPPKVA
                     TSNSSTLRNFDVSQPNDLFSTTTFTLLDTDLKFIAHSEALVSPVKQVFIEWGDLFILT
                     TDGKIYRYREKSLQQKLEILYQRSLYILAINLAQKKGVDTFQQNAIYRKYGDFLYQRG
                     DYDTAMQQYLRAIDNTEPSQVIRKYLDTQRIHNLIEYLEELHDHDSATVDHTTLLLNC
                     YAKLKDTGKLDEFIKAPGELKFDLETAIAMCRQGGYYEQAAYLATKYGENDMVVDILI
                     EDSKKYAEAVEYIWRLDPELAYYNLMKYARVLLSNCPQRTTELFIDYYKGKYKPITEV
                     QNPPEPQAQSTSTLQSLAAFLPLPLINSSAGTKTAAVEPSPEVEAEAAEDTTVYQIPK
                     PRTAFSAFVGHPQEFITFLEALISQESVKEEDKVDLYTTLFEMYLDTASRKKATTEKE
                     EWETKAKRLIEGKDIPISTSSVLLLSDLSGFREGSTLVREQEGLRSDIFRSFTSAKDT
                     RGAIQALKKYGPEEPQLYVDALTYFASSPKILEEAGEELDVVLKRINDEGLMSPLQVI
                     QALSNNAVVTMGRVKKYLSDNIERERKEISTNRRLISSYSTETENKRKELEQLGSKPV
                     VFQARRCALKSCGGVLDLPTVHFLCKHSFHQRCLNKVDEEAECPVCAPQNSTIRAIRK
                     RQVESADQHELFKGELQRSKDGFSVISEFFGRGVMRPQSTME"
     exon            complement(608358..608741)
                     /number=1
     exon            complement(608794..609192)
                     /number=2
     exon            complement(609249..609752)
                     /number=3
     exon            complement(609801..610136)
                     /number=4
     exon            complement(610191..610424)
                     /number=5
     exon            complement(610471..611103)
                     /number=6
     exon            complement(611160..611456)
                     /number=7
     exon            complement(611519..611587)
                     /number=8
     exon            complement(611644..611658)
                     /number=9
     CDS             join(612382..612524,612618..612879,612968..613147)
                     /codon_start=1
                     /locus_tag="AO090023000241"
                     /note="predicted protein"
                     /old_locus_tag="AO070264000007"
                     /protein_id="BAE58813.1"
                     /transl_table=1
                     /translation="MVFARANLLRASARAVGAASRRPAQQVARRTYASESSHSVQKSS
                     DLPWLLGSVGLGVPAAYYLLSSGPEKKPHGGHGDHHEAVKETEKKEEQAPAGESEPQP
                     DRDAEQKVDTEASSSSSGEKGGSFGEPPSNVDEATARGGTGGPATISGKQEGVSNADT
                     SNPYVNEPGKSQKGEGETETAKVKGTVDPARPQA"
     exon            612382..612524
                     /number=1
     exon            612618..612879
                     /number=2
     exon            612968..613147
                     /number=3
     CDS             complement(join(613813..614301,614352..615071,
                     615161..615283))
                     /codon_start=1
                     /locus_tag="AO090023000242"
                     /note="protein transporter of the TRAM (translocating
                     chain-associating membrane) superfamily"
                     /old_locus_tag="AO070264000006"
                     /protein_id="BAE58814.1"
                     /transl_table=1
                     /translation="MARGRSSSNLGADIPGDTSAPAMSTMNEVSPIETEAPKWNKSSE
                     KSLKSQPKRRKSRSLLRRFKDKCLKHTWLLPLLMVVVLLALYAVNPNPSNPLHSAIFL
                     SYPQGPKTPGGPVMYGKGPKDVAFVSFYTIVLSFTREFIMQRIIRPWAIYCGIRGKGK
                     TARFMEQVYTAIYFGIFGPFGLYVMYRSDIWYFNTTAMYEGFPHREHEALFKAYYLLQ
                     ASYWAQQAIVLLLQLEKPRKDFKELVGHHIITLALIALSYRFHFTYMGLAVYITHDVS
                     DFFLATSKTLNYLDSFITAPYFGMFVGIWIYCRHYLNLKILWAVLTEFRTVGPFELNW
                     DTQQYKCWISQYITFALLASLQAVNLFWLFLILRILKNYLFNSIRKDERSDDEDTEEE
                     EEVEQGQSGRATLATGAEVSTVTARNVGKENQAPQVLVNGEPLNEKSSSRR"
     exon            complement(613813..614301)
                     /number=1
     exon            complement(614352..615071)
                     /number=2
     exon            complement(615161..615283)
                     /number=3
     CDS             join(618168..618393,618483..618641,618711..619251,
                     619318..619721,619797..620050)
                     /codon_start=1
                     /locus_tag="AO090023000244"
                     /note="cytochrome P450"
                     /old_locus_tag="AO070264000004"
                     /protein_id="BAE58815.1"
                     /transl_table=1
                     /translation="MQALGRVALLTTLFNTSLNTSISIYRLFVHRLHPFPGPFACKLT
                     RFYSAFLAAKNIQYNVELKRLHKQYGDFVRTALPLSYGPQTGCRRSTWYGHVDVDDTK
                     ICMALSHDFNDHRRRRRAWDRAFSIISLSVYEPRVIAQAKKLMAQVEANQGKPLDATT
                     WSMLFTFDIMGDIGFGKNFGNLTTGKAHPAISAIRDNMRVIAVVSHLPWLLNMLGKIP
                     GAAAGYQGFFKWCTDQVETKRKVLSPRYAFGLAVDETSVYPDATQQSWDHDEYPQDII
                     SWILKAFIDNDVSAPPSEPALHDDSRVVVIAGSDTTALALASIIYFLAKHPQILQKLQ
                     AELDNAMPNGPRSWTYDKAKTICYIDDIIHESLRLRPSVSGGGYRVTPAEGLQIDEVF
                     IPGDVNVFVPQQLIQTDERYYKFSKEFIPERWGEKKVEWGTDKAPYFLFSLGIYGCVG
                     KNLAMLSLRVAVSTLAQRYDIRFRTGDILERCIGYIHHFSAAFASCVSPKEIVNTTPF
                     LRLLQVFFILHISGVKVRT"
     exon            618168..618393
                     /number=1
     exon            618483..618641
                     /number=2
     exon            618711..619251
                     /number=3
     exon            619318..619721
                     /number=4
     exon            619797..620050
                     /number=5
     CDS             complement(join(620828..621923,621984..622060,
                     622121..622244,622297..622601))
                     /codon_start=1
                     /locus_tag="AO090023000245"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070264000003"
                     /protein_id="BAE58816.1"
                     /transl_table=1
                     /translation="MAIGNIYVIAAIAVIGGGLFGFDISSMSAIIGTNTYKCYFNNGG
                     SVTINENGEKECGGPDTMTQGGITAAMAGGSWLGALVSGYLSDMLGRKQSIMVGSVIW
                     CIGCILVCAAQNIPMLIVGRIINGFSVGICSAQVPVYISEIAPPTKRGRLVGLQQWAI
                     TWGILIMFYISYGCSFIKGTAAFRIPWGLQMIPAILLFLGMMLLPESPRWLARKDRWE
                     ECHAVLTLVHGHGDPDSPFVQSEFEEIKGMCEFERQNADVSFMELLKPNMINRTHVGV
                     FTQIWSQLTGMNVMMYYITYVFAMAGLNGNNLLVSSSIQYVINVFMTIPAILWLDRWG
                     RRPTLLIGAALMAAWLYANAGLMAAHGHAAPPGGLNGTPAESWEITGPPSKAVIACTY
                     LFVASYAITWGPASWVYPPELFPLRVRGKANALCTSFNWAFNFALGWFVPPAFENIKW
                     QVYIVFGVFCTAMFIHVFFMFPETAGKTLEDVEAIFTDPTGIPYIGIPAWKTRNEFSR
                     GATLEQVGFDEEKKIGGTVQHSETA"
     exon            complement(620828..621923)
                     /number=1
     exon            complement(621984..622060)
                     /number=2
     exon            complement(622121..622244)
                     /number=3
     exon            complement(622297..622601)
                     /number=4
     CDS             complement(join(628073..628221,628271..628278,
                     628311..628341,628372..628418,628440..628576,
                     628619..628737,628745..628763))
                     /codon_start=1
                     /locus_tag="AO090023000246"
                     /note="predicted protein"
                     /old_locus_tag="AO070264000002"
                     /protein_id="BAE58817.1"
                     /transl_table=1
                     /translation="MPSILRTLKHRFYRILELLSILSRSFVELSIDFIIELLETIFKN
                     KISLFFPVLITINAVKLVKLFYNYIELQFRLSNSIVSNRELIFTSKFYYIKLRLSTAF
                     YLQIDKYYFKYFTNKDGILLLGYSPNFQLRTEDGTFSEEIPAVQHRIEKLTKIRENLA
                     EHWQNAIES"
     exon            complement(628073..628221)
                     /number=1
     exon            complement(628271..628278)
                     /number=2
     exon            complement(628311..628341)
                     /number=3
     exon            complement(628372..628418)
                     /number=4
     exon            complement(628440..628576)
                     /number=5
     exon            complement(628619..628737)
                     /number=6
     exon            complement(628745..628763)
                     /number=7
     CDS             complement(join(630131..630228,630274..630328,
                     630368..630566,630645..630703))
                     /codon_start=1
                     /locus_tag="AO090023000247"
                     /note="predicted protein"
                     /old_locus_tag="AO070264000001"
                     /protein_id="BAE58818.1"
                     /transl_table=1
                     /translation="MLFRKIIDYIIKFINDKISLWIRLLKSSVEAPILFIFKKNSGLK
                     LYINYRGLNKITIKNRYLLFLILEILDRLAGVKFFIKINIQDKIAFYTRYNHFKYLIV
                     FFVLYNILNICYIVYLDNILIFLLDRESYIRYIK"
     exon            complement(630131..630228)
                     /number=1
     exon            complement(630274..630328)
                     /number=2
     exon            complement(630368..630566)
                     /number=3
     exon            complement(630645..630703)
                     /number=4
     CDS             632261..632875
                     /codon_start=1
                     /locus_tag="AO090023000248"
                     /note="predicted protein"
                     /old_locus_tag="AO080606000002"
                     /protein_id="BAE58819.1"
                     /transl_table=1
                     /translation="MKDFLYTFVDPEADRHRNVAYRLINEKQNGRNMREWCARSLEVW
                     QAFPNNSLTAQTWIQTLDQEVQREITRAARQPQTLGEAHDMAIQYWSMLHRERSLRDS
                     EGSGRKRADGGNQGPAGFNRGRKRPRENETPATRPRGSRSSPGQPPFKARRWNDGTQA
                     AHERKRDWQKKEGRCFRCNEMGHRIWECPKAADGAPGKDASREQ"
     exon            632261..632875
                     /number=1
     CDS             complement(join(640337..640645,640751..640834,
                     640877..640978,641162..641206,641354..641431))
                     /codon_start=1
                     /locus_tag="AO090023000249"
                     /note="predicted protein"
                     /old_locus_tag="AO070252000024"
                     /protein_id="BAE58820.1"
                     /transl_table=1
                     /translation="MPKSSKDRVEQEGRILLAISALNKQKILLLDQYRAAPRYTHRVQ
                     ITIIQYRIQPNDIYNFNKISFTIGLISTTKIPRNQKWITSIKYIGSRKSLPPYLIFKG
                     KRLFIPFTISHIVSQYRLLILDSHNSYLTPQFNDIYSQNNIIPLYISIHSSYLLQPLN
                     IDYFSPLKRAYGQLIKNKIRLGFNHINKLNFFKAFCHRNDNDHAR"
     exon            complement(640337..640645)
                     /number=1
     exon            complement(640751..640834)
                     /number=2
     exon            complement(640877..640978)
                     /number=3
     exon            complement(641162..641206)
                     /number=4
     exon            complement(641354..641431)
                     /number=5
     CDS             complement(641713..643806)
                     /codon_start=1
                     /locus_tag="AO090023000250"
                     /note="predicted protein"
                     /old_locus_tag="AO070252000023"
                     /protein_id="BAE58821.1"
                     /transl_table=1
                     /translation="MAEETQVLSIQQRIAALNQAQVGQSPQAAASPLLGAQPTPFASR
                     PAPSRQQTINNPPVNSHDSLGDRNEPTGAQPKPVPRPPPIPVQKPRAPPPLPARKAST
                     ESAPALPPRRPSGFSRKESRESLGSDVSHSTSTSAGRATIASTTSNNSDTIRSVRAPA
                     WGAKLPPLPPKRQDTKTVQPPPRPRPSPANSSRSLSQGRPSLPPRRESTNSTSTNGNR
                     STSRPPPPLPSRINSDKSPGPSADTNGKQSTRKLPPPPPSSAALEKIQSSGLAGINRN
                     TENSGKGTNGSVQEPQPNGVPPPVPRATRPDVDLAKLQATKPRLCKTTHSATAPSTMC
                     LKCRDFSAPDAHAAQYPRESLPSYDLAWLARELTAPFPSPTDKARALFTWFHHNIEYD
                     VHSFFNKCVKPSTPAGTLASGLAVCEGYASLFATLATHAGLEAVVVAGHGKGYGYDAP
                     APGSPIPPVSATGHAWSAVRIDNGQWKLLDACWGAGVVQGPGLPYKKQFNPAMFTDSN
                     DEFGLRHFPSNRSHFFRDDGRPEITWEEYILGNPNSPLSAEQPTIFGDAQNHSIGERS
                     FRPAAKQISIHDPSPLRFQFNLICEHWTLEHHTRAKPGLFLLMVHGLDGRQDDRLPFT
                     HVRGSGPGGGGDFWYVDVPNAKILGAPGQKLAIAVLTSFGDRKDARGVTAEEYRQQVG
                     RVGMAWAYIAEWQLV"
     exon            complement(641713..643806)
                     /number=1
     CDS             complement(644742..645791)
                     /codon_start=1
                     /locus_tag="AO090023000251"
                     /note="predicted protein"
                     /old_locus_tag="AO070252000022"
                     /protein_id="BAE58822.1"
                     /transl_table=1
                     /translation="MAPRKELDPQIRLRICELHSIGWGPTKIYRQHPEIPLSTIKTTI
                     RRESIRVNNTTRARSGRPRKLTEQQRDHIYDLVQSEPHIRHIDLLTEVDHVVKRRSIQ
                     YLLSEMGCRKWKQLNRPEIKPIHAAKRLAWARRYEHYTAEDWARVKWSDEYMVERGIG
                     VRPTWTFLRPRDQLKNHDIHAKPCGKGIKQMFWAAFGEDIRTGLVPLDSDPESAQGGV
                     TAAIILALYRAFLPDLLQEGDIFMHDGASIHRTYIVREGLEEMGIEVMEWPPYSPDLN
                     PIENLWALMKEEIYKLYPELLTAPNTASIRELLTKAAQEAWHSIENRVLVRLSTTMPH
                     RVQAVIEADGWYTKY"
     exon            complement(644742..645791)
                     /number=1
     CDS             646621..647589
                     /codon_start=1
                     /locus_tag="AO090023000252"
                     /note="predicted protein"
                     /old_locus_tag="AO070252000021"
                     /protein_id="BAE58823.1"
                     /transl_table=1
                     /translation="MPPQGWLDIHGHFYLPQAPGEAEALAESFRAACFMVSRPVTWEV
                     ESILRYNDWANVQMQMLSYIPQSSLEKLKEANTYAASLVSKYPSRFGLLAALPTDDPE
                     LCLSEIKRTTSTFAIPADGFAVTTVYKGVGLGDPRLEPVWDVLNSRKAVVHIHPNAYA
                     APTNGRPSPLIEVAFDTARTVVDMLYNGVFRRYSNIKFVLAHCGGVLPVLSGRLALLG
                     TEEWVPNPNEITRKEIEEQLGRFYVDTAATAKTGLQPAVKMVGLENVVYGADCGAPCS
                     IEQTMEENRKDIMDFEAQNDIPRGTILANGWKLFPQAAARVTANDV"
     exon            646621..647589
                     /number=1
     CDS             complement(join(647968..648198,648259..648381,
                     648395..648406))
                     /codon_start=1
                     /locus_tag="AO090023000253"
                     /note="predicted protein"
                     /old_locus_tag="AO070252000020"
                     /protein_id="BAE58824.1"
                     /transl_table=1
                     /translation="MPSAIGTRTSLKLSSDHSDRKEAWGAVPTSDEIVVPFAAIDYLH
                     SALGDEGFQARTDGVLHLYEEPEKVFALLECKARRREDALPQVQYQEAAQIAAWVLQK
                     NHPETAMPGRYVFWTSAFL"
     exon            complement(647968..648198)
                     /number=1
     exon            complement(648259..648381)
                     /number=2
     exon            complement(648395..648406)
                     /number=3
     CDS             complement(join(650676..651223,651285..651384,
                     651438..651479,651551..652303))
                     /codon_start=1
                     /locus_tag="AO090023000254"
                     /note="phosphatidylinositol transfer protein PDR16 and
                     related proteins"
                     /old_locus_tag="AO070252000019"
                     /protein_id="BAE58825.1"
                     /transl_table=1
                     /translation="MSIATVETGYVGNLTQDQEEKLLQLWRIFLRSCDAELYRTDTNR
                     SGQTTSTTSPKQRRRLFSLSWSEDTSKTNDSPPVPAKLLSELEAMKMNAQEIKLIQQV
                     LTKLKPDERRSAFFAMMKQDHPDTFLLRYLRAEKWNVPKGFVKFVSALEWWSKQQQVE
                     TEVIRKGELHALQQSQSSTSSNEKKDGEGFIAQLRMGKGFFHGSDKSGRPICVVRART
                     HKPGAQTEKALNSCILWNIEVMRLLLVPPVETMTLIFDLTNFALSNMEYAPVKFIIEC
                     FQENYPESLGYMLFYNAPWFFSGIWKVIRGWLDPVVAAKVHFVNSVEDLEQFIDRSQI
                     VKELGGDEDWTYEYVEPEQDENAQLQDTTTRDSIMAQHQQIGEELFEATSMWLSAKDK
                     GNMGDASQQKDRRADIAMRLRENYWKLDPYVRSRTLLDRIGVIQAHGNIDFYPVKEGQ
                     GESKEVNEKDVKAVVDQVEYANGAQVASAA"
     exon            complement(650676..651223)
                     /number=1
     exon            complement(651285..651384)
                     /number=2
     exon            complement(651438..651479)
                     /number=3
     exon            complement(651551..652303)
                     /number=4
     CDS             653185..655422
                     /codon_start=1
                     /locus_tag="AO090023000255"
                     /note="predicted protein"
                     /old_locus_tag="AO070252000018"
                     /protein_id="BAE58826.1"
                     /transl_table=1
                     /translation="MTFKAAGGLRTTTSPSHHLHHRNGLRFEPPTPLAFAASSSMTNR
                     DPEFRHQLGKFRLDSSLSSHVSTPPPSVLHHETSPLSQPPSLTTPTSLQPPPTPSHTS
                     HHRSKRVSTACDFCRKRKKKCDFRYPNCSACTRAGVRCTIPPPGPQVASASVPRDQLE
                     NLQNRVRWLEDILRRKTGLSVADRPTGSALDGEGDLDWYQVPTVLMGRDNSHSTTSAT
                     VSASSPTESPAVGAELPNVGEIFRDQLENRRPSVARPVASAPRVLRLASLEDAERVAS
                     QYFDGIGYQYPFLHRHDFFAQLRRIYTGDVPPPDVLYTYHITIAIAMLISNAEGTQAN
                     EYYRASQETLSLSLQNEDLSAVRALLSLALWTMFSTNGPSVWHVLGSALRLATSLGLH
                     KPRNASSVVEDEMSKRAFWSLYNLDRLVASTLARPLGIADEDISVNLPREFNDDWSEA
                     PGASAMTIPVQVVRLRRIFSRIYRYCKFAERHYDTSGLTLAVYNNHPPPPPAEVSLTL
                     LHFRQELDDWRRNAPVYPPALLYSTSYYDYLYATTLLLMHRPSPRNPTPDATSIVSCG
                     DASIQVIRSYWDSYSVGKLKWIWLTLSQIYFAGITILWCLNQNFLSVRDGHPAAWQPN
                     DQMMRRAIQAVVVVLEEFGKRRPGVERLAETFRHHSTVIFSHLAYQQEQIHSQPQPQP
                     PLQPQLQQQNVLVAPPVPMAATLDDVLLVDGSGNVPLIDAQLADELFYSYDWFQEEMA
                     TFYTL"
     exon            653185..655422
                     /number=1
     CDS             655611..656981
                     /codon_start=1
                     /locus_tag="AO090023000256"
                     /note="atrazine chlorohydrolase/guanine deaminase"
                     /old_locus_tag="AO070252000017"
                     /protein_id="BAE58827.1"
                     /transl_table=1
                     /translation="MTTKTAQVFHGTLIHSKDPQTLEILPNTLLIISATGQIQSLHPS
                     TNPTDIPTLLTQANHNPDTTPITTLSATEFLIPGFIDTHTHAPQWSQRGLGRGIDLLT
                     WLEQITFAHEAKLSDPIYAKQLYRAAVQGSLKQGITTACYYGSRHKDASIILAETCLA
                     IGQRALIGKCNMNRHAPDWYVDSSVDESVSDTVEFIAKVKELDGDTGLVTPVITPRFA
                     ITCDETLLSQLGTIVKQNPGIPVQTHFNESHGEVNFTRDLFPQFKNETELYDNYGLLT
                     NRTILAHAIYPQPEEFPRLKELDCGVAHCPIPNTTMDEFMIAPVREYLSRGIKVGLGT
                     DCGGGYSSSMLDVMRAAFMVSVAKQTETEGKDAPLSVAESFYLATLGGARVAGLEDRV
                     GRFAPGLEFDACLVRTGVAEGIMAPVEEEDGVEGVFEKFLMTGDDRNIVRVWVRGREV
                     KGSSSA"
     exon            655611..656981
                     /number=1
     CDS             complement(join(657474..657673,657724..657993,
                     658043..658257,658308..659635,659692..659880,
                     660021..660074))
                     /codon_start=1
                     /locus_tag="AO090023000257"
                     /note="sexual differentiation process protein ISP4"
                     /old_locus_tag="AO070252000016"
                     /protein_id="BAE58828.1"
                     /transl_table=1
                     /translation="MADIPRRDEKPQQKEFLQEPSLDIDDSNYSILSDRDAAEILPYE
                     ADDSPFPEVRAVVRPVDDVHLPVSTVRMWTIGVIFTIVGSGLNQFFSLRQPSVTISAL
                     VAQLVAFPVGCAWAKWLPLGWLNPDRHFNIKEHALITIMANVSFGSAAATQIIEAMVK
                     FYNMPSQGGFEILLCITTQLFGFGLAGMASRWLVGPATMIWPQVLSNAALLSTLHSRA
                     NVVADGWSITRLRFFLFVFAGGAIWYFAPGYLFTGLSTFNFICWIVPTNVVVNQLFGQ
                     TTGLGMSILTFDWAQVVYANQSPLLVPFWAGLNVIGSFALFFWLICPILYYTNTWYSA
                     YLPMLNSNTFDNTGKSYNTSRVMNHDGTVNVEAYREYSPMFLPAGYAVTYGVAFANLT
                     GIFVHIALYHGTDLWEQWKGRDKKDVHSRLMSSYKDVPWWWFAAVTILMFALSIVTNE
                     VWHTGLPAWAVLLAFVLPMIYFIPVGIIKAVTNITSNQLNLITEFIGGYAFLGRPVAN
                     MAFKFYGYVAVSQGLEFVADMKLAHYLHIAPRTLFLAQGLATLIGAVVQCGVTVFMIT
                     RIDGVCTPDANGGFTCPHGRVTYSSSLIWGALGPGRNFSPGQIYGNLLWFFLAGPLVV
                     IVTYLIGRRWKQANYISWPVAFGAMSLVPPATGISFSSWWIVNFIFNGLIKRRRPAWW
                     SKYNYVLSAALDCAVAVATVIIFFCITLPAGPLHWWGNTVSARTADGKGTPWKALPES
                     GYFGPRKGTWE"
     exon            complement(657474..657673)
                     /number=1
     exon            complement(657724..657993)
                     /number=2
     exon            complement(658043..658257)
                     /number=3
     exon            complement(658308..659635)
                     /number=4
     exon            complement(659692..659880)
                     /number=5
     exon            complement(660021..660074)
                     /number=6
     CDS             join(661373..661753,661809..662206,662267..662552)
                     /codon_start=1
                     /locus_tag="AO090023000258"
                     /note="D-aspartate oxidase"
                     /old_locus_tag="AO070252000015"
                     /protein_id="BAE58829.1"
                     /transl_table=1
                     /translation="MGDLGHPVDISSVPFAQRPIIILGAGIIGCAAARQLLLNGFSVV
                     LVAEYLPGDQSIFYASAWAGAAWHAAGGISPEYRYFQAITHRHLLKMAQEDPESGVCI
                     VDTREYLEDPPTENSAIWGKTVVSKFRDLKPGEYPPNFACGWAYDTLVTDPTRHMPYL
                     GKQIKALGGQFIRKRVESLQELYTMFPESSIFINASGIGSKTLSDVQDEKCFPERGQN
                     VFLRTDNCQTMYFRNGKEYTYVIPRPLSKGVVLGGVKQSDNLSPEVDMEIARDEIARA
                     HRLAPEIVPEYPPEDVLDHIIGIRPSRKGGFRLESEKVGNRIVVSAYGFGGGGYAFSY
                     GVADALAKMVETAERENVIL"
     exon            661373..661753
                     /number=1
     exon            661809..662206
                     /number=2
     exon            662267..662552
                     /number=3
     CDS             664076..666202
                     /codon_start=1
                     /locus_tag="AO090023000259"
                     /note="PAS/PAC domain"
                     /old_locus_tag="AO070252000014"
                     /protein_id="BAE58830.1"
                     /transl_table=1
                     /translation="MSLRDRFLNLSMHDRAQTVNLPLITTPPEDNDMALSELKGDPKP
                     SLRTNDNCASDAEHVTPQHDASLYRIYRYTPVPTIVADANLSIVEVSDSHLALSGQTR
                     DTLLNTSICDIAPSIVPVPDTASLYGAIRAAISTKQIQLIDDIHLSDKKSYFRLQVTP
                     IFQDRALIYIVFEAHKDTRDRSDSQDHHHAYVNETYKILVDTVKDYAIFMLDTRGNIT
                     TWNPGAAIMKGYSASEIIGKHFSVFYSPEDRRNNKPGRGLAVCLRDGRMEDEGWRYRQ
                     DGSRFWANVMITPVYEFGRHVGFVKVTRDLTERKAAEGRLIAAFEESSRLKTDFLANM
                     SHEIRTPMNGMRLALSMLTDTELDNNQREYASILEDSTSVLLQIINDILDYSKLSSGS
                     FSLTSDIVEVESVVGAVVRNCKSCLKPGVTLSCSMPPNFPQTMRGDPLRYRQVLQNLI
                     GNAVKFTEKGHVKISTSFAIDTEDPRMYNVSTEVVDSGVGVPGSAINTMFTPFTRFAD
                     TTRRKYQGTGLGLSICKSLAELMNGSVGYRPNPDGPGSVFWFTAKMGRTDTRVSMRRS
                     SMLPTDSSENLIKKLREVAPRKHILLVEDNLVNHMVMLKLLQSFGFERIDAAWDGAEA
                     VRLVKQTPLSYNVVLMDISMPVLDGLEATSQIRSMNIDVPIIALTGNALKGDAETYLA
                     KGMNDYLGKPVHRNHLLQVLWKWLGT"
     exon            664076..666202
                     /number=1
     CDS             complement(join(669260..669508,669560..669866,
                     669929..670320))
                     /codon_start=1
                     /locus_tag="AO090023000260"
                     /note="thioredoxin reductase"
                     /old_locus_tag="AO070252000013"
                     /protein_id="BAE58831.1"
                     /transl_table=1
                     /translation="MTLYDVLIIGGGPAGLSVATGLARQLYRAVVFDSGVYRNALSNH
                     MHNVATWDHSSPAEFRREARERILARYDTIQFENIEIKDVQKTSDGYFKAFDALDRVW
                     TGRKLVLANGVRDIFPDIDGYKECWGRGIFHCLFCHGYEERGCASAGLLAVGDVANPM
                     VAMHFARMAKRFASTVTLYTDGAEELAQTLQESTRGTGIKVNKKKISKLVKGHGASDV
                     HVIFEDGTQVTEGFLTHKPKTEINGPFAEQLGLQLTPTGDLEATAPFYSTSVPGVFAA
                     GDCASPVKVVATAMSSGVLVAGGLVGQLQDELCLVSANE"
     exon            complement(669260..669508)
                     /number=1
     exon            complement(669560..669866)
                     /number=2
     exon            complement(669929..670320)
                     /number=3
     CDS             complement(join(672332..672525,672590..672755,
                     672815..673131,673180..673523,673568..673803))
                     /codon_start=1
                     /locus_tag="AO090023000262"
                     /note="serine/threonine protein kinase"
                     /old_locus_tag="AO070252000011"
                     /protein_id="BAE58832.1"
                     /transl_table=1
                     /translation="MLRALTNSIRRTRPCPRKSSSVAHILPTGTPIEEETLPHYKPEH
                     YYPVKIGDIYQARYEVTGKLGYGAYSTSWLCRDLHYESRVNKYTVLKVSTYFPDHPTV
                     TDREFRAYEHLAKVDSSHPGQSLIRELYDSFDLQGPDGTHRCLVLQPMHMTLLEMRGL
                     NPRPFNLPLLKMTVMRLLLALDFLHAEAEVIHTDLKTVNLMLSLEDSSMMADFAAAES
                     ENPSPRKLIGQSRIIYNSRKFRRPSGGRDYGLPVLCDFGEARIGKTQESGPFVQPYMY
                     RAPEVIFEMPWGSAIDIWNLAGLIWDMFEGLHLFGDIFDSKDGHDPFKHLALMVALIG
                     PPPTEFVRRSETTEQCFDSSGGWVAHQEATMPTVSLEVLEKRLNGKEKELFLAFIMSM
                     LKWLPEERKTAKQLLEHPFLVDYSYL"
     exon            complement(672332..672525)
                     /number=1
     exon            complement(672590..672755)
                     /number=2
     exon            complement(672815..673131)
                     /number=3
     exon            complement(673180..673523)
                     /number=4
     exon            complement(673568..673803)
                     /number=5
     CDS             join(675506..675714,675763..676026,676076..676299,
                     676351..676471,676522..677641)
                     /codon_start=1
                     /locus_tag="AO090023000263"
                     /note="predicted protein"
                     /old_locus_tag="AO070252000010"
                     /protein_id="BAE58833.1"
                     /transl_table=1
                     /translation="MKTSFLLLHTLVAGVLAIPTRTDYVLHERRDAVPAHWTGEKRLD
                     GQTVLPMRIGLTQSNLDRGHDLLMEVSTPGSPRYGDHMTLDEVHNLFAPSQDSVDSVR
                     SWLESAGISPDRISQSTNKQWLQFDAGVDEVEQLLKTEYYRYSHAGTGRSHVACREYH
                     VPESVQSHIDYITPGIKHLEIREEKPVEKRSLDKRSFGILPPILRPLTLPLEELLGQL
                     LLLCDVAVTPACIQAMYNVTDGDKATKGNELGIFEDLGDVYSQDDLDLFFSTVAHKIP
                     TGTHPILNAIDGAQAPADTTNAGTESDLDFEISYPLIWPQNSILFQTDDPIYQNNYTY
                     NGFLNNFLDAIDGSYCSEASPLDPPYPNPADGGYKSPRQCGVYKPTNVISISYGGAEA
                     DLPIAYQRRQCQEFMKLGLQGVSIVVASGDSGVQGRGGSPTPSGCLGKDNKVFAPDFP
                     ATCPYLTTAGGTYLPPGADVHAHEEQATTSFPSGGGFSNIYQRPDYQNAAVEEYFNTA
                     QLSYPYYESVDNSSFAANGGIYNRIGRAYPDVAAIADNVLVFNKGLPTLVGGTSAAAP
                     VFAALLTRINEERLAAGKKTVGFVNPVLYANPGVFFDVTKGSNQGCGTDGFPAVKGWD
                     PVTGLGTPNYPKLLELFMGLD"
     exon            675506..675714
                     /number=1
     exon            675763..676026
                     /number=2
     exon            676076..676299
                     /number=3
     exon            676351..676471
                     /number=4
     exon            676522..677641
                     /number=5
     CDS             complement(join(677863..678342,678418..678612,
                     678675..678951,679009..679055))
                     /codon_start=1
                     /locus_tag="AO090023000264"
                     /note="aldo/keto reductase family proteins"
                     /old_locus_tag="AO070252000009"
                     /protein_id="BAE58834.1"
                     /transl_table=1
                     /translation="MSLGKKVTLNSGAEIPTLGFGTWQSAPGEVGEAVYQALKAGYRH
                     LDLATIYQNQKEIAVGIKRAFEEFNIKREDVFITSKLWNSQHHPDVVEKALDDCLAEC
                     GLDYLDLYLVHWPVAFKTGNEYFPLVEGSTVPGGDCIIDDSISIVDTWKAMTKLPKSK
                     ARAIGVSNHMVEHLEAIINATGVVPAANQIERHPVLQSPKLIQYCKEKGIHVTAYSAF
                     GNNMIGEPLLITRPEIKAVAEEAGKRLGKEVSPAQVILAWSQVGGHSVIPKSVTPARI
                     AANFQEIELTPEEIAKVTALGTERRYNVPYVANKPRWNINVFGEPEEAPADHKVIL"
     exon            complement(677863..678342)
                     /number=1
     exon            complement(678418..678612)
                     /number=2
     exon            complement(678675..678951)
                     /number=3
     exon            complement(679009..679055)
                     /number=4
     CDS             join(682935..683246,683366..683404)
                     /codon_start=1
                     /locus_tag="AO090023000265"
                     /note="predicted protein"
                     /old_locus_tag="AO070252000008"
                     /protein_id="BAE58835.1"
                     /transl_table=1
                     /translation="MKTRDRGTLSKIPPGSDIFEAFAKVRADKDLTDEEAFLELLATY
                     DIPLSTLTQVSAKKLEVSFSSVTYKHIAPYVWLDPNYAGRDMLQLDIVRSRIPTGIFR
                     DIYRCQQARDPAGG"
     exon            682935..683246
                     /number=1
     exon            683366..683404
                     /number=2
     CDS             complement(join(685595..686112,686118..686184,
                     686199..686444,686557..686733))
                     /codon_start=1
                     /locus_tag="AO090023000266"
                     /note="voltage-gated shaker-like K+ channel, subunit
                     beta/KCNAB"
                     /old_locus_tag="AO070252000007"
                     /protein_id="BAE58836.1"
                     /transl_table=1
                     /translation="MAPPKQLITTHLGKNGPQVSPVGLRLMGASGMYGNPASDNERLA
                     FLVPRIKWARRFGILTTADIYGDSEHLLGKWFAANPSKRKGIFLTTKFGHPKRDLANL
                     QGTRAMNTNPEYFHDALEASLKRLGLPYIDLYYIHRLDRKTIEAMIQHKNEGKIKYLG
                     LSESDSLRRAHTVHPISCVQMEYNTFCLDIESPKYKLLETARDLGVAIVAYSPLGNGL
                     LSGTLWSKEDFTKPGDLHGGMPWFSDDHFKTNLAIVDKIREIAKAKGVTAAQFTLAWI
                     LAQGEDLFAILGTTKAHRVAENLGSLDIIVNPEQGKVVGGRFPAAIMEYCFADTPPLE
                     A"
     exon            complement(685595..686112)
                     /number=1
     exon            complement(686118..686184)
                     /number=2
     exon            complement(686199..686444)
                     /number=3
     exon            complement(686557..686733)
                     /number=4
     CDS             complement(join(687399..687442,687490..687738,
                     687797..688005,688079..688512,688607..688753,
                     688781..689081,689133..689212))
                     /codon_start=1
                     /locus_tag="AO090023000267"
                     /note="predicted protein"
                     /old_locus_tag="AO070252000006"
                     /protein_id="BAE58837.1"
                     /transl_table=1
                     /translation="MPLHIIYLLYNLELSHTIKYPQITSKHDQCTELSTIFGSALHYP
                     NNDSFTIWDAKQQEVRPACQIEPSTPSEVSQVLEILVHYWCYFSVKGGGHSRNPGDSN
                     SVGGVTVDLDRMTQVDILEHGNRALVYEALDAHNLSFVGGRVGTVGVGGFTLGGGTSP
                     FSNKYGWALDNVYEYEVVLANGTIVNANETHNRDLYFALRGGGNNFGIVTAFTVRTFS
                     QGPVSTTTTTYLQNQTEQVLDQVYQLFTDDALTSDVEMGYDMYYTYVSQDDSFSLSGT
                     QRYGKPVRNPAVFKAIYQIPRLTRSTTISNMGNLTRESEPLGTTRHLFATLTVLPSRS
                     LLTQAVRIFEQEARAIRSVDGLVPNLISYAISRTAIAAMAQRGGNSLGIHGDQPLFLI
                     LISTAWSDARDDAAVNTMTENAIRRIREAAETLNVAHPFLYVNYASAAQASEVFSSYG
                     EKNVQSLRDIQRAVDPHGVFTSRGFTERIRDLLLVTY"
     exon            complement(687399..687442)
                     /number=1
     exon            complement(687490..687738)
                     /number=2
     exon            complement(687797..688005)
                     /number=3
     exon            complement(688079..688512)
                     /number=4
     exon            complement(688607..688753)
                     /number=5
     exon            complement(688781..689081)
                     /number=6
     exon            complement(689133..689212)
                     /number=7
     CDS             join(692688..692882,692959..693252)
                     /codon_start=1
                     /locus_tag="AO090023000268"
                     /note="voltage-gated shaker-like K+ channel, subunit
                     beta/KCNAB"
                     /old_locus_tag="AO070252000005"
                     /protein_id="BAE58838.1"
                     /transl_table=1
                     /translation="MCRDQGMAIAPWAPLGQGKFKSSEARSSDSEGGCGRASNMSEHD
                     IQVSDALEKVAKRKNTTLHAVALAYVMHKTPSVFPIVGQRKVEHLKANVEALSVSLSD
                     EDLAEIDNASSFDIGFPMNFIFRDSYTTNSTAADVSFTRVSAHIDAPPNPSPVRPRRH
                     LV"
     exon            692688..692882
                     /number=1
     exon            692959..693252
                     /number=2
     CDS             join(694160..694408,694543..694890,694937..695402,
                     695563..695615)
                     /codon_start=1
                     /locus_tag="AO090023000269"
                     /note="predicted protein"
                     /old_locus_tag="AO070252000004"
                     /protein_id="BAE58839.1"
                     /transl_table=1
                     /translation="MAELSLRRLCIFALGLFSLVAAQPKVVTFALSRSERHVLEKRKY
                     AGALLGNDILDGKALYWVNASVGTPPQPVQLQVDTGGSDHQSTDQDNFFLDDPTLSST
                     SKILDKGGFTIQYVTPGSGVKGDYVGDNFGFGSVTVQGLTMGVARQAQYVIKGIMGIG
                     FAAGESIVSQGQRPHKNIIDMLVEQELINTRAYSLWLNDKLSNGNDACVFGVVPITDD
                     SPILFGDTFLRSAYVVYDLDQQQIAIAPTWFNSEDTNIVEISGKTGSSSPNWKTAGSN
                     AAKVTQTATGLQAPGGLSPATAPTGWVFSQTATPFHLPGKGGSVTGDQASSSPSKGAA
                     SSSVGIAVPGALASITVASLCVEWKDIPFDYSKHPDI"
     exon            694160..694408
                     /number=1
     exon            694543..694890
                     /number=2
     exon            694937..695402
                     /number=3
     exon            695563..695615
                     /number=4
     CDS             join(697967..698212,698270..698510,698566..698634,
                     698691..699137,699210..699763)
                     /codon_start=1
                     /locus_tag="AO090023000271"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070252000002"
                     /protein_id="BAE58840.1"
                     /transl_table=1
                     /translation="MGQPNDLKSPEVASVPVSSKNSISDPSSPLEDSLEAQQPSPPIY
                     HIFSRSQKLEMVVIVSLAAIFSPLSSNIYFPALGAISRDLHTSMTLTTLTVTIYMIVQ
                     GIAPTFWGSLSDTSGRRPVFIGTMVVYIIANIALAVSTNYGELMAFRALQAAGSAATI
                     SIGAGVIGDVTTSAERGSLVGIFGGVRMLGQGIGPVFGGLLAQYLGFRSIFWFLTICA
                     SVSLFTILLLLPETLRSIAGNGTVPLRGLQKPWLYYITGQPGAEEGAESGIKKSRVTF
                     GTVFAPLKFLFEIDVFITLFFGSIVYTVWSMVTSSTSDLFEETYNLTTLQVGLTFLGN
                     GLGCMSGSYTIGYLMDYNHRLTEREYCEKHNYPPGTRVNLKTHPDFPIETARMRNTWW
                     ITVIFIVCVAVYGVSLRTHLAVPIILQYIIAYCSTGIFTINSALVIDLYPGASASATA
                     VNNLMRCLIGAAGVAAVQPIIDALGPTYTFVLLAGITLVLCPLLWVETKYGAGWRLAR
                     HQRLNRPRAG"
     exon            697967..698212
                     /number=1
     exon            698270..698510
                     /number=2
     exon            698566..698634
                     /number=3
     exon            698691..699137
                     /number=4
     exon            699210..699763
                     /number=5
     CDS             700156..702705
                     /codon_start=1
                     /locus_tag="AO090023000272"
                     /note="predicted protein"
                     /old_locus_tag="AO070252000001"
                     /protein_id="BAE58841.1"
                     /transl_table=1
                     /translation="MEPMPDFQFDPFGPGATAYDNTEAGLDGIDWNDPASALKAIGAG
                     GPGGLPFPETLSPEEVRRQATARSDEIFTSYETLHRIIQRHEATIQKRWSKKTRQQRL
                     NVLLSAWPDMPAIHRPDFDAFRRESASDRVRGTKYRVHFMWPYVNQEDLLNTKALPLL
                     LNSRGRHPPSHFAAADMDAMHLGLVSKAIVPIFLNCHVLILNGMTENTRDYGQLVAWE
                     DHPDAFDWMHKQKQFLPGEGLLVMEAQARLLSFLVQCCQQLLHDIPESTLTSNSFPVL
                     PEPQIKPESEISGFESLGVIAAEAPYRVPAQIDLRRIASLLAARASAAEDHLWALRED
                     PDYFARTLLECKEHLQEMLKDLDGKSHPVLGFGRDNVLWARILGSILSEAYLRLELFS
                     ELSSQAGRLVAMQKMYADDISPSKDLPEAYLEALLRLRYFLTQAAKGPLSMLRIAGVA
                     SPPLRRFFARVPPPDPYTSKISVTSKPGAKMNKVETQLIWLLRNLWEDGYDLFLFGMP
                     LVVDELGRLLQSEKQAQELLSSYITEVIGDLSIFSQCLHQLALYHPWARSFESELVDR
                     EDKVKQEFAERTQSWARILAALKAALPERDESNKTVDLGKPTEGKFTYPFEKRRTKEN
                     VTALRNAESCLDAFWAAIDQTMVNKAGDLSGTAVRNLLSQPRILQRTREWIEPEKPQR
                     ASQDKPGGVDLYTLYQPVSSVYSGLSARALDISQPKTKVKTRGTSHPVRKTEALPRHD
                     PVDRQPTFSVDTRALKVFRAVFFNPATTSTPGEVSWNDFLHAMTSVGFSAMKLYGSVW
                     QFQPTRLDVERNILFHEPHPQGKLPFKTARQYGRRLNRAYGWFGEMFVLNK"
     exon            700156..702705
                     /number=1
     CDS             complement(join(711631..711690,711776..712080,
                     712134..712632))
                     /codon_start=1
                     /locus_tag="AO090023000273"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000138"
                     /protein_id="BAE58842.1"
                     /transl_table=1
                     /translation="MSPRNQKSSPSHSGRSPSHSSGAEDGGSRFAFVTEGTLAEARSH
                     AMREHWRQRQRRKQKSEDHRTQRKILPHRSPVEDSKPKPNGASEPVVEYHSTEDVFLL
                     HQPSPTRIKTRYSDYGEDNIKAQYPGVPEQALTGLNHALASSRLDPFEMFPVQLTSNH
                     HKLLHHWLITHATMMFEDVAIPSFNPMKDVWFPLDLSNAASFYGIMAHSAAHLAHLYA
                     GMNPSRGTSSTDALKYKSEAVRILSTWMADPEKSLSNDAFAAVIRLLTFERDIGGRKR
                     SGWCTAPASKE"
     exon            complement(711631..711690)
                     /number=1
     exon            complement(711776..712080)
                     /number=2
     exon            complement(712134..712632)
                     /number=3
     CDS             join(720449..720575,720671..720818,720887..721468,
                     721526..721640)
                     /codon_start=1
                     /locus_tag="AO090023000278"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000133"
                     /protein_id="BAE58843.1"
                     /transl_table=1
                     /translation="MSKRRLFRWPAPRTVCLGCLALVFTTLVTMFLYMSEPLDIQPDP
                     EPVNSQVFRQLSEITNTYTNASASEVGLVLAATQKEDLGWLLNYCRDHGTIPFIYTTD
                     TPPAPYLLVPATTRGREATAYLSYIVDFYDQLPKYTIFIHSNVDQWHNDLFGPRTSSV
                     LPHLRLEAVDAQGYVNLRCEHNPGCPTSVNPWEPTQIDIEKDDIRAFFPQVYETLFNV
                     GPEKVPQHIGNVCCGQFAVSRERILQRPRHDYERMLKWAAETELTDSFGVGWVFEKVW
                     HVVFGMEDIYCPRYEQCRCDAYGWCGPLPSGETLQAVRAPRSKGKST"
     exon            720449..720575
                     /number=1
     exon            720671..720818
                     /number=2
     exon            720887..721468
                     /number=3
     exon            721526..721640
                     /number=4
     CDS             complement(join(721933..722632,722728..723100,
                     723194..723255,723403..723430,723531..723555))
                     /codon_start=1
                     /locus_tag="AO090023000279"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000132"
                     /protein_id="BAE58844.1"
                     /transl_table=1
                     /translation="MTSSSASGVPSFGGLLFIHVRSISGLLLGGTGILASESCSGNVN
                     ISSQSDADALRDCETINGPLTISSSASGTISIPEVQDIKGPFTIEGSSNLNGITASNL
                     ETVSGPLTITGNGALNSVSLSNLQSVGGELRIQGNEGLKEVRLDDLERVNGNLVLNGD
                     FDRISLGNLENVYGETTIQSSGSFQCSSLDKLVSDKRAFKGSYSCNEKGSGLSSGAKA
                     GIAIGVIIGVILVVLLVWLCIRRQKRQKRKDAVLAGLTAAGVAGAVGNDVEKAENKVP
                     TAVSNTSPSSQDPPSPPSDTEVAASSIPRKPVSPPPPAPVPAALVPGDRSSRVVSSSD
                     DPSLFLRPIPRRRPSESEVPMLDSENVHEAPPPEVGRQQEGLFELDAGPVSGKHQQAI
                     HHE"
     exon            complement(721933..722632)
                     /number=1
     exon            complement(722728..723100)
                     /number=2
     exon            complement(723194..723255)
                     /number=3
     exon            complement(723403..723430)
                     /number=4
     exon            complement(723531..723555)
                     /number=5
     CDS             complement(join(724803..724954,725011..725268,
                     725319..726012,726075..726481,726560..726791))
                     /codon_start=1
                     /locus_tag="AO090023000280"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000131"
                     /protein_id="BAE58845.1"
                     /transl_table=1
                     /translation="MRIGRGCERCRLRHIRCTTRAGASSCNACARLGRTCRLDPPFRF
                     KTVRHVYQKSQGTASKFELEWDSAQTWVNVPRSLTFVQESAEESADGSISDVPPEPQR
                     DTQISSDEPHTYIPDPFVTHLPISGSLNPHNEAVSLPHVEPAISTPSIHDEHSTKATA
                     ISPGAVNDMVSPLASNTTWSPMTPSTPRSTSSSTMTSREAFLLRSYINKISHWLDICD
                     SGSTFNTEVPRRALHVPMVLKAVLALSARHDAIMSGASDWEASEYHSQCVELLLAALA
                     RPEETYDDNMLISVVILRIYEELESTTDEKCHWLGSNRLLNTMSRAASSGGLTEAASW
                     QFLRQAIYASIVQNQPMQLDLRNYERSSVFKRGDDGAYANTIIFYCARIIQLCSEGHV
                     AAVDEEDWHDLSSRVEQWYRDRPVSWQPLQYKDANPAENRPFPELWVMSPPAVVGLQY
                     YHTCQILLTSSDRHWGVVSNYERARLRRIEEVRTLECLTIPYTYIPQKVIASHVVQVI
                     GLSSSNETVENAYFMACHLLYRYGHCLRHPVEKRGSLKFLTRVESSVGWRTGWIIREL
                     EDQWNELQGLDSWE"
     exon            complement(724803..724954)
                     /number=1
     exon            complement(725011..725268)
                     /number=2
     exon            complement(725319..726012)
                     /number=3
     exon            complement(726075..726481)
                     /number=4
     exon            complement(726560..726791)
                     /number=5
     CDS             join(728540..728554,729872..729992,730047..730339,
                     730390..730464,730522..730620)
                     /codon_start=1
                     /locus_tag="AO090023000281"
                     /note="Ras GTPases"
                     /old_locus_tag="AO070306000130"
                     /protein_id="BAE58846.1"
                     /transl_table=1
                     /translation="MVAVRQTKNSVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQT
                     LGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNS
                     IKEWYRQGRGFNKTAIPFLVGTKYDHFVNFPREDQEEISVQAKRFAKAMKASLIFSST
                     SHSINVQKIFKIVLAKAFDLKCTIPEIENVGEPLLLYKNV"
     exon            728540..728554
                     /number=1
     exon            729872..729992
                     /number=2
     exon            730047..730339
                     /number=3
     exon            730390..730464
                     /number=4
     exon            730522..730620
                     /number=5
     CDS             complement(join(731180..731827,731931..731951))
                     /codon_start=1
                     /locus_tag="AO090023000282"
                     /note="uncharacterized protein conserved in bacteria"
                     /old_locus_tag="AO070306000129"
                     /protein_id="BAE58847.1"
                     /transl_table=1
                     /translation="MSPPSQNIVSPTEFQKAHSTHLAHEKAATHHLQALASARRSLPI
                     VPVPDASRFKFDTIDGEKTLPELFAGRKQLIMYHFMLGPEDEKGCVGCSFCMDHIPDL
                     RHLESRDTSFVAVARAPVGKIEEYKRLTGWGFPFYSSEKTHRAWEEAEKGGEVITWKP
                     GNGYFGLCVFFRGDEGEVFHTYSTTDRGMEILLGTYHLLDMTPLGRQEVGNGMNNFRR
                     IYEY"
     exon            complement(731180..731827)
                     /number=1
     exon            complement(731931..731951)
                     /number=2
     CDS             complement(join(733494..734022,734086..734105))
                     /codon_start=1
                     /locus_tag="AO090023000283"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000128"
                     /protein_id="BAE58848.1"
                     /transl_table=1
                     /translation="MGVENVAAMSPIERNILLLAKSSARKHLRLISTEPDFYLSKLKY
                     AMDFVWAKCAFCFLLLLKLSRLLPERREEHQELLDHGNRLLNELTRSVGSSGQITGNG
                     SIYMQILRLSIEKYGRIFQEREAGGDPVTTAPFWESFDAQADLQSFVPEQFVREWDFP
                     GLNLFYFPTAWQDFFGDFSLAV"
     exon            complement(733494..734022)
                     /number=1
     exon            complement(734086..734105)
                     /number=2
     CDS             complement(join(734553..734715,734749..734915))
                     /codon_start=1
                     /locus_tag="AO090023000284"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000127"
                     /protein_id="BAE58849.1"
                     /transl_table=1
                     /translation="MALDLSLDEAFEELIQRLTMDEIEGTPELHMTTDEEERSLMRKS
                     RTWFGLLVLDHMLIIFRFHVDGGKPPGIRMTGNAHRCRILLRHHTSTILDLRLFSQVE
                     VCLCIYI"
     exon            complement(734553..734715)
                     /number=1
     exon            complement(734749..734915)
                     /number=2
     CDS             complement(join(735283..735334,735390..735640))
                     /codon_start=1
                     /locus_tag="AO090023000285"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000126"
                     /protein_id="BAE58850.1"
                     /transl_table=1
                     /translation="MSDPGPMPTFLGTADPGGHHSRGPRCISTHRNGPLLQQLQTAEV
                     NSPHPARQRRSGFDVREEPISDFISKGLMTIDQAMSCFTTFFQGCVRTLSFYPPLT"
     exon            complement(735283..735334)
                     /number=1
     exon            complement(735390..735640)
                     /number=2
     CDS             complement(join(736685..736898,736956..736991,
                     737044..737108,737161..737258,737309..737330,
                     737382..737649,737704..737817,737874..737945,
                     738003..738055,738109..738171,738235..738332,
                     738395..738917))
                     /codon_start=1
                     /locus_tag="AO090023000287"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070306000124"
                     /protein_id="BAE58851.1"
                     /transl_table=1
                     /translation="MSHHKATASREQGQDEHIESVEDSAHQDREHPAGPGHDRALDLI
                     ADAGHSSVLTAENNARVLRKIDLRLLPILLGIYFLQQLDKSSLSYASIFGLVETAHLH
                     GQQYSWLGAVVYLVQLVAQPFVAYILVKVPIGKFLACTTLCWGIALTCMTPANSFAGL
                     LICRIFLGLFEAGIPACFIAVTQMWYRRIEQPVRLGSWYAMNGVVYMFGSLLSYGLGH
                     IKSSVFEPYQIIFLFFGLITIAFSGLILLFMPDSPIRSKFLTEEDKLLAIERLRMNQQ
                     GIETHEWKWGHVKEACLDIKSFFWFALMFAVSIPSGGISTFGPLIIESFGFDQFKTIL
                     FNIPFGAVQLVATMGGAWLATTLKMKGPVIALLSLPAIAGCVMLLQLPRDGHHNGALL
                     AGYYIVSVYPGITPMVYSWSAGNTAGETKKKIVNGIVLVGQCAGNVLGSNLYTTTDAP
                     LYRRGLISSLAMFCLLVLLSMMNMAYLCFLNKMHERKRVSMGKNAKIVDHSMQAVGSV
                     PVDKTEPQQSAVSEDNAFKDLTDWENEDFVYVY"
     exon            complement(736685..736898)
                     /number=1
     exon            complement(736956..736991)
                     /number=2
     exon            complement(737044..737108)
                     /number=3
     exon            complement(737161..737258)
                     /number=4
     exon            complement(737309..737330)
                     /number=5
     exon            complement(737382..737649)
                     /number=6
     exon            complement(737704..737817)
                     /number=7
     exon            complement(737874..737945)
                     /number=8
     exon            complement(738003..738055)
                     /number=9
     exon            complement(738109..738171)
                     /number=10
     exon            complement(738235..738332)
                     /number=11
     exon            complement(738395..738917)
                     /number=12
     CDS             739637..742180
                     /codon_start=1
                     /locus_tag="AO090023000288"
                     /note="alpha-glucosidases, family 31 of glycosyl
                     hydrolases"
                     /old_locus_tag="AO070306000123"
                     /protein_id="BAE58852.1"
                     /transl_table=1
                     /translation="MPQKEFCPKSYQETPAGAQSSAAVHLRSGSDKRQFDFSFEPIRE
                     NLFRVTFSSEDHPLPPFPSVTKPVTSLEDTHVSTEHGFQQKTIEVGDVIASVEWANTP
                     VVSLSWKGTDKPLYRDLPLRSYVADASGIAHYTEHDRNDLHVGLGEKRAPMDLSGRHF
                     QLSATDSFGYDVYNTDPLYKHIPLLIKASPAGCVAIFSTTHGRGTWSVGSEIDGLWGH
                     FKVYRQDYGGLEQYLIVGKTLKDVVRSYAELVGYPILVPRWAYGYISGGYKYTMMDEP
                     PAHQALMEFADKLKEHEIPCSGHQMSSGYSIAEVEPKVRNVFTWNKYRFPNPEEWIAK
                     YHSRGIRLITNIKPFLLGSHPDFQKLIDGNGFFKNPETNEPGYMRLWSAGGATGGDGC
                     HIDFTSAFAFKWWYNGVQSLKRAGIDGMWNDNNEYTIPDDDWQLALDEPTVSDGAKTG
                     VKGTVGDWGRAMHTELMGKASHDALLDLEPNQRPFVLTRSATAGTMRYAASTWSGDNV
                     TSWESMKGANALSLNAGMSLLQCCGHDIGGFEGPQPSPELLLRWIQLGIHSPRFAINC
                     FKTSPENNSVGEVIEPWMYPEITPLVRDTIKRRYEILPYIYSLGLESHLNASPPQRWV
                     GWGYETDPEVWTKTLKSGEEQFWFGDTIMVGGVYQPGVSFAKIYLPRKANDQFDFGYV
                     NMNEPYTYFASGQWVEVPSEWKKSIPLLARIGGAIPVGKSVHTRVPGDETPASVAVEE
                     LDDYRGVEIFPPRGSSHGQAFSTTWFEDDGISLKPSISQYTVTYSSTEEKVTVGFTRD
                     QKSGFVPAWKELDIILHNGDERRVVSDIGKPVEYKGRDSRGRVVYTLKN"
     exon            739637..742180
                     /number=1
     CDS             join(743096..743396,743464..743735)
                     /codon_start=1
                     /locus_tag="AO090023000289"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000122"
                     /protein_id="BAE58853.1"
                     /transl_table=1
                     /translation="MKAERATLKWLENIDVPSPKLHDYSLRNDRQNNVGVAYMLIDEL
                     PGIPLLHKRPSVEELRRVYDSYAKILSTLQGFPFHRIGCLSFRQDGDIHVGPIVGDKM
                     YLEMICSGQLFSAYPINAYLVFNYLKHLASTSRWNALEPILDDGPFFLNIWMTRGYHI
                     LVDERYNITGIIDWTYARVVPAFEAYGLSL"
     exon            743096..743396
                     /number=1
     exon            743464..743735
                     /number=2
     CDS             join(744050..744235,744306..745514)
                     /codon_start=1
                     /locus_tag="AO090023000290"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000121"
                     /protein_id="BAE58854.1"
                     /transl_table=1
                     /translation="MIQLRSQMVVQKGSTKSASEVCDLLVGLLHETQPSVRGQSCRKL
                     LCAKHQSRLYHNCEFSLELSDEGREKLIKNEIAELLSQTNTTELVRICTGLNNGVKCA
                     FIAGKHIESDATMGCAKYQAWLSFDNGEKWLLQIPRTGNSDVPSELVEYLIASEYATL
                     RFLERMKIPAPRAFIYGLASDPFNRVGVSYIVMQALPGRPFHAHKVSPSQKAKVLEQV
                     AEIMLEIHEHPVRSAGSPVEDKGQIQISTLAKDRFVGLSTSGPCTTPLEYILAITGQY
                     MDLIADGQLHHKHPLEAFLFYHYLHHNGAAIVTADMQGSFFLKHVDDKGNHLLVDEEF
                     NVVGIVSWQFARTVPASEAFGASYLTADLASMYSCNGSVTNDDRLLANALRERGASDL
                     VSYPEGKDIMRRLHHGLGRGSTTGEVRCLLKGMVKAVSGEQIDDIDLWMESQRESCRH
                     DSRRRAIHGLCESI"
     exon            744050..744235
                     /number=1
     exon            744306..745514
                     /number=2
     CDS             complement(746279..747988)
                     /codon_start=1
                     /locus_tag="AO090023000291"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000120"
                     /protein_id="BAE58855.1"
                     /transl_table=1
                     /translation="MFRSRRHALFRRTTVDDGLDQKEPDGMVDAGVPFRLIDVRAFCG
                     DHSHDIECGHNVRLVENLPVCPKYMTLSHCWGKRLDANGITTRGNLPSRMKEINLDDL
                     PANFWDAISINRRLGIRYLWIDALCIIQDSQDDWAQESVKMGHIYDSSYLTIAASASE
                     DSNGGCYRGAGIRQDSLGGGTLIEITNKLRVISRETSTLILWAPTLSDDDPLREPALL
                     VGCPLSQRGWVFQERILSPRTIHFTNSQLVWECREVYEMEDRLPFVTPHDTLSLAMDR
                     EISPDWIKRIWYNWLIGFGYSSRKFTVMEDRLIAIAGIARSLHERTGIPYIAGLWAKN
                     LGFGLGWLEVPNDGTEDPSRLSNRPYARRRPTWTWASTDHEFQYSLRNFIEDRDLHYV
                     DSRIKTLGNVDDPFTIITGGWLKIRGGVYRGSGSYFTELHLDRSQEVVPFATERSQLE
                     SSVFNWNGALSQPYYIRLGQFSTRPTYRTVVVRESWLIVRRVEAEEEEEKEYERLGIA
                     YRTHTSSLDEGEGQDTTEEYRRLSIGYPVPTKRLENEWYWVEEKGKKKLTPAFRVMDL
                     KLV"
     exon            complement(746279..747988)
                     /number=1
     CDS             complement(join(749089..749236,749293..749583,
                     749648..750137,750211..750451))
                     /codon_start=1
                     /locus_tag="AO090023000292"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000119"
                     /protein_id="BAE58856.1"
                     /transl_table=1
                     /translation="MDQYVDSFPYFPDRTEYEARARSVPQHEIEEAVLPEGFPIYLSS
                     KMAWDRESISSYEDDYILKLDDSQLKEIDDALQHFKALGQPLELLSPATFPLPSLHSV
                     LRGVSDNIHKGTGFSLVRGIPVDRYSAEENMIIYVGISSHIGRMRGRQGYQYNVSPVD
                     VVVTHITDMRPPSDPTLSVRVAGYTNEDMPFHTDDGDIVSLFALGEPAEGGESQLASG
                     WRVYNELARTRPDIIQVLASDWPIPRSKKEDPFLYRPLIHYQNCSGTPERLLINFSRR
                     WLAGYGDLKRTRLLSVRQAEALDALHFLAERFHISMKLQKGDMQFFNNWSILHARRGY
                     KDGPQRKRHLLRLWLRDPDNAWPTPKLLQHKLDAIYSKDQSRGPQVFPPYPYTTV"
     exon            complement(749089..749236)
                     /number=1
     exon            complement(749293..749583)
                     /number=2
     exon            complement(749648..750137)
                     /number=3
     exon            complement(750211..750451)
                     /number=4
     CDS             join(750901..751156,751229..751715,751785..752078,
                     752147..752330)
                     /codon_start=1
                     /locus_tag="AO090023000293"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000118"
                     /protein_id="BAE58857.1"
                     /transl_table=1
                     /translation="MASGIQQVSYHLNRNDYHSRIFNHAQRRSIGTSLPPGFPKRLES
                     KMAWEAKDISLDHALGGGTPYLLILQGPQLAEIDAALKHFQCLAQPMEALNPSTFPLP
                     GLSLILRSVSSNLHSGYGFTLIRGVPVERYTREENMIIYVGISSHIGAMRGRQDHQFK
                     GQPADVMLAHITDMRRPDGEQNYALAAYTDSEVVFHTDVGDIVSLFVLSEPANGGESL
                     LASGWTVYNALAENRPDLVRVLAEDWPIPSAQEPGLIKYRPLLFYQPASGSTPERVIL
                     QFSRRSFSGFGAHSQLNRLSPAQVEALDALHFLAEKFHVAMDLKRGDMQFINNLSMIH
                     ARNSYVDGPGSRRHLLRLWLRDSENGWATPDALRSRADRLYDEKFRRGPQIFPVDAIP
                     RSVGKVRVGTTQNS"
     exon            750901..751156
                     /number=1
     exon            751229..751715
                     /number=2
     exon            751785..752078
                     /number=3
     exon            752147..752330
                     /number=4
     CDS             join(752824..753214,753290..753411)
                     /codon_start=1
                     /locus_tag="AO090023000294"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000117"
                     /protein_id="BAE58858.1"
                     /transl_table=1
                     /translation="MTALTRHDQALFETTRRVLAEVVNEGLVRAKVEVTAPEGPGTLC
                     LLSPQDVSWVKVGVTPGTVIEMKEDRVVSVIRPESLQPPVIVGETGNQELDPGAIFAV
                     LSALLKDVADGTVLEAIVRELRNSATNQGSTRLRLGGYICEVGTGIDKWPSESPSMTP
                     QIVVYVLCWG"
     exon            752824..753214
                     /number=1
     exon            753290..753411
                     /number=2
     CDS             753490..754257
                     /codon_start=1
                     /locus_tag="AO090023000295"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000116"
                     /protein_id="BAE58859.1"
                     /transl_table=1
                     /translation="MLTPTLAFVSVPCDNLRITGHFERELQPLLKRLDIPQTTSDRVI
                     VPCLAQQLPSILQRFPDVVILKLAADCADAQASMRTITIRPELGFKYHLKLSLACHIT
                     GALRTITPWTACGGPVQTELLEKFLPDDLWVFREVAAVSGSQKDFNEARHLACILRDT
                     LESRAQANDEVLIMAMALTQKPYGDSRTYAEILYNLETVVQKKEWFQRYVDPNTSCSS
                     MECRLIARTKDILQSYSALCSLHWFSMESGWKATGRT"
     exon            753490..754257
                     /number=1
     CDS             join(754326..754640,754672..754818,754900..754962)
                     /codon_start=1
                     /locus_tag="AO090023000296"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000115"
                     /protein_id="BAE58860.1"
                     /transl_table=1
                     /translation="MHVPTLNNHGVKFDSLPPGGATLTDNLDNVWSKVHHSLLQNHVG
                     FLLVALGLENHGGWAITLETLSTVLGGGQDSPGAKLLEYFTKDTMPFKCFLRMRMESK
                     YRDDCQNQELTFPYITVHREGSAECDTHELSAVEVYNRDLSALVARDLTKPFLLSEES
                     SVHTQVIPRLPVLI"
     exon            754326..754640
                     /number=1
     exon            754672..754818
                     /number=2
     exon            754900..754962
                     /number=3
     CDS             755333..756361
                     /codon_start=1
                     /locus_tag="AO090023000297"
                     /note="phosphoglycerate dehydrogenase and related
                     dehydrogenases"
                     /old_locus_tag="AO070306000114"
                     /protein_id="BAE58861.1"
                     /transl_table=1
                     /translation="MSQPKLAILDDYQNISPAHFAHLEDRISISYFPETLNPRDERQR
                     ALLIERLQPFDVILAMRERTPFPKETLSALPNLKLLLTTGTRNLALDVQYCASRGIPV
                     AGTGGRPAGVHSTVQHTWALILGLARHVARDDAAVKRGEWQGSLGMTLAGKTLGLLGL
                     GKLGSQVGRIAVVAFDMKVIAWSTNLTQEKADEQAAALGLPAGSFQAVRDKAEFFRSA
                     DVVSLHSVLSERSRGIVGAAELEVMKPTAILVNTSRGPLVEEKALLETLNAGRIRGAA
                     LDVFEPEPLPKDSPWRTTAWGQDGRSEVVLSPHMGYGDEQIHGWYDEVASNLERWLNG
                     EELNTRMN"
     exon            755333..756361
                     /number=1
     CDS             complement(join(756964..757103,758193..759063))
                     /codon_start=1
                     /locus_tag="AO090023000298"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000113"
                     /protein_id="BAE58862.1"
                     /transl_table=1
                     /translation="MWMIRMRRTRAWVISAATSVLIFGSLYLFFFAHRRGGNIYRLVT
                     VPRPVERTNERTLVIAKTQDADTNWVDTLLQEDNLLNSAVYTVDAPNTTASGTTLTVP
                     MNKGHEVMVYLTYIIEHYFQLSDVTIFMHADQISWHNNDLMNMDSALMVRRLRNDYVY
                     KNGYTNLRCQHDPGCPAQIRPTLAGGKYNPDVPEAAVIGESWKTLFPEERMPAVLAQP
                     CCSQFAVSAEVIRRVPLMNYVAYRRWLIETDLDDNLSGRVWEYLWQWIFTGQAEVCPN
                     EQVCHCEGYGVCLGRSCLRRDGMEMSGAMSQASVVPNLCMAWLGQLRVEAKCRYAGLN
                     EL"
     exon            complement(756964..757103)
                     /number=1
     exon            complement(758193..759063)
                     /number=2
     CDS             join(761458..761707,761774..762260,762339..762644,
                     762703..762862)
                     /codon_start=1
                     /locus_tag="AO090023000299"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000112"
                     /protein_id="BAE58863.1"
                     /transl_table=1
                     /translation="MAVPRLSGHPEIGYMPDYDSYLARGKRRQETETLDKNVPEGFPS
                     QLNGSLVWDPRSLANTYDWNYHLTAEELDEINNALRHFKSLNKPMGELSPATFPLPKL
                     HRALREISHEVHNGHGFKVLRGLPVDKYTREENVIIYAGLSSHVAPIRGRQDSTWQGK
                     PADVLVAHVKDLSHGRDSQDIPGPVVTADKQVFHTDAGDIIALFCLSEGESGGESFLA
                     STCHVYNILAARRPDLIRTLSEPWPFDDFAPTGDVYKLRPLLYYQPSTETDPERLIIQ
                     YSRRNLTGYRDCKRSAKIPPLTEAQAEALDAVHFTAEENSISLDFHKGDIQFANNLSI
                     LHARAAFTDSIEKQRHLLRLWLRDPEYEWRKPKDLQERFDRVYAGVTIESSVFPLEAT
                     IRSSNVAT"
     exon            761458..761707
                     /number=1
     exon            761774..762260
                     /number=2
     exon            762339..762644
                     /number=3
     exon            762703..762862
                     /number=4
     CDS             join(764203..764551,764760..765043,765101..765511)
                     /codon_start=1
                     /locus_tag="AO090023000300"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000111"
                     /protein_id="BAE58864.1"
                     /transl_table=1
                     /translation="MRISSLIHRWMVIRVRDLRLIRVRLVVLTSIPGYLSWRKLGDVA
                     ASLYALGYHQQQTESFRTAPSFLRDLRQTAFCRTYSADKNVSIFLGRPPRILRKFCYF
                     HLPGTLAQPNQKAGHADARAQWDALPESYRLEGSLKTCNRPPVERDFMVNMKLNYLHV
                     HFLLRRALLRPMSMGPAPELFNISKDMLGLVVETILLKDQIVNSGTSLVWKVVYYGLS
                     AAGLVSLHLANQSYANEMLEMDISKIFQDLSILVGEIISGTLVYVDSPNYALLSEASQ
                     TIKSLLDRMILPLQISQRMGTTSGNRSAALPGSEPMGTLNDGGLDLWYDSNFQDFEMS
                     FWHHLAGHPFLHG"
     exon            764203..764551
                     /number=1
     exon            764760..765043
                     /number=2
     exon            765101..765511
                     /number=3
     CDS             complement(join(768691..769182,769268..769506,
                     769579..770320))
                     /codon_start=1
                     /locus_tag="AO090023000302"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000109"
                     /protein_id="BAE58865.1"
                     /transl_table=1
                     /translation="MTRWKSSQYQAIIFDLGGVILTWDLPEDTVISAQIFKRMLTSQT
                     WSDYERGNLSENGCYQRLAEDFGIDSADIAHTVRQARESLVTDTAIMNIISEIRAGAN
                     HIAIFAMSNISQPDYAALLLDHRGMCSFDRVFPSGCYGTRKPELSFYNKVLREIDTPP
                     ENVIFVDDQLENVISAQSIGIHGIAYTNAAELGRQLRNLIFDPVERGREFLRRNAGEF
                     HSITETDQIVRENFSQLLILEATGDKYVGQELEFLPRYGSNVQSRTLKPWTNVLCDVN
                     LLGNPILTTETFPDDVDTTSLALMTLPTDTKTANLLLDQILGLVNADEIVTTRERIDP
                     VVCVNVLRLFCTYGRGIALPLTLQWVYDVLAHRAYINGTRYYTSPESFLYFVGQLCRF
                     STGVLALRPLETLLIDRLKERLQVKADPLSLAMRILTCLSVGVSQVEVDLRELLSMQC
                     EDGSWEHCPFTRYGLSKVSIGNRGLTTAFVVKAVEMCRGS"
     exon            complement(768691..769182)
                     /number=1
     exon            complement(769268..769506)
                     /number=2
     exon            complement(769579..770320)
                     /number=3
     CDS             complement(join(771087..771435,771494..771631,
                     771682..771734,771791..771880,771938..772053,
                     772171..772189,772260..772316))
                     /codon_start=1
                     /locus_tag="AO090023000303"
                     /note="F-actin capping protein, alpha subunit"
                     /old_locus_tag="AO070306000108"
                     /protein_id="BAE58866.1"
                     /transl_table=1
                     /translation="MASTVDIASSFIEGAPPGELADVVADVKTLTSNGADIIPSLAPA
                     FERYNETQLATVKLPGASQEVLISEYNKLDGNRYFDVESQTSFEVDHVTQEASAAQSY
                     VLDSQNADLIKSLLKSLGAHAREHYPNCAYGVYPIENDSAVAILLVSNRYSPNNFWNG
                     RFRATYQFPVSEPTTVTGKIQVDVHYYEDGNVALNTNKPLNLSVSSLSAESIISRIAT
                     AERDYQEDLNRAFVQMAEGAFKGLRRQLPITRQKVEWEKVGGYRLGQDISGGKGR"
     exon            complement(771087..771435)
                     /number=1
     exon            complement(771494..771631)
                     /number=2
     exon            complement(771682..771734)
                     /number=3
     exon            complement(771791..771880)
                     /number=4
     exon            complement(771938..772053)
                     /number=5
     exon            complement(772171..772189)
                     /number=6
     exon            complement(772260..772316)
                     /number=7
     CDS             complement(join(772877..773674,773727..774875))
                     /codon_start=1
                     /locus_tag="AO090023000304"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000107"
                     /protein_id="BAE58867.1"
                     /transl_table=1
                     /translation="MTSSTTSSSVSHSVPSLPFASKLSEQLSQRKEQGESVTDTESSG
                     KSTSLGPPLRPSPKSRSLSDAPKPISARSTSEEHRPSSKDDNSLSSTPETPRRPSMQG
                     LPLNLPSKPSGPSSLSSRAPLSPKLDSSQIYGSPGSVLPRRSRGLDFSRACTNLHHST
                     LAESSPDSSPIIVGRGMTIPQRRGSMGSTSVPPFSTSGPADRTAISSSVSSVNMMESD
                     TSSSEEDDEPMMADRDDMIMNTPQANKMGSGMSPFAVGNVPSPGNDWMGGYSQAAASL
                     MSFQRARFRKGRSRHSSSSASGNSSKPSPGPLSPPVMKSIENQNGYFGSRSSLSARRE
                     SLSLGTRDLRLSDLSDEGENRGNSPGTSNSEGGPLGVIRRAVTRRSSLLPKTKTFARI
                     RAALMEESAPIDCEAKREAEVIRQVRESEPEIQQTSPSLDALSSSNPFQPTDLNRNLD
                     DVPAKTGTSVPDEPNFSEEANRNSGGAEFWNHFDERYRTPPPPPLRQMGTSVSEDDLS
                     MDITPSTTMGSTSEFAKPSERPSSRCSTPIATQPISILEFKRKRRREDDFDPNLFKRR
                     AVSPSMSVQSSPVMPNSPAVRDTGTSIWGPPKANIGSLFPDQPSTESGTRNPSTPKHA
                     GHLKRVGLQGMTETNDGLMNMSIE"
     exon            complement(772877..773674)
                     /number=1
     exon            complement(773727..774875)
                     /number=2
     CDS             complement(775465..777189)
                     /codon_start=1
                     /locus_tag="AO090023000305"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000106"
                     /protein_id="BAE58868.1"
                     /transl_table=1
                     /translation="MPRKKAADRVGPVKTRSRSGCKECRASRVRCDTQKPICTRCRER
                     GLVCSTQLVLKWESEFVSRGLAFGRAGVWSKSGSQSKTSPSSASLLDDDQEWCDIPFV
                     ESWGFVNSGVSTFEQPDQVNVACDELNAVVVRDKGKGRLAVKSSWPALVDISEYGPIL
                     QQLPQPTASLSLFPPVTGQNQGHLFEYYLQQVCPRTTASSKLSSPFASIILPFCLSAS
                     PILFKAIQALGACHWSRFDPTYGVIGLHLMSEALRGLRHRLATEGTLSCSTDPEVLAI
                     MMMLCLYEIVDNCDERWTIHLKGAKDLIRLRRQQTMLSKPRGAQDPITTFAELFFAFQ
                     DVMGRTACGEEVLFGSDYWQENERNIDLWMGCSPELVSILSSITELSRTRRQLTSDSA
                     RAAFSLRAASLGHKLENLVQEIDGDDDGDDQTLQTAAELKRLAAVLYLHCALHGASPS
                     TPLVVTYVRKILRLVSDLLDSGSLVSMTWPVFVAAVELDPLHDEVWSDGETVVYGRPL
                     VLRALAAMAESSVSNVARTRAVIVKVWQARDSDMLKGSTVDSLDHTTGCNDWEWYVAP
                     ISTAMSLA"
     exon            complement(775465..777189)
                     /number=1
     CDS             complement(join(777726..777959,778015..778065,
                     778121..778305,778361..778477,778532..778613,
                     778677..778730,778784..779005,779056..779570,
                     779624..779822,779875..780021,780078..780311,
                     780370..780642))
                     /codon_start=1
                     /locus_tag="AO090023000306"
                     /note="sexual differentiation process protein ISP4"
                     /old_locus_tag="AO070306000105"
                     /protein_id="BAE58869.1"
                     /transl_table=1
                     /translation="MSQSRSRGQQSADVEECPHDPTLQGDGAPKKPVTAEEALEIAIG
                     ESQDVEYTIDSDNSPYLEVRANVPNTDDPTLPINTFRMWFLGIVFTLVGTGVNQFFSM
                     RYPSVTITSLVAQLISYPVGCFFAKAMPIMTIRVRGREIPINPDHHFNVKEHAVITIM
                     SNLSFNQSWASAIIQAQKVYLDMPTPVGYQILLALSMQMFGLGLAGLSYRYIIEPPHM
                     IWPSTLANAALFQTLHSGANPIADGWRISRYRFFLYVFIGSFCWYWLPGYIFTGLSTF
                     AFICWAAPNNKVVNNLFGMTTGLGYMPTTFDWSQIAYNTSPLTIPFWAQANVFAGWFC
                     IYAVIAPILYYTNTWYTAHLPLTGSDAYDNTGNLYNSTRILNDEGAIDDAKYREYSPI
                     FLPITFALCYGVGFAVLSCLLTHVVLYHSKDILDTFRGQNKKDVHARLLSRYPDVAWW
                     WYAILTVIVVAVAIMVQYVWNTGLPFWGLFITLALATLYVIPVGTVYAVANLNANVLT
                     VLGEIVSGYLLKGKPLVLLIFKFYAYTGLSQAMYYGADMKLGLYMKIPRRTLFVAQLI
                     ACILGTLTQNGVLLWMLGHVKDVCASDQPNNFTCPQGRVNYNSAVFWGAIGPARLYNI
                     GQRYSGLLHMFWIGALLPIITFFLRRRYPNSRVLNAIHWPIFFAGTGNLPPATGINYS
                     TAFVVSLIFNKIIKGRRPNWWAKYNYVLSAALDSGVAVSAILIFFSLVLPGVSLNWWG
                     NNVNSGTVDSKGTPWLELKPNETFGESTWS"
     exon            complement(777726..777959)
                     /number=1
     exon            complement(778015..778065)
                     /number=2
     exon            complement(778121..778305)
                     /number=3
     exon            complement(778361..778477)
                     /number=4
     exon            complement(778532..778613)
                     /number=5
     exon            complement(778677..778730)
                     /number=6
     exon            complement(778784..779005)
                     /number=7
     exon            complement(779056..779570)
                     /number=8
     exon            complement(779624..779822)
                     /number=9
     exon            complement(779875..780021)
                     /number=10
     exon            complement(780078..780311)
                     /number=11
     exon            complement(780370..780642)
                     /number=12
     CDS             join(781753..782842,782900..783120)
                     /codon_start=1
                     /locus_tag="AO090023000307"
                     /note="FAD-dependent oxidoreductase"
                     /old_locus_tag="AO070306000104"
                     /protein_id="BAE58870.1"
                     /transl_table=1
                     /translation="MTVTKSSSILIIGAGTWGASTALHLGRRGYTNVTVLDPYTVPSA
                     ISAGNDVNKIISSGQYSNKKDEIEVNEILAEEAFKGWTTDPLFKPYYHDTGVVMSACS
                     SAGLDRLGIRVRPEEEPDVSEVTKPEHFRQLAPAVLKGNFPGWRGYHIRSNAGWAHAR
                     NALVAAIREAEKLGVKFVTGTQGRVITLIFENNDVKGAVTADGKIWRAEQTVLCAGAN
                     AAQFLDFKDQLRPTAWTLAHIRLKPEERALYKNLPVIFNIEKGFFFEPDEERGEIKIC
                     DEHPGYTNMVKSADGHLTSLPFEKTQIPKESEARVRALLSETMPQLADRPFSFARVCW
                     CADTANREFIIDRHPEHPSLVLGCGASGRGFKYLPSIGNLIVDAIEDKVPEKVHKLTR
                     WSPDIAVDRKWRDTLGRFGGPNRVMDFHDVKEWTNVQNKDTAKL"
     exon            781753..782842
                     /number=1
     exon            782900..783120
                     /number=2
     CDS             complement(join(783307..783694,783759..783826,
                     783860..784098,784154..784247,784306..784449))
                     /codon_start=1
                     /locus_tag="AO090023000308"
                     /note="lipid phosphate phosphatase and related enzymes of
                     the PAP2 family"
                     /old_locus_tag="AO070306000103"
                     /protein_id="BAE58871.1"
                     /transl_table=1
                     /translation="MPRSGLSAASFSHPAQSGVAGAVARFYQRSFPAVDYLALGCIVG
                     GWILIQLFVTPFHRLFSLDNKAIQYPFAVVERVPVVWSIIYAGVIPFVIVLLWAATFR
                     PKPYKVQVTILGFLVALMLTSLLTDIIKNAVGRPRPDLISRCIPKRGTPENKLVAWTE
                     GWRSFPSGHSSFSFSGLGYLSFFLSGQMHVFRPRTDLCRCLVALVPFLCALMIAISRL
                     DDYRHDVYDVTCGSILGTVVSYFSYRRYYPSLRSVICDMPYDKAGMAGEEGFHKLPSD
                     EEQQVQRPGVPSHQWGAEDEVYQLSETSSSPRRV"
     exon            complement(783307..783694)
                     /number=1
     exon            complement(783759..783826)
                     /number=2
     exon            complement(783860..784098)
                     /number=3
     exon            complement(784154..784247)
                     /number=4
     exon            complement(784306..784449)
                     /number=5
     CDS             join(784728..784988,785048..785572)
                     /codon_start=1
                     /locus_tag="AO090023000309"
                     /note="transcriptional coactivator"
                     /old_locus_tag="AO070306000102"
                     /protein_id="BAE58872.1"
                     /transl_table=1
                     /translation="MADAGQQRPLTAFAPPPPLWKHFTPDNLKKLDEIKKNASKGEDG
                     KPQKKKWTPTELRALDVPPELHFLVPPEIPKSGHYSVFGELQSLSTALPSLQDQGITQ
                     LYPSPPTGDADREQPSEPSQPLNHAYYLLKISKSLLLNFLEFVGILSVAPEQFESKVE
                     DLRNLFINAHHLLNLYRPHQARESLILMMEEQLSRTREEIQQMDKLKEEITGALEQLK
                     KDGVDVDAAPIEAPDNDTKKPNVSEEKAIEDTRLVWELLDENN"
     exon            784728..784988
                     /number=1
     exon            785048..785572
                     /number=2
     CDS             complement(join(786777..787032,787100..787881,
                     788021..788551))
                     /codon_start=1
                     /locus_tag="AO090023000310"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000101"
                     /protein_id="BAE58873.1"
                     /transl_table=1
                     /translation="MSVVSQLTGIPFLLPEGQEWVQSRTGQKLDVEKLSPTRPPWEKQ
                     RALNTCAMYSDLQTGAIFDLPDRTVVELHLERYRLSLIQSIFPIVDKELFQETIDAVY
                     QQPQPDSCYVESSLRACIFAFLAFSSLIMEPCHEGIAPQPPPVDGEKYFMKAHLLIPQ
                     ILQGTPTLDGVQAIASLSLNQALYELFTGSLQSANYFGTLVARMLFMLGAHTSLPDET
                     EYPKTTAGDHRSRVQRQLRIIFWLCFTVEKDVCIRIGQPQMFTDENCDLTLPTGYVEQ
                     LYEDIKVHHFAKEIPRTEITGYPLFPVDLRLSIIKSRAYSTLYSFKALKKTDAEILKD
                     IRELDDELERWRMSIPLEWRPTLSFSHETPDPNVSMHSVMLRLNYHLCMTIIHQASSR
                     CKSWAKGQGGVMDGVSSSLALSVEASRSTLLYIEAAEHVLVDGIFWTLIFYPMSALLA
                     IFCNILQNPSDPQATKDVRLLRTATGMMERLFSRQPFAVAEIVHIKLVADFVSELYRL
                     ATCAIEKAWNERSR"
     exon            complement(786777..787032)
                     /number=1
     exon            complement(787100..787881)
                     /number=2
     exon            complement(788021..788551)
                     /number=3
     CDS             complement(join(790200..790741,790805..791414,
                     791474..791593))
                     /codon_start=1
                     /locus_tag="AO090023000312"
                     /note="serine/threonine protein kinase/TGF-beta
                     stimulated factor"
                     /old_locus_tag="AO070306000099"
                     /protein_id="BAE58874.1"
                     /transl_table=1
                     /translation="MAQYFFDLLYNFTDCMCCFPSTPQLKINNRSFKMLRLLGEGGFS
                     YVYLVQDKATSELFALKKIRCPFGQESVSQALKEVEAYNLFASQSNIIHSIDHSVSTE
                     SGSKFRADGGEAGSKTVYILLPYYQRGNLQDAINANLVNQTRFPEKRLMVLMLGVATA
                     LRAMHQYRVKSGAGPTRKAKAVRREGEEVDTSMRMSKPKRRATQVADDEDSENEPLMD
                     DEVTRSQEGVQDGGLRPYAHRDIKPGNIMIDDDGQTPVLMDLGSLAPSPIAITSRSLA
                     LAVQDTAAEHSTMPYRAPELFDVKTGSIIDTKVDIWSLGCTLYACLVGKSPFEARSEE
                     TGGSLSMCVLGGDWRFPDEKPGTSKGKGKAGDESRKDATTTISAPVKDVVRKCLQVEP
                     ADRPDIDELIQILKDVIKDLPDDDELAGSSR"
     exon            complement(790200..790741)
                     /number=1
     exon            complement(790805..791414)
                     /number=2
     exon            complement(791474..791593)
                     /number=3
     CDS             792905..794926
                     /codon_start=1
                     /locus_tag="AO090023000313"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000098"
                     /protein_id="BAE58875.1"
                     /transl_table=1
                     /translation="MAPLDDIQVGDLVNVPGGMYGTIKYLGGVAGKPGKFAGIELAAE
                     HARRGKNSGDVEGKKYFSTSTPGSGIFVPMNNNKYVTKRLSAPSIPSVNPPTPSRPIN
                     FSKSVGPGLSPAVRTPRPVRRPSLPRAESPRGPPPSKLSLTGLRTPSGASRAASSNGC
                     PRSPVKAPSRTSTSRPPSRLSVDDDIQSTRSSDIQRKAMAAEVQELTDQVRSLEKQLL
                     DRDRQLDEQANTLAEFHRMLEEFEGSDSLSIRAQLREKNEKIAQLTTEFDLHRADFRS
                     TLDTLEVAAAETERVYEQRLDELMQQNKELQDRGEDVEAVARQLKQLEELVSELEEGL
                     EDARRGEAEARAEVEFLRGEVERTKLELKKERESSSHAVGDGQQHSRELDQKDDEIRG
                     LKAIIHSLSRGDPDLHALEQNELGAPQLEYDSEHVAHLERRVEEFERMTERKTFRIEE
                     LEHELQQLQLNGDSRPRNPATNGSHSYHKSSSSIGKIGGEHTVNHAHRLSDRTVVPGD
                     WHDQSQHDDQYQAYPGRLRSTSESSHQRLETMHESDARSDDGASLWCEICETGGHDIL
                     SCTNMFGAEQKNKSNTDTKEPSQEDSTDEKFTPETSPAPESAQSNHEDSTTPQKTGRD
                     VVLEGLKGVATTSSMAPVAGKASGAVDESKWCALCERDGHESIDCPFDD"
     exon            792905..794926
                     /number=1
     CDS             complement(join(796641..797187,797321..797352))
                     /codon_start=1
                     /locus_tag="AO090023000314"
                     /note="3-hydroxyanthranilate oxygenase HAAO"
                     /old_locus_tag="AO070306000097"
                     /protein_id="BAE58876.1"
                     /transl_table=1
                     /translation="MLPPALNIPKWLEANSHLLQPPVNNYCVYHPSSPATAGYTVMIV
                     GGPNARTDYHINTTPEFFYQYRGSMLLRTVDTSASPPVFQDIPIHEGSLFLLPANTPH
                     CPVRFKDTVGVVMEQPRAEGAVDILRWYCKSCGEIVWEKRFVCTDLGTQVKEVVEEFG
                     ADQEKRTCKACGTVAETKYKEGELVQPPRFLE"
     exon            complement(796641..797187)
                     /number=1
     exon            complement(797321..797352)
                     /number=2
     CDS             797649..798857
                     /codon_start=1
                     /locus_tag="AO090023000315"
                     /note="RNA 3'-terminal phosphate cyclase"
                     /old_locus_tag="AO070306000096"
                     /protein_id="BAE58877.1"
                     /transl_table=1
                     /translation="MATSQPPLRFTGHKNFVYRLVFATLTGRTVHISQIRPSSPTNPG
                     LAPHEISFLRLLEAVTNGSQLEISYTGTIVVYKPGLITGSGAGAGSGGVIRHELPAGC
                     NRGVSYYLLPLCLLAPFSKAPVKVLFTGPGVITSSTPTGDMSVDSVRTAILPLYNQFG
                     IFNNIELRILRRSNPGHNGRGGGGEVQLVFGHQVRLPKTLHLMNPGRIKKIRGVAYAV
                     GVSASNNARMIETARGVLNPLVPDTYVFSDVSSAPLVPAPEKSNPSAKKKIGLGFGLS
                     LVAESSTGCLFSADVASPPSGGQAPEDIGKQCAYQLLETISKGGCIAPAAAATMLGLM
                     TMGSEDVGRIQLGRDVIADEGVIQLARDLAKFGAPGWGLREAAGENERGDIVVSVVGR
                     GIGNVGRKVA"
     exon            797649..798857
                     /number=1
     CDS             join(803984..804009,804135..805764)
                     /codon_start=1
                     /locus_tag="AO090023000316"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000095"
                     /protein_id="BAE58878.1"
                     /transl_table=1
                     /translation="MDNYRDYSSIATDPPSLSLGYSIVHSPPFTFLVGANHTKLTVQS
                     GLARHVSQPLDHLMNSGETRESKHHIAVLEEEDVETFVAFCEYAYTGDYSVPGPDNRE
                     EYQEQVVNNPFKGVFSGEPVLAQPDPKPSDETDKGQSKPSEEVQPQPEQAPPTPEPEY
                     PLEENKAPEEPLAAPVEPPQEPEPVPEPAPEEPVEQPPATPAVEEGEPADANEGAGSG
                     KGKKGKKNKKDKKKKGAVAAEEPTTNLTPPSTPPPQKLEQVENPPVDETPAPAEEWNQ
                     PQESIEPPADAEAAQPAEPVQAEVDTWERSAPTPQEPETVEPERTSVKAETKEEEKVT
                     EEPKPSHFRTNSFIDMSFARQRFNFQHESGSNLWDEFAAMDYHDPRQTHGNRPPSSLS
                     YSASTKGDLPYLVFHAKLYVFATRFLIPALAQLCLRKLHTDLLNLGFPEHPMDSQDEE
                     TFALTTTKARMILDLLDYTYNKTTRLEPISAISATQLRDNELRRLVVHYAACKIRDLA
                     EFCPPEENTAGMPYPHKRSAKGLRPLLDTTTELASDLVYRMMW"
     exon            803984..804009
                     /number=1
     exon            804135..805764
                     /number=2
     CDS             809835..810977
                     /codon_start=1
                     /locus_tag="AO090023000318"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000093"
                     /protein_id="BAE58879.1"
                     /transl_table=1
                     /translation="MLTPPKFEDEKQLGPVGIRERLRHFTWAWYTLTMSGGGLAVLII
                     SQPFGFRGLREIGIAVYILNLILFALVCSTMAIRFILHGNLLESLRHDREGLFFPTFW
                     LSVATIICGLSRYFGEESNESFQLALEALFWIYCVCTLLVAIIQYSFVFSSHKYGLQT
                     MMPSWILPAFPIMLSGTIASVIGEQQPARAALPIIGAGVTFQGLGFSISFMMYAHYIG
                     RLMESGLPHSDHRPGMFICVGPPAFTALALVGMSKGLPEDFKLLHDAHALEDGRIIEL
                     LAISAGVFLWALSLWFFCIAIVAVIRSPPEAFHLNWWAMVFPNTGFTLATITLGKALN
                     SNGVKGVGSAMSICIVCMYIFVFVNNVRAVIRKDIMYPGKDEDVSD"
     exon            809835..810977
                     /number=1
     CDS             complement(812228..813046)
                     /codon_start=1
                     /locus_tag="AO090023000319"
                     /note="mitochondrial J-type chaperone"
                     /old_locus_tag="AO070306000092"
                     /protein_id="BAE58880.1"
                     /transl_table=1
                     /translation="MTASLRPQRLLPRLSSATSRTTSGTRPSFLDQTPGTCLICQFRP
                     QSTIRVPRVHHLQQTRRFASTSSSPNATTTDNNGTIQNIPDITNHYTIFPKTLPAGPP
                     PSSPFHISVSDLRREFLQLQGTIHPDKYPPGPSKQQAEALSARINEAYRTLSDPLARA
                     QYLLREMHDIDVTAEDGAAHHALDPETLMEVMEVQETIEEVGAEPGAESTIAELKKQN
                     ETRVVECVEKLANAFDAGDLESARQECVRLRFWYNIAQGLKEWEPGLTEIRLVH"
     exon            complement(812228..813046)
                     /number=1
     CDS             complement(join(813561..815057,815331..815372))
                     /codon_start=1
                     /locus_tag="AO090023000320"
                     /note="U4/U6 small nuclear ribonucleoprotein Prp4
                     (contains WD40 repeats)"
                     /old_locus_tag="AO070306000091"
                     /protein_id="BAE58881.1"
                     /transl_table=1
                     /translation="MMHPSRQAYVEEAEIPSAAAGIPSERASAILSQFERKRRAAAMV
                     VPTDDSRVRARLRELGEPITLFGEGPADRRDRLRELLTDLAEQQDAAAAEGDVDMREA
                     TQEAEEEEAEQQEEFYTEGSQDLLEARKAIARFSLPRAKQRVARQKEESTIPLRTHIK
                     HRKAVKEKLHGFDLYGSQIAGDRPVSICRFAPDGQTIATGNWGGGIKLLTVPNLEEKR
                     SFKAHTDRVGGLSWFPGATLSTSNVSESTVNLVSGGGEGNVCLWSLDQDQPIATLSGH
                     SGRVCRTEFHPSGRYVASASYDTTWRLWDVETTAELLLQEGHSREVYTVSFNNDGSLL
                     ASGGLDSIGRIWDLRTGRTVMILEGHIREIYGCDWGVDGYRVLTGSGDGWVKCWDLRQ
                     VRNTGGIGAHKSVVSDLRWYKGTESTSSYLPSTDGQNGRMDVDGDQPPQSTPVQPRKS
                     GTFFVSSGFDKNVNIFSADDWSLVKTLSGHSGNVLSTDISDDAQWIASCGHDRTVKLW
                     GIDS"
     exon            complement(813561..815057)
                     /number=1
     exon            complement(815331..815372)
                     /number=2
     CDS             816310..817602
                     /codon_start=1
                     /locus_tag="AO090023000321"
                     /note="serine/threonine protein phosphatase"
                     /old_locus_tag="AO070306000090"
                     /protein_id="BAE58882.1"
                     /transl_table=1
                     /translation="MTPLVFLRRACSPTCSRLQPVTRDRLLASFSNSTPWPRSSPISS
                     SSPPPRRSFHSTRSLDSESPRISYRVAASSSGKGRRFHPAKNTSDFDPQRHHAIGVAT
                     DVKSPAIRRQRRPDSGEDAYFVSRVGQHDNGAVAFAVADGVGGWAESRVDPADFSHAL
                     CGYMAQSALDWDAPAEQLRAKALLQAGYDQVVADESIRAGGCTASVGVGLDDGRVELA
                     NLGDSGSVLLRLAAVHHYSVPQTHGFNTPYQLSIIPPRMRTQASIFGGAFLEDFPRDA
                     AVTNLQMQHGDVLLLATDGVFDNLNNQDILKLITSRMVLTGAWTATPDVGIKPSIDLD
                     QLTGPEGLASLIPSSSTQASQHHRSTNKSHLYSLPSLLAATIAGEAKLASVDMRRDGP
                     FAKEAQRYYPGDWYRGGKVDDIAVLAVVAVEEGYVPSP"
     exon            816310..817602
                     /number=1
     CDS             join(819386..819533,819667..820126,820188..820557,
                     820619..820847,820906..821516)
                     /codon_start=1
                     /locus_tag="AO090023000322"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000089"
                     /protein_id="BAE58883.1"
                     /transl_table=1
                     /translation="MAEDTPTASAPAPDAAESVERAPAELKESTPEATKEKEETTNGS
                     EEKPSEKKETDEKSTEKPSASESTDAKKPEENAAPAESEAAPASEANGTPASAKKSGG
                     SKRKSTGAVPEHKSKLNRKKSQARITNLHAKPGEYYLARLRSYPPWPSIICDEEMLPK
                     SLLDTRPVTAQRPDGTYREDYAEGGKRAHERTFPVMFFETNEFAWIPNTDLSPLEPAA
                     CKEVSEKGKSKLLLAAYSVAADGHDLQHFKTLLADHQRAIEQEEEEREAQAAAKAAAK
                     AEKDAKKNKRKSMEIVDDEDIDMEDADEEAKKPKSSKKRKKDAEADAEEKPAKTPKTG
                     TKLKLTTPKTPASEKKAPASSKTKQTASTKKSGKAAASDESEESTPPAPKEPEKQVNP
                     EEAKAKKEKEILFVRHKLQKGFISRDQPPQEEEMTSMSTYFTKLENYQDLEVSIIRST
                     KINKVLKMIVKLSSIPRDEEFHFRRRAVDLLSKWKTVLDADTTPGPSEDKRKPRANGV
                     HKEDSVETPARGDTEGEKEDEPKPTKPETKDEEMTDADAKEKTEAPEAAKEESDKTTS
                     KADEPAVEKTTEEKGSEEKTTEEKPAGEKTEEKTAEASA"
     exon            819386..819533
                     /number=1
     exon            819667..820126
                     /number=2
     exon            820188..820557
                     /number=3
     exon            820619..820847
                     /number=4
     exon            820906..821516
                     /number=5
     CDS             complement(822900..823715)
                     /codon_start=1
                     /locus_tag="AO090023000323"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000088"
                     /protein_id="BAE58884.1"
                     /transl_table=1
                     /translation="MPSKSKSKSPYQFSYTDAIQGKELYSYFGNRVLESRASGGRVVA
                     VKQKSTRGFARSEADMMHYASQQPGILAPQVLGCYDVDPEITVTVSDLVEGDSLDNVW
                     HTMTKEERKSIKQQLKEQLRLFRQCTQPYIGRINRQETKNFYDRLEIHFMGPFESEEE
                     FDSWCLERVKSPTAKKIWARLLPGMRGSGEQKFVLTHGDLAARNIMVKGGKITGIVDW
                     EYSGFFPEYMEYALATVIHDGHEDWWKPHLKEILEPCGFKRARFTAAIKWRGW"
     exon            complement(822900..823715)
                     /number=1
     CDS             join(826197..826437,826494..826591,826646..827209)
                     /codon_start=1
                     /locus_tag="AO090023000324"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000087"
                     /protein_id="BAE58885.1"
                     /transl_table=1
                     /translation="MFCNFAILFIWYLLCRPSLGWGDVGHRTVAYIAEHHLTKEGIGL
                     LNDLLPKKHGFDVSDAAVWPDHIKHRHPETAPWHYVDVEDDPLNNHCKISPLPRDCET
                     TGCIISLMKDMTVQVNDHSANQTEAVMYLFHFFGDLHMPLHVEGYAKGGTKVDVSFDG
                     HSDHLHSIWDTDMPHKINGIKHRQKHNAEKPASQKWAEHLLQQNKHRPTTAECTDVTN
                     PHRCIKLWADESNRLNCAVVFKRGIPYITNEDLAGEYYDDAAPIIEEQIYKAGVRLAA
                     WINALAEERRSRTGFVVQGDRLDL"
     exon            826197..826437
                     /number=1
     exon            826494..826591
                     /number=2
     exon            826646..827209
                     /number=3
     CDS             complement(join(830365..830380,830512..830722,
                     830857..831384,831444..831468))
                     /codon_start=1
                     /locus_tag="AO090023000325"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000086"
                     /protein_id="BAE58886.1"
                     /transl_table=1
                     /translation="MKAALCFFWALSLATVSSAWPQNQAATSRDIQRPALESSHEYSP
                     AHYPFPDVILPSLETSFSPRLAIVKRDNNAEKPPSHCLRAREFPAEFDTLAISLKLAN
                     VDWAGTSSDVTISVTVNDKGKVPVFKGNVSPSVNAHQTISLKSADYFGAEKINLTDLK
                     VLKIYAYHNGHIFDAFEGLQFNLEARRRLRNRAKSGTLRTISGTPASLERRVHMVTNF
                     GVSEERLLSQPVYFDGLFVRYRTLASGLVARLRQLPRYVWA"
     exon            complement(830365..830380)
                     /number=1
     exon            complement(830512..830722)
                     /number=2
     exon            complement(830857..831384)
                     /number=3
     exon            complement(831444..831468)
                     /number=4
     CDS             join(832978..834106,834164..834308,834454..834517)
                     /codon_start=1
                     /locus_tag="AO090023000327"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000084"
                     /protein_id="BAE58887.1"
                     /transl_table=1
                     /translation="MDLAKGNTCEGVSETLMPVVHAMIKEFIRVSDETGFKSVLNEIG
                     DEITRFLNYPGIREGWKFLNTRLEDIPVIGLWFKTVGKAEGWTYEHLVPKSLRDSLQS
                     CANDGIRHPAQNPLGFLLALGIDTIEHPTILDILLAIPGVGEFAESIKFAEEAVKGAE
                     DAAKIAERLSNVVASDGVASDLDKIAKLADKADASADAAEAAAGSAKGTEQEAKALEQ
                     ATKADEASKAADKAFYDGENEAKKLCPRGITSSLMSWWCSPAEQAPAEEGPADNAARS
                     RARRNRKKRRNRRINKKAEPESEPETQPETESESEPEPTQPQGQPKPQDRPQNKPQKQ
                     PEPEPEFLKNTRFSRRNVERSIERGTSSLKGGITYVATDGKNTFPHHFSNFENIDFEL
                     PNPNEFNMKDLQEFPLTQTVFNTGMQPGPYRTVVGTFDDVWLFSGICVWQCAN"
     exon            832978..834106
                     /number=1
     exon            834164..834308
                     /number=2
     exon            834454..834517
                     /number=3
     CDS             join(836428..836517,837453..839207)
                     /codon_start=1
                     /locus_tag="AO090023000328"
                     /note="choline dehydrogenase and related flavoproteins"
                     /old_locus_tag="AO070306000083"
                     /protein_id="BAE58888.1"
                     /transl_table=1
                     /translation="MSTPDYKHERGGGGGGVGFSDLSVPRLYKCVIVGGGTAGLALAS
                     RLSRGLPESSILVLEAGPDAENEPRINIPAMRGSAIASAYDWNFTTVPQPHAGNRSLT
                     QPRGKVLGGSSALNFMSWDRASKVEYDIWGKLGNEGWNWSEMMRSMLKAENFTLSDKY
                     GDQGVGFGGPIQTMVCDWVPEHQTFFMEALKSLDVLENRNSLGGNSLGSGFQPSNVRY
                     SDRKRSYSAHHPGYPSLAGPNLQIRVGRRVRKINLVSIGGEDLVATGVTLEDNTTVLA
                     IKEVILAAGTMQSPGLLELSGIGQKDVLHAADVQQLVDLPGVGENLQDHLRIQNSYRL
                     LPNYTSVDMLKTNATFAKQQLEAYNTGQRSIYDYSGGSYAFLNWTGVADEPSRMESLA
                     RKAADEPLSLSPFERIRADIQLHHIRHEEENVPQMEIISADGYTGIKGYPPETSPLHG
                     SNFFTLIAVMLHPFSTGSIHVTSPLISTAPQIQPNYLSHEYDIQALASAAKYLRKLAS
                     TAPLRQAWTEEYEPGLSVVGDGPDSDSQWREYAINNTETIFHPVGTCAMLPRELHGVV
                     NANLTVYGTDNLRVVDASVMPVLISGHIQTAVYGIAEKAAEMIIKRWQ"
     exon            836428..836517
                     /number=1
     exon            837453..839207
                     /number=2
     CDS             join(839688..839936,840008..840045,840104..840141,
                     840193..840272,840331..840413,840474..840913,
                     840970..840982,841023..841098,841329..841370,
                     841420..843687)
                     /codon_start=1
                     /locus_tag="AO090023000329"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070306000082"
                     /protein_id="BAE58889.1"
                     /transl_table=1
                     /translation="MLLNMPHLSPISSKAILRSVSQQGPKVAGSTGPCRYLSTTAPAQ
                     KNVTLLQDKKNGFGFARSNPRPPKPRSKGVTEIRGPYYTVMGKRYLADVLETMGTHVD
                     GLKFAGGSFSLFQEKPLRELIDLAHEHGVYVSTGGWAEHLLTHPDTNAVFDKYLQKCK
                     DLGFDVIELSSGFLSFPEDDWLRLVDKVHSYKLKAKPELGIQFGAGGDTPASGLEAIG
                     TSDPGKLVNLGHKFLNAGVERLMIESEGITENVESWRTDVVSKIMKELPPERVMFEAA
                     DPKVYNWYIREFGIDVNLFVDHSQIVQLSCLRHDCLFLGSQFEWIYAMVVVIDDDSID
                     KCPQAITTGPRDLALRRYFIQSPYSSVAPIVMPKVTAAPGGRLRCRRACDSCKRRKQK
                     CNGEQPCTICVQRHKESECHFSDKPARLLKPSESSKDTMLLSERLVPTPQRQTAMDRL
                     LNSLEDRSANLEQQVVDDKDGTAPVPKVARLLRDGQGKFMYIGDSASLSFLQSVRRIV
                     SSSIGRCEFTEDNSRHSMLEAFQSSSTTQTGPLIPPPGNEEAQRLARQYVLATSPLLD
                     LFDLEEFHPRLANWIENPTGDEDTVSSIFYLVLAIGAQVSDTNHTLAEKYFISGRQLA
                     FSAFTETPSISTIQSYVLISMYMLGACRRNGAFMNLGIALRAAYAVGIHRKDANTLFC
                     TRERRARERVWKSLRMMDLFLSASLGRPPATTDFDYEPHDGNTTSGTQQRLQPEEQLS
                     LTVVSLCRIFERILTEVYMRQVVSISVADSISNQHRAWVRNLPTFLRMQTERLDAAKT
                     LEDTLAAAHIFGSYYWSIILLTRPFLVFRVSQYVKNKSESAAFSESKPSNSKISLFAD
                     ACVYSALRSLNVVDDLSQYSSLPRRLPFLINSVFNSAVVLGAAFFADYDNLLPLEEGL
                     NKAEKFLGLFVPHDPHACRFFQIIKYLRGAVGEYVHRRNRQWMERRSKQVDQLFGEVG
                     PSNETSTPSNNHHGISMNRGDHPTVPSPLSPDKFAGGPFSSQSLGQTTATAQPDDGIW
                     DALCATEGPSPFPYDTAISTLTTTGIPIGCSPGGTIPTGPPGMPDNGGQTPLSDMILS
                     DNGLLYMAEDLPVFGLWGDT"
     exon            839688..839936
                     /number=1
     exon            840008..840045
                     /number=2
     exon            840104..840141
                     /number=3
     exon            840193..840272
                     /number=4
     exon            840331..840413
                     /number=5
     exon            840474..840913
                     /number=6
     exon            840970..840982
                     /number=7
     exon            841023..841098
                     /number=8
     exon            841329..841370
                     /number=9
     exon            841420..843687
                     /number=10
     CDS             join(844542..845619,845697..845701)
                     /codon_start=1
                     /locus_tag="AO090023000330"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000081"
                     /protein_id="BAE58890.1"
                     /transl_table=1
                     /translation="MRILLLLLIQAAVAAAAPDQFQHWYKQFRSQIEFVLNNNCSEQY
                     QNYLNKTPGFDPEYQLWYDPTKGSALTAPLVSCMLSNLPENVKANMASAGVILGLLPT
                     MLSMLGSNTVDTAILARVAGRPFLSLCLALGSPAVLPDRPFEYPNVKALLGADGIKKG
                     LTIPKPGGRTWILISALEYIVALGAVANIVTACYQLGIQCICNYATEVTAQSLIWAFI
                     VGLVHIGGTIALSLRYRVIRSPVGETHTVQPNWFRRYLIREINPSLYSTPPPDVDEIE
                     ESYLFLLFSWCVSTGAVVHILYGTMVLSSLLFISVQDALALAGRFLASVVCCRAVLAY
                     ELAGLRQAKAGNMGNGEGSETLELRL"
     exon            844542..845619
                     /number=1
     exon            845697..845701
                     /number=2
     CDS             join(845752..845769,845975..845997,846321..846876)
                     /codon_start=1
                     /locus_tag="AO090023000331"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000080"
                     /protein_id="BAE58891.1"
                     /transl_table=1
                     /translation="MTSTVEALTGNPRSHERKHNRPIIHNPCFYASCFLPAQALIQRK
                     HTSVPTRHASQFASGIRLTLAMLDNVMGATVARNLAVIARAALRAAAGLNHTTGLVVA
                     AAVGEVVGLVVEVEGLVARAVSEPGQNASVGAGAFALDPDDPVVGLVVVLELLAVSDG
                     DGTGHGGWHWGWVGQDGGDEWEGGEEGFELHFCDCSLG"
     exon            845752..845769
                     /number=1
     exon            845975..845997
                     /number=2
     exon            846321..846876
                     /number=3
     tRNA            complement(848727..848872)
                     /locus_tag="AO090023t00013"
                     /note="tRNAscan-SE"
                     /product="tRNA-Tyr"
     CDS             complement(join(849441..851494,851550..851577,
                     851666..852970,853060..853116,853151..853348))
                     /codon_start=1
                     /locus_tag="AO090023000332"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000079"
                     /protein_id="BAE58892.1"
                     /transl_table=1
                     /translation="MGFLGVYTALYDYHPQAQGELELREGDLLYLLESSNEDDWWKAK
                     KKAEHDDEDEPEGLVPNNYIEEFGIIEGILVVLRASRPLFGAQPIHSAKALFDYTRQT
                     DEEVSFSEDAELVVYDTSDPDWTLVGVSGDFGFAPANYIEIVEQAAQTPVTSSVPSPP
                     AEAAPPTLPQRPAAAPTEEPSNPVSSSPIDTVQNPAAAAIADIIHKQHAEPEATRAVP
                     PPPQPQPLYEPEPSYQREPSPPPPALPQRPPSQQISPRVESPRSPGLPPRPPQITMAQ
                     EQDVKGHVKESPPYNRVGPAPRSPSGYHIYNVNEMVEVMGKRKKMPTTLGINIATGTI
                     FISPEDDGEEQEWTADKLSHYSIEGKHVFVDLVRPSKSIDFHAGAKDTAREIVAALGE
                     ISGAYRAEGLREVIAAGSGGGGQKKGQILYDFVAQQDDEVGVNVGDEVIVIDDTKSEE
                     WWMVRRVKNGKEGVVPSSYVEITGYASNSQPSGVDSGLSAVERNRLEESRLAKEALRK
                     SRTDSVDSPRAERDSRSSQKSKPDPTKTRQWTDRTKTFTVEAQFIGLQDGKIHLHKMN
                     GVKIAVPIPKMSLQDLEYVEKMTGVSLDEDKPLSDIKRRSTQREPEKPRPSADNKRPE
                     LAGASFQQSDYDWFDFFLKAGVGPHQCERYAQNFTKDSMDESILPDITPEVLRTLGLK
                     EGDILRVMRHLDTMFGRTGAKSKLRNVSFGGEEVISNGEDGGGLFAGPGGVLRNNTRK
                     GRPAPAVQTGDVVDPKAFEQKDDTNNAEPKEASPTSAPSEKPVQRGFDDDAWEVKQPK
                     QAAPAPAPAPAPAPAAATPTSPPAAASPATTQPPQQQLTGAMADLSVLHPPLQPTPSQ
                     PTPASQPPPASQAPPVIQPQPTAVPAPAPQQPQQTGATPGFFSQLGQPGQQSLQNPAQ
                     GFSPQATGFQQASRPRPQPPQTLGQNSLLPPPPQRPLSAPQNFPQQQSSFGLPPLQPQ
                     LTGLPQAGPPLAAPGQSLAELNQQRFQQPLQPQPTAFMPQNQFQNGLMPQPTGFQPQS
                     QFGIQQQQTGFQGLAPQPTGFGFQAQPQQSMQTGINSVLPPPLQPQPTGMNGVGSMHY
                     TTSPPPIPPIPQQPTAAPLTPQKTGPAPPIRFGVKHDAPKKLAPQPTGLRANLAQASK
                     FHQQYMSLVVTNHVVQRPRIRSVSNLNMYIIFFAFAAHDIYLIHYLLSTTAVPHANHK
                     TRVFLPLTP"
     exon            complement(849441..851494)
                     /number=1
     exon            complement(851550..851577)
                     /number=2
     exon            complement(851666..852970)
                     /number=3
     exon            complement(853060..853116)
                     /number=4
     exon            complement(853151..853348)
                     /number=5
     CDS             complement(join(855223..856674,856745..856861))
                     /codon_start=1
                     /locus_tag="AO090023000334"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000077"
                     /protein_id="BAE58893.1"
                     /transl_table=1
                     /translation="MGRRNRIVASLLTLACATSTALANKKAFNIHDDLLAFPQFQVLF
                     PDEYVLDSHAKELLKTQSSPPVYDDQQGNSLQKSQIPLKPRTDESPDTSSQQEGGPQL
                     TYEELTLQGQRFLCQIPQVETDERSPTNETKEASETDEEQELARATDRGLELLSEMEG
                     KCMYYVSGWWSYSFCYKKQIKQFHALPSGSGIPSYPPMEDPATHSFILGRFPRASDDE
                     EDGEAERKKTAETTTTATTTDVAELQTNGGSRYLVQRLEGGTKCDLTGKNRKIEVQFH
                     CHPQSTDRIGWIKELTTCSYLMVIYTPRLCNDVAFLPPQQEEVHSIECREVLLPDQVP
                     DWEAMRQYHLAQRLVESSTTTSEFPIVGDIEVGAKKLVGTEGKEIEKGRVASAGEEKV
                     EVVAKRENGEVLQLSKVDLEKLGLDPEKIETLKTRLEELAQGKDWTLEHVTANGERGL
                     RGIVDTDEDEEEEEKQAKTETESKEHNTLEEPQEKAPTEKKVPEAKPKGEPKEEPPTE
                     NVEEGSEEIFKDEL"
     exon            complement(855223..856674)
                     /number=1
     exon            complement(856745..856861)
                     /number=2
     CDS             858082..858990
                     /codon_start=1
                     /locus_tag="AO090023000335"
                     /note="pirin-related protein"
                     /old_locus_tag="AO070306000076"
                     /protein_id="BAE58894.1"
                     /transl_table=1
                     /translation="MAVPRAIRQVFLAIEQAEGAGARVRRSIGTAKLRNFSPFLMLDH
                     FTIGKGAGFPDHPHRGQETITYLLSGGVDHEDFAGNKGTIGPGDLQFMTAGRGIMHAE
                     MPHENPDGSPNVGMQLWVDLPKNLKMCEPRYRDLRASEIPVAKVDDDRVTVKVISGQS
                     HGVDSVRDLAYTPVWLLDVAIRPGGRISQALPKGWNAFAYTLSGTTVFGSNDSTKLVK
                     EFHNVVFDQGGDYVEASVPDNAESESRFILVAGQPLDQKVVQYGPFVLTSQEEVYQAM
                     VDYQTASNGFERVRGWESEIGKRMAF"
     exon            858082..858990
                     /number=1
     CDS             complement(join(859570..860015,860076..861660,
                     861781..862017))
                     /codon_start=1
                     /locus_tag="AO090023000336"
                     /note="dolichyl-phosphate-mannose:protein O-mannosyl
                     transferase"
                     /old_locus_tag="AO070306000075"
                     /protein_id="BAE58895.1"
                     /transl_table=1
                     /translation="MSQSPSPSLRKRGGKKEASPGPSEVSSPYPTNQGATPKPQSEWD
                     YRLAITVLTVLAFITRFYRISYPDEVVFDEVHFGKLLFAAVGWLIGYDGHFLFENIGD
                     SYIDNKVPYVAFRALPATLGALTVPVVFLIMWESGYSLPACVLAAGLVLFDNAHIGED
                     RLILLDATLVITMALSILCYVRFYKLRHEPFGRKWWKWLLLTGVSLSCVISTKYVGVF
                     TFVTIGAAVMVDLWNLLDIRRPAGALSMMEWTKHFAARGFALIVVPFFFYLFWFQVHF
                     AILTRSGPGDDFMTPEFQETLSDNALAAESIGIQYYDAITIRHKDTKVFLHSHWERYP
                     LRYDDGRISSQGQQVTGYPFNDTNNQWQILPTVPLEDNEGQGHSVRNGDLVQLLHLGT
                     DSILLTHDVASPFYPTNQEFTTVTKDVASGERHNETLFEIKIENGKAGQEFRTLSSHF
                     KLIHYPTRVAMWTHTTPLPEWGFKQAEINGNKNVLQTSNLWYAESIESLEEDSPRKQK
                     EERKVKQLPFLRKYLELQRAMFFHNNALTSSHPYASEPFQWPFLLRGVSFWTKNDTRE
                     QIYFLGNPIGWWIASSLLAVFAGVIGADQLSLRRGVDAVEEIWGPGARSRLYNSTGFL
                     FLCWGAHYFPFWLMGRQRFLHHYLPAHLASCLVTGALIEFIFNLQPVQAVTDSEVDPS
                     GKSKSIRPRHFVTAKERMSRKSLVACWIATLSILAVTVWGFWFYAPLTYGTPGLDVAG
                     VNARRWLGYDLHFAK"
     exon            complement(859570..860015)
                     /number=1
     exon            complement(860076..861660)
                     /number=2
     exon            complement(861781..862017)
                     /number=3
     CDS             complement(862677..863792)
                     /codon_start=1
                     /locus_tag="AO090023000337"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000074"
                     /protein_id="BAE58896.1"
                     /transl_table=1
                     /translation="MVELISPPDPRTLLPPLLACLPTAFVSPLPPPALLPLLSPVLRQ
                     RVQVLSSLAASPSESWLRLLCWDSGKAERLQTIVDETSFEPHPVSGEIELPDEVPVEY
                     KRVDEETLQSRVLLSDYRLKAIYLWCPNDKDGGGPGWRIAELLPHEDSRADGDVWSAS
                     IGEANSHSKERLIEDTLRAAEKEEEAAKDEEDDDDDDGYWAQYDATPGRTPSVKTPAP
                     NARSGLQHQDMSEASYFSRYADVQPAMDNHDPSEEQPELGPSSLGGDLLANLLKPHAD
                     NEASENPLQLNGHGDTDRALNHPRPSSASSNSSEAVAKLELEAENQSACEVGVKQHIS
                     SNIKSLFRLARATGITRAEFQSLVRTELELLNVSDDD"
     exon            complement(862677..863792)
                     /number=1
     CDS             join(865109..866089,866141..866542)
                     /codon_start=1
                     /locus_tag="AO090023000339"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070306000072"
                     /protein_id="BAE58897.1"
                     /transl_table=1
                     /translation="MIKEKAPEVGMAPSPLTPDVLESSGRELVEAALPEELKELERRL
                     RWKVDLRLCTIAGILCSLNLLDSGILSSASVTTMLSDLDLEGTRYSVSIFIFTIASVV
                     FQLPCTVAVRWVGPRIWFASITSCFGLLTLCTAFVQTWKQLIALRVLLGMAMSGIYPG
                     LTYLISTWYTRREQQLRFAFLQSGEVTVMATGTIVNYGLNHLDGRAGLSGWRWMFLVQ
                     GLITCVIGIITYWWMVDFPETAHRSFYFLSEAEAQLAVQRIQADRDDVVPEPFSWSKV
                     AVNFLDPKLYGFACLFFILNLVSTALSYFLPIILQSGMGFSSNAAIILSTPPYYWSVV
                     PVLFTSLVGDTYRLRGPLITFNALCLIAGFLMFGLPSSTQVTVRYIGTFLATGAYVSN
                     WAALNAFMANNIVGQWKRATTAAAVSACNGLGGVAGSYIVRQQEAPQYQTAVWVSVGY
                     VLIRQLLHEA"
     exon            865109..866089
                     /number=1
     exon            866141..866542
                     /number=2
     CDS             complement(join(866974..867271,867348..867590,
                     867672..868233,868293..868490,868542..868785,
                     869614..869748))
                     /codon_start=1
                     /locus_tag="AO090023000340"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070306000071"
                     /protein_id="BAE58898.1"
                     /transl_table=1
                     /translation="MQGDAHYSELSRNDNDYMPVELEAAPAFLVQETMSPGFERSTRT
                     EIPSMRRPQFLAYFNTRLALACSLIAVSSFNYGFDNQGFATTQAMDAFDKRFGDYNPG
                     TKAYALDPAWLSLFNSLNYIGFAAGVLIGSQISARFGRRWCMFSMSCYALITATITVT
                     SGNRDQILAARILNYVYVGMELAVVPTFQSEIVPAQVRGLAVGTYQFSIILGGLIINS
                     ICRGTSKIQDDRAWRIPLGLFYIVPAIVLSLIWFVPESPRWLLQKGRVEESQASLRQL
                     RQGCFTPEQIHNEFRELQTVLEQEVENGHWVDLVKGVNLKRTALVFMVNFFQQGTGQA
                     FSSQYGAVYVKQLGTINAFDMTIVLSLLNLVSIIGSLAYADRVGRRPMLLASSAVMAA
                     GLLTMGGLGTPSPMTTDLKKGVVGMYVVMALGFSLGWGPQTYVVATELPALRLRDMTL
                     QLGFFVNVISNFVVNFTIPYLVDAEYAGLNSKVGLIFGAIAVIAFVCTFLFVPECRGK
                     TLEQIDLMFHSGVKLRDFGSYDASTLIAEPELKEGEVHSDTGKVEENGVKQ"
     exon            complement(866974..867271)
                     /number=1
     exon            complement(867348..867590)
                     /number=2
     exon            complement(867672..868233)
                     /number=3
     exon            complement(868293..868490)
                     /number=4
     exon            complement(868542..868785)
                     /number=5
     exon            complement(869614..869748)
                     /number=6
     CDS             join(869901..870162,870262..870622,870679..871076,
                     871223..871256,871346..871697)
                     /codon_start=1
                     /locus_tag="AO090023000341"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000070"
                     /protein_id="BAE58899.1"
                     /transl_table=1
                     /translation="MWVNLMCSLSSTNATDRLSADTFRNPDNTEIQIALDIFFERIYP
                     LPGYAFLHRASLYDRFHRGQADQSLLLSIIAISISLTETDSSKLRCMMCLGEYSSAFP
                     LVSLLSRFAFSLRLNYDNQRVCFLAREARRRLMWAIYMLDQTWAAGLLEFTTCPVDAI
                     YVGLPCPEETWELDVCPETDVQLKSQTKLPGLLAANVGVCYLRDKVLRHAKRFAAGSC
                     SATEILYGIRELETELGQFYLRLPPSSAYSERNLRLRAHSPWLPRFILLHVLWHQCYC
                     DLYRCITSGLIESVPASTLNQFDPVFVLKCREQCTHHAVQIASIITSLIDLRLEISVL
                     PLDMAVYNCKLVASWQAKNIQQQGPRQILSIHSLIARSEFVDDSEELAFQDAHAGDNA
                     SVYQKDNHEYSGPLDTLGLPSPLPSFDSVEGMTPGPTMTSQMWLQGPNAFEGAWDEPG
                     IGFDLIRQMQWDGMGYFG"
     exon            869901..870162
                     /number=1
     exon            870262..870622
                     /number=2
     exon            870679..871076
                     /number=3
     exon            871223..871256
                     /number=4
     exon            871346..871697
                     /number=5
     CDS             872187..873737
                     /codon_start=1
                     /locus_tag="AO090023000342"
                     /note="arylsulfatase A and related enzymes"
                     /old_locus_tag="AO070306000069"
                     /protein_id="BAE58900.1"
                     /transl_table=1
                     /translation="MTVTTATTKIPSKNPNLVIFMPDQLRYDSLSCTSTPKTTFLKTP
                     NISSFASRGTLFTNCFTQASVCSQSRCSMFTGTYPHVSGHRSLENLIKPWEPNLFRSL
                     KENGYHVACLAPRGDTFAPTVTELSVDEYGFLETPDFVPRFSGGRPSDEKDESIWGRL
                     FYKGLRNAKEASDYDDAVVRSALRWLECPPQDKPWVLFMPLIFPHCPFQVEEPYFSLY
                     ERDIIPEPGAVPGEKTGYEPRYMRVIRERYGTGRATPEIWRELKATYYGMISRLDDQF
                     GRVVGRLDELGLWDETITMFFTDHGEYLGDHGLIEKWPSGLSDSLVHEPLIIAGGGLP
                     KGQVYTGMAEMVDLVPTVLELCGIPEQFPHNGRSLVPVLRDPSLGHKEYAFSEGGFLT
                     AEEPLLEQAPYPYDIKAALQHEDTTLVGKAVSIRSVEWTYVYRLYEPAELYHRQRDPE
                     EMYNLAAEPKYVPVARMLEAEVLRWLVESSDLLPWAKDTRFPEVKLKSPKEQLEERLR
                     KRDSGERN"
     exon            872187..873737
                     /number=1
     CDS             complement(join(875451..876199,876284..876716))
                     /codon_start=1
                     /locus_tag="AO090023000344"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000067"
                     /protein_id="BAE58901.1"
                     /transl_table=1
                     /translation="MLQSHILQLRQGVQASSLGKDTQQQLRQLLGLSENAAKRMAQQR
                     ILNALAFRAMRRRINAVEEAHQQTFRWMFEEKSTPGTEHDNCRDRIPEYKRDVAARLF
                     KDWLSRGQGIFHITGKLGSGKSTLMKFLYNHPQTRQELEHWAGDRKLVFASFFFWKPG
                     HELQNSIKGLLQSILHDLLAQCPDLITVVFPKHWDQVYGGPFSVPSKLEFQPNEIREA
                     FRRSIEDGALYHKCRFCFFIDGLDEYQETNQDDFKTMVEMLWSWTDIAPEGVKICVSS
                     REYNVFLNGFPPDRRIRIQDLTRLDMERYVEDKMKDVDHQTKERLISRIVRRARGIFL
                     WVALVVKSLREQIEDGCILRELEWSSSHCQTSWKVFLTICSIPLNRQSVRRRTRLFNS
                     S"
     exon            complement(875451..876199)
                     /number=1
     exon            complement(876284..876716)
                     /number=2
     CDS             complement(join(878355..879224,879276..880383,
                     880438..880586))
                     /codon_start=1
                     /locus_tag="AO090023000345"
                     /note="transketolase"
                     /old_locus_tag="AO070306000066"
                     /protein_id="BAE58902.1"
                     /transl_table=1
                     /translation="MAVGPVTINGSGKSALPLVQQMSKDHDIVLKTFRMLISDLCQQF
                     GGGHPGGAIGMAAIGVALWRYVMRYAPHTPDFFNRDRFILSNGHTCLFQYSFLHLTGY
                     KAMTFDQLKSYHSDRVDALCPGHPEIEHEGIEVTTGPLGQGVANAVGLAMATKNLAAK
                     FNQPGYDVVNNHTWCMIGDACLQEGVGLEAISYAGHLKLNNLTIIYDNNQITCDGSVD
                     LTNTEDINGKMRASGWDVIDVEDGCYDVEGLVRALEQARASTEKPTFINVRTVIGLGS
                     NVAGQAAAHGAAFGAPNVAQMKKENGFNPDEHFVIGETVRKFFEDLPARGESLVQEWK
                     DLVKQYTAQYPELGAEFQRRMSGELPSNWKDLIPASFPEKPTASRASSGLVFNPIAKE
                     IENFMVGTADLSPSVNMIWPGKVDFQHPDLRTTCGINGNYGGRYIHYGVREHAMCAIS
                     NGLAAYAPNTFIPITSSFFMFYLYAAPAVRMGALQHLQIIHAATHDSIGMGEDGPTHQ
                     PIELAALYRAMPNLLYIRPGDSEETAGAWIAAIEAKKTPTIISTSRHTLPQLKQTSRD
                     SVARGAYVLEEAENAAVTLIGVGAELSFALEVANKLKEKGVVARVVSFPCQRLFEQQS
                     LEYKRSVLQRHRGIPAVVIEPYAPNGWERYADAGVCIKRFGHSLPGKVAYKYFGYDID
                     TLTEKVHGYLGQVEKDELLKHEFVEL"
     exon            complement(878355..879224)
                     /number=1
     exon            complement(879276..880383)
                     /number=2
     exon            complement(880438..880586)
                     /number=3
     CDS             join(881036..881241,881295..881422,881478..881637,
                     881689..882157,882214..882417)
                     /codon_start=1
                     /locus_tag="AO090023000346"
                     /note="sorbitol dehydrogenase"
                     /old_locus_tag="AO070306000065"
                     /protein_id="BAE58903.1"
                     /transl_table=1
                     /translation="MAPSLLDPSLNPPTAATPAKSSTETIVTPFPNPSLQVTADHKLK
                     AIDAPVYAPKHGEVLLQIKATGICGSDLHFWKTGCIGELIFKGDCIIGHEAAGVVLKC
                     GEGVTHLRPGDRVAVEPGVPCGDCFLCLDGRYNLCEDVQFAGVYPYAGTIQRYKTHPA
                     KWVHKLPDNLTYAEGALLEPLSVVMRGMSVAGLQLGRGAVVCGAGPIGLIALAAARAS
                     GAHPIVITDLDASRLAFAKEFVPSCITYQVNRDLDAQGNAKAIRALFGSEEYFAPETV
                     LECTGVESSVCTAAFTARRGGTVVVIGVGKAVMNNLPFMHISLAEIDLRFINRYRDTW
                     APAIQCMSGGILDLKRLVTHTFPLEQAESALQLCSNPKNPSIKVLVVDEVEATL"
     exon            881036..881241
                     /number=1
     exon            881295..881422
                     /number=2
     exon            881478..881637
                     /number=3
     exon            881689..882157
                     /number=4
     exon            882214..882417
                     /number=5
     CDS             join(883968..884263,884316..885075)
                     /codon_start=1
                     /locus_tag="AO090023000347"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000064"
                     /protein_id="BAE58904.1"
                     /transl_table=1
                     /translation="MPTPRYFTQAPAFPAETSVASLPTISLRGLQDKSSTEGEKLFEA
                     CREWGFFLIDLRDSDDGTTLLQDAERMFDLTTELFALDQATLDRYAYDAPRDLTGYKS
                     MGRLKTDDGKTDHMHLYSINQDDILGNRPPRTNAGPVESKRTQLQAFIRHCSAALGVI
                     LGALDDQLGLKQGTLAALSPLEDESETSVRLLCSPPQPAPEYDRITLGGHTDIGTMTV
                     LFHVVGGLQILSAGKENVMENWQYVRPEPGCALVNVGDMLVEWTGELLRSSLHRVMTA
                     PGDQALVQRQSVAYLVRPAKKASMRRIQGGKIPPLAEGEEEETRPVNEWTAWRSRQIM
                     LGHLKPQSRGGNMAVSV"
     exon            883968..884263
                     /number=1
     exon            884316..885075
                     /number=2
     CDS             complement(join(886009..886709,886824..887213,
                     887362..887791))
                     /codon_start=1
                     /locus_tag="AO090023000348"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000063"
                     /protein_id="BAE58905.1"
                     /transl_table=1
                     /translation="MVQNLLMGISQRVNSGAVLLALSAWHLYPDMDVFCVSNKTVEQE
                     DALMSGAGRLIVGLEDADPSYSTGIFWSLSLSHLRYYGDPVLCRRSVAEDASRVSFNE
                     FTLVALGCLLQRWCTWTQDGLAINSVVEMIISLGDFVGEVSIKMGTRRGATFLGPLDE
                     HPPRLFGLSSPQVVLNLLRDDAECQIDAMRAIVRSSPDVGDSTMFIGYTHECQRLGKW
                     QEFTTVVPIATKEGKKKHVRWVPADVAKVKHNAWLRLGEDYNTTRFDEVISMGEVLRG
                     TNRREPDPEQPLKRFRYPKINDNPTIAVYAAGICVSDFEVFPENLTRFFDDRYFDVEK
                     LEVHLTHVWFAKASPEYVRSMRALARTDQIYKLMPNASVSLSVLRKELGQQKWVPCED
                     DAEHPYEDDKDDEFVIVKRNRSGFEVFDVARSESFSCVALFETGTMDLSPDCFTNVMA
                     ISSGNFIFASSSILCDPWEDAKPHEIQRLVANIGKSGVSLLIPLMNPKLRKAEFDT"
     exon            complement(886009..886709)
                     /number=1
     exon            complement(886824..887213)
                     /number=2
     exon            complement(887362..887791)
                     /number=3
     CDS             complement(join(890288..890325,890379..890941,
                     891001..891557))
                     /codon_start=1
                     /locus_tag="AO090023000349"
                     /note="branched chain alpha-keto acid dehydrogenase E1,
                     beta subunit"
                     /old_locus_tag="AO070306000062"
                     /protein_id="BAE58906.1"
                     /transl_table=1
                     /translation="MASLRLPRLIRPSGRRLYSGAASPSSRLNLPIDYKTTPLLHHTS
                     STLSESLELPGSTTSKSMNLYQAINSALRTALAKSEKVMLFGEDVAFGGVFRCSMDLQ
                     TEFGSERVFNTPLTEQGIVGFAIGAAAQGMKPVAEIQFADYVFPAFDQIVNEAAKFRY
                     REGATGVHAGGMVVRMPCGAVGHGALYHSQSPEALFAHVPGVQVVVPRSPSQAKGLLL
                     ASIFEHNNPVIFMEPKCLYRAAVEHVPNEYYTIPLSKAEILKPGNDVTLISYGQPLYL
                     CSAAIAAAEKALGVSVELIDLRTIYPWDRQTVLDSVKKTGRAIVVHESMINYGVGAEV
                     AATIQDQAFLRLEAPVKRVAGWSTHTGLQYEKFILPDVARIYDAIKQSIEY"
     exon            complement(890288..890325)
                     /number=1
     exon            complement(890379..890941)
                     /number=2
     exon            complement(891001..891557)
                     /number=3
     CDS             join(893877..894119,894188..894423,894740..894845)
                     /codon_start=1
                     /locus_tag="AO090023000350"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000061"
                     /protein_id="BAE58907.1"
                     /transl_table=1
                     /translation="MLSVLLLRPPSLPKLRVKPADLVHLDPQLPLSASLKTMVEFAQI
                     QEGVLDILLSHRDKNDQSVVIDKLLRDTYDIHTSIEKRQHQLPFRETTYEWVAIEFGY
                     YALLTSVLHLNKRVAQNRSSQEDCLRASRQSLIRLRRMQDEIWMDANFLDEYPYFLTC
                     NNAQFLWLKLRSRKWSQFTRPKYRRPRRTNQSGQ"
     exon            893877..894119
                     /number=1
     exon            894188..894423
                     /number=2
     exon            894740..894845
                     /number=3
     CDS             join(896040..896333,896871..896951)
                     /codon_start=1
                     /locus_tag="AO090023000351"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000060"
                     /protein_id="BAE58908.1"
                     /transl_table=1
                     /translation="MLILIAGITGFVGIPCARSAFARGHKVRGLARNIDNLPADVRDR
                     LEGFETMSDPHDIAAMDRATKGVDAIICSFAAVPEMFMESQMMLIRAAERAGVKLPIS
                     YPGPILGLRASGCCALPERQAD"
     exon            896040..896333
                     /number=1
     exon            896871..896951
                     /number=2
     CDS             899241..900818
                     /codon_start=1
                     /locus_tag="AO090023000352"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000059"
                     /protein_id="BAE58909.1"
                     /transl_table=1
                     /translation="MAKTKSSPRYVLTDEHRDWYLSWVQDCFENHPKCQRPSTMPTRL
                     VDLGDDDKGIICLREDIKQISRYIALSHSWKFSQARNCMTLKDNYESRKQLLPQQGLS
                     QAFHDAIKVARWLGVRYLWIDTFCIIQDDPDDWAQQASHMGDIFEGAYITIAVHCYQS
                     SPPTDGCFLERKVIHEVALPDDNGDRFPVFIRCAEAGLHNVNEDPSLMRRGWCVQERL
                     LSPRILHFRPWEVSFECFTHRRCECEKMSLDIRDDIYISMCEKELANFRHISGPRQEL
                     DEDGFWYAWQDIVWVYSAADVTVPTDRLAALSSMVQRMPRQIFGDYLAGLWSKKLIEQ
                     LAWTTRPEFKYFRYQQYIAPSFSWASIHGGPVEVNFQLRPWNPVKQKACILDAGTVPA
                     AHDPMGPVREGFIHMRLRVCEADVISLQRNTTEIDLRYNCKNGRPDSCRTSVDTEDDM
                     KDLEGQRVSLGEILNGSEFAEFLVMRKVADREGAFERVGTGTLYWTTKRDYGRGIPRT
                     PNRDPFCQVPEQEIRLV"
     exon            899241..900818
                     /number=1
     CDS             complement(900982..901665)
                     /codon_start=1
                     /locus_tag="AO090023000353"
                     /note="glutathione S-transferase"
                     /old_locus_tag="AO070306000058"
                     /protein_id="BAE58910.1"
                     /transl_table=1
                     /translation="MTTPLQPLKLYGDRPTVNPVKVLILLNELSLPYTISSVPFTEVK
                     STPYLSLNPNGRLPTLHDPNTNLTIWESGAIIEYLVDRYDTSRRISFEPGTHDFYLAK
                     QWLHFQMSGQGPYYGQLAWFKKFHHEPVPSAVERYVKEVNRVTGVLEGWLEKQAGVYG
                     EGEGNGPWLVGGKLSYVDLAFVPWQRVPGMFVGVEDFDIEKYPFVKGWLGRMLAREGV
                     RVGIEGEKE"
     exon            complement(900982..901665)
                     /number=1
     CDS             join(904734..904752,905209..905237,905289..905361,
                     905438..905534,905585..906339,906391..906516,
                     906583..906653)
                     /codon_start=1
                     /locus_tag="AO090023000354"
                     /note="succinyl-CoA synthetase, beta subunit"
                     /old_locus_tag="AO070306000057"
                     /protein_id="BAE58911.1"
                     /transl_table=1
                     /translation="MSLNIAQHHSHNLLKQFQIPVPEGFVVKSPEAARDVVYNIGAPS
                     VMKAQILAGGRGKGKYNSDGKGGVRIVDSPDEAFENASNMIGYSLVTKQTPPDGLPVN
                     KLYIYKSVDIAQEFYVAITFDRARYKPVLLMSDDGGVNIESNVNQLQRFWFNLSTGIT
                     PEIAAYIEAQFGFSDDDMGMVTHILRQLVKLFREKDATLLELNPFVRTTEGSLICIDA
                     KFNFDDSAKFRQPELVSLVEHSAEEKDEYEASQLGLSYIRLDGNIGVIVNGAGLAMAT
                     NDLVTLYGGNCANFLDIGGGATKETLSKAFSILQGDSRTKALFINIYGGIVRCDMIAE
                     SILAASAAMGGFSIPVVVRLQGTNYEKGFKLGNNIILEADFDAAAKKIVELTNSS"
     exon            904734..904752
                     /number=1
     exon            905209..905237
                     /number=2
     exon            905289..905361
                     /number=3
     exon            905438..905534
                     /number=4
     exon            905585..906339
                     /number=5
     exon            906391..906516
                     /number=6
     exon            906583..906653
                     /number=7
     CDS             complement(join(907094..907302,907363..907510))
                     /codon_start=1
                     /locus_tag="AO090023000355"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000056"
                     /protein_id="BAE58912.1"
                     /transl_table=1
                     /translation="MSFHQTSCDIHLTPEQGQRRTSLVAICNNDEGSGLTSDIFLDDF
                     LGNDNGHFIWGGKNVTRTCRNLEITREGPSRLPVLHGDLLNSSGDYVSDHCYLDEHIF
                     NINGELLFKPDEGTEW"
     exon            complement(907094..907302)
                     /number=1
     exon            complement(907363..907510)
                     /number=2
     CDS             complement(join(908128..908175,908361..909530,
                     909581..910057))
                     /codon_start=1
                     /locus_tag="AO090023000356"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000055"
                     /protein_id="BAE58913.1"
                     /transl_table=1
                     /translation="MSSWTWAPKNARRSPLRLITGRHIATVGVAISFLYLFYVFVLPQ
                     FLRFRFRTDLSQYDLGLYGFGPSTGYVSFEYESPIIEITESDSGCDPRYTFLAPRGDS
                     VPQAGPMILDAHGNLVWMKYNWETTQDFKVQRYKGEDYLTYWEGREIETRGYGSWYML
                     DSTYTQRYVINPVGNYGGDLHEFTITDEGTALVTIYDPTPVDLTDVGGPELGWIFDGV
                     FQEIDIETGELLFEWRASKHYPVSSTYEPLGEAGTDRASAFDFFHINSVGKDDQGNYL
                     VSSRHTHSVSCIDPNTGSLLWTLGGKMNDFTDLSDGEATNFAWQHDARWHANSTLTLF
                     DNAAHSYNDPDNESRGMAIQLDIPSRQAWLLAAYYHPQQMKSVSQGNVQMLDDTGRVL
                     VGWGHSAAYTEFSADGELLCNVHFGASAFFSFGRVVSYRAFKGDWVGHPQTTPDAEVD
                     DGKVYVSWNGATEVTSWRLEVWTSDDLTESSFGVVAQFEKTGFETEIDIPEDLGPLFR
                     LAALDSEGNVLGVTEVLQKEQRSSSDKFLDLHNWVLGLAMVAAREPRCSCPLSSCT"
     exon            complement(908128..908175)
                     /number=1
     exon            complement(908361..909530)
                     /number=2
     exon            complement(909581..910057)
                     /number=3
     CDS             complement(join(911764..911771,912860..913790,
                     913892..914104,914163..914279,914348..914452))
                     /codon_start=1
                     /locus_tag="AO090023000357"
                     /note="2-keto-4-pentenoate
                     hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase
                     (catechol pathway)"
                     /old_locus_tag="AO070306000054"
                     /protein_id="BAE58914.1"
                     /transl_table=1
                     /translation="MTVTSSFVSHPLPIRHDSPFPVSNIPFGIFSTAEDPTPRPGAAI
                     GDYVIDLFRVANRGALTIDYADGAQDIFREPTLNRFAALPRPVRSKIRKDIQALIVNA
                     DSPLYNQTDQAKLLIPRVAVSMHLPFSMGGFTDYTCSLEHVTNVGRVAGFGDIPPSFR
                     NQPLAYNGRASSVVPSGTPIQRPYGVGADGLYPCQKLDYEVELGMFISTKIPIGEHIP
                     ASRARDYIFGFVLLNDWSARDVQFAEMIPLGPFNGKSCGTSISTWVVTMDALEEAGAI
                     VPAKADVATEGKFTSNSFLKCAEDVSIDVSTFISSMYFPCRSSWEMLLMWDIGGESHR
                     TPISRSNLKHTYWSPFQMIAHHTSAGCGLAPGDLIGTGTLSSSAKQASEDLEQASTGL
                     GRLGCIHELTAGGKNPVQLVNDLSLVWLQDNDEIALEGWAGEGNSRIGFGQVVGRVAP
                     VAEIPAH"
     exon            complement(911764..911771)
                     /number=1
     exon            complement(912860..913790)
                     /number=2
     exon            complement(913892..914104)
                     /number=3
     exon            complement(914163..914279)
                     /number=4
     exon            complement(914348..914452)
                     /number=5
     CDS             join(915538..917169,917235..917375)
                     /codon_start=1
                     /locus_tag="AO090023000358"
                     /note="predicted acyl esterases"
                     /old_locus_tag="AO070306000053"
                     /protein_id="BAE58915.1"
                     /transl_table=1
                     /translation="MPPPVQVAYKRIGKPTVGENGYVDFQPGKTEVLPKGWNGFNAKP
                     LISDIRVEHDVEIVVRDGARLYVDIYRPADTTEKVPAVLSWSFYGKKYSALDMLPMCV
                     WNCCVPRSDLSGLEKFEGLDPQSWCPKGYAIVSVDTRGAGNSDGQICVMGSQDAEDGY
                     DVVEAIAAMDWCNGSIGMAGNSALAIAQWFIAAQQPPSLKAIAPWEGLGDLYREQFCR
                     GGWFFMSNFDLIAQRIVRGPENSGLEDYEEMYRRSPVSNAFWADKRVDMTKIQCPAYI
                     RGSDVSSIHTMGSVRGYLEIPHDKKWIHWGSKQEWYELYSEPESMEELTVFFDRYLKG
                     IENGWEKTPKVRWSALQFGDREAIDNIVLEDFPVPSTEYRNLYLGGNQQLLRTATTDY
                     STVSYDSESRASIAEFNYTFEKPSRLIGLPKAILYVSAEEQDDFTVFVILRKKDKDGK
                     ALMHLNFPFHATPVKSITEIPEKDQASLNLHLGSVGILRASHRAIDSTKSIHPQFPFH
                     PHLKQEKIEPGTVTKLEIGIWAMGVDFDAGESISLQIGGQYPSIAKDITSFSKPRPAY
                     ELNKGKHTVHFGGEYPSSVILPFI"
     exon            915538..917169
                     /number=1
     exon            917235..917375
                     /number=2
     CDS             complement(join(917828..919045,919103..919156))
                     /codon_start=1
                     /locus_tag="AO090023000359"
                     /note="2-polyprenyl-6-methoxyphenol hydroxylase and
                     related FAD-dependent oxidoreductases"
                     /old_locus_tag="AO070306000052"
                     /protein_id="BAE58916.1"
                     /transl_table=1
                     /translation="MGAFKIIIVGGGIAGLSAAIALRGNERDIVVLEQSSMSQEIGAL
                     ISLQPNASKIVEDQWGLGARLREQGSMIDEAFEIYNTKGELQSQILLSAVSSKYGADR
                     VCYHRVDLHQALKERATSPDYPGRPVELRLSSRVLDCDCETGTVKLQNGETIQGDLVI
                     GADGIKSKLRQAVLGEDVEARPTGLSAYRIMIPTDELLKETDFMQVLDPRICRTAMVI
                     GQDRRLVMGPARNGSVYGVVALVPDERMNESSKDTNWNTKGDRNKMLDTFSNFPKWAQ
                     RPLLSAKEVGLWQLRDLDPLSTWYRGRVLLIGDAAHAMLPTQGQGAGQAVEDAEALGA
                     FYKGFEKRYPDRSLSDISKTNEDIFNCRYERATTIQMYSRQAAKPGTDSSEKRVTMNP
                     AEFMDYNCLYNGAMDWNRRRQEQGSVASAAA"
     exon            complement(917828..919045)
                     /number=1
     exon            complement(919103..919156)
                     /number=2
     CDS             join(919610..919809,919861..920080)
                     /codon_start=1
                     /locus_tag="AO090023000360"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000051"
                     /protein_id="BAE58917.1"
                     /transl_table=1
                     /translation="MSTTTTVQETITLNQPKGRMALDGKPTNYGDFRDALNRDGYAVV
                     KGAIPLERAKKYADSFYGYLEGFDLGYKRDDPFTVKRAKLPVINEKGMILSYGVTHEK
                     WVWDIRSEPGVVEAFEKVYDDSDLIVSFDVVNVQFPG"
     exon            919610..919809
                     /number=1
     exon            919861..920080
                     /number=2
     CDS             join(920129..920168,920201..920272,920339..920704,
                     920765..920937)
                     /codon_start=1
                     /locus_tag="AO090023000361"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000050"
                     /protein_id="BAE58918.1"
                     /transl_table=1
                     /translation="MCYLYIGVVTSPKRKRLTESSKPWPHQDQDPESPGFRCLQGLVN
                     LNPGGPDDGGLIVCKGGHKFSEQFHREMADEPRIPAWTKEWFGFTENGMKWLKDHGLE
                     WEKVCVEPGDLIVWDSRTPHYNVPPTGKNDRLAVYTCYMPVADASQEDLIKKKEAFEK
                     RLGTTHWPNAQHVAPTNIAMRDGAPCPKAREVPVEEPVLGERAFRLTGIPYIKQEA"
     exon            920129..920168
                     /number=1
     exon            920201..920272
                     /number=2
     exon            920339..920704
                     /number=3
     exon            920765..920937
                     /number=4
     CDS             complement(join(921454..921989,922056..922107,
                     922180..923874))
                     /codon_start=1
                     /locus_tag="AO090023000362"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000049"
                     /protein_id="BAE58919.1"
                     /transl_table=1
                     /translation="MDRPPAAKRPRLSMACNICRQRKVKCDAEYPKCRNCRVRNQICV
                     TTDPQRPGVPGVREWLEMPEKINGHGVTQCDGSHKETACHQNDQNSPPNTSPQQQPQS
                     QEGQQPSPSVEDNLADEKLSELSPVHQPFDTSLNVERGTNRMKILGGSSSQCLAKSLD
                     VYFEAARLKPVSASFSHGMRHAEELDIPLTLSLPPLPDRDSRDRYARIYLARIHPTYP
                     IFSPHAFRESMAQLATIADYRHLPRDNVPVLVLVYLVVGLGSDEEAQSVTEAGEKYLQ
                     AAAGLVSHLVAIPYLPTVQALLVLTLMYRGRNQEGLAWQTLGMAIRIAYTLGIHRPQT
                     GPALATSNNSHDERHLPTQIWAVCCCLERMMQLACGRPSSISVEHVNPVGSLNCHSPY
                     LQWNLGLAEYQGSISQHIYNYHPGSRNVRHILLDTARLDRLLLSWANVIPPDLRPGSD
                     IFCPEEEYHMAAYLSMQFHETLIALHRAALIAPTASFDAEIEKHCSDEPSKFRLRNGE
                     SICVNSARAMAKLTIELSERGTASRLIPAGSSLLACIVLAIHLIKNPKSRLQTMDLEN
                     CSQQLARCNSDPRFMEGLAAMYDQIVLYHRVSSPYAERRHTLATTHQSDQPPLKAPIW
                     PPRNSNPQPTSNIAISHSTSNYPIPHSVLTPATYDDSAPPVSHMGYAACSEEAHIVAR
                     PPDHAPRGGLLDYSTATGKDQPHYQQGDTALHDTGSLIDQLAPSGDGLNEVDRLFPFE
                     GYNVEDLWNWMLYFDGPQPA"
     exon            complement(921454..921989)
                     /number=1
     exon            complement(922056..922107)
                     /number=2
     exon            complement(922180..923874)
                     /number=3
     CDS             join(925628..925908,925970..926173,926225..926647,
                     926705..926834)
                     /codon_start=1
                     /locus_tag="AO090023000363"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000048"
                     /protein_id="BAE58920.1"
                     /transl_table=1
                     /translation="MSTTTTEIQEIAEATHESFTIKDLVDFSGRTYGDWRDEFHRNGC
                     VVLKNVISPERAKYYADKQIEWLKNFELGFDENDESTWTAEHLPVSFKGGMYFAYGST
                     HEKSVWEARTEPAIIEIFEKLWETKELLCSFDGINISLPRRKDLNWSPWPHCDQNPNR
                     KGMQAVQGLINFAPNGPKDGGLMLMKGSAKLFDEFFAQKRDQYDHEDAPPPELKYMDL
                     FLFHEKDVKWFEERGCELIKVNLEPGDFVLWDSRTMHYACFPEADQIRHAQYICMTPK
                     RFATEKALELKKTCFENYLGTTHWPHCNIRPAAEKPMRDGKVCPKDRSEPFEKPVLTD
                     AVLKLAGVKPY"
     exon            925628..925908
                     /number=1
     exon            925970..926173
                     /number=2
     exon            926225..926647
                     /number=3
     exon            926705..926834
                     /number=4
     CDS             join(927587..927746,927804..927860,927915..928044,
                     928122..928320,928401..928814,928875..929527,
                     930238..930319)
                     /codon_start=1
                     /locus_tag="AO090023000364"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070306000047"
                     /protein_id="BAE58921.1"
                     /transl_table=1
                     /translation="MSQKDKSSVGHVEDIEAVETGQMKKHEATKVMGTVKLTEGSIIY
                     IPTPTADPQDPLNLSMLRKITILVVISIFSCLGLSLVSGFGGLLGFYIPQYEEVGVTY
                     NGITYLMTYPTLFMGIGNLIGMPLAIGVGRRVVMLASTAILAVGAILCATAKTYEWHF
                     GARILVGLAAGQSESIVPMISQEIFFVHERSRALMGQQAIQVCLTTVWVLFAGPIAEA
                     ITPKWWYGLGAVLAGALFVGTFFLLPETKYERSLSAYQEESSSGDEVLTEGFDDNKPN
                     HPEAVPCTERPELDFVNYSPRTFKSDLRLWNGKPEWFKVWEVLKQTAELLLFPNVLWA
                     LLLNGLVIGVNVAIGTTYSTIISAAPYNWPNSSASYINCGQIVVAIVALPLLGHSSDW
                     LVKFRAKRNNGLHEPETRLIPLILPAAIGTFTSSLYGEGGAHPYDYHWFVYAWAVAAY
                     YFCFVGVNIVTITYLLDSYLARAGPLLVIVCAFRGITSFGTSYGTAPFIELHGYDGTF
                     NTFAALTGFLSLIGIPIFIWGKRIRAFTGRSFSFCVSLRERVGLPPESHLSSYILH"
     exon            927587..927746
                     /number=1
     exon            927804..927860
                     /number=2
     exon            927915..928044
                     /number=3
     exon            928122..928320
                     /number=4
     exon            928401..928814
                     /number=5
     exon            928875..929527
                     /number=6
     exon            930238..930319
                     /number=7
     CDS             join(933318..934115,934165..935796)
                     /codon_start=1
                     /locus_tag="AO090023000365"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000046"
                     /protein_id="BAE58922.1"
                     /transl_table=1
                     /translation="MRDFLSLLGLASIIASSSAAVIPSSLAAISSSIGQVSQFTSSDT
                     TSAEIQSGIDSLIVAASGTCSGPIQSAPTSYWLADQDHSGDARGYAPNVNNTDYPVWR
                     NVLDYGARNDGSGNQTSNLQKAINDNGSGGSRKSSGVTRYPAEVFLPGGTYQLGKTLE
                     LRVGTIITGDPLDPPVLKAASNFDGDTLVLGYDSGNGNPETSFMTLMRNVVLDTTALS
                     ANTKITALQWGVAQGSGLTNVQIDMPTSSTGHTGIYIKAGSTIAVTDVQITGGAVGIK
                     NSNQQVNFKNISFKYCTTAFEAAGGHTALLQGATFETCGTGINMTSNSLGSLVLLDSS
                     SINSGPVVRFHDSSNDSGNRNSQILIQNLSHDNSNAIAVDSKDNIKLGAVSHVDTWVW
                     GNVTPGQYESGISFSTSRPDVLLANNEYFTRAQPTYAEYSNDQIVNVKAVDGYTVKGD
                     GSTDDSASLNAILANNAANCKITYFPYGVYLVKDTLVIPSGSRIVGEAWAVITGAGDA
                     FKDAGSPKPVVQIGHEGDVGVAEIQNMRFSVAEILPGAKILEINMAGSAPGDVALWNT
                     IATVGGTAETTIANSCTDQDTSQCMAAFMILHLTKTSSAYIENFWGWTADHNLDGGPI
                     TIISTGRGILVEATQGTWLTGTGSEHNWLYNYNLHNAKNVYAGLLQSESPYMQGDGAT
                     QTAPAPWTAESEFGDPDFSWCDEDDQKCRTSLATNVDGGSDIFLYNSAAWAFFNGPWD
                     GTYSHQCNGSCQSNMMRVTNSPSNLVWYSISTRKTDVMVLDDQSNPIEYNHPGGWEAI
                     IQAYRQFTWAQ"
     exon            933318..934115
                     /number=1
     exon            934165..935796
                     /number=2
     CDS             join(936201..936226,936341..936413,936503..936609,
                     936672..936843)
                     /codon_start=1
                     /locus_tag="AO090023000366"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000045"
                     /protein_id="BAE58923.1"
                     /transl_table=1
                     /translation="MSSAKVYVGNLSWNTNDESLRQTFSEFGNVLDAIVMKDRETGRS
                     RGFGFVTFSAQTEADAAIGGLNEQELDGRRIRVNLANARPAGGSRNYGGGNGYGGGYG
                     GGYSQGGYQGGGYQGGNYGQGDY"
     exon            936201..936226
                     /number=1
     exon            936341..936413
                     /number=2
     exon            936503..936609
                     /number=3
     exon            936672..936843
                     /number=4
     CDS             join(938975..939325,939371..939956,940014..940107,
                     940167..940299)
                     /codon_start=1
                     /locus_tag="AO090023000367"
                     /note="chitinase"
                     /old_locus_tag="AO070306000044"
                     /protein_id="BAE58924.1"
                     /transl_table=1
                     /translation="MSSSPIISQPTTHPTPVPSTPSSTPPIAQLTPGNSGDSTGKVIA
                     GYWQGWNMGKPCATMKPEEIPVESLTHLIFSFGFLAPNTYKVLPMPDTEEGLFRQVTD
                     VKKKNSNLKVLVALGGWTHTDPGPYREVFTTMVSSSANRQMFITNLFSFLSQYGFDGV
                     DIDWEYPGAEERGGRPTDKEDFTKLLQEMRQQFQNKYVITFAAPLASYYLQNYDLKSA
                     SEAVDWINVMAYDIHGTWESDKKAAGHTNLTDVNKGVENYLQAGVAPNKVVLGTAFYG
                     RSVKLASGGCTQPGCPFVGPGAEGQCVKTAGYLSYTEIQDIISGGAKPVFDQAGSVQH
                     LTWGGDNWVSYDDPQTIKIKVDYARRKGLRGLMAWAIDMDDEQRSMTKALSGH"
     exon            938975..939325
                     /number=1
     exon            939371..939956
                     /number=2
     exon            940014..940107
                     /number=3
     exon            940167..940299
                     /number=4
     CDS             943594..944937
                     /codon_start=1
                     /locus_tag="AO090023000370"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000041"
                     /protein_id="BAE58925.1"
                     /transl_table=1
                     /translation="MERTKWLDGLRGIAAAIVAFDHYFMGEVWHPFVSFWADPPEGNR
                     RFVQLPPIRILFSAHAMVTLFMVISGYAISINILKARPSQQYYTRISSAVLRRPFRIY
                     LPVLVMATISQLLFFFNLYNWTFDEDLLKGLEPWKAPWAHVEWLFLYMTDSLNIIAFA
                     YNGGFNGQLWTMPVEFRGSNVVFVLLVGLAAWRPKLRLWFLPLLSLYFLWYGLWDTFG
                     FIWGLFLAERAAAAATPATGNGSTQTTATDDEEKLPFFPLSRSNWKSHLLNRKNFTLA
                     RITTTISFLLGYHLLCLGDDGKLTPGYQWLSVFHPAKWHDDWQLIHWCWKVVGSALLV
                     YAIGESPLLQRPFNTRPVQYLGKISFSLYLVHQAIYHLLRDPLRNYLWLLGNGTAYPG
                     SVEAAATDPMSFHVAWWASGIVLGTVVVYAAHYYTIYVDNKCVALTKRIEKWLTS"
     exon            943594..944937
                     /number=1
     CDS             complement(join(945103..946478,946531..946582))
                     /codon_start=1
                     /locus_tag="AO090023000371"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000040"
                     /protein_id="BAE58926.1"
                     /transl_table=1
                     /translation="MLFGVALLFLGAVAANPVIPREDGSSTPTPTPTISSSTPISAPS
                     DACATSSTSSQWLSVCDTTIFWPTSTNYYYGPTTGPEASAVSCNAEWVEFDGRATGLE
                     SLGATSTSTIYSTYTTSTGACNTQIWGEGWDDPHTGPVTTLCDGIPRALGPREYSTTY
                     WPGTGPCSSFIATETTTTLVYRSPSPTPSCSLNTEECIPIWQTYTSLRDAYYASITTA
                     TPGDTNSPIAPGSCPSTKRNYTEQDPCTNCHFLPGTATLFYWPVTTTNGDLCLQNGST
                     VPATATGEGPNTAIVNGNTFVSPSIYVSFTSIYARSNRRAHPGGSCGGEYEDVIISVD
                     PKAVSSYRSHVNAKYPTIGTAYPFEYDEFQPHEVGNYTMSLIPWEKYQGASQCPFRGG
                     NKCTMIRDDYMPWMGIPEGVMTQIDPRWTECDREWYIPPVSMVPLVGDLESLPTGAAE
                     ARVPTPTPAVPESGVAVPTPEATLW"
     exon            complement(945103..946478)
                     /number=1
     exon            complement(946531..946582)
                     /number=2
     CDS             join(950465..950594,950668..951302)
                     /codon_start=1
                     /locus_tag="AO090023000372"
                     /note="predicted hydrolases or acyltransferases
                     (alpha/beta hydrolase superfamily)"
                     /old_locus_tag="AO070306000039"
                     /protein_id="BAE58927.1"
                     /transl_table=1
                     /translation="MTSPEIREFTVKIPRERGERLKRKPRDTRLPGQEIVPGAGTRYG
                     PEYNWTDDLYEKWTDDFDWYFVQDKINEPSHYIGEFEAVQIHFRHSRSKTANAIPLLL
                     INWWPAVFYEFSRVWGPMLHPVNENEQALHVVVPSVPGFCCSNWPPKAGWTLQDTVRL
                     FDSVMKKLGYNEYMVQCGGTRHFVGRELGMRCTPSCKLIHFNFIPSEMPNNAKSWTER
                     EHAIAERKEDRYENHLGYAVCMRTRVRTSLFWIVGY"
     exon            950465..950594
                     /number=1
     exon            950668..951302
                     /number=2
     CDS             complement(952987..953937)
                     /codon_start=1
                     /locus_tag="AO090023000373"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000038"
                     /protein_id="BAE58928.1"
                     /transl_table=1
                     /translation="MRIQSLVVLGTVFSGAIAHPEPGAELSSKWPSTTTGPVTAPTPA
                     ILQGNNGPRNKRYERGWLLEKRDSTTEDAATTTEDITSTTEEATTTTTEATTQADTTT
                     APTTTDATTTTESSTTTTSSTTSTTSSTSSTTSTTSSTSTTSSTSQSTSSMTTTTTKS
                     TSTAATTTSSTFTATTTTSAEMREYNRRGHIAAIITFSILGAIFFGYGFLHCYLSSRK
                     KRQIAARKAAAEAGSNYSLVALNEGAKSQSEVNFDRSSMMFASQSPSRTDLSSMVQQG
                     AGAQGYSQPMTRPSSLAVSETLHQSPPAGPRSLSPRGNFI"
     exon            complement(952987..953937)
                     /number=1
     CDS             join(958224..959147,959897..960014,960172..960353,
                     960469..960513)
                     /codon_start=1
                     /locus_tag="AO090023000375"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000036"
                     /protein_id="BAE58929.1"
                     /transl_table=1
                     /translation="MATTEKENGKLGSAKWLQPYLESLNPETEWEEIVRTLANYTLNE
                     FILNISYVSNFILVIQEPLGSEALVHTEKVFDRKQERFVDSVRYFTPWFIDGPSSERV
                     RKSISSLNNTHMRIAKRLPGRWDHDDDFIMPCVQMALFGHNMKQRLGVPVDSPHIQAA
                     WHRWCKEIFNLFLKESGPVAGFPEDFQGMVEYSNWFNRRSFKSTEKGHLASVALIQQF
                     CERWFPRPLHFVGYEIIITFLPDETIDRHRLGPRKKWLEFLIMLIFRIMFWLQAVLPD
                     PKKPCYPYMDSRSAKRVTKLKTTLTAILSIVALQLISRGYGGYCRLQEALPPLSRLLQ
                     VPWLDAQRKADSLRRHPRRMNAGDITSRTTLGRHCELQAICMKRPSIELLSSYSSDTG
                     DGQYVIRICENRSPANYFQSEPRNECVRLH"
     exon            958224..959147
                     /number=1
     exon            959897..960014
                     /number=2
     exon            960172..960353
                     /number=3
     exon            960469..960513
                     /number=4
     CDS             join(968109..968753,968835..968855)
                     /codon_start=1
                     /locus_tag="AO090023000377"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000034"
                     /protein_id="BAE58930.1"
                     /transl_table=1
                     /translation="MQQQPPQRLLLDISKIPKLDIKQAGHLRHFHNLAWQIDGEWRHM
                     GTQEPAQEFLDAYRYQISSMAYGAGVAHFHRLPALRSVFKPLLRRLIHKMLRREVWGY
                     WFNTSLSGNRTDPGRKELRKPWADPVVRENIMYSGHVLLMTSLYAMLFDDDEFEKAQS
                     LMFRWDPLFFGLGPEVFSYDNRSLQAAILAEMEKNHWIGVCCEPNLVFVVCNQFPRRH
                     ECG"
     exon            968109..968753
                     /number=1
     exon            968835..968855
                     /number=2
     CDS             join(969049..969810,969839..969913)
                     /codon_start=1
                     /locus_tag="AO090023000378"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000033"
                     /protein_id="BAE58931.1"
                     /transl_table=1
                     /translation="MNTWNSELVRSAFGRQAFGYITNLDGEIRLNSPTLANVYREIAG
                     TDAGNGALLLKALEIAKTIPPPKFPYSLPTFGYVVQWLSELGKSVELEGLLQYADTNL
                     NPTWEKGGLFYPRNDQPIDESHRWRHMDRFTGNAAIGYARLNVNDGQKIMWDKPWTRD
                     ILARRPWIDGVDLSQGVDFLRGQWNSEENALVLTIKTWDGSVVEVEPTARNLEKGIWA
                     VYIAGELQMCVEVIESNNLTFRVTAGEVEVDVVVIREDGEGAKLWIWSKSEINQNQLE
                     SG"
     exon            969049..969810
                     /number=1
     exon            969839..969913
                     /number=2
     CDS             join(975193..975595,975653..975876)
                     /codon_start=1
                     /locus_tag="AO090023000380"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000031"
                     /protein_id="BAE58932.1"
                     /transl_table=1
                     /translation="MTVNTTQSTSTSGSPLKLEHATLEDIPELIEVWYNAFDTPDMLA
                     IWPNTPGVRQWWDQANRHDMLHKPREKYLKVVDTRNGRIAAYAKWSLETAEERGPRFP
                     PWHSDMDPERNDAFIEGLELGRARLVGGKKNFYLDMLGTHTDYRKMGAARMLIGWGCQ
                     MADQEGAFAYIDASADGRPVYEKFGFVDRSDSASSAAGLASMVREPRN"
     exon            975193..975595
                     /number=1
     exon            975653..975876
                     /number=2
     CDS             977730..979148
                     /codon_start=1
                     /locus_tag="AO090023000381"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000030"
                     /protein_id="BAE58933.1"
                     /transl_table=1
                     /translation="MPSEANKSLGIINEFMREYEKEQEIYASAAKQAEMLCEDVLKRE
                     SVECIVTSRAKDPESLEKKLHERLKRRQETAASTREGKKGYGCIDDIRSDIADLAGVR
                     ISLYIPRKKSHVEKILRREFDVAWNLSLGEKGDIQATEPRLFPGYCADHYRVFFKQGS
                     SQDDRVGKRMIEIQVVSVLRHVWAQIQHDRVYKQLIPTAGEDIRILDALSSLLYAGDF
                     VLDQLFDSQASRSKSDSTSFKTVYQLGSALGQWIEGFPERRDDNLGNVQSLFTLLKAV
                     HMDTPEQLWGALKNMDISLSQTSDYVVLARTYEPLHLSISNYIMHRIIRPRNDRGVVQ
                     SIRQLELNTANDHCSKVNVIANAFILLDQLFSPPSQWWHLLYTGQNPKRLGEGIKWMS
                     TSKPWTDYHSMTTVHKADQKNIDILWHCLYEHDKEPIRFVLTFSEILVSEGFSTDWGL
                     LTRSLSLLIRAMELSRIFAKRS"
     exon            977730..979148
                     /number=1
     CDS             join(981294..981357,982501..982607,982653..982765,
                     982826..983486,983574..983786,983843..983894,
                     983954..984062,984112..984697)
                     /codon_start=1
                     /locus_tag="AO090023000382"
                     /note="carboxypeptidase C (cathepsin A)"
                     /old_locus_tag="AO070306000029"
                     /protein_id="BAE58934.1"
                     /transl_table=1
                     /translation="MANQSDLQQQFPVESQAQETSVCSLLGVATAQFPPTPEGVTVVK
                     SKLHENVSMSFKEPKICETTPGVRSYSGYVHLPPGFLDDDTGDKQDYPMNTFFWFFEA
                     RKDPKNAPLAIWLNGGPGGSSFMGLLEELGPCFVASDSKTTILNPWSWNNEVNLLFLD
                     QPMQVGFSYDVATNGTLAMDYDAVETTIVPGDFSVDIPESNFTHRVGTFASQELSQTA
                     NSSALAAHALWHFAQTWFFEFPHYKPVDDRISLWTESYGGHYGPAIFGFFQEQNERIG
                     KGTAEKGAQYLHLDTLGIVNGLIDAVVQGESYITIGYNNTYGLQIFNQSFYDSLMHEW
                     ARPGGCRDRAIACQAALKDRDLTSGKRNISEICKNIDLDCEGGGTAQYQQLDRSWYDI
                     AHPKNDPFPAHHMLGYLTQESVLKALGVPVNFTEAAPVVHKQFDKTYDITRGGFLDSI
                     AHLLDSGVKVHMMYGDRDYACNWIGGEKASLAVPYSRAAEFANTGYTPLVTSEGIKGM
                     TRQLGNYSFTRVYQAGHEVPAYQPVAAYEIFMRATLDRDIPTGEIGITGEFKTSGPKD
                     TWHIKNVAPEMPEPRCYVLNPGTCLPEVWERVVAGNVTVKDFFVVEDDTDDGMVGWPQ
                     DSSQVVLGGM"
     exon            981294..981357
                     /number=1
     exon            982501..982607
                     /number=2
     exon            982653..982765
                     /number=3
     exon            982826..983486
                     /number=4
     exon            983574..983786
                     /number=5
     exon            983843..983894
                     /number=6
     exon            983954..984062
                     /number=7
     exon            984112..984697
                     /number=8
     CDS             complement(984891..986294)
                     /codon_start=1
                     /locus_tag="AO090023000383"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000028"
                     /protein_id="BAE58935.1"
                     /transl_table=1
                     /translation="MGSISEFDQVPTLTAIERIGPKGYVRYIFPFQLDDDYDIDEVSR
                     VLRAAYAATQRRVPAMACEAVPDMNTKQAGVLKLQRLDDEAIEDIVIQDLRVSDTFPT
                     SYAELKSNSFPVASLDADLLCRRSVWPSAGERLPISLVQVNFIRGGLLLNWCTLHLVG
                     DGTSYFTWMKIWAEECRRAQGLYIPEPVELPPAVVRDRERVMRSSGRNLGLLESHPEY
                     TLLPFTPSSAPPKMIAQNHRAQVFYFSPEALQALKAEASPVNTSVPSDQNWISTNDAL
                     SALLWRTVMKVQWPWEILEGDPISVFNIAIDGRLRIEPPVHPDTLGCFLEYVAVSAPI
                     RKIVGSTNIADLAILIRKAILKADKQFTDDLVALIEKLEDVDRLVPTAFLDVPGFNCV
                     QTSWINFKLYSLDWGSLLGHNIGAVRSPHVGIINGLQVVLPAPPDGGMEILVGVEESC
                     LDKLLQDPLWMKYAVPR"
     exon            complement(984891..986294)
                     /number=1
     CDS             join(987989..988096,988146..988537,988652..988718,
                     989205..989228)
                     /codon_start=1
                     /locus_tag="AO090023000384"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000027"
                     /protein_id="BAE58936.1"
                     /transl_table=1
                     /translation="MANSKADSNKQIPGGTFGAGKHVRSVTLPGLTNIFKILLTYTFA
                     YAGACAACKASILFFYRRVFVIAQQDLLLRLSLLVGFFLTLSYPIIVWVTMGNSCKPL
                     SYFWSQLNGGSGKCIDTNTFFLAAGIINMVNDIVVLMVPFPQIARLQINPRKKIAICA
                     ILALGCFADVTWMMGPLFIWSTIEPAVAISVPQLRL"
     exon            987989..988096
                     /number=1
     exon            988146..988537
                     /number=2
     exon            988652..988718
                     /number=3
     exon            989205..989228
                     /number=4
     tRNA            992474..992547
                     /locus_tag="AO090023t00014"
                     /note="tRNAscan-SE"
                     /product="tRNA-Val"
     CDS             complement(join(992976..993580,993646..994085,
                     994148..995088))
                     /codon_start=1
                     /locus_tag="AO090023000385"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000026"
                     /protein_id="BAE58937.1"
                     /transl_table=1
                     /translation="MSSANTVYTGVWTNWSHGRIRGATLTLPQEYAGLLTAFLAIFVS
                     FAGTMMWRILCFIIHQNNTTPPSEKRDFLHHSRQVILRNSGSGTAAAWAFTTLAWNAG
                     RKAPQALLRILPLVLLALLNVALFGVSGVFTSYVTKVPGNTTIILGPHCGGAEGTPAA
                     DPGGIYLSKVLEDTKQAAAYAKQCYQGSSSLACGTYVRQSLPFTTQQNVSCPFAKGLC
                     RFNDQSAFAMDTGLLDSHDDFGINAPPKNRIKFRRLTTCSPIYGADFGSDRDEPGLGT
                     VVYINAGLTPQLVEIGNNWTFSYVARSAFDRLHAYSLSSVYGQADPTGVLHSTGAMWY
                     PDPRLNQTDSDITLMMLTQNDVYYRTPSDDPWIAAHEKLNGSDVYMGDYTVSLLGCID
                     QYQFCNPNLEGDTACTKLGGINSVAKDMVDRFVYFNLDQLATVERFMTTTHLHSMYQA
                     VQGRGGSALDIGQKLYNGHQYSVPANQWQIEVSNWFALSLAKAQAWPIEWATEPQNFD
                     APKEGEDSPWQYSPPTTPEAEAQCRNQLVHNSGDYKSLSVLGMGLILALGGVIIILGL
                     FLDSCVGLLQRGKRAYLREQWWTEETLGLHGAAYRALGVSTNWGDEVPPSSVFQGLTS
                     ASDGYRSVPLGGADAEGKSDGGIIVSERHESHRDTVV"
     exon            complement(992976..993580)
                     /number=1
     exon            complement(993646..994085)
                     /number=2
     exon            complement(994148..995088)
                     /number=3
     CDS             complement(996581..997135)
                     /codon_start=1
                     /locus_tag="AO090023000386"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000025"
                     /protein_id="BAE58938.1"
                     /transl_table=1
                     /translation="MRLQIPFLSLLSLLLFASFSHAFVGPSCMKMKDTLGTKPDIIFK
                     KFQSEICDKGCKPVVAHYERFARKNVIKPLVTKVMKDMGMPQHTKIVLNLAEDVFKVV
                     NEKCAKNLGKGHLCQDPETLTKFGNCLKGNLMPVVMGRVGELMPLVAEPICAKQLAYF
                     EKGDLWEKVIPSYIDKYAAVCQKL"
     exon            complement(996581..997135)
                     /number=1
     CDS             999100..1001013
                     /codon_start=1
                     /locus_tag="AO090023000387"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000024"
                     /protein_id="BAE58939.1"
                     /transl_table=1
                     /translation="MLCATCQQLFKNPEWKGVHHADIESLNNAARSGCPLCRPLQHIV
                     KQCLSTRDLFRYPWSYRIYTEENEAQICLDIDWPPGDFVELQENEPGPICYPMLAIPS
                     SSIMLNSAIRNRSSSLPLHEAIASGRRWLDECLDGHELCPKNTQPSSYPDLLLELDGS
                     TVRVISPVERKISGPYVALSYCCRDPNSDFLRLSASNKEAFEKGISCSELPTAFREAV
                     DLVQGMSIQYLWIDALCKIPQFQSHEEHSSGWAELEVIYANSIFNLALATVENPTESC
                     LGGWPSHVGLPFQVETCGLIGDDVRTVVPYRYYPNSLYHQPLGNRAESMQERFWSPRV
                     LSIGLGELFWDCTQLQNASESLPQGPAAMARWTKLRQTVIPRTSDRMKLEEFWWLMVE
                     EYSDCELAHPETHKLAGLSYIANQLAIALDDVYIAGHFWRTLSYSLNWRVDPQLAPVR
                     ERSRKPQRIANMVNNKVDERKLEAPSWSWASMDGTVYISRPWNFASLADVEAYTLAPV
                     MSDKNVKGARPASLIIRTYCREVHWIDGKPMIPQNLWTPVENFHWFRAKLDDEHDTPA
                     NGTRLLLAALTEDDRMCTWEGLVLQQLKAEEDIYQRIGHFQFHRIPAEEPRETWQDDY
                     RSMLDQRRALTLV"
     exon            999100..1001013
                     /number=1
     CDS             join(1001626..1001977,1002040..1002680)
                     /codon_start=1
                     /locus_tag="AO090023000388"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000023"
                     /protein_id="BAE58940.1"
                     /transl_table=1
                     /translation="MDSLHRARQANKSVSGRRSKLVAVFVGGTSGIGEATAKQLAAII
                     EFPTIYLVGRNGSAGSRITQELTTLNPRGTFEFIKSDVSLLREVDTTCQHIQRKERMV
                     DLLFMTPGHLATRKNDTVEGLDNNHVLRYYARMRFIHNLLPQLEAAEFPARVVSVLAA
                     GREGEIDESNFDLQVSFSFGTAATYGATMNSLAMEYLAAKHPSVTFIHTFPGVVQTPL
                     MKSSFGYILGSVIGLVAKLMSISEKESGERNVFIATSTAYPPATRAGERSVDGVGVAV
                     ASTGKLGCGSYLLDYDGKDVTNQTLMRSYREREYLTKLWDHTLDIFQRVLGSNT"
     exon            1001626..1001977
                     /number=1
     exon            1002040..1002680
                     /number=2
     CDS             complement(1003150..1003896)
                     /codon_start=1
                     /locus_tag="AO090023000390"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000021"
                     /protein_id="BAE58941.1"
                     /transl_table=1
                     /translation="MPFVSKLGIGSPHYKQTNVEPFISNICRFSEDRPGNMLTTAVRP
                     VCRSILNKSPTFGERLKNGQRYPLSTCSFNANTMFSAIRASTRLTSRTTVPRNTSKAS
                     VYAKMSTSTNNSLELNTTRTYDLIVQPSDLASAISSNAKIDKFPRVLTASRMVAFMEI
                     AAARVLQPLLSPGQLSVGTSINITHSAPTPAGAKVTAEARYIGQRGKLYESEVIAKDE
                     AGEVGRGSHERAIVEIARLENGAKKRGASQ"
     exon            complement(1003150..1003896)
                     /number=1
     CDS             join(1004129..1004357,1004419..1004469,1004526..1004605,
                     1004653..1004755,1004811..1005046)
                     /codon_start=1
                     /locus_tag="AO090023000391"
                     /note="isopentenyl pyrophosphate:dimethylallyl
                     pyrophosphate isomerase"
                     /old_locus_tag="AO070306000020"
                     /protein_id="BAE58942.1"
                     /transl_table=1
                     /translation="MGHTKAGSSAITAENVHELFPEVEALSAVSPVTCGVSAAESGDF
                     EGYDEEQVRLMDEVCIVLDVDDEPISRASKRVCHLMTNIDRGLLHRAFSCLISMIWTN
                     TCCSHPLDVQAREAWILRELGIKPEQVPLEDFHFLTRVHYKAPSDGKWGEHEMDYILF
                     IQADVDLAVNRNEAQDFRWFSPEDLKNMFATPGLQYTAWFKLICESLLFKWWADLGTP
                     EFQRNTNETIIRRM"
     exon            1004129..1004357
                     /number=1
     exon            1004419..1004469
                     /number=2
     exon            1004526..1004605
                     /number=3
     exon            1004653..1004755
                     /number=4
     exon            1004811..1005046
                     /number=5
     CDS             complement(join(1005758..1005763,1005816..1006247,
                     1006306..1007330,1007396..1007738))
                     /codon_start=1
                     /locus_tag="AO090023000392"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000019"
                     /protein_id="BAE58943.1"
                     /transl_table=1
                     /translation="MEQDRVVLPGFGKPLNDDLPLIEKEGPSKGQRLRFPHALCDNCY
                     SDGVSVRERRMLDFINKITDKPEWARKVFDEDIVGKWRSEACVHSEELNDDYLSTAMF
                     DYVSFAWLPFPDYSQMVSVYDSETAIVKSDTAVTPILAESLRSNVRVLEDVPENLKDW
                     HPGSDQTVLDLLHPSLFPLIHGRSRALPYGTVPLDDCARLTGEGELVVPDLYEYGKVV
                     PYKNTSLPQWGNFQWLPSNVEFDKDGTPRIVSYINNLQPRQHKELYGTLERFVAAAIP
                     LWNECLSWDHIRLRIIYRRGQDENDDFFIPDGLTFTPDEDEVDSPEKVRPYTYQEAYE
                     DDDISAIYSFDEWVRENRVFVEKEPDPFRSRRQWEEDSEHRAVNLQAQFATSGLQVIF
                     KLANIHLTPEKPEYEGGTWHIEGAMNEHIVATALYYYDEENITPSHLEFRQALDADDF
                     MYRVPQNEYASTEYFYGIENDNVAVQMLGSVLTKPGRLLAFPNALQHRVQSFKLADAT
                     KSGHRKILAMFLVDPYIRILSTANVPPQRKDWWTEEVRKVPPLRSLPLELFNMITDEV
                     RDFPLSWEEAVEVREALMDERGALIDDANDAIEEI"
     exon            complement(1005758..1005763)
                     /number=1
     exon            complement(1005816..1006247)
                     /number=2
     exon            complement(1006306..1007330)
                     /number=3
     exon            complement(1007396..1007738)
                     /number=4
     CDS             complement(join(1008455..1008651,1008723..1009320))
                     /codon_start=1
                     /locus_tag="AO090023000393"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000018"
                     /protein_id="BAE58944.1"
                     /transl_table=1
                     /translation="MKFTTAIATAILAGSALAAPERGLAARVKARAAGARGSRPLQTV
                     QKPAGVTNKTNVEYSSNWSGAVLENPPSASATYTAVTGTFTVPEPTGGSGSSSASAWV
                     GIDGDTYSEAILQTGVDFTVTNGQASFDAWYEWLPDYAYDFTGIDISAGDVIVAIVES
                     YSSTSGIAIIENQSTGQKVTKELSSSSPLGGINAEWIVEDYEENGSLVDLVDFGTVTF
                     TGAEAKAAGGQTVGLTDATIIEITQNNKVVTDVTIDSDSEVTITYV"
     exon            complement(1008455..1008651)
                     /number=1
     exon            complement(1008723..1009320)
                     /number=2
     CDS             complement(join(1011661..1011969,1012030..1012108,
                     1012177..1012772))
                     /codon_start=1
                     /locus_tag="AO090023000394"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000017"
                     /protein_id="BAE58945.1"
                     /transl_table=1
                     /translation="MTSHERLHIIFGTAAFGTGSPLAKIQDVETAAPIIVTLQARNVT
                     DVDTARAYPVGSPGAAERLLGELGVPTWANLSTKVNSWAPGTHTAEGIQQSVAQSLEA
                     LKTDKVDIMYLHAPDRHTPFEETCRAMDAEYRKGKFARFGISNYTADEVEEIVSICEK
                     HGFVKPSVYQGRYNPIIRSGETQLFPVLRRHGISFYAYSPAAVGLFTGRLSQDPSQLA
                     GSRWDDSTASGKIYHDAYYKPAVIAAAQTVADAGAAAGVSGHALALRWTIYHSALSRE
                     HGDAVLIGASSLSQLVQNLDAVDAGPLNEELARLVSNVGDLVGDEAAAYHV"
     exon            complement(1011661..1011969)
                     /number=1
     exon            complement(1012030..1012108)
                     /number=2
     exon            complement(1012177..1012772)
                     /number=3
     CDS             join(1014666..1014705,1014778..1014816,1014873..1015028,
                     1015086..1015697,1015755..1016103,1016159..1016216)
                     /codon_start=1
                     /locus_tag="AO090023000395"
                     /note="argininosuccinate synthase"
                     /old_locus_tag="AO070306000016"
                     /protein_id="BAE58946.1"
                     /transl_table=1
                     /translation="MATEKPRVCLAYSGGLDTSCILRWLIEEGYEVVCFLGNVGQEED
                     WAAVEEKALKIGAKKMVIEDLRREFVEELCFPAIQCNAIYEGRYLLGTSLARPVIARA
                     QMRVAQREGCQFVSHGATGKGNDQVRFELAFYAIQPSIKIIAPWRDPKFFKRFAGRND
                     LLDYAAQTGIPVTSTKAKPWSMDANSAHCSYEAGVLEDPNHTPPADMWTMTADPLNAP
                     NEPADITIQFEQGIPTKLVTPEKTYTDSVELFNALNKLGYTHGVGRIDIVENRFIGLK
                     SRGCYDSPAMTILRAAHLDLEGLVLDGQVRSLRDQFVTHNWSILLYNGYYFSPEREFI
                     ENSLKFSQKRVNGEVRVRLYKGSPYILGRSSSTEKLYDAEEASMDSLEDFEPTDTTGF
                     IAISSIRLKKYGLQKAEEGENLSRA"
     exon            1014666..1014705
                     /number=1
     exon            1014778..1014816
                     /number=2
     exon            1014873..1015028
                     /number=3
     exon            1015086..1015697
                     /number=4
     exon            1015755..1016103
                     /number=5
     exon            1016159..1016216
                     /number=6
     CDS             complement(1016763..1017491)
                     /codon_start=1
                     /locus_tag="AO090023000396"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000015"
                     /protein_id="BAE58947.1"
                     /transl_table=1
                     /translation="MASDTTLPFLQFPPEVRLSIYQYLIPDLPIRNFSLLRDRSKTIH
                     LRHDGSRCCPAILRANHQIYAEVIQEWYGSTSYEIVLDTKYILFCGKVIPPYVPLPST
                     IQWVQSVRLCLSIQGTPRHIHSQSTLEHLLGFQDRLTTLAVALSDKGYRKLSRLQIDI
                     GVNIPLLLSLSKTPSELVELLNWNLLPLRENVRDVPDVRWELQEQSYGIQSEEFQRSY
                     AGMKSIMCAFLQDMRLDMLERPDG"
     exon            complement(1016763..1017491)
                     /number=1
     CDS             complement(join(1018005..1018257,1018560..1020223,
                     1020293..1020971,1021036..1021364))
                     /codon_start=1
                     /locus_tag="AO090023000397"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000014"
                     /protein_id="BAE58948.1"
                     /transl_table=1
                     /translation="MSRYDDFRIAFNVEMSNEEIDAALTANGLIALHHALSSSSGYHS
                     NDSSHRPSSEAHRRFTRRLTPTEHTTPRTIPNLRQSPELEMNEISPRQTYFHNDRPYY
                     DVYPGPTNTIHRAENIIGESHLYPHDPLFIESPPERRPSIQRELMLRELSLALQTETH
                     RRDRPSEKVVTRHSLALIWSESRLERFIDLVRPGFDNTWMHNIREEWLQTLSILVDIG
                     WQDWGRFGDIFLKHRDEHGKWDRSDRMIPTYTLAILEDDSFLGSPWAEKFQASQYTFC
                     PIDIEEGKSLTFSKEWKLPFVNDISTSIGNGAYGRVTKEIIGSGHFRSQSEHHLPGAP
                     YSKDIAVALKQFEGRGDFHSETNNLDVLRSSLSKHDRIVPFLATVTIGNSFNILSPLA
                     DMDLDVFLREGHQRCPDFTLRDLMQEAAHLAGALAFLHQGLDSNPPGLSCCHMDLKPG
                     NILVFHGDALDFPKVGKWKISDFGISIMSRPERTGTTVTEFVDSFTQRQRLSPPPGPY
                     QSPDGAGHGLKSDIWSLGCILTRILALGLEGADGMMHLDQLRGTDGDGASPYENDYFH
                     RGSPPVLNPHVQSWLSGLTSGRYNYNQEFLTRCQSLIVSMLAISHDDRPSARNVQEEL
                     HNLVEIAQPIVLRTPSINTSVGGSASVGSGSDNIRVNSRDIQPGNERLLSEVINLWNG
                     DVNIEGIWDGNDRLLIYLIRLDYATALEVLLARHPGLDLETPDSKGDTPLKIAAAAGK
                     RHIVEMLLNAGANIDAPSRRGGTPLMPACRHGHVSTVRLLLDRGADCSSHCEDGYTCL
                     HYAIYSDNGANIIQLLNGKVSFNIRRSRTDETPLLSLIVRYDGTESWWDKFGRLLQGS
                     ADINMADIHRFTPLSRAVEQGHSQLAAILLSQGANYRDNPFVPVPVPVSVFSLYLFHY
                     FSVLIIAFLLLLLLLLLLLLLRLIRLFLVSLGVSFFFLFLYLGKMVRFCCEEKRVACI
                     KE"
     exon            complement(1018005..1018257)
                     /number=1
     exon            complement(1018560..1020223)
                     /number=2
     exon            complement(1020293..1020971)
                     /number=3
     exon            complement(1021036..1021364)
                     /number=4
     CDS             complement(join(1022503..1022672,1022776..1023047,
                     1023120..1023216,1023282..1023697,1023761..1023861,
                     1023917..1023978,1024035..1024129,1024180..1024650,
                     1024770..1024795))
                     /codon_start=1
                     /locus_tag="AO090023000399"
                     /note="permeases of the major facilitator superfamily"
                     /old_locus_tag="AO070306000012"
                     /protein_id="BAE58949.1"
                     /transl_table=1
                     /translation="MRVNNSARRPRNPLLLRTPEELEDDVHKFYDRNNLKDVVDLELL
                     VKGARIAQEPDNLYTLSLTPAEFKAIKDEKESGFWQQSKDLKVTILTTACAAITQYVR
                     LAGSHIIFRLQLTNSYRGWQQSTINAGSEGWKHDLSPQGEDWTQSHLLLGGFIDAAPW
                     LSGSIIGTWLSDPLQEGNYGRRPALFISAVFCAACVLGTARCVTWQQLLACRVILGIG
                     IGAKASIAPVFAAEAAVDHLRGRLLMMWQLFDTFGVFLGFACDWIVDRQWRVLLGTAS
                     IPALILLFLVFLCPESPRFLIRRGDYTGAFVSLRQLRGTDIQAARDLYYIHSQLQVET
                     EMFDGKRPQNWYSEEIYQKKVRETRFLKRIGKLFSHPRNQRACVAAFLVMASQQLCVR
                     STFSRFTLLDSSVKPRGRKHWIQMVPSNVRILGFGLANFLFTIPAYRYIDWRGRRLLL
                     LISLAGMFLSLLAIGLFFRIETYTVRLALVSTFTIGFFTFFYGIGAGPVPFTFSAEVF
                     PLAFREVGMSFSVMVNFLGLGLLVLFVPKLTDALGNYGESKLCFLFMWVFPVLSVACS
                     VGF"
     exon            complement(1022503..1022672)
                     /number=1
     exon            complement(1022776..1023047)
                     /number=2
     exon            complement(1023120..1023216)
                     /number=3
     exon            complement(1023282..1023697)
                     /number=4
     exon            complement(1023761..1023861)
                     /number=5
     exon            complement(1023917..1023978)
                     /number=6
     exon            complement(1024035..1024129)
                     /number=7
     exon            complement(1024180..1024650)
                     /number=8
     exon            complement(1024770..1024795)
                     /number=9
     CDS             join(1027575..1027721,1027782..1028084,1028155..1028385)
                     /codon_start=1
                     /locus_tag="AO090023000400"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000011"
                     /protein_id="BAE58950.1"
                     /transl_table=1
                     /translation="MQQQIEAEITSQHAGVSKRWYWMHLLVLSAYIGNWRWCIRSLGE
                     EIEKTVDIALTLDLSKADHDKDGLIRLLTPQYLGDKLLPLSSRLKVALETVRKLDEIN
                     TFFQSKGFMTDDDSQRFASEMAYYKTTIEGYSKSVEVLEGKVKGISDLLAVALNLKGQ
                     TVANEINDKMLQLTSEAFEDNATVRVVTLVTLIYLPASFVSVSLIQYAWYMSALTIRA
                     DSPRNEPF"
     exon            1027575..1027721
                     /number=1
     exon            1027782..1028084
                     /number=2
     exon            1028155..1028385
                     /number=3
     CDS             join(1031380..1031604,1031670..1032089,1032147..1032605)
                     /codon_start=1
                     /locus_tag="AO090023000401"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000010"
                     /protein_id="BAE58951.1"
                     /transl_table=1
                     /translation="MHFQLLGLAALGSLAAAAPAPSRTSELVERGSSCTFTSAAQASA
                     SAKSCSNIVLKNIAVPAGETLDLSKAKDGATITFEGTTTFGYKEWKGPLIRFGGNKIT
                     VTQAAGAVIDGQGSRWWDGKGTNGGKTKPKFIYAHKLQSSTIKGLHVKNSPVQVFSVQ
                     GNDVHLTDITIDNSDGDNNGGHNTDAFDVSESNGVYITGANVKNQDDCLAINSGENIE
                     FTGATCSGGHGISIGSIGNRDSNTVKNVKVADSTVVDSDNGIRIKTISGATGSVSGVT
                     YENITLKNIKKNGIVIEQDYKNGGPTGKPTTGVPITDLTVNGVTGSVASKATPVYILC
                     GKGSCSDWTWKGVSISGGKKSDKCQNIPSGASC"
     exon            1031380..1031604
                     /number=1
     exon            1031670..1032089
                     /number=2
     exon            1032147..1032605
                     /number=3
     CDS             join(1033468..1033497,1033550..1033641,1033699..1033761,
                     1033821..1033935,1033996..1035174)
                     /codon_start=1
                     /locus_tag="AO090023000402"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070306000009"
                     /protein_id="BAE58952.1"
                     /transl_table=1
                     /translation="MPDEEKNKQPEPAAGRETYPLMDMGNGIVGWESQDDPLNPRNYP
                     PSRKWFQLATVSIITFISPFASSVFAPGVSLADQEFGNTSSIRSSFAVTAYLFGYFSG
                     PLVLSPLSEVCGRRITLNAATSIFVLFQIGCALAPNLSALIVFRFFTGFGGSGCLTIG
                     GGVIADLFEAEQRGLALSFFSFGPLFAPVIGPICGGYIAQRAGWRWTFWVLVIVGGTL
                     TGIVMVTNRETNPTVLIRRKTVALRKELNRPELRSCYEMEGETRGPATLLLRTSTRVI
                     KLLATSPIVLIMALYIASVYGCLYLLFTTITSVFQNQYGWSVETSGLAYIGLGLGFFA
                     GQVVFALTSDRILIRLKRRNNNILEPEMRLPLCLPFALFVPISFFWYGWSVQEKTHWI
                     VPIIGLFPFAFGIIGIFGTLQAYIIDSYPRYAASGIGALTVTRSLFGALLPLAGPPMY
                     EKLGYGWGNSLLGFVTLAMVLLPMLFRCIGASLRQKFTVDLE"
     exon            1033468..1033497
                     /number=1
     exon            1033550..1033641
                     /number=2
     exon            1033699..1033761
                     /number=3
     exon            1033821..1033935
                     /number=4
     exon            1033996..1035174
                     /number=5
     CDS             complement(join(1035308..1035784,1035894..1036278,
                     1036346..1036529,1036701..1036969,1037022..1037086))
                     /codon_start=1
                     /locus_tag="AO090023000403"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000008"
                     /protein_id="BAE58953.1"
                     /transl_table=1
                     /translation="MALGCLFEIDDEGSREAYIVEGTQYFETCRSLADLQGCNDLVTL
                     QAILYMNIFLLYTARISSSFSALSYTFSLALRMKYHQIAETDDAFTREDKKHVFWTTR
                     HLLACVSITGHVTKRLYPLKGVKKTHNPGPLRHLVRKDTVRGLESELRSWLASLPPYL
                     RLGQEKHPLQIERAQYELCMSYAHAQIYLYRPFLHYLVTSSTGEIRSADGFPSYASAC
                     VDASRNIIRLAQDMYHRGLFHGVHWDISNMILAASLTMLYIILARKGSSVEDMALAEL
                     RTARDLMTLLEPYTTLAKRISIAVKHAVSSPSAQASDSHTTALAERTFGFVSRTNVSD
                     NQGMLPGGRESDSMPVLATTGISAESLSQRPFPIASTEGSTSQGPPMLNAAQSSGAST
                     SFPMQSDQAMYHTPFTSRDITEHNSLPSTLAQDYGIGGDDYGYMIDGTGPIDFSDMIG
                     DLFASEGLL"
     exon            complement(1035308..1035784)
                     /number=1
     exon            complement(1035894..1036278)
                     /number=2
     exon            complement(1036346..1036529)
                     /number=3
     exon            complement(1036701..1036969)
                     /number=4
     exon            complement(1037022..1037086)
                     /number=5
     CDS             join(1039071..1039473,1039543..1040420,1040491..1040817)
                     /codon_start=1
                     /locus_tag="AO090023000405"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070306000006"
                     /protein_id="BAE58954.1"
                     /transl_table=1
                     /translation="MQSIRQYRRLRQDLAEARRGKLPSESLAKTSTSSDNEAAKDPTE
                     KPAAIDPALVRGVTVSRPQEGDGSTVYVVGWRDNDPSNPQVWSLPRKWMAMINCCCLG
                     IALTIPTSVEGPAQEAFQDHFGVSPMAGSMSTGIFLIGVGVGSLFSGPLSETFGRNIV
                     YFVSMVVVMLFIMAKALAPSYGVALAFRFFGALFAATPMTVAGGTIGDIWTPMQIPFG
                     LPLVTICAYTGPILGHVIGAYTPEIGFESADWISMIIIGAVLVFVLIAQPETCSPLLL
                     EWRARHLRELTGDDRYQAEHTSASSLDFRLLANVYRPFFMVWTEPIILVFSFCLVLIY
                     FVLFTFLNGYPYIFTRPYGISASSTFIIWVAMMPEVAVAIIMVPYIYSLTKKAAASVM
                     TAGKPLQPEVSLYWAMAGASILMPVSLFWMAWTCYSDISIWSPIIASTIFGYALVCIF
                     TTIYMYIIFVYLQHLASALGFMTFARYVISGALSPASIKMYENIGAHWSLTIVGIIAT
                     VMAPVPYVLYNYGHKVRAMNKNIQNRA"
     exon            1039071..1039473
                     /number=1
     exon            1039543..1040420
                     /number=2
     exon            1040491..1040817
                     /number=3
     CDS             join(1041427..1041608,1041669..1041749,1041812..1042031)
                     /codon_start=1
                     /locus_tag="AO090023000406"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000005"
                     /protein_id="BAE58955.1"
                     /transl_table=1
                     /translation="MEPLSPPPALTHLFTLRCAVDPPMEIGNGPYGRRRCVPIKSGTV
                     RGKYLNGEVVPGGADFMLVEENQTTHVNTNYLLKSDDGAYIYIRTEGTRSGPPEVLKA
                     LMEGDDGVDPNQYWFHLHIKLETGHEKYKWMNNRVIVGRATRAKGEVAYDAYFLENIV
                     "
     exon            1041427..1041608
                     /number=1
     exon            1041669..1041749
                     /number=2
     exon            1041812..1042031
                     /number=3
     CDS             complement(join(1042507..1042545,1042618..1042933,
                     1042974..1043377))
                     /codon_start=1
                     /locus_tag="AO090023000407"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000004"
                     /protein_id="BAE58956.1"
                     /transl_table=1
                     /translation="MRMILALSASDMHRNGLIVRTPGRPTAEDHGRYHYGLAVKEFRQ
                     SLVSPRQVSPAELEAIFATMFLMVTYEWQYGHCVRHLELHLQGVKSLLESHPELFQIK
                     DVNNVLLSMESEESNEPESRVSFIPEQLLLWILLRYIDASCQPMGLSESLYDYVLQSG
                     NPALHPDRLYRCARVWGRCFWGKQYPDQEVSDDMENYRALELLHAGMSLRHRTWKLLF
                     DNIPDSGYQAESFFNEIMAVRDPNSPARPQCDAR"
     exon            complement(1042507..1042545)
                     /number=1
     exon            complement(1042618..1042933)
                     /number=2
     exon            complement(1042974..1043377)
                     /number=3
     CDS             complement(join(1044950..1044952,1045349..1045681))
                     /codon_start=1
                     /locus_tag="AO090023000408"
                     /note="predicted protein"
                     /old_locus_tag="AO070306000003"
                     /protein_id="BAE58957.1"
                     /transl_table=1
                     /translation="MLYRPNTLWTWILLVSTFIEVVVLIALEAYILTLTLLGTKPADL
                     WNRVIYTSIRNNVTPVAWDISAYRCIPTFFVLVTLWVVYQLLLVYDTSAHWGTIQLIG
                     LGIYSAALS"
     exon            complement(1044950..1044952)
                     /number=1
     exon            complement(1045349..1045681)
                     /number=2
     CDS             complement(join(1047108..1047337,1047393..1047520,
                     1047576..1047965,1048014..1048396,1048445..1048546))
                     /codon_start=1
                     /locus_tag="AO090023000409"
                     /note="metal-dependent
                     amidase/aminoacylase/carboxypeptidase"
                     /old_locus_tag="AO070306000002"
                     /protein_id="BAE58958.1"
                     /transl_table=1
                     /translation="MAIMQAKPSIADIKASVDAALESLQTTLRELNREIWSNPETAYE
                     EYKAHDAICDFLEAQGFTVTRHAYGLDTSFEAISGSGGRLINFNAEYDALPGIGHACG
                     HNLITTSSVAAFLALSALLKQYGIPGRTQLLGTPAEENGGGKAKLIDAGAYKGVDISL
                     MAHAGPQKLFPGVDATGVGGVLMNARKQIHCEFTGKSAHAGGNPWEGVNALDALVTSY
                     NNVAVLRQQLQPDERVHCAFLDTPKVANVIPAYTKAYWQVRSPTLKGLNRLMAKVRNC
                     IEAGALATGCEVKLVEDELYTDIKLNDTLCERYQTHMGSYDRNVLKSHEKVLTGSSDI
                     GNVSYIMPTLHTMFGIPGPDGSFPHHPSFAAAAGTDDAHVEAVVVGKSLAMIGWEMIT
                     DEALFKQAKSQWENCIQE"
     exon            complement(1047108..1047337)
                     /number=1
     exon            complement(1047393..1047520)
                     /number=2
     exon            complement(1047576..1047965)
                     /number=3
     exon            complement(1048014..1048396)
                     /number=4
     exon            complement(1048445..1048546)
                     /number=5
     CDS             join(1049669..1049799,1049849..1049942,1049991..1050058,
                     1050112..1050168,1050219..1050377,1050430..1050799,
                     1050850..1051257,1051312..1051512)
                     /codon_start=1
                     /locus_tag="AO090023000410"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070306000001"
                     /protein_id="BAE58959.1"
                     /transl_table=1
                     /translation="MPEIDDLKLEPEMSVTKDVDLGQMLGMDVTPQQERKVLLKLDLI
                     LIPLMGICYMMQYMDKLALSQATLFNLREDLDLQGTEYSWSSAIFYFGYFAWSWPSSY
                     LIVRLPIAKYLSASVLVWGGVLMCHAAAKNFGGLMAARFFLGVGEAAIAPGFALITGM
                     YYKREEQPARQAAWFFGNCVSTVIGGVVAYGIGTIKVNAIESWQLLFLFLGAITAAIS
                     IFLVILLPDAPQKAIFLTKTERTIAVQRTLKNKTGVMEGGDFKWNQAWLAVRDPQTWF
                     LVLYTFSVNLCNGGVTSFSSIIINGFGFTQLKSLLMQMPLGGAQIVFLLITAGVATAI
                     PNTRILMMIFNTTVSLVGMILVWKLDEDNQKGRLTGLALGAVFAVNIPLSLSIISSNV
                     AGFTKRSTTSALMFVAYCVGNIVGPQFFLSSEEPHYPTGMKAAISGLALGAFFLICLY
                     VYYIFENKRRDAAYGAPSELTEEEERMQGLSNKTDLEIESFRYVI"
     exon            1049669..1049799
                     /number=1
     exon            1049849..1049942
                     /number=2
     exon            1049991..1050058
                     /number=3
     exon            1050112..1050168
                     /number=4
     exon            1050219..1050377
                     /number=5
     exon            1050430..1050799
                     /number=6
     exon            1050850..1051257
                     /number=7
     exon            1051312..1051512
                     /number=8
     CDS             join(1053862..1054269,1054323..1055158,1055216..1055321)
                     /codon_start=1
                     /locus_tag="AO090023000411"
                     /note="ammonia permease"
                     /old_locus_tag="AO070226000030"
                     /protein_id="BAE58960.1"
                     /transl_table=1
                     /translation="MSVQAAWEACSKTDTLFILVCSVFCWLIIPAVGLAYSGYSTRYN
                     SLASFYPGLLAVAVCSIQWWMLGYSLAYGEGNSVFGGFSKIFHIGVLAEPVGSIPEIL
                     FSEFQLIFCATVCAIAIGGACERGRLLPLIPFIFLWCTFIYAPLAHMVWSENGFLANL
                     GALDFAGGTPVHICSGATATAMSLYLSYPLFRSKRSPIRTPQHLILHKPHNTLCQLLA
                     LIIIWNAWLAFDAGTTLALNFKSVMAACVTNLCAASGALTWASLTYYETGKWSLDSTF
                     LGAIAGLVLITPSAGFIDMTTAVGFGVLGASLGRQALRIKFTKRAALLRWVDNGDTFA
                     THCLGGFLGTIVTGLFARREVAAYDGSTIIKGGVVFDGNWGQLWIQIVEAVIGFVWSF
                     GGSYVLYALVDCVPGFEVLGTDEDIIAGMDASQMGESLYAAQWEGEEDYHPFEGVRL"
     exon            1053862..1054269
                     /number=1
     exon            1054323..1055158
                     /number=2
     exon            1055216..1055321
                     /number=3
     CDS             complement(1055421..1056278)
                     /codon_start=1
                     /locus_tag="AO090023000412"
                     /note="formyltetrahydrofolate hydrolase"
                     /old_locus_tag="AO070226000029"
                     /protein_id="BAE58961.1"
                     /transl_table=1
                     /translation="MTGFILTLSCPDRPGIVHAVTAFLVQHNLNIIDSSQFGDPTSHR
                     FFMRTHFSADKDASKKNIDELREAFEPTAKSLSMDFQLVPATQKPRVLIMVSKIGHCL
                     NDLLFRTSTGQLAIEIPLIVSNHPDFATLAATYNIPFVHLPVNKDTKPQQEARILELI
                     SEHNIDLVVLARYMQVLSPTLCEAMSGRIINIHHSFLPSFKGAKPYHQAYDRGVKIIG
                     ATAHFVTSDLDEGPIIEQNVVRVNHGMSPKELTHAGSNVESNVLAAAVKYFSERRVLL
                     NGHKTVVFN"
     exon            complement(1055421..1056278)
                     /number=1
     CDS             join(1056740..1056998,1057051..1057169)
                     /codon_start=1
                     /locus_tag="AO090023000413"
                     /note="predicted protein"
                     /old_locus_tag="AO070226000028"
                     /protein_id="BAE58962.1"
                     /transl_table=1
                     /translation="MPISLVPNTRWSDTVAEGEMPFKRIRAQAAQKARKRLRAAVDSP
                     PAEKQHDLDVNSGQSRHPTITYKFFGAYEPIATTEGGYKEWRRRESPHSTLCYECYQP
                     VDLDPCDTCTRVYHESCEPTGSY"
     exon            1056740..1056998
                     /number=1
     exon            1057051..1057169
                     /number=2
     CDS             complement(join(1058897..1058918,1059032..1059085,
                     1059179..1059265,1059356..1059610,1060180..1060202))
                     /codon_start=1
                     /locus_tag="AO090023000414"
                     /note="predicted protein"
                     /old_locus_tag="AO070226000027"
                     /protein_id="BAE58963.1"
                     /transl_table=1
                     /translation="MPGPRMAFSIAVAEDRTNETSTEATKATSQSSSNDGASKNLQSC
                     HIPELKKGHILRASCFSDPATQQLVHSELDLNHCFGASLLKGELSAEAEGRTAWYWNP
                     LRGMDTLLSLCCSESRNSTGNNQGLLECHGHVGKPISLAVVAFC"
     exon            complement(1058897..1058918)
                     /number=1
     exon            complement(1059032..1059085)
                     /number=2
     exon            complement(1059179..1059265)
                     /number=3
     exon            complement(1059356..1059610)
                     /number=4
     exon            complement(1060180..1060202)
                     /number=5
     CDS             join(1061371..1061607,1061647..1061938,1061986..1062595,
                     1062641..1062864,1062901..1063000,1063054..1063123)
                     /codon_start=1
                     /locus_tag="AO090023000415"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070226000026"
                     /protein_id="BAE58964.1"
                     /transl_table=1
                     /translation="MGANYPGTPNLTETSQYAFPLKPKDYAPGAVPTLEEWQKLWTAW
                     DLVTLKMFPKEALHEQPIALRNPLIFYLGHIPTLLKSSENLSEDIHLARATKTPPTEP
                     KYYQQIFERGIDPDVDDPSQCHDHSEVPNTWPELSDILVFREKVCARITALYQTQKPW
                     QDRTIGRALWIGFEHEGLHLETFLWMTLMSPNILPPPDIPRPDFIHMAEQAVRVRVEN
                     QWFSIKPRTFTIGIEDTDDDSALSPADFFAWDNERNTYEVSVQGFEAQARPASILDYA
                     IYLVKTSQKDCLLVTWSTVSGLPDRSIASSPQSDPVIEEFIDGLALKTVYGLLPVRLA
                     LDWPIYTSYNEAEGYAEWAGARLPTLHEARSIHRQVEEENAEKTQESQNSEPASKSIR
                     DDIYTDLTGCNVGFQNFHPTPVTQNGNRLSGQGDLGGAYEWTSSLFEPQPNFKPMDIY
                     QGYSVFDTIIADFMDGKHIVVVGSSWAFHPRIAGKKTFLNWWQKGYPYPWIGIRLVRD
                     RN"
     exon            1061371..1061607
                     /number=1
     exon            1061647..1061938
                     /number=2
     exon            1061986..1062595
                     /number=3
     exon            1062641..1062864
                     /number=4
     exon            1062901..1063000
                     /number=5
     exon            1063054..1063123
                     /number=6
     CDS             complement(join(1064803..1065238,1065301..1066019,
                     1066072..1066149))
                     /codon_start=1
                     /locus_tag="AO090023000416"
                     /note="predicted protein"
                     /old_locus_tag="AO070226000025"
                     /protein_id="BAE58965.1"
                     /transl_table=1
                     /translation="MQTRRSHRKSRTGCTECKRRRIKVYPCDELYPSCLNCQRRKQRC
                     SLAISRASTADIEPVRPSRTSDSEDPSRSAWPSFPALINIEFPLTPPALPAIWYGGVE
                     LMHHYSTVTAETLAIRPDMQNVWRTIVPEMGYQSPFVLHGILAVAAQHKAHLLPGVRD
                     KYLDMAAYHQAIGLKGFRAALPNVNDNNWKPFFCFSSIIVIYVCSLLGQVDERGTDTV
                     PDILKLFVMIRGLRATLPIRDSQLAGTELAPWSHGVWILDEQDASLYEQDPSPNHSRL
                     PQDVFDALRRLSGFFSTHLPESSRQDYEDAVILLRKAATLIVHAGTRVEIGMVMFFPY
                     VIHENIISDIQAANPYAMLLLSYFALLLKSMEDQFWFIRGWPARLWEAADERSKFHPK
                     LKTMLRWPKEQALKLYTY"
     exon            complement(1064803..1065238)
                     /number=1
     exon            complement(1065301..1066019)
                     /number=2
     exon            complement(1066072..1066149)
                     /number=3
     CDS             join(1066953..1067127,1067210..1067461,1067515..1067926,
                     1068443..1068668)
                     /codon_start=1
                     /locus_tag="AO090023000417"
                     /note="predicted protein"
                     /old_locus_tag="AO070226000024"
                     /protein_id="BAE58966.1"
                     /transl_table=1
                     /translation="MSCDPNYVDASWSFYRYKPSIAAPVFFVILFTSTTALHLLQMTK
                     TKTWYLIPFSIGGFCEIVGYIGRAINANENAGCWTLGPYVIQTLLLLIAPAFMAASIY
                     MILGRIILLTDGEIHAMLKRRWLTKTFVFGDVLSLFLQAAGGSLLGGADEHNSLMKTG
                     EHVIIAGLFVQLFFFGMFIVVAGLFHRRMLLAPTATSHNPLIRWQKYLVTLYIVSVLI
                     WVRSVFRVIEYLQGNAGSIMRHEAYVFIFDATLMFLVMAWMNWFHPSEIGLLLRHEEP
                     ISNGHLKRHLHGFRGFENRAALSALEKHLLGLSLVNLLEENVVFLILIGLHCRKFRCT
                     TASNVGIAYILLHHLPGSRK"
     exon            1066953..1067127
                     /number=1
     exon            1067210..1067461
                     /number=2
     exon            1067515..1067926
                     /number=3
     exon            1068443..1068668
                     /number=4
     CDS             join(1071556..1071699,1071757..1071865,1071929..1072402,
                     1072453..1072808)
                     /codon_start=1
                     /locus_tag="AO090023000419"
                     /note="predicted protein"
                     /old_locus_tag="AO070226000022"
                     /protein_id="BAE58967.1"
                     /transl_table=1
                     /translation="MKHHLMVGTWTPPGRIYTVAFDDEALTLDLVKKTDIPEAEPISW
                     MTFSHDKKTIYGAAMKKWNSFAVNSPTDIVHQVSHPVAGHPLAANDDTNTRAIFVLAA
                     RQAPYAVYGNPFYKYAGYGNVFSVESDGRLAKNIQNYEYEPNTGIHGMVFDPTETYLY
                     SADLQANKIWTHRKDATTGELTLVDCIDAPSPDDHPRWVEMHPSGKYLYVLMEAGNRL
                     GVYVIDEKRHVPVFTHITYPLLPPGLPPRNKYRGDVTFTTRSGEYLFATTRSNHFDVT
                     GYITAFKLGPNGNIERQLFIHPTSTSGGHSNAVSPCDFSDEWLALCDDQLGFVEIYRF
                     RDENLARVARVDIPEKGFGMNAIWYD"
     exon            1071556..1071699
                     /number=1
     exon            1071757..1071865
                     /number=2
     exon            1071929..1072402
                     /number=3
     exon            1072453..1072808
                     /number=4
     CDS             join(1074520..1074919,1074977..1074981)
                     /codon_start=1
                     /locus_tag="AO090023000420"
                     /note="predicted protein"
                     /old_locus_tag="AO070226000021"
                     /protein_id="BAE58968.1"
                     /transl_table=1
                     /translation="MIRFAGSIHLTSHQGQDPILKCIVDLWAKHRVIVKDLFSYEKDC
                     LEHEVNDSAIFNAIQVLQRELNVSLATAKEAARNIQLETEREMHGLYKEILGRTGTYS
                     PEARYVRALVESLAGNVFYSSTAERNAMPLLA"
     exon            1074520..1074919
                     /number=1
     exon            1074977..1074981
                     /number=2
     CDS             1075732..1077366
                     /codon_start=1
                     /locus_tag="AO090023000421"
                     /note="predicted hydrolases or acyltransferases
                     (alpha/beta hydrolase superfamily)"
                     /old_locus_tag="AO070226000020"
                     /protein_id="BAE58969.1"
                     /transl_table=1
                     /translation="MATPGLLYVTMQPRDSLPAAQFHDWYNTEHGPLRLRLPFVTNGF
                     RYRAVDGIEPEWVAPYDITDMVELTRETYLALRGDGVKTPREKATMAQIDVDRRLYDL
                     LHDHKASDYKPVEDIPDTEAAGSVLVSALVTVPADKEEDLQKWYREEHFPMLARVPGW
                     RRSRLFTTSSIDPKAAREFLCLYEYSAINGLGGPEHKAAMDTPWRNRLMNDPATSKKR
                     RVYQWAYTFGPAPRELSSLAHKDVAGPWASNDGRTRTFPSPTRPAVESFITTPDGVDL
                     PYRLEGSTDPHSPVIVLSNSILVDYTIWDSFVDAFLSNPKNQNFRILRYLTRGRLREC
                     GEKPINIDLLASDIIALLDALRIPKATLIGVSLGGVTVLNTSLLYPDRVTRFISCDTN
                     SSAPESNLKAWNDRVAMAESDGAVSATTHEPIIGEQLSEATTRRWFVPESYETQPEVP
                     ARVKEIVRNNSLDGFRKGVQALCAYDVRDRMAQAQVPGLFVAGEGDGVLPKTMQQMAN
                     DLKGGAELKLVPKAGHLPMAEQPAAFTEIVNGYLHA"
     exon            1075732..1077366
                     /number=1
     CDS             complement(join(1077499..1077947,1078010..1078074,
                     1078145..1078542,1078637..1078741,1078814..1078912))
                     /codon_start=1
                     /locus_tag="AO090023000422"
                     /note="predicted protein"
                     /old_locus_tag="AO070226000019"
                     /protein_id="BAE58970.1"
                     /transl_table=1
                     /translation="MSVAVVTVILRCYVRGWLVKAFGWDDGAMVVALLFYVMFSACMI
                     GGSVWGTGRRYKDLTAVQRVTAMRYWWLCEIAYCFASVGGKISICIFLMRITVKREHI
                     WSLYIVMILTVIAGLVFMFLMLLQCKPLEYFWTKVAFDPNIHGQCLDMTIIIAMTYVY
                     SAFAVICDFTVAILPIFLVRKLHMKKQTKIAVVGILSMACIASSAVIIRIPFVHTFND
                     PDFLYATVEIALWSNIEVGLGITAGSLATLRPLLRHWLGSRTDPTYPSPFPGRSGSRL
                     PGGASHDRPFPLGSLDESVQNRLRPDKLAVTVTTVQSQDHNGSWHGGSSPNSSEERLT
                     AQGSPALPAVGGEMGLGIHRTFEVTQTSTSQTVREHF"
     exon            complement(1077499..1077947)
                     /number=1
     exon            complement(1078010..1078074)
                     /number=2
     exon            complement(1078145..1078542)
                     /number=3
     exon            complement(1078637..1078741)
                     /number=4
     exon            complement(1078814..1078912)
                     /number=5
     CDS             1085030..1086808
                     /codon_start=1
                     /locus_tag="AO090023000424"
                     /note="predicted protein"
                     /old_locus_tag="AO070226000017"
                     /protein_id="BAE58971.1"
                     /transl_table=1
                     /translation="MTYTRHSIQQLQEWYDAGNREPLDKFVRAFKYIQSLPADHDDSF
                     HKLGGYHGEPFHYEKAPPNRSSKWWGGYCFHGCVLFPTWHRAYMLRFEQALRTAPGCE
                     DVTLPFWDECAGLVGRPSVGLRPHHLIPRVLTMRTYELDGQTIPNPLFSFKLKQKIED
                     LTVGKEQHYSKPEGYETVRYPLSGMVGTQEDEENTKIHNARFSDAESERLLNVNVTNW
                     LITGPRHIPTRQGAKPPSDTTSILARYLKCLDTDTYTIFSNTTSQTKLMEKLCRERNE
                     GHWLMSLESPHNGIHLAIGGFFQQGEDGTNADEIDDANGDMGDNETAGFDPIFFLHHC
                     FIDYMFWQWQLRHGATETLTIDEGDPGAKVPEGGILDLPEGEQLTMDTPLPPFVKPGE
                     KNYYTSKDMVNIESLGYTYGSGSLDKHHAPILHAPHVPVKQMVKISSIFRSKHKGSFV
                     IRTYATGPGCPEPIEIGREPILNRWNVSQCANCQNHLEAVSMIPLDAEMLALLLGDDW
                     EKENRTVDEIKYQVEIHARSEKTPSNEKRKRGKFFFSPTPLVGRLVPGGGLPAILKPP
                     VFNVPKDMPTVEHLLRNKSFRVERTA"
     exon            1085030..1086808
                     /number=1
     CDS             join(1088260..1088465,1088520..1089494,1089554..1089965)
                     /codon_start=1
                     /locus_tag="AO090023000425"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070226000016"
                     /protein_id="BAE58972.1"
                     /transl_table=1
                     /translation="MVDADNKPTAKHDEVRSDPPLIQRKISVLEDIKRSPKVAGYCLA
                     LTSGIILYGYDLAIVSNVSSMPEFQHDFGRKLGGQLIIPSLWLGLWNVANPIGGIFGA
                     IFGGYVQDRFGRRSSLAVASIISAIGVAIAYVSNLPGEIDGRRAVFFVAKLVQGYAVN
                     MLTCTIQTYMSEVLSPTLRGPILAFFPLFTLLGQLVGSIVVFTSLKEKGPGGYLKCFI
                     SQWPFSALPLLVSIILPESPTWLVRKDRMEAARKSQRRLDSARVDSEAAIEKLCSSIR
                     HEDEQAQNHPASYLECFRGNNLRRTMIVLFANLISQLFGLTLMSKSSYFLQIVGMGAT
                     NSLLFLEVGIALGLVANILSMWTLSRFNRVPLIMVGLAITTLLWTGMGILGCFQGVVT
                     IWWSAVTMMLVITVCGATAWPASYAVGAEASALRLRAKSQGLGWVMNGLSNGVFGLVL
                     PYIFNPDQGNLRAKTGFVYTGLCLVGLVGTWYVVPEMKDRTPIEIDRMFEMHLPARKF
                     KAQTFNDENSGTSPKSRSATPV"
     exon            1088260..1088465
                     /number=1
     exon            1088520..1089494
                     /number=2
     exon            1089554..1089965
                     /number=3
     CDS             complement(join(1090550..1092849,1092905..1092929))
                     /codon_start=1
                     /locus_tag="AO090023000426"
                     /note="Fe-S oxidoreductase"
                     /old_locus_tag="AO070226000015"
                     /protein_id="BAE58973.1"
                     /transl_table=1
                     /translation="MAELSLAEGLVTFWHSYRLPILIAIASVAILLRAYRKFQPKSKA
                     VTASSIPPSPRSQTPEKFEQIRTGESEKPVVVEKSVPKAATGNDPTPKVVSGPKRVFG
                     KKPLKVAGRRREDQGAPLSFIQPIIFFASLTATTERYAQILLEDLRAAAKERADPENR
                     ERGLLPPQIHDLSYIDFDDYFTTAPKPPSTSPGTRYVYCLLIPTYNIDTVLNTFLGHL
                     DETHHDFRIDTSSLSTLAGYSVFGFGDKEGWPTEEEGFCSQAKELDRWMAKLTGKKRA
                     YPLGLGDVKSDAESALKEWSRGLQDILVDILDNGGLGEGVAGSGDPLESDEEDLDDEE
                     NDGNRSKRRNDQDVVDLEDIKMGSDGPSGSGPVPVDFTTAGKSAAPNQSTVKEMVPKT
                     SPTYAALTKQGYTIVGSHSGVKICRWTKSALRGRGSCYKFSFYGIRSHLCMEATPSLS
                     CSNKCIFCWRHGTNPVGTTWRWKVDSPDLIFQGVKEGHYKKIKMMRGVPGVRAERFAE
                     AMRIRHCALSLVGEPIFYPHINEFLDMLHSEHISSFLVCNAQHPDQLETLHRVTQLYV
                     SIDASNRESLRTIDRPLHRDFWERFQRCLDILREKRHVQRTVFRLTLVKGFNVDDEVI
                     GYADLVEKALPCFIEIKGVTYCGTSTSAGAGLTMQNVPFYEEIQEFVVSLNKELERRG
                     LDYGIAAEHAHSCCVLLASTRFHVNGKWHSRIDYDRFFELLEKEKADGTSFRPEDYMR
                     ETEEWALWGNGGFDPNDQRVHKKGKKKALQAATE"
     exon            complement(1090550..1092849)
                     /number=1
     exon            complement(1092905..1092929)
                     /number=2
     CDS             join(1093113..1093158,1093252..1093456,1093607..1093793)
                     /codon_start=1
                     /locus_tag="AO090023000427"
                     /note="predicted protein"
                     /old_locus_tag="AO070226000014"
                     /protein_id="BAE58974.1"
                     /transl_table=1
                     /translation="MAAIKMNTAWVAPYNGIFRLDADWFPHGYQIRSLRALTPDSTHV
                     QLSFLSATTPTHVISTNELRWHKLICLLFRSFSTDYWSIPCQHTTGTRRLRHTREFAQ
                     DTGLSDQFSPSTYIDHRVPTRHDVRYGRSIVQREETSFSVLQS"
     exon            1093113..1093158
                     /number=1
     exon            1093252..1093456
                     /number=2
     exon            1093607..1093793
                     /number=3
     CDS             join(1093927..1094005,1094060..1094212,1094326..1095248)
                     /codon_start=1
                     /locus_tag="AO090023000428"
                     /note="renal dipeptidase"
                     /old_locus_tag="AO070226000013"
                     /protein_id="BAE58975.1"
                     /transl_table=1
                     /translation="MRISSHHEVLTLEQRVDNILQKTPLIDGHDDLPILIRLKYGNQI
                     YQDNFTTKFVHGGFPGHVDLPRLSKGKVGGTFWSVRQTMEQVDLWLRLQQAYPDTFST
                     PPNGTTALQPFLDGKIISPMGMEGLHSIGNSLAYLRHFYAQGVSYATLTHNCHNRYAD
                     AAVTELPDGSVKKADPHWHGVSEAGKALVSEMNRLGMIVDLSHVSAETMRDVLGAGKD
                     DWAGSSAPVIFSHSSAYAVCPHPRNVPDDVLQLVKSRNSLVMVNIAPDFVSCKAGDNP
                     NGLPDFVPENATLEHVADHIMHIGQLIGFDHVGFGSDFDGIGTVPRGLDDVSKFPDLV
                     AELLRRGVSDEDAGKVVGGNLLRVWRDVDRIALDKQANGALPLEDDLPEA"
     exon            1093927..1094005
                     /number=1
     exon            1094060..1094212
                     /number=2
     exon            1094326..1095248
                     /number=3
     CDS             complement(1095583..1096233)
                     /codon_start=1
                     /locus_tag="AO090023000429"
                     /note="predicted protein"
                     /old_locus_tag="AO070226000012"
                     /protein_id="BAE58976.1"
                     /transl_table=1
                     /translation="MHQNLTFTIPPHLNEYNVPLSSFKAARPQWTNFVVGGLVFSRFS
                     RDSQDKSKEEGEPRVLLLQRALTDSLPGYWEGPGGGCEETDETILTAAVREVVEESGL
                     HVSRIVDLVGVEEWTKERNGTMFFVAKFSFLVEVHEAQGVFGGIAGTDGEKTIEVEGD
                     AVQRWEDRVRLEPSEHSTFEWATEEQVRLGLEGKGKYKILEDEGRNLMKGFRMVAQ"
     exon            complement(1095583..1096233)
                     /number=1
     CDS             1098126..1098614
                     /codon_start=1
                     /locus_tag="AO090023000430"
                     /note="predicted protein"
                     /old_locus_tag="AO070226000011"
                     /protein_id="BAE58977.1"
                     /transl_table=1
                     /translation="MGMNMQNETSGHDHGHSHQDMSMPAIFTTGTKVTLFFSIWTTNS
                     MTTYLLTLSLLFLLAWFNRFLGALKFQLENKINSTRASGLPVPILGQPPAAHRYRKIP
                     KDRVSPLPRYIQVNTNDPFERPSPPPPSPPPLHDDERSELVLGSAGPSCVRRWFKILF
                     GK"
     exon            1098126..1098614
                     /number=1
     CDS             join(1098629..1098697,1098751..1099071)
                     /codon_start=1
                     /locus_tag="AO090023000431"
                     /note="predicted protein"
                     /old_locus_tag="AO070226000010"
                     /protein_id="BAE58978.1"
                     /transl_table=1
                     /translation="MELAARRRTITTRRHPCALGLCLNAGSHDFQHRHLLRRTGWHRC
                     GRTHYGEIYSAITGLAGRIMPRWMMTCLLGFIILPSFQCSNQFSPKYVCIKSLMCQPR
                     NTEKSNANTTLAIMDRPKPYPCAIQTQ"
     exon            1098629..1098697
                     /number=1
     exon            1098751..1099071
                     /number=2
     CDS             complement(join(1099878..1099984,1100037..1100153,
                     1100207..1100381,1100434..1101321,1101385..1101897))
                     /codon_start=1
                     /locus_tag="AO090023000432"
                     /note="2-polyprenyl-6-methoxyphenol hydroxylase and
                     related FAD-dependent oxidoreductases"
                     /old_locus_tag="AO070226000009"
                     /protein_id="BAE58979.1"
                     /transl_table=1
                     /translation="MVEKVDVLICGSGSAGLCAATWLARCGIRCKVLERRDGPMTMGQ
                     ADGVQCRTVEIFESFGIGEELLRESYHVLEVVFWAANGSGDIKRTGRTADTQPGLSHQ
                     PHVILNQARINGLFIESMQRFNDQIIDYGFDIKNVEVDSSLVNDPQSYPVKVTAEKEG
                     RTEIFEAKYALACDGAHSTVRRSLGYKMIGDSSDAVWGVMDMVPRTDFPDIRKKTTIR
                     SKAGNLLIIPREGDARNLTRFYIELPAGTKAKEVKLEDLQQSARAILSQYRIEFAETV
                     WWSAYAIGQRHADFFHRDYRVFLAGDACHTHSPKAGQGMNVSLQDGYNIGWKLATVLK
                     GLAPPSLLETYVLERQKVAIDLINFDRYFSKLFSSGGQTSPAEFQEGFIKSGKYTAGL
                     TAKYDSSAITFHTEGSEQLSTNIVTGMRLPSSQVVRYCDSKPVQLMTALKSDGRWRVM
                     AFVGDISKSENKSKLNALGNYLSSDESPLHRFRQKDADIDSVIEPILVGYGKRHGIEL
                     EEIPEAFHPIAGKNQIKDLHKIYFDDESYNKGHGHVYEYLGISPEKGAVVIVRPDQYV
                     SAVIGLDDYRQIGRFFEGFLIPQGESASPESKL"
     exon            complement(1099878..1099984)
                     /number=1
     exon            complement(1100037..1100153)
                     /number=2
     exon            complement(1100207..1100381)
                     /number=3
     exon            complement(1100434..1101321)
                     /number=4
     exon            complement(1101385..1101897)
                     /number=5
     CDS             complement(join(1102514..1102803,1102857..1103188,
                     1103247..1103360,1103496..1103634,1103701..1103854))
                     /codon_start=1
                     /locus_tag="AO090023000433"
                     /note="serine/threonine specific protein phosphatase
                     involved in cell cycle control, PP2A-related"
                     /old_locus_tag="AO070226000008"
                     /protein_id="BAE58980.1"
                     /transl_table=1
                     /translation="MVDSKVPQPGPAKLKRNAGPDEWLEAAKDCKYLSEQHMKQLCEI
                     VKEYMMEESNVQPVSTPVTICGDIHGQFYDLLELFRVSGGMPDESMVEPPKTSPAGSN
                     EVTLNRNFVFLGDYVDRGYFSLETLTLLLCLKAKYPDRVTLVRGNHESRQITQVYGFY
                     EECFQKYGNASVWKACCQVFDFMTLGAIIDGRVLCVHGGLSPEIRTLDQVRVVARAQE
                     IPHEGAFCDLVWSDPDDVETWAVSPRGAGWLFGDKVADEFCHVNDLTLIARAHQLVNE
                     GYKYHFANQNVVTVWSAPNYCYRCGNLASVCEIGEDLKPTFKLFSAVSDDQRHVPTSR
                     PGRSEYFL"
     exon            complement(1102514..1102803)
                     /number=1
     exon            complement(1102857..1103188)
                     /number=2
     exon            complement(1103247..1103360)
                     /number=3
     exon            complement(1103496..1103634)
                     /number=4
     exon            complement(1103701..1103854)
                     /number=5
     CDS             join(1104347..1104612,1104723..1106133)
                     /codon_start=1
                     /locus_tag="AO090023000434"
                     /note="predicted protein"
                     /old_locus_tag="AO070226000007"
                     /protein_id="BAE58981.1"
                     /transl_table=1
                     /translation="MTQTAAGKSTGGVLQIPIAATQKNTANAAAAPTPKKAPKPAAPR
                     LKLLVRRLPPGLTQAEFEVAVGPEWKLGAGKIDWFQYKPGKVSKDDHIIPLSNKVRQV
                     SFTDARNTFNDPILLGPPSVEYAPYAKVPGSRVRKDARQGTIDQDPDFIAFLESLTQP
                     ITKPPTVENATDAEEKKETVTTTPLVQYIKEKKANKAKDSSNKSSKHAKADKETKAEK
                     VQAKKLLQRPDKETAQAPEKIEKKAKADKATKEAVRVANKQAANVAKQAAKASAAQSS
                     PKDPGQSTPATERRRERGSIAAAAKILQRDLGLAPAGSRRKGGKSGSAETDASKAEAT
                     SSESGKKETPPRSSRGGASSQNAKVKGNVPQPNEPTSQSEANTPPASTTPTSGKSSKS
                     KGKQAPPAASTATQAFLKHANPSQGVTEPLLEAAFKTFGKVVKVEIDKKKGFGYIDFA
                     EPDGLQKAIAASPVSVAQSQVVVLERKINPGGEKGRGKNRNEPQPTNAGGNNNSNNTN
                     ANGGRGGKSNEGGSGSSRGRGGRLKKGGGGGAKGSGGGNANANAPAKDAK"
     exon            1104347..1104612
                     /number=1
     exon            1104723..1106133
                     /number=2
     CDS             complement(join(1109696..1109724,1109736..1110618))
                     /codon_start=1
                     /locus_tag="AO090023000436"
                     /note="predicted protein"
                     /old_locus_tag="AO070226000005"
                     /protein_id="BAE58982.1"
                     /transl_table=1
                     /translation="MGYPEIIRLLHSALSQTNKIHIYNIDTRDERGLTPLHYASLSNS
                     ARAGEVTEVLLELGADPNLADDRGCTPYMMASLLQHTQVMEVLQSNVTSPNSETRDTQ
                     DLPALTLAEHDHWALLREVTTTGRADLTYKCMLSGDTLLHMATAANETDILRLLIENK
                     LRPESAVNEQGHTPLHLARTVEIAKLLVDDGYHVDSTDLNNNTPLDIARRQPKTRDVA
                     DYLEDVSRMSEKKHRTERWEENTKGESETVSSELTVAIHDHNLTSSNSPAWIGRLKRC
                     ILHLQFWTFLLLAIYVVTVFRIVSLLQ"
     exon            complement(1109696..1109724)
                     /number=1
     exon            complement(1109736..1110618)
                     /number=2
     CDS             complement(join(1110793..1112112,1112184..1112425,
                     1112520..1113143,1113242..1113617))
                     /codon_start=1
                     /locus_tag="AO090023000437"
                     /note="nucleoside phosphorylase"
                     /old_locus_tag="AO070226000004"
                     /protein_id="BAE58983.1"
                     /transl_table=1
                     /translation="MDDPNRICLTPDAYTVGWVCVLASEQYAARALLDELHAPPPTPR
                     DENAYIVGRMGKHNVVITRPIGQGKVNAADAAVNMTRTFPQIRFGLLVGVGGGATDSP
                     DPYVGKRDIRLGDVVVSKPQGEHGGIVQYDTGKRYPEGYKIISHLDKPKSALIVAANV
                     LQSHHQFKEGHMKKYIQDATLKLRDLGMPYFGFPGREHDLLFRREYRHPEEGEDCSNC
                     DRTQIVDRDPRPDDGPSIHYGLIASADLTMQDPKFRDALRKSEKVLCFEKEAAGLMDR
                     FPCIAIRGISDYADTHKCKKWQPYAAVAAAAYAKDLLAVIQPHDIARDRAAAQVLEQF
                     THDLNEVREKFNKMSTAMDTKYRHEIMGWLSTLDFKTEQEDLLSRSVFIGKWLLKSEE
                     FMHWVKGSRWQLRCYGEAGTGKTNFCAMVIHRLQKTFGLKRPVIYLYLSDDEHKRVKQ
                     TLDNLLGSMLKQLISCGPNVDIPQKLIDAYEGLGNGAYSTREIMKQAFQDLVAKQERV
                     YLIVDGLNQCFPEVSELIKEYALGLVQDGLPLSLLTTSLGYREVKKIVFCNHCRKQNI
                     GMYVHCDCDDGQFDLCLDCKKQGIICPKNHDGEEPYDTVRIEVRARNDELEEYCREMI
                     SRALKTGRDRRDERVHPSPKYNPRPIARYLRDKPGLVNRISRQIAGKAQCSLIIAQLW
                     LQNLFESKEPENDKGVLRFLDKIPEKRLTAYVDERIAKLKRYRKENELHIAFTTLALI
                     MSACRYLTILQLQHALALHSDQVIESTLNDRTFILWSANGLITIDKAEESCSFVRFFH
                     GTLPAVLAKSDHHPFLKRAEYEMAKTCLKYLQDEQSLSHYENPTAYPFLPYALRF"
     exon            complement(1110793..1112112)
                     /number=1
     exon            complement(1112184..1112425)
                     /number=2
     exon            complement(1112520..1113143)
                     /number=3
     exon            complement(1113242..1113617)
                     /number=4
     CDS             join(1114503..1114641,1114706..1115095,1115149..1115861,
                     1115932..1116180,1116251..1117179,1117241..1117301)
                     /codon_start=1
                     /locus_tag="AO090023000438"
                     /note="predicted protein"
                     /old_locus_tag="AO070226000003"
                     /protein_id="BAE58984.1"
                     /transl_table=1
                     /translation="MLRQIIGTLVLLLMQVFAVTSQQQPTSSTTALTFNPTSCGEIIN
                     NEEVSIFDASQAHKCLTSLPFRADIASQLVQYVNDMIQFHSTLAYLADPPQSYQQPAV
                     DLVSGLSQFQRDIDNNVFRNEYAFEAALNHLIHAAHDDHLELVGGALSRFTYAAPYRI
                     VSVSSDGVELPKVYISEDLLANETRYLPWQSSAIRTINGQDVVEYLTQFAAVNSFGKL
                     EPHADWNMLMRSAALEIQGKREAFHGAATYPGDFITFTFENGTTVGPLPWEALFCCNG
                     GVGPLQTGDELYDFFVLGHYPASYDENLEADMTTISNRAAPAITPLNNPAYPPKADVT
                     EASYTRDGGALLRGYFLHDSSLAVLSIPHFVVDRKAPHSFSNAVKQFLAQSTKAGLKK
                     VVIDVQQNPGGSPLLALETFKIFFPSIKPWASSRRRVHPMANALGSALTTYWQNLTMD
                     RPEYYNLTANEWVVTGRLDLDTGRNFTSWDDFVGPTDRYRGDGFTKKQYNLSSTLFTM
                     KAAGIEIDGHDNGQPYKPEDIIILSDGLCSSACALFMELMHHEAGVQTVVIGGQPSYG
                     PMQAPSGSRGAALYKAENMHRDIELARGIDKSRHVDLPSRTHAFLITTATVNLRDQVR
                     QTDSSATPLQFLYEAADCRIFLVPATWYNYTNLWKYAVDAIWQNPAFCTKGSRTDHTQ
                     PTHPSVPGKPYNASSTLSNLADSQSEGHPSSLQDDSNFILDKVGSPGKLEGRPCQLHT
                     DCAGQLSCQDVQVCGIEQNSQKEFYGIPEKQKRCVEWCDNYTKKCVGWGKTCYQDNDP
                     ILEQPFPGETMKASIAMAQKTPLRAITG"
     exon            1114503..1114641
                     /number=1
     exon            1114706..1115095
                     /number=2
     exon            1115149..1115861
                     /number=3
     exon            1115932..1116180
                     /number=4
     exon            1116251..1117179
                     /number=5
     exon            1117241..1117301
                     /number=6
     CDS             join(1118640..1118899,1119061..1119115)
                     /codon_start=1
                     /locus_tag="AO090023000439"
                     /note="predicted protein"
                     /old_locus_tag="AO070226000002"
                     /protein_id="BAE58985.1"
                     /transl_table=1
                     /translation="MYRFLPLFFLPLAALAADELPGVVVPKKPVGGLYDTCAIQVVQL
                     SKGEKAWVTGNCSTRHGDQMESHLDLDRCFSSQFTFDITPEKDGGKFPFLKICLLVLI
                     YL"
     exon            1118640..1118899
                     /number=1
     exon            1119061..1119115
                     /number=2
     CDS             1119988..1120602
                     /codon_start=1
                     /locus_tag="AO090023000440"
                     /note="predicted protein"
                     /old_locus_tag="AO070226000001"
                     /protein_id="BAE58986.1"
                     /transl_table=1
                     /translation="MATNNANLQPFRAIRAQSTQSTITVYQAFSPEIAEPALRAQKFV
                     PPFSRTRMTWIKPSFLWMAYRCGWATKPKQERVLAIEITREGFEWALRRSCLSHVPGS
                     RDQDQEKWRQRLRESPVRVQWDPERDLWHRPLGYRSIQIGLSGEAVERYVDEWIVSIT
                     DVTGLMGDVKRALDKADAEGAEGLLPVESVYPLSEELRDILDAT"
     exon            1119988..1120602
                     /number=1
     CDS             complement(join(1121997..1122241,1122353..1122464))
                     /codon_start=1
                     /locus_tag="AO090023000441"
                     /note="predicted protein"
                     /old_locus_tag="AO070272000001"
                     /protein_id="BAE58987.1"
                     /transl_table=1
                     /translation="MNIHDISFTSLGLVVLDEIRLPHKNPLTDILGGSGAYGWMIHVG
                     NDFPKPIEDRLQSWDVTLVIERESDEPSTRGLLEYKDTTFGRATYFSSLKLIEPLPYC
                     RQTLLIINLVDVLSTT"
     exon            complement(1121997..1122241)
                     /number=1
     exon            complement(1122353..1122464)
                     /number=2
     tRNA            complement(1123419..1123527)
                     /locus_tag="AO090023t00015"
                     /note="tRNAscan-SE"
                     /product="tRNA-Ile"
     CDS             join(1124314..1124596,1124851..1124885)
                     /codon_start=1
                     /locus_tag="AO090023000442"
                     /note="predicted protein"
                     /old_locus_tag="AO070272000002"
                     /protein_id="BAE58988.1"
                     /transl_table=1
                     /translation="MPRITRNDPVISVTALEAWTTGVDALKAAVDVTIESGKRTLSFN
                     ATAGSTMNGVFDPIDKIWAMSGRQTTGSMLMPVGEEWVAISDNPRHPNRGNLADGTGF
                     SAA"
     exon            1124314..1124596
                     /number=1
     exon            1124851..1124885
                     /number=2
     CDS             complement(1125763..1127004)
                     /codon_start=1
                     /locus_tag="AO090023000443"
                     /note="NADH:flavin oxidoreductase/12-oxophytodienoate
                     reductase"
                     /old_locus_tag="AO070272000003"
                     /protein_id="BAE58989.1"
                     /transl_table=1
                     /translation="MTQDIIDNIAAEGISYYTPAQVPPAGTQVEGSTKLFSPLTIRGV
                     TFPNRLFLAPLCQYSAKDGYANDWHLTHIGGIVQRGPGLAIMEATAVQKVGRITPQDL
                     GLYDDGHIEPLKRITEFAHSQSQKIGIQLAHAGRKASAVAPWLSGNAMAVKEVGGWPD
                     DIVAPSAIPQEEGINAVPKVLTGEDIGVLKKDWAEAAKRAVRANFDAIEIHAAHGYLL
                     HQFLSPVSNRRTDKYGGSFENRVRILLEICEEVRAVIPTAMPLLVRISATDWFEFDDN
                     LTKEFPESWTVAQSIRLALLLADRGVDLVDVSSGGIHAKSAIAIRSGQGYQVHFAQEI
                     KKAVGEKLLISAVGGIKTGALAEEVVQSGIDAVQAGRWFQQNPGLVRAFANELGVKVR
                     MATQIDWSFEGRGKKAKKSSL"
     exon            complement(1125763..1127004)
                     /number=1
     CDS             complement(join(1128364..1129608,1129672..1131116,
                     1131178..1133098,1133147..1133435,1133515..1133810))
                     /codon_start=1
                     /locus_tag="AO090023000444"
                     /note="polyketide synthase modules and related proteins"
                     /old_locus_tag="AO080531000331"
                     /protein_id="BAE58990.1"
                     /transl_table=1
                     /translation="MRIIHFSNKFPPDDLADLFRRLRLHSKCPNHVILARVLEEVTDV
                     VREEITELPAELRSLLPPFQSILDLAESFNWHQGPLSGTFECVFLVLMPVCLFVGRPD
                     EFVFRRDTSLFTGLGLGFLAATAIVASPSLCSVPVTVAEVVRMAMRTGLLIYQRSQDL
                     EPQSLDGALESWTSIVKGMGEVAVREGIDEYNSSTDTPQPSSIYISVVEPDGSVFING
                     PPSRLRKFFSTSGKVQSAAHAPLPVYGGPCHAPHLYDHSHSSWAVKKCRAKVLSRDLS
                     HAAYLLSMADGNPLKADTVLELFESATYILLTSIIRWGDVVNAITASSPLLEKDMKLQ
                     VEILRPSPVVDGLVSAIQKSHPGCSAYVVDLGEWIFDDTHISPHGAHEKIAVIGMSCR
                     LPGGADDLELLWELLREGRDVHRKVPADRYDVDSHTDITGKQRNTSHTPFGCFVDQPG
                     LFDAGFFDMSPREAGQTDPTHRLALLTAYEALEQSGYVPDRTRSTRRERVGTIYGQCS
                     DDYRECNAGQDIDMYFIPGNYRAFAPGRISYFFKFSGPSFNIDTACSASLAAVQIACS
                     VLWRGEADMVVAGGLNILTGSDSFAGLSKGFFLSKTGNCQVFDDAADGYCRGDGIGSI
                     ILKRLSDAQQDNDNILGLILGSATNHSSNAISITHPHAPTQANLYRSTLMQAGVRPQD
                     VDLVEMHGTGTQAGDAAEIESVTKVFSPAVPRRSQPLRISSVKANVGHGEAAAGITAL
                     IKALLIFKHNEIPPQVCLRTTLNSKFPDLRQLNVHIPKKIIPWPRLPGRKRYIMVNNF
                     SAAGGNTSLLLEEPPARPDPKRMSSNEIRRYCVSKEHNLASLAYTTTARRMHHKYRIV
                     VHGASIQEIVKSLEQHISIAETQCAIQKAPTIGFVFSGQGSFYQGVGRQLFQEYPPYR
                     NEIQRLDEICTFHGFDSILPAITSRSSDILEISPFMAQLMTVCVQIALCRLWRSLGVI
                     PNVVVGASLGEYAALYAAGTLSASDVIYLVGQRARLMQELCTINSHSMLAVKATIGEI
                     RHTVRNNAYEFACINGPRDVTLAASVEDINDIQQTLVSQGYRVAKLNVPFAFHSSQIE
                     PILEPYNKIAHSVIFRNLKTALISPLLSDVVFDNKSFPPSYLRDSTRGTVQFSDAMTK
                     AQEIGLVDSKTVWVEIGVHQTYTGAMRANIPNLEVVAPSLRSDESNWHTLAASMSALH
                     SAGVHLDWNTWYKPFESQLRLLNLPPYQWNLKNHWIQHNGDWLLLKDKRSRTRYERSP
                     GPAPPPLRTALVHHILEESFGKDGGTVVIQSNVTDDEFHAVASGHKMSGRPLVSVFAY
                     TDIALIMARYMYSRLKSGTELSAMDFGKVRVFQGLIPRKDRSKPQYVRMRMQADPMCS
                     SMPLSLHRVLDDEMNEEELAIGVVTCGDSHSWRDEWAAYSYLLTSRIEALHQLADQGL
                     ASRVSKDLVYTLFKNVVDYAEHYRGIQSAVMYGLEAVADVILSPSQDSRWTAPPHHID
                     PITHVGGLILNAGPAMDHTNTIYVMEGWESMRFSDSLMAGELYRSYVKMNPANDNSGF
                     FSGDIYILHGNRVIGRVREMTLRPLPRILMSRFFDPPDSQYGQMAQQEPSTALPSTPQ
                     HTSSAKTTESTQSQQDESDNTSLATPENENKAPISGSWPNANSQLVRDAIALIASETG
                     VEPDALTDETEFSAVGVDSLLSLVLVEKFALELNIDLQGSFFLETPNVCDLKAYLEGN
                     QMTLR"
     exon            complement(1128364..1129608)
                     /number=1
     exon            complement(1129672..1131116)
                     /number=2
     exon            complement(1131178..1133098)
                     /number=3
     exon            complement(1133147..1133435)
                     /number=4
     exon            complement(1133515..1133810)
                     /number=5
     CDS             join(1135339..1135569,1135628..1135754,1135809..1135923,
                     1135983..1136431,1136496..1136806)
                     /codon_start=1
                     /locus_tag="AO090023000445"
                     /note="predicted protein"
                     /old_locus_tag="AO070272000005"
                     /protein_id="BAE58991.1"
                     /transl_table=1
                     /translation="MEVSEERDLYLHSITAALERLNSAASECQSRLLSEHDGSIEDHS
                     ANQTAHDNLVQEAYKFLQIAQGPIDTVATCFVRTAHVACARSLLEMGAFEGLPIGGES
                     RSTKELAEDLNVDEALLARLMRNSALFEETGPNQYRHTPFSEAYLRPEIRGMFRFAMD
                     EHMPAHLKMHEFLKSNSWREPTSTSNNPYTYAHDTNGKSMWEYLSERPTRMASFNDGM
                     TLQAMTELWMIDLFPWESLSDQQPTPTTVVAVDIGGGTGMGISRIRSYCCSLPGKFIL
                     QDQAHVIQSADPRGNGIEKMAYDFFEEQPIRGALTYLIRRCLHNWPQESIIQILKNVA
                     AAMQPEKSRLLIEEIIVPDMNAGIEEGWMDMIMMNLGAKQRTLKEWEEVLALAGFEVR
                     KIYQIPGNCHGLLEVWLK"
     exon            1135339..1135569
                     /number=1
     exon            1135628..1135754
                     /number=2
     exon            1135809..1135923
                     /number=3
     exon            1135983..1136431
                     /number=4
     exon            1136496..1136806
                     /number=5
     CDS             complement(join(1137867..1137902,1137955..1138004,
                     1138071..1138464))
                     /codon_start=1
                     /locus_tag="AO090023000446"
                     /note="predicted protein"
                     /old_locus_tag="AO070272000006"
                     /protein_id="BAE58992.1"
                     /transl_table=1
                     /translation="MQESLTPGSSAPLNIHDKRFAALYELGGKITELFAKELISQSGL
                     PWSSQEPLVILDNACGTGAVSSVLHHTIGNDKKANWHLTCGDKSENMLHYTRQKMLQE
                     EWHNAEVKIVNAQDTRLPSAHFTHIFTAFAFNLFPDDKSAMKGSPVNASEYFNQVAS"
     exon            complement(1137867..1137902)
                     /number=1
     exon            complement(1137955..1138004)
                     /number=2
     exon            complement(1138071..1138464)
                     /number=3
     CDS             complement(join(1139075..1139492,1139602..1140232,
                     1140283..1140340))
                     /codon_start=1
                     /locus_tag="AO090023000447"
                     /note="predicted protein"
                     /old_locus_tag="AO070272000007"
                     /protein_id="BAE58993.1"
                     /transl_table=1
                     /translation="MVDATDRALPLIVGKDTESEWKRANAFHTILSLCSTVAMSVLLG
                     PEFSMDTSLIQTIMMYNTAIMPSCAKRTSYPRILRPFVWRLSPLCRAVKSDLLKTKIK
                     LIPEIKHRIDIARSKKWWLEEGPMSLLDGLIETAFEKGCLSRSSDRGDDDQQVALLAE
                     EIIFYHFELSMPVVFFIIFAVYVIMNNKEYLTPLREEISEALKLSGGSFTLDTLNHAP
                     KLASFVKETCRFFRRVMKPIHLESINLSLKPGTIIMAPGRDVHLDPDYYDNPTTFNGY
                     RFYDASRGTCTPHISTTSPTFLTFSHGISACPARVLATQITRTIFIMFLLKFDVELAH
                     EEMPAYGFANGPAYLPNPSVMIRVRPCQKDVLGV"
     exon            complement(1139075..1139492)
                     /number=1
     exon            complement(1139602..1140232)
                     /number=2
     exon            complement(1140283..1140340)
                     /number=3
     CDS             join(1142969..1143557,1143612..1143732,1143795..1144462,
                     1145182..1145207)
                     /codon_start=1
                     /locus_tag="AO090023000448"
                     /note="multiple inositol polyphosphate phosphatase"
                     /old_locus_tag="AO070272000008"
                     /protein_id="BAE58994.1"
                     /transl_table=1
                     /translation="MVHLFSPQIVLSALLAFIRDAPSSSSSATSAGYSLHFDITNGWA
                     NLSPYKEADGFGVPKGVPRGCELSQVHILHRHAERYPESSWFDGEGMETFNRKLKSYS
                     SEHNVSVGIGPLAFLKNWKYLLGRDILLATGTATEAVSGAEIWSKYGRMVYRAPPGMA
                     VWDPELNVYPNGTRRATPTFRSTNKQRVLESAKWWLTGFFGPGHGNTSYNLVVIPEGN
                     GLNNTLAAEHSCPGDLKEGTHASETFVPRMVKDPLARLSKYFPDDFDLTTSDVLAMMN
                     FCPYEYATLGSSSFCDLFSEQEWLDFAYNLDLRLYGTSAFGSPTGRAQGIGYLLELSA
                     RLERKLIDSSDTSINTTYDNHSATFPVHQPLYMDMTHDKVIIGTITALGLQYFNYGPK
                     GMPSNVSHAVPRKFQLNKVAPFGARLISEIWTCPEEASIEVLDKTLYANPDLSDTKST
                     TDFIRFVLNALDWTCPR"
     exon            1142969..1143557
                     /number=1
     exon            1143612..1143732
                     /number=2
     exon            1143795..1144462
                     /number=3
     exon            1145182..1145207
                     /number=4
     CDS             join(1148972..1150341,1150393..1150552)
                     /codon_start=1
                     /locus_tag="AO090023000450"
                     /note="cytochrome P450 CYP2 subfamily"
                     /old_locus_tag="AO070272000010"
                     /protein_id="BAE58995.1"
                     /transl_table=1
                     /translation="MTITLVAIATGIVAFILYYICWSLFSSPLARIPGPKSFALTKWR
                     LAYEDYKGTRTRKIHALHERYGPVVRIGPNEVAFNSLSALRAIYGAGSGFERTNFYSM
                     FAIYGRKNMFSFNTVKQHAERKKLFAHAYAKSAMLKGINASMIETKVRKYMEFLEREG
                     RSQDIFTTLHYFSLDNITEFLYGDFGKTACLDGIEEDRALLHDILATGSRTLSWLTVH
                     HPKLTAWLYSRTGFLGCVARQFYPMQRPTPYTSIKLHATKAFQGFADASVAEKAKQSS
                     LISKLWKHHRSMKDGGLDNLDIASECADQLDGGIDTTSDTLMFTIWSLSRPEHWGFQQ
                     KLIDEVRSISEHDLNPEGIPRVEAADKLPYVEAVIKETLRLFAPLPASEPRSSPEATT
                     IDGYLIPARTVVSISPYTLHRNAEVFKNPLEFNPDRWLDPSQDLTEMNRFFWAFSSGG
                     RMCIGMHLAMAEMTTFVAALYRKYTTEPRGGFGTISPGITSRFEVFYDEGCSDMRVCF
                     P"
     exon            1148972..1150341
                     /number=1
     exon            1150393..1150552
                     /number=2
     CDS             join(1155287..1155380,1155463..1155483,1155533..1155688,
                     1155750..1155865,1155926..1156516)
                     /codon_start=1
                     /locus_tag="AO090023000451"
                     /note="predicted protein"
                     /old_locus_tag="AO070272000011"
                     /protein_id="BAE58996.1"
                     /transl_table=1
                     /translation="MITFIWLFVISLALHGVITSAHSHTLTSRTLARGIDIDKLLVAP
                     RSYYDSLATDHNVTYTGFNKDTNEQLLFSRYDEICVLDKQATYGPYYVSGEHIRQNIS
                     EMQLGIPLYLELQLVDVNTCQPVQNAFLDLPPNGNADDRDNVNTTFFRGIQKTDDFGV
                     ARFETKFPGHYALRATHIHVIVHENPHVLPNGTLELGTGSIAHVGQVFFGQTLIELAD
                     TFYPYTQNTNAIVLNQEDGIFYDEASSMDPVANYVHVGDSLEDGLVAWMAFGINTTSD
                     YTDTVQEASFYGAEGGETNENYNITKLGPLETVPSGVPTPSAFTTTIGL"
     exon            1155287..1155380
                     /number=1
     exon            1155463..1155483
                     /number=2
     exon            1155533..1155688
                     /number=3
     exon            1155750..1155865
                     /number=4
     exon            1155926..1156516
                     /number=5
     CDS             complement(join(1157388..1158813,1158869..1158984))
                     /codon_start=1
                     /locus_tag="AO090023000452"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070272000012"
                     /protein_id="BAE58997.1"
                     /transl_table=1
                     /translation="MFQGQGLRLAQVLLIVAPAFITYGYNQAGVGPLATLQTWVHTFP
                     EIDTINTHGAIKERNATRKGAVIASLQLGALLGALSCTYLGDRLGRRKTIFLAAAIVV
                     IGELLETSAYNTAQFTVGRVILGIGVGQLSATVPVFQAECSSAKNRGQHVVVDGICMV
                     LGFVLCNWIDFGLSKTTGQTQFRVPLALSFLFPLIILVSVFFLPESPRWLVLVGRTGD
                     AVRSLAAYRGLPVEDETIQAEIASIEAALELTEQSSCFKLREVFSGKNEDRLFYRFTL
                     CMVIQFFQQMCGGNLISTYISTIFEQNLKLGSDLSRILAASALTWKCLCNFIPFFAID
                     RLGRRKVFMFSGTGMCLCMVVLTITTSFDTSNKAASVLSVVFIWLFNLFYPIGFSGAN
                     FVYCTEVAPIQLRVAMASISTANKWLWNFIVVMITPVALDTIGYQYYIVYAAISACIP
                     VSVYFFYPETMGRNLESLNQVFRDAPSVWHVVSMAKDLPKGDVSHLDVEGVEKKLDIE
                     QKEHA"
     exon            complement(1157388..1158813)
                     /number=1
     exon            complement(1158869..1158984)
                     /number=2
     CDS             complement(join(1160385..1160933,1161020..1161444,
                     1161498..1161571,1161629..1161856,1161909..1162177))
                     /codon_start=1
                     /locus_tag="AO090023000453"
                     /note="permeases of the major facilitator superfamily"
                     /old_locus_tag="AO070272000013"
                     /protein_id="BAE58998.1"
                     /transl_table=1
                     /translation="MTPLPPGSEAEEQTNCTTDIKAMEKHIEDVSEYNKQQPPEGVYI
                     PSEEIQARFELLRYLSPEQMEALNKRVLKKIDWHMMPCVTLMFLMNYLDRINVSNARL
                     AGLQSDLNMTDTVWNAGISTFYVGYLVGQLPGNLLMAKSNPRWFLPVIMFMWSCGTIC
                     MPAMTNGVGFCVVRFFIGLAEAPFFPALTLLTSSWYTKEESPMRMAIWHAGNTISNII
                     SGFLAAGVLENMDGISGLHAWQWFFLIEGIASIVVAVASFIFLPAWPHNTRFLSEEES
                     QMAQYRVLVSNGGRDETVGGTWDGLKDAVKDPFTWFFCLMHFALVTAQSFKDFLPSII
                     KTFGFDTMTTYLVQAPPYAIAYVFACAAAWSCGRLQESTWHIVIPIIISAAGCSILIS
                     TLNVGARYFGIILLICGTYSGLNLQLSWETTVVPSPRAKKAALIAIANCISQSSHWFS
                     PYFYPTSQEPFYRMGGGLVLMGCALVALSAFAVNWRGRRLNKRLDEAEGWTMHSGNER
                     GWRYKL"
     exon            complement(1160385..1160933)
                     /number=1
     exon            complement(1161020..1161444)
                     /number=2
     exon            complement(1161498..1161571)
                     /number=3
     exon            complement(1161629..1161856)
                     /number=4
     exon            complement(1161909..1162177)
                     /number=5
     CDS             complement(join(1162623..1163115,1163175..1163509,
                     1163572..1163648,1165146..1165206))
                     /codon_start=1
                     /locus_tag="AO090023000454"
                     /note="mitochondrial tricarboxylate/dicarboxylate carrier
                     proteins"
                     /old_locus_tag="AO070272000014"
                     /protein_id="BAE58999.1"
                     /transl_table=1
                     /translation="MRNARPEYSHAALLSSPRAKTKKNAVSPGISLAAGAVAGAVEAT
                     VTYPFEFAKTRVQLSQKAASGTILTQASRHPLAVILETARHDGVRAIYTGCSTLILGT
                     AFKAGVRFLSFDTIKNLLADTDGTLSPARGILAGMVAGTVESVVAVTPTERIKTALID
                     DARSSTTRRYRGGFHALRTIVAESGISEVYRGLLSTTMKQSATSAVRMGSYNVIKEIV
                     SSRTSIKDTKNPALTFGMGATAGVITVYMTQPFDTIKTRAQGAKGASTMEALRDVLKD
                     GGVRAFWRGSSMRLGRLILSGGIVFTVYENVAALLMGSRKRRTNE"
     exon            complement(1162623..1163115)
                     /number=1
     exon            complement(1163175..1163509)
                     /number=2
     exon            complement(1163572..1163648)
                     /number=3
     exon            complement(1165146..1165206)
                     /number=4
     CDS             join(1167214..1167612,1167685..1168560)
                     /codon_start=1
                     /locus_tag="AO090023000455"
                     /note="uncharacterized protein conserved in bacteria"
                     /old_locus_tag="AO070272000015"
                     /protein_id="BAE59000.1"
                     /transl_table=1
                     /translation="MATELVTETRRLRRHALPCVLMRAGTSKGIFLHQKDLPTKEADW
                     APHLISALGSQGNDPRQIDGVGGGTSTTSKVAVVRRSQRPDADVDWTFVQVAVGKESV
                     DFTGTCGNMTAGVAPFAIQEGLVKPRRDQTKMDVRIYNTNTDRIVIETVALDDSGDYE
                     EDGNFIISGVKSPGSEVKCRFVKPMGSMTGKLFPSDNQQQQTLHVQPGSLMPNLEPFD
                     VRVTLIDSANPFVLIDTTSISTTLLGTNPSDSDRNDLVETIRRAGAVAMGLATDVEAA
                     SRTRGTPKVALMYPPTFTQANGSKKSRPDIRVQAYSMGLPHPSLQLTGAVTIAVALSY
                     PGTIAAGLSAMGAIMHGALPPTPEQSPPPDDREKENIGWERDVLIEHSQGTIKVGVVM
                     DDVGEVASCAVSRTARRLFEGKVRYYIQEDAM"
     exon            1167214..1167612
                     /number=1
     exon            1167685..1168560
                     /number=2
     CDS             complement(join(1170838..1170975,1171028..1172102,
                     1172148..1172220,1172254..1172488))
                     /codon_start=1
                     /locus_tag="AO090023000456"
                     /note="cytochrome P450 CYP2 subfamily"
                     /old_locus_tag="AO070272000016"
                     /protein_id="BAE59001.1"
                     /transl_table=1
                     /translation="MTQLSIETFVVFTAFGLLWLSYEYFRPGSILSRFASMRSKLPPG
                     PPGLPIFGNMFQFTRARDAGLWGPFVSPGFLPSAASLRQYGPMTTLHMGFQTWVVLNG
                     PERPDMPIAGDLVSHGLRTVIRPTAAWTEGRRVMHHLLSGSVLRIYGNWQEIESLQML
                     SAYLREPKHWYAHHYRYSIAVLYRLVMGENLSKTQDELNDYQKVTMEITLSSLNSMVD
                     FFPRLDRWIPIYLQWWRPYWAKMGDFHHSVFKSWWDPIRDAVRQGTANPGFVRDTLLH
                     PDMRYKGTEEEAMYLATSVIAAGSDNTRMALNTFIMAMISHPETMARARQQLDAVCIN
                     EDGTLRLPGMADFDRLPYLAAMVKEVLRWRPTTPVTPQHQLTEDLEYEGYRFPKGTCF
                     VVNGIALGQVCDNPDQFDPSRWLDGNEGNIVHNLWAFGGGRRICVGYRVAQQALYVAI
                     ARIIFCFDLCADGPIDTRKLNHFHIHNEPFPVRVTVRSAKHEFLIKEEAEKASTAF"
     exon            complement(1170838..1170975)
                     /number=1
     exon            complement(1171028..1172102)
                     /number=2
     exon            complement(1172148..1172220)
                     /number=3
     exon            complement(1172254..1172488)
                     /number=4
     CDS             1172850..1173800
                     /codon_start=1
                     /locus_tag="AO090023000457"
                     /note="predicted protein"
                     /old_locus_tag="AO070272000017"
                     /protein_id="BAE59002.1"
                     /transl_table=1
                     /translation="MADFETLALTTKPSAQLSYNYQPAQGISKPVLVVFLNGLGLPQA
                     FWQPVIAQLKALRQDSPIPAFLTYDRYGQGQTTDRDPSDAGAEDPTHGHDCLTAVRDL
                     RQLITQISADKLGATDVDSVALVLVGNSIGCALARIYAQEYPGTVAGLLLLDSILANS
                     DFVSVFPDPDAPDFDPASLGPLPVEAICAVREGARRIFHPDVGNKEGLSRRNLRELLP
                     ASDGPLLKGPDGHGPYVTVVGHDFDTFAEESTKMGPPKPVTNRFVNPYWHKYNEGLAK
                     ITEAEYSKGPLQAPNAGHFIQKDNPEFVVQELNELLGKIL"
     exon            1172850..1173800
                     /number=1
     CDS             join(1174739..1174909,1174971..1175248,1175304..1175330,
                     1175388..1175738,1175850..1175858,1175923..1175958,
                     1176012..1176071,1176122..1176257,1176282..1176320,
                     1176400..1176586,1176640..1177112,1177119..1177580)
                     /codon_start=1
                     /locus_tag="AO090023000458"
                     /note="1-aminocyclopropane-1-carboxylate synthase, and
                     related proteins"
                     /old_locus_tag="AO070272000018"
                     /protein_id="BAE59003.1"
                     /transl_table=1
                     /translation="MEQMAGPRPPDVSIGYRLLVGTTVTFVCAFIVVSLRGVARSLYA
                     RMSWDDYLTIFALVQALIATIFDCIAVDKGLGCHLIYIPKNDAVTAMYYDLLSQVFCI
                     NALSFAKISICLSYLRILKGSRHTVLRVICYLTAFLVFVVNTVVTISFAGLMGLGVIT
                     GVFATIRTIESGLGLKNGISDASYTTVMGLMWAGMERNIAMMIGSVPALRPLTTPFMK
                     LTSETMSYLGIRSSSKTQSSSGVNGSGSFPNRSGNKSTKHLPTTSMVMVAMSEKQTRC
                     VNLPDTYETSLPEARARASKDYRQHVSGYNWRLPCMTNVDGLLSTRGGLNVTQVLGRI
                     PSHVLNPALHRDEIDLSMAENQLAKVAIETILYYEGFFGDATLLDLLASTVNTHFRSH
                     SQVAADNIAVTAGAAAGLDAILYNICNPGDGVLVPCPYWNGYDALFALHSGVRPVGVV
                     VPSLEDSFGPALLSALEESYEKASCPIRALVLANPHNPLGRPYSRLILEQCMAFCQRR
                     NIHLVSDEAFAFSSFTSPDFTNPEPFISCLSIDPSRVGCDPQRIHVVWSMSKDLSASG
                     VRLVRSQLPLFLLPWINSRVLTKGCVITRNRPLRDVVGLVASVHVSVLSTVFAKEVLA
                     SPQLPKLLTLSATRLAKAYSTLTTAFKATGIEYFPSYATVFVLARLAPNATAWDEEML
                     ALRAYMQAGVAVAPGRAYHMAERQKGWMRVTFAVSNEDLSEGIRRTKTVYVSLLAGGV
                     IL"
     exon            1174739..1174909
                     /number=1
     exon            1174971..1175248
                     /number=2
     exon            1175304..1175330
                     /number=3
     exon            1175388..1175738
                     /number=4
     exon            1175850..1175858
                     /number=5
     exon            1175923..1175958
                     /number=6
     exon            1176012..1176071
                     /number=7
     exon            1176122..1176257
                     /number=8
     exon            1176282..1176320
                     /number=9
     exon            1176400..1176586
                     /number=10
     exon            1176640..1177112
                     /number=11
     exon            1177119..1177580
                     /number=12
     CDS             join(1180272..1180454,1180531..1181445)
                     /codon_start=1
                     /locus_tag="AO090023000460"
                     /note="alcohol dehydrogenase, class V"
                     /old_locus_tag="AO070272000020"
                     /protein_id="BAE59004.1"
                     /transl_table=1
                     /translation="MTSDSNSDYVFQGWMGLDKDSVGNMKWQTYEPKPWEETDVDIKI
                     THSGICGSDIHTLRSGWGPTMYPCVVGHEIVGIAVRVGSEVKHIKVGDRVGVGAQSDS
                     CRNRRGKCSDCSAGRENMCWKEGRADTYNGVYLNGGKSYGGHADYNRAPGHFVIKIPD
                     QMNPTHAAPMLCGGITTYSPLKANGCGPGKRVGVIGVGGLGHFAILWAKALGADRVVG
                     VSRRESKRADVLKLGADDYIATEDEKDWAQTHAASLDLIICTVSSPDMPLRDYMGLLD
                     SYGRLVQVGAPEDKLPVLYAFDFIPKGKSLSGSVIGSPKEIEEMLQLAVEKNVQPWVV
                     ERPLSDANQAFIDMENGLARYRYTLVNEKHI"
     exon            1180272..1180454
                     /number=1
     exon            1180531..1181445
                     /number=2
     CDS             join(1181757..1183213,1184230..1184245)
                     /codon_start=1
                     /locus_tag="AO090023000461"
                     /note="ankyrin repeat"
                     /old_locus_tag="AO070272000021"
                     /protein_id="BAE59005.1"
                     /transl_table=1
                     /translation="MHNVVANTARPSLDELRMTEILQAIERGHVDTAQSLLDGVSPDI
                     QDRTGRTLFSRAVSLNSKEELQSRLKAEIMFDLLIARGADPDLGDHTGETPVHWAAKA
                     GDHEMVCLLLQKGTLSDLPDKWGRTPLSRAAERGHNLAVERLLVDGRADSNSRDNRGR
                     TPLSWAAESSHLQIVETLVNHGADVEIRDNEGQIPLWWFLNNTDRSNPTDRGTTKEPV
                     DFQRWCSILGPKSSIEPVTKKRRTFLAWACERGDRQLVQELLRTTWTDPNSIDRHRKT
                     PLIYALEWKHYEIADMLMSGVEPERAKKDCVSLHLLIREGRSRLLKMFLERYKSNLKE
                     EDKYSAIPLMRMALQQSDRPTVRLLLDYKASTQGLKSSDWFGPCSTLRAAEPLVGLNK
                     ANWDGYSSIPVMEMTIQERDRIAVATLLGKRAQILEIEDDDDDFAQYSSNIQQSIAVD
                     IMTRKDGRQAVEWISEDTFDQKMRELTKSPDESHLIVFSE"
     exon            1181757..1183213
                     /number=1
     exon            1184230..1184245
                     /number=2
     CDS             complement(join(1189953..1189970,1190251..1190830,
                     1191378..1191568))
                     /codon_start=1
                     /locus_tag="AO090023000463"
                     /note="predicted protein"
                     /old_locus_tag="AO070272000023"
                     /protein_id="BAE59006.1"
                     /transl_table=1
                     /translation="MDIAGLDTAFQCVTDVLGTDLIVPDLLSSESYKICIALPKRSSF
                     ADEKPAGRLDGLWIRPSRKRNQNSPHATTQPEPNVETLVQYDLCHAPDEIDPKEGEDE
                     TWLKFSFYLPIPSNIPPTTETVLGSVSYAITATVAPSTISSTRILKDTQQIKMSRRVV
                     SEPIRHIRQYPGERVLTELSMVPSQLYTDTPEEMKVAYSLEWVAHSTIAKGARDMEVK
                     YVVGKELKWRVEETVKYLSISRGGNPQREAVTTTCKEQRIADPG"
     exon            complement(1189953..1189970)
                     /number=1
     exon            complement(1190251..1190830)
                     /number=2
     exon            complement(1191378..1191568)
                     /number=3
     CDS             join(1192203..1192216,1192327..1193179,1193259..1193348)
                     /codon_start=1
                     /locus_tag="AO090023000464"
                     /note="predicted protein"
                     /old_locus_tag="AO070272000024"
                     /protein_id="BAE59007.1"
                     /transl_table=1
                     /translation="MRRRSVLSHLPQHLERLLKAPISLDCANEARFVLATVLLLYNLE
                     LLSAKTTQWRLHIQGARAIIQWKLQAIGLHRPPDVADNFLRYEYYFTAVFNGLTTFDA
                     TYDVIDDIPINDKIAVFGDFVRIMHCVTRAERINFSGSPNTETTRVEDVVGEIETARD
                     RALQLNHIIRFQYPDARHDFEHLTHMYYHASLIYSHRVLSDPAPSQELIQASRDAILD
                     HLSHLIDLAYFAHDLVWPLFVCGTECRGSPDKQDTIERALLGVIRLSGSLDRRRFLSF
                     LRMFWQLDCGDRENTTNPSFHQSFCLGNSPQSHRVFPLFPNR"