LOCUS       AP007155             4170692 bp    DNA     linear   PLN 16-DEC-2016
DEFINITION  Aspergillus oryzae RIB40 DNA, SC003.
ACCESSION   AP007155
VERSION     AP007155.1
DBLINK      BioProject:PRJNA20809
            BioSample:SAMD00067075
KEYWORDS    .
SOURCE      Aspergillus oryzae RIB40
  ORGANISM  Aspergillus oryzae RIB40
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Eurotiomycetes; Eurotiomycetidae; Eurotiales; Aspergillaceae;
            Aspergillus.
REFERENCE   1  (bases 1 to 4170692)
  AUTHORS   Sawano,T., Tanaka,T., Machida,M. and Yamada,O.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-JUN-2004) to the DDBJ/EMBL/GenBank databases.
            Contact:Toshihiko Sawano
            National Institute of Technology and Evaluation, Genome Analysis
            Center, Department Of Biotechnology; 2-49-10 Nishihara,
            Shibuya-ku, Tokyo 151-0066, Japan
REFERENCE   2
  AUTHORS   Machida,M., Asai,K., Sano,M., Tanaka,T., Kumagai,T., Terai,G.,
            Kusumoto,K., Arima,T., Akita,O., Kashiwagi,Y., Abe,K., Gomi,K.,
            Horiuchi,H., Kitamoto,K., Kobayashi,T., Takeuchi,M., Denning,D.W.,
            Galagan,J.E., Nierman,W.C., Yu,J., Archer,D.B., Bennett,J.W.,
            Bhatnagar,D., Cleveland,T.E., Fedorova,N.D., Gotoh,O.,
            Horikawa,H., Hosoyama,A., Ichinomiya,M., Igarashi,R., Iwashita,K.,
            Juvvadi,P.R., Kato,M., Kato,Y., Kin,T., Kokubun,A., Maeda,H.,
            Maeyama,N., Maruyama,J., Nagasaki,H., Nakajima,T., Oda,K.,
            Okada,K., Paulsen,I., Sakamoto,K., Sawano,T., Takahashi,M.,
            Takase,K., Terabayashi,Y., Wortman,J., Yamada,O., Yamagata,Y.,
            Anazawa,H., Hata,Y., Koide,Y., Komori,T., Koyama,Y., Minetoki,T.,
            Suharnan,S., Tanaka,A., Isono,K., Kuhara,S., Ogasawara,N. and
            Kikuchi,H.
  TITLE     Genome sequencing and analysis of Aspergillus oryzae
  JOURNAL   Nature 438, 1157-1161 (2005)
COMMENT     URL:http://www.bio.nite.go.jp/dogan/Top
FEATURES             Location/Qualifiers
     source          1..4170692
                     /db_xref="taxon:510516"
                     /mol_type="genomic DNA"
                     /note="SC003"
                     /note="phrap>=30:1-4170692"
                     /organism="Aspergillus oryzae RIB40"
                     /strain="RIB 40"
     CDS             join(5042..5227,5292..5481,5531..5535)
                     /codon_start=1
                     /locus_tag="AO090003000001"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070249000043"
                     /protein_id="BAE57241.1"
                     /transl_table=1
                     /translation="MKLITANFLTCAVKGCKASPASFPLHFRDAELELQELDFQPDFI
                     RNIVPRIDWHALQIMANELGFPKILDKKPEGDELKDEQILKELHRLLLETHINEGKLT
                     CGNCGHEYLIKEGIANFLLPSHLV"
     exon            5042..5227
                     /number=1
     exon            5292..5481
                     /number=2
     exon            5531..5535
                     /number=3
     CDS             complement(join(6061..6164,6229..9814))
                     /codon_start=1
                     /locus_tag="AO090003000002"
                     /note="histone H3 (Lys4) methyltransferase complex,
                     subunit SET1 and related methyltransferases"
                     /old_locus_tag="AO070249000042"
                     /protein_id="BAE57242.1"
                     /transl_table=1
                     /translation="MSRSSAGFADFFPTAPSVLQQKRFKVTRERPRPKAQIDSEHSDE
                     SSACPTETRAILNLSNGGASLDSGQISSTDLKKTSPESSVEGSASSTAGDRSALSLSV
                     AQHGANSHEARLDTLTPLTNAESSPPQKANSPRNKIAEGIVANTTIDTKSGINPLHTP
                     PTPQSQGRRTGSIRGYKLVYDPDTEKRSSSKEKRRKPRYVDIILSEQNNCPPDPRLGI
                     PNYMRGAGCKQKRKYRPAPYTLKPWPYDASSTIGPGPPAQIVITGFDPLTPIAPISAL
                     FSSFGDIGEINNRTDPITGRFLGICSVKYKDSASFRGGGPVLAASAARRAYYECRKEQ
                     RIGTRRIRVDLDRDGVVSERFVARTIESQRMGQKSNLQSTEEVKSDSETKKNEPPPTA
                     PKGPSGKTSVRPIVAIPEGPRANFLKPVMPSLVEEVPILGQIKRDPYIFIAHCYVPVL
                     STTVPHLKKRLKLFNWKDIRCDKTGYYIIFENSRRGEEETERCYKMCHMKPLFTYIMN
                     MESQPYGNPSYERSPSPERCRAEQRERAERERLKREVGLDIEEEKRQRAVDLDPCQEV
                     LTIIIRDLKDKLLEDVKSRIAAPALYDYLDPDRHALKRKTLGIADPEGIKRPMFRIDD
                     SFGTPDSRSGLSDARRPFSGSTPNILALPRIRKARHLGRTDTAFLDERRKQPLRRREV
                     RPLYHRLQQLHDVDDSDDEQRTPKDTDEQDSRPPSRMSSGTSESDDGDGFVSEALGLP
                     VVELAGSGQNKEPDEILKDNQSVGESSQLESNEISPELRKRKRASEELEARKRQKEDD
                     ELFGINPIAEAEVEGTQIIATPIAVDINLEVSEAALSILPKESNDNRQETGEANHLDF
                     DGIDVTSSTIEKDRRGILDPLDDIDNAAAREESRTEVGWRVSNDEPRPIVDDDDAIIM
                     DLDGWQNLIKDDEDLHFLRDILVGYSESNVGNLSAWAWRQKEIKALNHPGDVGPLRGG
                     TGIAGYYVPNTTGAARTEGRKRILESEKSKYLPHRIKVQKAREEREARAKNDPHTAAV
                     EAARVAAAKNISKSTSRSTRVNNRRLIADINAQKQALPTQSGDGDVLRFNQLKKRKKP
                     VRFARSAIHNWGLYAEENISANDMIIEYVGEKVRQQVADMRERQYLKSGIGSSYLFRI
                     DENTVIDATKRGGIARFINHSCTPNCTAKIIKVDGSKRIVIYALRDIERDEELTYDYK
                     FEREWDSDDRIPCLCGSTGCKGFLN"
     exon            complement(6061..6164)
                     /number=1
     exon            complement(6229..9814)
                     /number=2
     CDS             join(14081..14085,14143..14213,14300..14531,14605..15995,
                     16046..16207,16268..16488)
                     /codon_start=1
                     /locus_tag="AO090003000003"
                     /note="glucosamine 6-phosphate synthetases, contain
                     amidotransferase and phosphosugar isomerase domains"
                     /old_locus_tag="AO070249000041"
                     /protein_id="BAE57243.1"
                     /transl_table=1
                     /translation="MCGIFGYINYLVERDRKFILDTLLNGLSRLEYRGYDSAGLAIDG
                     DKKNEVCAFKEVGKVAKLRELIDECKPDLTKSFESHAGISHTRWATHGTPSRLNCHPH
                     RSDLNWEFSVVHNGIITNYKELKALLESKGFRFETDTDTECIAKLTKYLYDQQPDIEF
                     TVLAKAVVKELEGAFGLLIKSVHYPHEVIAARKGSPLVIGVRTSKKMKVDFVDVEYSE
                     DGALPAEQASQNVAIKKSATGLLAPPDKSLLHRSQSRAFLSDDGIPQPAEFFLSSDPS
                     AIVEHTKKVLYLEDDDIAHVHEGQLNIHRLTKDDGTSNVRAIQTIELELQEIMKGKFD
                     HFMQKEIFEQPESVINTMRGRLDVANKQVTLGGLRQYISTIRRCRRIIFVACGTSYHS
                     CMAVRGVFEELTEIPISVELASDFLDRQAPVFRDDTCVFVSQSGETADSLMALRYCLE
                     RGALTVGIVNVVGSSISLLTHCGVHINAGPEIGVASTKAYTSQFVAMVMFALSLSEDR
                     ASKQKRREEIMEGLSKVSEQFKEILKLNEPIKQLCANFKNQKSLLLLGRGGQFPTALE
                     GALKIKEISYLHCEAVMSGELKHGVLALVDENLPIIMILTRDNLFTKSLNAYQQVIAR
                     GGRPIVICNSDDPEFSSAQTVKIEVPKTVDCLQGLLNVIPLQLIAYWLAVSEGLNVDF
                     PRNLAKSVTVE"
     exon            14081..14085
                     /number=1
     exon            14143..14213
                     /number=2
     exon            14300..14531
                     /number=3
     exon            14605..15995
                     /number=4
     exon            16046..16207
                     /number=5
     exon            16268..16488
                     /number=6
     CDS             join(17579..17621,17681..17846,17922..18339)
                     /codon_start=1
                     /locus_tag="AO090003000004"
                     /note="6,7-dimethyl-8-ribityllumazine synthase"
                     /old_locus_tag="AO070249000040"
                     /protein_id="BAE57244.1"
                     /transl_table=1
                     /translation="MASLKGPGATPSFDGSGLRIAIVHARWNMGIIGPLVEGARKSLL
                     AAGVVEDHITTLTVPGSYELPYAAQRLYAASQLQAAKSSSSGEGISATDLLSSSTADI
                     SKASPESPTPATSRPFDAIIAIGVLIKGETMHFEYIADAVSHGLMRVQLDSGVPVIFG
                     VLTVLTEEQGLERAGLGKKGMHNHGEDWGSAAVELGARRREWAEGRIA"
     exon            17579..17621
                     /number=1
     exon            17681..17846
                     /number=2
     exon            17922..18339
                     /number=3
     CDS             complement(join(18551..18892,18951..19277,19370..19528,
                     19596..19661,19726..19728))
                     /codon_start=1
                     /locus_tag="AO090003000005"
                     /note="20S proteasome, regulatory subunit alpha type
                     PSMA3/PRE10"
                     /old_locus_tag="AO070249000039"
                     /protein_id="BAE57245.1"
                     /transl_table=1
                     /translation="MTSIGTGYDLSNSVFSPDGRNFQVEYAAKAVENGGTAIGIRCKD
                     GVVLAVEKIITSKLLKPGANKRIATVDRHVGIVSAGLVPDGRHFVSRARDEAASWRSV
                     YKGPIPVSALSNRLGSYVQAYTLYSSVRPFGVTAIVGGWDSEAELAVDGQVGSGPKSG
                     SGGKVDGARAGGPGLYMIEPSGLYWGYYGAATGKGRQAAKAELEKLDLSSGNLSLVDA
                     VKEAARIIYVAHEDSKDKDFELEMSWISSLDGPTHGRHEEVPKQLLEEAEKAAKRSLE
                     GEDEEEEEVAKDGPNQGERMEE"
     exon            complement(18551..18892)
                     /number=1
     exon            complement(18951..19277)
                     /number=2
     exon            complement(19370..19528)
                     /number=3
     exon            complement(19596..19661)
                     /number=4
     exon            complement(19726..19728)
                     /number=5
     CDS             20667..21467
                     /codon_start=1
                     /locus_tag="AO090003000006"
                     /note="predicted protein"
                     /old_locus_tag="AO070249000038"
                     /protein_id="BAE57246.1"
                     /transl_table=1
                     /translation="MQEDLVALFSRQMRMDIPISSGSQEMPSSTHVPVAHSISQHYHH
                     SSHVARCTFPTGSPKHDESLGHSVTLNSAHEMLRLQNINPSSLTSTQLQLFENAMPEQ
                     RLRLIQIWQIFPESRDASSNSGMKRVNQSNSELCANPSGGTAVNEGGSNQSTHTDSTD
                     DLDMCDSVHDGGNNSDGHQYAEPYMISGYEVLAQRDYELSAIKNMPVVNEPTTGSPYK
                     LANDPIYRAQGHRWWEHSQSDALEYQYGTLEEMNRYAGCGLLQPRWLA"
     exon            20667..21467
                     /number=1
     CDS             join(21944..22007,22195..22442)
                     /codon_start=1
                     /locus_tag="AO090003000007"
                     /note="predicted protein"
                     /old_locus_tag="AO070249000037"
                     /protein_id="BAE57247.1"
                     /transl_table=1
                     /translation="MRPGPRALKRCKHQKGRSNDDLLSKICHSIRKGIGGTSGFFNSL
                     SSPLSFEASLTRQGTPLGQGFCIRHGLRKGLGRTSNVSTGIGGTFQHVAALSRQGAPF
                     L"
     exon            21944..22007
                     /number=1
     exon            22195..22442
                     /number=2
     CDS             join(23806..23838,24133..24193,24264..24338,24416..25319,
                     25380..25467)
                     /codon_start=1
                     /locus_tag="AO090003000008"
                     /note="isocitrate dehydrogenase, gamma subunit"
                     /old_locus_tag="AO070249000036"
                     /protein_id="BAE57248.1"
                     /transl_table=1
                     /translation="MFSLRTAQPAQSFLRRAAVTAPTVRSSLAARSFASVQSDIFKPT
                     KYGGKYTVTLIPGDGIGAEVAESVKTIFKADNVPIEWEQVDVSGVDAGNKHSEELFKE
                     SIASLRRNKLGLKGILFTPVERSGHQSFNVALRQELDIFASIVLIKNIPGYKTRHENV
                     DLCIIRENTEGEYSGLEHQSVQGVVESLKIITRAKSERISKFAFGFALANNRKKVTCI
                     HKANIMKLADGLFRSTFHKVAENYPTLEVNDMIVDNASMQAVSRPQQFDVMVMPNLYG
                     GILSNVGAALVGGPGVVPGCNMGRDVAVFEPGCRHVGLDIKGKDQANPSAMILSGSML
                     LRHLGLDDHANRISKAVYDVIGEGKTRTRDMGGQATTHEFTRAVLDKMEAAL"
     exon            23806..23838
                     /number=1
     exon            24133..24193
                     /number=2
     exon            24264..24338
                     /number=3
     exon            24416..25319
                     /number=4
     exon            25380..25467
                     /number=5
     CDS             complement(join(26096..26912,26979..27001))
                     /codon_start=1
                     /locus_tag="AO090003000009"
                     /note="predicted protein carboxyl methylase"
                     /old_locus_tag="AO070249000035"
                     /protein_id="BAE57249.1"
                     /transl_table=1
                     /translation="MSRPEDVLPPDLFYDDNESRKYTTSSRIRNIQSDMTNRALELLD
                     LRSPSLVLDIGCGSGLSGEILSAVPPEHGGPHTWIGMDISPSMLDIALQRDVEGDLFL
                     ADIGQGVPFRPGTFDAAISISAIQWLCNAETSDVSPEGRLRRFFEGLYASLRRGGRAV
                     CQFYPKNDAQRNMISGAAIKAGFGAGILEDDPGTKNSKLYLVLTVGGGGLQGDITGVV
                     NGMDDVNILDARRKAMEHGKMQLPRKGDKAWIMRKKEQMERKGKVVKQNSRYTGRKRR
                     PAF"
     exon            complement(26096..26912)
                     /number=1
     exon            complement(26979..27001)
                     /number=2
     CDS             join(27525..27594,27764..28401)
                     /codon_start=1
                     /locus_tag="AO090003000010"
                     /note="predicted mitochondrial cholesterol transporter"
                     /old_locus_tag="AO070249000034"
                     /protein_id="BAE57250.1"
                     /transl_table=1
                     /translation="MWILPLLGYLGVIVGFSFLTLAIASGLYYMSELVEEHTVLTRRL
                     LTRLIYSIILIQILLFVFDRFPFSLSLLGIGSHIVYASNLRRFPIVKLSDPFFILSCV
                     LVGLNHWLWFRHFSKPLPASRAASSWRQPYQINAEDMPTFTEVASYFGLCVWLVPFAL
                     FVSLSAGENVLPSIGSEYATGDHVSAPGFARNTLTSDGKSKNKGMAKVLVDSVRDWVK
                     ENGELMGFWRGERSKRF"
     exon            27525..27594
                     /number=1
     exon            27764..28401
                     /number=2
     CDS             complement(join(29452..29524,29572..29818,29883..33112,
                     33175..33188))
                     /codon_start=1
                     /locus_tag="AO090003000011"
                     /note="Rac GTPase-activating protein BCR/ABR"
                     /old_locus_tag="AO070249000033"
                     /protein_id="BAE57251.1"
                     /transl_table=1
                     /translation="MRRSRPDQHDRNLTEQTTPTKSRQPLDAMEANQSSTPSPISSVS
                     VPGERSGQRIMPRTSSIDSAISSLSSASQSHKSSFDATALSQADIGNLITTAGSAEAV
                     IVHLLKEKHHAASQNSQLWRLVDKQRTLILGLNKDLERALKEKERYRKKFKELQSPAP
                     SLPPNNGLHFQHKAIQSEDKSLGQGNPEPGKSQYQGVSAPSPNSIGRNLSSSTIRSQN
                     VAAQELSENLIKECSTGHKGGLDRRSGSQPPPPSVYSQQELAAASPSSLASSSSPVND
                     TMPGEDKQQRVPHPVRKPPPAPLNLVQGERTLLGNPDIYDSESEYEDILAVDELPIER
                     GRRKTRDDDDREREAVLARERITLSSSRNESSHSTKAPADHLRRQAASIIEQSGSLTA
                     PLSPRMTPGDHPIIIPPKSPGLPVSPRPEDRPPNSPLPRLPRDMTNNMASLPIASGSG
                     LSGLALSPHVSKYQAPFSATHSYLPIDVASRSIPSIDAAVRAESTRSTVPNTNGIYRG
                     LVSEDYPGYLLSPNALPLVLVKVSSSRLRPSRNSYLASRPSEEEPVFTLSVTSRSENK
                     ELWRVEKVIAALPQLDQQLKQLSSYGGKLPDRSIFSGHSPAKVDARRAAINAYFEALL
                     DTPMDEEAALVICQFLTSDAIEPRDDETSLLKGSQHVSSEILRGPDGKPRKEGYLTKR
                     GKNFGGWKARYFVLHGPELKYLESPGGPHLGTIKIYNAQIGKQSQGTNGQNNSPPTRA
                     EDDSDNQYRHAFLILEPKKKDSSALVRHVLCAESDEERDSWVEALLEYVEGQSENEGS
                     NSGSSRGQASGVHLANITVNPKMPSNGNKNNRTTDSSDLDGLDLVQGFSYEDAVPAEP
                     PVFGPPYEQQALRSPTFSQMSPTDPTDATQATNHVPDPSQLSSRIISGPTNGAVIQDA
                     GAWGNKSATSTKEKKRSIWGFRTRSSVDLASQLQASYDSPSVQPQNLTSGDRRDLVRP
                     VFGIPLAEAVQFCAPRGVDVDLPAVVYRCIEYLKAKGAESEEGIFRLSGSNIVVKALK
                     ERFNTEGDVDFLAGDQYYDVHAVASLFKQYLRELPTTVLTRELHIEFLRVLELNERQD
                     KIAAFNSLVHRLPRPNLALLRALVQFLIIIVNNSDVNKMTVRNVGIVFAPTLNIPAPV
                     FSMFLTEFERIFENLLGIGFSFYAMPDADRDADFAYKNNFP"
     exon            complement(29452..29524)
                     /number=1
     exon            complement(29572..29818)
                     /number=2
     exon            complement(29883..33112)
                     /number=3
     exon            complement(33175..33188)
                     /number=4
     CDS             complement(join(34615..34746,34803..36025,36079..36484))
                     /codon_start=1
                     /locus_tag="AO090003000012"
                     /note="predicted protein"
                     /old_locus_tag="AO070249000032"
                     /protein_id="BAE57252.1"
                     /transl_table=1
                     /translation="MEAHMESLRYSNGSSLENVKPSEYEMNTKDTRSKQDMPRPQQPG
                     PSTRHLIDRLPHMPQLHRPTKEELLAAANGFWSRLKVRFKWFSIRSVRPFNLDEITAL
                     FSWVLLGHVVWVVLGTTTFFSLLIIAINTVFAQETLAGWIGNYLTKSSGVKVVFESAI
                     VPKWRDGVITFKNVFVSRRPGQGAGHVSKGSPKTAAAVAAAAALNDRPNLDLSDQRLS
                     SVEEDTNYTQFDLAIETVNVTLSFTKWINGKGLLRDVEVQGIRGVVDRRYVYWSEDDF
                     DPKSYRHEHNPGDFEIDSFKMSDVLVTVYQPDNFRPFSVSIFSCDLPQLRKQWLFYDF
                     MSANMMSGSFDNSLFTIHPRQTHSFTGAQLDNGVGEDGRASHWKKHSRIRIDGLNIDH
                     LNRGVQGPFSWIHEGTVDIVADIMFPTDNDESLTKVMADIYDRLEATVTSTHYRDALL
                     ENSAQPGETPSENDRRFLVTDLRLHLNNVRAVVPLFTRDLSYINNALIRPIVAYINSR
                     RTFIPVNCRLVKRVGDFDGSWTIFDSGLMDDLSAAVYDAFARDVVDEQARKRRFKKVG
                     FWSLQLAAQAIFMGMAGNIA"
     exon            complement(34615..34746)
                     /number=1
     exon            complement(34803..36025)
                     /number=2
     exon            complement(36079..36484)
                     /number=3
     CDS             join(36541..36571,36619..36723,36828..36882,36932..37058)
                     /codon_start=1
                     /locus_tag="AO090003000013"
                     /note="predicted protein"
                     /old_locus_tag="AO070249000031"
                     /protein_id="BAE57253.1"
                     /transl_table=1
                     /translation="MSREETFYRTSQVVPVSTAVEFGDIPITRKLPEANRLVICVVFR
                     GETASKERIRCFPEAGVQPADEVKQGPFQLFRTKNPVALSKTFDEYVTGNVCPWAAEV
                     EKC"
     exon            36541..36571
                     /number=1
     exon            36619..36723
                     /number=2
     exon            36828..36882
                     /number=3
     exon            36932..37058
                     /number=4
     CDS             join(37210..37285,37343..37992,38044..38100)
                     /codon_start=1
                     /locus_tag="AO090003000014"
                     /note="predicted RNA-binding protein Pno1p interacting
                     with Nob1p and involved in 26S proteasome assembly"
                     /old_locus_tag="AO070249000030"
                     /protein_id="BAE57254.1"
                     /transl_table=1
                     /translation="MPAPTALKGLDQTTTAGVPVTQAAIVQDDEVLIDAQTSAEESVP
                     VLAPLGENAQDTDMRIDEEGRPVFTPAKDTNTVYRVETRKVPVPPHRFSPLKASWSRI
                     YPPLVEHLKLQVRMNIKSRAVELRTSKFTTDTGALQKGEDFVKAFTLGFDVDDAIALL
                     RLDDLYIRSFEIRDVKASLHGEHLSRAIGRIAGKDGKLKHSIENATRTRIVLADQKIH
                     LLGGYRNILVAQEAVVSLILGSPPGKVYGNLRKVASRMKERF"
     exon            37210..37285
                     /number=1
     exon            37343..37992
                     /number=2
     exon            38044..38100
                     /number=3
     CDS             complement(join(38321..39008,39061..39158))
                     /codon_start=1
                     /locus_tag="AO090003000015"
                     /note="20S proteasome, regulatory subunit beta type
                     PSMB1/PRE7"
                     /old_locus_tag="AO070249000029"
                     /protein_id="BAE57255.1"
                     /transl_table=1
                     /translation="MMSFMGHQPQSQAVGYTFSQPTNAPNKEHSFYPYTDNGGSTLGI
                     TGADFAILAGDTRSVAGYNINSRYAPKVFKIGGDDDTGEGAHIILSVVGFAADGQALK
                     ERLDAVVKMYKYQHGKPMSVRACAQRLSTILYQKRFFPYYVHAILAGLDEEGKGALYS
                     YDPVGSYEREQCRAAGSAASLIMPFLDNQVNFKNQYIPSSGDGHALEPKKPEPLPRET
                     VEQLVRDAFTSAVERHIEVGDGLQMMVITQNGIEEIYTPLKKD"
     exon            complement(38321..39008)
                     /number=1
     exon            complement(39061..39158)
                     /number=2
     CDS             join(41016..41045,41098..41245,41309..41913)
                     /codon_start=1
                     /locus_tag="AO090003000016"
                     /note="20S proteasome, regulatory subunit beta type
                     PSMB4/PRE4"
                     /old_locus_tag="AO070249000028"
                     /protein_id="BAE57256.1"
                     /transl_table=1
                     /translation="MNHYPEVWGRPRDDIYGPYNSSYLQTTGPKTHTQSPAVTGTSVI
                     AVKFNGGVAIAADNLASYGSLARFTDVKRLRVFGDSAVVGFSGDVSDMQYIDRLLESL
                     DIRENYSTHGNMMNAKNLHTYLSKVLYKRRSEFNPLWNHILVAGFDEDKKPFLSSADL
                     LGTTYSAPHLATGFGAHLAIPILRRLFPEEKPLEEISKGEAEAALRECLKVLWYRDAR
                     SLDKYSIAVITAEGVEIKEDQVIEAQSWAFAESIRGYGAQVN"
     exon            41016..41045
                     /number=1
     exon            41098..41245
                     /number=2
     exon            41309..41913
                     /number=3
     CDS             complement(join(42089..42221,42315..43036,43261..43275))
                     /codon_start=1
                     /locus_tag="AO090003000017"
                     /note="predicted fumarylacetoacetate hydralase"
                     /old_locus_tag="AO070249000027"
                     /protein_id="BAE57257.1"
                     /transl_table=1
                     /translation="MTTFSRLIRFLATDGHIYYGDAIMPAGTSDIGKVTRAQVIRGDI
                     FGQYQVTDQVAEVKMLLAPLAREDIATVRCLGLNYEQHARESNLPIPKYPVLFYKPIT
                     AITGPYDDIPICSMAQDVEGLDYECELVLVIGKQAKNIPEEQALDYVLGYAVGNDISH
                     RDWQLKRGGGQWGLGKGFDGWAPFGPGIVSTKLIRNPNALNISTKVNGQTVQSSSTKD
                     MIFGVAQTVSFLSQGTTLLPGDLIFTGTPQGVGMGRKPAAWLTNGDQVEVSLEDVGSC
                     VNRVAFEKPPSKL"
     exon            complement(42089..42221)
                     /number=1
     exon            complement(42315..43036)
                     /number=2
     exon            complement(43261..43275)
                     /number=3
     CDS             44586..45182
                     /codon_start=1
                     /locus_tag="AO090003000018"
                     /note="predicted protein"
                     /old_locus_tag="AO070249000026"
                     /protein_id="BAE57258.1"
                     /transl_table=1
                     /translation="MAFFSNFSGDFAPLFHLLDDYDVHQAYRPKPRTTTVRSFTPRFD
                     VYELNNNYHLNGELPGVNQASLDIEFTDPHTLVIKGRVERKYSDSTSSTNEHAEVPND
                     ASSVKSLQPTVEDEDEEANDAASVGSSAQSSKQVALQEQTNHKYWITERPVGEFHRAF
                     TFPTRVDQDTVKATLKDGILSVIVPKEPAPTFKKIRVE"
     exon            44586..45182
                     /number=1
     CDS             join(50944..51177,51327..51500)
                     /codon_start=1
                     /locus_tag="AO090003000019"
                     /note="predicted protein"
                     /old_locus_tag="AO070249000025"
                     /protein_id="BAE57259.1"
                     /transl_table=1
                     /translation="MQEVSAAVVPRWSLEVELHRVFTSRMASSSLSSQRVLSAFPFLT
                     PEEFECACRAFLDRIHVLGNLDGVGWSSIRFVQQATGPVLKISQSIHNTSIPYYDNAL
                     SGSVDTEEPQVEICEDDPVRGKSFVPLYMLAII"
     exon            50944..51177
                     /number=1
     exon            51327..51500
                     /number=2
     CDS             complement(join(52074..52364,52426..52639,52697..52773))
                     /codon_start=1
                     /locus_tag="AO090003000020"
                     /note="spliceosomal protein snRNP-U1A/U2B"
                     /old_locus_tag="AO070249000024"
                     /protein_id="BAE57260.1"
                     /transl_table=1
                     /translation="MASKVAPTRINPSSKPASAAGLPNQTLYCANLPDKLPKYDLRLS
                     LYMLFSTYGTVLDVVAMKTKRMRGQAHIVFKDVQASTQAMRALQGFEFFGKQLKIVYA
                     KGTSDVIAKLRGAYNVSTVAAPAGGASTDLQKSIFSGPPGSTTLPSRPTGETNGEATS
                     QGVKRPREEESDEGEAPMDEESDVPMEDSSDED"
     exon            complement(52074..52364)
                     /number=1
     exon            complement(52426..52639)
                     /number=2
     exon            complement(52697..52773)
                     /number=3
     CDS             join(53089..53302,53371..53957,54011..54251,54325..54368)
                     /codon_start=1
                     /locus_tag="AO090003000021"
                     /note="actin-related protein Arp2/3 complex, subunit
                     ARPC1/p41-ARC"
                     /old_locus_tag="AO070249000023"
                     /protein_id="BAE57261.1"
                     /transl_table=1
                     /translation="MAAPEVHHLFHNPIADHSFSPDKSTLAVARDSNVELYQKAGNKF
                     SLTDELKGHEKIVTGVDIAPNSGRIVTYRNAYVWERTPAGWKPTLVLLRINRAATFVR
                     WSPSEQKFAVGSGARVIAVCYFEEENDWWISKHLKKPIRSTITTLAWHPNSVLLAAGS
                     TDSHARVLSSYIKGVDTRPEPSAWGERLPFNTICGEFLNDSAGWIKGVSFSPSGNALA
                     FTGHDSSVTVVYPSAPDQPPRAMLNITTRFLPFNSLIWNGENEIIAAGHDCEPYRFHG
                     DENGWQLTGTIENKSGSGVGAVREESALNLFRQMDLKGQTQADTQLKTVHQNTINTVR
                     VYEEANGNVSKFSTSGVDGRVVVWTIG"
     exon            53089..53302
                     /number=1
     exon            53371..53957
                     /number=2
     exon            54011..54251
                     /number=3
     exon            54325..54368
                     /number=4
     CDS             join(54832..55119,55184..56158)
                     /codon_start=1
                     /locus_tag="AO090003000022"
                     /note="predicted protein"
                     /old_locus_tag="AO070249000022"
                     /protein_id="BAE57262.1"
                     /transl_table=1
                     /translation="MIMAFDEVVTVILVVLSILLYGTCSTASLISFGTSGASTYDQSD
                     RKDSTVSRETFASLEELSRIVDVSYCVGSTGVQKPFRCLSRCNEFPGFELITTWSTGP
                     LLSDSCGYIALSHFPHAKRIIIAFRGTYSITDTIIDLSAYPQAYVPYDPNGRDDQELL
                     RCRNCTVHAGFLASWLNTRPIILKHVSAARKQYRDYKVVLVGHSLGGAVAALAGLEMQ
                     MRGWEPQVTTFGEPKIGNKEFVTFLNEAFKLGTVSPSDDAQQWKFRRVTHVNDPVPLL
                     PLEEWGYEMHAGEIFISKAVLPPSESDVIICDGDKDARCITGEQNNMRAMFHEIKLNA
                     AKHEWLYSVADLTDQVVLAESDTSPSAMGFPSGAERQQISLRLPWNLIPSRYRLWELF
                     FAHRDYFWRIGLCVPGGDPTGKEKNYQS"
     exon            54832..55119
                     /number=1
     exon            55184..56158
                     /number=2
     CDS             complement(join(56766..57308,57374..57980,58034..60471))
                     /codon_start=1
                     /locus_tag="AO090003000023"
                     /note="predicted protein"
                     /old_locus_tag="AO070249000021"
                     /protein_id="BAE57263.1"
                     /transl_table=1
                     /translation="MNPSKARQGNHSDEELFIHTPGRSPVEPPIVGPLRINKRDTPSP
                     VPQGAPLPYPDDRQNPQKMRSASTSRPTPTADGGRTGGSPTNPDNMPSIPANTGPSRS
                     DYPAALRPRDGREPKPATLAERRGNVPKPLPESPAGDTPDKEGLFVTRYQRTPAPPAL
                     ANGTQLDGTVHPNYRQQYYPPPQAATSSGPSARPPTAQSLQTPSSAINRISSTASTST
                     TRAQRGSPPPPETPIVEPGQPPASDIEARYAASGIAGTSALAGLQAQSSAAHRRAEQY
                     VGQQATSQPPVQRPWTPTEQPGSQPHGPPTVYQGAEVVSTENLPGNPFPPQSAASSAQ
                     AGQALHHPRIPSNALEQDLERMRISSSPPPAYSSVSGPATSQGYPNEKQRAQTTPGQQ
                     AASAVHPATVAPINAATNSAALEVSAQDHPAFANDPRQEQPLEQSLQNGTQTGVLDGQ
                     QQIVQESQAAMLPTSTGIPPASPPPLPEGWIAHMDPNSGQYYYIHLPTQSTQWEFPKG
                     PTPLNLNETPLSPVGSIYSSHPLASPGLSAFGKPLASPGIPLTPGYESLQSPVVAGFT
                     GPPPSSGVDLYKVAPTNGVYFGPYLRYVNMNLERGIWLGSILLVTDAAQPPTIHIHQS
                     VDLSPNPRQLKASAIAVHQRWTFYKYDVDLQMNESGPAKWTYAITSHLGCTRYEFLVA
                     GRHETNWRFVTTSGNDFSLNVNANERSRLGGVSFMWKDIMQKHNEIGGFHAQLCLGGQ
                     IYADRMWKEIPSLKQWLVIRGKEARRTMPWTAAHEEDVSHAYFHYYTSHFDQPYLRES
                     FAQIPYVCQVDDHDIFDGYGSYPEHMQFSNMFKNIGRVGTEMYLLFQHHTTLELLHNA
                     STDVDLFTITGTGWHFVKFLGPAVVVVGLDCRSERNPHQVVAGPTYQGIFPKVAMLPP
                     SVQHCLWMISVPVIYPRLETAEHIANTVASGKRAVTGAYNVLGKVTSSVAGVVGAKEV
                     VGSGFDSVKRAVGKSGLMGGILSPFGEFDLMDELRDQWTHESKDLERTYLIRTLQGIA
                     HQKFLRMTFLSGSVNVCGAGLVHDPAHPSDYKTMYQIISSAVVNNPPPSYVIKLLHSS
                     NKPLYVPANGQRSSPSQPTDTKEDMMEIFQTDVTGQAREHRKLMGRRNYAAIVAYDPE
                     TVNAMYGQAPVVHGGRLNLAVDFMVQGDGSYGTVVKYGPVIIPSLGHGK"
     exon            complement(56766..57308)
                     /number=1
     exon            complement(57374..57980)
                     /number=2
     exon            complement(58034..60471)
                     /number=3
     CDS             complement(join(61166..61591,61653..61957,62220..62277,
                     62464..63068,63139..63178))
                     /codon_start=1
                     /locus_tag="AO090003000024"
                     /note="predicted protein"
                     /old_locus_tag="AO070249000020"
                     /protein_id="BAE57264.1"
                     /transl_table=1
                     /translation="MSDVETVGNLVWDPHTSRSVRPPSADYGLPDLLPSFATLTSDEE
                     RERKAQSSIPGTYTVIVMPESFSYLPGHADERSGEQSRSSTSSPLVDSGQSSQRNDNP
                     EVNDPNVVILKTFPDARRYLCSDYRGSTRTLESDPQDSSHSSTVSVYSADLSALDDYN
                     AQEQTTLTDYEAMLLSHFRNVIWPKLVPQGIWPDGSHGPRLGVEVLEQEASICPPRQS
                     SIGRFISYAISTAHTRGSDLLPWPGSSLSSIDSCGTDVIGSHEPDNPTLLLQLYRDMF
                     GLAVQLGLAIAGRKKLGASDPYAPINLHEDLKQLWDSSEVRFWAEKQTRLPKQLQSIL
                     EQMNLLFHTSLLCYYTTSPCPGQSIGLGEIPEQRVHHHTTMILQHAEATIMNIQGSLP
                     HFIIFPLFLAGIAAETIDLKVKAWELLSNIEENEIGYNASTTCYMLQLVYECQMQRSS
                     GNSGRPFPWIDWVELLAERGFRLVSYG"
     exon            complement(61166..61591)
                     /number=1
     exon            complement(61653..61957)
                     /number=2
     exon            complement(62220..62277)
                     /number=3
     exon            complement(62464..63068)
                     /number=4
     exon            complement(63139..63178)
                     /number=5
     CDS             complement(join(65551..65960,66018..66100,66149..66348,
                     66423..71342))
                     /codon_start=1
                     /locus_tag="AO090003000026"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070249000018"
                     /protein_id="BAE57265.1"
                     /transl_table=1
                     /translation="MAAQAASASSEARELNLISNVEFRIALADTDEKLDALLNKYLAP
                     LLLKLGSESLAVRNKVIAVCQHINNRVQAPSIKLPVAALLKQFKEQKSKLIRHFDLIY
                     IQQGIDRLGASARIEILLPLLQGISEIGTSTDEQAAVVFNLVLRLLPLLKLPPKDSTE
                     DIQLKSRLGLSDKDTEFLSSWFEKLLILFPADKNASTCPGLSPADYVFLNKGASLSET
                     WNPSSHGGLNLTETKATALRFLCSRAFTDSERFFPALVASADPNSRLADLGEEILKRF
                     IPALENIDVVRRLFTLYFGSVEPEGASPARTALQIKILVYLGKSLRAATETANVLRLI
                     EEGLLSDVARSSQGLQASKLRTQIFTFTTWVVRIGSPTDLKQIAPKVIAGLRDFINSQ
                     GWPSPGSSGQRLPATDLSLRGLAYESIGILVPKVDFQSQDEQTAISGFELIRWLFISL
                     SSDDSSAQIFVSIEQALGSILNSSVDSWDKEFQESLRPFLLRQMNSLPGEEDPVTGFK
                     VVRRTQYAAVRFANRFLPYSDVVARWIDFMAVACGSERHQEVVEEGKKGLHPYWYRLL
                     NPTKDKVWFTSVTSDSRSSWFKFPNFPETARFLLGSTASTVVPGLSAAEILSGPYKEA
                     FNYTITFPRNILLWESFSGSNISMEIEQDWDIKLDVLLTSDEQARCAVKRYIETSDKE
                     AVLLFLTSALSGLGGGAQKGLWQCGENFIGICSLASNDIVEPMVSMVITLKNSLYSND
                     QELQNLAARALGILASHPAFSENKLRELLSELSVPIESWKSAIGEVVLKIRGAVLALA
                     YILSRLAFRNVIYKAPETTVKLFIATIFDIIRDARDSLLRRSAQVAIGQLSLSGVLST
                     TVLSNDEWDTIVDKLKPDAKAESETAITAIGLLSLSFSKVDHRDPQFTKFLNCLHNLH
                     EIRSPETHFTIGEALSSAAAGWTSKSMATEFDVDEKLPTWQLSDAVLAEMCDKIISDC
                     GASKPSLRKASSIWLLCLVKNCGHLQQMQDRLRKCQRTFTRLLADRDEVVQETGAQGL
                     SLVYDIGDQTLKDDLVRDLVDSFTASGSNLAGGKVSEDTELFEPGALPTGGGSSVNTY
                     KDIMNLASEAGDPTLVYRFMSLASNNALWTNRAAFSKLGISTIFSDSSANGYLAKNPK
                     IYPKLFRYRFDPNPNVQRSMNTIWQALVKDPAAIISDHFDEIMDDLLRSMLAGREWRV
                     RQASCAAIADLIQGRQPEKYFKYMEEIFLKAFKLIDDIKESVRAAALKLCQTITNAVI
                     RTLETSDTETRRAGTMLAGTITFLLSDKGMESDVQEVQGFALGALIQIIKKSPGQPLR
                     PFVPRVMEQFLNSLSSLEPQAVNYVHLNADKYGLTGQEIDKMRLSSIRTSPMMEVIER
                     YLIDMLDETSMREFAGNLESVLRSAVGLPTKVGCSRVLVLLSMRTVLFRPYADRFIQL
                     LIKYVVDRNDTVSASYCTSIGYLMRLASDDRVLKTIEHAKSLYLTAEDANQRIIAAEI
                     LHSTSKLSNDRFMAFAATALPFIFVSKYDTDEHVQEAFEKTWQDNVGGNRAVSLYIKE
                     ITSLVSDNLDSPRWIVKHTAALGFANSIMALDSELDLATSEYLWPILEKALAGKTWDG
                     KEVVVKAFTKFTSQAKTLWLEKPRIGDTMKAIAIREAKRINPTYRPHAITAFGGIAQA
                     RQDLNLMPDAVDIVSRVLSEFDEGEDSMDIDSGSGQKNKQTREDTLVACVKCLLQCIN
                     LTCAASAEATNNSMSDIKRLLHETLDSGGRNVQITLYEQLRMFFSRVTTGALESHDEE
                     PKLRKVQKSLAALAGEMLSRQIDVTAEAIRRERAQAAMSYIMLCRQLDIGLDIDGELC
                     ELLKSWRKGERSGPVQQALDQALARLMQ"
     exon            complement(65551..65960)
                     /number=1
     exon            complement(66018..66100)
                     /number=2
     exon            complement(66149..66348)
                     /number=3
     exon            complement(66423..71342)
                     /number=4
     CDS             complement(join(71716..72261,72331..72788,72835..75760,
                     75809..75954,76006..76042,76103..76318))
                     /codon_start=1
                     /locus_tag="AO090003000027"
                     /note="DEAD box-containing helicase-like transcription
                     factor/DNA repair protein"
                     /old_locus_tag="AO070249000017"
                     /protein_id="BAE57266.1"
                     /transl_table=1
                     /translation="MSNCSPTPPGAVPDILITALARRSPEDLDSDAPPNKRRKLTSGI
                     QSLRELNGLSDTRVPRGSIPLARFHLYLDFASASPIQDDPENVCVGTTTLDWFKLELA
                     TTVDRETVFEYQSHDPPFIKFSKDLEFASSLSTLYTVPERKSSFCLETIILWKDSLDI
                     LGNNQLVEGARKVFSRYVFQEQEDLASQQERHSQRQLSWSPRDFYDHVYVPPDTPESS
                     AEVKCSLIECQMFPFQRRAVRWLLQREGVELQADGQVVPVRDTLKGGLPASFREFIDA
                     DGRVCFASQLFMIVATDLANWFDGGNHLRGGILAEEMGLGKTVEIISLICLNRRHLAP
                     EETFPDHRHDGLRPSGATLIITPPAILEQWEQEIKLHAPGLSVFHYTGIQRHQSLSDE
                     ELIELLADQDVVLTTYNILAREVHYSGDVPQRNLRHKKRFEPRRTPLVRISWWRVCID
                     EAQMIESGVSNAARVARLIPRQNAWAVTGTPLRKDISDLLGLLLFLRYEPFCGVIWHR
                     LCGSFRTELANIVSMIALRHSKVHVRNELHIPPQKRIVITVPFTAVEEQRYGQLFEEM
                     CGACGLNLSGAPLNGDWDPDDLSIIERMRSWLTKLRRTCLHPAGKPLRGLGTGTGPLR
                     SVAEVLEVMIDQNDALIHAEERSLLLSQLRRGQLLENAKHRQQALGLWSKSLERANAI
                     VKECRDRLHPERMERRMDAVNVDRDVTSADTASEDETEEAAKNTRGGARQRLRAALEV
                     QHICVFFTGNAYFQMKTDPKLTRPDSEESRALEKREVEAYESAKLIRKEMLAEISRKV
                     GHFMKIIRERAQKNQFVNIPKMKPQLWSKGLESHRILDKLENFCDSMNKHAAQYDEWR
                     QTMIKFLSESLIDQEDESELEGDEYEKSTKHQDEVYVYMEALRAMFADRHDALTGQKN
                     VLIAHEVKSGIVQAQKGEGPSPALFLQMMNTRSRIKPDPQLGSLRGIIGELRSLATSL
                     EWQASGGNSRARAELELVSLVLQNASQMASEQAKVATNMEKEVEMFRDTMNNRLEYYR
                     QLQQISDTVAPYDEESAGKPLNEALFSAKLRQEEIIDEKISALRAKHRYLIHLRDESG
                     SDDSSKICVICQSGFEVGEHGVLTVCGHKYCKDCLRMWWHQHRTCPTCKKRLKANDFY
                     QITYKPQEFLVQEEKPPAKVEPERRPKNSIYTDISSGTLREIKTVDLDGSFGTKIDTL
                     ARHILWLRHHDPGGKSVIFSQYKDFLEVLAIAFHRFKIGFSSVDSKDGISKFKSDSSI
                     ECFFLHARAHSSGLNLVNATHVFLCEPLINTAIELQAIARVHRIGQHRPTTVWMYLVS
                     DTVEESIYELSVSRRLAHIVQKEKAEPLCADVENGRAVTDNITEAAIDSANSLEIRDA
                     ALSNLMAGGAFGGELVKKDDLWRCLFGNPTKKEANNFQAGASGEVARFLRDEAAEHRR
                     RAGAGF"
     exon            complement(71716..72261)
                     /number=1
     exon            complement(72331..72788)
                     /number=2
     exon            complement(72835..75760)
                     /number=3
     exon            complement(75809..75954)
                     /number=4
     exon            complement(76006..76042)
                     /number=5
     exon            complement(76103..76318)
                     /number=6
     CDS             complement(join(77004..78535,78591..78771))
                     /codon_start=1
                     /locus_tag="AO090003000028"
                     /note="predicted protein"
                     /old_locus_tag="AO070249000016"
                     /protein_id="BAE57267.1"
                     /transl_table=1
                     /translation="MLLRTVLWLCFLLVAPSEGTLEVFQIYQPVQYGGVDGTHCNQNV
                     LLMEHVFASSYGHPFIGYYSPPECEFDTVKINLTVTSQGRQFDRLAILFLGDTEVFRT
                     STAEPTADGIVWAYIKDMSQYNALWQIQQKLIFDLGNIINDIYTGPFSVTLTAYFSCE
                     GHARTADVILPISARKSASNLSSVFTVPGDNTKTLYQIPPNTSRAVVSISACGQSTEE
                     FWWSNVFSYDTEAFNTTMGELYGYSPFREVQLYVDDILAGIIWPFPVIFTGGVAPGFW
                     RPIVGIDAFDLRQPEIDISPFLPILKDGQPHSFEIKIVGLSVAQNGTVTLSDSVGSYW
                     AVTGNIFLYLSDSALDSTSLGTEKPYVDAPTPQFKATRSLVQNQTGGNDSLAYSVVGE
                     RTLSIKSSAFQWSQNLTYSNFGLFSQQGMSQSTNQHTSGRSTIIAFGANQTSNEVQFE
                     YPLSVNQTYRPTDAGQSIHAWMSRGLDIKTTGATGISTYTLTSGPSRLHTQQWGEAFY
                     QPTDNSSISFGDTTDVFESNSILGHYKRSVRAVNGSVVSDTDDRDDQPSKSNDYSDHS
                     SFLK"
     exon            complement(77004..78535)
                     /number=1
     exon            complement(78591..78771)
                     /number=2
     CDS             complement(join(80169..80226,80294..80627,80736..80751))
                     /codon_start=1
                     /locus_tag="AO090003000029"
                     /note="uncharacterized membrane protein"
                     /old_locus_tag="AO070249000015"
                     /protein_id="BAE57268.1"
                     /transl_table=1
                     /translation="MVLREDTERSTYTQKVDFAKLRSELLNADSTEAQLTRSSHEKIA
                     ADLAKLNSRLRDEIGRTQASVRLDLNLEKGRIREEANSQEMRIKETETRIEQEVAGLR
                     ERVEAVKFSTLQWLMGVCTGTAALILGAWRLFM"
     exon            complement(80169..80226)
                     /number=1
     exon            complement(80294..80627)
                     /number=2
     exon            complement(80736..80751)
                     /number=3
     CDS             complement(join(82282..82531,82601..82675,82735..83051,
                     83102..83164,83245..83349))
                     /codon_start=1
                     /locus_tag="AO090003000030"
                     /note="phosphomannomutase"
                     /old_locus_tag="AO070249000014"
                     /protein_id="BAE57269.1"
                     /transl_table=1
                     /translation="MAAEAAGVYPALEDRPVKDTICLFDVDGTLTPARRTISPEMLQL
                     LSQLRHKCAIGTVGGSDLAKQQEQLGTSSTKVSSLFDFCFAENGLTAIRLGRFLASNS
                     FIAWIGEEKYQKLANFCLKYIADLQLPKKRGTFVEFRNGMINVSPVGRNASVDERIEF
                     EAYDKQHNIRKSFVEALKTEFPDYNLSYSIGGQISFDVFPAGWDKTYCLRHIEAEKDI
                     SGIKYKTIHFFGDKSFPGGNDYEIYTDSRTIGHAVKDPDDTMKQLKEIFQL"
     exon            complement(82282..82531)
                     /number=1
     exon            complement(82601..82675)
                     /number=2
     exon            complement(82735..83051)
                     /number=3
     exon            complement(83102..83164)
                     /number=4
     exon            complement(83245..83349)
                     /number=5
     CDS             complement(84049..84696)
                     /codon_start=1
                     /locus_tag="AO090003000031"
                     /note="predicted protein"
                     /old_locus_tag="AO070249000013"
                     /protein_id="BAE57270.1"
                     /transl_table=1
                     /translation="MHIKGDYQHLLIPERSSLCVIDPSRESLKSHPDRVPADSPERPT
                     RTRKFQEINDAYYTLSDESRRREYDATRPVEEETEDEVPLGGTGGFSWSSFGFGTSDR
                     EQRASEQFGSVFEEMLREEGLASDDTDADGRRRTRPTSRFWSIVGGISGGALGFIVAN
                     AAGAFAGAVAGNRLGAVRDAKGKSVYEVFLDLPQGDRARLLSELAAKVFQSTVGR"
     exon            complement(84049..84696)
                     /number=1
     CDS             complement(join(85406..86942,87007..87393,87520..87575))
                     /codon_start=1
                     /locus_tag="AO090003000032"
                     /note="glucose dehydrogenase/choline
                     dehydrogenase/mandelonitrile lyase (GMC oxidoreductase
                     family)"
                     /old_locus_tag="AO070249000012"
                     /protein_id="BAE57271.1"
                     /transl_table=1
                     /translation="MIFLRSFVLSLALSPLLASSYIASDNPTEYDYVVVGSGPGGGPL
                     AARLAIAGYRVLLIDAGDDQGNATKQQVPALQLQSTEYEPMRWDYFVNHYSNLTRQEE
                     DSKITYRTPSGDIHVGPSPPANSEPLGILYPRAGTLGGCSAHNAMITILAYDSDWDSI
                     ASATSDDSWSAEKMREYLKRLERNRYLPNSIAGHGFNGWLTTSLTQLKLVLEDQKLLS
                     LVIAAATAAGQNLLGKIVDTVTGLSDILLRDLNNDGATRDQQVGLFQVPLAVDIPEYR
                     RTGPRDFLMDTVNAVNADGSRKYHLDIQLNTLVTNVRFETSGTKPRATGVDYIRGRSL
                     YRADPRSESASVGTPGYVNAAREIVLSAGTFNTPQLLKLSGIGPKDELNRWNISVLVD
                     LPGVGTNLQDRYETGLVGKTPTDFTLTTKCTFMDSLPDPCLEQWQNNSLDKGTYTTNG
                     IAIAIIRKSSTSDGEPDLLISGAPANFQGYFPGYSYEALKDAQHWTWITLKSHSRNNA
                     GTVELRSTDPKDTPIINFNSFDTGITENDADDKDLQAVYEAMEFSRKIFDNLVPLDGS
                     FEEVWPGPNVTTEAELKEFIKREAWGHHACCTNPIGPDTDKNSVLDSRFRVLGVDGLR
                     VVDASVFPKIPGYYIALPVYMVSEKAADVILSDAA"
     exon            complement(85406..86942)
                     /number=1
     exon            complement(87007..87393)
                     /number=2
     exon            complement(87520..87575)
                     /number=3
     CDS             complement(join(89505..89782,89844..89911,89962..90353,
                     90366..90466,90522..90558,90616..90630))
                     /codon_start=1
                     /locus_tag="AO090003000033"
                     /note="predicted protein"
                     /old_locus_tag="AO070249000011"
                     /protein_id="BAE57272.1"
                     /transl_table=1
                     /translation="MAVTMLLVIALSSLSVVLADTGLGKDIWTLPFDNITRILKVSKM
                     NVSAAYGEYQIYFFDECLYLSILPLTKISILFFYLRVFPKRSFRNAVYTVIGLNVCYM
                     IAFVLISVFQCRPLDGAWLHWDKEDQYQCNDINAQGWAAAVFNMVLDLVVMIMPLREL
                     YHLQLSLRKKLLVMCMFSLGIFVTLVSILRLKSLIHFADTDNLTWDYVQVGYWSTIEV
                     HVGVICACLPAIRSLLTRICPSIFGDTRVQTSTSRSGGASSRLEGVVQSKPKVKGDDS
                     DFLPLVDMDNSSHFDLQTHW"
     exon            complement(89505..89782)
                     /number=1
     exon            complement(89844..89911)
                     /number=2
     exon            complement(89962..90353)
                     /number=3
     exon            complement(90366..90466)
                     /number=4
     exon            complement(90522..90558)
                     /number=5
     exon            complement(90616..90630)
                     /number=6
     CDS             join(94908..95127,95183..95357,95410..95740)
                     /codon_start=1
                     /locus_tag="AO090003000034"
                     /note="predicted protein"
                     /old_locus_tag="AO070249000010"
                     /protein_id="BAE57273.1"
                     /transl_table=1
                     /translation="MSKFMEWYNMSTDGTFSMDLMAKRAKIRMDQTKQSNPEFYYGPV
                     TGLIARNAGYLFPARLFRNYSQENPEGVLTKEIVRNFFAIYGEEGNFTYRQGWERIPE
                     NWYKSPVDYGLVKLNLDTLDWLLKYPELGSIGGNTGTINSFTGIDLSDATGGVFNLTT
                     LLKENNLLCFAFEALKFLSPNALAGLYKTLSIPLDMISVAISTSLLNFSCPAFKDMQI
                     GGKPFWEAIQNDFPGAAKSGGAF"
     exon            94908..95127
                     /number=1
     exon            95183..95357
                     /number=2
     exon            95410..95740
                     /number=3
     CDS             join(96428..96900,96934..96970)
                     /codon_start=1
                     /locus_tag="AO090003000035"
                     /note="predicted protein"
                     /old_locus_tag="AO070249000009"
                     /protein_id="BAE57274.1"
                     /transl_table=1
                     /translation="MGWFDTQSSVSSSHSGRKRSPSRRSTYSTHHSRHSAPSIFSFNG
                     GGSRSRAGRSSPSAYSSSSRRARPRSGFVQKVVHIIKRLLRDIYKYAREHPIKVLLLV
                     LIPLLTSGVLQKLFAMIGIRLPKNIFGGQGGQSRDGGKKGIMEHLNSFMSIAKMIMLC
                     GLAERLAGK"
     exon            96428..96900
                     /number=1
     exon            96934..96970
                     /number=2
     CDS             complement(join(97376..98517,98626..98698))
                     /codon_start=1
                     /locus_tag="AO090003000036"
                     /note="predicted protein"
                     /old_locus_tag="AO070249000008"
                     /protein_id="BAE57275.1"
                     /transl_table=1
                     /translation="MKSTALRLVVFAVLCVLATAWTKDGYKCDILRCATFCSPFPVLY
                     HALTIIPTDFLGIQPNANQDDINKAYRKKSRLLHPDKVKRSFIANASKDKSRAKNKKP
                     GIHVNQGPSKREIDAAVKKAHDRASRLNTVANILRGPGRERYDYFLKNGFPKWKGTGY
                     YYSRFRPGLGSVLTGLFLAFGGGAHYAALFLGWKRQREFVDRYIRQARRAAWGDELGV
                     RGIPGVDSANVTAPAPAPTPEAETSAVPINRRQKRMMEKENRKESKKGNRASSRNSGT
                     ATPTGESTEPSGERKRVIAENGKVLIVDSVGKVFLEEETEDGEKQEFLLDIDEIQRPT
                     VRDTMLFRVPIWFYHKTVGRLLGASSAAGGEIVDEEPSEVPEQTIEQANDSAVAPKSR
                     VSRRRGKRSQKS"
     exon            complement(97376..98517)
                     /number=1
     exon            complement(98626..98698)
                     /number=2
     CDS             100015..100539
                     /codon_start=1
                     /locus_tag="AO090003000038"
                     /note="prenylated rab acceptor 1"
                     /old_locus_tag="AO070249000006"
                     /protein_id="BAE57276.1"
                     /transl_table=1
                     /translation="MSPIQIPVDAITSRFGERFNSLRSQSLGSRFANLRPISEFLDVK
                     RVSKPANFGEVQSRVNYNLSYFSSNYAAVFAMLSIYSLLTNFMLLFVIILVTGGLYGI
                     GKLQGRDLDLGFARFNTSQLYTGLLIVAVPLGFLASPISTVLWLIGATGVCVFGHAAF
                     LDKPIENAFSEEAV"
     exon            100015..100539
                     /number=1
     CDS             100728..101633
                     /codon_start=1
                     /locus_tag="AO090003000039"
                     /note="predicted protein"
                     /old_locus_tag="AO070249000005"
                     /protein_id="BAE57277.1"
                     /transl_table=1
                     /translation="MDMDEILGWRKRMLEYDKLSDETGFVDGMDYNLHEDGDSTVAYA
                     VQLALKDKEEWHVEHALERIRRAQMLGQKNVRLSKRELEALERKRMQTGGKRDSTRGN
                     PTTKGSRSRDSPASDVQRRGSSISQGEQTTPYRLAGSSWARSSDAPSRQSQPPVPSPK
                     SSLRYSERHSTRSPQASLRGTASAYPLPDDPGWVPSYQLPSSRDRHLHARRSSVDPLQ
                     GASRRPSSYMSTYQAVASPSVRGSFTPRKTALRSTVGGSHDDDDEESDSDDNDRVHIV
                     DVVGRKVPTGRTAVGRGSRQRRRRS"
     exon            100728..101633
                     /number=1
     CDS             join(102911..102965,103017..103098,103153..103422,
                     103478..103683,103740..103960)
                     /codon_start=1
                     /locus_tag="AO090003000040"
                     /note="predicted protein"
                     /old_locus_tag="AO070249000004"
                     /protein_id="BAE57278.1"
                     /transl_table=1
                     /translation="MWIISFWIFPVISAFMWIAMLLAMLGSWAVQGTPVYSSMEEGQT
                     IAYISDIGAQGLKPLFITGSVITVVFLDLSFISERWLRHAGQLVPNKGRFDKACAVLS
                     IFFSIAGALGLILLSIFDTVRHPHMHDGFLVMFLVGYIISAILICAEYLRLGVFYRSQ
                     HRVLFASFVIKLLFIIIEIALAIAFAVLGKKGPSKRNAAAVLEWVIALIFTFYVLSFV
                     VDLLPSVRTRRHVPQGEKRIVRSEMENGMAQPNATIEEPLTTDSAGPNMDYSYYRGQR
                     M"
     exon            102911..102965
                     /number=1
     exon            103017..103098
                     /number=2
     exon            103153..103422
                     /number=3
     exon            103478..103683
                     /number=4
     exon            103740..103960
                     /number=5
     CDS             complement(join(104291..104801,104958..105166))
                     /codon_start=1
                     /locus_tag="AO090003000041"
                     /note="predicted protein"
                     /old_locus_tag="AO070249000003"
                     /protein_id="BAE57279.1"
                     /transl_table=1
                     /translation="MENERLMILRTEHQMATAKLHAETGTSTPPNNNNTDHLFQLPHV
                     RRQLISLTGKAFERSLLWRLDWWNFFKVLALAASGYRNDAVIIVGEQVMSPRGLTGLG
                     LDTLDSSTAEMKEIFELFASQNDGADRTYPALVHCTQGKDRTGLVVLMLLLLTGVVSD
                     EAMTADYVRSEPELVVEVEERMKEIRKLGLSEDYTKCPDGFTTEIRRHLQERYGGVDG
                     YLRFVGVEKKKLDVIREALVA"
     exon            complement(104291..104801)
                     /number=1
     exon            complement(104958..105166)
                     /number=2
     CDS             complement(join(106144..107278,107332..107833,
                     107881..108957,109012..109252))
                     /codon_start=1
                     /locus_tag="AO090003000042"
                     /note="beta-galactosidase"
                     /old_locus_tag="AO070249000002"
                     /protein_id="BAE57280.1"
                     /transl_table=1
                     /translation="MRLLSFIYLVWLALLTGTPQVSATDNGKTSDVAWDKYSLSVKGE
                     RLFVFSGEFHYQRLPVPELWLDVFQKLRANGFNTISVYFFWSYHSASEDVFDFTTGAH
                     DIQRLFDYAKQAGLYVIARAGPYCNAETSAGGFALWAANGQMGSERTSDEAYYKKWKP
                     WILEVGKIIAANQITNGGPVILNQHENELQETTYDSNDTKVIYMEQVAKAFEEAGVVV
                     PSSHNEKGMRTVSWSTDYKNVGGAVNVYGLDSYPGSLSCANPNSGFNLLRTYYQWFQN
                     YSYTQPEYLAEFEGGWFQPWGGSFYDSCASELSPEFADVYYKNNIGSRVTLHNIYMTF
                     GGTNWGHSAAPVVYTSYDYGSPLRETREIRDKLKQTKLLGLFTRVSKDLLKTYMEGNG
                     TSYTSDDSIYTWALRNPDSDAGFYVVAHNTSSSREVTTFSLNITTSAGAMTIPDIELD
                     GRQSKIIVTDYSIGSESSLLYSSAEVLTYATLDVDVLVFYLNAGQKGAFVFKDAPADL
                     KYQTYGNSNLSALETSQGTQYSYTQGEGVTAVKFSNGVLVYLLDKETAWNFFAPPTVS
                     SPTVAPNEHILVFGPYLVRGASIKHDTVEIVGDNSNSTSIEIYTGDEHVKKVSWNGNL
                     IDTRATAYGSLIGTVPGAEDIEISLPSLSSWKAQDTLPEISPDYDDSRWTICNKTTSV
                     NSVAPLSLPVLYSGDYGYHTGTKIYRGRFDGQNATGANVTVQNGVAAGWAAWLNGAYV
                     GGFSGDPDKVASWEVLKFNHSSLRSRDNVLTIITDYTGHDQNSQKPIGTQNPRGIMGA
                     TLIGGGNFTLWRIQGNAGGEKNIDPVRGPMNEGGLYGERMGWHLPGYQVPESALDSSP
                     LEGVSGAEGRFYTTSFQLDLEEDLDVPIGLQLSAPAGTEAVVQIFMNGYQFGHYLPHI
                     GPQSLFPFPPGVIKNRGQNSLAISMWALTDAGARLEQVELKAYAKYRSGFDFNRDWTY
                     LQPGWKDRTEYA"
     exon            complement(106144..107278)
                     /number=1
     exon            complement(107332..107833)
                     /number=2
     exon            complement(107881..108957)
                     /number=3
     exon            complement(109012..109252)
                     /number=4
     CDS             complement(join(109890..110788,110843..112162,
                     112231..112326,112391..112460))
                     /codon_start=1
                     /locus_tag="AO090003000043"
                     /note="predicted protein"
                     /old_locus_tag="AO070249000001"
                     /protein_id="BAE57281.1"
                     /transl_table=1
                     /translation="MATIEQPSVQSIPRSRSTRLADQGLRIAASAALYVTHPERRLSA
                     REPSAFETDLSNLKVPGSRPGFSHASAVAALAQAKNRQLEAEKQAAAAFYAQDHHSDI
                     SSYGGNRAGASARRDRSSISSLPPSTEISAADLTPEARREISEREKAVRAARGALYSN
                     RRRAESAPSEAPYTTSAGQLGDIDAAMEASRIQHLAHVNRRLFTATPPVAPELEEQRR
                     RSVLQAAAVSMARDMYSLTEATEPEQLYPSIPGTQANHGRVRPKRSVSRPEAGAIQRA
                     VNLQETAQKLAAEKLASMQDDTAVYREYYRLEQQDTRSSVPTRRRRLSIDSDASEFDV
                     ERSREIRHQMTSLRTKLDAVDEQRDKDRALLMEAAKKNVDAVLQDMEMRVYAETGRAP
                     AALQKEWEEAALARARKDMQENDRQYYSGEKVNLGAQKFIDMSDVEALARSRLQPTFD
                     EITDRAETERAKELERRLDEEERQRREAVARQREADLVAEEKRQKAAMKQELKGKGEK
                     TWLWRKSRKSQDHEPTIGKHTVTRATEGLEGAAEEHAKSAPRETEQPQTTLAGNEATA
                     SGAMVDTGSTEPITRTESKLKTWFSKLGGRRPSASTGEAPKVAEGNRETPSNAVEETA
                     QAAEGPNESVEAAETADATNLAEADGDNERGAPLRSNPVTADDLQEMQRKSVDAGTLE
                     AMKSEGQAVEPGSKESPEQNGDKRSRLKSRLSQMVSKNSQDKTDGVTDHNKEDDEGSV
                     PVEHTAADELPSHATERDELRESAADQGLPVPPAIGKRASNGTTGRESRFSEDL"
     exon            complement(109890..110788)
                     /number=1
     exon            complement(110843..112162)
                     /number=2
     exon            complement(112231..112326)
                     /number=3
     exon            complement(112391..112460)
                     /number=4
     CDS             complement(join(113328..113398,113455..113622,
                     113682..114090,114141..114644,114700..115089,
                     115158..115291,115353..115398))
                     /codon_start=1
                     /locus_tag="AO090003000044"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070193000009"
                     /protein_id="BAE57282.1"
                     /transl_table=1
                     /translation="MGLGVLEDTALAQVPGTSDILKRECFNEQTDVDSNLKYDRSGTV
                     PILLVPQPSDDPNDPLNWPLWKRDITLLALSFVAVLCATTNSLMAANTVTISLHFKKS
                     FTSVALLTGYHLCGVGVAGILIVPTARVWGKRHLFLLGNVLMVISCGWAGGSANNYTS
                     LVWARIFQGVALAPFEALVNACVGDLYYVHERGKRMALSNVALFGAAFLTPVLAGKIT
                     HSLGWEWTFYLLAIFSAASLPLTFFLVPETAFRRPEYLNNDLKQIVNQRTENRMCSPQ
                     QSNEYQHEASHISGEKKHLSSLTNTESQAGTQERDTRLNTIVPTKASYIQTLKPFNGR
                     KTDENFLKLLLRPFPLFFHPAILWACLIQGVIIGWTVFIGVVLAAIFLGPPLWFNEVQ
                     TGYLYTGAFIGSILGLILSGLLSDSMNKIMIKLNKGRYEPEFRIFLVVFQLVFSGAGL
                     YGFGIVAQDVGKYGWLVVDMFFALVIIGMVMGAVASALYIVDAHRQIAIESFTCMLIF
                     KNIFSFILTFFAYEWLLSNGIKPAFLAISSIQMGICVLSIPMYIFGKRNRSFFARHDL
                     LKILHLW"
     exon            complement(113328..113398)
                     /number=1
     exon            complement(113455..113622)
                     /number=2
     exon            complement(113682..114090)
                     /number=3
     exon            complement(114141..114644)
                     /number=4
     exon            complement(114700..115089)
                     /number=5
     exon            complement(115158..115291)
                     /number=6
     exon            complement(115353..115398)
                     /number=7
     CDS             join(117183..117269,117370..117502,117594..117949)
                     /codon_start=1
                     /locus_tag="AO090003000045"
                     /note="predicted protein"
                     /old_locus_tag="AO070193000008"
                     /protein_id="BAE57283.1"
                     /transl_table=1
                     /translation="MKLYYISVILMTCLSTALAQGMDGLPDCAKDCATGSIPKQCQTI
                     DVACICGDKSFINSISCCVANKCSKDQQDAVLKFASQLCSGAGVNDLPKSASCAEGGS
                     SATETSSDSSVSSKSTTAKSTATDEPATTTSGSSDSSASPTASKSDSNTKTSSTSASS
                     PTTSTGGAALVQGKDTSLLAAIGAAILAFLA"
     exon            117183..117269
                     /number=1
     exon            117370..117502
                     /number=2
     exon            117594..117949
                     /number=3
     CDS             complement(join(118261..118335,118397..118822,
                     118896..119033))
                     /codon_start=1
                     /locus_tag="AO090003000046"
                     /note="predicted protein"
                     /old_locus_tag="AO070193000007"
                     /protein_id="BAE57284.1"
                     /transl_table=1
                     /translation="MGLLSSKTLIQAHALFLFILAVYLTRSPEVITDSDVVFMLGETL
                     QIDAAPSLSRPQSPFALCGILLVADALVDLILVTKVPRINEIIAMAEIARSAAPTSIA
                     GAMRTNPFLARLASLYTDIWTLLSASRFCLFFAVSFFIYQSKPSDWGVDVRHTVDGYG
                     QESASGLNQLKNRVVFTYGFMEMMFWLWIFLTLREERHEIAVRFAEEEQQLS"
     exon            complement(118261..118335)
                     /number=1
     exon            complement(118397..118822)
                     /number=2
     exon            complement(118896..119033)
                     /number=3
     CDS             join(119441..120031,120100..120145,120223..120590,
                     120648..120756,120837..120982)
                     /codon_start=1
                     /locus_tag="AO090003000047"
                     /note="protein geranylgeranyltransferase Type I, beta
                     subunit"
                     /old_locus_tag="AO070193000006"
                     /protein_id="BAE57285.1"
                     /transl_table=1
                     /translation="MTEAVFQKERHIKYFLRCLKTFLPSLYTSNDSNRVLLAYFTVAG
                     LDLLGELYNKTTSEERQGYVEWIYHCQVPSGGFRGFTGTDFGSERRTPENEAWDPANI
                     PSTFFALVILLILGDDLSRVKRTECLQWLSKMQRENGSFGEVLGTEGKIEGGGDLRFC
                     CFGAGTRYILRGKCGDGLEGIMDIDVDKLVAFIEACQAYDGGIGEGPFCESHSGHTYC
                     AIGALTFLDRLSKNHKPIALLSPKTGPFESLVRWLVTRQTCELGDDEEESDEEDGHGV
                     DEIGPLSATVEEPSLDTKVDQLPVVPPETEDSLRWAGFNGRCNKYADTCYSFWNTASL
                     NMMNRLTLVDATRNRRYLLEKTQHIVGGFGKGVGEPPDLLHSYFGLVSLAFQGEPGLE
                     SVDPALCASQRAVRHLHSLPWWQETKR"
     exon            119441..120031
                     /number=1
     exon            120100..120145
                     /number=2
     exon            120223..120590
                     /number=3
     exon            120648..120756
                     /number=4
     exon            120837..120982
                     /number=5
     CDS             join(122593..122646,122833..122861,122936..123053,
                     123116..123272,123318..123999,124226..124406)
                     /codon_start=1
                     /locus_tag="AO090003000049"
                     /note="serine/threonine protein kinase"
                     /old_locus_tag="AO070193000004"
                     /protein_id="BAE57286.1"
                     /transl_table=1
                     /translation="MPPPRTRAEVQAQKQKEKLAQSYHDLLEEFSSKDLRSVGNYTLG
                     RLIGKGSFGKVYLASHKLTNGSKVVLKSSSREDTNLPREIHHHRQFLHPHIARLYEVL
                     VTEKLVWLVLEYCPGMGRDELYNYLLRHGPLPVDKVKRIFTQLVGAVAYVHSKSCVHR
                     DLKLENILLDKHENVKLCDFGFTREYEGKASYLQTFCGTICYSAPEMLKGEKYAGEKV
                     DVWSLGIILYALLAGELPFDEDDDQVTKTRILTEDPAYNDRFPDDAKTLINLLLSKRP
                     LIRPSLDEILAHPFLAEHAPEQLAILKIPRPAPFTTPLEKTTLQRMKSAGVNIDEVVD
                     SVLAQRCDPLAGCLLCLSCLVYQSQFPSNLQLPATHLHPLTKTLFGLLVLPDTAHYRL
                     PKIEDAQAGQVHCM"
     exon            122593..122646
                     /number=1
     exon            122833..122861
                     /number=2
     exon            122936..123053
                     /number=3
     exon            123116..123272
                     /number=4
     exon            123318..123999
                     /number=5
     exon            124226..124406
                     /number=6
     CDS             complement(join(125954..125980,126562..126932,
                     127008..127238,127328..127672,127748..127965,
                     128013..128113,128172..128306))
                     /codon_start=1
                     /locus_tag="AO090003000050"
                     /note="fucose permease"
                     /old_locus_tag="AO070193000003"
                     /protein_id="BAE57287.1"
                     /transl_table=1
                     /translation="MGLLHFLQTRSGFKVDNRKTTSAATLTLRQSLWPLCLVTILFFL
                     WGFAYGLLDTLNKHFQITLGITRTRSAGLQAAYFGAYPLASLGYANYMLRHFGYKSVF
                     IMGLVLYGIGALCMLPAGLNRSFGGFCAATLVIGSGLGSLETAANPYLAVCGPPKYAE
                     IRINLAQAFNGIGTCVAPALASYVFFADTSDDVDALKSVQWVYLAIGIFVFILAGVFF
                     VSNIPEVTDEDMASQVASTHAGEQEQPFRKQYKLFHATLAQFTYTGAQVAIAGYFINY
                     VTETWPGTGDSTASKYLAGAQGAFAVGRFIGAFFMRYVKARWVFLVYLSCTVAFIAAS
                     TTQGYKTGLAMLFLTLFFESVCFPTIVALGIRGLGRHYKRGSGFIVAGVSGGAVVAPI
                     LGHVADMRNNTGFAMIVPTMFMIVAWTYAVAVNFVPAYRDTVDKTGESDVGLQAGGGV
                     PKEDVEIGAMGRSKEVVIHRKEITM"
     exon            complement(125954..125980)
                     /number=1
     exon            complement(126562..126932)
                     /number=2
     exon            complement(127008..127238)
                     /number=3
     exon            complement(127328..127672)
                     /number=4
     exon            complement(127748..127965)
                     /number=5
     exon            complement(128013..128113)
                     /number=6
     exon            complement(128172..128306)
                     /number=7
     CDS             complement(join(129518..129623,129674..129996,
                     130064..132379,132449..132606,132672..132789))
                     /codon_start=1
                     /locus_tag="AO090003000051"
                     /note="Ca2+ transporting ATPase"
                     /old_locus_tag="AO070193000002"
                     /protein_id="BAE57288.1"
                     /transl_table=1
                     /translation="MEHSYLYSPKEVLEHFSVSEHSGLSQEQALKSRQKHGPNALAED
                     PPTPLWELILEQFKDQLVLILLGSAALSFVLALFEEGDDWTAFVDPIVILTILILNSV
                     VGVTQETSAEKAIAALQEYSANEATVVRDGKTQRIKAEDLVPGDIIHIAVGDRVPADC
                     RLIAVHSNSFRVDQAILTGESESVGKDTRAIRDKQAVKQDQTNILFSGTTVVNGHATA
                     LVVLTGGSTAIGDIHDSITSQISEPTPLKQKLNDFGDMLAKVITVICILVWVINIEHF
                     NDPSHGGWTKGAIYYLKIAVSLGVAAIPEGLAVVITTCLALGTRKMANKNAVVRSLPS
                     VETLGSCSVICSDKTGTLTTNQMSVNKVVYLDKTGNGVQEIDVEGTTFAPEGNLSQNG
                     KVLQNLAVSSSTIRQMAEVMAICNSANLSHDAKSGVYSCIGEPTEGALRVLVEKIGTD
                     DAATNMKIFQLPASQRLRASSAYYEGRLPLKATYEFSRDRKSMSVLVGTEKKQSLLVK
                     GAPESILERCTHVLLGPDGPRVPITKEHADLLSAEIVEYGNRGLRVMAFARVDDVGAN
                     PLLRNAQTSDDYAQLERNMTLIGLAAMLDPPRVEVADSIKKCLAAGIRVIVITGDSRN
                     TAEAVCRHIGIFAEDEDLAGKSFTGREFDGLSDSEKLEAVKTASLFSRTEPSHKSKLV
                     DLLQSLGHVVAMTGDGVNDAPALKKSDIGVAMGTGTDVAKLAADMVLADDNFATITVA
                     VEEGRSIYSNTQQFIRYLISSNIGEVVSIFLTAALGMPEALVPVQLLWVNLVTDGLPA
                     TALSFNPPDHDVMRRPPRKRDEPLVGGWLLFRYMVIGTYVGAATVFGYVWWFLYNPEG
                     PQISFWQLSHFHKCSAQFPEIGCEMFTNDMSRAASTVSLSILVVIEMLNAMNALSSSE
                     SLFTFALWNNMMLVYAIILSMTLHFAILYIPFLQGLFSILPLNWVEWKAVLAISAPVI
                     IIDEALKFVERQMYTTTPKAIGQQNGAASKPKRA"
     exon            complement(129518..129623)
                     /number=1
     exon            complement(129674..129996)
                     /number=2
     exon            complement(130064..132379)
                     /number=3
     exon            complement(132449..132606)
                     /number=4
     exon            complement(132672..132789)
                     /number=5
     CDS             join(136621..136632,136879..136921,137120..137441,
                     137504..137591,137644..138000)
                     /codon_start=1
                     /locus_tag="AO090003000053"
                     /note="multifunctional chaperone (14-3-3 family)"
                     /old_locus_tag="AO070341000001"
                     /protein_id="BAE57289.1"
                     /transl_table=1
                     /translation="MTSETFLARLCEQAERYDDRFPRTPFLALLTPHQIGGELTVDER
                     NLLSVAYKNVVGTRRASWRIISSIEQKEESKGSEQHVSIIRDYRQKIETELEKVCQDV
                     LDVLDESLIPKAETGESKVFYYKMKGDYHRYLAEFASGNKRKVAATAAHEAYKNATDV
                     AQTDLTPTHPIRLGLALNFSVFYYEILNSPDRACHLAKQAFDDAIAELDSLSEESYRD
                     STLIMQLLRDNLTLWTSSDGQEPEGAASKEDKPEEESAPAPEDKGEESKPAAPES"
     exon            136621..136632
                     /number=1
     exon            136879..136921
                     /number=2
     exon            137120..137441
                     /number=3
     exon            137504..137591
                     /number=4
     exon            137644..138000
                     /number=5
     CDS             complement(join(139017..139721,139822..139895,
                     139986..140004))
                     /codon_start=1
                     /locus_tag="AO090003000054"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000002"
                     /protein_id="BAE57290.1"
                     /transl_table=1
                     /translation="MAPERWDDEEDSVSPPPVAPRRRFDDEEEDEVLDSWDAAEDSEV
                     EREKAAKAAEAKAKADAEAAAKKKSKSQRIQEHKEERKKKAEEEDSDSEEEDDADKRA
                     RLRRAQKDADLKHAEDLFGDIDLNRNRGAPKAIVISDSADPTQAVDLSAMPLFKPTTK
                     EQFARLTSTLIPLLTPHSKKPHYSLWAQEFAKQLVKELNSADVKKIASAMTTMSNEKM
                     REERAADKGSKKSKAAKTKVSLVTSRDNKLDADYDNGDDGLGDDDFM"
     exon            complement(139017..139721)
                     /number=1
     exon            complement(139822..139895)
                     /number=2
     exon            complement(139986..140004)
                     /number=3
     CDS             complement(join(140536..140890,140950..141390,
                     141454..141793,141862..141918,141982..142105))
                     /codon_start=1
                     /locus_tag="AO090003000055"
                     /note="enolase"
                     /old_locus_tag="AO070341000003"
                     /protein_id="BAE57291.1"
                     /transl_table=1
                     /translation="MPITKIHARSVYDSRGNPTVEVDVVTETGLHRAIVPSGASTGQH
                     EAHELRDGDKTHWGGKGVLKAVENVNKTIAPAVIEENLDVKDQSKVDEFLKKLDGSAN
                     KSNLGANAILGVSLAIAKAGAAEKGVPLYAHISDLAGTKKPYVLPVPFQNVLNGGSHA
                     GGRLAFQEFMIVPSAAPSFSEALRQGAEVYQKLKTLAKKKYGQSAGNVGDEGGVAPDI
                     QTAEEALDLITEAIEQAGYTGKMKIAMDVASSEFYKADVKKYDLDFKNPDSDSSKWLT
                     YEQLADLYKTLASKYPIVSIEDPFAEDDWEAWSYFYKTSDFQIVGDDLTVTNPLRIKK
                     AIETKACNALLLKVNQIGTLTESIQAAKDSYADNWGVMVSHRSGETEDVTIADIAVGL
                     RSGQIKTGAPARSERLAKLNQILRIEEELGNNAIYAGEKFRTSVNL"
     exon            complement(140536..140890)
                     /number=1
     exon            complement(140950..141390)
                     /number=2
     exon            complement(141454..141793)
                     /number=3
     exon            complement(141862..141918)
                     /number=4
     exon            complement(141982..142105)
                     /number=5
     CDS             join(143545..143761,143869..144255,144310..144766,
                     144827..144947)
                     /codon_start=1
                     /locus_tag="AO090003000056"
                     /note="26S proteasome regulatory complex, ATPase RPT4"
                     /old_locus_tag="AO070341000004"
                     /protein_id="BAE57292.1"
                     /transl_table=1
                     /translation="MNGAADPEREQALEDYKKSLLELREWEAKLKSLRMGIKDLQREF
                     DISEENIKALQSVGQIIGEVLKQLDEERFIVKASSGPRYVVGCRSKVDKSKLKQGTRV
                     ALDMTTLTIMRMLPREVDPLVYNMSLEDPGQVNFAGIGGLNEQIRELREVIELPLKNP
                     ELFHRVGIKPPKGVLLYGPPGTGKTLLARAVASSMETNFLKVVSSAIVDKYIGESARL
                     IREMFGYAKEHEPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDYLGK
                     TKIIMATNRPDTLDPALLRAGRLDRKIEIPLPNEVGRLEILKIHSSTVQLEGDIDFES
                     VVKMSDGLNGADLRNVVTEAGLFAIKDYRDAINQDDFNRAVRKVAEAKKLEGKLEYQK
                     L"
     exon            143545..143761
                     /number=1
     exon            143869..144255
                     /number=2
     exon            144310..144766
                     /number=3
     exon            144827..144947
                     /number=4
     CDS             join(146312..146804,146863..147489,147552..148567)
                     /codon_start=1
                     /locus_tag="AO090003000057"
                     /note="1, 2-alpha-mannosidase"
                     /old_locus_tag="AO070341000005"
                     /protein_id="BAE57293.1"
                     /transl_table=1
                     /translation="MSFHYPPRNPSLSPQPPLENNSWRASRSPGPKLGGYGLSQSAGV
                     SNNLTTFFGDGRTLPMYKDKPYFAPRRTGPKVRQRRVLYGGLCLFFLVSLWYYMSGSW
                     GKPEIKTSESQKGEELWAWVQSLDKEPAYNGEELKGIDWAARREKVRDAFIVSWDDYA
                     KNGWGLDQYRPAAKDGKNMVEGGLGWIIVDALDTMIMMNLTSRVQHARDWIQHSLQYN
                     QDHDVSTFETTIRMLGGLLSAHYLSTTYTDLAPVSGDEDLYIEKATDLAERLSGAFES
                     SSGVPFASINLKKSEGIPAHSDNGASSTAEATTVQLEFKYLAKLTGEAEYWRMAEKVM
                     EVVDRSKMEDGLVPIYIYPDTGKFRGKNIRLGSRGDSYYEYLIKQYLQTSEQEPVYKE
                     MWDEALIGIRKHLVAYTKRAQLAIVGERPEGLEGKLSPKMDHLVCFLPGTIALGATGG
                     IPLSQAKKSPYWSQRHDEEILLAKELMKTCWATYLATKTGLAAEITYFKLDNPAVMMQ
                     DMYPESTLTTGNRKSEQEDLPLKSKPLYPLDDKTLNWENDLDIHMQDRHNLQRPETLE
                     SLFYMYRITGDETYRHWGWEMFKSFVRHTAIVEHDNTHADPTSDKPAEPSRPQIISFT
                     SLNNVDVIPPTRRDNMESFWMAETLKYFYLLFSDRDFIPLEENVFNTEAHPFPRFKLG
                     GELRTGWERKSSESESVPGSAPQEQEQAP"
     exon            146312..146804
                     /number=1
     exon            146863..147489
                     /number=2
     exon            147552..148567
                     /number=3
     CDS             complement(148890..150182)
                     /codon_start=1
                     /locus_tag="AO090003000058"
                     /note="aminoacylase ACY1 and related metalloexopeptidases"
                     /old_locus_tag="AO070341000006"
                     /protein_id="BAE57294.1"
                     /transl_table=1
                     /translation="MKSIYSLVLCTALTAASPHPAFPQSPLGVPTTSSPSTGTFNSAE
                     EVINASPFLSFHRDIVQIESISSNEHNVGEFIADFLRARNFTVIEQAVTSSSQTENQE
                     RFNVFAYPSSNTPEILITSHIDTVPPFIPYSLDTDSTTDNDPSTIRISGRGSVDAKGS
                     VAAQIFAALDVLEQNPSAPLGLLFVVGEETGGDGMRAFSESSLNPAPSAFHTVIFGEP
                     TELALVSGHKGMLGFEIVAKGHAAHSGYPWLGRSAISAVLPALSRVDQLGNIPADKGG
                     LPSSPKYGNTTVNIGRVDAGVAANVVPATARADVAVRLAAGTPDEARDIVRRAVRDAT
                     DGNPDVYAEFNTRSEGYPPQDLDTDVDGFDITTVNYGTDVPNLQIHEREDGPVRRYLY
                     GPGSIHVAHGDNEAITVGDLQEAVRGYRKLIEAALQRR"
     exon            complement(148890..150182)
                     /number=1
     CDS             153134..154711
                     /codon_start=1
                     /locus_tag="AO090003000059"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000007"
                     /protein_id="BAE57295.1"
                     /transl_table=1
                     /translation="MLKLSQLIDTKGRDSSEVMVDSYRQPPQSPLTNTSSTPVSPTVS
                     LFSAKGHTRFSSSVSSLVSSPGHNNSMEIASKNPLTGVKEESCGAPARDLEEDYFRML
                     LPLLPAPRFSSLFSDCTYTIVLTNTEHFDQDLSEFEGPYFASVDYSDEYDLTDAGMDI
                     PHSPKKRRSDSVSAKGLSRIGSRISTISNRWKSRQGSDGFDALDAFSMRSRTNSTSSI
                     LIGPTIVPVSRVNSVTVPPSPARTIFEERLSESGALPIDIAKANRHSQGNDDASPKAT
                     TPLLPPFMGDQPTYPVTSRVHSPLQSPSVADMSEDACDGAASRDSRLASLPSPPLSTR
                     PSISSFNRPRASTVRPASVDAPPYLLSDPNDEWANKLGHANFTIQPEPYVPEVYDLES
                     FRQLRAQWDLAQCNFTKHLVRTGEHYGITSTIYKLTEEKWDCVNSEWKHHHEMMLSQL
                     EVTEGHRLHLIESQCDPCEQIKLPRLHDEKFPELGDGEIVGPMKIAPATSGSGRCRSQ
                     SLKRNFFRFFQDLMSRS"
     exon            153134..154711
                     /number=1
     CDS             complement(join(156245..156391,156446..156585,
                     156680..156807,156858..157035,157351..157572,
                     157649..157736))
                     /codon_start=1
                     /locus_tag="AO090003000060"
                     /note="polynucleotide kinase 3' phosphatase"
                     /old_locus_tag="AO070341000008"
                     /protein_id="BAE57296.1"
                     /transl_table=1
                     /translation="MAGSVKRPASTTGTISPPPVKRKIESTLTKQSVSSFFTPASQKK
                     PEQITWRIVNNSLVVGKYAKKADHKQTIEKPKVAAFDLVGMHLLGALGRCGRLTRRRT
                     QHIPLSVYAATLDDGYRKPRIGMWKEFLDDYDFDVNGVDLSKSIYVGDAAGRPNDHSQ
                     VDRGFAVNAGVPFKTPEEFFLNAAPEPLVESFDPSLYLQSDQTDDASPPFSRQSALEL
                     VIFCGSPGAGKSTFYWDYLEPLGYERVNQDILKTDPGAEHRSCRGSQRDQEKGMLIRP
                     GQRPKCIKVAKEHLTAGRSVVVGM"
     exon            complement(156245..156391)
                     /number=1
     exon            complement(156446..156585)
                     /number=2
     exon            complement(156680..156807)
                     /number=3
     exon            complement(156858..157035)
                     /number=4
     exon            complement(157351..157572)
                     /number=5
     exon            complement(157649..157736)
                     /number=6
     CDS             complement(join(158491..158812,158874..159373))
                     /codon_start=1
                     /locus_tag="AO090003000061"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000009"
                     /protein_id="BAE57297.1"
                     /transl_table=1
                     /translation="MHELLLFASVPAHQHHELLQQLAGLTAMQPRHRLERRLIFKAYR
                     KPGLINTRVGASQDLQGNEMQRLNKMLNGGMFYTQVVGPVSEADFGAQSSAASSGDPD
                     APMSGTDTGTNFEYHPYSYENQPWKLEFRDIPEAGTRSAVTTRLMASASLPKGDITTP
                     MNAWGYSFVTEYVVEGDVFILNDIVIYLHRVLHYPAESSGSHEPRRQLPPFQQMSPLE
                     KTGSYVLQASIAVQDGGNQEMMKTASQHLFGLREQLKSAVRLEQADRLSLDTRAK"
     exon            complement(158491..158812)
                     /number=1
     exon            complement(158874..159373)
                     /number=2
     CDS             complement(163338..164594)
                     /codon_start=1
                     /locus_tag="AO090003000062"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000010"
                     /protein_id="BAE57298.1"
                     /transl_table=1
                     /translation="MSFPIGAGETNLFGINADRTPLTLDESTRTLYKRAISDPFSLTD
                     QERRLVTHRPLPEEENTLCQNACGLSMDELIAKAINSNNNDNNNNDLSLGLSNEEARL
                     LTAGVVQGQSGRILSEVARLSPEDRELKARAMEAARTEDVRAAIEVAQRVRQRWTAVQ
                     LAAAKALSNDDIRNIQVAMKVPWQEHVLQSSSTSAGDSSSGGQNPGEAGARFGLVAFY
                     QKEEEEGGGGGGGGGGGGGGVDRLSEYKSQIGTAIYHGLHYSVSLIKDETRNRFTLHW
                     VVVPGSHNNDLDPSALRTRFSTMLANNEIPIGFRRDAFLYVDKEAFDSRETARPYLWL
                     AEPESKPEYETGTTTGAQPGVLPPLKVDIKHIAPTLFARLVQRDLQGEARRKPYRYTS
                     ELSRLHAATDATREGDGIWPPPSRLQ"
     exon            complement(163338..164594)
                     /number=1
     CDS             join(165650..165782,165842..166206)
                     /codon_start=1
                     /locus_tag="AO090003000064"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070341000012"
                     /protein_id="BAE57299.1"
                     /transl_table=1
                     /translation="MSPQRCLFTKQRITSVTNSLTLKDSLQAFSSSIAGLLSSRAVLQ
                     GVGVGNADASPTAALLLHILQDTSGRISTILFAHRVGTALEPECKMYRLAADVFNDAA
                     MILDCLSPMIPAGFGRVTVLSTAGVLRALCGVAGGSSKASLSAHFSRWGNLAEVNAVR
                     FAHLV"
     exon            165650..165782
                     /number=1
     exon            165842..166206
                     /number=2
     CDS             166394..167134
                     /codon_start=1
                     /locus_tag="AO090003000065"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000013"
                     /protein_id="BAE57300.1"
                     /transl_table=1
                     /translation="MLLTMHLSLNYAAVRSVQMTSLNRQRANIVFSTLLNSDTDLDIA
                     NFNPTHETHPTPKHSKATQSQKQWQIPTPAQVSKQEKIFETDGILRWVSAPSTQHKLG
                     TCRIGVPLEQFLAPSSTRTGSGSLKTSTPISDLSSLFKSEDYLLFLHRNRQSWDARIL
                     LKTSSTTQTQLKAWMHVLLAARVLCSSAKEMRTQEIEYIMDTISKTLTFLNDGSRTDQ
                     YMSALTEAGWDLNVAALETRSGRRIACT"
     exon            166394..167134
                     /number=1
     tRNA            complement(167419..167490)
                     /locus_tag="AO090003t00001"
                     /note="tRNAscan-SE"
                     /product="tRNA-Gln"
     CDS             complement(168481..169461)
                     /codon_start=1
                     /locus_tag="AO090003000066"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000014"
                     /protein_id="BAE57301.1"
                     /transl_table=1
                     /translation="MDLSGSRPLSLTVPAGAFCPMRPTLDEVLANTAPAPYTLSAFMA
                     YLSQNHCLETLEFTLEAKRYRETYEALSQQLGEYPIGTECPESQHLRMLWQRLLTAYI
                     MPGSPREINVSSEVRDDILRQANSTIPPLPETLDAAVKLVHELMEESIFLPFLNAHSA
                     SAQVVPLAEPLFPQEDGVMVVAGPGLDEHAMKRARSKGRRLSPRSSKDFGSPTYSSSH
                     SGRSNFSLSAMTSMGKSSHRHSSHTSSGSGDCSAGLTDDSGSLQSMSTSEPMTPPTTP
                     PSSDAHGLHLAHSPKQRTDNPWKKMGMKLGFKKRSTTGSSGSNKLSGTDE"
     exon            complement(168481..169461)
                     /number=1
     CDS             complement(join(175859..175933,176023..176137,
                     176240..176346,176494..176505))
                     /codon_start=1
                     /locus_tag="AO090003000067"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000015"
                     /protein_id="BAE57302.1"
                     /transl_table=1
                     /translation="MESKGIDVTRDWPILRGLLKPSSVDHLVIVWRERGREQMMEIRG
                     DPYVHQGTALYPILAINAQRARTSTPFQKELVYTDPDLVESFWNSCKRLNLLLSGLDW
                     "
     exon            complement(175859..175933)
                     /number=1
     exon            complement(176023..176137)
                     /number=2
     exon            complement(176240..176346)
                     /number=3
     exon            complement(176494..176505)
                     /number=4
     CDS             complement(join(178799..179382,179446..179851,
                     179902..180050,180106..180175,180231..180359))
                     /codon_start=1
                     /locus_tag="AO090003000068"
                     /note="casein kinase (serine/threonine/tyrosine protein
                     kinase)"
                     /old_locus_tag="AO070341000016"
                     /protein_id="BAE57303.1"
                     /transl_table=1
                     /translation="MSSSSSNVVGVHYRVGKKIGEGSFGVIFEGTNLLNNQQVAIKFE
                     PRKSDAPQLRDEYRTYKILVGCPGIPNVYYFGQEGLHNILVIDLLGPSLEDLFDHCNR
                     RFSTKTVVMVAKQMLSRVQTIHEKNLIYRDIKPDNFLIGRPNSKAANVIHVVDFGMAK
                     QYRDPKTKQHIPYRERKSLSGTARYMSINTHLGREQSRRDDLEALGHVFMYFLRGGLP
                     WQGLKAATNKQKYEKIGEKKQTTAIKDLCEGFPEEFTKYLTYVRNLGFEDTPDYDYLR
                     DLLTQALKNAGEVEDGEYDWMKLNNGRGWEYKSYSSQQHLHNNALPNSSARELHAQQL
                     RSSQRPGVTADRLNAAQPPPPSPAKPGAGKTRERQNVQGGMPPKRQSGGMETTPTVST
                     QAQFQNSNANIPGRMGSPANPTKNSQQGPGAQGINEPQPTFVQKVMKALCCGR"
     exon            complement(178799..179382)
                     /number=1
     exon            complement(179446..179851)
                     /number=2
     exon            complement(179902..180050)
                     /number=3
     exon            complement(180106..180175)
                     /number=4
     exon            complement(180231..180359)
                     /number=5
     CDS             complement(join(183694..183772,183812..183989,
                     184357..184788,184907..185263,185320..185661,
                     185734..185839))
                     /codon_start=1
                     /locus_tag="AO090003000069"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000017"
                     /protein_id="BAE57304.1"
                     /transl_table=1
                     /translation="MAFAAINLSATKKIPAIEDAFAAEPSLKKRVYDAIGTTPQYIPL
                     FEDIAKYTSSLLVRNASAPVQPVETPTDGPAAKKRKLQNGDTAGQAQSPGDLKADAPL
                     QFYMQDISFALPQRKKLTLEITAGRGFLRARNQTSKAVEFGIHVDKIQHVLCLPVPEK
                     NQKQFNFCIIPQYGDGINSPPEGETAPEAMVWTVNDGPPRAAFSGNGQQMGSNDGQTA
                     ENVVRQMLNENLSQTKVVRPDEREFVSAMPEAHRKGEKAYHVKAFRGSKEVFFAFENI
                     DSISYTSVLQRTLNLNIVARPTSSDETQELEFSMIDQADFAGIDAYIKKHGLQDASLA
                     EARRAKRYNINGAKTGEEGAMDADGPVEEESELQKAQRELDDEEDEDEEDYDPGSDDS
                     NDGSGSSSEEDSDEDGDEDEEPFQGGMVCGFQPPGSAPLPYKKIHARAVWWVTYVSGG
                     AFQCFGWLFNCICRLLLCISPSAIHYALTVSPKTPRFVVTRICILRR"
     exon            complement(183694..183772)
                     /number=1
     exon            complement(183812..183989)
                     /number=2
     exon            complement(184357..184788)
                     /number=3
     exon            complement(184907..185263)
                     /number=4
     exon            complement(185320..185661)
                     /number=5
     exon            complement(185734..185839)
                     /number=6
     CDS             complement(join(186276..186911,186983..187399))
                     /codon_start=1
                     /locus_tag="AO090003000070"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000018"
                     /protein_id="BAE57305.1"
                     /transl_table=1
                     /translation="MQKVIRRTALARNQAQRKAVRAVKDAEREEFKDHLRQRFALNRI
                     ELDNIRAERQRRREDWLRGPLAPQRDAGFEGQSFGALSPQAMNPPPIPKHLRRKYINI
                     AVGDRVCIMKGRDKGKINEVVRVDTSNETVNVRDLNMNDVHLPSWINSQYGNKGTVNA
                     MALPIPIDDVRLVVALDDPATGQTRDVLVEHVHGGEPILEREHGTETPRHTRYISGEN
                     IEIPWPRREPPVLNDEEWDTLRMEVETPTWTPSLHYAPFPPSVLDELRNKFSKYRTRH
                     DPEWVEAKKMEDYRKEYLQSRSLLTPKGELIAMIQAKKKERLDARRDANGNMLMDDQT
                     AGFIENFLKEKVANKA"
     exon            complement(186276..186911)
                     /number=1
     exon            complement(186983..187399)
                     /number=2
     CDS             join(190997..191064,191141..191168,191254..191451,
                     191553..191687,191729..191893)
                     /codon_start=1
                     /locus_tag="AO090003000071"
                     /note="Ras-related small GTPase, Rho type"
                     /old_locus_tag="AO070341000019"
                     /protein_id="BAE57306.1"
                     /transl_table=1
                     /translation="MAEIRRKLVIVGDGACGKTCLLIVFSKGTFPEVYVPTVFENYVA
                     DVEVDGKRVELALWDTAGQEDYDRLRPLSYPDSHVILICFAVDSPDSLDNVQEKWISE
                     VLHFCQGLPIILVGCKKDLRNDPKTIEELTKTSQKPVTAEQPCFQGEEVRKKIGAYKY
                     LECSARTNEGVREVFEAATRAALLTKTHKKKKGCTIL"
     exon            190997..191064
                     /number=1
     exon            191141..191168
                     /number=2
     exon            191254..191451
                     /number=3
     exon            191553..191687
                     /number=4
     exon            191729..191893
                     /number=5
     CDS             complement(194037..195311)
                     /codon_start=1
                     /locus_tag="AO090003000073"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000021"
                     /protein_id="BAE57307.1"
                     /transl_table=1
                     /translation="MCPSHHLIQQLRRAHSIFLLHHDITLDALYKRVGRSTFCPLLEN
                     FWLRFAWNWDILLSGNPAVDVYNGIKLSAGGELGIGVGEEEWGSGEREVFEDFVARTD
                     GLVDLVVSRFGDPNTLGESAATANKSADTTRDDDETHWLGLDTYPRPSDGVIFSGVGT
                     ISRSSVVRISQWMEWIYKYGIDAYGVGEDPTSPRRRKHRRRQRGRPRRDANAMTQARG
                     NSQSRDTDGSFSPGIPRPLVVGTTQSTQPPQGPDGVSLQSSGETSPARSDKGSDWMGV
                     TTGTFVKYLTLGYGSSWSMSRTPSAHPRVEALKREDDSASSNKQTGPPTDGQEGSEES
                     PSVPEDPPKPESRGKFLIGLKNEKAKRDSKSLETDPTIKKSRDRITQRTLHMYLANPS
                     EDNPSGQSYTAPLLLISVLKPIDLQAQYNNEQ"
     exon            complement(194037..195311)
                     /number=1
     CDS             join(196028..196080,196672..197413)
                     /codon_start=1
                     /locus_tag="AO090003000074"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000022"
                     /protein_id="BAE57308.1"
                     /transl_table=1
                     /translation="MLWQLPRHVSSAGPRGALFRGPAPLHHTLLAGRTRTGVTLQTLD
                     LKDFDHGVILQQTPSPGFEIPNPESCTVPELLNLVAPKGAEILVDGIRKGLFVPPVHD
                     AGWRSPEEHESLIHAAKIKPEDRHIDWANWTWLDISRRIRVLGPLWSKALVINDATAN
                     PSSFQYRRVIFTEMEEVEPMKGSEAYAVVPGLPFVDGAHPIESRQGKGVYVFTQDGKL
                     LRINQMKVEGEQNADALRAALKARMVGGRTFSSNGSDYTPFYNPLQ"
     exon            196028..196080
                     /number=1
     exon            196672..197413
                     /number=2
     CDS             join(199166..199291,199364..200200,200257..200313)
                     /codon_start=1
                     /locus_tag="AO090003000075"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070341000023"
                     /protein_id="BAE57309.1"
                     /transl_table=1
                     /translation="MAPLFAKRLTCFYCGRRSAQTEKGSIRKWRCNACEAINYLDEKG
                     QIADPPAADTNPNVYGSDVSSTPFESTDITGSGLFCAQCIRNQHLFTSALAAYFPPTD
                     DPNYGAYEQEYPKFRKNLEERYPQVCAKCEPRVKDRIRQAGYEAKSDHLRRMMDRSKA
                     GRAARHARKWNWRSLLLYAGAMTYWASVAGQLSWNLVGALATDELLRDPDDLLTPASI
                     VKCVQQTLETRRMPSYCFVDLAPYAGLSLVAGIISAWYNPKLRFKVEGRAGRFVGLGE
                     YYQVQLIVMVVRCVFWALLRDPSANGLQSNLPPTLHTFMFIFTALSSLFYSLGALRSM
                     TLALW"
     exon            199166..199291
                     /number=1
     exon            199364..200200
                     /number=2
     exon            200257..200313
                     /number=3
     CDS             200520..201854
                     /codon_start=1
                     /locus_tag="AO090003000076"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000024"
                     /protein_id="BAE57310.1"
                     /transl_table=1
                     /translation="MDWTPSVQHNVTPTVSVHQRERKSVLDGPLPFYGSLPAAPKPPS
                     WNLRNQPVQRQKPIEQVVERNPFHRTPAQPSSPWARNNGPFDTAFAPPKFFPMSDHAA
                     STGLESLFDKAFTIKSPEDEDHGAWQSQQQTTNTRPHQSVDLHSYFIFQYLRLGLLLS
                     SIAAWLVSQYGHISLPGDCIEVASLGSASLIAGFALLEALKQPLAQWNGMEILVYFAE
                     LVAAVHLGGNLPHVSYERHYFDRYGKLLLIFMTVQEALGLLSLYRFSSAISSGQVPQA
                     NQNQPPPAGLPSTSPRLENSSGQGLQSVTTQQSVPPLSFSSTVTGSSFSAQTPEARRH
                     HHFPSYDGGHQDYSFSLKSLKGDESDVSDPLDRDSDTETTVTTATTATNATIRNIRYG
                     RSGSDAFLSPRRSELGPGIGGLSLDDEPSRRMTRSQTQKLRRFPGRGNVRTK"
     exon            200520..201854
                     /number=1
     CDS             complement(join(203814..203962,204041..204114,
                     204203..205186,205248..205472,205537..205613,
                     205662..205757))
                     /codon_start=1
                     /locus_tag="AO090003000077"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070341000025"
                     /protein_id="BAE57311.1"
                     /transl_table=1
                     /translation="MSVILRRLVHNEAMREDPKEIYGWRVYMLACSACFGGMLFGMET
                     GIIGGVLTMDPFQVKYGLKNLGDIGEANLSANIVSTLQAGCFFGALIASPVADKWGRK
                     TGLISASLIAIVGVIMQVAASGHLEAMYIGRLINGFGVGFASMINPLYVSENAPRAIR
                     GGLTGLYQLFITMGIMLAFWINYGSSLHIKGTAQYMVPLAMQALPALLMLVGMLLCNE
                     SPRWLAKQDRWEDARKTLSRVRNLPSTHQYIENEFQDIVNQLEHERQLIGGSGFWDLM
                     KEMWLIPGNRKRAMISIFLMVCQQMTGTNAINYYAPQIFENLGITGTTTGLFATGVYG
                     IVKVVACAVFLVFVADSLGRRRSLLWTSVAQGLAMLYIGLYIRIAPPVEGQPVIPAGY
                     VALVCIFLFAACFQFGWGPVCWIYVSEIPTARLRSLNVAMAAATQWLFNFVVSRAVPN
                     MLATVGANGYGTYIIFACFCFSMGVWVWFFIPETKGLSLEKMDELFGATSSDTHLKTE
                     DVERSASQVEGDHKDEVATETRVERV"
     exon            complement(203814..203962)
                     /number=1
     exon            complement(204041..204114)
                     /number=2
     exon            complement(204203..205186)
                     /number=3
     exon            complement(205248..205472)
                     /number=4
     exon            complement(205537..205613)
                     /number=5
     exon            complement(205662..205757)
                     /number=6
     CDS             join(208568..208623,208674..208715,210346..210783,
                     210853..211151,211217..212373)
                     /codon_start=1
                     /locus_tag="AO090003000079"
                     /note="uncharacterized protein conserved in bacteria"
                     /old_locus_tag="AO070341000027"
                     /protein_id="BAE57312.1"
                     /transl_table=1
                     /translation="MAPVLKKYKAAAVNAEPGCWKGWLQVHCFPRAFRSPFRTRRDFQ
                     DACRALLDPLVPRFTAGCSRVKIGSSTTRFDEGGAQIEGFARPLWALAALLGGGYQYP
                     EAVRWYQGLINGTDPHSPEYWGDIEDLDQRMVEMCPLGFALAVAPHVFWDPLTIQQKH
                     NVANWLASINEREMPNTNWLWFRVFANLGLRRNGAPYSLPRIEADMDHLDTFHVGGGW
                     SNDGPKSHHQMDYYSGSFAIQFLQLLYSRLAADFDPQRAERYRERARQFALDFVYYFD
                     ADGAAIPFGRSMTYRFAMAGFWGALAFADVAPPAPLTWGVVKGLLLRHFRWWATQEDM
                     FSSDGTLNLGYSYANMYLTENYNSPGSPYWCCLSFVPLVLGETHPFWAAKEEPYPIAS
                     LSPVAALQYPKHIVVHRGGHSFLLSSGQACHYPLKATQAKYGKFAYSASFGYSVPTGS
                     YQLEQHAPDSMLALSEDGGDIWQTRRLAINARIEYHDDTPVLASSWKPWSDVEVETYL
                     IPPHEESENWHIRAHRVRTGRDLMTSEGAFAIYGCRSDNGRILGPLAERPSEGTLQES
                     QKALTVSSVGVVGIVELQPGVDRAGRVVLADPNSNLMYGRTLLPSLGADLPSGSERWF
                     VTAVFALPAHGDGDAWRQKWERLPVIPEWLKRVMESGGQ"
     exon            208568..208623
                     /number=1
     exon            208674..208715
                     /number=2
     exon            210346..210783
                     /number=3
     exon            210853..211151
                     /number=4
     exon            211217..212373
                     /number=5
     CDS             complement(join(212550..212804,212858..212965,
                     213037..214020))
                     /codon_start=1
                     /locus_tag="AO090003000080"
                     /note="lipoate-protein ligase A"
                     /old_locus_tag="AO070341000028"
                     /protein_id="BAE57313.1"
                     /transl_table=1
                     /translation="MRPPRRGSCLLSSLRTPTWLAPALRPVFVRYNSSFSSDQFAQLA
                     RRESSQHQIYQSFSTNPYVNLSIEHFLLENAPPDSSILFLYINQPCVVIGRNQNPWHE
                     TNLLALQNDREPITREKNDNGALLVRRRSGGGAVYHDEGNLNYSVISPRTTFTRNKHA
                     EMVVRALHRVGATNTSVNDRHDIVMSTGQPQPRKISGSAFKLTRHRALHHGTCLLDTP
                     NINRLGSFLRSPARDYIKAKGVESVRSPVANVSSVFVDAMMPFSIERVMASIVEEFAQ
                     MYQVDADAVRRAQRAHVLEPELYAGDTWVAGAVGESQGYGEPDIKKGIDELMSLEWKY
                     TQTPQFIFSTYPIEDDPRERLPLPSTLPPATRVFLRLKHGAIIESHISTSGDASEASE
                     QAARVHEALNGRKLHEITPAQWREVLLDRLGADVEDKSLVELAKFIGSKLGWDTSS"
     exon            complement(212550..212804)
                     /number=1
     exon            complement(212858..212965)
                     /number=2
     exon            complement(213037..214020)
                     /number=3
     CDS             join(214447..214481,214546..214907,214975..215816)
                     /codon_start=1
                     /locus_tag="AO090003000081"
                     /note="chorismate synthase"
                     /old_locus_tag="AO070341000029"
                     /protein_id="BAE57314.1"
                     /transl_table=1
                     /translation="MSTWGEYFKVTTYGESHCRSVGCIVDGCPPGMELTEADVQPQMT
                     RRRPGQSALTTPRNEKDRVEIQSGTEFGVTLGTPIGMIVRNEDQRPKDYGGSTMDLYP
                     RPSHADFTYLEKYGVKASSGGGRSSARETIGRVAAGAIAEKYLRLSHGVEIVSFVSSV
                     GNEHLFPPTPEHPSPATNPEFLNLIENISRETVDSFVPTRCPNQEAAARMTKVIEQFR
                     DNQDSIGGTVTCVIRNVPVGLGEPCFDKLEAKLAHAMLSIPATKGFEIGSGFGGCEVP
                     GSIHNDPFVVSDVETRTGTETTTKQRLTTKTNNSGGIQGGISNGASIYFRVAFKPPAT
                     IGQAQTTASYGLEEGTLEAKGRHDPCVVPRAVPIVETMSALVIMDALMAQYARESAKN
                     LLPPLPKTIPTHPTVKPGSA"
     exon            214447..214481
                     /number=1
     exon            214546..214907
                     /number=2
     exon            214975..215816
                     /number=3
     CDS             complement(join(217043..217169,217225..217586))
                     /codon_start=1
                     /locus_tag="AO090003000082"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000030"
                     /protein_id="BAE57315.1"
                     /transl_table=1
                     /translation="MNVFVALFLVALMGCPLAQAMPINGGMAHHFQPSLSAHAGLAVG
                     LGVGMPFLCLVAIFIWRYNKNAKREENRARDEWLRDLSLTTQRRIFWSPLETHLACHI
                     KRPVMAEKDPGSVQKPPKCVVKDGRLLLCACHQPRTHDAEIRRAEIRHSVGAGGMYTI
                     LE"
     exon            complement(217043..217169)
                     /number=1
     exon            complement(217225..217586)
                     /number=2
     CDS             complement(join(217931..217995,218330..220706))
                     /codon_start=1
                     /locus_tag="AO090003000083"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000031"
                     /protein_id="BAE57316.1"
                     /transl_table=1
                     /translation="MNAFVTLLVALFLGYQVSAIPYIPSHLLYSAQYNGSMAYLLRPS
                     ANYTTEFLSLNVSQDIDSAKPQYTTLLDHAPFQLDKQTPALIPAIDQHGIVKVYVGDC
                     HNTSGYGALWQFTPDAASSTGNGTWERIEVNGTGQSNVSPHGPNYLAAGFTYASTNIT
                     NTSFYAFGGMCPLASASEATWITAANYSQSMIALEPPKADGLTSYRISATGDRAPPIP
                     EAGFTITPLQATYRSTSSGTLLQQQDFLMIGGQTQNAFINMSQVAVFSLPQSSWSFVT
                     IDSTQSLGRTELAIRDSSVVEPRSGHTAVLSPDGSKVVVFGGWVGSTSIPANPQLAIL
                     ELAAESTGAEWAWKIPSTRDAGVAEGTGIYGHGATMLPGGVMMIAGGYHIAQPSKRSV
                     TGTEVNSEILLYNVTSGKWVSSYSNPGPLQPDGESRSSVSRRTGLGVGLGLGIPCVAG
                     AAVFLWFYFRRRRVRRTRNQMLRELSLGAERSIFWSPEESHLAGSTYKPSQIMAERTG
                     LLREIPSPTETNRLPLNARIYRPPAQCNEYRRSDGTGDMHPIDEEDEAHGAVGGDSTG
                     LLQKMTRTELSLEGATEFATSIGRPSEGQSSEHADRTYSNISDFSRLAGHPSRGTIDN
                     HPSHPSTGRESPEKSSSASNQSRETWSRPNSTVISHERRSSDSFSTAHTTISQRQAEG
                     EHLLPNDPEPSSPIDLIPRPLSISKPKAEWIGNVRRVLSMTRKRPQSSGDGSVASTAS
                     GIDRRSAVLGSAGPLFDYEPESKLPRRSVSASAELFRRKQGAKDWGTGNIVSHPTGSP
                     EAGAVVLCNGRSNGP"
     exon            complement(217931..217995)
                     /number=1
     exon            complement(218330..220706)
                     /number=2
     CDS             complement(224967..226736)
                     /codon_start=1
                     /locus_tag="AO090003000085"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000033"
                     /protein_id="BAE57317.1"
                     /transl_table=1
                     /translation="MWLHRSGYHPPNETMAIHCRRRYRLLPSKNPNPNMPPPDPSLWI
                     VHYSRAPPTEHIPANRIHVLPQVQSMLGQRRFLQSQGQLARKDFMLHDRNNWPTINFP
                     PQVAPQGFAQVPPAYPSAMVGRQPFYPQPGSGVPAPAGGAPAKAPRGHRASSAAVNAA
                     TADFALEDEDVSAGDMMDLLTPREVSKMRYQQHHEWMEEIFASPYAISQITPVSLGLG
                     RKGELESLTAGFFDAPSGPTSGESKDAADSAQATKMEPAKAEEFADRVAKKVADMTAE
                     IEKLKKRHARRMEKFNRTSLLKDAELRLREAAADPNATGTEIWRLEGRIEIPSEGDET
                     QTPPASEPKAKYRVDDVVKELETSWKKQIVPEPKVSCVQKGGLLEKIEPEQKLEAPAD
                     GDIDMGHADSHLLDQFGSPPPSGPVQGSAPIAQELAAPAHVPGVSEVPGINAPAPLQT
                     TAAVPQQSVTMSGMDVEMDMGNAPPANTAAGETGDWVMVNDEKKDQGDKPAVGDAPLH
                     GIETPGSGLQGLTPGNTGGDTGLDGANFDFTNMDSAGDALAAYTEQNEVLDLPDLENS
                     AFGDAFHASDNENTHHHDADDMA"
     exon            complement(224967..226736)
                     /number=1
     CDS             complement(join(226796..227080,227304..227380,
                     227504..227621))
                     /codon_start=1
                     /locus_tag="AO090003000086"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000034"
                     /protein_id="BAE57318.1"
                     /transl_table=1
                     /translation="MAENLGQDALDIPHRIVNVKDFSRSHDPYIRALPHFTNSRTSNF
                     RVAFAKAFARCVHSFHCLFPTLPHMHLVSRHRFPLMHMMPTDTVVEYLLGAPKIVREA
                     QPMHWTFLDGPQDGTVMLTWQPLNHLGTNFASDGYVWADVEQAFTFEARGYVGRPDL"
     exon            complement(226796..227080)
                     /number=1
     exon            complement(227304..227380)
                     /number=2
     exon            complement(227504..227621)
                     /number=3
     CDS             join(230025..230283,230349..230665)
                     /codon_start=1
                     /locus_tag="AO090003000088"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000036"
                     /protein_id="BAE57319.1"
                     /transl_table=1
                     /translation="MGFTSINAQGLTAPPYFASFLVTIATTWIADRLQQRGLMLVILS
                     LIGAVGYVLLAVCTSVGARYAGVFLAAIGVFPCIANILPWALNNQGSDSRRGMGIVIL
                     NIIGQCGPFLGTNVFPESDGPRYIRGQSICAAFMFFTMILALTLRTLLVWENRRLDKQ
                     HGTQAEREARGWNKGENVAEENYGAGFRYVL"
     exon            230025..230283
                     /number=1
     exon            230349..230665
                     /number=2
     CDS             join(231170..231225,231276..232920)
                     /codon_start=1
                     /locus_tag="AO090003000089"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000037"
                     /protein_id="BAE57320.1"
                     /transl_table=1
                     /translation="MAYASESNAYLYGIVDMGSNGIRFSITDIPPHTARTMPTVYQDR
                     AGISLYDAQFSGGSRGPIPQDIIEQVVDRLVQFQITCYDFGVPPQNIYVLATEATRTA
                     PNSEEFRARIKDRTGWEVRLLSKEDEGRIGALGIASSASSAAGLAMDLGGGSTQITWV
                     VEKDGVVTTSPKGSFSFPYGAAALTKRLEQAKAEGKKAEKALKQEMIKNFQEAYRALE
                     VPEFLLETAKSLGRFDLYLCGGGFRGWGYVLMKQHKVDPYPIPIINGFRVRREDFHDT
                     VSVLNSVSDSDEKIFGVSKRRASQIPAVAVLVNVIMDALPDITHIQFCQGGVREGFLF
                     DLMPQEIRAQDPLLAASLPYASPSNAAIRGLLTAALPSTSSPMESRHAPVSFTPQLLG
                     ALANLLFAHSRVPRESRSAVALHSTTTGILASVNTLSHTERALIALILCERWAGDLAP
                     TDEEFHRQLSRCVSKQEAWWCQYLGRVATLIGDVHPSGRVSDMHWRIRLETEWESIVK
                     KKDECDMLRLKVKCNNDVAVAAFSLDSLQERAEKVEKVGKKKNWIKDYGVRVGVTIIC
                     "
     exon            231170..231225
                     /number=1
     exon            231276..232920
                     /number=2
     CDS             join(233776..234112,234171..234817)
                     /codon_start=1
                     /locus_tag="AO090003000090"
                     /note="protein involved in thiamine biosynthesis and DNA
                     damage tolerance"
                     /old_locus_tag="AO070341000038"
                     /protein_id="BAE57321.1"
                     /transl_table=1
                     /translation="MSPPAAIYEPTVAATGLKGKVVVSETAPVEGASQTKLLDHFGGK
                     WDEFKFAPIRESQVSRAMTRRYFEDLDKYAESDVVIVGAGSCGLSTAYVLAKARPDLK
                     IAIVEASVSPGGGAWLGGQLFSAMVMRRPAEVFLNELGVPYEEDANPNYVVVKHASLF
                     TSTLMSKVLSFPNVKLFNATAVEDLITRPTENGNPQIAGVVVNWTLVTLHHDDHSCMD
                     PNTINAPVIISTTGHDGPFGAFCAKRLVSMGSVDKLGGMRGLDMNSAEDAIVKNTREV
                     TKGLIIGGMELSEIDGFNRMGPTFGAMVLSGVKAAEEALKVFDERQRECAE"
     exon            233776..234112
                     /number=1
     exon            234171..234817
                     /number=2
     CDS             complement(235073..236503)
                     /codon_start=1
                     /locus_tag="AO090003000091"
                     /note="sphingomyelinase family protein"
                     /old_locus_tag="AO070341000039"
                     /protein_id="BAE57322.1"
                     /transl_table=1
                     /translation="MSAQSTVYPSEAPSQIRIFTLNCWGLKYLAKYRHERLSEIGRQL
                     ALADPAPEIVGLQECWTQQDYESIREQTRHLLPYGKFYFGGVMGAGLAILSKWPIEES
                     SMYGYPLNGRPTAFFRGDWYVGKGVACARVRFGPGASDVAEVFCTHLHAPYEKEPNDS
                     YICHRTAQAWEIAKLMRGAAERGHLAIGLGDFNMVPSSFAHQLIRAHSPVQDVWQAIY
                     PDSSVAAPIDPIEQKRGKPTPSAEFNLHVNGATCDGKFNTWRWTKEERKRLEKGEEIA
                     VDKDAPCPRGKRLDYIFVGDGGYPPAFPAPQWSVESVNIGMTQRHPTLRCSLSDHFAV
                     EATITRSPRPSEADNLTDNKLRQSVVPNTALSPDTYDRIIDMIHTYVQRERSQRRWRL
                     AHFIISVFVSIGCFVGVWWTGDLPYVAFILVLVSTLSFGAGILDGLIGGLFMSSELRA
                     LKEFEWEVRNAKELVEKSGGTGQKLE"
     exon            complement(235073..236503)
                     /number=1
     CDS             join(236832..237399,237454..237617,237676..238557)
                     /codon_start=1
                     /locus_tag="AO090003000092"
                     /note="WD40 repeat-containing protein"
                     /old_locus_tag="AO070341000040"
                     /protein_id="BAE57323.1"
                     /transl_table=1
                     /translation="MDGNNHRSKRRRLDRSPSHENGYIQSPVESSSDELAAGSDHDEA
                     ERRRASWTLQKALPPKRPNTRLRSFSGSESPDELAVDADVYWRSRNRGRNSSPSEVSA
                     AGPSSEHYQDEEEVDADVDDNESPMEGDAEPEQAYSDRSPTPVPPPPPPPPPKPDKIN
                     YQQKFLLRGHLRGVSAVRFSPDSTMIASGGADGAVKVWDTLTGRLVHTFEGHLAGIST
                     ISWSPDGAIIASGSDDKTIRLWNVLTGKAHSIPFVGHHNYVYQIAFSPKGNMLVSGSY
                     DEAVFLWDVRSATVMRSLPAHSDPVGGIDVVWDGTLIASCATDGLIRIWDTATGQCLR
                     TLVHEDNPPVTSVKFSPNGKFVLAWSLDDCVRLWNYVEGRCIKTYQGHVNRKYSLSGG
                     FGTYGVRGAPPHAFAVSGSEDGAVLCWDVVSKKTLQRIEGHTGVVLGVDTCTLGDKRL
                     MVSCGIDQTVRVYEEVEEDGRMETDAKESPPAINGTGPNGTEPNGILPNGTTQNGAEG
                     HDTSEQQDTGDTQEPQDTEMADADTVPEG"
     exon            236832..237399
                     /number=1
     exon            237454..237617
                     /number=2
     exon            237676..238557
                     /number=3
     CDS             complement(239415..240482)
                     /codon_start=1
                     /locus_tag="AO090003000093"
                     /note="hydrolases of the alpha/beta superfamily"
                     /old_locus_tag="AO070341000041"
                     /protein_id="BAE57324.1"
                     /transl_table=1
                     /translation="MKMMGSGIAALGLMTIVNTMSAMAQNMSFGADNFYRSDSVTVQP
                     ITFENQYRMKIGGNLFIRNNFTRSVNAPAIIVGHPMGAVKEQSANLYATKLAEQGFVT
                     VSLDLSFWGSSEGEPRNGVSPDLYAEAYSAAVDYLGTQDFVDRERIGALGICGSGGFV
                     ISAAKIDPRIKAIATSSMYDMGASNRNGLQKSQSLEQRKEVIAEAAQQRWTEIEGGEI
                     QYTSGTPDELTADTPAVGREFYDFYRTPRGEFTPEGTTPNLTTHPTLSSNVKFMNFYP
                     FNDIETISPRPLLFISGDQAHSREFSEDAYARAAEPKELFWVPRAGHVDLYDRVDLIP
                     FGKITQFFRQNLSKRASRRAN"
     exon            complement(239415..240482)
                     /number=1
     CDS             join(243361..243365,243413..243442,243862..243968,
                     244062..244225,244284..245297)
                     /codon_start=1
                     /locus_tag="AO090003000094"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000042"
                     /protein_id="BAE57325.1"
                     /transl_table=1
                     /translation="MTALILPLHEHGAYEKAGRERVSTAKELSDWGEATEDDAVSDIT
                     DKLENSVQPSRNHRAKIQDDIAKLKIKDPESIRLETLEQELVRAEAQSLVAEAQLTNM
                     TRAKLKEAFDIHLAAVIERGEKQILLARHARRLLGILDDSPVVPGEPRKDYDRGDEAS
                     QIIQDAERGLRTWESTTVPIPTSAGHLHDSTLLPAPAARAARDSQALTVGSSEVDGRE
                     MSASTRDINGSASDIRYTEEYPPETQGTNEYVNEYGSGTQQGIAPVIEAQEFQEPVTA
                     PVEPTRDTYSAPGNAITYIPGTKQRVDTATGAEGYGESSIQGARGMYGATPDVTGYTP
                     GAQDTIPGTKEHVGPISEARSWDASVTDVSGDVNENVASGRSIDDSVSITDPTQHFEE
                     PSTELTEGTEATKMTEATDDANGSIREKLQEQPQAALGIPQVVAVPY"
     exon            243361..243365
                     /number=1
     exon            243413..243442
                     /number=2
     exon            243862..243968
                     /number=3
     exon            244062..244225
                     /number=4
     exon            244284..245297
                     /number=5
     CDS             join(245708..245839,245997..246104,246160..246315,
                     246405..246453,246519..246628,246701..247036)
                     /codon_start=1
                     /locus_tag="AO090003000095"
                     /note="20S proteasome, regulatory subunit beta type
                     PSMB5/PSMB8/PRE2"
                     /old_locus_tag="AO070341000043"
                     /protein_id="BAE57326.1"
                     /transl_table=1
                     /translation="MDKLVAQYSRPAHQNEMYSEQEQHDLTESLPPLSLKFNLPPVDN
                     SRSWLRAMTDDHSNPSCPIKLAHGTTTLAFRFQGGIIVATDSRATAGNWIASQTVKKV
                     IPVSRLSRGEDKANNAPTPGLLGTMAGGAADCQYWLRYLSQQCTLHEIRHKRRITVAA
                     ASKILANLTYAYKGYGLSMGTMLAGMTPQEGPALYYIDSDGTRLPGNLFCVGSGQTFA
                     YGVLDANYRYDLTEEEALELGRRSILAAMHRDAYSGGFINLYHVKEEGWVHHGFDDMN
                     PIFWKTKLEKGEFSNVTSEL"
     exon            245708..245839
                     /number=1
     exon            245997..246104
                     /number=2
     exon            246160..246315
                     /number=3
     exon            246405..246453
                     /number=4
     exon            246519..246628
                     /number=5
     exon            246701..247036
                     /number=6
     CDS             complement(join(247504..248276,248338..250777,
                     250849..251349))
                     /codon_start=1
                     /locus_tag="AO090003000096"
                     /note="RNA polymerase I, second largest subunit"
                     /old_locus_tag="AO070341000044"
                     /protein_id="BAE57327.1"
                     /transl_table=1
                     /translation="MAPAKTDTNWSVNYDVLRREHLFKNPPKDRTAYPALAASIKPHV
                     DSFNALFEDSKILQAGLKDIGTKTFIDGEAETPEQKKARQAEGRKAPKRNKLHVRIKE
                     VFLEKPAIPPTNKFTTRNRNIYPSECRERHATYRGKLRARIEYRVNNGDWMEAVRELG
                     QVPIMMRTNRCHLEKATPAELVEHKEESEELGGYFIVNGNEKLIRMLIVGKRNFPMAI
                     VRGSFVKRGHTYTKFGVQIRSVRPDQTSQTNVLHYLSDGNVTFRFSWRKNEYLVPVMM
                     ILKALVETNDREIFEGLVGSASSEGINNTFVTDRVELLLRTYKGYNLHSRSACRAYLG
                     EKFKPVLGVPMDMSNEEAGTEFLRKVVLPHLGNQNVTETQDYDKFKLIMFMIRKLYAL
                     VAGDCAPDNPDAVSNQEILLGGFLYGMILKERLEEWVRSFGPILRDWSMRNHGAKFTD
                     PSFERDFLSKVVKRSNENIGGALEYFLSTGNLVSPTGLDLQQTSGYTVMAEKINFYRF
                     ISHFRMIHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLLNHLAHKCLISTS
                     DIDVSHLPRLLVQLGVRSESSVSLEESVTVQLDGRIVGFCSPKQARMIADTLRHWKVE
                     GSHNVPRELEIGYVPNSNGGQYPGIYMFSQAARMYREVKYLPLDKLDYVGPFEQPFME
                     IACLPSDLVAGISTHIEFTPTNILSIVANMTPFSDYNQSPRNMYQCQMSKQTMGTPGT
                     AIDYRTDNKLYRLQTGQTPIVRPPLYNAYGLDNFPNGTNAVVAIISYTGYDMDDAMII
                     NKSSHERGFGHGTIYKTKVHSLDEKESRRNKSRREITKLFGFAPGGEIRAEWRNTIDE
                     DGLPHIGARVKEGSLVAAYHNVRYDAASDSYVNVDGITHFVKYKDAEEGYIDSIRIMG
                     AETGIEPCQSLSVKYRIPRKPVIGDKFSSRHGQKGVCSQLWPAVDMPFSESGIQPDLI
                     INPHAFPSRMTIAQMIESMAGKAGALHGHPQDSTPFQFSEENTAADYFGHQLRKAGYN
                     YYGNEPLYSGITGKEFAADIFIGVVHYQRLRHMVNDKFQVRTTGPVNSLTGQPVKGRA
                     KGGGIRVGEMERDSLIAHGAAFILQDRLMNCSDTQRAWLCRDCGSFLSTQVALAGGSG
                     KARNQGAAAAAAKAASSQLTQASGSSGIVRCRRCAREAVFDDSRAITWEDGDGRRYVG
                     GDNVTVVAVPGVLRYLDVELAAMGIRMKFKVDN"
     exon            complement(247504..248276)
                     /number=1
     exon            complement(248338..250777)
                     /number=2
     exon            complement(250849..251349)
                     /number=3
     CDS             join(252697..252746,252803..252951,253077..253179,
                     253239..253310,253382..253655)
                     /codon_start=1
                     /locus_tag="AO090003000097"
                     /note="GTP-binding ADP-ribosylation factor-like protein"
                     /old_locus_tag="AO070341000045"
                     /protein_id="BAE57328.1"
                     /transl_table=1
                     /translation="MAGIFRTIYDWLLRMFCSPARPRKNKKRFGLLSAVLCISKLQGD
                     GDGCHHDRASKCRKIVAFAGACAVRVVISLANPPHSSIPTIGFNTKRVQKGHVTLKCW
                     DLGGQPRFRPMWERYCRGVNAIVYIVDAADRAALPVATDELHELMDKPTLEGIPLLVL
                     GNKSDLPNKLSVDELIDAMDLKSITHREVSCYGISAKEETNLDAVLHWLIAKASR"
     exon            252697..252746
                     /number=1
     exon            252803..252951
                     /number=2
     exon            253077..253179
                     /number=3
     exon            253239..253310
                     /number=4
     exon            253382..253655
                     /number=5
     CDS             join(256016..256044,256121..256237,256311..256605)
                     /codon_start=1
                     /locus_tag="AO090003000098"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000046"
                     /protein_id="BAE57329.1"
                     /transl_table=1
                     /translation="MGVIHARRECGYNSWGDWVCRPSSWYDWGRWVAFAVIVGCAFII
                     FFLFACHNARRRRTRGLQPHPGTAWLAGPPPYGQQHQQHPYYADPHYQQQPPPQYTPQ
                     PQTYGYFGGQQTGIELQSPPNAYHNGPDRAYQPPPGPPPNGRKV"
     exon            256016..256044
                     /number=1
     exon            256121..256237
                     /number=2
     exon            256311..256605
                     /number=3
     CDS             join(258348..258647,258737..259723)
                     /codon_start=1
                     /locus_tag="AO090003000099"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000047"
                     /protein_id="BAE57330.1"
                     /transl_table=1
                     /translation="MSPVDTTPFPIWPRDFVSDLKSAPETLSSWDNCMAKSYCKYVAL
                     LFPSSNSISDPDATDGPSSLRSLLVRSLLSPFWRALSIACVAASNVANAVDAVHAAPP
                     APPSLPTYRGAQVARFDTPPSPAVSKGNEDALPAMPTWDSAVTKRVDDTDHHQDAMEM
                     EPLNLANQRPRRMPSAPRPNGAGYMGPPPVRTGTAVTSSSFYPDDQSAYHARSPGGPS
                     PISPYEQPYGDYSQAYGSQPHYMPIGTAVSPSAEAGPAPYRHPSPAITQTPGMALSTD
                     GARPIPYRQPSPAINQSPINRTMSPANVAPPYRALTPANANPAYRTMSPPTQEPVYRA
                     MSPPSHEAAYHAMPPSHEPAYQAMPPPGSEPTYRAMPPSFNAEPAWNTSPSIPSSPPP
                     PFTSSPAPHETVQDSGRPPTLLQSGRKPVPNSFRDV"
     exon            258348..258647
                     /number=1
     exon            258737..259723
                     /number=2
     CDS             complement(join(260580..262215,262273..262286))
                     /codon_start=1
                     /locus_tag="AO090003000100"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070341000048"
                     /protein_id="BAE57331.1"
                     /transl_table=1
                     /translation="MASKIIVIGGVNCQLREVFTKLAKLHVKQSFSFAIVVGDLFGDC
                     STEQELDEISALFQGSISVPLPTYFTLGSRPLPTRVIERIEANDEVCPNLYFLGKRGT
                     LKTSEGIRLVALGGYLETESQSSDKYHPGYTESDARALYGAHSADILITHQWPKGIRT
                     RSQVPIPDEATKPEEVQCIADLSSTLKPRYHLSSAPEFFYEREPFFHMPPEDNPDAKP
                     LTRFISLASYNNPSKQKWMYAFTLDPKTPHPLTIPTGATASPLAPVLTKRKPLSSQKE
                     SYSRFAIDDEGSNRPRKRARGPPPGPDQCFFCLSNPNIATHLITSIGNEAYLTTAKGP
                     LPTSKTFPTLGFPGHMLIIPFTHTPTLSSIPDEDSRLATYKEMHRYRQALHSMLKSKT
                     NSSLGAVTWEVSRGNGIHTHWQFLPVPGDLITRGLVTAAFKVEAENLKYPKFESPSST
                     DPSAEPGDFFRVWIWGPNKNSDSDADAGASSGETERMLLLPLGPDFRFDLQFGRRVMA
                     KLMELEGRINWKNDVQSQEEEEADATAFKDAFKEFDFTLEE"
     exon            complement(260580..262215)
                     /number=1
     exon            complement(262273..262286)
                     /number=2
     CDS             join(262732..264086,264141..270638,270925..270949)
                     /codon_start=1
                     /locus_tag="AO090003000101"
                     /note="DRIM (Down-regulated in metastasis)-like proteins"
                     /old_locus_tag="AO070341000049"
                     /protein_id="BAE57332.1"
                     /transl_table=1
                     /translation="MVAASSASRAKPVKRVKKGTETTKNYRFEGFSQRVAKLKIDPIH
                     RVRRPSFGEDEGDANSSHFRSAFDYWTELNLSDNFAQFARRVNPLCESLVQILYHEEK
                     IMNLLVEFIEKRDHLSMEPLLSLLAQFARDLGVKFEKHFATSVTLVASVAATHPEVEV
                     VEWSFTCLAWIFKFLSRLLVPDLRQLLGIMTPYLGKERQKPFVARFAAESMSFLIRKA
                     GLVYYKNSTPLQRAISFLLDDLHQTAVDNKNVEIYKEGLMAMFSDAIKGVKYGLHSNG
                     TDIFKAILENMCTDDDLRSSLGLDVASGILTNIIHNTTPDTFEPIVDTIKSHIEARCR
                     KADKRRAMACCRLIFVCVSTRKGLRVKNWKNVHQALLLLLQSAAAAPGAYAEAIPQLL
                     TAVAYALQVSPMDEMLPFMRTIMETVTSDPLSNYFLSFCATFSEWGAERFHSVILPYF
                     QKFVNTSWKEQEYELCLILLRLNQAGCITSEVSKPGYISCPAPWKAKIKKTLKTQRPG
                     ETEVTLLNAYSKLPSALSLSTEPSLLPEMTQSLHDHVSRALEINESEPSLSTKFFVGQ
                     GFKTYVELASICGGVDSNLWDQISNVASTYSRLPVFLEATLAYVSACSKELDLNKPAL
                     GDFADVLITNLAGPSHELRLVSLKILREIVQASGDDTSPISLAIQIEESPLTLQSARE
                     LAMHVRKMAISYPQVASRRWMSRLIPNFLFGLFSKKMAPLWDDSAAALKSISEHADGE
                     KIVSDLAIQWLQERGSPASAEDTEDDSNTDSFVSGDYQCFNAAKVESVSTTNFEAAEP
                     ISMLTQRLEKDHQFSEVIPAAPRTQALRVLNAAPNIAEKRSRQVVPLFLSWATRDEED
                     IPSTTDLKSSESSSYIPWGFHDRLAFLGLFGQYLNPRVLFRASEVHDALLGLLCHGNS
                     EIQKAALKALFTWKSQGIVPYKENLLNILDESRFRDELSAFVQVGGEDSMIEEAHRDE
                     LLPVLLRLLYGRMISKAGASASQAGQAGRRKAVLRTLAQLPDNEFQLFIQISFGPLGD
                     VHLVQNSEIDQEVFTRELASPRRQMGLLRMIETVFESLQSKMTPYAERSMEVVLYCLV
                     RACRELEKSQPENVADSQEGKLLTVLRNIRSTCIKCLDLIFSVSLDRDWTPFVRVIFN
                     ETINPRLENFATETTQGVSSLLRLFHTWATAPRSSFYLVQYNDALLMKVVDCLAVDST
                     RDEVKVFIMDEILVPLVGLATGKELREQEEMSDIPADEIRSVVLAPYLDHTLSHLGNL
                     LKRGPSRPVLISGVQTLSLMAPCVESSKETSSLVNITTYLLRQPPDRVSPKTKSGLLR
                     ILEHFLPLYDPKEDSELFQEVFDAVSSMFDYFKDEANREVLSRVFSAFAKHDPELVKV
                     AALCEDLNSVSRKKLEVDFERRLQAFREINDGLWEKFNARQWRPVLYNMLYHVKDDEE
                     LAIRSSASFGLKRFMERATLATDKNVEEFEPLVKDVLFPSLQNGIRQKSELVRMEFLS
                     ALGYFVKLNPDRPNVQDMHDLLVDDDDEASFFNNVLHIQQHRRLRALRRLAAEASKGK
                     LQASNISTIFIPLNEHFVFDEEADEATHNLIAEAVATIGALAEWLDWNQFRAIFRRYK
                     GYMQSKPEMEKNILRLLGRMSDALTTAMNQINVPKATTEDQMEGVETSVPSQCTLART
                     IPSTSKVASELTTNFTPFLTNFVHHKDEAQMSLRLPASVTTIKLLKLLPEQDMTIRLP
                     AVLLDVCSILKSRAQDSRDTARKTLNDIALLLGPVYFGYILKELRTTLTKGYQLHVLS
                     FTVHSILVATTDDFKQGDLDYCLADLSAVVMDDTFGTVGQEKDAEDYVSKMKEVKSNK
                     SYDSIELLAKNSTIGNLSNLIRPLQSLLKEKLTSTIVRKADELLRRIGIGLLRNPGAE
                     NRDILMFCYEVIKESYQEPVQTAKKALSASEEHFLIKLHGPKRGEKRGTTSSYAYKLT
                     RFALDVLRSVLSKFDSLLTPANVAGFLPIIGDSLVQGQEEVKISALRLLSTMIKLPLA
                     ELDNNSHVYLTEAVKIIKEAPSTNTEAAQASLKLIAAMLRERKSTKLRDGHLSYLLQR
                     LTSDIEEPDRQGITFNFIRAVMSRKFVVTEMYELVDHIATMMVTNQTRSARDLARGVY
                     IHFLIEYPQAKNRWTKQLAFLAKNLEYKHSEGRQSVMEAIHTLLSKTGQELAQDIIGT
                     FFLPVVIAMANDDASECRELAGALLSQFYSRADSETMKTMLVPLHSWLEQTDNLLLTG
                     TGLHAMRIYFEAEDTTKEKEARFVRELLPSIMQPVLEAEDTENWQTLYYALQLYAKLC
                     KSVPAIALAKESATNWTAIRECLFYPHAWVKTSASNLVGTWLADLAKSNATSGYSSLP
                     LENASGLALDRDAMLQLIRASVRCLRTPAVSEELAMQTVRNIIFITRCCAQNGLEFSR
                     RGDKAAESDASDSEESDDENEEDQPADSAKPAIRYIFEQVSSVLRRELLTTRANSLIP
                     KTASIGLLAALCRHLDAEQIQPSIPIILIPLQHMTDSSIPPPRSSDPVFRESYKALVS
                     NCHEVLDLIQKKLGTSEFVKQMALVQEKIKEKREGRRVKRRIEAVTEPEKFGREKKRR
                     NDRKRDKRKEKGMEHRSKRRGCQSSFIIH"
     exon            262732..264086
                     /number=1
     exon            264141..270638
                     /number=2
     exon            270925..270949
                     /number=3
     CDS             complement(270977..271561)
                     /codon_start=1
                     /locus_tag="AO090003000102"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070341000050"
                     /protein_id="BAE57333.1"
                     /transl_table=1
                     /translation="MRSFTSFPRGFRAIQSSLPRTAISRPTSRPFSQLINRSTRSSPA
                     LSWASGRTSVSASTLRHNSSSARPLTDQAADAARDAENEEQNRKRREQEPAYQITFTC
                     KPCGERSSHRMSKQGYHRGTVVIRCPSCKNRHIISDHLNIFYDKKTTLEDILAEQGNK
                     LKRGYVEGDMEFWDDGSVTPKEGEEAKSDQGQLP"
     exon            complement(270977..271561)
                     /number=1
     CDS             join(271990..272031,272180..272566,272621..274485,
                     274553..274724)
                     /codon_start=1
                     /locus_tag="AO090003000103"
                     /note="cullins"
                     /old_locus_tag="AO070341000051"
                     /protein_id="BAE57334.1"
                     /transl_table=1
                     /translation="MSLRARQKIRAPRRGLNTNKTDDFETNWEGLSTSLKKIHTKDAS
                     NLSFEQLYRNAYNIVLMMRGDELYERVKKLEQEWLDTEVQKRVTAAISSILLQAKDQA
                     EIQDQENERRDTGEKFLNVLREAWEDHQISMGMITDVLMYMDRVVSADHKKPSIYVAS
                     MALFRDFVLRSAVRADAESMVADVLKSTVLFMIQLERSGQMINRPLIRHCIYMLEGLY
                     ETITEEESSKLYLTMFEPAFIETSKVFYRAEGRRLLETGDAATFCKAASDRIAEEGAR
                     CLSTLSPLSEPKIKDVLDKELIGSNIAEVINLEGTGVKNMLDNDRMDVLRNVYVLSAR
                     VDSKKIPLTAAVQKRIVEMGDEINKSAAAAAQAQPTKSAEKTAEGGKKPAEKPVNQQT
                     VSAIKWVDDVLGLKTKFDKIWEESFRSDPTMQSAITTSFSEFINSNTRSSEYLSLFFD
                     ENLKKGIKGKTETEVDALLDNGITLLRYVKDKDLFEAYYKKHLSRRLLMKRSVSMDAE
                     RQMISKMKMEVGNQFTQRLESMFKDMTVSEDLTASYKEHIRGAGDPDQKPVDLEINVL
                     TSTMWPMEAMSSIKGDEVQLPCIFPKEIDHLRQSFEQFYLSKHNGRKLSWQASMGTAD
                     IRATFHRSNGKVQRHELNVSTYAMVILLLFNDVPQGEPLTYEEIQARTRIPDHDLIRN
                     LQSLAVAPKTRVLKKDPMSKDVKPADRFVFNNDFQSPFMKVRIGVVSGSANKVENQDQ
                     RKETEKRMNDERGASIEAAVVRIMKQRKTLVHSKLMSEVLSQLSARFVPDVNMIKRRI
                     ESLIDREYLERVGEDPPTYGYVA"
     exon            271990..272031
                     /number=1
     exon            272180..272566
                     /number=2
     exon            272621..274485
                     /number=3
     exon            274553..274724
                     /number=4
     CDS             complement(275261..275710)
                     /codon_start=1
                     /locus_tag="AO090003000104"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000052"
                     /protein_id="BAE57335.1"
                     /transl_table=1
                     /translation="MHYLLRISSASSQQQHPDSQNNPDQQPEDSIPDLTAVTDPSPLS
                     TQELGFLRAHQTLLAGHFGASFLSSFPAQLRRLDDNAGGVSMVQGPDGREVVFVRCLA
                     ERVGVVVPPGDGVEVETVGTEMRMGDVWVVRWEGVRGAWERGEVEVL"
     exon            complement(275261..275710)
                     /number=1
     CDS             complement(join(277211..278336,278396..278609,
                     278667..278734,278807..279042))
                     /codon_start=1
                     /locus_tag="AO090003000105"
                     /note="M-phase inducer phosphatase"
                     /old_locus_tag="AO070341000053"
                     /protein_id="BAE57336.1"
                     /transl_table=1
                     /translation="MEHSSPLAAMQPPSVLFGHCFRSDARTSYPAFGLNSNSFNFKDL
                     SMKKAHGADYFNVKGTSPTASLAADLSQNFHIDQSPQVATPRRSLFSSNLFGNGNRRE
                     EAMTTPPLSSSPALDIMEMSPLPHKPPFNVLEAELRTPTIEISSMDTPMRSNAASPLQ
                     DSPLVAQKEGQHERRRPTFLRPSLARSKAQSFQLGMVKPAPESQAPPFKFQSKGTKTS
                     LSTSASLEDMFNESPPRERSSLRNHSSHGLVNPRLRPPFGRETSHVRGNGSPSAASIR
                     KNSHPMMRPRKQCRRSLSMFENPEDVMVEKEASFTSNAPLQSICDIEGTPSLQLPHFL
                     PEDQADTLPRIDKSILVDLIDGKYNDRFDNIMIIDCRFEYEYEGGHINGAVNYNDKDN
                     LAAELFASPKPRTALVLHCEYSAHRAPIMAKYIRHQDRAFNVDHYPHLTYPDMYILDG
                     GYSSFFSDHRTLCFPQNYVEMSAKEHEFACERGLGKVKQRSKLSRAQTFAFGQSPQME
                     DSPTGRCRNGLGDRNRLLGSPFAASPVSGRMSGRRMLSY"
     exon            complement(277211..278336)
                     /number=1
     exon            complement(278396..278609)
                     /number=2
     exon            complement(278667..278734)
                     /number=3
     exon            complement(278807..279042)
                     /number=4
     CDS             join(287528..287566,288840..289148,289200..289785,
                     289841..290658,290719..291024,291080..291961)
                     /codon_start=1
                     /locus_tag="AO090003000106"
                     /note="predicted regulator of rRNA gene transcription
                     (MYB-binding protein)"
                     /old_locus_tag="AO070341000054"
                     /protein_id="BAE57337.1"
                     /transl_table=1
                     /translation="MADLTCTVATSATLVEIYEDLASEKDEIRLKAAQALVSQFTPDK
                     NATDDQIQKTLRRLFRGLCSSRKAARIGFSIALTEILSQILSSPRESSEFDIPRVVGF
                     WESQSSASGSESGQEQRDHHFGRLFGAEAIIKSGILFKPNAPFSEWTKLLDLVFDLAK
                     KKPWIREECGWIVYRCVYELSAQKAEAKFVESALERLCTNELARTPEGVAIWLAAKDL
                     FPKVKLPSKVWKHDDPLDVKERNQLAKVMKESSVSEAEGENKGSNPKSSGVWNSKLHF
                     AWDAVLSRLSETSAKESKSKTSRLSFSDFWTEVVDNGLFAASSSDERKYWGFLLFVKV
                     LNESPLPLASLVFTKNLVRCLTNQLAVEDRYLHRMAAKAAKTIQTRVSKEPEFAAASI
                     NGLMGSAGSVNFDQVTKTKTVEKIVIEANLDALKQIVPLFEKLVACPGTSDSKAAASS
                     RQFLAGLLLSIVRSRASASDESEEGAKEVLEQILFTFVRFAYFVEKEGDSRGQTAAEP
                     ALTEQTQELFRSRINSCLNSLIANQKYATALPYAVVRKVRDAAKSEEYGKFIIAMDDT
                     LQDSVKGAFKSLKKLSSTEKKGDAAGVDAFKLLYSMTILQVYNGDADAVSMLDELDFC
                     FSKIFGDKKSKKDETADASDALVEILLSFASKPSQLFRRMSEQVFGAFADKISENGLD
                     SLVSILEAKESLAGQQEMFEQDDEGEEDEEMMDVDEDDSDVEVIDAEGSNDDEDEDDE
                     EEGSEEEEDGNDDEEAIFEAKLAEALGPHRANQDLNDDDEGSDADMNDDEMEQVDQQL
                     AKVFQARRDALSKNKDKKDAKGNMVNFKNRVLDLLEIYVKKCHSKLLALDLLLPLLRL
                     TRKSTVKQISNKANSVLRDYTRLCKGSALPKLESVEPAWELLNSIHKEASHSGPPSHA
                     SACSQASLLMVKVLVAHDKNNISGIVDVYAETRKQQFLSKKCHVQPSFFSEWSNWCVS
                     ASKQMKN"
     exon            287528..287566
                     /number=1
     exon            288840..289148
                     /number=2
     exon            289200..289785
                     /number=3
     exon            289841..290658
                     /number=4
     exon            290719..291024
                     /number=5
     exon            291080..291961
                     /number=6
     CDS             complement(292168..293229)
                     /codon_start=1
                     /locus_tag="AO090003000107"
                     /note="uncharacterized Fe-S protein"
                     /old_locus_tag="AO070341000055"
                     /protein_id="BAE57338.1"
                     /transl_table=1
                     /translation="MLDLDTPQALTIATTIITLLTIPVLYPQLPTWLKTTTSKLLPNS
                     QKKKHPSSEILALRVYPIKSCRGLSLNSTTLHMEGLDLDRRWMLIDAKTHDFLTIRQI
                     PQMTLINTALSTDDQSLVVTFTGVTDKEVRVPLRPDTAWLDAHTTLGQVKIWDIETDA
                     YIYGPEVNAPFSEFLSRDVCLVYKGPTPRIMRGNGDPSLLGREQSVNFPDVHPVLVAS
                     EASLAELNSRLVEKGVEPIGVERFRANVIVKGGEPWVEDEWKVVRVGDGAGKVLEFDV
                     LARCARCQVPNVDPDTAGKHKTEPWDTLMSYRRVDEGMKYKPCFGMLCAPRGEGVLEV
                     GMRFDVLEVTSEHRYIKGF"
     exon            complement(292168..293229)
                     /number=1
     CDS             293801..294394
                     /codon_start=1
                     /locus_tag="AO090003000108"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000056"
                     /protein_id="BAE57339.1"
                     /transl_table=1
                     /translation="MQVYISSSAHALALQNDTSNLHAALYLLANPTSYKSFDQSSCNI
                     RASLDVLVGARSRHMEENDVSVLALLKRLGQTCIKDELAEVASSVLGYPDVCSRRYKR
                     LPRVEKVVIGRLGVENFPYYVCGIRRRTSLEYWRELLLPPNLLPIFITDSAFDIGQVV
                     RISMRLGLNRVVRSCSRYSHMEYNVWSSTSMGLGVIL"
     exon            293801..294394
                     /number=1
     CDS             complement(295858..296475)
                     /codon_start=1
                     /locus_tag="AO090003000109"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000057"
                     /protein_id="BAE57340.1"
                     /transl_table=1
                     /translation="MEAGNRAVEGEQWYDFYPWEEWLASEADRVLLVDIGRSKGHDLA
                     RFKEKKNPAGRLILQDLSEVIQDIQAPLAQGIEAQGYSMFDPQPIRGAKAYYMRTVLH
                     DWPDKQALQALQRIREAMADDSVLLINENSVPVTGVSRFNASVDLIMMTVLSSLQRTE
                     KQWLSLLERAQFNVIKVWRSDNQGVGSNALFEAVPVFVGSSGQVP"
     exon            complement(295858..296475)
                     /number=1
     CDS             join(298711..298935,299012..299128,299175..299277,
                     299341..299409,299471..300076,300153..300604)
                     /codon_start=1
                     /locus_tag="AO090003000111"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000059"
                     /protein_id="BAE57341.1"
                     /transl_table=1
                     /translation="MPVLATFLESHYFFQGIAVALALIFVSNFYRELADGLPYRKIPL
                     VGRSRWEISNTKAKKLFVTSAKDLMVQGFSQGRTVFQAMFTAGPTIVLHPRYVDELKN
                     HPHLDFGEAVRKSFFGATIPGFEPFNNQTKEDIVIEVINKKLTHTLGQLTIPLSKETA
                     AVLTDKLPGSDEWKPFTFAQEIPHMVARLSSLVFLGEKICRNETWLDVSVNYTIDAFN
                     AARELRDLPAVARPFIHWFMPSMQKLRHHRKVAAEIVQQEIIKRDMIREGKLPEENPP
                     RTHADALDWFREVAAGRPCDETVSQIGLSVAAIHTTSNMLTNVMYDLTAHPEYIQPLR
                     DEIKAIVEQDGILKKTSLTKMKLMDSVMKESQRTNPVSIAFFNRIATEAVVLSDGTSI
                     PKGANVVVSAHVMEDESIYPNAKVYDGFRFYNKRQVPGNEHRYQFVTTSPEHLGFGHG
                     MHACPGRFFANNEIKILLAHLLLKYDWKFADRVDRPKSFLHGTEIICDPTVKLLYKSR
                     QPEVDLSALGEGTTD"
     exon            298711..298935
                     /number=1
     exon            299012..299128
                     /number=2
     exon            299175..299277
                     /number=3
     exon            299341..299409
                     /number=4
     exon            299471..300076
                     /number=5
     exon            300153..300604
                     /number=6
     CDS             305833..306336
                     /codon_start=1
                     /locus_tag="AO090003000113"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000061"
                     /protein_id="BAE57342.1"
                     /transl_table=1
                     /translation="MATAESPSDEETRQSLEELFRQGKLNDIGQRRVRIRNRGATMSS
                     VNSGGLDQLFSPPSSSSRNDESQREEKPAPHLRNLSGEAIKRLGSPFKIDPPRRAGDS
                     PARFIRHAPSRSEPFARGLLSQARKTTQVGGQGTSNTLPYDPTEPGLSDAERIRRQIL
                     NMSYSRQ"
     exon            305833..306336
                     /number=1
     CDS             complement(join(308303..308409,308527..308727,
                     308784..308901))
                     /codon_start=1
                     /locus_tag="AO090003000115"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000063"
                     /protein_id="BAE57343.1"
                     /transl_table=1
                     /translation="MDISTATMWRACGPLTCEGASHGSPAKTQMPTPQPPDMPQAKTL
                     SRDISDETAAVIDGWRITHLTQDPFGQIATAELHITAPVLTAVLDYHSASSDYYLRGP
                     HDTGVPVQGQEHTYRRVGHIWELGMSHFQALERQSIVLI"
     exon            complement(308303..308409)
                     /number=1
     exon            complement(308527..308727)
                     /number=2
     exon            complement(308784..308901)
                     /number=3
     CDS             complement(join(309006..309022,309079..309293,
                     309639..309855,309912..311499))
                     /codon_start=1
                     /locus_tag="AO090003000116"
                     /note="ankyrin repeat"
                     /old_locus_tag="AO070341000064"
                     /protein_id="BAE57344.1"
                     /transl_table=1
                     /translation="MTALESAAQGGHLPCVRYLLGHGATVTPQNSHSSALKRASAGGI
                     PDVVDTLLQAGAGSNDDNALHAAAFGGHLEIFNRLVDTGADIDASHEYENSFRAGHLT
                     ALQEAARGGHLNVVDTLIRKGADVNALPRGMTALQAAVASNSPEVVRYLIAVGANINA
                     PAEKWGRTALQKAAEIGSIEMVNMLLDAGAVMERSAHQNGRDAPALELAIKGGHLSVA
                     ETLLRKMDRAGEQEQKYLCDPLTLALHAAAFEGYEHIVRRLLEAGAPILDLDNSDLVP
                     RTAFKGHTGIIKILLDAGAEMDSSRHSPYSGTALQRAVAGGHVETARLLLEYGADVNA
                     APARVKSPLHLACRNGDVIMARMLLDARANFRAVSYSGKTVRRSAEKGGSVEILQLLN
                     MREALEPSDGNKTEILDVSTIAKRGLCSTCSGLPLEVFTSPRWLRRYHSNAFCFHPSL
                     VSLEKSARGGCPFCLFFWKRLGINIISIPQPSKVRLFYGRRSTDDVAKMLSQIDEPYP
                     KDIERPRSERADFQACVEPFDGKVKALPGNTQSAETYQQIVTWLQQCIKDHHACTVGS
                     NGRFLPTRLIDLTDWGRGKVVKLVESNSIHRDQSIPSQDGQSSKMVRAVKTQPSWVGL
                     LGQGPLQSRGWCLQERELSPRVLHYTPSQVLWECRAFKASEGWPERDISSTGCS"
     exon            complement(309006..309022)
                     /number=1
     exon            complement(309079..309293)
                     /number=2
     exon            complement(309639..309855)
                     /number=3
     exon            complement(309912..311499)
                     /number=4
     CDS             complement(311588..312127)
                     /codon_start=1
                     /locus_tag="AO090003000117"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000065"
                     /protein_id="BAE57345.1"
                     /transl_table=1
                     /translation="MPATGNIYSWMISHRNIELEEDEHGDTKWLLVVDDTERSALDLA
                     RDSNTTQRQLQEAVQLEFKTLWDQFNLYHTWSLTEAAKQGDLFAVQRLVEAGAEIHMQ
                     SDRSENSYSAVRIAARKGHNLVVHYLLDAEKDRLSRHIYTPERLERAVRDGIHEEVAR
                     MIPERDFISRSLSAKNEAL"
     exon            complement(311588..312127)
                     /number=1
     CDS             complement(join(312929..315180,315243..315675,
                     315780..316766))
                     /codon_start=1
                     /locus_tag="AO090003000118"
                     /note="mitotic checkpoint serine/threonine protein kinase"
                     /old_locus_tag="AO070341000066"
                     /protein_id="BAE57346.1"
                     /transl_table=1
                     /translation="MAAQEEVVDFDIIENQKENIQSLPGGRSARELARIFSPRGTEDK
                     LYSPSPNDTRTVNDAIRQDYEAELQAIGESDDPLDIYDRYVKWTLDAYPSSQATPESG
                     LLPLLERAVKSFLTSPHYKNDPRYLRLWVHYIRLFSDSPRETFAFLARHQIGEGLALF
                     YEEFASWLEGAGRWTQADEVYRLGVDREARPVERLVRKYREFQQRYEQRTQDNGPSSP
                     ALPAVRPALAAKVDPFASAAAPSPDPQAQRAAPAAAAPKTKSGKPKMAIFSDADSASQ
                     PAVSGQTRGWDSIGSMSDRRKENKVEAKPWAGETLKAGKKPAPKEKMTIFRDESNQNS
                     HLKESMQSKHVPEHRVREAVNPRTGRRERVFVNLDAVYPDYTNPNVEVSFEELRAMRR
                     GWMDKKWRPQKEPLRQISGNENSAAIDPARALPDEFNEKLTMKDADISAQQQAPESDA
                     HHEAKAGKARKLKLREVKQETQTVKMKFDSPTGGKIRRKSTAEPTMTIHTRAATDEIY
                     SIFNQPLKAETEAAESSDFDDDDYTSAGESTVTGHISAASSDFGDDENTFHKPFDETV
                     GDGFDDNTRAESVVDGEWTQFSAVDDTAGLRSLGVESVSQHHTDERDSIDGDDFEDNQ
                     NRQRFIPEMPDDYNPPCGPYRDPAIVAQNRLPFMTPIVEQTEYSLASLTAARNHLYNA
                     KTPSKPQMADLLSTPLIDGTPRQGDTTIGLPEDVALSPTAKKALSSVKSASPFGRKYR
                     QGPIIHDAQCNPTDKKIRNTILSALDPPLATYAGYHGHTETDAHYASDIQKFMKAQPK
                     RSRSGDEASFELPILELPGAERSYIIRRELGAGAFAPVYLAESIDSLPADSDDESEDS
                     NSGGSQLTYSNRSTRRKPRYSFEAIKMEVGPPSPWEFYMIRTAHDRLNQRPGLSRAVD
                     SIIDAHELHVYKRESILVEDYRSQGTLLDLVNLVRNEQVIGGGHGEGGLDEVLAMFFT
                     VELFRTVEALHSCGILHGDIKADNCLVRLEEKAEPPSLIDLGDENAYDPREVHYSPRG
                     SYGWRNKGLSLIDFGRGIDMHAFQPSVQFVADWEAKKHECNEIQEMRPWTHQIDLYGL
                     AGTVHVMLFGKYIESSPVRQSEGAPPNGPRTYRIRESLKRYWEREIWNDVFDLLLNPS
                     SERWVQMELEGNNNPAAMLFDENTPTSPILPVVNSMRYVREKMEAWLLANAEKKGLGL
                     QLRKLEAIFNERKKKLERS"
     exon            complement(312929..315180)
                     /number=1
     exon            complement(315243..315675)
                     /number=2
     exon            complement(315780..316766)
                     /number=3
     CDS             complement(join(318472..318659,320301..321339,
                     321423..321866,322923..323072))
                     /codon_start=1
                     /locus_tag="AO090003000119"
                     /note="predicted integral membrane protein"
                     /old_locus_tag="AO070341000067"
                     /protein_id="BAE57347.1"
                     /transl_table=1
                     /translation="MDDPGSSGKGPKKSKIKLGDPNLCNPRSNRRGFPEDERSKSTMP
                     KKTLKDHSRMGLSPSGNHHRRRSSVLTATGGPSQVGPAEQRDDNPRTNADPVNYKREE
                     QKAAEDADVSDLSSIAESSEDDLQDDEETGLTAKQRRQRRRRRKQRRQLDARIAGVKG
                     SQSDVFSVGLADRNVMRRLLVNAGLILMWYFFSLAISIYNKWMFSEDDVVFPFPLFTT
                     SLHMLVQFSLSSFILYMIPSLRPRAPSSSPSGSPMRQQDGSENSVVSKVFYFTRLVPC
                     GAATSLDIGLGNMSLKFISLTFLTMCKSSALAFVLLFAFLFRLETPSAKLIVIIATMT
                     IGVVMMVAGETAFNVVGFLLVIASAFFSGFRWGLTQILLLRHPATANPFSTLFFLTPV
                     MFISLITIALAVEGPSQIVTGFVALSDVHGGMFATFLLIFPGILAFCMISSEFALLKR
                     SSVVTLSICGIFKEVVTISAAGVVFHDQLTLINIVGLVITISSIGSYNYMKISKMRAE
                     ARKGTWEPEPDSDSETEDSDPSRGREGYHRVANPETSFESFWRSEIISCREAVTGINA
                     DSDAGMILLWDHGEEIAEFSKLAADCSSVAAHRLKNRRDC"
     exon            complement(318472..318659)
                     /number=1
     exon            complement(320301..321339)
                     /number=2
     exon            complement(321423..321866)
                     /number=3
     exon            complement(322923..323072)
                     /number=4
     CDS             complement(join(325831..325983,326048..326540,
                     326661..326704))
                     /codon_start=1
                     /locus_tag="AO090003000120"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000068"
                     /protein_id="BAE57348.1"
                     /transl_table=1
                     /translation="MVPLEVALSGAIGARVRITTAPVSTTIEGTLFTACPITNLVAIN
                     TAADTKQTAGDYRIIPISRIQSFQLLSLAPSSNSAEGPSFADAVPPVHALDIRALKAR
                     EANAVGKLQEGEAKRGKGVTREAQDIFDAFSRTMPTRWDGPSIIVADAVSIAAPYRVD
                     DCQPLVAGDTAALARVRKVLEMERKKIELRNASATIGTANAFSRSASAKASTNPNPSP
                     GPGAAGPRKGG"
     exon            complement(325831..325983)
                     /number=1
     exon            complement(326048..326540)
                     /number=2
     exon            complement(326661..326704)
                     /number=3
     CDS             complement(join(327689..328129,328194..328622,
                     328691..329142,329203..329339,329721..329737))
                     /codon_start=1
                     /locus_tag="AO090003000121"
                     /note="6-phosphogluconate dehydrogenase"
                     /old_locus_tag="AO070341000069"
                     /protein_id="BAE57349.1"
                     /transl_table=1
                     /translation="MADQAVADFGLIGLAVMGQNLIMNVADHGFTVCAYNRTTSKVDR
                     FLENEAKGKSIVGAHSIEEFCAKLKRPRRIMLLVMAGKPVDQFIESLLPHLEKGDIII
                     DGGNSHFPDSNRRTKYLAEKGIRFVGSGVSGGEEGARYGPSLMPGGNEEAWPFIKDIF
                     QSIAAKSEGEACCDWVGDEGAGHYVKMVHNGIEYGDMQLICEAYDILKRGVGMPVNEI
                     AEVFDKWNKGVLDSFLIEITRDVLRFNDDDGTPLVEKILDKAGQKGTGKWTAINALDL
                     GMPVTLIGEAVFSRCLSALKDERVRASSLLPGPTPQFTGDKQAFVDDLEQALYASKII
                     SYAQGFMLMQEAAKEYGWKLNKPSIALMWRGGCIIRSVFLKDITNAYRQNPDLENLLF
                     DKFFNEAIAKAQNGWRNVVSKGALWGIPTPAFSTALSFYDGYRTRDLPANLLQAQRDY
                     FGAHTFRVKPEHANETYPEGKDIHVNWTGRGGNVSASTYIA"
     exon            complement(327689..328129)
                     /number=1
     exon            complement(328194..328622)
                     /number=2
     exon            complement(328691..329142)
                     /number=3
     exon            complement(329203..329339)
                     /number=4
     exon            complement(329721..329737)
                     /number=5
     CDS             331250..332398
                     /codon_start=1
                     /locus_tag="AO090003000122"
                     /note="RNA-binding proteins"
                     /old_locus_tag="AO070341000070"
                     /protein_id="BAE57350.1"
                     /transl_table=1
                     /translation="MSFPRPPGLKQAPSSLPPRPPNTASPSPASSQPAYSAAPSYSSA
                     GTSNGYGSSGPRTGYNAFTAFAPRSVASSQPYRTSSPVVSAPPATSAGYSTPTTAGYG
                     SYYSQPQQTYQSGASYYCSAQYNENTYGPSVPRIQNPFPAAGADQANNYGMHGRNYGR
                     SESGLDPETEAQIAQWQSAYANRDETQSTSKVPGRRDGYAVSGTGSGVNTPSGTATAA
                     TTPAPVAGQAEPQKTVVRAGGGQTWTDSTLLEWDPAHFRLFVGNLAGEVTDDSLLKAF
                     AKYTSVQKARVIRDKRTQKSKGYGFVSFSDGDDYFKAAREMQGKYIGSHPVLLRRATT
                     EVRPVANSKNGKKHGGGGGSGGGHGGGKVKHDGIRKPGKTKGGLRIIG"
     exon            331250..332398
                     /number=1
     CDS             join(335022..335171,335253..335631,335687..335808)
                     /codon_start=1
                     /locus_tag="AO090003000123"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000071"
                     /protein_id="BAE57351.1"
                     /transl_table=1
                     /translation="MAPLAGDARSVLKGTWSLAAVAIVVMVLRVVAKLKLRHVGIDDC
                     AMITALLLALVTSTLFSVAVVVYGFGDGLDTHNHSDLVNALKYYVILQVFGIASSCMG
                     RVAFIFYLLPILSTTKISKIILRGLLTLQVVNFVSIVLLLSQCRDIRGIWDPLFAERT
                     ECMDVSVEIYYGYFQCSCNGLTDLILSVYPSYIFWNLKLRLRVKISLVILISLGLL"
     exon            335022..335171
                     /number=1
     exon            335253..335631
                     /number=2
     exon            335687..335808
                     /number=3
     CDS             complement(336563..337603)
                     /codon_start=1
                     /locus_tag="AO090003000124"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000072"
                     /protein_id="BAE57352.1"
                     /transl_table=1
                     /translation="MPTVLVTGANGYIGNAVARAFVRAGWITYGLIRSQTTATSLAVE
                     EIIPIIGSIDDIASHETIRNKLPPTLDAIISTTENINEYIPHYNNTVHLLRTLATAST
                     ANGVRPVVIFSSGCKDYGIGPHYDGDAALAPHTEESSLNPPDILADRTYQSLKFLEHR
                     DVFSPVVVRPTNVYGRSASYYRGFFEAAAQSVDTRKPLLIPVPPNSICHALHVDDCGD
                     AYVAIAGHPRREEIEGEIFNISSRRYETIDEIAKTLVTEYGITAGVKYVEPESLAPAE
                     NPWPPALIDFPQWTGSAKVRAITGWCDVRPLFTEAIHTYRLAYEAAVVAGHENIEKMK
                     ERVELFKATVGQ"
     exon            complement(336563..337603)
                     /number=1
     CDS             complement(join(338154..338285,338362..338409,
                     338475..338928,338985..339274,339327..339578,
                     339639..340200,340254..340331,340395..341064,
                     341118..341165,341226..341350,341410..341508,
                     341558..341680,341740..342643,342703..342874,
                     342929..343048,343105..343473))
                     /codon_start=1
                     /locus_tag="AO090003000126"
                     /note="pleiotropic drug resistance proteins (PDR1-15),
                     ABC superfamily"
                     /old_locus_tag="AO070341000074"
                     /protein_id="BAE57353.1"
                     /transl_table=1
                     /translation="MDVHHGHLSRDTASDLSSVSASSSNISSNSCPDQNAELNETEKS
                     SRPGSLNRRLTEDEIVRVLSRRRTGGSGENTEGKSEDMTQIMKLVSRMFGHERKSNSD
                     EEKTRHLGVVWKHLTVKGVGLGAAIQPTNSEILLALPRKIKSLLTRGRNKPPLRTIID
                     DFTGCVRPGEMLLVLGRPGSGCSTFLKVVGNQRSGYKSVEGDVRYGGADAQTMADKYR
                     SEVLYNPEDDLHYPTLTVRDTLLFALKTRTPNKESRLPGESRKEYQETFLSAIAKLFW
                     IEHALDTKVGNELIRGISGGEKKRVSIAEALVTRASTQSWDNSTKGLDASTALEYVQS
                     LRSLTDMANVSTLVALYQASENLYKLFDKVIFIEEGKCVYYGRAESARHYFESLGFEC
                     APRWTTPDFLLSVTDPQARRVRQGWEDRIPRTAEEFRKIYRKSDIYKAALADNESFEE
                     ELESHQEEREAARKQSEKKNYTVSFYQQVAILTHRQFLIMYGDKTTLIGKWVILTGQA
                     LITGSLFYDLPQTSAGVFTRGGVMFYVLLFNALLAMAELTSFFDTRPVILKHKSFSFY
                     RPSAFALAQVIVDIPIIFVQVTLFELIVYFMANLSRTASQFFINFLFIFTLTMTMYSF
                     FRTIGALCGSLDIATRITGVAIQALVVYTGYLIPPWKMHPWLKWLIWINPVQYAFEGI
                     MSNEFYNLDIQCEPPSIVPDGPNASPGHQTCAIQGSSANQLIVRGSNYIKSAFTYSRS
                     HLWRNFGIIIAWLALFIALTMLGMELQKPNKGGSAATIFKRGEEPETVRRALENKKLP
                     EDVESGNKEKGVDGNMNESASEDSGEKVTGIAQSTSIFTWRNVNYTIPYKGREKKLLQ
                     DVQGYVKPGRLTALVGASGAGKTTLLNTLAQRINFGVVTGEFLVDGRPLPRSFQRATG
                     FAEQMDIHEPTATVRESLRFSALLRQPKEVPIHEKYDYCEKILDLLEMRSIAGATVGS
                     GGIGLSEEQRKRLTIAVELASKPQLLLFLDEPTSGLDSLAAFNIVRFLRRLADAGQAI
                     LCTIHQPSAVLFEHFDDLVLLQSGGKVVYNGELGQDSSKLISYFERNGGKKCPPHANP
                     AEYMLEVIGAGNPDYEGQDWSEVWAKSSENKQLTEEIDSIIQSRRNKNEGDNDDDRRE
                     YAMPIGVQVVAVTKRAFVAYWRSPEYNLGKFLLHIFTGLFNTFTFWHLGNSYIDMQSR
                     LFSIFMTLTIAPPLIQQLQPRFLHFRNLYESREANSKIYSWVAFVTSAILPELPYSIV
                     AGSIYFNCWYWGVWFPRDSFSSGYVWMLLMLFEMFYVGFGQFIAALAPNELFASLLVP
                     CFFIFVVSFCGVVVPYKALIHFWRSWMYWLTPFHYLLEGLLGVVTHNVPLRCVSREES
                     QFSPPPGETCQSYAGPFAQQAGGYVHDTGNGLCSYCQYSDGDTFAAESFNVYYSHKWR
                     AYGIFWAFVMFNFAAVYAFSWLYLHGIRDIKKWFSTRKTKRGAQA"
     exon            complement(338154..338285)
                     /number=1
     exon            complement(338362..338409)
                     /number=2
     exon            complement(338475..338928)
                     /number=3
     exon            complement(338985..339274)
                     /number=4
     exon            complement(339327..339578)
                     /number=5
     exon            complement(339639..340200)
                     /number=6
     exon            complement(340254..340331)
                     /number=7
     exon            complement(340395..341064)
                     /number=8
     exon            complement(341118..341165)
                     /number=9
     exon            complement(341226..341350)
                     /number=10
     exon            complement(341410..341508)
                     /number=11
     exon            complement(341558..341680)
                     /number=12
     exon            complement(341740..342643)
                     /number=13
     exon            complement(342703..342874)
                     /number=14
     exon            complement(342929..343048)
                     /number=15
     exon            complement(343105..343473)
                     /number=16
     CDS             complement(345234..346061)
                     /codon_start=1
                     /locus_tag="AO090003000127"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000075"
                     /protein_id="BAE57354.1"
                     /transl_table=1
                     /translation="MIARSAQQHEDISLRHLELAFKHWASLPSDTRRDAWQLEITRAF
                     AREMEKRKSLDDQLARVQQEANQLRAQVERLGSCQWPREFALFPPDTLPLPRDVARDL
                     DTKESKISPDSSRWDYDNVVAKWKRVVMHDKSMGRVGVGHSSPVLDDYGTADSKRVGD
                     DSGSMSRSRILQPPAGMSPPAPSPIQTGGPSASSSQQTSPYLPHDVTRSPNAGPQAKR
                     PRLMNGHHSGAAPEGSNSPSTSQTAGTSKPWNPQQSLTVSNLTGPSGPTPPPSSSGP"
     exon            complement(345234..346061)
                     /number=1
     CDS             complement(join(346150..346163,346235..346344,
                     346436..347019))
                     /codon_start=1
                     /locus_tag="AO090003000128"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000076"
                     /protein_id="BAE57355.1"
                     /transl_table=1
                     /translation="MDESASNRPIDTPEGSAGADDAQSGAAKNAAVKDRKCQYCHQAF
                     TSSSLGRHLDQFLFKKKPDGVHDVEEIRRIRSGITRRQARTSSGKRDTPERIIGKGQL
                     DPYASDSGAKPRDGVRMMFNTPTWHATGVINDIPNPSQSHDVSSTSRFSASQTRAPKP
                     LPDYASRGASANNPDTMRALELALREVLDNIKAATSRMRPRLSPFDFDIQSQTFPSLC
                     LQLLPPPPSLFATSSSC"
     exon            complement(346150..346163)
                     /number=1
     exon            complement(346235..346344)
                     /number=2
     exon            complement(346436..347019)
                     /number=3
     CDS             complement(join(347769..347905,347964..348378,
                     348433..348480,348517..349377,349433..349708))
                     /codon_start=1
                     /locus_tag="AO090003000129"
                     /note="amidases"
                     /old_locus_tag="AO070341000077"
                     /protein_id="BAE57356.1"
                     /transl_table=1
                     /translation="MTNTTYEQLGDLKRRSILGAIPAKWRLQNPIPQADELRDVTGAY
                     IQQFLTPQEIEITETDAAGITEQTTSGSWTAVEVAEAFCHRAALAHQLVNCLHEVFFD
                     AAIEDAKRLDAYFAEHKKPIGPLHGLPISLKDQFHVKGVETTMGYVGWIGTFQGKKDD
                     PRRATFESELVKELRNLGAVLYCKTSVPATLMAGETVNNIISYTWNPKNRLLSSGGSS
                     GGEGALIALKGSPGGFGTDIGGSIRIPAVFNGVFGIRPSSGRMPYEGAANSIDGQNMI
                     LSVVGPLATTARSLTLLFKTVLSQQPWYHDPLVLELPWRADVEERTRALIRKSADGSP
                     SLAFAIMRHDGMVRPHPPIARAVEIVEQTLKRLGHKVTQNLKGQGVIEWKPPAHQIGI
                     DIFGRVCVADGGADIAHHLGLSGEPKSLQCIVGEGIPHMSALEIAALNVEKRQYQKLY
                     MDYWNSTAEITGTGRPVDGVICPCAPHAAVIPHKYAHVGYTAFVNLLDYTSVVFPVTQ
                     ADKKVDVPEPKDDFLSEIDKIVHEQYDPEMYDGAPAGLQIVGRRLEEEKMLTLADYIS
                     QEVSLHSGISQN"
     exon            complement(347769..347905)
                     /number=1
     exon            complement(347964..348378)
                     /number=2
     exon            complement(348433..348480)
                     /number=3
     exon            complement(348517..349377)
                     /number=4
     exon            complement(349433..349708)
                     /number=5
     CDS             complement(join(350285..350861,350921..351177,
                     351286..351714,351792..352087,352148..352178))
                     /codon_start=1
                     /locus_tag="AO090003000130"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000078"
                     /protein_id="BAE57357.1"
                     /transl_table=1
                     /translation="MTLACLRMAKEQPRVQRFWLIELISISQFNDYFLRVYSPGPATD
                     ADMIIVNGGLYWLYCECASLFVDQKVKGNYMDQAMLCRDNLETVLSNLPFHMPVTTDV
                     VFAMNVAATYCLQMAKPSIAWSFITTASHLSQTLGLHSAHALSTDNQETKDQKIRLFW
                     AVFLTEKWLCLRLGRSSTFRDEDITAPLVTFDQNVETLLVPKWIDLAKIQGKTYNDIY
                     SPSALMQPIDTRISRARTLVAEVNKLMVSEDELERRYNDARRRAIGDDLHEIIQRSDR
                     VCNLSLLSLIYRAIPPKKPSGTAFCDECIATAREALKEHEKCVALILKCPWDESFLEM
                     YINWTLLQFPFFPFIVLFCYIVETSEPDDLKCLGAFVEVLQSVRSTATYKVSRNQVRL
                     FRALYDVARKYVEVKASTPGVRMNVPSSNSTGGHIANSNAIGSSMLLQSSSANLDQVS
                     SNPGVLHSVSEAGLSNPWVNSGQQLLTQIPGYGPSVYPSAPPQTDLNNNMGMDLTGME
                     LGDWFYENHQMFRLMDDGQLW"
     exon            complement(350285..350861)
                     /number=1
     exon            complement(350921..351177)
                     /number=2
     exon            complement(351286..351714)
                     /number=3
     exon            complement(351792..352087)
                     /number=4
     exon            complement(352148..352178)
                     /number=5
     CDS             join(354008..354081,354144..354800,354877..355156,
                     355221..355367,355423..356170,356223..356319,
                     356367..356975,357047..358118)
                     /codon_start=1
                     /locus_tag="AO090003000131"
                     /note="multidrug/pheromone exporter, ABC superfamily"
                     /old_locus_tag="AO070341000079"
                     /protein_id="BAE57358.1"
                     /transl_table=1
                     /translation="MTLLSGSTLGTSLPDNFMSRVSKFSLYFVYIGIARLGCTYIYSS
                     LLTYVAYHLTRNIRYKYLRAALSQETGYFDQGTGGSISTQATSNGKLIHSGISEKLGI
                     FIQAIATFIAAFIIAFVSHWKLTLIICCIVPALIAVGGGLSFVDAGYETNILKVNAQS
                     ASYAENILSGIRAVHAFSLRPRITHKYGQYLQSVFKIGMKKNPIYGLMFGSEYFIIYA
                     GMGLAFWQGIHMLARGNIPDIGTVFTVLFSVVIAASTITAIASHTVTFTRAASAAAEL
                     FALIDRESEINPLDESGDKPQDTYGVINIDNITFNYPSRPNVCVLKDFSLHVPAGKVT
                     ALVGASGSGKSTIVGLLERWYKPLAGSIKLDGRDITQLNLRWLRTNVRLVQQEPVLFN
                     GSVFDNIMNGLIGTQWETAPYEEQRKRVEDAAKLAFAHDFIMNLPNGYDSSIGERGGL
                     LSGGQKQRIAIARSIISEPKILLLDEATSALDPHAEGIVQQALDRASKNRTTIVIAHK
                     LATIRNADNIVVMSKGRIVEQGQHSELITRGGAYASLVKAQDLSAARSADDEEQSTED
                     EIPDKESEPVQSLARYQTAEAQQLTMLQHREDFGLYKKSGILRSIAKLVIRTPKLKFW
                     YFLTIICCAAGAAIFPGQALLLANVMDIFSAPNMVERGNFIALMLGHKYYCAGTASIC
                     LEHDIFTDSSHQTFNKVFRHDLLNSMLKQDLRFFDRPENTVGALTSRLDSHPQAILEL
                     MGFNIALVVLAAINVLASSILSLAIAWKLGVMGVFVGLPPMVIAGYARIRLETKMDTD
                     MGKRFSQSASMASEAVLSIRTVSSLAMEKNILKRYTNELDQAIQTSIRPLFSMMVWFS
                     LTQSIEYFILALGFWWGSKLIHDGDITFYQFIVSFMGVYFSGQAAGQLFSFSSSFTKA
                     NEAANYYFWITNLSPLIQKTKENRDNGPSNNCQAIDFQGIQFSYPLAPDTRILKGVSF
                     NVRMPSVTPILPLLLPAHRTNIVITFQIRKGQFVALVGASGCGKSTMISLLERFYDPT
                     HGTISVDSSPLNSMNPVLYRQQVALVQQEPTLFPGTILENISYGLDIAPSESASAPSS
                     EVENACRAANVWDFICSLPDGLQTPCGTSGSQLSGGQRQRVAIARALIRNPRVILLDE
                     ATSALDTESERVVQGALMQAATSGERITVAVAHRLSTVREADCIFVFLGGKIVECGRH
                     GELVEKGGIYAKMCEAQSLDSAA"
     exon            354008..354081
                     /number=1
     exon            354144..354800
                     /number=2
     exon            354877..355156
                     /number=3
     exon            355221..355367
                     /number=4
     exon            355423..356170
                     /number=5
     exon            356223..356319
                     /number=6
     exon            356367..356975
                     /number=7
     exon            357047..358118
                     /number=8
     CDS             complement(358661..359482)
                     /codon_start=1
                     /locus_tag="AO090003000132"
                     /note="DNA alkylation damage repair protein"
                     /old_locus_tag="AO070341000080"
                     /protein_id="BAE57359.1"
                     /transl_table=1
                     /translation="MVGLQMIPSLVPPAVQVELLSRLLHRDLSNKEHQTNLHLHYNIT
                     YPGETEIAPIEGGTSTSSAGNSPEGNGVLSFFEDDPARVVYPKDPAVHKPLTVQQMLN
                     KKLRWATLGGQYNWTTKEYPTECPPAFPEDVASVLHAAFPQTEAQAAILNVYSPGDTL
                     SPHRDVSEECDVGLISISFGCDGLFLISHDDGKGCEIVRLRSGDAVYMDGTSRFAWHA
                     VPKIVPGTCPEWLADWPLCPVDDADTSKYGRWKGWMSGKRVNLNVRQMTVTDTHT"
     exon            complement(358661..359482)
                     /number=1
     CDS             join(360540..360576,360676..361184,361245..361408,
                     361493..361745)
                     /codon_start=1
                     /locus_tag="AO090003000133"
                     /note="protein kinase PCTAIRE and related kinases"
                     /old_locus_tag="AO070341000081"
                     /protein_id="BAE57360.1"
                     /transl_table=1
                     /translation="MENYQKIEKIGEGTYGVVYKARELTHPNRIVALKKIRLEAEDEG
                     VPSTAIREISLLKEMSDPNIVRLLNIVHADGHKLYLVFEFLDLDLKKYMEALPVSEGG
                     RGKALPDGSGLSKSMGLGEAMVKKFMAQLIEGIRYCHSHRILHRDLKPQNLLIDRDGN
                     LKLADFGLARAFGVPLRTYTHEVVTLWYRSPEILLGGRQYSTGVDMWSCGAIFAEMCT
                     RKPLFPGDSEIDEIFKIFRLLGTPDEVAWPGVTSFPDYKPTFPKWKREETRALVPGLE
                     ENGLDLLDALLEYDPARRISAKQACMHPYFQYGSSHYSGRTRRH"
     exon            360540..360576
                     /number=1
     exon            360676..361184
                     /number=2
     exon            361245..361408
                     /number=3
     exon            361493..361745
                     /number=4
     CDS             join(363250..363681,363736..363922,363980..364244,
                     364299..364559,364609..364714,364779..364970,
                     365037..366044)
                     /codon_start=1
                     /locus_tag="AO090003000135"
                     /note="cytosolic Ca2+-dependent cysteine protease
                     (calpain), large subunit (EF-Hand protein superfamily)"
                     /old_locus_tag="AO070341000083"
                     /protein_id="BAE57361.1"
                     /transl_table=1
                     /translation="MDHDDDLTDMVFTPPLSTRSGGRKRRASQTPQETLRQFWNQFNS
                     KFPGRVYTVLPDNPYARTKAERAPKGVIQGQDAGKSYEEARKECRRAVDRIVKECERL
                     NQKYTDPHFDIEVDLKSGKRNCLDTLEEENMEMRPRGVKRVTEIFEKPRFFVNGPTAS
                     DVRQGRDGDCWFMAALCTMGNKQGLIEQICVARDEKIGVYGFVFYRDGEWQQCIVDDK
                     LYLRAADYDESVDERPIWDDINRADTEEEYRKVWQTGSRALYFARCVDENETWLPLLE
                     KAYAKAHGDFSAIEGGFVGEAIEDLTGGVTSEILSSSILDKDRFWKEELMKVNKEFLF
                     GCGTGLYSNWLDPKYRGPPRDRKGISENHSYSIMDAKEIDGERLLRLRNPWGKKEWTG
                     AWSDGSEQWTPEWMEKLGHKFGNDGFFWISYDDLLKKYQHFDRTRLFGPEWSIAQQWT
                     TVNVPWSADYHSTKFMVNVTKAGPVVLVLSQLDSRYFRGLAGEYGFVLKFRVQKEGED
                     DYMVRSQSSHLICRSVNAEVDLEPGRYHVLMKVTAYRNGEMESTEEAVSRLAPIKREK
                     LVQIGLSYDLAHAKGMVVETEDERRVREELEHHRKAAERQKQIEATRKKLQKEWIRQQ
                     KMTARKQRMAERISAKGQSNAVRNKAIEQILTDGPVQSPVELGNGSGAGFGAKHTRNG
                     SVPIIQCNGVHVSEAEIIGKSQSAQSTLDSTYSSVSSYHEDLDMLEGFEFDPDLDMPP
                     EEPAEPKPAHLTSNGCLEETNSDPWNAVCVVGLRVYSKDPQLSLEVVRSVSKRDTGAA
                     LDMDDPLKSASFSRLEAN"
     exon            363250..363681
                     /number=1
     exon            363736..363922
                     /number=2
     exon            363980..364244
                     /number=3
     exon            364299..364559
                     /number=4
     exon            364609..364714
                     /number=5
     exon            364779..364970
                     /number=6
     exon            365037..366044
                     /number=7
     CDS             complement(366750..367682)
                     /codon_start=1
                     /locus_tag="AO090003000136"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000084"
                     /protein_id="BAE57362.1"
                     /transl_table=1
                     /translation="MADPQESLVDIVKKNKFTAKSDDEIVELFKNAFKTELNHLKNAS
                     PTVESGATKKWNGTPSQKVFGDDYHEVNRTLTSMLAIKWVLTGDYKTFTSGQDTGKLS
                     EKSFVKMQEFFRDRLPTPEDVYALIVALMIDDIGKDKALAENVEIPEENHGEVLLKAV
                     EKGLVPALEAITDQAKKQNIIQSLTIGSKLDISQIVQGETVPHSMLALNDSRNLHDAF
                     NIKAMVTLLDVGGAAAHSDPRGCIVMTQPIFDHYMKAIELLDEYRRKENPGWPECYNK
                     YLAYRADILKDNGFALLSTKDSEERALLRLLCMG"
     exon            complement(366750..367682)
                     /number=1
     tRNA            complement(369616..369688)
                     /locus_tag="AO090003t00002"
                     /note="tRNAscan-SE"
                     /product="tRNA-Thr"
     tRNA            complement(370039..370111)
                     /locus_tag="AO090003t00003"
                     /note="tRNAscan-SE"
                     /product="tRNA-Thr"
     CDS             complement(370331..370888)
                     /codon_start=1
                     /locus_tag="AO090003000138"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000086"
                     /protein_id="BAE57363.1"
                     /transl_table=1
                     /translation="MVAYLNLCFRALDELGQSFENAKRTRDFLVSLQRRWQAHMRRSG
                     SALKRQISNRPSSQHLVGLSSDADASRKKTRITAPRNQINYPVSATAASQATTAVPNQ
                     PQSQPQPSGQHPLDATQHIGVPGEFDWIRNSDLQLLSGNFGDSSFSQFGNVNTFGEDP
                     ALPSLSDIEPWWDTPNGNTFGGSSL"
     exon            complement(370331..370888)
                     /number=1
     CDS             complement(372186..373082)
                     /codon_start=1
                     /locus_tag="AO090003000139"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000087"
                     /protein_id="BAE57364.1"
                     /transl_table=1
                     /translation="MRPEDEAGVNRVLDTLQIPRGLAKKRETSAANEIISLPQKAVAH
                     SPAHSSPSAVPDANERPPEIPTPPQNALSNQKLVPSAEKGRETINSFGVNSIPTSHYV
                     PANWGFTLPTAESLDTIYANLNDGTSLSQENSLSPESLQLTPDMQQQPGELLRQARYD
                     RECESDSGDEDEAEKDVIEQISNRIGTLKIAGDGHLRFYGATSNLNLVDVSATQQRQR
                     PDARTVRHDGQDILNHLRVGQPVDQALEDHLVELYFTWQNTSTYVVDKDMYMIARSKW
                     RNEYDDTPFYSEVLTNAMYVSC"
     exon            complement(372186..373082)
                     /number=1
     CDS             complement(join(374109..374284,374365..375075,
                     375145..375180,375243..375276))
                     /codon_start=1
                     /locus_tag="AO090003000140"
                     /note="glyoxalase"
                     /old_locus_tag="AO070341000088"
                     /protein_id="BAE57365.1"
                     /transl_table=1
                     /translation="MATDTSTYKLNHTMIRVKDPKKSLEFYKFLGLTQIQQLDFPENK
                     FSLYFLAYNGPKSLQGDRHWTDRNAVLELTHNYGTENDPNYSVANGNTEPHRGFGHIA
                     ISVDNIESACKRIEDAGYPFQKKLTDGRMKHIAFAKDPDGYWVELIRRHNEDVGTTTD
                     TANYRLNHSMLRVKCAETSLKFYQEVMGMTLLRTAENKDAGFNLYFLGYPAGNPKVQE
                     DAKNPVAEWEGLLELTWNYGTEKQEGPVYHNGNAEPQGFGHICVAVDDLNAACERFES
                     LNVNWKKRLTDGRMKDVAFVLDPDGYWIEVIQNQALKRTSNW"
     exon            complement(374109..374284)
                     /number=1
     exon            complement(374365..375075)
                     /number=2
     exon            complement(375145..375180)
                     /number=3
     exon            complement(375243..375276)
                     /number=4
     CDS             377475..378146
                     /codon_start=1
                     /locus_tag="AO090003000141"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000089"
                     /protein_id="BAE57366.1"
                     /transl_table=1
                     /translation="MGCHSCRVFGTNGAIFAYASSLPSRQLRNLTATYGAAYTAYAKN
                     ASSGNLTGVNPASHPSSYVTAQSVSLGDVGSIVFELDELVAVVTRIADRVLLAAVGPS
                     KLEPEGETGPSNGAQNGSLNASADEFPLHEPRTGANGTSTNQTPTNGTPNSISRTHSE
                     ANMQSDAQLETQYEIDRSNDLARLASLNLSSSPSILLALESKSAALGKFLSQKLEDLE
                     SPEDF"
     exon            377475..378146
                     /number=1
     CDS             complement(378619..379845)
                     /codon_start=1
                     /locus_tag="AO090003000142"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000090"
                     /protein_id="BAE57367.1"
                     /transl_table=1
                     /translation="MVNMYLETEKNLKGTVSPTLERLHKEIKAKSKELTSGASKSAKA
                     VDKARAVTQKHIELLAQQTASMDAAAGNKLEQHHDPYILRRGVNHRLNKQIIEENNNR
                     KDIIAVQNNFQQFEAHVLQTIQGAMQEFVQIVSGQLEHQGTMYQDMLGSAQKIPPDFE
                     WVNFITKNDNVLINPDAPPRTLSNITFPNMDHRATMALIEGSLERKSRAMLKGYSSGY
                     YVVTPARYLHEFKDDDDFRRDPAPELSLYLPDCVIGAIDGVKFSVKGKDVSGSKVGNA
                     FHTTTELSFKAHTANDAEKWWTVIKDCTRGPVHTAAAATSSQPASPAVAQPPAYSEKA
                     NEATSPAQATAPQSATQATAPESATQAAQPMQPAASEAAAQSPVSPPAVSRTASTASG
                     HFHTAPGGTATTGDKA"
     exon            complement(378619..379845)
                     /number=1
     CDS             complement(join(380019..380198,380264..380392))
                     /codon_start=1
                     /locus_tag="AO090003000143"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000091"
                     /protein_id="BAE57368.1"
                     /transl_table=1
                     /translation="MSTPTSPVDKLPHRSSTLTSSIAPDRRASMSDDEAIPDSDSSET
                     TNLLNERLRALKHMCGYLEDYVTVTSKVQRSHSKDYEKVLKVSGLPSDYSSIYLYIQI
                     "
     exon            complement(380019..380198)
                     /number=1
     exon            complement(380264..380392)
                     /number=2
     CDS             complement(join(381729..381953,382003..382450,
                     382484..382617,382673..383101,383162..383480,
                     383539..383631,383766..383827))
                     /codon_start=1
                     /locus_tag="AO090003000144"
                     /note="thioredoxin binding protein TBP-2/VDUP1"
                     /old_locus_tag="AO070341000092"
                     /protein_id="BAE57369.1"
                     /transl_table=1
                     /translation="MALSFFSGGGSASHAKYFDIRAHLSGKLLLCLSEPLSIKHIRLH
                     LTGISRVCWHLPSSSAGGGRKSWRERVIYEKTWRFRDPGKGKTEILPAGNYEYPFNLV
                     LEGNMPESIEGLSDTYITYRFKAEIGRKYAKDIIVRKPLRIIRTLEPSALELAHAMSV
                     ENIWPNKIEYSISTPTKAVIFGTSIRVDFKLIPLLKGLTIGQIVSQLIESHDLTLNPE
                     DPDSIRNTYKNTRTILNDEFELDHDNALEIIDEAAEGYQFSRYLDLPKTLTRCLQDTD
                     TKGIKVRHKLKFRVQLMNPDGHISELRATLPVSIFISPNLAIDENNNLVDQTPQSAQR
                     AINDIAQQAPPFELDPNGYRTPGPGSGPGTPFGTLSRNLSAENLASMNALTNTDISAS
                     ALHSRLSNLSNLNITRPHQPSPTDHESQNDSEHRRLGVPADYFGPSSGSNSHSPSSPV
                     LSRRPSDEVDHEHVPSGMATPFHPQYAEVETLSRVPSYSTAVRTTKTFPFRHLSSHLS
                     KPISEMLGADLANSSLPWIFFIIGRALVTLTPLVTMMKTEDCDSFKLGLESRIRTEAA
                     SPA"
     exon            complement(381729..381953)
                     /number=1
     exon            complement(382003..382450)
                     /number=2
     exon            complement(382484..382617)
                     /number=3
     exon            complement(382673..383101)
                     /number=4
     exon            complement(383162..383480)
                     /number=5
     exon            complement(383539..383631)
                     /number=6
     exon            complement(383766..383827)
                     /number=7
     CDS             complement(join(391324..391338,391363..393515,
                     393671..393695))
                     /codon_start=1
                     /locus_tag="AO090003000146"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000094"
                     /protein_id="BAE57370.1"
                     /transl_table=1
                     /translation="MSRRPLVIFNNHHPVNGKSRPPTDGATSLDRESSSPASPSSTAS
                     PGSTDTATTSFPLNDIDYESDPAAVAQELNNLAAIRRMSMDVAATGDPDLPSFNSDFS
                     VPPSPSADENDAARLFWVPARLHPELAPKEFKSFLESKTEQIKRRSGDFNSLGPERQG
                     SSGGLRRKRSMLSRQIDNSHGYTDGAERLERKRSQSRRDPLTPNLQELESLVDNSKPR
                     STSPVTLLNEIQNLGITADEDRPILPPAPPGHSLRRSTRTQYRKAGSLKKGEKLPYSK
                     RFAKASDLKEGTLSTANSFGEQATSGLTRVSTDPTPSITRNQASGIPAQSAASPSNET
                     TRSAPESVSDQPQSGNDRPSESSTVETGGQTNASSQTRQWHSRLSSNGRSTLNIPPTE
                     QKIPEIIETPPPESNAAPTTQTSLSSATSGRGFAHDSPSPSSSPAKGSGNYDQSSSKW
                     SLHNRMHSKDSASTLSDFANSPQALPGNSTRTDSLSFIPTLSEERKPETKKSKDKKES
                     EGSRKSSWHWLLGSEEKDKDKDKEKKKDKESDAKKIKAKLVDKVHETANALPSSNDSG
                     QRGRESLVLDRLDPKLEEERRKDHVRRTSGESKKEKESGLFSSLFGGGKKKSSTDSHH
                     KKSSSRTLSPDPPPRELRPDVDYPWTRFTILEERAIYRMAHIKLANPRRALYSQVLLS
                     NFMYSYLAKVQQMHPLMLASSASQRHQKARDQQDDYSGYQQYQELHTR"
     exon            complement(391324..391338)
                     /number=1
     exon            complement(391363..393515)
                     /number=2
     exon            complement(393671..393695)
                     /number=3
     CDS             complement(join(396622..396643,396703..397766,
                     397841..397944,398037..398079))
                     /codon_start=1
                     /locus_tag="AO090003000147"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070341000095"
                     /protein_id="BAE57371.1"
                     /transl_table=1
                     /translation="MPLGIHNPLPSSLNSECRKAGKILASFIDPRQAFGPDKIIPPEI
                     LAGAKGLAVLTVLKAGFLGSARFGSGVVVARLADGSWSAPSAIATAGAGFGGQIGFEL
                     TDFVFILNDAAAVRTFSQVGTLTLGGNVSLAAGPVGRNAEAAGAASTKGVAAVFSYSK
                     TKGLFAGISLEGSMLVERKDANEKLYNSRVSARQLLSGTIRPPPSAEPLMRVLNSRAF
                     YGNTRNGDGMYNDIPIYDDHHDDVVWEGRRGDAYGQGLRRDRTGANDVDTYEYRDRPR
                     RANTWADDIYDRPAGGLSRSSTTRSPRNDTFDTYGRNRSNTAPFEEDYVYSDHKPSRP
                     TAPKPVFGQRTGQAPSLRQDQAIALYTFDADQEGDLGFKKGDIITIVKRTEKKEDWWT
                     GRIGDRVGIFPANYVDTA"
     exon            complement(396622..396643)
                     /number=1
     exon            complement(396703..397766)
                     /number=2
     exon            complement(397841..397944)
                     /number=3
     exon            complement(398037..398079)
                     /number=4
     CDS             join(398893..398902,398961..400852)
                     /codon_start=1
                     /locus_tag="AO090003000148"
                     /note="predicted Ras related/Rac-GTP binding protein"
                     /old_locus_tag="AO070341000096"
                     /protein_id="BAE57372.1"
                     /transl_table=1
                     /translation="MATVRICVCGDEGTGKSSLITSLVKGVFVTNKIQPILPQITIPP
                     TIGTPENVTTTTVVDTSALPQERSNLAREIRKSNVILLVYSDHYSYERVALFWLPYFR
                     SLGVNVPVVLCANKSDLAADHSEAQVIEEEMLPLMAEFKEIDSCIRTSAREHRNVNEA
                     FFLCQKAVTHPIAPLFDSKESALKPAAVAALQRIFYLSDKDRDGYLSDKELEDFQMRC
                     FEKPLSEEDLVHIKETIQKTHPTSVAPSGIDCRGFIHLNKMYAEKGRHETVWIILRAF
                     QYTDNLSLQESFLHPRFEVPPYASAELSPEGYRFFVNLFLLSDKDNDGGLNDAELASL
                     FAPTPGLPASWADGSFPSSTVRNEAGHVTLQGWLAQWSMTTFTSPKTTLEYLAYLGFE
                     SSDRSNPSTTAALKVTRPRKRRKRPGRVGRNVVLGHVLGPPGSGKSALLDAFLARGFS
                     TTYHPTIQPRTAVNTVELPGGKQCYLILDELGELEPAILENQVKLLDQCDVIVYTYDS
                     SDPDSFAYIPELRSKYPHLEELPSVFVALKADLDRTTQRAEYQPHEYTAMLNMPSSPL
                     HVSVTWSSMQEVFVHIAEAAMEPSTAFPRSEEDVEGKWMAWGIALGAVVCAGAAAVMI
                     WRRVSGSGT"
     exon            398893..398902
                     /number=1
     exon            398961..400852
                     /number=2
     CDS             join(402097..403118,403205..403490,403551..403748,
                     403823..403898,403954..404090)
                     /codon_start=1
                     /locus_tag="AO090003000149"
                     /note="WD40 protein DMR-N9"
                     /old_locus_tag="AO070341000097"
                     /protein_id="BAE57373.1"
                     /transl_table=1
                     /translation="MAQGPSCASELHYYRALDHANAGFATGTYHLKDDLHLATPPPHP
                     SEAPVVNPNPLATVPTPPTSGVKLSLVSVGQRNKLPVFTSKEKVTAPPFADGNPALAA
                     IPTKDGLKRRKPKNNIIKSSSSFVSRVITHEASSKRLNDRNPDGLFAFANINRAFQWL
                     DLSSKNKEEPLAKILFTKAHMLTHDINELTKSSSHIDIAMGSSAGDIIWYEPISQKYA
                     RINKNGVVSNSPVTHIKWIPGSENMFMAAHANGQLVVYDKEKEDALFTPEISNHSAEA
                     MKASSRLPLQVLKSVNSRNQKTNPVALWKLANQKISQFAFSPDQRHLAVVLEDGSLRV
                     MDYLKEEVLDIFRSYYGGLICVCWSPDGKYIVTGGQDDLVTIWSFPERKIVARCQGHN
                     SWVSTVAFDPWRCDERTYRFGSVGDDCRLLLWDFSVGMLHRPRAHQASARQRTSMIAS
                     NTQHFNRHRADSASNRMRSDSQRTADTYNDYDSAVRHPVEPRARTALLPPIMSKIVGD
                     DPICWLGFQEDSIMTSSLEGHIRTWDRPREGINDSYNGNTSSPAISTSAAGSGSGIAD
                     SAMGSL"
     exon            402097..403118
                     /number=1
     exon            403205..403490
                     /number=2
     exon            403551..403748
                     /number=3
     exon            403823..403898
                     /number=4
     exon            403954..404090
                     /number=5
     CDS             complement(join(406274..406294,406345..406502,
                     406770..406807,407023..407049,407147..407207,
                     407695..408020,408105..408230,408301..408379,
                     408440..408491))
                     /codon_start=1
                     /locus_tag="AO090003000150"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000098"
                     /protein_id="BAE57374.1"
                     /transl_table=1
                     /translation="MRFFQIASIVAYAATSLAVTITSPQNGDKVDFSKPYTVKWTTVP
                     SDPEQVNIVLKNQTSSEKEIAKNVKTSDGKYTIDSIWDIETGTGYQFNFISNSTKNTG
                     ILAQSQIFNVTAVADPPKPCKQYFSTKITKTSSSTTPSCTCTSISTTIKTRTTSRPCI
                     IHSTLSTSKSSPSSSRAPCSPSSSTALPSASVNKVLSLPGLDMSFECDVHGRCNEAID
                     ISIDNRNLAWENAYTRSSALPSHETKTLSLRMISERDAEQGKGISAIVHRCTSVARAP
                     AVGMALKRSYGVGKKLLMI"
     exon            complement(406274..406294)
                     /number=1
     exon            complement(406345..406502)
                     /number=2
     exon            complement(406770..406807)
                     /number=3
     exon            complement(407023..407049)
                     /number=4
     exon            complement(407147..407207)
                     /number=5
     exon            complement(407695..408020)
                     /number=6
     exon            complement(408105..408230)
                     /number=7
     exon            complement(408301..408379)
                     /number=8
     exon            complement(408440..408491)
                     /number=9
     CDS             join(411738..412046,412078..412206)
                     /codon_start=1
                     /locus_tag="AO090003000152"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000100"
                     /protein_id="BAE57375.1"
                     /transl_table=1
                     /translation="MRIQSIALFLGLCTAVLAVPHKPHNARYMGKDWQESSSSTATPT
                     PTPSPTPRPTPRPTPTTPPGDDDDSGEFPFPWPTEWPPIFDDFPDIGGNDDSSSGDVP
                     DMSRAMSVFGRGRSRRMDSTLKTLFGLCGGGHFVLSSCPALKV"
     exon            411738..412046
                     /number=1
     exon            412078..412206
                     /number=2
     CDS             413389..414504
                     /codon_start=1
                     /locus_tag="AO090003000153"
                     /note="predicted unsaturated glucuronyl hydrolase
                     involved in regulation of bacterial surface properties,
                     and related proteins"
                     /old_locus_tag="AO070341000101"
                     /protein_id="BAE57376.1"
                     /transl_table=1
                     /translation="MASKHPASEIHRVIDLLIDNLINIRDDKGEFLLHLKDGRTIQAK
                     CWNGWEWTHGIGLYGVWKFYEITGQAKYLKIIEDWFAERFAEGGTTKNINTMSVFLTL
                     AYVYEKTGNLTYLPWLDAWGEWAMYELPRTKYGGMQHITYVAENDQELWDDTLMMTVM
                     PLAKIGKLLNRPEYIAEAKRQCLIHVKYLFDTKTGLFFHGWKFENGGHGNGGHNFADA
                     RWARGNSWCTIVIPEILELLELEPNDAIRTHLCDTLEAQCEALQQSQSVSGAWHTLID
                     HPDSYLEASATAGFAYGILKAVRRRYIGSQYRAMGEKAISSVLKDVDEKGELQNTSFG
                     TPMGHDLQVYKDIPLTAMPYGQAMAIMALGEYLWTYL"
     exon            413389..414504
                     /number=1
     CDS             join(415323..415352,415447..415771,415814..417096)
                     /codon_start=1
                     /locus_tag="AO090003000154"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000102"
                     /protein_id="BAE57377.1"
                     /transl_table=1
                     /translation="MVDRADNQLRELEKDYCPPLDPALFTAIACDYDLSDSAQLQQLR
                     ETLDTLKLSAWEQEDLPFDPSGTSGLGANGVDSEGIPSEHSVSQNGTVRSRETDITSL
                     ASEFSSFSVGDKGSHNDGSLCLSGATEEDKIGYLSEMFPSVDKFTIQHALRKSNGDVD
                     RSMDVLLNLTFFSEQPSIEDGDKVAIPKGIDGFQDGSNGETGRKKNRKRKGKTKSGRN
                     YERSSPLDSEPGCFLQDEPCTVNKWDAAQKDIEFIHSRTSPVLKKEMVTSTYHANGAS
                     LTATIRSLAETHAPKDERAISQDTVTEAQVAELIQELPSIPPTTFAGLLKITRSSVSA
                     ASELAAAMVTGPVSPSMSELIKFTTSPPPVDVDVETPRRRNEPRVIRDYDRVRSSAGA
                     HFAASSEALAKASAAYRRGKSDRLMGGAAAYYSAVGRDHLERAKRDAAEAADALVDSQ
                     STHNTLDLHGVSVQDAVRIASERVSDWWESFGDAKYVRGGEIARSGYRIVTGLGRHSH
                     DGTSRLGPAVGKMLAREGWKVEVGEGVLTVVGVVRRH"
     exon            415323..415352
                     /number=1
     exon            415447..415771
                     /number=2
     exon            415814..417096
                     /number=3
     CDS             join(418840..418948,419045..419213,419273..419317,
                     419387..419489,419543..420868)
                     /codon_start=1
                     /locus_tag="AO090003000156"
                     /note="predicted GTPase-activating protein"
                     /old_locus_tag="AO070341000104"
                     /protein_id="BAE57378.1"
                     /transl_table=1
                     /translation="MSRRATPGQAAQNQQTIKGLLKLEHNKICADCKRNKHPRWASWN
                     LGIFVCIRCSGIHRGMGTHISRVKSVDLDSWTDEQLQSVMRWGNARANKYWEAKLAPG
                     HVPSEAKIENFIRTKYESKRWIMDGPMPDPSTLDDGDDDVPLAVVQEKAKIERSASQR
                     VAASSQPPAAHRQQASIDLFADDDIAPPARPSTTDPTPRAAPKQPQSAPKPTRPGDSL
                     LGLDFFGSAQPAANSHPSSTASTPGGSTGISRPDLKQSILSLYSKPQPAPAQHGRTSS
                     FGDFGDLASPAPPSASPSSNLGGLTDAFSGLSFPSTTSPPPQKPAEKSSPFANLTSFA
                     TKKSSPAAPKVSSPTASAGSGGGSLFDSLASPTIPAAKPQSRTTSISSNGFDSGFTSF
                     ASPPPSKPNPPPSSSLSNDLFGLSSPAPVAPSKVSSPPAPTAISPQNELKAAFNLNPP
                     VPAPVSAAPKPSMSATTASIASALPASIDPWGGGNAWSTPDPAPAAEPSGPSMMKVPD
                     TLTANDIGAGWGATASTSGGSKQAPTVAADEDFGGWTSAAPISSTTAATTTNMSVPSK
                     PAGGFSGADDLFSNVWE"
     exon            418840..418948
                     /number=1
     exon            419045..419213
                     /number=2
     exon            419273..419317
                     /number=3
     exon            419387..419489
                     /number=4
     exon            419543..420868
                     /number=5
     CDS             join(421675..422103,422163..422639,422707..423915)
                     /codon_start=1
                     /locus_tag="AO090003000157"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000105"
                     /protein_id="BAE57379.1"
                     /transl_table=1
                     /translation="MADYRRPIPTGKELPQSVTSTPRVRLSCELCRQRKVKCDKLNPC
                     TNCQRFGATCVPVERARLPRGRSGRVTGKNASGQDTGLKDRVDRLEELLRELTEHDDG
                     TIAAQVGSSSSGSSDQAPANKKADKSEPGTENSLWANILKEIHDIRGTKSYGSTNEDR
                     TFNSDAMKFRKLLATPRGLGSSMATKEPILTRQAERNLVQVFLKKVDPAFKILHAPSL
                     KAFLLDGKPYLDYEPGHMAPAALSSAIHFAAACSATEDESNDLLGCNKAWLVARYQQE
                     SEAALAKADFMTSNDLTILQAFVLFLLASRSQDSSRRVWTMLSMALRIAQALLLHLPE
                     LPFPVRPFERELRRRLWTYIGLLDIQCSLERASEPMMQAKWVDSNPPSNVNDCDIFFG
                     MDGPVQESEGFTEMTFALMTLKAQNTVRLLNFSDFIDKTVSCVNKRQQLVLEFQETAS
                     KLLQNSQPDKIPFHWYTRQVAEIISASLQLIVLRPLQRNAKFIPPRVRGDRLLQIAVD
                     VLKKSKTIRNDPRGQSWRWCEFMFVPWHSLAVAIAELCVCEDHSLMESFWGPVRDAYE
                     NLGDLIADSRRGMIWKPMEKIMAQAEAKRNELLAVSNVVSYPTHFPGTAAPLQVPVCS
                     QRSMQPSVALTGDIIPNTGAYTEAVPIVTLPETVELGPWPSVWDAVDFGCPVATNEMS
                     WLNYENFIEDVYETMDYTLLSH"
     exon            421675..422103
                     /number=1
     exon            422163..422639
                     /number=2
     exon            422707..423915
                     /number=3
     CDS             complement(join(424716..426574,426630..426959,
                     427029..427062))
                     /codon_start=1
                     /locus_tag="AO090003000158"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000106"
                     /protein_id="BAE57380.1"
                     /transl_table=1
                     /translation="MSTATPRTSLREGLRQAPKANQPFIPDTAPVRRSHVHAHPQSPQ
                     PVSMSQTHTNSVASNSPHPTIDSWEGREQKVPMSTREVATPGNRPGLFIGLNDRGKTA
                     KQPDFYDPYFPLRYLEVPKSDHIYKRAHYGLQSGISDEVDFALYHLVQISNQRWDKFK
                     FEGFPLLAETLMEKAIDISILCTGVKWELQYDFRQPTDRVNVLNSLHGTRDILEKIKQ
                     IPVTLPDDTLETYEFNHRLRNVKEATLVLRNMVLLKENAFYVSRYAKGLLRDFLVILI
                     NLPNQPRLNEIKNDALDIAEEVTKFMRTDPEDPLWISLLGCLESPDRAHVIRALWALT
                     HFSTELDDQEANRAMERVPKDTLQQLYFHTLLDQDRDILSGALDFWYQYTLSRENIEN
                     LIDIFNLPIVFAPRMIALLTHDARPSKKETVLQEEKVAPPPSEIPRVPPELLKDLMEL
                     SEPERSSRWLRCCFVEDADCEITQIALWQAYQSRFADPRVPGGGVLPAAEFIKNVSTT
                     FTNAQAQVINGPGATTRFIIKGIRPLETAYTFQGFPYLFCKWTDNSKPSKTCQRAFKT
                     PTDLRNHVFSDHMNLATSGEEPGHYNLDKAESPIHTCLWDNCTKFRSSGPSANTAMVA
                     GHVSSHLPEERPADAEAPSSKRPVLQERIVRKWFYLDTPVNERGEPVGVAYKAALVLR
                     NLARNLPDRVAQQYDGLSWKKAVFLSHRPRIVEIWDRNRSLRKELTELIMILEREEYY
                     "
     exon            complement(424716..426574)
                     /number=1
     exon            complement(426630..426959)
                     /number=2
     exon            complement(427029..427062)
                     /number=3
     CDS             join(428284..428421,428492..428632,429074..429346)
                     /codon_start=1
                     /locus_tag="AO090003000159"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000107"
                     /protein_id="BAE57381.1"
                     /transl_table=1
                     /translation="MSHRGPFNWSHIIGNGDIICIFERHAIPSPLYSRVLLKVMRDHD
                     ILEQIDIMHLSRDAMGQPQPSQHGQTKPIFAVVVKLPCLAVKYPEGSGCWSLSVQCQS
                     KAQFNQCYCPYETVITSSIERQYLNWSHIKTINSYNLPRYSGSQSAFASEKRPAISQT
                     TGKETMFNIGATTFYRLTHRRSI"
     exon            428284..428421
                     /number=1
     exon            428492..428632
                     /number=2
     exon            429074..429346
                     /number=3
     CDS             complement(join(430359..431149,431289..431878,
                     431944..432432,432496..432608,432680..433090))
                     /codon_start=1
                     /locus_tag="AO090003000160"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000108"
                     /protein_id="BAE57382.1"
                     /transl_table=1
                     /translation="MNSREHSDMPPTASYPSPNAAQMGQGAMQYYANRQLTADELLSA
                     ELSRETSGPGLADGSSNGVHHGQSMVLGSSNPGGGDMGRPSSPDQHQQQHMLQFTPSQ
                     QVGVDPNHDLSYGDQSARRKRSKISRACDECRRKKVRCDASSESGVETCSNCRRLGVV
                     CQFSRVPMKRGPSKGYIKELAERLHTLESQMQPAMVHPDMPYQSMNEVSSPRAYQDFS
                     PPMDAGSIGRKRTYSVFEGLPSSSFTQPQFNSRSQNAFGSCPSTIVFGLTLLTIQDTG
                     ETSTDPYNPSAVSGTAPKPGNLFWTTGNETELPHGLEVPEVPKQAMEEDMTPLDVDEG
                     SLNAYYQKIHPVFPILSHSKERLLEILHQCSREVQEIFLYSLYTVTRTNMDRVISTFE
                     RVTSFDNAQDLLLYYTRQPALARPTGVNLIWLQTMLLMILDCDSRGPDNFVLKDGVPK
                     HSLIQSASKLGSDLAKGLGQLKSKRSSDPDVDSEANLVRRNWVALAILSRWHAISVAD
                     PSILGTYEIGGREDERVVGPVATGIGCRMVGANMLASLERLTQVEDFHKSNETLESAT
                     SQSFLDSLQNQLEWTIRLLIKRHIYVYSPYEIIHSAVEVINEMHKSNTQSRLTTPFDL
                     HSLALASMTLLEATVIPEHANECWDALKKVEEILDYRAKRSGEATEFSDIFATPGWDS
                     KIRIFLEWRRTKSQESQLQDPSLGKSGSAAPPVMGPNEQRSLQHLADLAVGAEGTVAA
                     NAGSPPPGLSTESNLNATSPNLTSVSQPQGRVVVDFTLLTKEGYLNVFSGLIYRRSR"
     exon            complement(430359..431149)
                     /number=1
     exon            complement(431289..431878)
                     /number=2
     exon            complement(431944..432432)
                     /number=3
     exon            complement(432496..432608)
                     /number=4
     exon            complement(432680..433090)
                     /number=5
     CDS             439649..440323
                     /codon_start=1
                     /locus_tag="AO090003000161"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000109"
                     /protein_id="BAE57383.1"
                     /transl_table=1
                     /translation="MAFQDPYKEQFFTSPDNDMTLGPTGFNAPPVDWSSFPLYSSDVP
                     AATSTQAPSYASFDYNSMSHGLPAPSSSGDISEVEDFAPFSGFGNAGNDLQDLASGSE
                     GSDLDHFRISSASSFIGLPQAQLLSSNQLDSINIDDFLKSANESTAALEHQLQANMGM
                     EPKPLPSQDAYAISDAQTFKPMTTPTTSLSMTTSAADPMWPAALFDPAAASVDDNNFY
                     PPSWVQ"
     exon            439649..440323
                     /number=1
     CDS             join(446375..446489,446600..446825,446930..446981)
                     /codon_start=1
                     /locus_tag="AO090003000162"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000110"
                     /protein_id="BAE57384.1"
                     /transl_table=1
                     /translation="MDPVAPVQEDIRRVGRKELYTDFGKRMEYIKTFLDFTDVIPELT
                     HRLYEKMLEFDITARALRTRSTTSEAQIEDLFTIDSPQVQRRKIFWKWYLTRLCSDPG
                     QPSYWEYLRKVGVHPYECLSRLRKTTSL"
     exon            446375..446489
                     /number=1
     exon            446600..446825
                     /number=2
     exon            446930..446981
                     /number=3
     CDS             447040..447621
                     /codon_start=1
                     /locus_tag="AO090003000163"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000111"
                     /protein_id="BAE57385.1"
                     /transl_table=1
                     /translation="MSKVFCIQNDLISKCYINEGQEFAEEASNTTNADNAPAKGNTDN
                     ASIATCITDNASAVTGTTDTVSMTTTDSMTTTDTVSIANSEVSSMTRDKQSHPHCLIP
                     GFNTSRPSSAGDTQSSISRDRSGSVDLDRVNSTAETAVSSDCPSTSSSHMISPNVVSN
                     PSAFASPFAVGHIHNFETKIWSSGMKQKGSGYK"
     exon            447040..447621
                     /number=1
     CDS             complement(join(448243..448497,448555..449796))
                     /codon_start=1
                     /locus_tag="AO090003000164"
                     /note="alanine aminotransferase"
                     /old_locus_tag="AO070341000112"
                     /protein_id="BAE57386.1"
                     /transl_table=1
                     /translation="MATQTTVSYTTTRTLSTPARCLNPDNINPHVTEAKYAVRGELAV
                     KAEEYRVKLANGDKSLPFDSVIFANIGNPQQLDQKPITFFRQVLSLLENPQLLNNTEA
                     LRTSFFYEQDVVDRAKKLLADVQSVGAYSHSQGAPVIRQSIAKFIEERDGFPANPQDL
                     FCCAGASSGVSTILNIICNGPQAGVLVPIPQYPLYTATLSLLNAQCVPYLLEEQKAWG
                     TDVTAIRNSLAQARSTGTDVRSIVVINPGNPTGASLSAEDIKNVLDLAAEEKLVVIAD
                     EVYQTNVFEGEFISFKKRLRQLQQETPGKYDYVELVSLHSVSKGMVGECGHRGGYFEL
                     VGFDPEVQAQIYKLVSIGLCPPVIGQCLLELMVNPPKEGEGSYELYQKEYNGISEGLH
                     KRAFALYEAFQQMEGVECQKPQGAMYLFPTITLPPKAIEAAKAENRAADEFYCLRLLD
                     ATGVCVVPGSGFGQKENTLHFRTTFLAPGTDWVERIVKFHSEFMAKYK"
     exon            complement(448243..448497)
                     /number=1
     exon            complement(448555..449796)
                     /number=2
     CDS             complement(join(451267..451459,451516..452342,
                     452407..452862))
                     /codon_start=1
                     /locus_tag="AO090003000166"
                     /note="26S proteasome regulatory complex, subunit
                     RPN7/PSMD6"
                     /old_locus_tag="AO070341000114"
                     /protein_id="BAE57387.1"
                     /transl_table=1
                     /translation="MGSDPQYIKFPDLTLAQHVFNLSNPSCPQTVRQTSLKKVQDAIS
                     ENKMAPFYRHLAHPVEGILNHSGEGVPQHQASSTKSLITSNMLASRKSPQKIDFPWDE
                     SLYQSLVEDNKKELDAFQKEEDEAEEAAGDTEVLAARGKRAEFWARVGDKDKAIESHE
                     ALLEKTTFLGTKIDLVLAMIRIGLFFGDTLSVRKNIERANTLIESGGDWDRRNRLKAY
                     KGLHLLTIRSYSVAAPLLLDSLSTFTSYELCSYSALVIYSVLAGSLSLKRVDFKAKVV
                     DAPEIKAILGSGEDRVAALTGEVSSGPGAKDEEMKDASTSRATPGAATTAVNLTTLGA
                     GSGIQAEAEAPVDFSPLANLVSSLYNGNYRSFFVALAAVEDNFLTQDRYLYEHRAWFV
                     REMRLRAYQQLLQSYRVVGLNSMASDFGVTVDFLDRDLAKFIASNRIACTIDRVNGII
                     ETNRPDDKNKQYADVVKHGDALITKLQKYGQAVRLRGSERS"
     exon            complement(451267..451459)
                     /number=1
     exon            complement(451516..452342)
                     /number=2
     exon            complement(452407..452862)
                     /number=3
     CDS             join(454373..454543,454617..455215,455270..455315,
                     455344..455654,455716..455986,456040..456132)
                     /codon_start=1
                     /locus_tag="AO090003000167"
                     /note="inorganic phosphate transporter"
                     /old_locus_tag="AO070341000115"
                     /protein_id="BAE57388.1"
                     /transl_table=1
                     /translation="MDPQKHSEEPPEKAVASPDAVPIDVAPSENMQKGRWERSWPTIA
                     CGAGLFSDGYLNGVIGSVNTILGKIYPDSYSNSPASQNVSSITFAGTVLGQLVFGYVS
                     DHWSRKWSLMISTIILIIFSALCAGAYGLNGSQYGLFAALTAYRFFLGIGIGGEYPAG
                     SVAAAENTGELKKGHRNRWFIMFTNFQIDFAYVVSALVPMILVLICTENHLRLVWRIA
                     LGLGVIPPLSLFYLRLKLEEPEEFNRERMHKFPVWLIIRFYWKRLVCPQCCHFRTVVS
                     LIWFIYDFSAYSFNIYSSKWVGIILGDSAPLWKTFGWTTVTNAFYIPGSFLGALVSDW
                     IGPRNTLAIGVGLQGVIGFVMSGCYEYLSIPKNVAGFVVVFGIFSALGEFGPGDNIGL
                     CAAKSSATAIRGQYYAIAAAAGKIGAFVGTYVIPIIQKNAPNEVRSGQDPFFVSSSLC
                     LLSAAMAYFLLPHIGQDTITEEDEKFRAFLEANGYDTSTMGNREAR"
     exon            454373..454543
                     /number=1
     exon            454617..455215
                     /number=2
     exon            455270..455315
                     /number=3
     exon            455344..455654
                     /number=4
     exon            455716..455986
                     /number=5
     exon            456040..456132
                     /number=6
     CDS             join(457297..457363,457522..457999,458059..458221)
                     /codon_start=1
                     /locus_tag="AO090003000168"
                     /note="peroxisomal biogenesis protein (peroxin)"
                     /old_locus_tag="AO070341000116"
                     /protein_id="BAE57389.1"
                     /transl_table=1
                     /translation="MVANALAYHPTLAHYLRFVATTVGRDKILRTLQYFSRFYAWYLY
                     RTNRPQSSIDPYNAVKKQFGTTRKILRIGKFAEHLKAAAVAADNKSPVDPVLRYLAVG
                     RQLGYAGYLTLDTITVIDVIGFRKLAAAKRLQDTAYRSWLAGLICSAIASVYSLWRLR
                     EKERTLDRTEGEGVVEAKKLEKERSAARIQLFSDLCDLTIPVSGLGLANLDDGIVGIG
                     GTISSLLGVVSQWRKTA"
     exon            457297..457363
                     /number=1
     exon            457522..457999
                     /number=2
     exon            458059..458221
                     /number=3
     CDS             complement(459764..460510)
                     /codon_start=1
                     /locus_tag="AO090003000170"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000118"
                     /protein_id="BAE57390.1"
                     /transl_table=1
                     /translation="MYTSIYFILNTLLASNLASQTYASPFQPQVDQIRVPEPVSPNTH
                     WPNFNDIISQVTQPTEKEESLSGSLGLRYGSCYYIENRQGDTLGSDGGVYSYYKFGSS
                     KRIFQVWYSRGFPWKDGSSYQLVPDGGKFYLWDPKGSSVTNGGSWIATNLGGNTYPGF
                     YSYYYYLHFKGRRDDHGSGAMPQSENEMHMMGSRYPVTLEIAKVEPPNGIPNYKGLTI
                     SNGYLQNRNNEDSVDVRFHEVSCPVDGADD"
     exon            complement(459764..460510)
                     /number=1
     CDS             join(462989..463006,463172..463297,463351..463389,
                     463506..463679,463752..464065,464125..464182)
                     /codon_start=1
                     /locus_tag="AO090003000171"
                     /note="Na+/H+ antiporter"
                     /old_locus_tag="AO070341000119"
                     /protein_id="BAE57391.1"
                     /transl_table=1
                     /translation="MKVPSSYVHIVLRGGSVIDSSHSIKASISFFSAIYLYNSSKDGI
                     WVKLSPPFLLAFPLDLLALTRLVIGIQLVKVGYQLPKRYIKQRSIELTFCLLPLMGIG
                     WVITSSCIMLMVPNLSFLAALIIGSCVTCTDPILSQAIAKGPFADKYVRRHLREFISS
                     EAGGNDGFGFTFLLLAVSLLRYAETPANAESLREFDLVRGIPDVLGAADVGRFGGGVG
                     KALKHWVHDSQTLGHSPEEVCELR"
     exon            462989..463006
                     /number=1
     exon            463172..463297
                     /number=2
     exon            463351..463389
                     /number=3
     exon            463506..463679
                     /number=4
     exon            463752..464065
                     /number=5
     exon            464125..464182
                     /number=6
     CDS             join(464310..464676,464743..464844,465742..465749)
                     /codon_start=1
                     /locus_tag="AO090003000172"
                     /note="Na+/H+ antiporter"
                     /old_locus_tag="AO070341000120"
                     /protein_id="BAE57392.1"
                     /transl_table=1
                     /translation="MLVVGTCGCVGSDETLACFIAGSFLNWDGVYNSEMQARHDTFNP
                     TLKTLLNFGTFMYLGAVMPWEQFHMPHDTGITLPRLFGLGFLILVLRRIPTILLGYRF
                     IPAVCHDWTEALFMGYFGPIGIGAISYVEYARRLFPDSGESDNEINNLTAAMIPEV"
     exon            464310..464676
                     /number=1
     exon            464743..464844
                     /number=2
     exon            465742..465749
                     /number=3
     CDS             join(470743..470792,470928..471003,471060..471260,
                     471562..472905)
                     /codon_start=1
                     /locus_tag="AO090003000174"
                     /note="phosphoenolpyruvate carboxykinase (ATP)"
                     /old_locus_tag="AO070341000122"
                     /protein_id="BAE57393.1"
                     /transl_table=1
                     /translation="MVATSVNRTALHPGGVQPGKGHTELEEELHEHAHIDYERVAIIA
                     NPAVPALYEDALVYETGTAITSSGALTAYSGAKTGRSPSDKRIVKEESSEQDIWWGPV
                     NKPMTPDVWRINRERAVDYLNTRNRIYVIDGFAGWDERYRISVRVVCARAYHALFMRN
                     MLIRPSQEELKHFHPDYVIYNAGSFPANRFTEGMTSATSVAINFAEKEMVILGTEYAG
                     EMKKGVFTVLFYEMPVKHNVLTLHSSANEGKNGDVTVFFGLSGTGKTTLSADPNRALI
                     GDDEHCWTDRGVFNIEGGCYAKCIGLSAEKEPDIFNAIRFGSVLENVVFDPISRVVNY
                     DDSTLTENTRCAYPIEYIDNAKIPCISDKHPTNIILLTCDARGVLPPISKLTTEQTMF
                     HFISGYTSKMAGTEDGVTEPQATFSSCFAQPFLALHPMRYATMLAEKISQHKANAWLL
                     NTGWVGAGATTGGKRCPLKYTRAILDAIHSGELANAEYEVYDVFNLHVPKSCPNVPSE
                     LLNPKNSWTASTSFKDEVNKLAKLFNENFTKYADQATKEVIEAGPVVA"
     exon            470743..470792
                     /number=1
     exon            470928..471003
                     /number=2
     exon            471060..471260
                     /number=3
     exon            471562..472905
                     /number=4
     CDS             join(476979..477874,477945..477993)
                     /codon_start=1
                     /locus_tag="AO090003000175"
                     /note="mitochondrial oxoglutarate/malate carrier proteins"
                     /old_locus_tag="AO070341000123"
                     /protein_id="BAE57394.1"
                     /transl_table=1
                     /translation="MASPTTKESQAAMDFLHHPYTRAALPFINGGLAGMTATTVIQPI
                     DMIKVRLQLAGEGVRTGPRPTAFGVARDIIAGGKILDLYTGLSAGLLRQAVYTTARLG
                     FFDTFSKTLNKRAEAANRKITFAERAGAGLTAGGIAAMIGNPADLALVRMQSDGLKPL
                     EARANYRSVVDALFRISKNEGIPALWAGALPTVVRAMALNVGQLTFFAESKAQLKAHT
                     SLSAQNQTFAASAIAGFFASFLSLPFDFIKTRLQKQQKDPKTGQVPYKGVLDCARKVA
                     KDEGWLRFYRGFGTYYVRIAPHAMVTLIVADYLNLITK"
     exon            476979..477874
                     /number=1
     exon            477945..477993
                     /number=2
     CDS             complement(478709..479122)
                     /codon_start=1
                     /locus_tag="AO090003000176"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000124"
                     /protein_id="BAE57395.1"
                     /transl_table=1
                     /translation="MIAHSSTTVPAPQPAGAAGRSARRVRSVKCPVCSVVLTAADLRP
                     DPVLVRRVRRHEAALRREAEEDELSDGARRRRSGARKSGITLVDDDGAEDANEMDVDS
                     DETSDEDDRQNKESSSSQDHVRIKQEMSTAPVDDD"
     exon            complement(478709..479122)
                     /number=1
     CDS             complement(join(480780..480814,480863..481029,
                     481084..482325,483019..483083))
                     /codon_start=1
                     /locus_tag="AO090003000177"
                     /note="mRNA cap methyltransferase"
                     /old_locus_tag="AO070341000125"
                     /protein_id="BAE57396.1"
                     /transl_table=1
                     /translation="MADENPQAQGAEGGGKGKSSSMRLQERHQQLRKRGRTPPSAYAR
                     RDMNETAQQHNRNESSNRSPSPLAPPRSPSPDAQARKRKRPGGGARMGLVDRETLRRR
                     QEERERSQQEEAMRFSQNRGVTDIVRHHYNAVPQRGREWRKTESKIKGLRSFNNWIKS
                     TLIQKFSPDEEFVARSIGTKDWADETAPPPMEDKRLLVVDLGCGKGGDLGKWQLAPQP
                     VDLYVGLDPAEVSIVQARERYNGMRTGRGPRGRRGPLFHAEFAPKDCFGEYLGDVPIV
                     QQVGIDPNAGPGGSVMSSRWGGGGFDVVASMFTIHYAFESEEKARQMLRNVAGCLKKG
                     GRFLGVCPNSDIISARVAEMNAKRKERETAAKKEEAEPEDGEVEEDDNKIEWGNSIYR
                     VRFSGDTPEDGIFRPPFGWKYSYFMEEAVEEIPEYVVPWEAFRALTEDYNLELQYRKP
                     FLEVWKDEKDDQELGPLSERMGVRDRNTGALLMTEEEKEAASFYHAFCFYKV"
     exon            complement(480780..480814)
                     /number=1
     exon            complement(480863..481029)
                     /number=2
     exon            complement(481084..482325)
                     /number=3
     exon            complement(483019..483083)
                     /number=4
     CDS             complement(483785..484465)
                     /codon_start=1
                     /locus_tag="AO090003000178"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000126"
                     /protein_id="BAE57397.1"
                     /transl_table=1
                     /translation="MADQLPFQEIIQTPEPFDLETIIKILPDDFERLEEHTEIAVPQT
                     PQRVDENQLASVQSPSNRGISINRTAFALAFFGWDSVADGAAGLAGCGACFRRLGLWM
                     YKPKNNGDVSVYDALDVATEHMEYCPWVSGKAQSGTGKSSEKSAELRSGWELLAQALK
                     VKHRRHIRSTVSVDSRAVSETPSADGLAVDEANNEAKKASDREWWAKLRRMRQVLNVK
                     SPKKPTAP"
     exon            complement(483785..484465)
                     /number=1
     CDS             complement(484727..485284)
                     /codon_start=1
                     /locus_tag="AO090003000179"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000127"
                     /protein_id="BAE57398.1"
                     /transl_table=1
                     /translation="MSYAVETKKRKFHRVLESLTKPSNAESSSKPTPAATTATTTTTA
                     NTNERISADLAAKKARLSDRQDGNDLASVRKTVLRVARSSSRDSSVSSSSRPSYVPWD
                     RERFLERLETFRRVDRWSPKPSAINELEWAKRGWICTDVSRVACVGGCGGSVVVKLPD
                     ELDELDGYDSEKVQERKEVRKLRLR"
     exon            complement(484727..485284)
                     /number=1
     CDS             join(485943..486340,486398..487511)
                     /codon_start=1
                     /locus_tag="AO090003000180"
                     /note="cytochrome oxidase assembly factor COX15"
                     /old_locus_tag="AO070341000128"
                     /protein_id="BAE57399.1"
                     /transl_table=1
                     /translation="MASLGSSVSLMRSFTPRLSKEFFTCRQCLGRSQNYATKSTFRKN
                     FAVSPFTQNTSKLNTPASFPKTKSAIPNIFRRSASGSAAANAVEEGASNAKSSFPKVS
                     DKTVAYWLLGSAASVFGIVVFGGLTRLTESGLSITEWRPVTGSLPPMNAEDWESEFAK
                     YRASPEFQLLNPHMTLSEFKSIYYMEWIHRLWGRFVGLSFVLPALYFVARKKVSKPMA
                     LRLGGIAGLIGFQGFIGWWMVKSGLKDDLFAPGSHPRVSQYRLTAHLGAAFVCYVAML
                     WNGLAILRSHRLLADPEAGIKLLDSLRDPKLKIFRRSVAGLAALVFVTAMSGALVAGL
                     DAGLIYNEFPFMGTGLAPPKSELFDERYSRHEDRSDLWWRNMLENPSLVQLDHRILAM
                     TTFTTIMALWAYTRRSPTMKRLLPPAAKKGVHGVVAFAFCQVGLGISTLLYLVPTPLA
                     SAHQAGSLFLLTWVLVLGSRVWHPSRTAKLLQMAVKARGQAISSATAHGPRNL"
     exon            485943..486340
                     /number=1
     exon            486398..487511
                     /number=2
     CDS             complement(join(491849..491883,491958..492025,
                     492109..492395))
                     /codon_start=1
                     /locus_tag="AO090003000182"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000130"
                     /protein_id="BAE57400.1"
                     /transl_table=1
                     /translation="MRQKRPPGSILKYTQSFNLNPFKLNLEHGGLEINDQFQIEVGDF
                     VARVIPDSISMERINHFREQNSDALFDLLALSITPRHFLYGKESPEGTEDRGISRRVA
                     LACARLKSWIKQTSQFRSLSLSLSVGH"
     exon            complement(491849..491883)
                     /number=1
     exon            complement(491958..492025)
                     /number=2
     exon            complement(492109..492395)
                     /number=3
     CDS             493885..494937
                     /codon_start=1
                     /locus_tag="AO090003000183"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000131"
                     /protein_id="BAE57401.1"
                     /transl_table=1
                     /translation="MTTGTAELLRLPEVQACIRSNFLLLSCDLLCDIPGEHLLEAWLV
                     SQGELGPASQGGLSVFYPAKGIKDEVKKEPTDFMAITSLEQDEVPAVSRYKLSKLVLS
                     MPMDTLKEQIEEDKTFLLRHTLVEKHASVKMLTSYRDAHLYILPKWVQSLAQYQERFE
                     SVSEDLIGYWAKAEWQRGLSEKLGINKILGGQNENQEDHGSNDGDLLEEEIDLRGMTT
                     THAQGSEARSTNSTPNDQSSVEVPSILAYMTKSSEQLVRRVDSSALVLAMSLRLAKLE
                     SVEEVGRAAASPFSHASKIATPEGIASKSIVTKGDCLLGSNVTVKHPVFHLLNGSTNI
                     LIGGGKVCYKRIVHFA"
     exon            493885..494937
                     /number=1
     CDS             complement(join(496132..496475,496537..497518,
                     497588..497737))
                     /codon_start=1
                     /locus_tag="AO090003000185"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000133"
                     /protein_id="BAE57402.1"
                     /transl_table=1
                     /translation="MIDRDETGDNTDPFRQLRYLPPPQTSQYHQTSQHLFHPQPIRQT
                     VGPACLRQSRDPNGAIDSFSLRESLFGQGELNPGARHFTLESQNIHRTTPRFPPEYVN
                     WRFGDPIPSNWRITVTPRAVNSPRPEQHCILMPDIGTPESYERCRDISLSSLLCPQPD
                     RTVLEHAAILHHMRNSEPEFVTVGNPKIVSRPGSAREDTLMDCGDPHEQSSPRETTVP
                     VTTNAPDDMFPFAMPAMGKEVILCEFEELATHTAKCDICNKHNYSGMSRCLTCGWQTC
                     NPCTIARGYFRTHHVNGNIHTGPTSQNNLDATAKEISKAKKKSSPPKRKKGPMNARKS
                     KKGHPAKNKTAKKVPRTPSKSSLVSNKVDADQEASAEEISDSGNRIKQSDPDTWDVDS
                     ILDDDATEYLPEDDQLEEEEASTWSPSNTPLSQGSLHNWNLQQAQRGHEIRRQKNIRS
                     QKVKTSRETDADTPLTKSKASGQRTKAQAYCRKQPGRYSRL"
     exon            complement(496132..496475)
                     /number=1
     exon            complement(496537..497518)
                     /number=2
     exon            complement(497588..497737)
                     /number=3
     CDS             complement(join(498985..498995,499064..500651,
                     500740..500955))
                     /codon_start=1
                     /locus_tag="AO090003000186"
                     /note="lysyl-tRNA synthetase (class II)"
                     /old_locus_tag="AO070341000134"
                     /protein_id="BAE57403.1"
                     /transl_table=1
                     /translation="MSEANAVKEAEASMANLLLDEVTGEKVSKSELKRRQKLREKEAK
                     KKEKEAAAPPKPAKKTSAEEDEANLTPNQYFEIRSKRINKLRETKQPDPYPHKFQVTD
                     DLRQFLKDYDHLGKGDQLPDKTVRIAGRIYTKRSSGAKLIFYDIRAEGVKVQVVCQAQ
                     NAAGDVSFEAQHEHLRRGDVVGIVGFPGRSNPKNRPDGELSIFASEIVLLAPCLHAIP
                     SEHYGFQDKEQRFRQRYLDLIMNDRSRNVFVTRSKIVSYIRNFFDTRDFVEVETPMMN
                     AIAGGATAKPFVTHHNDLDMNLFMRVAPELYLKMLIVGGLERVYEMGRQFRNEGIDLT
                     HNPEFTTCEFYWAYADVYDVMNLTEELVSGLVKHVTGGYETVFHTQTGEEYNVNWKAP
                     WRRVEMIPALEEATGEKFPPGDQLHTAETGEFLKKVLKKTGVECSPPLTNARMLDKLV
                     GEFIEETCVNPTFITGHPQMMSPLAKYHRQNVGLCERFEAFVCKKEIVNAYTELNDPF
                     DQRLRFEEQARQKDQGDDEAQLIDENFCTSLEYGLPPTGGWGMGIDRLVMFLTDNYSI
                     KEVLAFPFMKEDKSAAETKSAAEVVGIEPQPEEGIPHK"
     exon            complement(498985..498995)
                     /number=1
     exon            complement(499064..500651)
                     /number=2
     exon            complement(500740..500955)
                     /number=3
     CDS             502301..504397
                     /codon_start=1
                     /locus_tag="AO090003000188"
                     /note="vacuolar sorting protein VPS1, dynamin, and
                     related proteins"
                     /old_locus_tag="AO070341000136"
                     /protein_id="BAE57404.1"
                     /transl_table=1
                     /translation="MRSLENKAIQVIARDMKALVRKIQDLRHIGIEDNRIALPKICVI
                     GDQSTGKSSLIEGMSEIKVPRSAGTCTRCPMEINLSEGEPGQPWACQIYLSRRYMYDG
                     SRKFRTPRKAQPLGPWIEQDQEDEHFITLSEKDQVQEAIKWAQLAILNPGQSSREYIP
                     GENAGTNTHYQVKFSPNIVRLDISAPDFPNLSFYDLPGVISQAELDEEKYLILLIENL
                     VKEYISQQNCIVLLTLPMTDDATNSSAARIMRNVRGAHQRTLGVLTKPDRIQAGESYS
                     QWVDILEGYKFKLGHGYYIVRNNPDPEIEHSQAREEEDDFFDSPPWTAEELAPYQDRF
                     GTRRLQTSLSSLLLEQIQGCLPGIVEQINTKAARINEELKELPDPPSANVLYILCKLL
                     YDLGDRIRANFEGGSSDYPLPKIWGHIAQDFRAALIRTRPTVSLLSQSDRTSFPVQPD
                     GDSDCEMTSAPRPVKRKSPSVPPDTQMPKPGPSGYSTNHFNQFIQPARVFTWEDIREI
                     NEDSCRAGIPEQADPKALEKLRQLSVQHWDGPMLVFLKATHNLVKEMLLKQLREVFFQ
                     YYQTTLFRELKRIIEKYLGELQEKHTRYAIDNYNIEHHKPFTMATAQLEHATKDAYHF
                     LSTRRHLARADLYLELQGKCPENESKRAAELKKLTTAELGPDRFFQEVKMMAVSLLSL
                     LTLCIDVDFLVYSWLL"
     exon            502301..504397
                     /number=1
     CDS             join(505512..505571,505630..505686,505769..506938,
                     506996..507022)
                     /codon_start=1
                     /locus_tag="AO090003000189"
                     /note="GDP-mannose pyrophosphorylase"
                     /old_locus_tag="AO070341000137"
                     /protein_id="BAE57405.1"
                     /transl_table=1
                     /translation="MLQVPVREHTNVASTKAIILVGGPSRGTRFRPLSLDLPKPLFEV
                     AGHPIIYHGLKALAKIPDIRDVYLVGYYDETVFRDFIKDSTKEFPQFRIQYLREYTSL
                     GTAGGLYHFRDAILKGKPERIFVLNADVCCSFPLGEMLRLFEEKDAEAVILGTRVNND
                     AATNFGCIVSDSHTKRVLHYVEKPESHISNLINCGVYLFATECIFPSIRSAIKRRTTR
                     PRLVSYPSSENLESSFVAAEEDSEKSEVLRLEQDILSDLADSNRFFVHETKDFWRQIK
                     TAGSAVPANALYLQKAFQAQSDELTPPSATIVPPVFIHPSATVDPTAKLGPNVSIGPR
                     AVVGAGARVKDSIVLEDAEIKHDACVMHSIIGWSSRVGAWARVEGTPIANGTHSTSIV
                     KHGIKVQSITILGKECAVGDEVRVQNCVCLPYKELKRDVANEVIM"
     exon            505512..505571
                     /number=1
     exon            505630..505686
                     /number=2
     exon            505769..506938
                     /number=3
     exon            506996..507022
                     /number=4
     CDS             complement(join(507538..508230,508291..508458))
                     /codon_start=1
                     /locus_tag="AO090003000190"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000138"
                     /protein_id="BAE57406.1"
                     /transl_table=1
                     /translation="MRSKPRSVKPSAYPAIPFHSIRAVGFISTLVVGIILAVFIYNLH
                     QGGFKLPWAFLVLLIAVILSLLNYVLTTITHCCYGLSPRLSLLSNTICLLLWLISLGL
                     LSWSMSHTILTTCNATYWATSTGITVCRIYKALFAFTVLGNISYIAAIALDVIVRRRQ
                     TRLGEYDPMASNPALNDYKMHDRSSSVLSGGMGPYGGLEEQHPAFRSNNHADEVYNDI
                     PAPGNYAGQTMPPPVYGASSTLEQHHGGEAQDYYQPTPTRPRVRFSAYGHDGYSHPSE
                     QTHYDPAAYR"
     exon            complement(507538..508230)
                     /number=1
     exon            complement(508291..508458)
                     /number=2
     CDS             join(509411..509888,510056..510374,510458..510467)
                     /codon_start=1
                     /locus_tag="AO090003000191"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000139"
                     /protein_id="BAE57407.1"
                     /transl_table=1
                     /translation="MASLLTDTLPWHDGEIQMRSLLRIPPIINPTVPSLSYGATYLLL
                     NSPLLAIGAVDREGRPWSTLWGGEVGFAKPTSQSKIEIRTPVDSKHDPLADILLHNSS
                     GESGQLVSGLVVDLATRKRAKLFGRKITGSIQVDEENHIDSSRVGFAHLLVQIEASLD
                     TLFISSRHGDVDMDTNIRGGPPGFVRVISNEPNGAVFAYPEYSGNRLYQTLGNLQTTP
                     LAGFVFPDFETGDALYVTGQTEVLVGKEAAALLPRSNLAVKVTVTAARKG"
     exon            509411..509888
                     /number=1
     exon            510056..510374
                     /number=2
     exon            510458..510467
                     /number=3
     CDS             join(511755..511770,511828..512157,512232..512495,
                     512545..512600)
                     /codon_start=1
                     /locus_tag="AO090003000192"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000140"
                     /protein_id="BAE57408.1"
                     /transl_table=1
                     /translation="MSTYEVEHNTTDPGTATPSTHRRRPDLSTFFATLSEISPDEART
                     REHAVPVPRDVSAAFYSLAEAFDLMRREGDHSVPTSGEGDNDLLTQMIQSLLSSAETP
                     PREVEGVSEEFCDVLDRVPKASLKPSQSCPICGNAFLEDQYPLVVRLPCHSTHLFDLE
                     CVRPWLRLRGTCPLDRTDFAKQEREKAEARRKKPVEDDEEEWDGWGVWGCWGFLILGR
                     ILS"
     exon            511755..511770
                     /number=1
     exon            511828..512157
                     /number=2
     exon            512232..512495
                     /number=3
     exon            512545..512600
                     /number=4
     CDS             complement(512708..515020)
                     /codon_start=1
                     /locus_tag="AO090003000193"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000141"
                     /protein_id="BAE57409.1"
                     /transl_table=1
                     /translation="MAAEKGFDQRILALVDTCVRVTARGFDGETNARNEERWQKVVNL
                     YKRLLITCLQFLHNFIMHNEQRKMVLWLDLFGYHSTGDSNIIQPREPLDPASGQPEGA
                     APIVKTGERIVNPPIRALYDQTAEDLLLETISNFPREPATIKEEAAMLLLANIKDHME
                     KLLGRDLTAIQEMGKDPEQVKEIRAALTAILGAKVDGFSDLQDRAKDLPPALPEDEPP
                     RKKAILTIDRSTTAGFPRICWADLPDLNAYGALAAGDATIMEEDTSMPRSAQSAAETL
                     QEAKDELMARLQESSQIGGDGDQDYDTGDAGTVGDDDSRSLEAVADGSMEEEEEEDDE
                     DDDDYRGRPGDQQRGLLTDIPLVLGPAEIEALPMIIQAGIVDSFGLKGGERTGSRNMQ
                     ALRCHILLTQETGRNLLRELLIFIAAWDLPDDELYFKMMVQIMDAVLRNGLMSHAYSD
                     FGQTKDIISPAQAVVVKILTHIFRAKYSPASVTGSTQANTTKNPAPLSRVDILTVRYI
                     FTIFRGNIIPETCALIYLQGQIRAGRALPEDFPLNLWDMERVYEGVYQFLEFFAVLTE
                     NNDWKNLLVKWEIVYDLVTLIKELEASIPKGQLSQLSLGPRSPSKESQPNTIPGPVAV
                     ERPYDPSDPDPVDGGAPSRAESPPITEDPSEFEWRNLKKLVVLVLSSLVWKCPEVQDQ
                     IRRHGGVETILSCTNFDAHNPYIKEHAVMCLKFLLEGNRENQKLVEELEAREVVKDEN
                     GLLERSGFEAVIDKTGKLAIRPKDGTGEKR"
     exon            complement(512708..515020)
                     /number=1
     CDS             complement(join(515330..515532,515549..515657))
                     /codon_start=1
                     /locus_tag="AO090003000194"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000142"
                     /protein_id="BAE57410.1"
                     /transl_table=1
                     /translation="MESAGPEPEKFTFQCGVSVFPAQFVILSQRLLSHSVCPVKMADR
                     NSADIKPKCTPAELMLKVILTGTLSHYETRGMIDDKRLEHMLSAGKQILYKTHQESDV
                     R"
     exon            complement(515330..515532)
                     /number=1
     exon            complement(515549..515657)
                     /number=2
     CDS             complement(515815..516423)
                     /codon_start=1
                     /locus_tag="AO090003000195"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000143"
                     /protein_id="BAE57411.1"
                     /transl_table=1
                     /translation="MLIYGSCIGFSLLSQSWEELIPLDSPLRTTRQSWTMSFNVWTIV
                     ISTDLRIGGVTSLMFMTAPLAMAFLVYHTYLIWAGMTTNESAKWSDWKEDVADGMVFK
                     STKAEAYGNSPLLREYQSPQTSWPVNSDQVLVLTEGEPPRVGFVFSLDSNEIRQPNDG
                     EAPIDHIWTPVRSMREIDNIYDLGFWDNLRHSFGLPARRKMS"
     exon            complement(515815..516423)
                     /number=1
     tRNA            complement(517541..517633)
                     /locus_tag="AO090003t00004"
                     /note="tRNAscan-SE"
                     /product="tRNA-Cys"
     CDS             518967..519521
                     /codon_start=1
                     /locus_tag="AO090003000196"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000144"
                     /protein_id="BAE57412.1"
                     /transl_table=1
                     /translation="MIHAQQSKSPHLERTPTSSISVDNEAHIAHDPVTNISEPVQYDK
                     TETSDHDPENAIDPLFLELPFLPSSPEPEPEEPPEQDIDTWIDHRLQTGRAENEEQII
                     EALRCTSMDPYLADQVLDYLIAGKGIPDNMPGVWTAEDDRCLEAKETRTIEQVLKKHG
                     SDAFNSRWEYLGMARAAGLDDIDS"
     exon            518967..519521
                     /number=1
     CDS             complement(join(519917..519935,519988..520013,
                     520062..520413,520470..520492))
                     /codon_start=1
                     /locus_tag="AO090003000197"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000145"
                     /protein_id="BAE57413.1"
                     /transl_table=1
                     /translation="MEPEENLLEGAKDLVEEYYRAQGGRPEKPQRGKRKSMTGPKQTT
                     EKSEPKRRRKSRAEAATETPDEDDDLPNWVPRSKNWENEVQSVDTILRDAETSTLIAY
                     LHWKNGKKSKVSLETCYEKCPRKMLKFYEEHLVFKEG"
     exon            complement(519917..519935)
                     /number=1
     exon            complement(519988..520013)
                     /number=2
     exon            complement(520062..520413)
                     /number=3
     exon            complement(520470..520492)
                     /number=4
     CDS             join(521335..521344,521468..521537,521620..521713,
                     521766..521849,521909..522198,522257..522905,
                     522958..523095,523145..523325,523373..523467,
                     523513..523524)
                     /codon_start=1
                     /locus_tag="AO090003000198"
                     /note="chaperonin complex component, TCP-1 epsilon
                     subunit (CCT5)"
                     /old_locus_tag="AO070341000146"
                     /protein_id="BAE57414.1"
                     /transl_table=1
                     /translation="MAMLSADSPTASVMKDEQGRPFIVVRDQGKKKRQHGTDAVKSHI
                     VAAKTVANIVKTSLGPRGLDKILISPDGDITVTNDGATILSQMEITNNVAKLLVELSK
                     SQDEEIGDGTTGVVVLAAAMLEQASDLIDKGIHPIRIADGYDQACEIAVAELDKISDE
                     IPFTKEDTSNLLKVAKTSLGSKIVSKSHDQFAKIAIDAVLSVADLERKDVDFELIKVD
                     GKVGGALEDSMLVKGVIVDKDFSHPQMPDEVKDAKLAILTCPFEPPKPKTKHKLDITS
                     VEEFKKLQDYEREKFTEMIQHLKDSGANLVICQWGFDDEANHLLLQNNLPAVRWVGGP
                     EIELIAIATNGRIVPRFEDLNAEKLGTAGSVREMTFGTTREKMLVIEDCANSRAVTVF
                     VRGSNKMIIDEAKRSLHDALCVVRNLVRDNRVVYGGGAAEIACSIAVEDAAVKSPGIE
                     QYAMRAFADALDAVPLALAENSGLSPIETLASIKSRQVKEKNTRLGVDCMMTGNNVLD
                     MREHFAIDPLIGKRQQLLLATQLCRMVLKKVD"
     exon            521335..521344
                     /number=1
     exon            521468..521537
                     /number=2
     exon            521620..521713
                     /number=3
     exon            521766..521849
                     /number=4
     exon            521909..522198
                     /number=5
     exon            522257..522905
                     /number=6
     exon            522958..523095
                     /number=7
     exon            523145..523325
                     /number=8
     exon            523373..523467
                     /number=9
     exon            523513..523524
                     /number=10
     CDS             complement(join(532467..532566,532713..532927))
                     /codon_start=1
                     /locus_tag="AO090003000201"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000149"
                     /protein_id="BAE57415.1"
                     /transl_table=1
                     /translation="MKEISPIHSSPITQNPFVPSPSRLLSFFPFFLPFSFFQLPVSPR
                     VTHFARFVNHVMIHVKGTSPEEHLIDEFDKSQKTETGMEEMIDGGRGPVARLIVTFLK
                     AL"
     exon            complement(532467..532566)
                     /number=1
     exon            complement(532713..532927)
                     /number=2
     CDS             join(535753..535852,535915..537569)
                     /codon_start=1
                     /locus_tag="AO090003000203"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000151"
                     /protein_id="BAE57416.1"
                     /transl_table=1
                     /translation="MPSRLTTPVVTVDTAKIHKVDTANAQSLHGMWMVFSKCADYMEE
                     GRRLENLSWRLWTRETFCVEPATSNDASVLPLLRQESADMPELSASVESAASEQAERI
                     EHHIKRPKCEIKPAVVRDDSLASLGRGKEKHITSMGLERMVLNIKEKKDLEPISSAMA
                     TVSPPVVDITPRPSTPTPTPPSESTARRTPSPSPSFPVIQQPNHSTESCSTTAPDCND
                     SDAANANASDTSVSSSGILPSRCELIKSPSIIRGFSPSLISSSYRSQPRMAAEPSPAK
                     ASAQLKPTPFKKKGGMFTLGGSSGDDDESSFEDRMVLRGPHRSSLSDELSKSGTMQPS
                     PKKKVTSFKEHDGTIKPVKEPSGDNDEDAIESEDEVDESAIEDEDSDWEDSITESGRS
                     SLDERDMFQRVDSRPNLVSRRSLLTMMMHQPTKMGAPTRSSPALQRSRLTSPNGPSIP
                     ASPPEDDEDNLTMRGPGVPRSKPIVMKPTPQSVAHSPRTTRRNMLATELTESLRRHLL
                     WERQQKSATANAFLKRRHTAHDMANLQEYPNPKGAQKGQGVGVSNPGADKDKDMAKTA
                     SFNQYTDFGPWEYHAKGW"
     exon            535753..535852
                     /number=1
     exon            535915..537569
                     /number=2
     CDS             complement(join(547657..548985,549053..549247))
                     /codon_start=1
                     /locus_tag="AO090003000205"
                     /note="cytochrome P450"
                     /old_locus_tag="AO070341000153"
                     /protein_id="BAE57417.1"
                     /transl_table=1
                     /translation="MASFTLVSAYAAAGLLAIIVLNLLRQLLFRNKTDPPLVFHWIPF
                     LGSTVTYGMDPYAFFFSCRQKYGDIFTFILLGRKITVYLGIQGNEFILNGKLKDVNAE
                     EIYSPLTTPVFGSDIVYDCPNSKLMEQKKFIKFGLTQAALESHVPLIEKEVLDYLKTS
                     PNFKGTSGRVEITDAMAEITIFTAGRALQGEEVRKKLTTEFADLYHDLDRGFTPINFM
                     LPWAPLPRNRKRDAAHARMREIYMDIINERRKNPDRETSDMIWNLMHCTYKNGQPLPD
                     KEIAHMMITLLMAGQHSSSSISSWIMLRLASEPAVMEELYQEQITKLSPDGRTLPPLQ
                     YRDLDLLPLHQNLIKETLRLHLSIHSLMRKVKNPMPVPGTPYVVPADHVLLASPGVTA
                     LSDEYFPNASRWDPHRWENRVEKEDEEDIVDYGYGTVSKGTSSPYLPFGAGRHRCIGE
                     KFAYVNLGVIVATMARHMKLFNVDGKKGVPATDYSSMFSGPSKPAIIGWERRFPEKS"
     exon            complement(547657..548985)
                     /number=1
     exon            complement(549053..549247)
                     /number=2
     CDS             551258..552697
                     /codon_start=1
                     /locus_tag="AO090003000206"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000154"
                     /protein_id="BAE57418.1"
                     /transl_table=1
                     /translation="MTSTSSTAAQRPISKAESSNPREFQINQLRRRFRPTESTDDVGT
                     TLTFGMAPSDPDFPFEMDKLQCVLHVPLSYPGRERPTLKVTNSEMGSAFQDNIARGFD
                     DIVDSTLRSGGRATLLTWMNALDRHLERLLTTTERGPTLKFVPNVGSKQKPESQAIVE
                     GVKSLAVSTPASTQDTKPKSLPVPEAPSRIYTAEEKSQAEKRRAVETKQIEARLGRLP
                     LFQKSKDGLSFVIPIQPPKPDRLPISIRSVKTVKLLVPLLYPLEQSSVELQGVDRAEA
                     RPVEVGFAQWVEGNSKLNLMSQINYLTANMHNFAKTPLETPQEPVFDASPEPFTGSKA
                     PENTSTTTRGPTLEDRPHVHVVPRPPEWTVGERSSESEGTDMTESEDDFTGEDEEDGG
                     APVPALPETTVERGVALSFPFLELYGIELLELVGLSITVKCDRCKEQMDVKNVAQVKD
                     KADALSPKVESCKKCANTMSFGKVYSNST"
     exon            551258..552697
                     /number=1
     CDS             552927..553394
                     /codon_start=1
                     /locus_tag="AO090003000207"
                     /note="Zn-finger protein"
                     /old_locus_tag="AO070341000155"
                     /protein_id="BAE57419.1"
                     /transl_table=1
                     /translation="MVFKLPEVKFLRVGSAAFTSRNQALPRKKPKEALGIVAGQELPR
                     RGRCSHYGKSYRWFRFSCCAKVFPCDKCHDAETDHPNEHANRMICGFCSREQIYRPEN
                     CGVCRAVLIGKAGSGFWEGGKGTRNKVLMSRKDPRKYKRRPGSTPGGSSSKKK"
     exon            552927..553394
                     /number=1
     CDS             complement(join(553763..553897,553952..554309,
                     554363..554422,554479..555122))
                     /codon_start=1
                     /locus_tag="AO090003000208"
                     /note="4-hydroxyphenylpyruvate dioxygenase"
                     /old_locus_tag="AO070341000156"
                     /protein_id="BAE57420.1"
                     /transl_table=1
                     /translation="MAPISTSPPPTDRNSLASYRGYDHVHWYVGNAKQAATYYITRMG
                     FKRVAYRGLETGNRSICSHVVRNGDITFILTSPLRSIDQIDRFSSEEQEQLREIHHHL
                     EQHGDGVKDVAFEVDSVDAVFNAAVSNGAKAVSNPQTLKDENGEVRVATIQTYGQTTH
                     TLLERSNYRGAFIPGYRLETAEDPVSKFLPGVHLNRIDHCVGNQDWDEMDKVCEYYEK
                     ALGFHRFWSVDDKQICTEFSALKSIVMASPNEIVKMPINEPAKGKKQSQIEEYVDFYN
                     GAGVQHIALLTDDIIRDITNLKARGVEFIKVPSTYYDDVKIRLKKAGLTLHEDFETIQ
                     KLDILIDFDENGYLLQLFTKHLMDRPTVFIEIIQRHNFEGFGAGNFKSLFEAIEREQE
                     LRGNLV"
     exon            complement(553763..553897)
                     /number=1
     exon            complement(553952..554309)
                     /number=2
     exon            complement(554363..554422)
                     /number=3
     exon            complement(554479..555122)
                     /number=4
     CDS             555217..556557
                     /codon_start=1
                     /locus_tag="AO090003000209"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000157"
                     /protein_id="BAE57421.1"
                     /transl_table=1
                     /translation="MNQSLMLSLYQPRRMIIILNTIRLPAVDWSPGILLAHHFIEPTP
                     TSPMNNDDCILPNDTSPNSVSEVMATWGLRRLWTGVAWKGSAGRGYLEIAGVQMTLGK
                     TSATMTMKLITASFALINGTIPFSFFIDIHNLVLHNIRSTTPEIYNPLYQVLLLHLLT
                     TKIKPSYLHLYFIKSHKPITSNQQNPKEKKKKKKKMDSITISPTKPNLTTNDSAVLQA
                     LFDAESSPSNGITINPSLPPFPAHLNIDPTLHETLKAREITIVRTLASPNPTPETIQS
                     AIDQLSTLITEHPTYPPAYVNRAQALRMLISTHNGGQAEETETDLFTPQNAETVSSLL
                     SDLGEAIGLATPRSPADPVSEVQARLLADAHTHRGYLLLRLAKVKKSGEAFEGTGRWS
                     QLDADRLEEMASRDFFFGGRFGNKVAQQLAVQTNPYAKMCGAIVKEALRKEVEG"
     exon            555217..556557
                     /number=1
     CDS             complement(join(556968..557088,557140..557790,
                     557848..558357,558408..558475))
                     /codon_start=1
                     /locus_tag="AO090003000210"
                     /note="homogentisate 1,2-dioxygenase"
                     /old_locus_tag="AO070341000158"
                     /protein_id="BAE57422.1"
                     /transl_table=1
                     /translation="MPVTKFSHPDPYSYQTGFDSYHETEAIEGALPVGQNSPQKAPYG
                     LYAEKLSGTAFTAPRHENKQTWVYRIIPAAAHENFKVENGDSYHTHMTTETTKLHHIP
                     NQLRWNPFDLDETVDWVHGLHLIAGSGDPTLKQGLGILMYAAGKDMGKEAFYSADGDF
                     LIVPQHGVLDIQTELGRLIVRPNEICVIPRGVRYRVTLPAGPVRGYICELYQGHYQLP
                     ELGPIGSNCLANARDFQAPVASFDDEEEPSEYRLYSKFNNTLFSARQDHTPFDIVAWH
                     GNYYPYKYDLGRFNTIGSISFDHPDPSIFTVLTGPSDHVGTAIADFVIFPPRWLVQEN
                     TFRPPWYHRNTMSEFMGLISGNYDAKTGGGFQPAGASLHNVMSAHGPDTDAFEGASNA
                     ELKPQKVGDGSMAFMFESSLMVGVSEWGLKTCQKVQEEYNEHSWRPLKRHFKNPNKA"
     exon            complement(556968..557088)
                     /number=1
     exon            complement(557140..557790)
                     /number=2
     exon            complement(557848..558357)
                     /number=3
     exon            complement(558408..558475)
                     /number=4
     CDS             558987..560282
                     /codon_start=1
                     /locus_tag="AO090003000211"
                     /note="fumarylacetoacetase"
                     /old_locus_tag="AO070341000159"
                     /protein_id="BAE57423.1"
                     /transl_table=1
                     /translation="MASWLQIPKNSPFSLANIPFGIISSTKSTSRVAAIAIGEYALNL
                     STFASSGGFAQLPDFQPHLSVFSQPTLNAFAALGRPVHRQVREYIQNVFRADTPFPQV
                     LKDNASLQKEALLPLSEVTNHVPMQIGDYTDFYAGLNHAYNVGVLFRGPENALQPNYK
                     HLPVAYHSRASSVVPSGTPIHRPNGQILANPAATPKLPTFSPCKKLDIELELAAFVSK
                     PNDLGKPININEAEDHIFGLVLMNDWSARDIQAWEYIPLGPFNAKNFATTITPWVVLL
                     DALEPFRATGLEPGDRDSLLPYLREKRAANVYDIPLEVEITNAGGKPTIISNSNAKNL
                     LYSFPQMLAHHTITGCNMNPGDLLGSGTISGTEPKTQGSLLEQTNGKNPLKLDDGSER
                     LFLEDGDTIVLRGKAGTEGNYVGFGDCTGTILPAIKLEY"
     exon            558987..560282
                     /number=1
     CDS             complement(560458..561159)
                     /codon_start=1
                     /locus_tag="AO090003000212"
                     /note="glutathione S-transferase"
                     /old_locus_tag="AO070341000160"
                     /protein_id="BAE57424.1"
                     /transl_table=1
                     /translation="MTDETPKITLYTYFRSSSAARLRIALNLKSIPYTSIPVNLLKGE
                     QSSPANRALNPSGTVPTLVVERPASQGATVTITQSLAALEYLEEITPASSHALLPPVS
                     DPESRAVVRTLCEIIGCDVQPVTNLKILKRVGPLGFDRETWSKELIEDGFRAYETIVS
                     RTAGVFSVADTVTMADVCLLPAVWGAQRSGVNLAEYPTIQRIAERLEKEDAVKKAHWR
                     TQDDTPEEFRLKESS"
     exon            complement(560458..561159)
                     /number=1
     CDS             join(563090..563984,564078..564085)
                     /codon_start=1
                     /locus_tag="AO090003000213"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000161"
                     /protein_id="BAE57425.1"
                     /transl_table=1
                     /translation="MSDLSPILTDFYADHNNHRWLVSHDPVLCCTILMISSRYHLLPG
                     AGGGSRNFFIHHRLWQHCQQLVMRLMFGQEKSSQSKVRNIGTIEALMLMSEWHPRSLH
                     FPPESDGWDFDLTSVPPEPQELEDSSSTNRWLEDMIEPARRSDQMSWMLLGSALSLAH
                     ELGIFELDEKKLGYASGYEGFISGEQIKLRRQRVQRLLYVYINQLAWRIGCVSLMPQS
                     LNHAILGRRATKELNQTGDEWLIFMDSWMDLTKLAKSVTDMFFPTVSFARQQLHSGRY
                     IELLDHFRPILDKWKEEHLQVRLL"
     exon            563090..563984
                     /number=1
     exon            564078..564085
                     /number=2
     CDS             564138..564812
                     /codon_start=1
                     /locus_tag="AO090003000214"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000162"
                     /protein_id="BAE57426.1"
                     /transl_table=1
                     /translation="MQAVVERVLADSDPRAEEVRALNIDPIDYEYIQEVIDGCCQILQ
                     KVIQLAENGVLRFCPVRIFLRITSSSIFLMKALSLGTRQSTLRESLDVLERSIQALRS
                     NALDDIHLSTRYAALLDMHVARLRRNLLASSKTVKSNQGTASRPSMGVSSSTDHGNNT
                     PMMDISMSQNISDMGYIPSLNDIAADDWLSLPFDPSMAPFGISSAGQFPAYEGGALNF
                     IWNLPS"
     exon            564138..564812
                     /number=1
     CDS             join(565502..565507,565578..565776,565865..566034)
                     /codon_start=1
                     /locus_tag="AO090003000215"
                     /note="mitochondrial import inner membrane translocase,
                     subunit TIM17"
                     /old_locus_tag="AO070341000163"
                     /protein_id="BAE57427.1"
                     /transl_table=1
                     /translation="MGAIGGAVWHGIKGFRNSPYGERRIGALTAIKARAPVLGGNFGV
                     WGGMFSTFDCAIKGIRKKEDPYNAIIAGFFTGGALAVRGGVKAARNSAIMCAVFLAVI
                     EGVGIGFQRMMADNTKLEVSLI"
     exon            565502..565507
                     /number=1
     exon            565578..565776
                     /number=2
     exon            565865..566034
                     /number=3
     CDS             566892..568229
                     /codon_start=1
                     /locus_tag="AO090003000216"
                     /note="asparaginase"
                     /old_locus_tag="AO070341000164"
                     /protein_id="BAE57428.1"
                     /transl_table=1
                     /translation="MAEPKPNSQQRKPLFKPTLIIHGGAGALKRSTLPPSLYNQYQTS
                     LLTYLRSTHSLLKSGSTALDAAVHAVTLLEDDELFNCGRGSVFTTAGTIEMEASLMVT
                     SLVSDDSSPDYPGSIKRGAGVMGLKNVRHPILAAKESLLRTGNGSQDGGSMHSQLVAP
                     YVEEKAREWGLEFMDDEWFWTQRRWDEHLRGLQGEPEPVSFSQGTVGCVCLDMWGGVA
                     VATSTGGLTNKWPGRIGDTPTLGGGFWAEEWEVQCDTVDDGEGADGGGLLDGMLGDCL
                     SFFNSRGRSGDYVSLPMEVPLERGLKEKMVMCSSPENRVKRRAVAVSGTGNGDSFLRV
                     AAARTACAMVRFSERMPTLADAVTAVAGPGGELQRSAGRRWGLTGEGGGGIIGIEAEV
                     EVDEDTGVPVSGMELGRGKVVFDFNCGGMWRAWVEEDGDGNDMENVMVFREPY"
     exon            566892..568229
                     /number=1
     CDS             complement(join(568521..569678,569734..570009,
                     570074..570250))
                     /codon_start=1
                     /locus_tag="AO090003000217"
                     /note="cytochrome P450 CYP4/CYP19/CYP26 subfamilies"
                     /old_locus_tag="AO070341000165"
                     /protein_id="BAE57429.1"
                     /transl_table=1
                     /translation="MMGLPWATVYIVIAGYAIAKSTFGNFILLSILVSLLKVFYNWVL
                     YPDFFTPIKKIPSPPGRSWITGNSDTVFLEAPYEHMRKWLENVPNDGLIRYYVSINLE
                     RILPVGPRALKEILVTKSYDFPKPEFIRASLKRLAGEHGLLLVEGDDHKKSKKNLLPA
                     FAYRHVKEMYPIFWSKSIEMVRVMDEDLRKKADPTDNVLRMGAYASRAALDIVGVAGM
                     DHDFQSLRDPNNKLVRTYQNLMSEPPLYMKIIFLLTLLLGDPAVVHDLPLERNRSIER
                     SSETIRDVARQMIRQKRAKWESGSSTAEDIDIVSVALRSGNFTEEELVDQMMTFLGAG
                     HETTSTALQWCVYVLCKHPDVQTRLREEIRANLPPISTENPQPPAATDIDNLPYLNAV
                     CNEVLRYHPSVPATIRCASRDTTIIGEPIPKGTLFLIAPEIIGKSKELWGPDADKFNP
                     ERWLGPGRANNGGADSNYANLTFLHGPRSCIGQGFAKAELACMVAVVVGKYHMELKNP
                     NAPLEIRQQATVCPKDGVLAKFTNIEGW"
     exon            complement(568521..569678)
                     /number=1
     exon            complement(569734..570009)
                     /number=2
     exon            complement(570074..570250)
                     /number=3
     CDS             join(572248..572427,572489..573574)
                     /codon_start=1
                     /locus_tag="AO090003000218"
                     /note="NADH:flavin oxidoreductase/12-oxophytodienoate
                     reductase"
                     /old_locus_tag="AO070341000166"
                     /protein_id="BAE57430.1"
                     /transl_table=1
                     /translation="MTSRELPDIVNKAAPGISYFTPAQEPPAGTAADPQSDGTAPPKL
                     FQPLSVRGLTFHNRIGLSPLCQYSGDDGHMTDWHMAHLGGIAQRGPGFLMVEATAVEP
                     EGRITPEDLGLWKDSQIEPLRRIIEFVHSQNQLIGVQIAHAGRKASTVAPWLSMNDTA
                     SRNVGGWPDHVKGPTDAPFNDRNPTPKEMTKQDIEDLKVAWVSAVKRAVKAGADFVEI
                     HNAHGYLLMSFLSPAVNKRTDEYGGSFENRIRLSMEIAKLTREAVPEDKPVFLRVSAT
                     DWLEESRPSEPSWKSEDTVKFAQALAESGYIDLIDISSGGTHQAQHIHAKPGFQAPFA
                     VAVKRAVGDKLKVGSVGMIDSAQLANSLLEKEGLDFVMVGRGFQKNPGLVWAWADDLN
                     VEISMANQIRWGFSRRGAGPFLRKRQEKI"
     exon            572248..572427
                     /number=1
     exon            572489..573574
                     /number=2
     CDS             complement(574063..575148)
                     /codon_start=1
                     /locus_tag="AO090003000219"
                     /note="2-polyprenyl-6-methoxyphenol hydroxylase and
                     related FAD-dependent oxidoreductases"
                     /old_locus_tag="AO070341000167"
                     /protein_id="BAE57431.1"
                     /transl_table=1
                     /translation="MPVNKTYGQQVVIHRADLHNALIEQALALPNVELRVNSTVTDVQ
                     FDPASVTLADDTVVQGDVVIAADGIKSTIRGHLLGEDSPSKAIPTGDAAYRIMLPRSV
                     MEKDPELKELVDEPQATRWLGPDRHIIAYPVRKHELFNVVLLHPDGHGVEESWTTKGS
                     KQEMVDNYRGWDRRVRKLIDMVAEDEVLEWKLCLHSPLKTWIKGSVALIGDACHPMLS
                     VSPPVLSQKVYPTNVPFRPYVAQGAAQAVEDAAALGVLLSTISSKHEIPIALRAYEKS
                     RKQRAETVQQSGSANRITLHLPDGPEQQARDEQFRLSMTGGSNPDRWTDRETQNFLWG
                     WDAEKAALEAWNGKFPKVAHFNPFLCH"
     exon            complement(574063..575148)
                     /number=1
     CDS             complement(578975..580471)
                     /codon_start=1
                     /locus_tag="AO090003000220"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000168"
                     /protein_id="BAE57432.1"
                     /transl_table=1
                     /translation="MDTMIPQRPLPSKEALKQFYMHKTLTEIPKPAAVLDLAIIKRHC
                     NSMLQTIQTLGVGFRAHVKSHKVSSISISQTSRNQATLFPKKKKKRTHRRNPHPKSPL
                     PTNDNNEKTTELSRLQVGTSSPEINYVASTVLEIESLVPLLREFQSKGRKVNILYGIP
                     LVPSQVSRLALAAAELGPDSVSVMIDHPDQIKFLDTFSRIAGFAAGVFLKVDCGYHRA
                     GLPPRAMDKGGLFSKLEELEKTGAGRLVGIYSHSSLSYGGRNRGDALRHLRGEVEACL
                     LALDSYAGVLPVDRELVVSVGATPQVVAAEAVAEGDDAELEELRKFLKEPDTGAFKGR
                     VRVELHAGNYPLLDMQQMSTNAGGVRERFFDEVGAYVVAETCSVYNDGEREYPEALVA
                     VGTLGMGREPCPSYKGWGVVGPWGLPTTPQRDRLYIDRISQEHSILRWESEDVAKKIP
                     LSVGQTVKIYPNHACITGAMYGWYLVVDSSSDPDATKVVDVWVRWLGW"
     exon            complement(578975..580471)
                     /number=1
     CDS             complement(join(581294..581352,581391..582567,
                     582625..582684))
                     /codon_start=1
                     /locus_tag="AO090003000221"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000169"
                     /protein_id="BAE57433.1"
                     /transl_table=1
                     /translation="MAPFGETIAVIDKSGKVVSTSKQLFGVFSNAKNAYSARKAQFQS
                     ERNAIIAEREALKAIQNYTIDDAPSVASSRRSRSRHHSGRSHHARHYYDDDYEYEQDR
                     GSVASRPDSYYDRPQDLVRRHTHHDIAMRGPEARPTTSRSKSDAHIDMDLAYGDYNPH
                     VLTKAPPQQNQLQKIEDPELSGLVNRAQWLMEEANCVHHSATATIAHLQKNPDAMAAV
                     ALTLAEISKIASKMAPAALSSLKSAAPAVFALLASPQFLIAAGVGLTATIVMFGGYKI
                     IKQMSGNGNEVSRGPDRGLGPRPGESVGMDDMVEINTECLSGVEMWRRGVADAADESI
                     GTSVDGEFITPTAAMMSGIDVTTARMMRDPRFKFDDEESRASSHRSHRSRPPRSRAPT
                     RLDERPESYVASKAPTKSFFGAIESPKQSSIEGTLPSSI"
     exon            complement(581294..581352)
                     /number=1
     exon            complement(581391..582567)
                     /number=2
     exon            complement(582625..582684)
                     /number=3
     CDS             join(584871..585107,585169..585294,585347..585478,
                     585528..586088,586166..586331,586381..587585,
                     587826..588083)
                     /codon_start=1
                     /locus_tag="AO090003000222"
                     /note="metalloexopeptidases"
                     /old_locus_tag="AO070341000170"
                     /protein_id="BAE57434.1"
                     /transl_table=1
                     /translation="MDHTVLHESDSTSEIDEQTKTWESDPRSITTHLTDDDANDSNAM
                     IECGIGHRVQASRSVLALVLDDDCVFAGLQGGDIVAWSLQTYELVLSVHAHQESVLDL
                     HLSEDKELLFSSGGDSVVNVWSTRTFDRLYSIHSHHDVGDIFAVAYSSSLKTIYCAGQ
                     NTSIQWCDISQADAAATQLSAAHLSRRTHRFFDSRGPDGTRAPRPEAGADGSHSVTQG
                     GQVLTFKRDHHRIFSHHGYVYTMLLVRGLVESAPSEEVLITGAGDGVVKLWSLDQDKT
                     NAAPSQMAKLQNGDPVLSIAVDGSFLYCGLAGGALNIWNLDSHQLVKRITRHTGDLWA
                     VDIIHGVAVCGDSNGIVKEVGSWAAHEGTMLASAAGRHKDRFIYASGGNDNTVGIWDL
                     TDVSLKQNELPPINNDEMVNCLAKFVAFKTVSASPKFAGECNQGAAFLRRHCVYLGAK
                     TKLLTTGKDTNPIVYARFNATSSEKIDKTILFYGHYDVVGADANLTKWKTDPYQLTSM
                     DGFLYGRGVSDNKGPILAALYAAADLARQKALRCNVAFLIEGEEESGSQGFHETVRQH
                     KEQIGSVDYILLANSYWLDDYNPCLTYGQRGVVHANLIVTSDHPDLHSGIDGSALLDE
                     PLKDLTLLIGTLVGPKGRINLPDFRDRVLPLPEAEKQRYADIAQILLQQHPEITDRDA
                     LIDSLMHRWREPALTIHSIEVPGNSKSTTTTISRRAKASVSIRLVPNQEADDVAASLT
                     MYAQEQFDLLESQNDLTVEITGKSDPWLGDPDNEMFETLAEAITAAWTPDRQGQKHQY
                     PPVQRNLQDRTGETPPPPEPVPGPSDVRPIYIREGGSIPTIRFLEKEFSAPAANLPCG
                     QASDNAHLYNERLRVQNLYKSREIFSYVFSRLPERERK"
     exon            584871..585107
                     /number=1
     exon            585169..585294
                     /number=2
     exon            585347..585478
                     /number=3
     exon            585528..586088
                     /number=4
     exon            586166..586331
                     /number=5
     exon            586381..587585
                     /number=6
     exon            587826..588083
                     /number=7
     CDS             complement(588833..590308)
                     /codon_start=1
                     /locus_tag="AO090003000223"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000171"
                     /protein_id="BAE57435.1"
                     /transl_table=1
                     /translation="MLIKSTPPIHPNKATSHQPTMECPKTFSSSFFNTVLTPTTSSPR
                     LPQTFPEPDYLNPTYNLTQNIPPIHPFTAPKTLPPIHTSDKHTITDRIKFASSLLSHP
                     HYNPPLQTRLRLQEYKTLCNNLLSLTQPTTQTGLQAYKAWLQKRTASMQPGFQIKALH
                     PKIHQIETDLKTKFLITEPLSTTPATTVLDLNLSFSKTDLQAFSNETLTLHLQVLLHR
                     YKNFIPPSTKKEMDFFNPIRVLHYAPSLYHTHSHPTTNQPTWNRPFWTTINKYLTKEL
                     PTFNQLLTTTTPTSTLLNSVPVSLLFTRTCHDHNLDIVEMNHVLAHILSPDSIPLPEM
                     DIGAFIRDRDPLGLAKRLKRDLSVVPGCGVESPLGRDLEVVFDVVGGLQEGFFELGRS
                     RLLSVPRNWDGACVGGLDYGSLEREDDEVVDREKGGEEEVEEKRSTDEDDSEETEESE
                     ESEESEEDDDNDSDSDTLSNRDDAEVNNGARWSALLRKDIA"
     exon            complement(588833..590308)
                     /number=1
     CDS             complement(592800..595757)
                     /codon_start=1
                     /locus_tag="AO090003000225"
                     /note="predicted membrane protein"
                     /old_locus_tag="AO070341000173"
                     /protein_id="BAE57436.1"
                     /transl_table=1
                     /translation="MPRRSRQLQPSPLNLLDDGFEAPVVSETPDATKRRSLGAEPHRN
                     GSQVNGHSASHHRSPSQRTTNGDQKNAQYSLPPDQAFGMVFEHSQGPGGVNGNTPHRT
                     SLVDVIDGPEVATVLNQWSGEVSPVRNQDTDRERVPKLSPAKIEELTSSPQSIPYRAA
                     DSEHSRRVVSDQTHASNSQTTSTDEASPLLNDIKFPPDHATKSRTNKEFTLDGGLARP
                     PTSSTRHRSQSSRAVSTPTSARRQTLPSNERLAQTWASRSKHDRPSIGRGSESKHLNP
                     APEMSDSTLPSPMPPSIPLPPLSIPTYLQLELASGRPSPLYIHPSASSDFPYESSRVK
                     LERLMNFFMLPPVLEQVFWFGILACLDSWLYSFTILPLRFVKALYILLESWMVNLGVE
                     FRFLSGFIIKGVGRVWRRRNKISGDGTDEQRLVSEAEGRSRQESAGTERDVKTKAAEA
                     RRRCRSDTHHKYQHRRQKSIPSTLLPDDKADILKGLLMIATCAVLMYFDASRMYHWIR
                     GQAAIKLYVIYNVLEVSDRLFAAIGQDVLECLFSREALERRPNGRSKVFRPFGLFLLA
                     LAYTVVHATALFYQVMTLNVAVNSYSNALLSLLLSNQFVEIKSTVFKKFEKENLFQLT
                     CADVVERFQLWLMLTIIASRNIVETGAFNFIGNLGSSFTSQSTSTNSTPLSTPPRTMS
                     SILPQSFTIVPSSIIASFSHVNSFLPTLAQVLGPFLVVLGSEMLVDWLKHAYIGKFNN
                     TRPVIYKRFLDILTKDYYTNAFGDQNLTRRLGLPVIPLSCLFFRVSVQTYQMFLAALL
                     PQHPSSTAVESTSLSSIYSHYVPAPIPSPPPLTLRTIVPASAAHMNAFFQQLLANTMP
                     SPAQSVYIFTVVLILTGYVVLLIVKLLLGMVLLAYARSRYRAMKQRETEQSSHENSGP
                     PRAREYAVEGSRRFGGWGVVEVNDDHRRWIYTDDLEGLRRLKAKEEKEKNSKEELNMD
                     HVRRYEMVAKRIW"
     exon            complement(592800..595757)
                     /number=1
     CDS             complement(599145..600365)
                     /codon_start=1
                     /locus_tag="AO090003000227"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000175"
                     /protein_id="BAE57437.1"
                     /transl_table=1
                     /translation="MLFTLVIWVLSILKLALAIILYLIFLFHHIPSQDGSLKAYCRRK
                     IKTRLTRIVRRKVDKALAKGMVLQERKPTQPNMGLNTNPTLPTVGSDDKAPTVTTLSR
                     STTQTTLRSYSSRPGTAAPDRAPTLPSVAAFEDKPPLSRTMTQSSAYSASTSLSGSTA
                     VSGYSPLDRQSSPVPPVPPLPTQIPMPVSRIQTPMSRFNNTPGPATAPSVGGVSGMAS
                     AHSFGDTGDTQSPYDTYAPHDLASTAPYHSYSPTETTARTMTPGRSMSPGENGPLRTF
                     SPPGPSGTPTLPPLTGYPARSFGAAGQPPARPQPSFSPVDGAVMRNFSPVASRGDPRP
                     SGSDGYAPFNPPSRNSPAPFTREFTSDSPVYQQAGPSAFASPVEYDDRPAPARAYSNR
                     AHPPQSQNYGQDYI"
     exon            complement(599145..600365)
                     /number=1
     CDS             complement(join(600448..600565,600655..600964,
                     601115..601127))
                     /codon_start=1
                     /locus_tag="AO090003000228"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000176"
                     /protein_id="BAE57438.1"
                     /transl_table=1
                     /translation="MGLHSVYAVDTFTAVNLLAFSKWAGQIEPAIPFTVSRWIFAVCI
                     IISFVLLVLRWIRAIRAIRSGSISQSYLDSLAVRLQSIRLWSSGHGWKRFLVFAELTK
                     SKKGADLDECPYRRWAASSRQRNHVVFSHAHGSASRWGECVQDR"
     exon            complement(600448..600565)
                     /number=1
     exon            complement(600655..600964)
                     /number=2
     exon            complement(601115..601127)
                     /number=3
     CDS             complement(602644..603981)
                     /codon_start=1
                     /locus_tag="AO090003000229"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000177"
                     /protein_id="BAE57439.1"
                     /transl_table=1
                     /translation="MPPTPREIDLWNMIDQCEGVIAKQKGLIIAKTEELRVVKQRMED
                     GWALVKKLSARQALIEETRPRETTVIVELRQELAVKKGQLIIAQGKLRHVQDDTTAKE
                     RSLCERVAQLEQQLAREREQAEADSLSEHRSLRAELQTRKDQLVTLEHRLAAAEARER
                     QSRGHIDTEHQNLVIRNNELVAQNQELMAQCQASQTEHDRLELQVRDSSVAIQERDAA
                     LGRVILLETELVTTKSSAESVVRQAQESLAHAYKADVALRQSMPDLQHTCDLTLAQER
                     ATADQAQKRASDLTAEVNVLQGKIGMAMRDAQRSHNQAAAAERTIQILEHRLSRWEAS
                     HSSQEIPKRPSRDVGSISTALAQSQVTVSQQQTEINDLRRQLGEAKQGFLWPSEQVAQ
                     EGVQKLWEVLSNEKRARTEDNIRWSRKTRELEDECQKLRISLSNAAASTPVRR"
     exon            complement(602644..603981)
                     /number=1
     CDS             complement(join(606062..606076,606132..606440))
                     /codon_start=1
                     /locus_tag="AO090003000230"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000178"
                     /protein_id="BAE57440.1"
                     /transl_table=1
                     /translation="MPSGWQSRSPNDPVIIDGEVIGNDPRGTNIAVHSVAVLPEYQGT
                     GVGKCLVKAYVEYIRNAGIEADQIMLICHDYLIRFYESAGFVNRGPSPSRFAGGGWYD
                     MVLEV"
     exon            complement(606062..606076)
                     /number=1
     exon            complement(606132..606440)
                     /number=2
     CDS             complement(join(609533..610499,610550..610737))
                     /codon_start=1
                     /locus_tag="AO090003000231"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000179"
                     /protein_id="BAE57441.1"
                     /transl_table=1
                     /translation="MSGRSNDKQSLSRYKEMFSDLVNEHYEMKFDKLLPTHNGGSESE
                     GHDLAKVISDYPEKGVLSSIMPSLETKLDNTAFLVAFITSAHDYSLSGKFDKEEADAV
                     LKALFSKVVASFNIESVTSSHHTRGLYGGTSGYDGPSNNLRISPSLVVKLIQFADATG
                     NDSTKLINTLTEYTLDVKEGTEESTFHDFLFPVANGICAHIDTTERSSTGSERRFMKH
                     MLAKYVRDYVKKAPPSPPPDWKKKTTIRCICLNCASLRDFIDDPSSTTKDFALGEKRR
                     NHLDQQIDKTFFTTTIVRANPHKLRVEKTQALLVSDFKAWVARVQIANSVLDQLSQKG
                     YLEDMLGNQYHSILSHQNLVLPDDLPALPAPPGLRNMVQRTVPAKRPFGQ"
     exon            complement(609533..610499)
                     /number=1
     exon            complement(610550..610737)
                     /number=2
     CDS             complement(611215..612498)
                     /codon_start=1
                     /locus_tag="AO090003000232"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000180"
                     /protein_id="BAE57442.1"
                     /transl_table=1
                     /translation="MAPSNNENDPIDIKNGLNLVLDKVRSTGSFMTSANIDTAVNPGL
                     YIPDVGNIGLPISTEHAKAIIQSCHPSPYGKGTETLVDESVRKSWQLDASQFALQNPR
                     WQLQVELFVDKAVTGLGLTANGREVKAKLYKLLIYEEGAFFLPHRDSEKADGMFGTLA
                     VCFPSKHEGGDVIVSHSRDQLKFQTAPTSEFGISWAAWYADVTHEVKPVTSGYRVVLI
                     YNLIHRPSTALLESRGSSTENITRLLDPWARAAGVDPIPYLDGWNNRIHDTCPPALIY
                     VLGHQYTNAALNFSRLKGVDQCRFAELRGACQRAGFDIFLANIEKKEMGAVEDDGSFY
                     GGSYGRGGNGTHRIDYLIESSLTLSHVVDSGGIAVGRDIPFPKDMLIQTSVFDRDPDK
                     EDFQGFTGNEGASATHFYHETVSFYVVHSDPYALC"
     exon            complement(611215..612498)
                     /number=1
     CDS             join(616031..616279,616355..616568,616624..617293,
                     617358..618405)
                     /codon_start=1
                     /locus_tag="AO090003000235"
                     /note="predicted membrane protein, contains two CBS
                     domains"
                     /old_locus_tag="AO070341000183"
                     /protein_id="BAE57443.1"
                     /transl_table=1
                     /translation="MATPSAVRLLAIRPVIVGFAKLLMLALGGLPLVSAAPATYIAYS
                     EESPKAPNDPDLWLYLGVAAILVLSGGAFAGLTIALMGQDEVYLQVIKTSGEGSERKN
                     AESVLKLLKRGKHWVLVTLLLSNVITNETLPIVLDRSLGGGWPAVLGSTVLIVIFGEV
                     VPQSICVRYGLPIGAWMAPCVLALMYIMAPVAWPIAKLLDRLLGEDHGTIYKKAGLKT
                     LVTLHKTLGEAGEQLNSDEVTIISAVLDLKDKPVGSIMTPMDDVFTMSADTVLDEDTM
                     DLILSQGYSRIPIHAPDNPTNFVGMLLVKMLITYDPEDCRRVREFALATLPETRPETS
                     CLDIVNFFQEGKSHMVLVSEYPGEDRGALGVVTLEDVIEELIGEEIVDESDVFIDVHK
                     AIRRMTPAPIKSRVPKGKIVEEPPSLPPQKTGTLVDVDGEPQVSKPPANVRRRSSVEP
                     PLPRFQLRMPQSDRNSDSTDGLVTKRGTTDEIREHLKHLGPSNLASRPRQTRYQNVKI
                     KRASVSPTRSAQTDMDSGHSMSGSQALHPNSTALPGGIGEGLVQPGLDARDGAYAVRV
                     GYGTMSGPKPADAGTQTVGKDVSIPEAVHEEQDEPPRPPGSAAISVNSESSNSQKFKP
                     TSYQHQGPARSGSITEHVVDVNGIRKVVLHTTSTSSSDHEGRTSPKSKFPVRQDGEVV
                     DLNGKRSDGTQGDGTKKRRRRRKRGQASKHADNHVDEESPLLPQ"
     exon            616031..616279
                     /number=1
     exon            616355..616568
                     /number=2
     exon            616624..617293
                     /number=3
     exon            617358..618405
                     /number=4
     CDS             complement(join(620084..620101,620152..621345))
                     /codon_start=1
                     /locus_tag="AO090003000236"
                     /note="C2H2-type Zn-finger protein"
                     /old_locus_tag="AO070341000184"
                     /protein_id="BAE57444.1"
                     /transl_table=1
                     /translation="MKRRIASLPPVSQEVFNDKVLAAKATTSAAAAKASFEKTCVACQ
                     KTFFSENSYQNHVKSSKHKAREAQMLRDSADDASSVMSSTFSLGEPVNKPRERSEVSK
                     VTESLKNATIEEDDEDEEMEEQGFSASRCLFCNEKSSDLQQNTEHMFKTHGMFIPEKD
                     YLVDLEGLVHYLYRKINENSECLYCHAVRNNPEGARTHMRDKGHCMIAFEKQDEQVEI
                     GQFYDFRSTYSDGEGEDEEDSIMEDGGVKVDGEDDEGWETETSASSMDDDEDELDDTK
                     GQVYATEFELHLPSGRTAGHRSLAKYYRQNLRNYPTAEERAARQLAIENGEIEEEEPK
                     PRGRDLNRAVVSRGNGGMGMIGATDSQKQFAAELERKDRTRAQRQEKRYTARVNRAAN
                     NQKHFRDPLLQ"
     exon            complement(620084..620101)
                     /number=1
     exon            complement(620152..621345)
                     /number=2
     CDS             join(622146..622348,622406..626093,626151..626273)
                     /codon_start=1
                     /locus_tag="AO090003000237"
                     /note="E3 ubiquitin protein ligase"
                     /old_locus_tag="AO070341000185"
                     /protein_id="BAE57445.1"
                     /transl_table=1
                     /translation="MTRLRGASVSSYEVSHCGTDKPQFHRSKVPPNAPEVITQNTVDV
                     SDPAQVLLWYRDERRRHFNLLVRRYKNQLLYGCQDPSCSIPTCASYRRRVTEEPFRRY
                     TELSARTLACYLASVDNAESGLCRNTPRVPSDLSSQDHHRRSKRRSRASTNDSRKECS
                     GSSVVGQGATDGYSVAQTSDGQGDFWDNAGRTSSPGFALQAEAECIPANEDQSTQPLK
                     DPKSFTQNLFDTLSLRMIEWLPLRRSPSTFSADSDHSYSRSSSRSPKPSTVHGKSHSR
                     TEKHRQERERTSRHNTSTRGNPLTPSSRTITNTTAAVELKLPNQQIKRLSLADVDQRR
                     QSPRSSIDEKVYPELKPARKLSINTHASADGLVNIPSPPALRHRPQKHRGRTGDGACL
                     HEQPKKERRVSWDGAKLLNGVHVPDDHNPLSADDDQPASEPRSPSAPSLKHNGIHQSE
                     DMPTIQSLTHLTSEIIDELGKLVALSDDEAERWKDELAYIESMGTFDDSEWRFATSRQ
                     REAFTFVSQSVFYALSSTRQILRSFRDNTAGPNDIGQSNSNLKLNLQQLQPSLRKLFT
                     ICPRELVFHSLWSALESLFVPPKELSHPRQSRRSSYNSTTGAVSAPIIIRRASDALGN
                     EHVTDSCAADVATVALFALASSLPEIDATTWRGILQMRATGAVASSADMQKLPLRNTR
                     AVVDVTDALEHDLALRLVDRLVRALTARMAFYEISKVRHPYSHASRKSKNSVLDFLIN
                     NLSDNHRLVTADVDDQNQVRPPGAAAVIAEWLRTLLLKEWDGSPEMSKSSATGGAVQI
                     LSLMYKERNRLGLVPEDFHTPFLSERLEPLEMPVEWIGRSPNNKTLHLLSYPFLFPPS
                     ALVIYFRALNYAAMSRFYEAAMTTTRHVMQTAFGAIQIQDDVGMLARLKTSMTAYLVL
                     VVRRDNLLPDALNQLWRRERRELMRPLKVQMGMDEGEEGLDHGGVQQEFFRVLMAEAL
                     DQSYGMFATDSRTRVSWFQPCSLEPLYKFELLGLLMSLAVYNGLTLPINFPTAFYRKL
                     LGLKVKHLDHIRDGWPELTKGLEQLLTWEDGDVEDVFMRTYEFSFEAFGAIETVDMQK
                     VDRDAPWPLPSALARSGGGNRSLGSPTWSEVRRYTDCVNLSPPSSMGAEATESFADMA
                     KSLDGSVVMQSPTPPAEEASFVTNRNRSQFVRDYIFWLTDKSIRPQFEAFAQGFYTCL
                     DRSALSIFTPEALKTVVEGIQEINMDELEHHARYEGGFGPSHRTIRDFWSIARRFSVE
                     KKAQLLEFVTASDRVPVNGIASIMFVIQKNGVGDARLPTSLTCFGRLLLPEYSSRSVL
                     EDKLNKALENARGFGAA"
     exon            622146..622348
                     /number=1
     exon            622406..626093
                     /number=2
     exon            626151..626273
                     /number=3
     CDS             join(629043..629297,630378..630523,630580..631701,
                     631753..631831,631905..632039)
                     /codon_start=1
                     /locus_tag="AO090003000238"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070341000186"
                     /protein_id="BAE57446.1"
                     /transl_table=1
                     /translation="MLVDEGRSSWLDPMQKYKPDFNPGGGDADIGPKAGLIDAPGHST
                     ELAAPTSGSLARTIAFLLMDSTIVAVAKKSRPGTIVVVMVKHIPIRYPLLLATNALVP
                     SPDRIARMSVQYVDFESPDDPSIPFNWPIRKRVYISGLLGLLTMVVAMASSIFTSAIP
                     TVIMMYNIDREVATLGVSLYVLGFATGPLCWAPFSELKGRKLPLVTSAFGFTVFCFAT
                     AVSKDLQSLMILRYFTGFFGAGPLTLSGAVYADIFPPHQRGIAMVGFCLMVFSGPLTA
                     PFIGGFTVMNHSLGWRWTAYIPGILGSGIFVLLLTTMRETYVPVLLSWKADRLRREQG
                     DWSIHAKHEEISLDLRAIIADYVSLPLKMLALDPIVLCMSVFASFVYGLLYLFLTAYP
                     IIFQQIHGMNPGVGGLPYIGIIVGQLFGALGVFAMQPWVLRKMERNGGIIMPEWRLPI
                     AIPGALAFSGGLFWLGWSGYRRSISWVAPTVSGLLTGFGLLTMFLPSIAYVVEARPKK
                     AASAVAAHTFLRSLAGAIFPLFASYMFDALGVEWACTLLGCVAALLIPIPLLLYIYGA
                     RIRNRSGLSNES"
     exon            629043..629297
                     /number=1
     exon            630378..630523
                     /number=2
     exon            630580..631701
                     /number=3
     exon            631753..631831
                     /number=4
     exon            631905..632039
                     /number=5
     CDS             634494..635195
                     /codon_start=1
                     /locus_tag="AO090003000239"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000187"
                     /protein_id="BAE57447.1"
                     /transl_table=1
                     /translation="MHLKPIQTLLPTLLLFLHLPTPALTTQSPLSPSTPKSGNPVING
                     WYADPEARIFDTTYWLYPTYSAAYEAQTFFDAFSSPDLLTWTKHPTILNLTAIPWSTN
                     RAAWAPSVTRSPSTGEYFMYFSAGDGAGIGVAKSLSGRPEGPFEDVLGRPLIGETVFG
                     AEPIDAQVFVDEEDGNRVWLYFGGWSHAVVVELGADMVSLKGEYLEITPKEYVEGPWV
                     LRRGGVYYFMYSVGG"
     exon            634494..635195
                     /number=1
     CDS             complement(join(635779..637169,637234..637255))
                     /codon_start=1
                     /locus_tag="AO090003000240"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000188"
                     /protein_id="BAE57448.1"
                     /transl_table=1
                     /translation="MLDENLPTFFLKKTQQKFVWTILHSHRGTEPEPAYTLRHPDPAS
                     PSSKNRYAAALVDPYVPDIVYGEVLLIPEWTQPSLSAEAIRQNGGVTPSPEPILPTRF
                     TVHLYNPDQQVTVQYKPKTWNSPATWSFEMPQQSFRQPSSSTLDRTQTDPAAADTTPK
                     LRFSWRKDSKLSKDLTCLLSGKTTALSGTKAKSKEPDITISIFQALRELTLYEPNLYR
                     VEMEDFKGLEVVLLLGAITIRDVYFTTMKDAFKLDATSVPVGPTPAAVANSPNGHTTA
                     PAAGKDKQPVSAGSGALNANTTPTIPEEPTVENPPRRKQEQDKEEERRTKKLLEEEEK
                     ARRKRQAEIDKETRRLQRLYGEEEQRVRHSTPSLPPRPLQSPPPSERPAAAGRGAPAQ
                     RYYHTHHHSPSVPHIGHSPYLQTPGGNPHRQSVAFLPTQPQPAAVSKPQKLQQKKSFF
                     GFRRSSSDENKLSKKRSSMF"
     exon            complement(635779..637169)
                     /number=1
     exon            complement(637234..637255)
                     /number=2
     CDS             complement(join(639162..639451,639511..639670,
                     639741..640085,640141..640176))
                     /codon_start=1
                     /locus_tag="AO090003000241"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000189"
                     /protein_id="BAE57449.1"
                     /transl_table=1
                     /translation="MPPVIHCVRHAQGFHNLCTENHVIRDPLLTDLGNEQCRKLSENF
                     PFHDKIDLVTASPLRRTIYTALQSFGPVFEAHKDTKLLLLPDVQETSDVPCDTGSDPV
                     DLRKEIEENGLPVDPSLVHEGWNNKTGRYAPTHDAIRKRAREARRWLKARPEKEIVVV
                     THGGFLHYFTEDWEDGNQYQGTAWANTEYRTYEFSSEAHKTDVEGHELEGEDATLVET
                     ISSRERRGKEGPAPDREAQKALYKKGIQGWDDQGLQLSTAERKAAKVPEGKEVDGVRV
                     "
     exon            complement(639162..639451)
                     /number=1
     exon            complement(639511..639670)
                     /number=2
     exon            complement(639741..640085)
                     /number=3
     exon            complement(640141..640176)
                     /number=4
     CDS             complement(640944..641645)
                     /codon_start=1
                     /locus_tag="AO090003000242"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000190"
                     /protein_id="BAE57450.1"
                     /transl_table=1
                     /translation="MIGASILLFIYEMRVPSEDHGGWASHCDGVAALMKEMGAQSFTH
                     GFARSCYIFFRGFLIAYAFHKEQPCFLEEDQWQQLAEKVRAEDSQKPGLSRMFADVTE
                     RIVMELVKCPRYVHDAQLHQSTQNSQQALVLYSRILCTKNNLGFLVTQLKDLISIYQP
                     ENTASAPEFLLNGAVDAINLLNTLVQKLIMDPIPPIRLYSSLARLLDNKYIVQDARCL
                     DRLGCSMGISGTRLD"
     exon            complement(640944..641645)
                     /number=1
     CDS             complement(join(644220..645226,645272..645336,
                     645378..645799))
                     /codon_start=1
                     /locus_tag="AO090003000243"
                     /note="alcohol dehydrogenase, class IV"
                     /old_locus_tag="AO070341000191"
                     /protein_id="BAE57451.1"
                     /transl_table=1
                     /translation="MVAPSIRVAPSAANRALNLLRTVQYTHPPSCPCHSNPNHHHHHR
                     TPTLADHVRRHMATPVDPSRQKEYAFEMAASSIRFGPGATKEVGMDFANMQAKRVCIV
                     TDQNVSKLDAMKQAVEGLSREGIEFTVFDKVRIEPKDYSISVKEAIAFAKPYNPDAFL
                     AVGGGSVIDTAKLMNLYTVYPEADFLDFVNAPLGKGLPVERKLKPLVAVPTTAGTGSE
                     TTGTAIFDLVSKKAKTGIAHRNLKPTLGICDPLNTRTMPSAVHASSGLDVLCHSLESW
                     TAIPYNERTPRPTNPINRPAYQGANPISDIFSLQALRDTVKYLPRAVKDPDDFEAQSK
                     MLLAATLAGVGFGNAGVHLCHGMSYPISSQNPGYKHAGYDVEHPIIPHGVSVAVTAPA
                     VFRFTAASNPDRHLAAAEAFGVDISNVKRESAGEVLGEAIAKFLAELGDQPRGLKDLG
                     FKSSDIDSLVEGTIPQKRVLMLAPNLNEELEAEKIELRGLLEQSMDH"
     exon            complement(644220..645226)
                     /number=1
     exon            complement(645272..645336)
                     /number=2
     exon            complement(645378..645799)
                     /number=3
     CDS             join(647083..647124,647175..647198,647258..648103)
                     /codon_start=1
                     /locus_tag="AO090003000244"
                     /note="protein kinase PCTAIRE and related kinases"
                     /old_locus_tag="AO070341000192"
                     /protein_id="BAE57452.1"
                     /transl_table=1
                     /translation="MASAPHASFQQLEKLGEGTYATVFKGRNNQTGEMVALKEIHLDT
                     EEGTPSTAIREISLMKELQHENILSLYDVVHTENKLMLVFEYMDKDLKRYMDTYGNRG
                     QLEPGIIKSFVYQLLRGVAHCHENRILHRDLKPQNLLINTKGQLKLADFGLARAFGIP
                     VNTFSNEVVTLWYRAPDVLLGSRSYNTSIDIWSIGCILAEMYTGRPLFPGTTNEDQLL
                     KIFRVMGTPSEISWPGISKFPEYKPDFPVYATQDLRQVVSRIDHLGVDLLRRMLQMRP
                     EMRISAASALKHAWFNDIPRPIPSNAQ"
     exon            647083..647124
                     /number=1
     exon            647175..647198
                     /number=2
     exon            647258..648103
                     /number=3
     CDS             complement(join(648292..648333,648343..648888))
                     /codon_start=1
                     /locus_tag="AO090003000245"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000193"
                     /protein_id="BAE57453.1"
                     /transl_table=1
                     /translation="MHFPLTLLTTLTTTLLFLPTLTPANPLPKTQNQTNYQNQTSSQN
                     QTQTQTQTHQLGHAIVRNNCAFPVYLWSVSSTVSEQQNMTQGALYAETFRRDSQTGGV
                     GIKLTTVPNGLETSAPQTIFAYNLVADRVWYDLSDVFGDPFRGSRVFLDGEVTDIIWE
                     RGVPPAGSRVGNQRAGVDLILTSGVFLGVEGSGCG"
     exon            complement(648292..648333)
                     /number=1
     exon            complement(648343..648888)
                     /number=2
     CDS             complement(join(649903..650586,650640..651446))
                     /codon_start=1
                     /locus_tag="AO090003000246"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000194"
                     /protein_id="BAE57454.1"
                     /transl_table=1
                     /translation="MTRGFLAVFGTLLLSMGALADDTWPYMTLQTADFTPPQLEVKKT
                     GTTDPGYIFIGPRGNQPNGTAALIYDEDGNLVYQGPTEVSANFKVQNLYNKDVITFWA
                     GNMMELGFGYGTVHILDDTYEEIYTVTLPGNFISPDGVVRDSYIDLHESHVTSRNTLL
                     VTAYNITQYDLTSIGGKMDDYMLDGMFFEIDIATNNIVYQWSALEHIQAIPLEQSKQG
                     LGDDYGTQEKPWDAYHINSVELVDGGWIISLRHYWSGYFIAENGTVMWRLSGEKSVGD
                     FEIDDGAIFSWQHDMRVYNQTNEGMVLDLFNNANTPTETVAPTTGLSLSLDLVNRKVT
                     TLRTMNDGDDVIHSVSQGSYQLMSEETNHVFMGYGSISKVKEFDADNNAVLTAQFGDD
                     NAVASYRGYKCQWKATPFWKPAVVIERHSTSATVHMSWNGATEYDNWAIYTASSPEAT
                     DHTFITSAKRTGFETAVDVNNLRSPYFQVVARKGNVPLSSIIVPVA"
     exon            complement(649903..650586)
                     /number=1
     exon            complement(650640..651446)
                     /number=2
     CDS             complement(join(653290..654519,654621..654646,
                     654697..654703,654823..654834,654942..655013,
                     655050..655805,655859..656071))
                     /codon_start=1
                     /locus_tag="AO090003000247"
                     /note="NADH:flavin oxidoreductase/12-oxophytodienoate
                     reductase"
                     /old_locus_tag="AO070341000195"
                     /protein_id="BAE57455.1"
                     /transl_table=1
                     /translation="MPFEKPIVVVTGATGGQGGSVIDALLESGRYQIRAVLRNLTPAK
                     TQPLRDRGVEIVHGDLNDEASLVEAFRGAHAIFAVTDFFEPFMKYGPQEAEKRELAQA
                     KNLAKAAAETSGLSHYIWSTLPSSATLSQGKYHTPHFESKASVDEYILKQFPDLAAKT
                     TFLWVAYYASNLTFPLFTPSLLKTSGKYAWVQPVGPSTPITTIGDHRKNVGIFVEAVL
                     RQPALTRGRYVHAEVETLTNGELLERWGKVTGKPTSYVPSTLEAYNQLFPAWGLEMGV
                     MLQFWEAVGEASWRKPGVMLLRKDDLGIDTAHLTGLDTAFAQIDWNQHNPEIDWFPVS
                     TVRWAFSHKRSKPGRTSDTITLLSLVAYYPFAIASTSKMTPLQQPFTSPSLTLNHRVV
                     LAPMTRMRSSDITAIPNASSATYYAERTTQGSLLISEGTVIHPRGKGFPNTPGLWTHE
                     QALAWKPITDAVHERGGIFFVQLWHVGRVSVPSQIGGLAPLSSTSAHLPGMHMLFGDK
                     NGTEPYVESHAMTGKDIKEVVDAFAHAARLAVGIAGFDGVEIHGANGYLLDSFVHDNI
                     NTRNDEYGGPAIEARLKFPLEVVDAVTQAIGNHRTAIRLAPYHVLQETHDSDRLATFS
                     AFSRSLEERKLAYVHVVEPRYDQLSNEGAFSGSINRENSAESISSALSVSIWPFRRLL
                     KNTPLIGAGGYDAESANEAIAEGRIDLAAFGRYFTSNPDLPERLFRGLPLSRYHRPTF
                     YTSGLEGYLGWPRWGNSLNGEEEVAKPYLKP"
     exon            complement(653290..654519)
                     /number=1
     exon            complement(654621..654646)
                     /number=2
     exon            complement(654697..654703)
                     /number=3
     exon            complement(654823..654834)
                     /number=4
     exon            complement(654942..655013)
                     /number=5
     exon            complement(655050..655805)
                     /number=6
     exon            complement(655859..656071)
                     /number=7
     CDS             complement(657476..658441)
                     /codon_start=1
                     /locus_tag="AO090003000248"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000196"
                     /protein_id="BAE57456.1"
                     /transl_table=1
                     /translation="MSKPQQILVIGAGELGAQVIQALVQHPLRTTAHISVLLRPSSIT
                     PPDRDRAQELSHLRIQGVKYIPADIALDTESHLTSIFRTFDTVIGCTGFSAGRGMQVK
                     IARAVLAAKVPRYIPWQFGVNYDAIGRGSAQDLFDEQLDVRDMLRCAAGTSDSGDNHS
                     KTQWVIISTGMFTSFLFEPSFGVVDILNRRVTALGHQDNQVSVTAVEDIGRVTAEVVL
                     GPESDSAFDNKVIYVAGDTLTYAKLGDLVESLVPGKSRIERNVKTVQEARDDLAREPN
                     NTLFKYQVVFGEGRGVAWDLAETWNRKVGIKTMTVEEWARTHSLV"
     exon            complement(657476..658441)
                     /number=1
     CDS             complement(join(659068..659851,659925..660453,
                     660517..660811))
                     /codon_start=1
                     /locus_tag="AO090003000249"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000197"
                     /protein_id="BAE57457.1"
                     /transl_table=1
                     /translation="MADSTPLMLIRGPTIRRGTEDASLVRSQLMRQRYREKRLRVLRK
                     DTHTNNIPINIQCYENETQALLAGTNLRQISPCRIDPFLSDDRRTGYFDFLLHNCLHV
                     VLPMARPDGFAERCLQAYLHPDRDPMVIQSLFYSATLSLHALPILRGTQNFIVAPGLA
                     SSAVIPPTHHLQLKGFVLNRIRQKLPTMNGNNPHDDIIDDILLSILYLAANENLDRIL
                     PPEKSPFLPPFRRLQSMEFYGSCEFQPLHWQTVQHIISQRGGLSTVKLYGLAWLICIS
                     GLVVAVNANCKPAFPLIYPDGKPFVYRAPLQALAVRQPPRHVTLRNFGFQQLALLHPP
                     VKGTIIRVFLDLTEMTQALQYLAGQPCGSRLLTLIGDTRSNIMHRLCSLPDQTDRPTS
                     IFHKRTCTAEDQARATTVYIISRKTALLYSAHVVLPLPQTSLIRRKMTLEIHEYMLLL
                     KGQRPEAELEILLWCSIVAGICADAMLAIQSWFVREARELCDGLKITTWDELSETLQS
                     FAWLDCASDEAGKALWSQIQLCDGSTI"
     exon            complement(659068..659851)
                     /number=1
     exon            complement(659925..660453)
                     /number=2
     exon            complement(660517..660811)
                     /number=3
     CDS             661401..662279
                     /codon_start=1
                     /locus_tag="AO090003000250"
                     /note="soluble epoxide hydrolase"
                     /old_locus_tag="AO070341000198"
                     /protein_id="BAE57458.1"
                     /transl_table=1
                     /translation="MSSTQLKKLPLPVSKAHVFYRESGAQSAPVVLLLHGFPSSSHQY
                     RNLIPILATKYRVIAPDLPGFGFTEFEDAKIREGIHYTFDTLATVVLEFLDVLSITKF
                     SMFIFDYGSPTGLRLALKRPQSIQAIITQNGNAYEDGLGQFWSQIRELWESNNDPKVR
                     AKLATSLLSLEATKWQYEEGTKGLVAPEAYMLDYALLQRPGNAEIQLDLFWDYQNNIK
                     LYPEFHRYFRESQVPLLAVWGERDQIFIPSGAEAFKLDLPKAEVHLLDAGHFAAETET
                     AEIGALVLDFLARNNI"
     exon            661401..662279
                     /number=1
     CDS             join(664041..664478,664631..664873,664943..665124,
                     665239..665883,665979..666150)
                     /codon_start=1
                     /locus_tag="AO090003000251"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000199"
                     /protein_id="BAE57459.1"
                     /transl_table=1
                     /translation="MPTVPSFRKMKHNPDLLKNLPADFLAGHDKLSREQAGHLRHFHN
                     LATQRDGEWGVMGSQDPGQEWLDAYRYQLATMAYAAGAAHFHRLPALRSIFQSLLSGL
                     IHKMLRREVWGYWFLTSHSGKFVDPDIKRLRQPWADPVVKENIMYSGHLLLMVSLYTM
                     LFNDDKYNQEGALTFNWSPIFWGMGPEKFSYTRESLQKAILAEMEREKWLGVCCEPNC
                     IFIVCNQFPIIAMRYNDVRDGTNVATEVLSKYTAAWEAKGMAGPNGLFISWYSPKQDT
                     KRPALDLGFTAWATAFMNAWNPILANETFQAQSIGFLTRADHDRISINRGPVAFAIRE
                     LAEKKGVDPYSLSTMQKARDIVASNPTTGEHREPFPRPMFGYILMAMSELGDESKLAG
                     LLNHVDRFFQPTWQNGGLYYPVNAEQYDKDGNWTEVEPFTGNGAVGYARLTVLGGQRK
                     MWEEPWSAEQVSRAPHISGIDLGSGVDFLRGCWDESHQAMVVTMRTWDQTEKFYHHSV
                     RLENHNLPVGTYGVYRNGVLTETKFVDRPGDTLEVYVRVEGIDFDLVLLKA"
     exon            664041..664478
                     /number=1
     exon            664631..664873
                     /number=2
     exon            664943..665124
                     /number=3
     exon            665239..665883
                     /number=4
     exon            665979..666150
                     /number=5
     CDS             complement(join(668908..669718,669770..669780))
                     /codon_start=1
                     /locus_tag="AO090003000252"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000200"
                     /protein_id="BAE57460.1"
                     /transl_table=1
                     /translation="MISWVSMIVMGHPQFETQDDVGIGDGIPPIPEWQMDPTALYDDL
                     SELISMEVDYAVRNVFVRLRSAFQQAQRIHFPTTRLHDLTCFVIHRLLLTAPDTESSH
                     SSSITECIRYAIILYMFIIHGPTYYSHAAMMHSIVIRFIDQLKQLESTPRVYGSLDAW
                     LLAIGLVASTGTPDYQWFIERARIMAASLRLSNWNDVLVRIKCILWMETLQGEDIFRP
                     HWDAIFSTMNHPGACISPGNAGGELLCISPSSLVPSKPEPASTNGRQWDMSVASP"
     exon            complement(668908..669718)
                     /number=1
     exon            complement(669770..669780)
                     /number=2
     CDS             join(672417..672594,672650..672800,672881..674129,
                     674197..674232)
                     /codon_start=1
                     /locus_tag="AO090003000253"
                     /note="cytochrome P450 CYP4/CYP19/CYP26 subfamilies"
                     /old_locus_tag="AO070341000201"
                     /protein_id="BAE57461.1"
                     /transl_table=1
                     /translation="MDAKMATEIFNTTSAQPESPQSWAYKTSQLQGALPDFLAEWSAW
                     QYVVTFLVGLVLYDQVLYLKRKGALPGPTFKIPLMGPFIQAIHPTFDGYLRQWASGPL
                     SCVSIFHRFVVLASDRDLAHKVFKSPAYAEPCLVPVARDIIGHKAWVFLQGRDHAEYR
                     RGLVPLFTSRAIATYLPVQERVLDDYYNQFVAATKANQGKPMAFMTLFREINCALSCR
                     TFFGDYISDDQVKKIADDFYLATDALDLVNIPLAMYVPFTKTWLGKRTADAVHRVFAE
                     CAARCKANMAKGATPTCIVDHWVLHMMESNRYRERVAAGETNLEKPKNMIREFTNEEI
                     SDTLFTFLFASQDASSSATTWLFQILAQRPDVLDKLREENLAARGGDRNKPFDLPMLE
                     SLTYTNAVIKELLRYKPPVILVPYLATKDFPVTPDYTVPKGSMIIPSCYPALHDPEAY
                     PNPDVFDPERWISGDAESKTKNWLVFGAGPHDCLARKYVPLSLAGMIGKASLELDWEH
                     HPTPRSEEIRVFATLFPMDGCNLVFKRRP"
     exon            672417..672594
                     /number=1
     exon            672650..672800
                     /number=2
     exon            672881..674129
                     /number=3
     exon            674197..674232
                     /number=4
     CDS             join(677195..677288,677353..678629,678762..678875)
                     /codon_start=1
                     /locus_tag="AO090003000254"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070341000202"
                     /protein_id="BAE57462.1"
                     /transl_table=1
                     /translation="MGRKLGLFRATYLASASCMGSFAFAFDTGVISGVLTLPSFQRDF
                     RYSTSQKTTVNSNAVSILQAGAFFGCFFTMPIASKLGRRSGLILSSLVFTVGTILQII
                     NAHTLGTFYAGRVIAGLGIGAATTLIPMYAAEMAPKEIRGRLGACFQLFFATGVMVAY
                     WVTYAVSKDQPDATKQWQIALGLQLLPSTLLLLGMCTVKESARWLAAKGKKDKAWESL
                     KWVRGGEETEELQKEFDEIIAGIEEEARVKENFTIRELLLPVNRYRIFIAFTIQLCAQ
                     LTGNTSLAYYANQIFEAVGAEGEAKLVTGFFGVVKVVGVSIFQLFVLDRVGRRVPFMV
                     GAFAMGSFMLIIACVLATHPTQSGGSNSSPTKAGIAMIIMTYAEAFSFNMSWGPLPWL
                     YVGEIFSSRTREVGVAVGAASQWLFNFMMSQITPHAITNIGWRMFLMFAIFNYAIIVY
                     SWFFLKETSNHSLEEMQAVFGGGDPPKEASLAGEKGEIDATVRP"
     exon            677195..677288
                     /number=1
     exon            677353..678629
                     /number=2
     exon            678762..678875
                     /number=3
     CDS             join(680457..680567,680627..680878,680996..681040)
                     /codon_start=1
                     /locus_tag="AO090003000256"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000204"
                     /protein_id="BAE57463.1"
                     /transl_table=1
                     /translation="MLASMCLSIAFIIIDTCVVLNAFPAHTLPTGVEPFWKLSFIFKC
                     LCDTVILDDFKTALDRMRNYWLRKQARNGEVLLPETQYEPGSRRHEEDDLEAFGSGRR
                     GSGLRKPDSAVPRVHTREDAKILGVDALNLVTV"
     exon            680457..680567
                     /number=1
     exon            680627..680878
                     /number=2
     exon            680996..681040
                     /number=3
     CDS             join(682684..682865,682925..683089,683143..684248,
                     684304..684869)
                     /codon_start=1
                     /locus_tag="AO090003000257"
                     /note="molecular chaperones GRP78/BiP/KAR2, HSP70
                     superfamily"
                     /old_locus_tag="AO070341000205"
                     /protein_id="BAE57464.1"
                     /transl_table=1
                     /translation="MARLSSRNGAAKPFTAWTTIFYLLLVFIAPLAFFGTAHAEEDSV
                     QDNYGTVIGIDLGTTYSCVGVMQNGKVEILVNDQGNRITPSYVAFTDEERLVGDAAKN
                     QYAANPVRTIFDIKRLIGRKYDDKDVTKDTKNFPFKVVNKDGKPVVKVDVNKTPKTFT
                     PEEVSAMVLGKMKEIAEGYLGKSVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVLRVV
                     NEPTAAAIAYGLDKTGDERQVIVYDLGGGTFDVSLLSIDNGVFEVLATAGDTHLGGED
                     FDHRVMDYFVKQYNKKNNVDITKDLKSMGKLKREVEKAKRTLSSQMSTRIEIESFHNG
                     EDFSETLTRAKFEELNMDLFKKTLKPVEQVLKDAKVKKSEVDDIVLVGGSTRIPKVQA
                     LLEEFFGGKKASKGINPDEAVAFGAAVQGGVLSGEAGTEDVVLMDVNPLTLGIETTGG
                     VMTKLIPRNTVIPTRKSQIFSTAADNQPTVLIQVYEGERSLTKDNNLLGKFELTSIPP
                     APRGVPQIEVSFDLDANGILKVSASDKGTGKAESITITNDKGRLSQEEIDRMVAEAEE
                     FAEEDKAIKSKIEARNSLENYAFSLKNQVNDENGLGGQIDEDDKQTILDAVKEVTDWL
                     EDNAAEATTEDFEEQKEQLSNVAYPITSKLYGSAPADEDDEPSGHDEL"
     exon            682684..682865
                     /number=1
     exon            682925..683089
                     /number=2
     exon            683143..684248
                     /number=3
     exon            684304..684869
                     /number=4
     CDS             complement(join(685240..685779,685856..685891))
                     /codon_start=1
                     /locus_tag="AO090003000258"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000206"
                     /protein_id="BAE57465.1"
                     /transl_table=1
                     /translation="MEDKPLAPASKDPRELTAQESSAAVIFPSFTSNTAWSLGLALRS
                     RILSLPADQRKPALISIAPTGGSEPHVVFQAATEPGTFADNEVWVRRKRNTVLRWGVS
                     SWLMRNKMLTSTGLGADQVEAAFVRKHALTSTGGGGAADDFAIHGGAFPVRVKGVDGV
                     IGVVVVSGLKQEDDHQVVLETIQEFIQQGGQ"
     exon            complement(685240..685779)
                     /number=1
     exon            complement(685856..685891)
                     /number=2
     CDS             join(689657..690375,690401..690920)
                     /codon_start=1
                     /locus_tag="AO090003000260"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000208"
                     /protein_id="BAE57466.1"
                     /transl_table=1
                     /translation="MRPKLTKRACDECITRKVKCSGAWPCDTCRSAPKQVKCTYLKPA
                     RRRGPKVRRQMGNIESVSSVSETNASTSLNGGASNESHDGHRTISRPVLEKVVRWYQH
                     SSYSVWPVIDAEVLVWRFADGDGYDTSIYCLATALCAATMAQLQLPPLIDDGGLVDCA
                     AMASECIRVREESNYRENLDMKSILVSFFLHVYHAKINKRNSAMMFIQEAISGARLLK
                     LDEWDCGTRAGDDRVIANDEILGNVTFVFANAGKVDVDLLRGYAMHLGLLPSYTSPIR
                     LPERIYLAGNEYAQGLLELARLFAAFDSVSLKRSTGTLNPDAISVDCLTETEAALSML
                     SLGEGGRASVRMADYCITREWMRTIIWQEALSRQMLSSKAYAELLTFKFPARVSRDLL
                     YSLQGFSESDLLPLGRDQVC"
     exon            689657..690375
                     /number=1
     exon            690401..690920
                     /number=2
     CDS             complement(join(691330..691811,691865..691943,
                     692002..692369,692450..692615))
                     /codon_start=1
                     /locus_tag="AO090003000261"
                     /note="alcohol dehydrogenase, class V"
                     /old_locus_tag="AO070341000209"
                     /protein_id="BAE57467.1"
                     /transl_table=1
                     /translation="MGARQPTSDPIPSTQTVALVSELGGNVEFREGYPVPTPGENEVL
                     AKVLYTGVCQSDLHTKNGTAAGPSGDPITKIKLPHVGGHEGVGRIVALGPRCGSDLKV
                     GGLVGIRFSSRICRRCEFCLAGTEQYCIKSTNHLHHEDGSFQEFIALDADYLTILPDD
                     IDPVVIGPVLCAGVTAYKAVLNANIRAGNWLVVVGAGGGLGHLAVQYAKAQGALVIGV
                     DAADKRDFVLGLGATEFIDFTSTDPVQRVHEITGLGAHAVVVTAGSAKAFAHACEMLR
                     VGGTLSCVGIPPGRPVLETPICTIVIKGLRITGNLVGSLKECMEAVDLVRRGVVKPEI
                     KVRKFKELPQVYEEMENGDIAGRIVLQVSE"
     exon            complement(691330..691811)
                     /number=1
     exon            complement(691865..691943)
                     /number=2
     exon            complement(692002..692369)
                     /number=3
     exon            complement(692450..692615)
                     /number=4
     CDS             complement(join(695756..696963,697019..697201,
                     697254..698000,698178..698240,698341..698566))
                     /codon_start=1
                     /locus_tag="AO090003000262"
                     /note="elongation factor 1 alpha"
                     /old_locus_tag="AO070341000210"
                     /protein_id="BAE57468.1"
                     /transl_table=1
                     /translation="MSRHRVKAVAYDEDDFDDGYDSPDPEEQEFLEQCTAEVLSQLLA
                     GSPSVTATRDEVQEALWHYYNDVEKSVNYLRNKKAKETKKKESAPAPAAKAKVPAYPL
                     PPDLVLQEPPHFSAADFFRDSPWLNVPAHRKADILIEPLYPRLGLLGGAPESGGKVSK
                     LAALAAARKKKEGDKASTAAPAQNAEVNKTPVPSTEQKGASLSLRERLAGNGKILKPE
                     GAQSPRPLGKLSHPGSHSPQKKPSPELVKQNGASQVNSANVQQELTAEPLVKKEEKEQ
                     PTVNIRASPSTFASTIVGDVTRPKLTEPSPLFSTSLDLMEIYGQNLTEPFDFTGPSPD
                     DVVLNAQSSAKGFKSKQPASKPAGDKKNQTDLAGGMNNLSVAEKVTVKSKNLDVLSEY
                     QKSKRKNAMNFAVIGHVDAGKSTLMGRLLADLKAIDQRTLDKYRREAEKIGKGSFALA
                     WVLDQGSEERARGVTIDIATNKFETEKTVFTIVDAPGHRDFVPNMIAGASQADFAVLV
                     IDSGTGNFESGLKGQTKEHALLVRSMGVQRIIVAVNKMDSVQWNKDRYDEIEQQVSAF
                     LTTAGFQAKNIAFVPCSGISGDNVTKRSEDPNVSWYTGRTLIEELEATEPYSHALDKP
                     LRMTIGDVFRGSVQNPLSISGRLDAGSLQVGDQILTMPSGETALVRSLEVDSEPSDWA
                     VAGQNVVLNLANIDPIHLRSGDVICRASAPIANITSFTAKVLAFEHLMPSMVDVHRGR
                     LHVPGRISRLVATLDKGSGASIKKKPKIVAPGSVARIVVEMDHAVPLEAPTRVVLRAG
                     GDTVAAGLLE"
     exon            complement(695756..696963)
                     /number=1
     exon            complement(697019..697201)
                     /number=2
     exon            complement(697254..698000)
                     /number=3
     exon            complement(698178..698240)
                     /number=4
     exon            complement(698341..698566)
                     /number=5
     CDS             complement(join(699112..700036,700094..701209,
                     701266..702563,702623..702751))
                     /codon_start=1
                     /locus_tag="AO090003000263"
                     /note="PAB-dependent poly(A) ribonuclease, subunit PAN2"
                     /old_locus_tag="AO070341000211"
                     /protein_id="BAE57469.1"
                     /transl_table=1
                     /translation="MEADWDELSRIQVPPPSPHGMPTIATAIAFDDVMELLWVGNEYG
                     RITSFCGPELQRYTSVRAHPVSEGPVRQILFHDRGVISLSSKSVHMITRRGLTQWHIT
                     HEDMTDLRCMSFTAQLNKVIVAGCQKAMFTIDIDKGHIVDKLPTEYNYTMMKKSRYLC
                     AATDTGSVNALSLTDFRVVKSWKAHGTAVNDMDARNDLLVTCGFSVRHLGSPIVDPLA
                     NVYDLKTLSPLPPIPFHAGAAYVRMHPKLHTTSFVASQTGQLQVVDLMNPNAINLRQA
                     NVSFMLGIDLSPSGEALAINDAECAIHLWGSPSKVHFNEMSKEVEFADVPARPPPLDW
                     SPDTPLSMIGMPYYHERLFSAWPSHLVFEIGSPPAPIDQALIPYLRPAEIGHYAPNPK
                     KTRRNQVENTRALANSEPALIAPKFLSEKAREQSKAKSDGLVTDAAETLAGTKLNGEA
                     EDDPLLKYSNVEIKYSRFGVDDFDFRFYNQTKFSGLETHIANSFTNALLQLFKFIPLI
                     RNVALQHAASACIFENCLLCEMGYLFDMLEKADGQNCQATNLLKTFGSFREASSLGLL
                     EENLTNKSLSTSIQSVNRFFLGQISHDFRMILPSSDDLDHKLATVASESIRCMFCQKE
                     IVRPGNSLVNELIYPAIDIKQIRRNPAYRFSNILRASIERETQNRGWCNYCRRYQQVA
                     IRKTVHRMPLVMMLNTALNNPIYRRLWAIPGWLPEAVGLVVDAGQILCFEGEDLRMRM
                     QNNMPGLVVYELVGVVSEIDIPEHQKAHLVSFINVSISSREPETTNKWHLFNDFLVTE
                     VDKDEALRFNQPWKVPCVLAYQVKDARHAMDDNWKNVLDTTLLYRDWSLNGGRSVESL
                     ATLSEEEKPTPGTPVALDTEFVDLEKAEIDVKADGSQEIVRPSKSGLARVSVLRGSGT
                     REGVPFIDDYITIKETIVDYVTQYSGIKPGDLDPRTSQHNLVPLKVAYKKLWLLLNLG
                     CVFVGHGLASDFRKINIQVPKCQTVDTQYLFFHPGKNRRLSLRYLAWAVFKEYIQEEP
                     TDNNQGHDSIEDARMALRLWKKFQEYEDAGVVSQILEELFREGSKLGFRPPARNGATA
                     VLSRPGTAVTMQNNSGRNTPSTPEVTAPTASAPTTPRQGFRRSVALTPSNGSFAPGTG
                     DFFGGSPLK"
     exon            complement(699112..700036)
                     /number=1
     exon            complement(700094..701209)
                     /number=2
     exon            complement(701266..702563)
                     /number=3
     exon            complement(702623..702751)
                     /number=4
     CDS             complement(704342..705136)
                     /codon_start=1
                     /locus_tag="AO090003000264"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000212"
                     /protein_id="BAE57470.1"
                     /transl_table=1
                     /translation="MNSPNSMRSSLKRDGTMNLSWRHPCRTPPSLRMAGLVHLSMGIL
                     GPRHPWAILRALRNLSLKDISALGLKVCDPQRILSSNITLMSREETQSHQPNTSPYYG
                     ADQAPMYPPTSQSPDPRNRTPPAGASYQPVHHRPESTYEHPQELGTSVYDSPVEHPSA
                     SQRLPYPASGQAPPAAQPPFQQQQQQQQQEYPPYAPEDAAKPQPPYPIGPASNQQPPM
                     HQPPPVPGTTSTPTPYPSLTPGAAGYQAYNPSQGTAPNSNPASFYR"
     exon            complement(704342..705136)
                     /number=1
     CDS             complement(join(706168..706270,706344..706378,
                     706456..706656))
                     /codon_start=1
                     /locus_tag="AO090003000265"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000213"
                     /protein_id="BAE57471.1"
                     /transl_table=1
                     /translation="MFRAQQNAFDDAVGTISQLHFFHTGMQCVGTRYQTRCFVELADV
                     TSFAQLAKATDENLTSENWEYILDVCDKVAAEESGAKDAVAALIKRLAHRNANVQLYT
                     LEVRTPVRKT"
     exon            complement(706168..706270)
                     /number=1
     exon            complement(706344..706378)
                     /number=2
     exon            complement(706456..706656)
                     /number=3
     CDS             complement(join(708288..708392,708444..708778,
                     708830..708929,708992..710998))
                     /codon_start=1
                     /locus_tag="AO090003000267"
                     /note="p21-activated serine/threonine protein kinase"
                     /old_locus_tag="AO070341000215"
                     /protein_id="BAE57472.1"
                     /transl_table=1
                     /translation="MNHDSFSSLKFRRPSSKLHKDPPSIGSRMLKSQQSNTSLKRHPS
                     APVYPRSSASRSREHSRTRSNAYGSSTSSLDQNSGGPSPVLANNESGYFSGNHNTTKS
                     RPPHSGRFSLNDQSSDELIGSPFDSRGMLSALQENTAESDRQPIQKPPTLRSQTTPDT
                     RGLRQSASFTALHNRMDALVNRTDSDRSTNTKRYSDEGNGTKPVGRSKKASFSSFVNS
                     MLGSPRGIKISAPENPVHVTHVGYDNQTGQFTGLPKEWQRLLQESGISKKEQEEHPQT
                     MVDIMRFYEKNAQGDDEVWHKFDHAYAHHHPVTTSSSQPSSGGSTPYGTVGQRASSPT
                     SPRFPQNHEGSFENPRAPPPIPRGAPAATQAMSPPVGGLVPNRAPPRPPAAANMTPAR
                     PAPQPPTTASYATTRPVQDPWPQFGTIPENAQPFGTPPIPESEPLPSGPQLSRSNSKA
                     NGATAPWVSPAVTPSPTQYQQQQEQAMATAQQAIASKQLDRSQSLRQQQAQQPKQKQA
                     THPTPQQVSPVEDPSAALQQSARAVPAARPRQRARQSNAMDIRSRLVAICTPGDPTKM
                     YYNLNKIGQGASGGVFTAYHNGTGSCVAIKQMNLDLQPKKDLIINEIIVMKDSKHKNI
                     VNFLDSYLHGLDLWVVMEYMEGGSLTDVVTFNIMSEGQIAAVCRETLNGLQHLHSKGV
                     IHRDIKSDNILLSLDGNIKLTDFGFCAQINDSHNKRNTMVGTPYWMAPEVVTRKEYGR
                     KVDIWSLGIMAIEMIEGEPPYLTESPLRALYLIATNGTPTIKDEQSLTPVFRDFLHLA
                     LKVDPEKRASAHDLLKHPFMSFCAPLSHLAPLVKAARLSRAQEKAQKGGH"
     exon            complement(708288..708392)
                     /number=1
     exon            complement(708444..708778)
                     /number=2
     exon            complement(708830..708929)
                     /number=3
     exon            complement(708992..710998)
                     /number=4
     CDS             complement(join(714411..714904,714975..715656,
                     715740..716084))
                     /codon_start=1
                     /locus_tag="AO090003000268"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000216"
                     /protein_id="BAE57473.1"
                     /transl_table=1
                     /translation="METYTLEAGKEAQAELSAAPFEEETPTKPRGLFARIRYYEEYLD
                     RKLGIESHSLDRVLPEGRNPPNSLAMAFMWASATMNISCFSTGFLGKQFGLSLGQTIP
                     IIICSTLMGAAVTGWCATMGPETGLRQVAISRYSLGFYPSSIIALLNVIEQLGWASVN
                     CITGGLALSAVSDGRVSIAVGVVIVACISFLFSFIGLKGVLMYEQYAWMVFFVIFMII
                     YGESAHRANLAAPATVSGITRSGNVLSLISVVYGSSASWSSIVSDFYVHYPVNISKVK
                     VFLYTTLGITIPTCIGMLLGACISSALDTNPEWAAAYDRGIGEILQEIIYPNGFAKFL
                     LVLLVLSGIGVNCIAIYSGALSAQLFAKPCEKVPRAIWSTLVFGCILALGIAGRDHLL
                     DVLENFLSLLGYWNTSFFVILFCEHYVFRGGNVANYDLDAWNTPSKMPIGFAGLTAFL
                     CGAAGWIVGMVETYYVGVIAKLIGADGGDIANELALVFTSVSYIPLRKLELKYIGR"
     exon            complement(714411..714904)
                     /number=1
     exon            complement(714975..715656)
                     /number=2
     exon            complement(715740..716084)
                     /number=3
     CDS             join(718950..719340,719400..719650,719705..721988,
                     722040..723025)
                     /codon_start=1
                     /locus_tag="AO090003000269"
                     /note="vigilin"
                     /old_locus_tag="AO070341000217"
                     /protein_id="BAE57474.1"
                     /transl_table=1
                     /translation="MASDLSNADVNGGIPKSRAAMLEEQHARDEVHKPTVEDVVDEED
                     LKHPPPSSSVQDQKVDAPAQSPAPTEVPAPKAAPKKAPAFDVQSEELFPALGSGPKPK
                     APAASAWGARGPSAAAAVANGIPGGSPAAQGPRIMSLPGKHVEQLRLAPSQMLPRGQL
                     KKPLRDILRDISRRSKANVDMRGGPGGSIIFEGKGSVDAVRQALKEVAQQVGSKQSVR
                     VPIPTSARPHIIGRQGAVVQDMQQRTGARVQVPRVDESAGQVEDDEDTIDVLIEGDAV
                     AAEMARREIEAIVKERASNMSLRLKSIPPEFFPFIAGAHNANLRDIEQRTNAQVHVPR
                     YDTWQSQPPPQEADPGHVQFVAIPEKHIHISGERAAAQEARAEIERLAADLQRQLTLR
                     QLAINRGQHQFILGDNADALHEFLADTGCAIVLPPASDDSEFLTITGPLDSIENGINR
                     AMDLATSMQMASIDLSRQHPNAPSGAHAHARALTRYLRQRQIIKELESMYDARIALPP
                     SSDGPVTWEVYSRDGKNTIRARSDIMNLVHAHPPARLRHISVDPYFHPYIRSRAIPKL
                     QEEYGVHVLTPEELDCPDVVLVYEGPSATASQFEVPRQRPTTAELAAFEKALQEAQEY
                     LSSVLGDQNDIVAKSVTVPAKYQEKVRKFIAREEQAKGEDLIPVRALVAEPSGRGAEC
                     EVALRGPSRLVEELISKLQAFVTEQEKDDLERGYTTSFDFPQKFANFLIGKKGENINK
                     LREEFDVDIKVENGKVEVKGPKAKADAAKARIINLGKKLEDETTHILKIPAQYHRELI
                     GQQGSQVNRLQDRYHVRVQFPRAAPIVADDQSVEASSEAGGSRPSRPQQGADEVIVKG
                     PSKGADATRDELLSLLQWVVDHSHSGSVSVAQSQIPSLIGQRGREMDKLRADTGARID
                     VPGADDTPDASGRVQIKIKGTKKQVEEAKKILEQRSNEFDATVTKTIDIDKKYHKSLI
                     GGGGANIRKIVADAGGPTDGGASRIVRFPRPESAETTIKLEGNGQVVDKIIAAIEEFV
                     KERADQVTANVEVPSTQHRLLIGRGGETRRGIESKFNITLDIPKQGSGRSDIKLKGPS
                     NAVAEAKEHILSMLKDQQGETVEVPRHLHHAISDNGSFFRRLRNDYQVTVDHAGQQVP
                     SKPSSEDTRGAANGGSSLPLITDEPDQAADAHSWKVVENAPAANDPTQPATIPWVLAG
                     NRDNVAKAKAALEKAIANASQQSATGYLILPDPKTYRFVVGQGGSQINAIRKQTGCRI
                     NVPKDQAKGEAIEVKGNKESLEQAKDMILEAVRAGLEGNSR"
     exon            718950..719340
                     /number=1
     exon            719400..719650
                     /number=2
     exon            719705..721988
                     /number=3
     exon            722040..723025
                     /number=4
     CDS             complement(join(723689..723856,723933..724059,
                     724142..724260))
                     /codon_start=1
                     /locus_tag="AO090003000270"
                     /note="cytochrome b5"
                     /old_locus_tag="AO070341000218"
                     /protein_id="BAE57475.1"
                     /transl_table=1
                     /translation="MSENKEFTFQEVSGHNTKKDLYMVIHDKVYDCTSFVDEHPGGEE
                     VLLDVGGQDATEAFEDVGHSDEAREILDGLLVGNLKRVPGDPAPRSHAQATTNASSNS
                     GSSTGLGVGLYAFLLIGGAVAYGAYQYLNAASEAQ"
     exon            complement(723689..723856)
                     /number=1
     exon            complement(723933..724059)
                     /number=2
     exon            complement(724142..724260)
                     /number=3
     CDS             complement(join(726457..728607,729436..729903))
                     /codon_start=1
                     /locus_tag="AO090003000271"
                     /note="ubiquitin C-terminal hydrolase"
                     /old_locus_tag="AO070341000219"
                     /protein_id="BAE57476.1"
                     /transl_table=1
                     /translation="MSSDAAALPSPPGFAPWENIGHPGGQISRPDSLSSSNHATPAGY
                     QSPRFSNIKDLQDEAAALDVNEDSSVCYPTQDSVKHPGKIANSLQLNLLLNRAQDAIE
                     NARRFADNDQPDKAYVQYLRASEITINIIPHHPDYRTTASQRSDWYKQFANLMMLKED
                     RSNTADLPHSTAISAQDLLDYLRRYNVLLIDVRPRDQYDSGHVYAKSIICIEPVALKE
                     NVSAEELEERLVVSPEHEQSLFEKRNEFDMIVYYDQSTDSVSYLAGSPVGTTAPHLRA
                     LYDTLYEFNAYKPLKDGRPPALLLGGLDAWIDLLGQQSLATSSTATVLGSLQKKRPVA
                     RPGRPLGRVPTMVSANSSLEVRKRRLREYKPLNPDELTAWMEKSKNEEIDTTTYIEEE
                     PMAEEPEGQETNEPPTPFVHTYEDFLRRFPEPHAIQESMVTPHARPPVPPMPNYAAPV
                     PVAPSRPPPAVPRPSYSGVTDGRQIQPTLARQNSATKTALYTPSSIYRAKLPRTGLAN
                     FGVTCYMNSTIQCLNATMMLSRFFVDNRFRYYVQKNWKGSQGVMPGLFANLIRSLWKG
                     DVEVIVPTSFRNFCGRLNQEWAIDRQQDAKEFFDFTVDCLHEDLNINWQRSPLRPLTF
                     EEEMQRERMPVAKVSKIEWDRYCHREESFISSLFAGQHASRLRCTTCKRTSTTYEAFY
                     SISVEIPSSGTGDIYQCLRSYCKEEMLSGDEVWKCPYCKCERVATKQIIITRAPQILV
                     IHFKRFSASKTQTARKIHTPIEFPLHGLRMDDFVYSPPSPESNGDPKATMPHDTTLAT
                     VPPFTYDAYGVLRHIGSSMSSGHYISLVRDGARQCWRRFDDERTVDFNPRDLRNKDRL
                     QNEQAYIVFYERVPAK"
     exon            complement(726457..728607)
                     /number=1
     exon            complement(729436..729903)
                     /number=2
     CDS             join(731829..732117,733611..733676,733733..734487,
                     734543..734763,734820..735146,735702..735765)
                     /codon_start=1
                     /locus_tag="AO090003000273"
                     /note="glycolate oxidase"
                     /old_locus_tag="AO070341000221"
                     /protein_id="BAE57477.1"
                     /transl_table=1
                     /translation="MEQHKQKHAAALKNTPTTEPSTSRDAPGTTSLPKNPYELSPVEV
                     ENIHLFATLVDRLQHQPPGTILREPQIQELYESIGTLRPKLARSYGETMSKHVEGHNS
                     KASCWVAIHGSVYDVTDFVDSHPGGPNVILRCAGKDATEDFDSVHEQEILTQSLAPSA
                     LRGHIEPGTLVKSNDINETKIPNKDASLPPPLSSLLNLHDFEIVAEKHLPPNAWAYYA
                     SGAEGEISKRQNSKAFQKVSLRPRILRSIPTVVTTTTILGKQVSLPVYMSAVGIAKLA
                     HPDGERALAAAAGKEGLAQVLANGANNVIESVMDARTSPEQPIFQQLYVNRDITKSED
                     VVRRAERAGASAIWITVDSPVVGKREMDERINLQVEARDDPSRKGQGVAKTMANFISP
                     FIDWDILLWLRGLTKLPIVIKGIQCVEDAVQAYHYGVQGIVLSNHGGRSQDTAQAPLL
                     TLLEIRRYAPFLIESKMQIFIDGGIRRGTDVLKAIALGATAVGLGRPTLYSLAAGYGE
                     QGVRRAVEILRQEIESNMVFLGVTNLKELGPHLLNTARLERDVVGVSSSTAETMGSTD
                     SALTTVI"
     exon            731829..732117
                     /number=1
     exon            733611..733676
                     /number=2
     exon            733733..734487
                     /number=3
     exon            734543..734763
                     /number=4
     exon            734820..735146
                     /number=5
     exon            735702..735765
                     /number=6
     CDS             join(737265..737513,737560..737670,737799..737898,
                     738037..738047)
                     /codon_start=1
                     /locus_tag="AO090003000274"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070341000222"
                     /protein_id="BAE57478.1"
                     /transl_table=1
                     /translation="MTAEQPTPAPPQPAGHGIKPSAMHVEAIPGQPGKIQNGDTALAL
                     FENFDELHEDVDPGELKRLVRKIDFMILPFLAVCYAFYYIDKTTLSYAAIFGINEDLG
                     LSGEQYSWLSSVFYFGFLVWAFPTNFLMQKFPVGKYLGANIFLWGSFLMLQDPP"
     exon            737265..737513
                     /number=1
     exon            737560..737670
                     /number=2
     exon            737799..737898
                     /number=3
     exon            738037..738047
                     /number=4
     CDS             738098..739222
                     /codon_start=1
                     /locus_tag="AO090003000275"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070341000223"
                     /protein_id="BAE57479.1"
                     /transl_table=1
                     /translation="MWYTRRQQPIRIGLWYTANGFGIALGGLLGYGIGHIKGALSSWK
                     YEFLIIGALCSLWGILIVIFLPDSPVTTRYLSPREKRLTVERLRENQTGVENKTLKPA
                     QIYEAFLDWKVWVFLLLGLSGNIPNGGISNFGTLILKGFGFSTCMLCNVSNPSFTWLN
                     PATATATDINADYMGKPNTVVTTLMQIPYGAFIALMILFSIWLNDRLPQNNRCYVTIL
                     FLLPNLAGSFGLCYLPESNKVGRLICYYLTGSYNASFVLILSILTANIAGHTKKVVTN
                     AMIFIGVCAGNIAGPFFYKEAQAPRYPLGIWSMIVSHFVEILLVIVLRTALAWENRRR
                     DRLQGIGPGGEGEEARQWEMDRTAFSDLTDKENLNFRYVY"
     exon            738098..739222
                     /number=1
     CDS             join(739636..739811,739877..740098,740154..740907)
                     /codon_start=1
                     /locus_tag="AO090003000276"
                     /note="L-alanine-DL-glutamate epimerase and related
                     enzymes of enolase superfamily"
                     /old_locus_tag="AO070341000224"
                     /protein_id="BAE57480.1"
                     /transl_table=1
                     /translation="MAKIKSIEYFRVKPRWLFVKVTDEQGRFGWGEGTLEGHTQAVEG
                     ALDELIARLVGYEADDIEHIWQTAWRLGFYRGGPVFMSALSGIDIALWDLKGRVLGVP
                     VYQLLGGKVRQKVQVYAWIGGDRPSDVEVAAKARIAQGLKCVKMNATEDVNWLDSPSA
                     VDSCVERLKQVKALGLDAGLDFHGRLHKPMAKQLAKALEPYRPLFIEEPLLCEHPEAL
                     KQLSDLTTIPIAFGERLYTRWDAKRFLEDASVDVLQPDIAHAGGISETKRIATMAETY
                     DVAIAPHCPLGPIALAASIQVALSTPNFVIQEMSLGMHYNVEAGDIDLNSYLVDKSVF
                     DINEGYVKAPSGVGLGIEIDEAMVRRISAETEPWLPKEFYGPDGGIREW"
     exon            739636..739811
                     /number=1
     exon            739877..740098
                     /number=2
     exon            740154..740907
                     /number=3
     CDS             join(741170..741286,741345..741557,741615..742058)
                     /codon_start=1
                     /locus_tag="AO090003000277"
                     /note="dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /old_locus_tag="AO070341000225"
                     /protein_id="BAE57481.1"
                     /transl_table=1
                     /translation="MDLFSLTDRTALVTGGTRGIGQQMAIAMAEAGADIILVQRDTSN
                     QDTRQKIEDLGRKATIYTADLSSRESVSSLVSNVLNDGHDIDILLNCAGIQRRHPSHI
                     FPDNDWDEVLQVNLSTIFTLCRDIGAYMLTRTPDSSGHRGNIINIASLVSFQGGLTVP
                     AYAAAKGGVAQLTKALSNEWAAKGINVNAIAPGYVATDMNTALLQDPERSASILARIP
                     AGRWATPEDFKGVTIFLASRASGYVSGEILTVDGGWMGR"
     exon            741170..741286
                     /number=1
     exon            741345..741557
                     /number=2
     exon            741615..742058
                     /number=3
     CDS             743248..745266
                     /codon_start=1
                     /locus_tag="AO090003000278"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000226"
                     /protein_id="BAE57482.1"
                     /transl_table=1
                     /translation="MPTSNTSSPVKRPGLGRRAVSSHAVVTRSTSTQSELANSNTAHQ
                     QSSKLSHRPHRAHVVGGGHRNHHRNPSFGKNLNKQLQRHLSHTQIDSERPARHHQRKK
                     SAPATPAAVTPATSPRGTHHVRWDGALGDSQQTTTSMKKNNSSPALRRNSSSVVGKVG
                     KKALVTDRPHTSSGKKKTVGFELADSDDNDEGDWEDTTQSPESTRRSSVAQSKDSVEN
                     TAVLVDPLTFVKRSYPQFPRSTSLPESSLNNFGHNNPLPDDDSDDEPDEDGDTQQPLK
                     TEEREEGSRATDHGDIASRLLSPAHAAKAPPAMSSISATAKPATVDSLSRNASLTNIA
                     SGHDGLRRPPLSSSQNALANTPGNLTQATSSSIEGGVSRFIKTGFHATSRTDSDPNTP
                     SSFLPHYHPQTPPSPGRGASSKRARASPPTRPPGAEPHSRTQQKLWLQRTAALNTSPP
                     DGHGVAATASPSAMDPTFMAAAHARPGAGFDAGRGIVNGVSRAGPAYDNEAKHVRKAY
                     EKTALELTVVRRFQSPTGDSFRRLASLVNDTKSGSSHQRHSSLGKPIKSAPALTLLQN
                     GKQQSPSQNSASPEPKQLISRKRSDLKTSASQTYLQEPADLANEPTDSSQRPKSQHPS
                     HRVLSTSDEAAHPTPAGEENPEEPSFMASEAELMIRRLWESREVAIAG"
     exon            743248..745266
                     /number=1
     CDS             complement(join(745885..747601,747652..747769,
                     747830..748554,748678..750899))
                     /codon_start=1
                     /locus_tag="AO090003000279"
                     /note="uncharacterized conserved protein, contains
                     ankyrin and BTB/POZ domains"
                     /old_locus_tag="AO070341000227"
                     /protein_id="BAE57483.1"
                     /transl_table=1
                     /translation="MSSKLWEFFLRDDVDSFRRVLATASYTSGSQRASGPAGSSSFKI
                     GSPGGIIASSGLSLKSKKLSGTSPGSPVPDRSNTPRSGATLSREELNARDQLGRTLLH
                     LVASSTKPTATDFAVALLEAPFIDIYAQDWESGWTALHRALYAGNAAIAQALLIRDVR
                     DATDFSKSGNTSNASGTLIKIKDREGYSPFDVYGATIASRDIKSIVSSTADVSKLADL
                     DNADTASIASSQLDDFDGDGHFAKRVLKPRTNVLGDEVFTFGSNKNLNLGVGDQDDRQ
                     YPERITFRRPDHLLQRFFSDFQEQQLDEGSSDFQQVRGVTDLPALIKNKPIKIQNIAM
                     SKLHTAILTNDPESNLFLCGFGPGGRLGTGDESTRFSFVCIETGGLASKKVISVALGQ
                     DHTLAITENGEIFSWGSNKFGQLGYGLPRTNNRDDVPMQKTPRQIFNPFKKETILGAA
                     ASAIHSVVFSNFGLYTFGKNEGQLGLVDSDARSLETQTTPRRVGASLFSAPIQSVSAI
                     DQATTILLQNHEVWVFSQYGYSRLSFPLDISSSFIRNSFMSTRYDTSINRIVKVTSGG
                     NTICALSSSGEVFTVQVNRTENPPSSTSTTNPTKTRNSLSTPARVWSVKKAHMAVKDV
                     DVGQDGSIIICTASGSAWRKEKRGKAKDSSSKDHKFARVPGLSRVVSVCSNAFGAFAA
                     VQQNCDVTREQINVDQSTLWKDMLPLSPFNSVVGSLATDQDGVLDPEPIINIKKAVMS
                     DPVLRKAFHDLRHAQSFSIPDVLIIKYDGEGYAQLQLQGVDFLTVLNLAFYSYTDNVF
                     EVWQLVKHTPESASRYRQVRSEVMRIATCLGLPSLERSARLMIEPTKALKSDMERAIN
                     DITFFDSGDVIVELKNGTMRVHSQVICQRCPFFDALFRGRSGGRWLSSRRIDPTDDVH
                     VDLKHIDRHVFEFVLRYMYADTEEQLFDQVRTNDLEEFIDLVLDVAFVANELMIDRLG
                     QICQKMLGRFVTTRNVCHLLNAIAPCCVSEFKDAALEYICLNLEDLLSNRFLGDLDEF
                     LLGALDSVCHENQLSSFPVSRGRNSEEYVFEKYPELVFLAERDRRRKIDTMRLRSHIN
                     QIEANEGKLRATLTPSGQKAQQTPTKGASAATSRSPSLKPKHSISDLMFQMDDENLLT
                     PGELIKGKAAVRGVKPNDANDSRSYPDSPALGSSLAERGSLEGRSYLDDQMASPQDAM
                     LAESPTELRASALNGKKKGFLTPPDASQKPWSASVVSGSKKNLKDIMDEASENRVSNL
                     SLGISSVPRESNSNNSNNLPPKLSQKERKKIQQQQMQEMLAAQKKAKEPPQNPWKMAT
                     PTKPIPLGATSGQDNQTPGSVKSTPKGPSMTLRQTVAGTPPPSKPGTPPVQIQNRKAS
                     TTITQTPSRPSISGPSTAPSPNPPATPLPQPRPAIQSVRHIPRPEPYQTSFTSPSPNS
                     LSLATILMQQQTEKDEIREAATAKHNLQDIQAEQEFQEWWDKESRRIQGLPPVDQKEN
                     ERDGRSGRGGRGKGGQGQGQQRKRRGGGGKGSGNTTSTPAPSQQLPRGNGPDQPGQKS
                     SASTPRQQRTVHVGAAAGGNNARRGGRGGGRGRGKDRDRNT"
     exon            complement(745885..747601)
                     /number=1
     exon            complement(747652..747769)
                     /number=2
     exon            complement(747830..748554)
                     /number=3
     exon            complement(748678..750899)
                     /number=4
     CDS             join(754938..755159,755237..755335,755450..758053)
                     /codon_start=1
                     /locus_tag="AO090003000280"
                     /note="phosphoprotein involved in cytoplasm to vacuole
                     targeting and autophagy"
                     /old_locus_tag="AO070341000228"
                     /protein_id="BAE57484.1"
                     /transl_table=1
                     /translation="MHQHPRSPAPTAPTSSARPNSSRSRELDYRPNSPAADVRVHNSR
                     GLGIETEPDSSGQTVQPAKEAIAKLNQIISNYHTKAALIILHSRIELPPSFNKGSDTP
                     RVNRWFNVEIEDTDVLREQLRTWRTCDATENRPPPLIIETYLDTKGLTNNQTLVALDE
                     NGKRWDVLEALAASQQAHPVRPPSASSDDVILERWRVELGDTSNALPADLGSILPTVY
                     KKSIVLFRSLFTYSKFLPAWKFAKRNGRLRANPALRIKYRIIIGSPNQVSSKPDHLTM
                     PLYESSSKVVETYSFGVTDSPAGPFSAQVTYRTSCDFRVDDSEALLSSRFMGADDEIF
                     RPSLPTRVVDSKVPPPEIGSLPQERRTIEDPDPGRAYGSLSTFHQVGPTTSASPISAL
                     RAKGKLGTSSPSSPGSSSRKALAVAKASPVGRAAALASEGSPGVVRRPSISFQPFKAP
                     PLSASPSLVDPPLSSPRSVSGPRPHPPMAASARKSFPAVQDNSIASPSSASPRPSSIS
                     RYSSAFSHRRGRPSSGGINKLEDDTSSGKASATSSAQPGSGLLAEPTGTSADSIHADD
                     ENISEFLKMLDLRKDLLNTSGSAALDATARRTTVTSAALTRFQRMRDSNAALSDSMSS
                     SLLLQRSSNSSSKQLSGVPPMVAGTSISTASSPGKPISPHTPHTPAIPSRLSSNSIVD
                     YTHSEGNGTELSQGHGSPLDENTSDGTTMEHGPSAVNAIDIPTSPRLFPPVYRRSSSA
                     AHRPRTVAVDDDEIFPFNRSVSLGAEERSNLSLGALHRQHEYESSDTATHRAQREPRP
                     MSSNEDAVVPPSSITRGQGSHKGVTPGPTVASSSSSHHHVYQPRFSHSRGRGSSGGHH
                     SLSSGSSSLARGAAITPGLAERESERDGNGSGSNSVTSAMEDRRGVGRRPSAGRGGPP
                     QSAQLEEDEPLLFAMSDFGASRRSFEEGKHVNHAHDPTGNIAGSRRGGSSRRGGGFHA
                     WS"
     exon            754938..755159
                     /number=1
     exon            755237..755335
                     /number=2
     exon            755450..758053
                     /number=3
     CDS             complement(join(759161..761106,761173..761389))
                     /codon_start=1
                     /locus_tag="AO090003000282"
                     /note="WD40 repeat protein"
                     /old_locus_tag="AO070341000230"
                     /protein_id="BAE57485.1"
                     /transl_table=1
                     /translation="MKLSNQSEVPVYTISGSNTARPLPEWLARRRKRSLKNDPEYANR
                     VELLQDFEFEEASQCVRVSEDGEWVMSTGTYKPQIHTHHLPQLSLSWARHTDALNTTF
                     LLLSSDYSKSLHLQSDRSLQFHTPAGCHYTTRLPRYGRDLVYDRQSTEALVPSVGVNQ
                     DGMGEVFRLNLEMGRYMRSFEIDVGGDDFTSAGGGTLQGGINTGAVNTGAIAEESHNL
                     LAFGTTLGTVELWDPRAKGRAGILLPPTQSVPDEGRHEITALEFHRSGLTLGTGSSNG
                     LIHLYDLRSPVPLLKKDQGYGFPIHTLKFLQPSSLTREQTMEPKILSSDKKIIKIWDP
                     RDGSPWTSVEPAVDINSVAWCKDSGMILTANEGRQQHAFFIPQLGPAPKWCSFLDNLV
                     EEMAEDPNDPNAFSSGQANSVYDNYKFLTIPQLRTLNLEHLIGRTNLLRPYMHGYFVA
                     QRLYEEARLITNPYVWEEERAKRVKEKIDKERESRIRGKKKAAVKVNKKLADRLMAIE
                     EKNERKRAQRVLQKGGDEDMVDAPASAPAAEKPGQGLLGDSRFAKLFEDEDFAVDEAS
                     HEFKLLNPSTVTDVPERKERGLTAVEQEEIDDVPGSSSDDSDSESEAERPVKEKSSGK
                     ISTSSYKRTNRSQQPRMQVSSSSAVNSTRDRSFGSRAQNMRTKERPSRRGGVVGEREV
                     TFTPHVKSKQNRAPAPSRDTSFRAKERRSASGNTFRKM"
     exon            complement(759161..761106)
                     /number=1
     exon            complement(761173..761389)
                     /number=2
     CDS             join(761802..761823,762088..762312,762378..765248,
                     765301..765951,766005..766639)
                     /codon_start=1
                     /locus_tag="AO090003000283"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000231"
                     /protein_id="BAE57486.1"
                     /transl_table=1
                     /translation="MGCFLGYSEAPANGFTILKHLSRLKDLELRLRNSDCLVSSYPRR
                     LGLWVFSATPEFESVRSLRSDESKGEQSRLAVGSSTLKVSASGSVTPRELVKNLSTDP
                     QTAGGSTGSQRPQGTPTPTRRVDSYSSSVAIYAAFISAITGSLNLQLIRRSSAIPLGS
                     RTLFTIIERDYYETSGIVNDDPSSISALTTLQVQLTSVGKLTVSLQTTSQPGIAPLCR
                     LGESPSDICDVAPGADIWLSPSGSVARLVSTKPGPPNTSSPFPPTGSIGIDSLGAAGR
                     KQWKANVLEWLRNFGLPMDSVHETAWVEVEVWEPFYSRLAGETLRLNEDNSSTLPLKR
                     VLWPAVYCFRRTKSASPGSSQWIENACPVVGDPLDFAENWRVVEKPKQDETSPKPPSS
                     HPEQQSRNPEPSAATTDILEGIESLSRASEYPDLQTVSLVYPTPPDGAAAMGLNLAGP
                     SDTFAEEPDLVPSLLQNQSKPKYYEQLTTKDRSEADPSAGFGPLGGLAVGSGLYDTNE
                     DDDLFGDMDERDFGTKGITDADFNFFDDPSFAAMDTDVPADDAQEVPGMVDLEVTEAH
                     PTISEGALLEDFAAQKTPAEILEVAQASPDEVTPKVQPEHMDAEETTVAASPHIEQNQ
                     TISPPLSPVEIKRILLPEPEGDNHVPTKGSRKQSYYNPVAFKPNMSAWDQKYGADGKF
                     RFTTAGPSASKVYTNSDIPTVGMPRRNKKYPTAGAGLMSLDGHASPSSEGQHLQTVSD
                     SSSDTSDDSDGSASESDAPPLPSRKRKRARSNSVGSPAISQVKSLGEAEQEIPVHRPE
                     HSIFLGNLLSTFSDWSMTGYFSLTENRLFPVLTRKDMQIQIAQLFVDQITQSSLDHKL
                     DGGFCLSDLDNKAYSVQTFFEEEGILGTIERLDLNSWISLQENEQASPAPNGAVSRQS
                     SQRKEMGKGSITKLSPPHLRVRRGKEYLEALPPAISFWETFGLEPADGPKDISAYCIH
                     PQIAADAADVFLERLGLLYASCNLGKHVRGCRSSAFERGLCPWDVGSLETAHFLPAMQ
                     SLKLICEDLGTALLKSSPSNDSLVIYIINPFAHASALVDICSAFWCLFQKYIADTGKQ
                     QARQLNEVVLQIIPISFIMSTDSMVVPPQAQYLSLALEIYSRCPPKALQSSLVNCAPP
                     VLLAEPLPRTISFRLASEKTSPLQEGKCLHIAYSKSQDQRWIGVAWSDNSGALQRTIS
                     YNLRYRNASAVRSISDVRSEIWVATKDILDRIQARWKVFVVSTGPVDQDEVDAWTSFI
                     EQYNKANSIPLELTILSVNTAPDLHLEPPFLPMSMSIFNPQTSSTPVATPNASGNVFS
                     PDQSGSAPTPPSGGNAPTNAPTPTEPTLEAETESVLTDICDESWGVILSHRLNNSPHL
                     TEYRPALASGYLLRRKGDTDGDGVYAMTLNLIYTQRPSSCEAILRETLGMYRDLGTLA
                     RARGTRTVQRNTLPWHIATAVRAQEMLSHVL"
     exon            761802..761823
                     /number=1
     exon            762088..762312
                     /number=2
     exon            762378..765248
                     /number=3
     exon            765301..765951
                     /number=4
     exon            766005..766639
                     /number=5
     CDS             complement(767569..768108)
                     /codon_start=1
                     /locus_tag="AO090003000284"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000232"
                     /protein_id="BAE57487.1"
                     /transl_table=1
                     /translation="MKQYPYTQRVSISKQLIATKHIMKKREGKKKKSPLLLSNNLSEP
                     ILIHLRFNLLLRSPNQSRSLLHINVLLILLIILIGILVLILTPFESRRNITSLLLTLR
                     LVVLPHLLDRTEIALRHQPPHLHNLRRNRHRTLIVNHHIKLIIHNLDQHILKILCIRL
                     GSIIQHIGDRTAEPIALIR"
     exon            complement(767569..768108)
                     /number=1
     CDS             complement(join(768397..768456,768514..770622))
                     /codon_start=1
                     /locus_tag="AO090003000285"
                     /note="polypeptide release factor 3"
                     /old_locus_tag="AO070341000233"
                     /protein_id="BAE57488.1"
                     /transl_table=1
                     /translation="MAGQTPESWEDELSQQTEGVNLNAQNRPQPQAPSFRPGVASFQP
                     GAASFVPGQSFQGYGGFQQYGQYGQQAYGGYPYGQQQAYGQYGAYAQQPGGYNQPYNQ
                     QYGGYQQPQQQQQPAQQQPQATQQPKAAESQPAQSAPKPAAVAAPKAKVLSIGGASDS
                     PAAPKTKVLSIGTPSPAPASNTPSSGSATPGDSKGPDAAQAAAKVTATKAIEKTEKKA
                     EQKAAASGKSSPAPASGRSSPGRSSPSRAEVAKAARAADAVAKEQQADVDEATLKEIY
                     GEKKEHVNIVFIGHVDAGKSTLGGSILYVTGMVDERTLDKYKRDAKEAGRETWYLSWA
                     LDLTNEERAKGKTVEVGRAHFKLDVQSPDGPIERHFSILDAPGHKAYVHHMIGGASQA
                     DVGVLVISARKGEYETGFEKGGQTREHALLARNTGVQKLVVAVNKMDDPTVEWSHARY
                     KECTVKVSKFLENLGYKKDDLTFMPISAQKTYGIKDRVSKDLAPWYDGPSLLEYLSNM
                     KLPERKINAPFMMPITAKYRDMGTMVEGRVESGVIKKNANCIIMPNRTKVEITALYGE
                     TEDEIPTGTCGDQVRMRLRGVEEEDLLPGFVLCSPKRLVNCVSSFEAKIRILDLKSIL
                     TAGYNCVMHVHSAVEEVTFTSLLHKCEPGTGRRSKRPPPFASKGQTIIARLDVTSTAG
                     AVCVERFEDYNQMGRFTLRDQGQTIAIGMITKLIKSDEDN"
     exon            complement(768397..768456)
                     /number=1
     exon            complement(768514..770622)
                     /number=2
     CDS             join(771289..771305,771367..771424,771498..771566,
                     771630..771664,771716..773507)
                     /codon_start=1
                     /locus_tag="AO090003000286"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000234"
                     /protein_id="BAE57489.1"
                     /transl_table=1
                     /translation="MNYAIRSGIAITAKYAIRQSSRLLKNVENAEEREELLVLQQRLE
                     SKIQVISPAIDMIELIAARGNTSLESAVSLTKSLRWDIQALGQRLANAAASEEIARKG
                     GQSSISRSQIDDEIKSIIKDIRRLLVRIEDAVPLMNLAITTSGAKLSTNLPATISPSR
                     LLQASTFLTAGDTQYSMSPSQAVQIGPTFTLSMYMLFASHLRSHDDEGIRETTWKEVM
                     HKARLKLRRVPMDLAVNSQTQLPRTQIAAEARVDEYAYQLLIIEDLDDGRVHTFEEDE
                     PQPQTFEGVVSAGLREILPIHQISKIFYADTGKILNISPDGEVNNPVILLKRDINAIP
                     PRRMVEREEAFDYSNEDSDQDEEEVDEVQAQLDAQLNGAGAPSTYPNFHESSIPEEWR
                     LPKDLDPEWIAFEVYNEDDESDSESDDENLRPSAKGDSIDPELMAKLSLDSDATPSRQ
                     GALGESPSQHMATTTVTNPHFNNIRTSLSLLETLLRLTSLQQFQQQSHLSISDELLNF
                     FLEESSTTGAGGDEQHRQRLRADARRRVGWDPYDESPMKRRGEDYQYGWVPEGTPSAY
                     PRESSEFPYSPSDRLRGFQLRSRENTPETPPRSRRNTPRQPDMRQHSTLRSTPAYMDK
                     GSRKNSPLPNRSTSASGDDSERAGHESSEEKP"
     exon            771289..771305
                     /number=1
     exon            771367..771424
                     /number=2
     exon            771498..771566
                     /number=3
     exon            771630..771664
                     /number=4
     exon            771716..773507
                     /number=5
     CDS             complement(join(773903..774204,774280..775198))
                     /codon_start=1
                     /locus_tag="AO090003000287"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000235"
                     /protein_id="BAE57490.1"
                     /transl_table=1
                     /translation="MDIAYDHIQEEILSSNDTKKEGTSQDENKTPQQSNVDLNAELQE
                     TFRAFSASPWGMRIGGLWDNVRKQGETYYEGAKQEYAAASEEAAKGFSDLKQSLVGRT
                     RGLSLSTAFNAGATDKAAEGETAATPEASRSVDAQGESSVGEGFLSRFKAEAARRLKE
                     IEKAEEAADEAIMRFGMNIGQKLRDAVSIVPPESDSSKLLFESKDAEGKRVIHATRFE
                     AQLHVIHSNMESFTKDPVSDEWPSFKEKFNVDNKTTEIAADLEKYPELRSAMEKLVPE
                     QVDYASFWCRYYFLRLVIETEEQKRKELLKGANVSDEEEVGWDDDSDDDTDSPSTPQA
                     KVDTNKANVAQGSATAAPDIKALKPNEPRKSNDQQSQPDSESSYDLVSGATSRAPASP
                     KEKAKDDDSDDDWE"
     exon            complement(773903..774204)
                     /number=1
     exon            complement(774280..775198)
                     /number=2
     CDS             complement(775506..777440)
                     /codon_start=1
                     /locus_tag="AO090003000288"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000236"
                     /protein_id="BAE57491.1"
                     /transl_table=1
                     /translation="MRRGDTSGTNAQTNQEQFQTPDKLPPGDSLRGSLTTKKRIGTPA
                     SSSSTSRSWKRSSFAGARDQPTLTQIDFVTQVSQHQSDDDDDLDYIAEAPKHGTRKRK
                     EVIEIADESGNDADYRPPSNSRVPRARGVRFDQDTNSVGSKQSKAVSRGDGPSKRGLR
                     KSGDGVKGNKKGKDKQQKDKTLTQMDYVRRYLKIEPDEDVKLEYTYTTPQKHERNSHD
                     LQPPNAGDTAPNPVDTYATSSESKRRKLNDESRSSGEAESAGHPKPAEPFAGPVTPRK
                     PRRSEIPSSQSPESPGLAIITSSQFRSATRSPLKRESPTPTIKRIKEESPGYEQVEGA
                     LKSPEETLSHDSTPPSMIPHPPPTVKLTSKESLETNASSTQSYSTKGTTVPKEGIDTH
                     QELDENPKTTQRTVVYETDAETDTGDFQDNDFNIPGSPPERRSDNHFHTYEDDNELPN
                     EDSQELPPIPPSGLDVESGPLQSETNLPSDASVYYRRPQQATQFPLEPIPVLNTQKMA
                     ELFPDYQQESATVSEPPSTPQRLLYTQTQTQSQTQDQDKASTEIVPESSPIVRCESGV
                     NPKDAIRRGHIARESVVQVESSQPADRFQRKADTDRSSQPRGILSRSDLLTSSVMESI
                     PLPAFMLGSQDSIGEPYSDI"
     exon            complement(775506..777440)
                     /number=1
     CDS             complement(join(777812..779571,779623..779977,
                     780031..780219,780291..780851))
                     /codon_start=1
                     /locus_tag="AO090003000289"
                     /note="nucleotide excision repair complex XPC-HR23B,
                     subunit XPC/DPB11"
                     /old_locus_tag="AO070341000237"
                     /protein_id="BAE57492.1"
                     /transl_table=1
                     /translation="MPRTTRARSKKNGARGGRQSREQDDEVPEVYREMLAEAEARDPG
                     NLENDRPIKKRKVQGQSLASPAPSQTTKQEDQHPSKQQENVNLQVQTVYDSSSSDESE
                     MEWEEVDILQAPAAPIQTAPAPGENETMQITLDPHQDQKRKVIRRRKPITAAEREMRL
                     HVHKAHLLCLLSHAQLRNLWCNDEEIQMLTKRVISLLNPSQEQPQYTRSTTFIDGLNQ
                     ASDAFLKRFRVIKSGLKRAHWADDSLALKQRVEDIMSDAEMFLSKDDFQKQAKTLQGS
                     RDFGAQLFCALLRSVAVEARLVCSLQPLPFTGTTKQMTPTKPGRQVIVMSSDDLDTST
                     DDLAKRGASPTPPRTRRLGRPQFKPSTQLKSFVANSRPSIRESSFPVFWVEAFNEAMQ
                     KWVPVDPLVTKSIAKSFKFEPPSSDPYNCMSYVIAFEEDASARDVTRRYSKAFNAKTR
                     KLRVESTKNGERWWGRVMRFYEKPFLEDRDEVEISELTAKIAAEPMPRNLQDFKDHPI
                     YALGRHLRRHEAIFPKRVVGQVSVGKSGSRNQVLEPVYRRSDVHALRSANRWFRLGRD
                     IKVGEQPLKRVQSHRNQVMAIEEDAGDSEQYTETALYAYHQTELYRPPSVIQGKVPKN
                     AFGNLDVYVPSMVPSGGVHIKHSDARHAAKLLGIDYADAVTGFDFKGRHGTAVIQGVV
                     IAKEYEEALKEVLGCLEDQKLQAELEQKSAESLRLWKHFLLKLRIAERVQSYAVEGEE
                     ADDEESVASSNNDHGSPEETGGGFIPEPNQETIGSQYVAQERHFESPAAPKDDDLLGG
                     RFIPNDGERHQETVQESVLEVASGPSHTNREEQSLYSLVVMSDDTNTARSTTPYQGAT
                     MLPEASAPGSRDKEGHRDGDRKIPEGVPSDTPILVESSTAADTPSGSVKVVSQPLSAT
                     QSRIESPVTSDEESNSNDEGSLLSHDPEDEDAIPEWLMSD"
     exon            complement(777812..779571)
                     /number=1
     exon            complement(779623..779977)
                     /number=2
     exon            complement(780031..780219)
                     /number=3
     exon            complement(780291..780851)
                     /number=4
     CDS             join(781737..781891,781954..782408,782461..782966)
                     /codon_start=1
                     /locus_tag="AO090003000290"
                     /note="pyruvate dehydrogenase E1, alpha subunit"
                     /old_locus_tag="AO070341000238"
                     /protein_id="BAE57493.1"
                     /transl_table=1
                     /translation="MTLDVFKEDDKPFSVPIAEDSFDTYHLDPPPYSVETTKRELKQL
                     YHDMTMIRRMELAADGLYKDRKIRGFCHLSTGQEAVAVGIEHALTKQDKLITAYRSHG
                     FTLMRGGTVKSIIGELLGRRDGISYGKGGSMHMFCESFFGGNGIVGASVPVGAGIAFA
                     QQYNDANNVTIDLYGDGAANQGQVHEAFNMAKLWNLPVIFGCENNKYGMGTSVERASA
                     MTEYYKRGQYIPGLRINGMDVLAVLSAVRYGKNFIQAGNGPLVYEYMTYRYAGHSMSD
                     PGIAYRSREELKDQRANDPISNFKERLIEWGVFSEEDAKAIDKNVRSKVNDEVAEAEK
                     MPEPDTKLDILFEDIYVRGSEPQQRRGRTIDETYYRG"
     exon            781737..781891
                     /number=1
     exon            781954..782408
                     /number=2
     exon            782461..782966
                     /number=3
     CDS             join(791105..791130,791231..791310,791370..791531,
                     791598..792295)
                     /codon_start=1
                     /locus_tag="AO090003000293"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000241"
                     /protein_id="BAE57494.1"
                     /transl_table=1
                     /translation="MSQESSRDYDTQSLTASVTDYPIENGRRYHKYHEGSYIYPNDEQ
                     ELDRLDMQHHLIKMVNGGRLFFAPLEHPKRILDIGTGSGIWPIEMAPIFPEAEIIGTD
                     LSPVQPNEVPENVHFLVDDATEDEWLWGPDHFDLIHTGHMSGSLPSFKELLRKALNHL
                     KPGGYMECHEFDPKPKCDDGTMPPDDPEKFSEFALQDWCDLNVRSGQITDPPRQFRVA
                     HRIARWMREVGFVDVQERIKKVPNNPWPTDPRMKEIGKWNETNWLEALSGWSYKPLTA
                     LGWSKPEIEVFLVDVRKSIQNRDVHSYLNFFVVTGRKPLPGEQKP"
     exon            791105..791130
                     /number=1
     exon            791231..791310
                     /number=2
     exon            791370..791531
                     /number=3
     exon            791598..792295
                     /number=4
     CDS             join(793195..793243,793311..794279,794344..794384)
                     /codon_start=1
                     /locus_tag="AO090003000294"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000242"
                     /protein_id="BAE57495.1"
                     /transl_table=1
                     /translation="MKWVGGQSRNAPREAQGSATYAIGSSAYPFPFYNETTESNEFAR
                     SSGWPGSSYIANKASLEQCLAESLKDCQTITAIKDVVRKLRIDLQQEPAYSRSIFEHL
                     VSQSIDHKCAADELVRFLDDPHLNTRGAGNYLCTVEHFVSRGADLSKRSALLGNVTAA
                     LELGRVPEDELCQIIRVLFERVIGGTVVRQRDARILTAYFREMWDAIGRCNIYEYENL
                     DKETIDTWLEGLEKMDLYDSFVLAKDIISATQDRYWAPLFITRFLKFSLDHETDRDYA
                     RGLLSCFTPDEASRCIITVTELLAPSRKQHLFEMWQDHLRRLQNIPSLVSSSPWSDIR
                     VTASPTSTSLKGLYGDKL"
     exon            793195..793243
                     /number=1
     exon            793311..794279
                     /number=2
     exon            794344..794384
                     /number=3
     CDS             complement(join(795595..796239,796339..796386,
                     796458..796583))
                     /codon_start=1
                     /locus_tag="AO090003000295"
                     /note="20S proteasome, regulatory subunit beta type
                     PSMB7/PSMB10/PUP1"
                     /old_locus_tag="AO070341000243"
                     /protein_id="BAE57496.1"
                     /transl_table=1
                     /translation="MTGFDFSNYNRNAALHAKGVPLPKATSTGTTIVGCIFDNGVVIA
                     ADTRATSGPIVADKNCEKLHYISPKIWCAGAGTAADTEFTTALISSNVELHSLSTGRD
                     PRVITCMTMLKQHLFRYQGHIGAYLVVAGVDPTGTGLYTVHAHGSTDKLPYVTMGSGS
                     LAAMSVFESTWKANLNREEAVELCAEAIKAGIFNDLGSGSNVDVCVIEKDKPTQLLRN
                     YIKPNERGEKERNYRFPRGTTAYLNQKVISKEDMRKYVTVEEVSGDPNLMEVDS"
     exon            complement(795595..796239)
                     /number=1
     exon            complement(796339..796386)
                     /number=2
     exon            complement(796458..796583)
                     /number=3
     CDS             join(797185..797271,797338..798057)
                     /codon_start=1
                     /locus_tag="AO090003000296"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000244"
                     /protein_id="BAE57497.1"
                     /transl_table=1
                     /translation="MAFSFGASSPAGGNIPAELGPELPDVSAEEVGFKGVSSDSNVRL
                     LPTPWPDNALPAPSSSLLAVAPTKGVIVGAGPDSLAVASSDAVRKAISAPTEDKAKTK
                     PFQPQATIPLPARPTHVAFASGDDALILATENSSQLLVYETTSLTTGNAQPALSIPTN
                     GATFRSLAPNPAPPSDEAHSSLVALITTNGELLVANLKAGNLVSGPNGNVLKTGVSSV
                     CWSNKGKQLVAGLADGTGYQMTPDGTQKDLIPRPSDLEGNCHGNAQCHIS"
     exon            797185..797271
                     /number=1
     exon            797338..798057
                     /number=2
     CDS             complement(join(801555..801619,803277..804153,
                     804217..804723))
                     /codon_start=1
                     /locus_tag="AO090003000297"
                     /note="polyC-binding proteins alphaCP-1 and related KH
                     domain proteins"
                     /old_locus_tag="AO070341000245"
                     /protein_id="BAE57498.1"
                     /transl_table=1
                     /translation="MSASPSALQSTKRPLEDPSSPSGPNDQPEAKRPALDKVVKGDES
                     EAYAEVKTESSGVPSASADGQGDTVVPDAPNAKGTNPETQPIQSTASHAETGSQSEQH
                     RPQDESSWIHIRAVISSQEAATVIGKGGENVSQIRRLSGAKCTVSDYSRGAVERILTV
                     SGPQDAVAKAFGLIIRTLNNEPLDAPSTAQSKTYPLRLLIPHILIGSIIGKGGGRIRE
                     IQEASGARLNASDACLPLSTERSLVILGVADAVHIATYYVAVTLVEQLTERFGGPAAS
                     AYATRSGGPAGAVPGGMQVVPYVPQPAGGQYGHPDTFKRHHPHPNRAAAGAYGVPYLH
                     GQPAPAPVAQPAMHYGGAPQPYAGAGPHQPAPYGAPQAAPARGGPTPVAPVGGAMPGQ
                     PLTQQIYIPNDMVGAIIGKGGAKINEIRHLSGSVIKINEPQENSNERLVTITGTQECN
                     QMALYMLYSRLGFQQYVACVAPLPSIAHFLPC"
     exon            complement(801555..801619)
                     /number=1
     exon            complement(803277..804153)
                     /number=2
     exon            complement(804217..804723)
                     /number=3
     CDS             join(805723..805905,805968..806837)
                     /codon_start=1
                     /locus_tag="AO090003000298"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000246"
                     /protein_id="BAE57499.1"
                     /transl_table=1
                     /translation="MDVPQETVDKIQRFAVKREKAEESYDQQISPATLQAYNKKLDET
                     LKNLQEQVKRQEDDLRKLRSVNAVDLSKIGADPSSRVSQVRRAKKAYDSLLGSETKLP
                     SSGSPLPSLLAVEEISRLVKESKLSVTMTADKLSTNRQRLKVEEANLRDAQAINDGLQ
                     KRIARIREQQAKKEQKSPSQLAHDLVDQQQEKKEELDKATEELQTSLHNFIDETLAPM
                     LAAEDLGGPTAGDAMSVSDETLERGYTSHGKPKKLKASAANHDSGQRRIDELVRGQTS
                     QGENQERNPSNRREAAAAEMHELLTSLLDAGTSYIDLPRESAAARFLVRAKVAQFHPR
                     DARRLRLIDFGRSLND"
     exon            805723..805905
                     /number=1
     exon            805968..806837
                     /number=2
     CDS             complement(join(807208..807345,807907..807982,
                     808337..810014,810306..810843))
                     /codon_start=1
                     /locus_tag="AO090003000299"
                     /note="ATP-dependent DNA helicase"
                     /old_locus_tag="AO070341000247"
                     /protein_id="BAE57500.1"
                     /transl_table=1
                     /translation="MDLTSSVTDTSVSKTFTKAGDSGLTYALGTPGSQPKNSDVTKFL
                     TLSDEILDQRISGFEDTLRKNSEIVFEQAMKGEPAPGLIAENKSITARIEAIKSLKNK
                     KAAYHACESTRDQLKKALMQVISQGGSPNTMPEELEQSRKATLQLEQIESDIQRLLVQ
                     ADLLSASSSSKGPSRQGSEHADDEEMLEAAGFLDDGYSVSTASNSLQIRKVFAETSGN
                     VARTPTTQKSQTHNGLWHHHPWSKDVKSVLKDRFHLRGFRLNQLEAIDATLSGKDTFV
                     LMPTGGGKSLCYQLPSIVKSGTTRGVTIVISPLLSLMQDQVYHLRQLEIKAYLLNGET
                     QKTERQWIMSTLSSSDAEGHIELLYITPEMVNKNQTLIRNLERLNNRHRLARIVIDEA
                     HCVSQWGHDFRPDYKELGGLRAQLPGVPMMALTATATENVKVDVIHNLKMEGCDIFTQ
                     SFNRPNLTYEVRQKKKGNELLASIADTIKSSYHNKSGIVYCLSRDTCQKVAKSLRDDY
                     RIKAEHYHAGMKPDERAEVQQRWQAGRSHVIVATIAFGMGIDKPDVRFVIHHSLPKSL
                     EGYYQETGRAGRDGKRSGCYMYYCYRDSMTITRMIDSSDGSKQQKNRQRQMLRNVVQF
                     CENKSDCRRVQILAYFNEHFRREDCNASCDNCKSDSVFELRDFSQHAASVIKVVRYFE
                     QSKENVTLSYCVNIFRGSAKKFRSPQHRQAPGYGEGSSLEMGEAERLFYHLLSEGALF
                     DRLDPLHKAVAEDFMVYAKNYCQDSAGESKPRNKTPRPRKKTASRADSRPPRKGSKAK
                     EPMSRIGMMPI"
     exon            complement(807208..807345)
                     /number=1
     exon            complement(807907..807982)
                     /number=2
     exon            complement(808337..810014)
                     /number=3
     exon            complement(810306..810843)
                     /number=4
     CDS             join(812740..813154,813248..813393,813459..814889)
                     /codon_start=1
                     /locus_tag="AO090003000300"
                     /note="protein containing repeated kelch motifs"
                     /old_locus_tag="AO070341000248"
                     /protein_id="BAE57501.1"
                     /transl_table=1
                     /translation="MGKKNKKSAEHKERVAAKQNKKAAQKEKRSKGKKGRDADSDVED
                     ADLDAILAQYAEEQAKFLKVTEVVSGPPSPRSSATVLASPSNRNELLVFGGEYFDGTL
                     ATFFNNLFVYNIDKGEWKEVTSPNTPLPRSGHAWCRGEFSSPKQGTFYHYNDFWYLDP
                     STKEWARLETKGKGPPARSGHRMTYYKNYIILFGGFQDTSQQTKYLQDLWIYDCSKYT
                     WYNPILPPASQKPDPRSSFSFLPHEAGAVILGGYSRVKATTSVGGKQMKGGAQRMTMK
                     PMVHQDTWLLRITPPAADAPASATPTIRWERRKKPANAPNPPRAGATMAYHKGRGIMF
                     GGVHDVELSEEGIDSEFFNTLYAWNTDRNRFFPLSLRRPRAQGKKQANQVKSRDRTKA
                     DEEELLQNLRALEAKKGIRSQDDDDEMELNTPPVEEESDKPEKPSIVRFEMPHMRFNA
                     QLTVQDDTLFIFGGTYEKGDREFTFNDMYSIDLVKLDGVKEIFYNEPENWNLLNEEEE
                     SDDEMDDDEDDEEEEEGDEEEDAMSLDTASPAPTETTVPSVTQEMEQLEVEEPEGEPS
                     VQDSRPLPRPFESLREFFNRTSEEWQKILLETLKAKGLEPEMNIKELRKDAFNIAEEK
                     WWDSREEVMALEDEQEEAGIGEVVSLAERENAGGAGRRR"
     exon            812740..813154
                     /number=1
     exon            813248..813393
                     /number=2
     exon            813459..814889
                     /number=3
     CDS             complement(815045..816601)
                     /codon_start=1
                     /locus_tag="AO090003000301"
                     /note="glutamate decarboxylase and related PLP-dependent
                     proteins"
                     /old_locus_tag="AO070341000249"
                     /protein_id="BAE57502.1"
                     /transl_table=1
                     /translation="MSDKSVMTAMELKDVTVTAETQASLQQQLWEITQTPWKSGILPS
                     ANHLARARASLPSCLANEGVGFEDAKQHILNDIVPAFNGSSISPNYYGFVTGGITPAA
                     LFADNIVSAYDQNVQVHLPDHSIATDVESNALGLLVDLLHLERADWHNGIFTTGATAS
                     NILGLACGREYVLNVTARKAGVPEESVGEHGLYEVIQASGLSGIQVLSTLPHSSLVKA
                     AGILGIGRANVKNICQESNPLLFDMENLERELARPDKASIVALSCGEVNTGRFATTSI
                     DDMRELRRLCDKYSAWLHVDGAFGIFNRVLDDSPEFATIKKGVAGIELADCIAGDGHK
                     FLNVPYDCGFFLCRHPNEAFNVFQNANAAYLTGNSNGPPSIPSPLNIGIENSRRFRAL
                     PVYTSLVAYGRTGYQSMLKKQIRLARMIAGWLFDHSEYNVLPEATTKEELMDQTFMVV
                     LLSAKQDELNKVLAAKINETSKMFVSGTSWQGRPACRIAISNWRVQGDKEFEIVTDVL
                     KSVVEGGTTN"
     exon            complement(815045..816601)
                     /number=1
     CDS             join(817036..817078,817136..817371,817444..817688,
                     817759..817844,817906..818070,818195..818333,
                     818392..818488,818546..818857)
                     /codon_start=1
                     /locus_tag="AO090003000302"
                     /note="predicted hydrolases or acyltransferases
                     (alpha/beta hydrolase superfamily)"
                     /old_locus_tag="AO070341000250"
                     /protein_id="BAE57503.1"
                     /transl_table=1
                     /translation="MAAKLVDKKLHNVPGKLRVAELLFDVPVNYSRPNDGTLRLFARS
                     VRRLTTSFDAPKEDKQLPWLVYLQGGPGYGCRPPQENGWIGTALDKGYQVLFLDQRGT
                     GLSSTISAGTLALKGNAIKQAEYLKNFRADNIVRDCEAVRRCLTVDYPEDKRKWSIIG
                     QSFGGFCAVTYLSIFPEGLAEAFICGGLPPLVNDPDPVYARTYEKLEERNKAYYSKFP
                     EDVERVKRIMQYLEENDVSVPSGRLTPARFQQLGLIFGMHELVLRAWNDLEIFGFLTH
                     PTRTSIDAAGGFDGAVIYAILHESIYCQGQASNWSADRLRSANANFSIDASRPEIWFT
                     GEMIYKDMFDSYDELNEIKEAADILATTKDWPALYDEAQLAKNEVPVYAATYIDDMYV
                     HFSHASNTAAKIKGIKQFITNTMYHNALRAKSDEVMQQLFALRDDSID"
     exon            817036..817078
                     /number=1
     exon            817136..817371
                     /number=2
     exon            817444..817688
                     /number=3
     exon            817759..817844
                     /number=4
     exon            817906..818070
                     /number=5
     exon            818195..818333
                     /number=6
     exon            818392..818488
                     /number=7
     exon            818546..818857
                     /number=8
     CDS             complement(join(819034..819042,819102..819336,
                     819414..819595,819668..820524,820591..821194))
                     /codon_start=1
                     /locus_tag="AO090003000303"
                     /note="uncharacterized conserved protein Sand"
                     /old_locus_tag="AO070341000251"
                     /protein_id="BAE57504.1"
                     /transl_table=1
                     /translation="MDSEIKNQLQDSLGGNDDSKDDITCSSKSSPTMAASSVRERSTS
                     PEGPPPPLPPRPNTLNLLDEGASSSRTLRQSTQSALQSRATTAVSLTDIASHDGGKES
                     YPARGLPGTLRAKASLSHLASPRGSDTADSASVKSSVPQTDFGEVENVFSDFVATESG
                     PMQHDSTGLLQFPEFQADDVDDDFTEEFEPVGDVGDEGENEVLENWKSKRKHYLILSA
                     AGKPIWTRHGDGGLISTYIGVIQTIISFYEDSQDRLNSFTAGDTKFVIVAKGPLYLVA
                     ISRILESETQLKLQLEALYMQILSTLTLPSLTHLFSVRPSTDLKRPLQGSETLLSTLA
                     DSFTKGSPSTLLSALECLKIRKAHRQTINNALLKTRTNSLLYGLVVAGGRLVSVVRPR
                     KHSLHPGDLQLIFNMVFEAEAVKAGGGESWIPVCLPGFNSSGYLYMYVSFVDLREDAG
                     NVADDTATKEESVAVILISTDKERFFELQEMRNSFIEQLEKDGSLKIMKEAIDKGRPK
                     TTDIVPGTVLHHFLYKSRGNVQFTMSSYEPDFSSVSRRRRLMSTYNNLHASIHSKHAH
                     VRVHHCVSQSSTSLAWVTPVFQLYCVAGPNANRNALAHSASKIVQWVQQEEERLFIIG
                     GAVF"
     exon            complement(819034..819042)
                     /number=1
     exon            complement(819102..819336)
                     /number=2
     exon            complement(819414..819595)
                     /number=3
     exon            complement(819668..820524)
                     /number=4
     exon            complement(820591..821194)
                     /number=5
     CDS             join(821649..821739,821821..821945,822006..822155,
                     822217..824378,824523..824752,824803..826268,
                     826315..827574)
                     /codon_start=1
                     /locus_tag="AO090003000304"
                     /note="dopey and related predicted leucine zipper
                     transcription factors"
                     /old_locus_tag="AO070341000252"
                     /protein_id="BAE57505.1"
                     /transl_table=1
                     /translation="MSLDPSSFPRSNSPASSESSLARSRLRGKEENLKKDKNYRRYAS
                     SVERALSLFDTALQEWADYISFLSRLLKALQSHPPDLPIVPHKVLVSKRLAQCLNPSL
                     PSGVHQKALEVYTYVFGLIKPEGLSHDLPLYLPGVAPTLAFASLTVRPLFLNLVETYI
                     CGLEPWAIRPALKAIILALLPGIEEETSDDFDPTLRLINKFRDISSQMDTQRPGGDVN
                     TSGQYFWQCLFLASITSPSRRSGVLAYLNRYLPKLGVTDRRPSKSSSDGSNDMPHDMQ
                     MAADSVVLPEPGLLIRCFASGLTDEQVLVQRNFLDLLVTHLPLSSPILQSRITVDDLQ
                     RLLIAAVGVVARRDMSLNRRLWAWLLGPDPASDRTSFEARNSISENADASTGSGQELS
                     QSEYFRQFGLEPLVGGLLEIIGQKTVVPSEKTRPFRISLSLMDRWEVGGHIVTAVFLP
                     IIRNVQAFEKVASKPHFDEVFRSASAFFDGVESGVIFSELLKLIDWTPESLDRDNGQV
                     MDNLRLAQFILENFNVREEDMVLNHVPLLTLSVLIKMNELSPKNHPKIAHDQLRLVSQ
                     GLFKVISSLTGLLTERAFSKKLASEKITKNHPTDDLNMPEVLEKIHGFYKQSTSSLDP
                     HPLPFASKQLAELIISKAYELVISALAGDNDIASIQENVNLLIILLKKLPKSRIPRDR
                     RLYLAICNRVSANHTEQSTATFSAISSIATGVKNLYSIQSPGFYISYEDISDLIPSLV
                     KQIWQYLSPLSPKFHVEAVRCLWHLHSVSWLDHLVEASITSLMVNSSNTSRQLLSEEQ
                     VGRYFVLWNHSHHGAYELPSKHAQDSALTQVSYQSSLLERPLFIVVFHIVVSRLESLF
                     TQADPSVANQTSLSISSDDYKECSYLLETIHNIISVIPHNGWVALLAQASAQGDRHHD
                     VSASEDNPGTQTLHSSIFHAILRIVSGPKTTAQTSFDEVKLQQTSLLVMRQLLLGPGA
                     EEVAESGIDSLLVERLSSALDEGGSVAVQEALIDTLLAALKVRFAQAYLPQPPPRPKH
                     QRASSRERLTSPSILSFTSDKAEKAPPIPTMPQPPQQLLECLLKGISSPNSRGTVEKW
                     TMLLCEVLPLYSGSIFQIILMLVDCFCKEIQIAYANLQLSFKHTKGWPEDRSEHATIA
                     LLTGLETCIATAHDRLLVDEANVTAVKSPDQPQGFFGNMVSGVFASDASHGRSTAANN
                     RLTVLLCFQDAVRLCFSIWAWGAVERSTLPQDAESLASFQYTSVRMRNRSRRILEHLF
                     TAEALECLETLVEMWTKTDSNTSSLIFSLLHTLDGSRPKITIPAVFNAIYTRTNPSAL
                     DPSRKSTLSSTLTENELAGFLVTYARSLDDDVLDEIWTDCTTFLRDVLSNPFPHRQIL
                     PRLVEFAAILGAKLENTSFGEDRRMRKELGDVLLRLLTAIFTSKPLGLSQESGLLGRG
                     SLEHDNLPAPHIGPDDMLSILASSMPAFTITLGDSDRITTAVSGISTNVIGPLLRSRL
                     FPNNISHSFMALLQHIAKVPAAAKIWKKDIADAFNDPRFFSSHLELVKGGWMNLLRQW
                     VLADKDRLSELMSRLPPPSTAGIMFGVGASAARLDADRKAQLNLRRITLLILSANNDY
                     FIGELPGLLQKLEDLLGATSSSSPSSTTRAEIFMVLRALALKSSTTALAPFWPLINTE
                     LQEAIAAVPLGLQQEVYNPYALLQACKLLDTLLVLAPDDFQLLEWLYVTDTIDAVYPP
                     ERWEPMALADEISQSFGTRSAAADGPRESNELGYSVKQPGLTADWIRETAKDELIDRV
                     LRPWFEQLSIHAFESTYSMSSPGLTTSYDDLLADLFNESTMAN"
     exon            821649..821739
                     /number=1
     exon            821821..821945
                     /number=2
     exon            822006..822155
                     /number=3
     exon            822217..824378
                     /number=4
     exon            824523..824752
                     /number=5
     exon            824803..826268
                     /number=6
     exon            826315..827574
                     /number=7
     CDS             join(828061..828218,828292..828397,828463..828549)
                     /codon_start=1
                     /locus_tag="AO090003000305"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000253"
                     /protein_id="BAE57506.1"
                     /transl_table=1
                     /translation="MSAYRMAFPGLRSVATRRAVIPVRRSFSTSPSVRDAAGSTLPAK
                     KPVGAFRGGIFGFLTGTIVAGASVYYYILGEYRVTNEMLTEDIYSSLALAFPFSFSSF
                     CFITWFRPFFHLLF"
     exon            828061..828218
                     /number=1
     exon            828292..828397
                     /number=2
     exon            828463..828549
                     /number=3
     CDS             complement(join(830837..831835,831883..832461,
                     832522..832589,832639..832897))
                     /codon_start=1
                     /locus_tag="AO090003000307"
                     /note="acyltransferase required for palmitoylation of
                     Hedgehog (Hh) family of secreted signaling proteins"
                     /old_locus_tag="AO070341000255"
                     /protein_id="BAE57507.1"
                     /transl_table=1
                     /translation="MTSILSWFRRLYSLDTLDTRFIVSSNTPLKAVATDRRSAPAKDA
                     RANAIASNAAPSKWRTPEFWVYYVIFLIAVPLMFKTVIEVSQESHPTYPTYSHLLSPG
                     WIAGRKVDNSDAQYSSFRDNIPYLLALLVAHPLLRRVYEHFAQPVDAGSTQTKANATT
                     AQGDARLARRVRFDFYFALIFIVALHGVSAIKVLGILYVNYKIAKSLPRQYVPTITWT
                     FNIAILFANELCTGYPFERIATMLSSEGNAGQESPLILWGRYLDSFGGIMPRWEVLFK
                     VTILRQISFNMDYYWSLDYPASSPIEKKQADPTALSERDRVNIPAEPSAFNGRNYLAY
                     VLYSPLYLAGPILTFNDYISQQRFPPLSLTRSRVTRYAVRILLTVLAMEFILHFIYAV
                     AISQAHPDWSLYSPGQLSMLGFFNLHIIWLKLLIPWRFFRLWALVDGVDPPENMVRCV
                     SNNYSAFAFWRAWHRSFNRWIVRYVYVPLGGGRGRARGDDNKSSSVLFAKARQIFNFL
                     IVFTFVALWHDLNLRLLMWGWLITLFVLPEIIATLLFPAHKWRSRPNTYRVLCGIGAV
                     GNILMMMIANLVGFALGLDGIQGLLSEMLGSYSGLVYLATACAALFVGVQVMFEIRQE
                     ELRAGINLKC"
     exon            complement(830837..831835)
                     /number=1
     exon            complement(831883..832461)
                     /number=2
     exon            complement(832522..832589)
                     /number=3
     exon            complement(832639..832897)
                     /number=4
     CDS             complement(join(834880..835477,835542..836347,
                     836417..836760,836873..836936))
                     /codon_start=1
                     /locus_tag="AO090003000309"
                     /note="choline dehydrogenase and related flavoproteins"
                     /old_locus_tag="AO070341000257"
                     /protein_id="BAE57508.1"
                     /transl_table=1
                     /translation="MGGLYKELPEGLDEVDVIIAGGGTAGCVVASRLSDAYPTLSILV
                     VEGGRDNRGLQNVTYPILLLNNILPGNTDTLFYEGIPEKAVGNRSLVVPSGGVLGGGS
                     SINLLTYSRAQAVDYDQWGVEGWFSKDLVPYLQRLETYKGEGTPETHGYSGPMLVTPG
                     NYTAKASEEGFIKAAAKLGYPEARDIQDLETINATQRNIRYVNGGKRQDAASNYLHPR
                     LGDGFHPNLHVLTQHQVIRVLFNGNKASGVEFRPNPKFNDGVERPVQRVSAKKLVVLS
                     SGALGTPLVLERSGVGDPEILGKAGVDVVAEVPGVGAEYQDHQLMTYAYYSSLLPNET
                     FDAIYSGRTNVDELIQKNDPIIGWTAADVYSKLRPSDEEAKALGSAFESAWNRDYKTN
                     PTKPLSMITSLNGFPGDSTGQPEVQYFSCSTFTPYPYSRGHLHITSKDLDASLDFATG
                     FFADEDDIDIKKSVWSYKKQREIIRRMDIYRGEFAPLHPAFAADSDAATPSEPLDGPL
                     PDDVPDIVYTAEDDAVLEQWLRAHVGTTWHSLGTCKMAPKSEGGVVDSSLSVYGVEKL
                     KIADLSVPPGNVGANTANTAYMIGEKAADIFIQELKA"
     exon            complement(834880..835477)
                     /number=1
     exon            complement(835542..836347)
                     /number=2
     exon            complement(836417..836760)
                     /number=3
     exon            complement(836873..836936)
                     /number=4
     CDS             join(838410..838669,838729..839530)
                     /codon_start=1
                     /locus_tag="AO090003000310"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000258"
                     /protein_id="BAE57509.1"
                     /transl_table=1
                     /translation="MNSITTTVPLRAASLPKSYLHLTLRGCTGSVATAGLRCSSPLLA
                     SRINHQNTKRFISSTPQTQTKEFFPPPNAPHIKEVETAWAHPVYTEEQMRRVTVAHRE
                     TKDWADWVALGTVRLLRWGMDFVTGYRHPPPGKEHEAKFQMTEQKWLTRFVFLESVAG
                     VPGMVGGMLRHLRSLRRMKRDNGWIETLLEEAYNERMHLLTFLKLAEPGWFMRLMVLG
                     AQGVFFNGFFLSYLMSPRICHRFVGYLEEEAVLTYTRAIQDIEHGKLPKWTKLEAPEI
                     AVQYWKMPEGQRTMKDLLMYVRADEAKHREVNHTLGNLNQAADPNPYSVKYKDPSKAH
                     PGKGIANLKATGWEREEVI"
     exon            838410..838669
                     /number=1
     exon            838729..839530
                     /number=2
     CDS             join(840989..841264,843220..846438)
                     /codon_start=1
                     /locus_tag="AO090003000311"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000259"
                     /protein_id="BAE57510.1"
                     /transl_table=1
                     /translation="MLPPTVSTYSVKTFHIPPPPDLVALRKDLRDALDEAGKIMETIG
                     SEKEPPRNMKPPRINVDELSDTDDSRSKMLAGATPLGWHEIQGMRILDPFTLLQQHKQ
                     TRAVAPSLRTMFTTSTVTTAPTHPDSGPKTPTTSSLSQLLSSPPPPPPPAVAVSPPEN
                     SSPRRIKSKSSLRSLRSLGSSLHDDDLDDFHDQAGSDKSLIRPSILRRLSPGLAARVK
                     LLDGSHRNATPTRNPGAVGRIPEEHIKELDNRNKDLSIKIEKRGRSWNAIHLGGKGRR
                     PQQIESTYLEVHDPDTELPSPVESESVEPVEETSTSVANQDPLEETLVEQAPDASATQ
                     EVEELEVEEPEEAPVAMAAVASPRASVGIESGASPNTQVEHAQTDFEKYIQSTSDNEA
                     EQPPPPPPKDLPRPTSANSNVQSYFNPQGLQRPESIYSFSRASFSHQLTQLTSIPLPQ
                     PSSLEASIAAIPNAPLAVKSLTGSAAQIQIWIKKASDVLSGLDAEDEVEWAAAGGREG
                     LDGIDKAITRFEGLMNIYVKAIEDVQLRDDICNVSADSLKTIVIQMDSILQSWADIKN
                     RLRNVKEQVELAMEWEELWNTILGDVSAEVESLSRLLFEIEEKRHINMANAWAADQES
                     NSGLDISELETIVEETPNNGSFSNSNRHSILFDAPPTLDTPLIQTPQDDSEHADLIAV
                     FARIQPLRASLAFLPMRLSMFQCRAERIFPSACAEMEERRKGLEKSYRTLEADAEALR
                     KEFSEDRWVLVFRNAGMQARKMFLSVERSIAKLQEALETGAHVHNPAGLAKRVESYEA
                     KKQHYVPAIERVISLIEKGVKDQLTVNGETVNLLSDMASRMDALKRSVEVMDSSLTEY
                     NVAPGQHLRDSISTIVTMDSPATSLIDTPGSSPPSSVVMTPANKGSGASMGSSSRRGS
                     SVGSVARSTVAKVRRYSGIPQPTATLTVKKSAIPKPILTAPSPSKPSGLYTPTPAAKK
                     VPRPPPPAKDNRPRWNSSVNTNDLEVGHVYKSNTPFRKSSAPGRTSRPLSMMSRRDFA
                     VSPAPSTTRSPSRVSSRVSSRLASRSPNRTGSPTPNRSLLDPPPYSKLRRPPGAEGIN
                     NTPRNRQSFAGLSFGRSVSHDYNRGLLSPTKAERPGTALGHGGSRRISLLPLPRNKSG
                     RDSSAGTRSKPSERPPWR"
     exon            840989..841264
                     /number=1
     exon            843220..846438
                     /number=2
     CDS             complement(join(847010..847177,847253..847362,
                     847471..847840))
                     /codon_start=1
                     /locus_tag="AO090003000312"
                     /note="histone acetyltransferase HPA2 and related
                     acetyltransferases"
                     /old_locus_tag="AO070341000260"
                     /protein_id="BAE57511.1"
                     /transl_table=1
                     /translation="MPSILEDPTTTLPPPKTALQASQTLTPRTSHLKDGTPVTLYPIA
                     NGPQSIPADLVALLHREFSAEIKAGCTYPMEEPMTLERFAEYWFGTFAVVAVLGEEGL
                     VEGRDWEKECLGTFYIKPNYPGRCSHVCNAGFLTTVAARGRGVGIVMGETYLQFAPKL
                     GYKYSVFNLVFENNVASVKIWERLGFKIIGRVPGAARLANSEELVDALIIGRELV"
     exon            complement(847010..847177)
                     /number=1
     exon            complement(847253..847362)
                     /number=2
     exon            complement(847471..847840)
                     /number=3
     CDS             849416..850228
                     /codon_start=1
                     /locus_tag="AO090003000314"
                     /note="predicted N6-DNA-methyltransferase"
                     /old_locus_tag="AO070341000262"
                     /protein_id="BAE57512.1"
                     /transl_table=1
                     /translation="MLPTPCTSHVSFDTIYEPSEDSYLFLDTLASPSESAWLTQRFNA
                     TSSSPNQSTASPLVVELGTGSGVVLGFVAANSQVIFGRRDILPLGIDVNRNACIATRE
                     TANKAIKERQTDNESEANCQKTVYLSSVMADLGSSLRPGSVDVLMFNPPYVPSEDLPR
                     LPSVTEQDVDESGMSRSAKFERDSYFLSLTYAGGRDGMETTDRLLEEIPGLLAPGRGV
                     AYVLFCAQNRPQEVKERIRAWGDGWQAATVGNSGQQAGWEKLVIVRIWKETA"
     exon            849416..850228
                     /number=1
     CDS             complement(join(850848..851155,851260..851309,
                     851399..851412))
                     /codon_start=1
                     /locus_tag="AO090003000315"
                     /note="small nuclear ribonucleoprotein SMD1 and related
                     snRNPs"
                     /old_locus_tag="AO070341000263"
                     /protein_id="BAE57513.1"
                     /transl_table=1
                     /translation="MKLVRFLMKCANETVTIELKNGTILHGTITSVSPQMNTSLRTVK
                     MTPKGRDPISLDTINIRGSTIRYYILPDSLPLDTLLVDDQPKPKNKARKEADRGGRGG
                     GGRGGPRGRGRGRGRGRGRGF"
     exon            complement(850848..851155)
                     /number=1
     exon            complement(851260..851309)
                     /number=2
     exon            complement(851399..851412)
                     /number=3
     CDS             complement(856002..858773)
                     /codon_start=1
                     /locus_tag="AO090003000316"
                     /note="predicted translation elongation factor"
                     /old_locus_tag="AO070341000264"
                     /protein_id="BAE57514.1"
                     /transl_table=1
                     /translation="MASIFTYDPDPPRVSSPWSTSGSSTPQVAGTGCRTVTRNQSATN
                     LDRPDPNVLSDYGITKLEPEPQEGPTEYKLHLLLRARRLYTAMSTGHLVGGSYHSRLP
                     LSTSVPTSSSCESPSKQSQVRSTQSRQQRLQQLTTQLLWRLQQSSPFHSSTAANLVLP
                     VLPEAALELGIPQKPARLLPGLEESQGALYEIGVADDGTFVGLTHDELEESLLNLQVM
                     AGSLGCKVEILRRVIVGNCEWTEDACVPNAEVGKVHAEELWVAEALVSPDWDYYRIES
                     PKNGSHEGKSSSLAARQGELEGDHSKTEQIRISITGPTTAGKSSLLGTLTSSVLDNGR
                     GTSRLGLLKHRHEISSGITSSVAHELIGYAANELSEDTLDVVNYSSGNVAAWDDVHAA
                     SAQGRLAFVSDLPGSVRYLKSTLRGLVSWAPHYVLLCIPANCDDETLKESQPDSAEQT
                     TDINLALSHLDLCNKLEIPTIVVITKMDLASRASLKQNLTKVLSALKLSGKRPAILPV
                     QSGSSEASLDLHHVGPKDSVEIKKLIATTEDWSSTVPIILTSAVDGSGIGRLHALLGN
                     LPIPARPSLRTISPSKALPPPALPTNIFDVDEVFAIPPSKVYSMSAEQSSKENHGVVL
                     CGLVRYGSISIGDELVIGPLLDNALPEHGGRVRSERRSDTQPQSEPFRSRPSSGDFST
                     SFVQGSFPGKIPYPAQAHWQRVRVVSVRNLRLPVRKLVEDQVGTVGVEPLPNFQGEPP
                     PRLGRVRKGIILASFPAPPTSSIPKSLLFHTGFIASFDSSQFASSLSPPLLLGGNAIV
                     YIANIRSTVKVTCMALADDEVVPSPPSPTEPEFFSFDSDVNDRDKGDPSELNHMIKSS
                     TNLNVGDVKITCCFVTSVEWVEVGSRVLLMPGASAALASAHNSGSPSGLEGFVGRVCD
                     VVSTADSSK"
     exon            complement(856002..858773)
                     /number=1
     CDS             join(866948..866959,868333..868637,868884..868968,
                     869035..869107,869554..869597)
                     /codon_start=1
                     /locus_tag="AO090003000318"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000266"
                     /protein_id="BAE57515.1"
                     /transl_table=1
                     /translation="MRSALELMVWSMKPIHCLPRSAPPAIGSSPLKPNAFLASRDEAS
                     HSASATRPRRSSLLSANFDRMGNDEDIEVVGSRRATPRKGSKYPFCARFDRLVRPQCG
                     VGILATEALWWVALQARSNWKWARPAASPDNLLDKGGGDSTWKFTQDELHAVPDKLKS
                     VRTGLKATAPTD"
     exon            866948..866959
                     /number=1
     exon            868333..868637
                     /number=2
     exon            868884..868968
                     /number=3
     exon            869035..869107
                     /number=4
     exon            869554..869597
                     /number=5
     CDS             complement(join(873398..873848,873895..874702,
                     874762..874984))
                     /codon_start=1
                     /locus_tag="AO090003000321"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000269"
                     /protein_id="BAE57516.1"
                     /transl_table=1
                     /translation="MRNNLLFSLNAIAGAVAHPSFPIHKRQSDLNAFIETQTPIAKQG
                     VLNNIGADGKLVEGAAAGIVVASPSKSNPDYFYTWTRDAGLTMEEVIEQFIGGDATLE
                     STIQNYVDSQAKQQAVSNPSGGLSDGSGLAEPKFYVNISQFTDSWGRPQRDGPALRAS
                     ALIAYGNSLISSDKQSVVKANIWPIVQNDLSYVGQYWNQTGFDLWEEVQGSSFFTVAV
                     QHKALVEGDAFAKALGEECQACSVAPQILCHLQDFWNGSAVLSNLPTNGRSGLDTNSL
                     LGSIHTFDPAAACDDTTFQPCSSRALSNHKLVVDSFRSVYGINNGRGAGKAAAVGRYA
                     EDTYQGGNPWYLTTLVAAELLYDALYQWDKQGQVNVTETSLPFFKDLSSNVTTGSYAK
                     SSSAYESLTSAVKTYADGFISVVQEYTPDGGALAEQYSRDQGTPVSASDLTWSYAAFL
                     SAVGRRNGTVPASWGSSTANAVPSQCSGGTVSGSYTTPTVGSW"
     exon            complement(873398..873848)
                     /number=1
     exon            complement(873895..874702)
                     /number=2
     exon            complement(874762..874984)
                     /number=3
     CDS             join(876345..876702,876817..876877,877055..877067)
                     /codon_start=1
                     /locus_tag="AO090003000322"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000270"
                     /protein_id="BAE57517.1"
                     /transl_table=1
                     /translation="MVMATVGAAYGLGTPSATLTNNNDKDALLFGWINQFLALIAIGL
                     GKVALVAFIDHLQKHEAKAKRAFLWFIAGSNFIVNMIAAILVFVQCSPAKKLWDERIP
                     GRCPGRKRVQTFGYIQGLQAFSLPTKIGLSVLMGLGVVDIG"
     exon            876345..876702
                     /number=1
     exon            876817..876877
                     /number=2
     exon            877055..877067
                     /number=3
     CDS             join(879532..879660,879716..880259,880311..880536,
                     880591..881048,881119..881642)
                     /codon_start=1
                     /locus_tag="AO090003000323"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000271"
                     /protein_id="BAE57518.1"
                     /transl_table=1
                     /translation="MKIKPFVLGIASVLSSLVDALPSAGNDTSQPQASDRMVFAHFMI
                     GIVSNRKSAADFDSDMKRAKELGIDAFALNIGVDRVDPFTDTQLEFAYQSAANNDMKV
                     FISFDFNWWKEDSEASQVGQKIAKFGGKPAQLMMDGKIFVSSFAGDRVDVNAIRSAAG
                     RPIYWAPNYHRPESADISKVDALLNWMAWPNDGNNKAPKPGRLVTVQDGDKKYMNALG
                     GKPYIAPVSPWFSTHFGPEVPYSKNWVFPSDNLWYERWVEMLNLKPRFIEIVTWNDYG
                     ESHYIAPLASPHTDDGCSKYVNDMPHNGWMELARPFIAAYKAGASSVNEYIKEEQLIY
                     WYRPSPRGANCDATDTCMVPADNSSGNYFMGRPNGWESMDDVVFVVSMLKSPANIQIS
                     SGNSQQVFEAKAGATAFKAPMGVGKQSFAVVRDNKMVLAGTSPKDIIEGCVCGIYNFN
                     AFVGMLPPEPLDPLQPDSLSRFAQGLKVQCEAKPSLKPPPPPPSTINPNPPTNPPTNP
                     PPTNNPPPPSTTQNPPPQPPPTNNPPPPNQPPPNQPPGTVCTGGTGENNYKGLCDFCC
                     HFGYCPPGPCTCNAYGAPIPAPPSTGQRGVPADGMDDSYKGLCSFACDHGYCPQGACK
                     LV"
     exon            879532..879660
                     /number=1
     exon            879716..880259
                     /number=2
     exon            880311..880536
                     /number=3
     exon            880591..881048
                     /number=4
     exon            881119..881642
                     /number=5
     CDS             complement(join(882165..882170,882318..882824))
                     /codon_start=1
                     /locus_tag="AO090003000324"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000272"
                     /protein_id="BAE57519.1"
                     /transl_table=1
                     /translation="MGSFVEDLWASVFTPGPTPTLLVAANATFAALQLVLFLLLLATY
                     SIHFIVLSVLSASLWWSINWFAQELAAVQAQEAEKEKTESKELLTEEDDDDKRKSEAS
                     RKTPGALDSTESDTETESLMERKISAVSAAAPPSTTAAATTTATLQPPEQQGGIRKRL
                     SMSGESSGYI"
     exon            complement(882165..882170)
                     /number=1
     exon            complement(882318..882824)
                     /number=2
     CDS             join(884891..885422,885483..885955,886011..886356,
                     886418..886494,886554..886796)
                     /codon_start=1
                     /locus_tag="AO090003000325"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070341000273"
                     /protein_id="BAE57520.1"
                     /transl_table=1
                     /translation="MASEEQVQTKDTLDGKSDIQGFSHHAEDILNDREPYGPPGLAGL
                     VANPFVLMCAACSTLGGLLFGYDQGVVSVILVMDQFLERFPEVSPDSSGSGFWKGLMT
                     AMIELGALLGALNQGWIADKISRRYSIIVAVIIFTIGSALQTGAVDYAMLTVARLIGG
                     VGIGMLSMVAPLYISEISPPECRGTLLVLEEFCIVLGIVIAYWITYGTRFMAGEWSWR
                     LPFLLQMVPGFVLIGGVAILPFSPRWLASKDRYEEALQSLSKLRRLPTTDKRVRQEFL
                     DIQAEVRFHQEMNAEKHPNLQGGGLKDAFLLEMASWADCFKPGCWKRTHIGVGLMFFQ
                     QFVGINALIYYSPTLFETMGLDYDMQLLMSGILNVTQLVGVITTIWTMDSLGRRSLLL
                     SGALLMTISHVIIAVLVGLYSDNWPAYRPQGWASVALLLVYMIAFGASWGPVGWAMPS
                     EVFPSSLRAKGVALSTCSNWLNNFIIGLITPPLVQNTGFGAYTFFAVFCLLAFVWTFF
                     FVPETKGRTLEQMDHVFKDNSSEAEEARRHAIEVELLRAEAERYAMEA"
     exon            884891..885422
                     /number=1
     exon            885483..885955
                     /number=2
     exon            886011..886356
                     /number=3
     exon            886418..886494
                     /number=4
     exon            886554..886796
                     /number=5
     CDS             join(887600..887870,887927..887988,888052..888126,
                     888187..890271)
                     /codon_start=1
                     /locus_tag="AO090003000326"
                     /note="anaphase-promoting complex (APC), subunit 2"
                     /old_locus_tag="AO070341000274"
                     /protein_id="BAE57521.1"
                     /transl_table=1
                     /translation="MATTEPNRRRIFASVFPPVQLDGPKPKTKSRDPEQATWDRAWLA
                     ATKFLSIPDQGFRGIENYVPKAPGREVNDALAYLAADKGVMDREEWSCACEGGYFLIC
                     VWVGNFAKRLIRKIYFAPLMEYLLPLLGAVEQEKHVSPLLTREMMTHAVTILGIDTLE
                     DDTVEDDEDSMEVDRRYSVSYRDWRDEPSAEVRVQMMTEGEDTRVTAARERLLSLFND
                     LELVGLGGVRAQKVFASVMNTMMTEFIRAAYSGQWEGPSKVSQHLRHWIENVYARLAV
                     QVLAIINVPESGTKESDRLDVKLSDVEKWQEIGLSRLGALRTGELFDIIVEWPASSGA
                     IEDLRHFTAYPAGRFQVTHSFSAVLDHRLLHPGASTVEILQIYISIIRAFNLLDPKGV
                     LLDRIARPIRRYLRDRPDTVKVIVGGLMADPADARDQTSSGDTLVELSAELTKAHQNS
                     LRSDRGELDWDDMNWMPDPIDAAPDYRKSKTSDVIGSLISLFDSKEAFVKEMQRMLAD
                     RLLQKRTDYDQEMSVLELLKLRFGDNALQACEVMMRDIFDSRRVDAVVRNDQDLTRKP
                     AVSTSSSDDEDIPELHAKILSHFFWPEIQEQDFNVPEEILELQQRYAAGFASLKQSRK
                     LTWLNGLGQVTVELDLEDRVFVDEVSTWQATVIYAFDSPSDDAVSKTANELAEELDMS
                     VALVRSACLFWVSKRILAEVQRDTFRVLEVLPNEEDEAVGGTGVSGTDDNAGDASADT
                     AAAAEAAAAAAAKESAEAAAMEKMNLYWQFIMGMLTNQGAMPLQRIVMMLKIAVPGGF
                     PFSNEELREFLAGMVAKGKLEIVSGGNYKIVQ"
     exon            887600..887870
                     /number=1
     exon            887927..887988
                     /number=2
     exon            888052..888126
                     /number=3
     exon            888187..890271
                     /number=4
     CDS             complement(join(890429..890792,890845..891105,
                     891158..891423,891476..891751))
                     /codon_start=1
                     /locus_tag="AO090003000327"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000275"
                     /protein_id="BAE57522.1"
                     /transl_table=1
                     /translation="MAALTQAPVAIPLDVFPDGLKTTGQHAPLYDHIKSFEQFPKEIS
                     GPTVWKAEEYRDAPEKWTHRFTAEEIAELSATADQFLANKIPLTGISKSNFPLPNLSK
                     RLAELRADLIDGKGFILFKGFPVQEWGNHKSAVAYMGLGTYLGYFVSQNSRGHVLGHV
                     KDLGEDPTQIDSVRIYRTNARQFFHADDSDIVGLLCIARALEGGESDIVSSHHVYNTL
                     AKERPDVLKTLTEPIWYFDRKGETSKGQEEYIRTSVMYLERGENPRVYTKWDPYYVRS
                     LSRFSEAGIVPPLSAAQVEALEVLEATCNRLSLHMILEVGDIQFLSNSHVLHARTAYT
                     DHAPPTPRRHLMRLWLATPEHEGGWKLPFWDSNEKKRGGIQVDDQAPVAPLDAE"
     exon            complement(890429..890792)
                     /number=1
     exon            complement(890845..891105)
                     /number=2
     exon            complement(891158..891423)
                     /number=3
     exon            complement(891476..891751)
                     /number=4
     CDS             join(895389..895554,895960..897623)
                     /codon_start=1
                     /locus_tag="AO090003000328"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000276"
                     /protein_id="BAE57523.1"
                     /transl_table=1
                     /translation="MEHSSSPHRERVHSRQFRCDYCTKTYSKLEHLTVCLAPLSNQTS
                     GTNISQRHQRSRFDHGGDGSVADAGRTAVSEICGFIDQLSRRLNLELSGESITSAFVD
                     ACLHEFLQQILPRFPVIHRPTFSPRNCIPPLLLNIIALGSLFVCLPRAREKGEMLWRL
                     AHTAVATSWQTLIGSQSAKDGFDSAQIVLTALLGQTYAYLSSDSSIRTTAFVFHGLGF
                     LWARVRGMHTVDDCKWETLAADASDAEKQSLWDTWAAKEVQRRAVLGHYILDGLLSQA
                     SGSPTSARHMTNRLTFAASDAAFAATNVGDWIRAMQETNRTDCSFSESFHRICSSQYC
                     LTPLQLSPFSVMVILEGLQSLIAELSEVDQAGVGIVSRQEVVRGLMNLYQANITTIPT
                     TTETHVQLLIQWHAVCIEASVSSAGLYYALCKHFDLPQQIAGMRAEAAGSQIDIEAWC
                     ASSSAFRSLLHADGINKLLKDVTISNICMIHFPSAIFSSAVVYATLCIFRQDVIRFPK
                     SWVWHDIWKPVLDGTAPQEKHLPADGGYLGQGFANGDNVSSLENVLQPIELLHEINFL
                     QLTLKMIGSRWGVAEQMASAVSRFAALAQERYDLGVYPNFVHL"
     exon            895389..895554
                     /number=1
     exon            895960..897623
                     /number=2
     CDS             898985..900289
                     /codon_start=1
                     /locus_tag="AO090003000329"
                     /note="predicted protein"
                     /old_locus_tag="AO080503000322"
                     /protein_id="BAE57524.1"
                     /transl_table=1
                     /translation="MITYNTASDPGVEWSVVRLAEPITSYAPTASERASQGFWVGDAF
                     TQNTFLSQTRLALANLRDYEGLPSMTIQITLLEGGGYGIGIKLSHCLADAQALMVFMQ
                     QWASACRILHGHTNSNSLSPKDKLNPIFNPSLLDTKASAGINTPTPDPTLITKARNLP
                     LHRYDWWKTSDPAYPPIMIPNTTNSKPPPEYLTPNPLSPSTPAPWATWDFTKPVSYTQ
                     IHFTGPELDHLRQQACTQLEPTQTHTPISRLDALLAHIWTLINQARGYDQLKEKVYLN
                     ITLGARTRLNPPLPETFIGSPIFITHVSTSGEEICTSTISKTASQIRSTIQQFTPDNL
                     GAMLYDAGLEVSPQRLWQGFMGQRHTLITSWLRLGVYEVDFDGRGRGPRYVHAVMQMM
                     DGCVQVMDSGVEDGGVDLGVYLDREVLGRVLEGIRLFGNEGD"
     exon            898985..900289
                     /number=1
     CDS             complement(join(901155..901157,901251..902228,
                     902275..902625))
                     /codon_start=1
                     /locus_tag="AO090003000331"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000279"
                     /protein_id="BAE57525.1"
                     /transl_table=1
                     /translation="MSAEQSNRLQLPGYNLPLNYRPDVSITTSPCIIKICMLEYNSRV
                     SVYRVASLLGVRSFQMPWIMATLRVAGLSKTSHCILCHGQNLLTHVSRINVHREILMM
                     RVMNTITDKPDWDKKVFDEAITSKWREEIAQSGQDVTPKMMDYILKELQWKTKDFQKT
                     GFLSVYDAGVVKSDTAIPEDLKQALKNSVAPFEQVPEDQKDYHPGSDMKVVDLVHPSL
                     FPVVYGRTRILPDRVINLDDCLGSVGQGDLLPVPPEGEAQIEGYEGSAYGWRRWEREA
                     LMPFSRKFQWLPCDVKLTGQDGECRIDSYINNVHHSEHRDLYQAVEKIIAQTIPLWDK
                     SLTHVQERRHARIVYDSVDYHPTSTKEPAYDDYSDDEEFDRKYQEWQRSQEIILPEPG
                     EFTPPEITEKINLREQFHESGLQIIVKLANIELTPEKPEYEGGTWHVEGQL"
     exon            complement(901155..901157)
                     /number=1
     exon            complement(901251..902228)
                     /number=2
     exon            complement(902275..902625)
                     /number=3
     CDS             904675..905589
                     /codon_start=1
                     /locus_tag="AO090003000332"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000280"
                     /protein_id="BAE57526.1"
                     /transl_table=1
                     /translation="MSFHIAVLDADVPVPAVYNARGLYSSQFRHLLQSAAARLSEAGH
                     KITIHTSAYDVVGGTFPPLESLRTTKRPETRSNETSTSTSNPLAQPIDGILITGAAAG
                     AYDTYPWIKPLETWIQRVYTQYPHVKFFGSCFGHQIIAQALLSTSAPQCAPGPAMKVE
                     LCPDGRETGLVPIDLSPEFVAAFPEALEKLPGAGRQMRLQMIHGDWVVPVAGPKKELP
                     AGWVNVGSTELCPVQGLYCPGRALTYQGHFEFDVFVNRETCLAFGRRLKWSEEETARF
                     VELIEVGEDDDSKVAAEVVAMFFCGLNE"
     exon            904675..905589
                     /number=1
     CDS             complement(join(905980..906689,906740..907193))
                     /codon_start=1
                     /locus_tag="AO090003000333"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000281"
                     /protein_id="BAE57527.1"
                     /transl_table=1
                     /translation="MSSTAAERRQVFLACKGKAIFSGPYASYRNTGAIIKRIVKHKTS
                     LRALFPKFSVGRVCRISKELLEAGVFESDIKAQLIFPDLLAPSTTKEREHNAFEDEAA
                     HTQAKTVKEVDSVCEEEESEIKQSPSISMSMKVETSVEEETHANQENTSVPLPPPSAE
                     PELPIPSLHPSYFPYHAQHSILSQVQQVLEEGCFDFTKKWLPSELEDNGWDCAAAVEL
                     TKWTKLFKKWSSQLPDGSLQCSGPEFHARLAEVAGIRHTAVHRAPITARAVDAFIVSA
                     VRLTEALRDSQRTSQLENLHLDIQAKVNAMEFSKNALEGDLRREWEAIQRQGEELERK
                     KVELLAKTIANDNEIKVLTGLMVKKSIERIFLGGTHENSSTGFVTADEKVEGD"
     exon            complement(905980..906689)
                     /number=1
     exon            complement(906740..907193)
                     /number=2
     CDS             join(910212..910281,910341..910533,910660..910792)
                     /codon_start=1
                     /locus_tag="AO090003000334"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000282"
                     /protein_id="BAE57528.1"
                     /transl_table=1
                     /translation="MKVFTPIFVLMALATSQAIAAPAAEAESLEARADYCVDIKVCHG
                     YNYEGGCYKECKKPGEPVDIRKGYKKNAGSFKLGTKGYSCQVGSVSVQQTLRHPMVPF
                     KDDRCCRGGLEVISTGEEMLLADELTRKV"
     exon            910212..910281
                     /number=1
     exon            910341..910533
                     /number=2
     exon            910660..910792
                     /number=3
     CDS             join(912020..912980,913041..913048)
                     /codon_start=1
                     /locus_tag="AO090003000335"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000283"
                     /protein_id="BAE57529.1"
                     /transl_table=1
                     /translation="MRLLNVHTLLLEEFNESKAPPYAILSHTWGEGEVTFDDIQDTSD
                     KYTKKAGYEKIHSTCKQAISDKLEYVWIDTCCIDKSSSAELSESINSMFRWYEKAEIC
                     YAFLADVPEIPFRMSRWFTRGWTLQELLAPRKVVFFGADWSFIGTRAELNEKISEATG
                     IDRMFLCNGEARDPHAFDHGDGKQHPSLSIHKASIAARMSWASSRETTRPEDMAYCLF
                     GLFDVNMPLIYGEGQKAFLRLQEEIIKRYNDHSIFAWIIQNKLGSAKKHDDSVSRSGI
                     LALSPAAFSGCGSIISFPISSHSSPFNVTNQGVQIRLPISNGDKFR"
     exon            912020..912980
                     /number=1
     exon            913041..913048
                     /number=2
     CDS             join(914883..915229,915281..915347,915542..915587,
                     915693..916330)
                     /codon_start=1
                     /locus_tag="AO090003000336"
                     /note="acyl-CoA dehydrogenases"
                     /old_locus_tag="AO070341000284"
                     /protein_id="BAE57530.1"
                     /transl_table=1
                     /translation="MSQSNPTLLTLQNHPPPNPAPPATDPSIYQVHHDAFAAEGQPTT
                     TAGWLERARKVSNILAPDASARSKDQKTPRAEISLLKSSGLTKVLGDVKYGGGGQTWE
                     TGYKVIREVAAGDGFLDQLVCSWDTICFGQLLHILWNFNTGGVVSDLTVLEESGSVKI
                     ENVPITWDDALGWSKETKAPIPEVLQVPFTALLLPTIQLVFSNFYIGIAQGALRTARH
                     YTLTQTRAWPFAHDPKQSPTDEHYVLARYGKFFASLRAADALADRAGKEIADAFNEHG
                     SKRDLPARKRGEVAEWVASVKVVATHTSLEVTSGVFEVTGARSTAEKYGFDRFWKDVR
                     THTLHDPVAYKESELGRFWLLDEVPTPTWYT"
     exon            914883..915229
                     /number=1
     exon            915281..915347
                     /number=2
     exon            915542..915587
                     /number=3
     exon            915693..916330
                     /number=4
     CDS             join(916805..917821,917978..918248,918310..918453,
                     918587..918633)
                     /codon_start=1
                     /locus_tag="AO090003000337"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000285"
                     /protein_id="BAE57531.1"
                     /transl_table=1
                     /translation="MFEIILTKVWTLAYGVKTPSSSPHRDTLQRHISTHSDQQNQALL
                     ALRAKRPRSNRACQSCAREKQRCSGNPPCTRCINKNRTCVFDQHSRGGNDARNRSSTV
                     HVSSQDGTGHAEMSFSGDISKSGLLPGDQQLVGSASVQALPEIRPFSDALGYPNYIPD
                     LGNLFTWGPFDCLDDPQYNPSLNNGVGFGGLDSLCQQVSLPSEPSVLQTPRSSTPLEP
                     ATLHSLLTPAEGIHQSSQTASHVLKDPTAYSSASTRGDPDPQSGDDILIAENFFHVRA
                     VDNETYEKIHGFYLAQTDICFKKLAFPDVNHLNCLVQVYFEYFHAQMPFVHPVMLEND
                     GSWILAVKALQYDAMTLAQSTLLLNVNLVFNGFRDDIINLQFLRTWLATLIRPFLKPH
                     SKRDPALLHVSRTGNTYDRWHAWLQAEAHARLVYAFFLLDSFCVVFHDMPPSYSVDDF
                     EHRLPSPDELWSSQDAHSWESHLQSCQGWYYYLVSLSERNKP"
     exon            916805..917821
                     /number=1
     exon            917978..918248
                     /number=2
     exon            918310..918453
                     /number=3
     exon            918587..918633
                     /number=4
     CDS             join(919886..920120,920192..920504,920765..920795)
                     /codon_start=1
                     /locus_tag="AO090003000338"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000286"
                     /protein_id="BAE57532.1"
                     /transl_table=1
                     /translation="MADGLGVPVLKTQGASILITLVIGIGTLHIVRSIYRRHFHPLSQ
                     FSGPPEAALSTKWLYKTNQAGFPEHEFERLHEKYQTKALRIAPNELHLSDVHQYKVIY
                     SQSKPFLKDPPFYSSFNIDHSLFAETDPALHKERRKMLNPLFSRAGIFKLEGVIHTKA
                     GIMMKKIDRLREKHLINVYDAFRLRPFLKLSM"
     exon            919886..920120
                     /number=1
     exon            920192..920504
                     /number=2
     exon            920765..920795
                     /number=3
     CDS             complement(join(925854..926407,926659..926683))
                     /codon_start=1
                     /locus_tag="AO090003000341"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000289"
                     /protein_id="BAE57533.1"
                     /transl_table=1
                     /translation="MQRSRINFRTGVLGFNYLRRRALSDSSARAATPILRRDAAKVQG
                     DITQKIEPQINTLYNDVRGFPTSGLTGAMTIRSDLQSLATTVNDATADVKSTGSLDTP
                     SGTTILADIQSLMPTSLVTLTHVGAEAPAWEDIQGGPALILSDLRSLKTALDNFANAL
                     ISNEPLLLQAKALAIKTQIDGGLDIAIAPYSV"
     exon            complement(925854..926407)
                     /number=1
     exon            complement(926659..926683)
                     /number=2
     CDS             complement(join(927084..927137,927202..927423,
                     927498..927635))
                     /codon_start=1
                     /locus_tag="AO090003000342"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000290"
                     /protein_id="BAE57534.1"
                     /transl_table=1
                     /translation="MKNLLPVISFAVLTAAQTIELGAPTDGAVLSRGSEFTAQVLKPG
                     SLQPCIEVGIALAVNSCNDGVCPQPSDQLGNVLYAGPWTPTAHPSSGNYQNFTLQVPE
                     YMPEGPATFTLTHLCLIGAGPVPLLEFRNVTVTVE"
     exon            complement(927084..927137)
                     /number=1
     exon            complement(927202..927423)
                     /number=2
     exon            complement(927498..927635)
                     /number=3
     CDS             929017..929610
                     /codon_start=1
                     /locus_tag="AO090003000343"
                     /note="predicted flavoprotein"
                     /old_locus_tag="AO070341000291"
                     /protein_id="BAE57535.1"
                     /transl_table=1
                     /translation="MAPKIGLIICSQRTPRAGLHIGITILNDLQSAGSVRTNAVTLSL
                     IDLTEWNLPMYNEPGIPSQIHSSDQYLHPHTQRWSEEIASYAAFVFVTPQYNWGYPAS
                     IKNAIDYLYHEWKGKPAMIVSYGGHGGGKAAEQLKQVLCGVRMRPLERTVGMTFPSKE
                     VLMVAAEGQELDLSFWEGERREVVEVFGEMVKLLVEA"
     exon            929017..929610
                     /number=1
     CDS             complement(join(929705..929987,930015..930277,
                     930353..930487,930563..930598))
                     /codon_start=1
                     /locus_tag="AO090003000344"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000292"
                     /protein_id="BAE57536.1"
                     /transl_table=1
                     /translation="MILGVAFTRRLSLLTNADNGRWNQLSHGTKALIQNCDIGRFQQP
                     FERAMLESQRAFFPCFLARSPWREFLRETEETALTPASWACVLRSKLCDWLVDIPVLL
                     EEITGILRSGNYGMKLKRLVQRAMVIHDQIDGWYLAEVVPAVPAPLRPSAEYSQPLMG
                     VLDCVTNSTLITLEDAISTSVSLFSESDGFHKSIDFSITISKRQQTISNALKYVRGYS
                     LVAAKPLEFGLQQLRSLRAD"
     exon            complement(929705..929987)
                     /number=1
     exon            complement(930015..930277)
                     /number=2
     exon            complement(930353..930487)
                     /number=3
     exon            complement(930563..930598)
                     /number=4
     CDS             932382..933293
                     /codon_start=1
                     /locus_tag="AO090003000346"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000294"
                     /protein_id="BAE57537.1"
                     /transl_table=1
                     /translation="MFHPVVPMMLHSILTTGHSGNSSISLFNIPFADKQQVKPFDVVK
                     LPPPKNVTEKQPKSQPHQVLLDPTESFILSPDLGSDVMHVFAIDHKSGKLNKCGSNST
                     IYYDKGSGPRHGVFVTSSEGHHARRARSPHRERLMGREGKKTTLYTVEELRGNVCSFD
                     VSYVNKGCPVFKPLTCFRPYPGSNFPSNTTTLGEIRAAGPTLHISVRKDGKFDGKDSL
                     VTLKPGQKTVTDGDLFSSGGKTPRSFVINRKGDLVAVGNQDSSTIVIIKRDPKTGKLL
                     NEVASLLVGEAPAEGTWGGLSSIVWYE"
     exon            932382..933293
                     /number=1
     CDS             complement(join(933774..934436,934518..934928,
                     935016..935062,935226..935394,935517..935711))
                     /codon_start=1
                     /locus_tag="AO090003000347"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000295"
                     /protein_id="BAE57538.1"
                     /transl_table=1
                     /translation="MPPRASLTSSFSVTDANNEVVCPLKNNDGSNCRKRCLGVSISPI
                     FPLCVGRSIGAPLPATPAIAAEKRYRSMQEHIRRAHPNNYIPKLPATEESFILMVTTP
                     PEQRAQISPPNQAQSRRRNAQLHHNRLASDWDTDMETHSDNDIGRDRMRSSIELPSLR
                     DHFKQESLPPFSPRPRELLPSILNHSPPGRSSTLPPIQRRDKLPRPRKSSISAARKPK
                     HDRVKSKEYGRRPSLGDRKALSAEPQTAAWAQGKRWEDLIEAATSATEADDDRQSEVG
                     RSPTLAPLISNITSAPSAPGNRSSLPPAFQSAGGLPPPNSHRPFPPHSFGASPLHKSL
                     TPPPYETARSRDNDLEPFPSIESSLDSASTASGKNFAFSGHLGPLAKPDSSPGLNLFP
                     RQHHRFSNPTPASFRQKDVQVYCASCHRPWALSECYACTECICGVCRDCVGMYISSPT
                     ASFRNVTSSPGSAMSHGPTSYPPRGCPRCRTIGSKWKAFQLEFK"
     exon            complement(933774..934436)
                     /number=1
     exon            complement(934518..934928)
                     /number=2
     exon            complement(935016..935062)
                     /number=3
     exon            complement(935226..935394)
                     /number=4
     exon            complement(935517..935711)
                     /number=5
     CDS             join(937796..937805,937880..937948,938147..938442)
                     /codon_start=1
                     /locus_tag="AO090003000348"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000296"
                     /protein_id="BAE57539.1"
                     /transl_table=1
                     /translation="MACDTNQHFGKAGGTASPLWRFATAAALKSDHVQPTPPDPSHLS
                     SSPQLRMLSFPCNPAQSSKLELSQVFWCSVGLSRIRFNSVATFQLSQSSGAATPVPYS
                     RPSGAGVETEKKKKRTRQQNRN"
     exon            937796..937805
                     /number=1
     exon            937880..937948
                     /number=2
     exon            938147..938442
                     /number=3
     CDS             join(941498..942184,942246..942452,942506..942940)
                     /codon_start=1
                     /locus_tag="AO090003000349"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000297"
                     /protein_id="BAE57540.1"
                     /transl_table=1
                     /translation="MSPQRKNFHVAVVGGGIAGLTLAIALYHRNIPVTIYEQAEAFGE
                     VGAGVSFGPNAVEAMKACHSGIYEAFEKVFTQNLWPSKQKVWFDYLDGYNKGTSTTAK
                     NASRQDIAFTISNSLGQTGVHRAHFLDELIKLIPGDIARFHKRLENIVERETDGKLLL
                     KFADGTQDEADLVIGCDGIKSQVRQVIVGAEHPSAKPSYTHKYAYRGLVPMEKAIEAV
                     GEELASNSCMHMGPGGHMLTFPVNQGKTLNIVAFHTSPDEWADYPRLTRQGTRDEALR
                     DFAGYGPNVINLLKLTDAELSVWAIFDLGENPVPTFYKGRVAISGDAAHATSPHHGAG
                     AGFCVEDTAVLATLLADERVQTHKDLEAVLAAYDISRRERSQWLVQSSRFIGDSYEWR
                     AEGVGSDFKKIEEAINYRNGVITNVDIPQMCADATKCLERRLSSVTKASI"
     exon            941498..942184
                     /number=1
     exon            942246..942452
                     /number=2
     exon            942506..942940
                     /number=3
     CDS             join(944659..944818,945319..945432,945543..945836,
                     945900..946742,946823..946905,946955..947524)
                     /codon_start=1
                     /locus_tag="AO090003000350"
                     /note="NAD+ ADP-ribosyltransferase Parp, required for
                     poly-ADP ribosylation of nuclear proteins"
                     /old_locus_tag="AO070341000298"
                     /protein_id="BAE57541.1"
                     /transl_table=1
                     /translation="MARSYWKIGKNQSDKVLIDLDKNPDRFGKSSRQSKLLWGWCLRP
                     GVVTTNQRPADVKKLVEGQGAKFCTTVTGDCTHFVTTQREVDNNNSKYKQACNVYDCN
                     IVSIDWLLESIDAKKPIPEKPYLLNRKDAKSDDKKDDEKNDKKEKKKRTLEEALDVSE
                     ESSNKKAKDAQKLGSKTLNVPVDEGCYLSGFAVYIDPAGLIWDATLNQTVSANNANKF
                     YRIQLLVDRSGTNFKTWTRWGRVGETGQHGLLGSGALSEAQLQFQKKFKDKSGLSWDD
                     RLDPPKKGKYTFIERNYEEDSDEEDGDDKGTAKKNDEEKPEVKSELPEQVQDLMSFIF
                     NPSHFMNTMASMDYDAKKLPLGKLSKRTLRQGFLKLKELSELIADPNLAATQYGTTYN
                     AAAEDLSNQYFTTIPHVFGRNRPPVLNSDQHIKKEIELLEALTDMEVANGIMKESKDA
                     DTIHQLDRQFQSLKMQEMTPLDHSSTEFIELENYLNQSRASTHHFRYNVVNIFRIERD
                     GENDRFNSSKYGKIKNSDRRLLWHGSRSTNFGGILSQGLRIAPPEAPVSGYMFGKGVY
                     FADMSSKSANYCCSYNSGGMALLLLCDVELGDPMLELDHSNYNAGEDAKRDGKIATLG
                     KGRTVPAAWKDAGSVNPQLQGVKMPDVSASSKSANAQSLMYNEYIVYDVAQIRQKYLF
                     QVHMR"
     exon            944659..944818
                     /number=1
     exon            945319..945432
                     /number=2
     exon            945543..945836
                     /number=3
     exon            945900..946742
                     /number=4
     exon            946823..946905
                     /number=5
     exon            946955..947524
                     /number=6
     CDS             join(948347..948646,948697..948790,948843..949042,
                     949089..949162,949210..949308,949354..949526,
                     949574..949737,949788..950091,950158..950348,
                     950405..950476)
                     /codon_start=1
                     /locus_tag="AO090003000352"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070341000300"
                     /protein_id="BAE57542.1"
                     /transl_table=1
                     /translation="MATDKGVTTKLVDDHNGRYYTEPATDSKGTYQVETRPYEESTNS
                     HASNPFADPEVAERYALIYEKAQYECRHVFDPTLTWTPEEERALVRKLDWRVCLWACV
                     MFFGLQVDRGNLVQAVSDNLLDDLNLSSNDYNTGNTIFYISFLLAELPSQLISKKIGP
                     DRWIPMQISLWSIVATCQAGLMGRSSFYATRALLGILEGGFIPDIVLWLSYFYTSKEL
                     PTRLSIFWTALSLTTIVTSFMAFGILHMRGVLGWAGWRWLFLIEGLITLLIGLASFFR
                     MPASAVETKKWFRPKGWFTDREVRIVVNRVLRDDPSKGDMHNRQAITLPRLWNALCDY
                     DLWPIYLIGLIAYTPMVPVKSYITLTLKDLGFNTFVTNLLTIPNNVGHIILLLALTRL
                     SVWLNERSLTSMLQCVWTLPCVIALRFWPGTMENAWGTFSVVTVLLSYPYCHAIVVGW
                     ASKNSNNVGTRTVSAALYNMCVQLGNIIGNNVYREDDKPKYRRGNAVLLALNILGVLL
                     FIGTKVYYILRNRHRERVWNSMTEEQRQDYLNNTTDTGSKRLDFRFAH"
     exon            948347..948646
                     /number=1
     exon            948697..948790
                     /number=2
     exon            948843..949042
                     /number=3
     exon            949089..949162
                     /number=4
     exon            949210..949308
                     /number=5
     exon            949354..949526
                     /number=6
     exon            949574..949737
                     /number=7
     exon            949788..950091
                     /number=8
     exon            950158..950348
                     /number=9
     exon            950405..950476
                     /number=10
     CDS             join(952000..952065,952154..953578)
                     /codon_start=1
                     /locus_tag="AO090003000354"
                     /note="transferrin receptor and related proteins
                     containing the protease-associated (PA) domain"
                     /old_locus_tag="AO070341000302"
                     /protein_id="BAE57543.1"
                     /transl_table=1
                     /translation="MRSLLWASLLSGVLAGRALVSPDEFPEDIQLEDLLEGSQQLEDF
                     AYAYPERNRVFGGKAHDDTVNYLYEELKKTGYYDVYKQPQVHLWSNADQTLKVGDEEI
                     EAKTMTYSPSVEVTADVAVVKNLGCSEADYPSDVEGKVALIKRGECPFGDKSVLAAKA
                     KAAASIVYNNVAGSMAGTLGAAQSDKGPYSAIVGISLEDGQKLIKLAEAGSVSVDLWV
                     DSKQENRTTYNVVAQTKGGDPNNVVALGGHTDSVEAGPGINDDGSGIISNLVIAKALT
                     QYSVKNAVRFLFWTAEEFGLLGSNYYVSHLNATELNKIRLYLNFDMIASPNYALMIYD
                     GDGSAFNQSGPAGSAQIEKLFEDYYDSIDLPHIPTQFDGRSDYEAFILNGIPSGGLFT
                     GAEGIMSEENASRWGGQAGVAYDANYHAAGDNMTNLNHEAFLINSKATAFAVATYAND
                     LSSIPKRNTTSSLHRRARTMRPFGKRAPKTHAHVSGSGCWHSQVEA"
     exon            952000..952065
                     /number=1
     exon            952154..953578
                     /number=2
     CDS             complement(join(955411..955610,955660..957151,
                     957203..957511))
                     /codon_start=1
                     /locus_tag="AO090003000356"
                     /note="copper amine oxidase"
                     /old_locus_tag="AO070341000304"
                     /protein_id="BAE57544.1"
                     /transl_table=1
                     /translation="MASLPHPFDPITPGEIQLATKIVQAAFPGVSLRYKKIDIQEPIK
                     KEVVPFIEAERLGKPLPRRPTRLLQVLFHRLDNGAFYKALLDAGKQSVISAKELPKDI
                     QANVDVDEMIEMEQLCLNHPAVQAEVAKLQLPEGVTVCNDPWIYGTDDPKETRRLFQC
                     YMYIVATDHPQNNQYSTPCKFSPVFDGLTKQLVRMDYLPSGSDVQTTETQPWKPVETI
                     QYAHDLLQEPLRTDLKPYIVQQPHGASFDVEGNVVSWQKWRFRVGFNSREGLVIYNLT
                     YDGRNVFYRLSVSEMTVPYGDPRAPYHRKQAFDVGDVGFGITANQLSLGCDCLGHIKY
                     FDGYRSDSKGNPIHLPNVICLHEQDNGLQHKHTNYRSGAATVVRNRQLVIQMICTVAN
                     YEYIFAFIFDQAANIELEVRATGILSTVPFDNEEFGKTVPWGTNVGPGVMAPYHQHMF
                     SFRMDPALDGFQNTVYYEDSVPMPEDENNPWNVGYTTEQTVVRTSGTANTSVDRHRVF
                     KIRNDSQINPITYKPIAYKLQAVPSQMLLASPKSFGAKRAAFATKPIWVTKYQDDELF
                     AAGEFTNQSKESQGVEKWVQRNDPVENEDIVLWHTFGLTHNPRIEDFPVMPMERISVM
                     LKPDGFFTKNPALDVPQSSQSFNRSTQHPEPAACCGPAKGKL"
     exon            complement(955411..955610)
                     /number=1
     exon            complement(955660..957151)
                     /number=2
     exon            complement(957203..957511)
                     /number=3
     CDS             join(958330..958367,958419..958538,958975..959485,
                     959535..959808,959885..960037,960120..960269,
                     960315..960835)
                     /codon_start=1
                     /locus_tag="AO090003000357"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000305"
                     /protein_id="BAE57545.1"
                     /transl_table=1
                     /translation="MDRSERPKRTSNACKRCRSRKVKCSGTHPCDKCRQRRQDCVFED
                     DRKIVVSEDRRILNTIQARLSPHNSTPLPLAVDGDAYQLQWRQASSEELPDISGLPSL
                     EHAIYILNTVQFHFSHLYLLFDEDEFLRHLYEFYDNAEVKVQESRLWYVQFLIVLAFG
                     EALLAPVRKVSNAASWTKYFLRAMSFLPDITGLWQDPVLAIEVLTLIGLYFHSIDMRD
                     TAYCYIGHAMRMALVEGHHRAPPVEQLGQKLVDRCQNIWWTVYILDRKFSSLIGSPNA
                     VKDHEITTPLYDPKSCHQKEAALSLHVRITQVITRVLDTRGHLPPKGSVSLAGNDGPF
                     TRVGGCLRASIFKFRRIAIWRHYAADVILPPTLLWERLSCFEQGEVFRTLSSPVQTLL
                     HASTDSALKSLRILTALRDQNLLGPPETFLPFDLENLFSSFFILSLISAILPDIIPDP
                     SYRDMGFSLLDDMIARGNRVAQLRKSEIVQLEELVQPLLQPHLQPLTPGSSAKQAGEE
                     RTSEQVNDSVAVLNAGISPALSVPEAADVVQDDEMHFDWRDCGLSLDQMLSVTDQLNA
                     NNLVLDAEREGLQTDLWLWSDG"
     exon            958330..958367
                     /number=1
     exon            958419..958538
                     /number=2
     exon            958975..959485
                     /number=3
     exon            959535..959808
                     /number=4
     exon            959885..960037
                     /number=5
     exon            960120..960269
                     /number=6
     exon            960315..960835
                     /number=7
     CDS             complement(join(962314..963221,963296..963482))
                     /codon_start=1
                     /locus_tag="AO090003000358"
                     /note="monocarboxylate transporter"
                     /old_locus_tag="AO070341000306"
                     /protein_id="BAE57546.1"
                     /transl_table=1
                     /translation="MALMGSSFTLLEHKPVGEVLSGIGTVTELCAGPIFDAYGPAYVV
                     IPGSIGIVAALICFSFSEEYYQIFLSFSVLGGLSACTLFTPAVSCVGHWFNIRRGYAT
                     GIACTAGGLGGVIFPIIILFAAPKIGFPWAIRIIALLCAILCTLACLLMKTRLPRNET
                     AGASIDFKALRDIKYATTTAAIFLVEFAVFIPITYIASYAVHVGINNTLSYPLIVFLN
                     LGAIPGRFLPGLIADHLGRFNVMVLTSFICGVLTLGLWLKAGVNIAAIICYAVLSGFW
                     SGAAISLTPVCISQVCATEDYGKRNGTTFTIVSVGTLTGIPIAGAIQQNNGGDYWGLI
                     VFGGVLYLAATVAFAVARGVCAGWALRIRF"
     exon            complement(962314..963221)
                     /number=1
     exon            complement(963296..963482)
                     /number=2
     CDS             complement(join(965438..965586,965642..966170,
                     966238..966448,966529..966632))
                     /codon_start=1
                     /locus_tag="AO090003000360"
                     /note="sideroflexin"
                     /old_locus_tag="AO070341000308"
                     /protein_id="BAE57547.1"
                     /transl_table=1
                     /translation="MSASLPGNRDLPASQYDLSTYLGRVRQCADLSDPSARLQNAKDL
                     LTKYRSGQIQSMSPELWQAKKIVDSTLHPDTGEPVLLPFRMSCYVFSNLFVTAGMLIP
                     GMKWKGTLAWQIANQSLNVAINSANANKSTPLSTTGMIKSYFMAVSASCSVALGLNSI
                     VPRLKSVSPSTKVILGRLVPFAAVASAGALNVFLMRSEEIRQGIDVYPFNSATSEGNT
                     GEKVPATSLGKSQKAATIAVGETAISRVVTSTPVMVIPPLLLLRFQKTELLKKRPYLA
                     MPINIGLVFLTSAFALPFALGVFPQRLVMSSDRLEERFHGRGGESEQVVFNRGI"
     exon            complement(965438..965586)
                     /number=1
     exon            complement(965642..966170)
                     /number=2
     exon            complement(966238..966448)
                     /number=3
     exon            complement(966529..966632)
                     /number=4
     CDS             join(968001..968569,968600..968689,968747..969548)
                     /codon_start=1
                     /locus_tag="AO090003000361"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000309"
                     /protein_id="BAE57548.1"
                     /transl_table=1
                     /translation="MKFIFPTLPIISRSLFGLTSTRITPDQHVLNNMPVHLLAAIYAS
                     AQPFAKFDEYLSVLNAYSTPPTEQLWRIVWEILLQEIHTPHLASLQAGLLYLHKAPEK
                     SQSAVADSASVWSFVGLLVGLATSLGLQLECGPMGLPAWERRLRRRLWWAIYAEDKWR
                     SLLMGRPPYIRNDEWDVTELDDKDFHIDEAPLAQDVLQAQQFQCFARLSRIADEVQHD
                     LYALRSAQRLSSNFSESLKTARPLLQRLREWYVHLPAPLRLHDRLFASIDGTGPQLTC
                     LHFAYTLLEVFIFRALLRPIVRSATPPPLFEETEASTNFTTALDDYIFHIMDPDEIEP
                     SPAIDLSNENGVGCAVLKAAENCAAKMLRLVMRMAYSDLAGYWFSCMCLLTPHCSMSR
                     HCLTCYLFPGSRIGFATVSSFMLLLLVQAPSKDHAIRARRLVHMWRQALRRQSEGSSL
                     MNLALVRLDGIYWTGLCRNYYLSKHVKEALDETVYQ"
     exon            968001..968569
                     /number=1
     exon            968600..968689
                     /number=2
     exon            968747..969548
                     /number=3
     CDS             join(971967..972038,972113..972256,972293..972499)
                     /codon_start=1
                     /locus_tag="AO090003000362"
                     /note="heat shock transcription factor"
                     /old_locus_tag="AO070341000310"
                     /protein_id="BAE57549.1"
                     /transl_table=1
                     /translation="MLEDPSYAEIVRWGDEGDSFVVLECEKFTKTILPKHFKHSNFAS
                     FVRQLNKYDFHKVRQNNEENGQSPYGQNGCLTRNLGMGIQAPRIPGEQQRITRQYSTE
                     GACPSKTDPEQRRFRSNATDRSPEPANSGAATTNSASL"
     exon            971967..972038
                     /number=1
     exon            972113..972256
                     /number=2
     exon            972293..972499
                     /number=3
     CDS             join(972549..973250,973311..973500,973558..974078)
                     /codon_start=1
                     /locus_tag="AO090003000363"
                     /note="sensory transduction histidine kinase"
                     /old_locus_tag="AO070341000311"
                     /protein_id="BAE57550.1"
                     /transl_table=1
                     /translation="MRVQKTVLNHEHVIHQLMTYLLSVDARQRRDSKASGPFQAQGQG
                     GSTLSPSQVASMDDEPSSPLQHASKLLNDMNAEIQFNLGGLDSLGEPPKTGPVVATTP
                     AMDAAPRNGVVRPSTAAAATPANPANPTNAATTALVYPKMSGEIEPVVYPVGATNGID
                     PMYSEHVNNVPYPMPPKQEVDDARRQFADNRKKSNHVDPGWMRSPHILLVEDDATCRQ
                     IGGKFLYSFSCVIDTAFDGLEAVNKIQDGSKYDLILMDIIMPNLDGVSACHLIRQFDR
                     TPIIAMTSNIRSDDIQLYFQHGMDDVLPKPFTRKSLLDMLEKHLVHLKTMPQGMETAQ
                     PTAAVTMAAQSSAAQSVKEDSSPSQSPATSINNWQTPGQFQGMAAVHPNLQQVQGQYV
                     PATPATAAAYAVDQNGVQYPTAPVALTAAAAAAARPQPRRQVSDMASAAENPNLAKRQ
                     RVYAPQPQAMVNPVQAARTG"
     exon            972549..973250
                     /number=1
     exon            973311..973500
                     /number=2
     exon            973558..974078
                     /number=3
     CDS             join(975312..975392,975492..975548,975638..975762,
                     975829..977000,977060..977739)
                     /codon_start=1
                     /locus_tag="AO090003000364"
                     /note="translation initiation factor 2B, epsilon subunit
                     (eIF-2Bepsilon/GCD6)"
                     /old_locus_tag="AO070341000312"
                     /protein_id="BAE57551.1"
                     /transl_table=1
                     /translation="MGPKQKGGGSKQRGNAAEEVEETLQAVVLADTFETRFEPFTLDK
                     PRCLLPLANTPLIEYTLEFLANAGVEDVFLYGGAHSDQLEKYINASKWRSLSSPFKQL
                     AFLKSTSTSVGDVMRDLDGKHLITGDFIVVSGDVISNLPIEGALTQHRARRAANKDAI
                     MTMILREAGRNHRTKSSSSSPVFIIDPTKDRCLHYEEIDHHSRETTRLNIDSEIILEN
                     AELDIRQDLIDCGIDICTPDVLSLWSDSFDYQTPRTQFLYGVLKDYELNGKTIHTHIV
                     KDHYAARVRNLKAYDAVTKDVISRWAYPLCPDTNLLPGHNYELRKGNLYQEQGVTLAR
                     SCVIGRRTVIGQGTSIGDKTTVKDTVLGRNCKIGKNVTLDGAFIWDGAVIGDGTTVRH
                     AIVADNVQVGSKCIVEPGALLSFGVKIADGMTVSEGKRITNAPREEDGGAPESEPEVV
                     GEGGEGYEYVPYEDEDDSDTESNASSGLVYNMAQLSLSTDSISTLSSDVSDYGHSRSG
                     SFSSSGGDDDEEHFVHDAATSVYDSLRDGVTSDVVQLELVSLRMTANASDHQVRRAVV
                     SAFMKRTQQLMEGGKAAGDIVRELFGKYREIIERSLFDRDRDAKPDQVDLLLLLQQDL
                     VHRNRGDTVLLFVAKELYDLEILEEEAYEQWWDDERSSSTDEMKQVRSQTQQFVDWLA
                     NAEEEESSEEEDDDEEEESDDE"
     exon            975312..975392
                     /number=1
     exon            975492..975548
                     /number=2
     exon            975638..975762
                     /number=3
     exon            975829..977000
                     /number=4
     exon            977060..977739
                     /number=5
     CDS             join(979155..979245,979339..979867,979921..980807,
                     980874..980902)
                     /codon_start=1
                     /locus_tag="AO090003000365"
                     /note="predicted E3 ubiquitin ligase"
                     /old_locus_tag="AO070341000313"
                     /protein_id="BAE57552.1"
                     /transl_table=1
                     /translation="MESDDDFMSVASSGDDFLDTQASDDESLGEDFGDDFDGGFSKDK
                     DIVATSRKPYEVEFKVLSPDDIDRDQNQQINEVSSILSLPPESSAILLRYGRWNREKL
                     IEGYMDHPEETLEEAGLGTNFEGTPKTEVIPGFVCDICCEDGDNLETYAMRCGHRFCV
                     DCYRHYLAQKIRGEGEAARIECPGDGCNMIVDSKSLSLLVTPALKDRYYTLLQRTYVD
                     DKENLKWCPAPNCEYAVDCSVKQRDLRRIVPTVQCNCKHHFCFGCTLNDHQPAPCQLV
                     KMWLKKCEDDSETANWISANTKECPRCHSTIEKNGGCNHMTCRKCKHEFCWMCMGLWS
                     EHGTSWYNCNRYEEKSGSEARTAQAKSRASLERYLHYYNRYANHEQSAKLDKDLYLKT
                     EKKMTSLQSQSGLSWIEVQFLDTASQALQQCRQTLKWTYAFAYYLARNNLTEIFEDNQ
                     KDLELAVENLSEMFEKPVPELANLKVDILDKTAYCNKRRVILLSDTAENLKNGEWSFN
                     VEW"
     exon            979155..979245
                     /number=1
     exon            979339..979867
                     /number=2
     exon            979921..980807
                     /number=3
     exon            980874..980902
                     /number=4
     CDS             join(983878..984200,984278..984329)
                     /codon_start=1
                     /locus_tag="AO090003000367"
                     /note="mitochondrial carrier protein MRS3/4"
                     /old_locus_tag="AO070341000315"
                     /protein_id="BAE57553.1"
                     /transl_table=1
                     /translation="MTVPFTATQFVAYESISKVMNPSGDYDPFTHCIAGGLAGAFAAG
                     LTTPLDVVKTLLQTRGLAQNEEIRSAKGLFNAASIIKRQFGWSGFLRGARPRIISTMP
                     STAICWTSYEMAKAYFKRQEVA"
     exon            983878..984200
                     /number=1
     exon            984278..984329
                     /number=2
     CDS             join(985617..985703,985763..987806,987993..988093)
                     /codon_start=1
                     /locus_tag="AO090003000368"
                     /note="AAA+-type ATPase"
                     /old_locus_tag="AO070341000316"
                     /protein_id="BAE57554.1"
                     /transl_table=1
                     /translation="MRPKPASSLQKTYDDCYLMCSTAVYFEGQNNEEEALKSWRSALE
                     TIYYHNAYRVPSKYTPKNETEKALQDSIRQLELQCRERVDLLEALRESRKDTSGKSPP
                     FTTGYRGWIGEGTVPAVGYTDLSKPPTIPGRPPPPVTTASSESAGNETGSSVPMAGRP
                     GLRKTQSSSAKTTSSRNSSPERRKAMPSTLRNADLKKPAKKKVSPRRKDLRPAAASQA
                     AGLAWGSLYRTPSSEKTVSDAALASSRLTAANDPSFRKESIPPRSKSGDGVPPRKSVP
                     PEDSGEERRSGRKLRVPGQTPRRSPAKSTPAPTSTPTSTPQAPAGIRQPSGNRTHSAS
                     VSTGSKDTVQPRASPKPSVKPKPVALRSSYQPPTPSGGSAGAATTSNNLQAGSASTPR
                     RITPASTGEDALSDNIDRMSISRTSPERRATPRIRRAVTPPSSSDPESLGPKSTDADE
                     DDVDVEDEDDAIMDILNKLPKGVDVATARQILNDIVVRGDEVHWDDIAGLDGAKKALK
                     EAVVYPFLRPDLFSGLREPARGMLLFGPPGTGKTMLARAVATESKSTFFSVSASTLTS
                     KWHGESEKLVRALFGLAKALAPSIIFVDEIDSLLSARSSGTENEASRRSKTEFLIQWS
                     DLQRAAAGRESPRDKKAGGDPSRVLVLAATNMPWDIDEAARRRFVRRQYIPLPEHHVR
                     EKQLRTLLSHQVHDLTDQDIDALVQLTDDFEASLSSIRPSVSQEGLKEYEDWARQFGE
                     RGG"
     exon            985617..985703
                     /number=1
     exon            985763..987806
                     /number=2
     exon            987993..988093
                     /number=3
     CDS             complement(join(989133..990508,990567..990787,
                     990861..990930,991058..991130))
                     /codon_start=1
                     /locus_tag="AO090003000369"
                     /note="equilibrative nucleoside transporter protein"
                     /old_locus_tag="AO070341000317"
                     /protein_id="BAE57555.1"
                     /transl_table=1
                     /translation="MSKVVRSVKNVTKGYSSVQVKVRNATSNDPWGPTGTEMAEIAAL
                     TFSSPTDFYEIMDMLDKRLNDKGKNWRHVLKSLKVLDYCLHEGSELVVTWARKNVYII
                     KTLREFQYVDEDGRDVGQNVRVAAKELTSLVMDEDRLRSERSDRKLWKSRVSGLDDYP
                     GHGSEPQQPRRNERRRRPADEEDVEYRLAIEASKHEAEEERKRRAKSSMQTGEEDEDL
                     AKAIKLSKEEEELRKRELEESNAHSLFDDTPVQAAPAQPTGYNQGYQQQSAVDWFGNP
                     INPQQPLSTGYLNNQYAQPTGFQGQMTGMPNGYTNGFQAQPTAFDQNPYGQPQNNFLQ
                     PQATLQPQATLQPQHTAFNTNNPYGTTDMFAQQQQQPQQQQQQQQQQPQDNFLSSGSN
                     NPWASSSPQPGDMLKPMQTGSNNPFAQRTQTQQFQTRPATSGHPSLNTLAEERATTAF
                     NPIANYQAPVAPAPPKSTPPQMNDPHHARLNALLASGDGQDTFGNVGDLRIPAQHTAP
                     GTFVNSAGQGLDRLRANQTGSNPFFAQQRFVPQQTGFAQQQTGFAQPTNNPWGAQKSY
                     QQQPQAGGSLIDL"
     exon            complement(989133..990508)
                     /number=1
     exon            complement(990567..990787)
                     /number=2
     exon            complement(990861..990930)
                     /number=3
     exon            complement(991058..991130)
                     /number=4
     CDS             complement(join(994239..995554,995627..995700,
                     995774..995922,996082..996093))
                     /codon_start=1
                     /locus_tag="AO090003000371"
                     /note="isochorismate synthase"
                     /old_locus_tag="AO070341000319"
                     /protein_id="BAE57556.1"
                     /transl_table=1
                     /translation="MAPPITVVPSLETAKDVISHSKDAKYPPNLLPLTASIPADLLTP
                     TVAYLKVAEKSKLSFLYESAATTETIGRYSFVGADPRKVLKTGPGHGPECDPLPILEK
                     EIAEYRVATVPGLTLPPLTGGAIGYVGYDCVKYFEPKTARPLKDVLGIPESLFMLFDT
                     IVAFDHFYQVIKIITFIPITHVDSDFETEYRKGEDVIKRYIERLLRPETPLPPQGPII
                     PNQEYTSNIGREGYERHVVKLKEHISKGDIFQTVPSQRLSRPTSLHPFNLFRHLRTVN
                     PSPYLFYIDCEDFQLVGASPELLAKEEKGRIITHPIAGTVKRGKSPEEDEALADELRG
                     SLKDRAEHVMLVDLARNDVNRVCDPTTTQVDRLMVVEKFSHVQHLVSQVSGILRPDKT
                     RFDAFRSIFPAGTVSGAPKVRAMQLIAELEGEKRGVYAGAVGYFGYNIASTDGATEMP
                     GAMDTCIALRTMMVKDGVAYLQAGGGIVFDSDPYDEYMETINKLGANIACIKGAEAKY
                     LSMEGEQS"
     exon            complement(994239..995554)
                     /number=1
     exon            complement(995627..995700)
                     /number=2
     exon            complement(995774..995922)
                     /number=3
     exon            complement(996082..996093)
                     /number=4
     CDS             996888..997439
                     /codon_start=1
                     /locus_tag="AO090003000372"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000320"
                     /protein_id="BAE57557.1"
                     /transl_table=1
                     /translation="MENSPYPACLDQLSSPHSLPEHTWETDMSRPTSPSDTHDTGEDA
                     TPLPQRLAKIAHMVSQNADVSSEDTIAAHHCLNTLEALLDPRPSLRKEVVKCRPTRIY
                     PGTSHPVASAASCSAPMKDRASLAFEPSSSQLIALLNEVTALNADLNQRRKESSQIYD
                     LLRRECQGLSRRISELEAVVHDL"
     exon            996888..997439
                     /number=1
     CDS             complement(998522..999898)
                     /codon_start=1
                     /locus_tag="AO090003000373"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000321"
                     /protein_id="BAE57558.1"
                     /transl_table=1
                     /translation="MEIDSNGVANETKSAVAASPSLADTAVDGDGDVSMGIRPDSQDQ
                     EPTAAPTFTLTNGHSVGVQITPAKAADLSPDTALLNVADDCHVTRTLWRPNDSTVVVA
                     VGETFCSLWKMPSSASPVQEKLVEGKGDSICVSAVAWDPTGQKLAVATYNDMRGSITM
                     YDVAGNAVDLLPEVPRMITGLHWTESGTHLIVVASDSKVSELALWDDSVRPDEFPSPQ
                     VIDGSIYDLSWLGRNEAYASGNGTVYQCEVDSSIHISKTFTSETDRPWTFIRCANVNV
                     SSVAVAASSAAAAFWIPTHDMHLDGAHEGDITAIELKPNTLDQPQANHPLVLASSSTD
                     DTVKIWHIDLDTKRFDCIHRLFLGPSSPALASSFSPDGYALAAASKEKLFIWNSQRGG
                     TAMATWSVPGTDGTKIEEGQSRLANGHNGDAESIPDRSLAWDTDGKRLAFGFGKQVCC
                     LSYPSGDK"
     exon            complement(998522..999898)
                     /number=1
     CDS             1003328..1004503
                     /codon_start=1
                     /locus_tag="AO090003000375"
                     /note="predicted membrane protein"
                     /old_locus_tag="AO070341000323"
                     /protein_id="BAE57559.1"
                     /transl_table=1
                     /translation="MALRVNIPPATRTCLITLLTLSLLYNIARWRQIDATGGHPLTTP
                     VVPYLTLVPSEFFYYPWTFLTATFVEQNIFTVLLNGATLFYGGKYLERAWGSREFAKF
                     ILTIAVIPNVTIIPLYLLGTTIRGGSTGGYALLSDTECTTSCAFPADSPFPSVTQICG
                     GMSIQTSFLVAFKQLVPEHTVTIFKGLVKMRVKHFPALFLLLNTISGIVFGTHVAAIL
                     SWLGLLTSWTYLRFFKRQPDLTGTSTDGLGFKGDASETFAFACFFPDAIQPPISFVSE
                     QVYSLLVALKICTPFSEEDIASGNQQVLARGEAGLPTLNNHRGGTRGAAKREEAERRR
                     ALALKALDQRLQAAAAGRAHSPSPLNQQGSSQTQTATPTVPAGQSMLGETSYTPDHA"
     exon            1003328..1004503
                     /number=1
     CDS             join(1005760..1005834,1006480..1008983,1009050..1009248,
                     1009303..1009914)
                     /codon_start=1
                     /locus_tag="AO090003000376"
                     /note="Leucyl-tRNA synthetase"
                     /old_locus_tag="AO070341000324"
                     /protein_id="BAE57560.1"
                     /transl_table=1
                     /translation="MMTGMAQRALTLKQQLEEGLLKIAKTEKRDTLIAIEKKYQAQWK
                     ENKVFEVDAPSFAEVPEGSMSAAELREKYPKFFGTMAYPYMNGTLHAGHSFTASKVEF
                     MAGVARMDGKRALFPLGFHCTGMPIKACADKLSDEVKKFGQNFEGYKEDDEEEEKAPA
                     APTQEVKNEQQEKFSGKKSKAAAKTVKMKYQFQIMLAIGIPLEEIHKFADAGHWLHHF
                     PPLAIRDLDSLGARIDWRRQMVTTDANPYYDAFVRWQMNRLHELGKIQYGSRYTIYSP
                     KDGQPCMDHDRTKGEGVGPQEYTAMKLKVKEWAPQIAEIVKGKIEEDASVYFVPATLR
                     PETMYGQTCCFLGPKINYGIFKVKEKEYYVCTKRAAWNMAFQGTFFTSDNFPKSQDQL
                     PLVAEAPGSAYVGTLVNAPLSFHTEGVRILPMEGVSASKGTGVVTSVPSDSPDDYATL
                     ADLAKKPDYYGIQKEWAELEIFPLIETPTYGNLTAPALVKQLKINSPKDVTQLAKAKE
                     LAYSEAFYKGTMCVGEYKGEPVSAAKDKIRKSLYESGDAFPFADPMGEVVSRSGDDCV
                     VAYLGQWFLNYGENDAKWQKDTLNHVVNTLNTYTNETKNGFEKNLDWLNRWACARTYG
                     LGSKLPWDPQFLVESLSDSTVYMAYYTIAHLLHGDRYGETLGPLNVKAEQMIDEVWDY
                     VFTRRELSDELISKSGISKEALQQMRREFEYWYPLDVRVSGKDLIQNHLTFFLYIHVA
                     LFPPEYWPRGVRANGHLLLNGEKMSKSTGNFLTLKDSVDKFGADATRIAFADAGDGIE
                     DANFDETVANSNILRLHTLKEWVEEISKDETLRTGPADAFWDKIFNNEMNGLVREARK
                     HYQNTDFKLALKSGLYDLVSARDTYREAATSAGVGMHRDVILRYIELQALMLAVIAPH
                     WAEYVWLEILKKPESIHHARFPEVPEQSPELTAISTYVRATSSSITSAEAQLAKKASK
                     GKSAGYDPRKPKKLTIYAAKKYPSWQEKYIDLVREAFDGLNLSINDKELNAKVGKMGE
                     MKKAMPFVQTLKRRLIQSREEPETVFSRKLPFDEFAVLKEMLVNLQKTTGCKVIEIIA
                     VDEGGKTGEVVGSGEKKEGLSAENAVPGQPTFQFTNIEESN"
     exon            1005760..1005834
                     /number=1
     exon            1006480..1008983
                     /number=2
     exon            1009050..1009248
                     /number=3
     exon            1009303..1009914
                     /number=4
     CDS             complement(join(1010125..1010161,1010190..1010396,
                     1010495..1010662,1010711..1010813,1010870..1010873,
                     1010926..1011046,1011114..1011120,1011162..1011564,
                     1011741..1011866))
                     /codon_start=1
                     /locus_tag="AO090003000377"
                     /note="1-aminocyclopropane-1-carboxylate synthase, and
                     related proteins"
                     /old_locus_tag="AO070341000325"
                     /protein_id="BAE57561.1"
                     /transl_table=1
                     /translation="MLSSRGIKKAELPKIPWRYAPPHTYNKESNPAGLISFGMAEHVT
                     FTEDSVGYGSSSSTPNRLPKAVASHLNNILKPLSPIEPETVIVASGITAIGSMLSFTL
                     AEPTDGILVSRPVYGRFELDYGVEADVQIVYADTDPEEAFTPAVVDKYEAALKRAEEN
                     GTKVRAVLIVNPHNPVGAWKFSGSVINTNSISSVTKYTHPVSLTRETRMLSLSLRSYL
                     SQDNQDFAAGGLHLGFLITQNTALRQACKAILSVPTPRLHNASTASITIGATILEDQD
                     FITQFTQESRQSLASTYRIATSILNHEGINYVKGGNAGFFIYIDLSSYLPYPDRSVRE
                     REFALAQRFLDAGVFLHPGEEHGKESGWFRLVFAHEEQVLREGLWRFCEVLADAKVF"
     exon            complement(1010125..1010161)
                     /number=1
     exon            complement(1010190..1010396)
                     /number=2
     exon            complement(1010495..1010662)
                     /number=3
     exon            complement(1010711..1010813)
                     /number=4
     exon            complement(1010870..1010873)
                     /number=5
     exon            complement(1010926..1011046)
                     /number=6
     exon            complement(1011114..1011120)
                     /number=7
     exon            complement(1011162..1011564)
                     /number=8
     exon            complement(1011741..1011866)
                     /number=9
     CDS             complement(join(1012585..1012674,1012746..1013648))
                     /codon_start=1
                     /locus_tag="AO090003000378"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000326"
                     /protein_id="BAE57562.1"
                     /transl_table=1
                     /translation="MLPPCPNPDNIEICIICASLQESNAVCSIFDETYKSGSTDRHAQ
                     DQITNPQKYDYIMGRIAGHNVVLARLPGMGIVYSAGESHRLKERFKRIKLALLVGVCG
                     AVPKRPDGQKISLGDVVISRDVIRYDLGKQYPFGFQWTDASGDSCMRPNGHIREFVAK
                     LEMRREKLEQRACEFLRKTAGIPCVDQGCDLNLLLPRNPPKAETSDNKPVLHFGNFAS
                     EEIVMDYAEDRDEIAQLENVIAFETIAVGVWDNLPCMIVKGVGDHADGHVSEEWEQYA
                     AATAAACAKAILEEWITSARLNYDCLNRLHGVAMTLALEPKRMKLRVLLSVCWL"
     exon            complement(1012585..1012674)
                     /number=1
     exon            complement(1012746..1013648)
                     /number=2
     CDS             complement(join(1014059..1014242,1014348..1014681,
                     1014747..1015098))
                     /codon_start=1
                     /locus_tag="AO090003000379"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000327"
                     /protein_id="BAE57563.1"
                     /transl_table=1
                     /translation="MLKKSPTMKATTRIHTNDSDAVIIGLYIIFFIYFSVNRGKSYRG
                     HHKRTIPLCTYKTHVIELTTSDLPWHVLAGITELTLYYCNFNCTLLAVLACYVQSLTS
                     LSLVKRLPNGYPPHTRPAYQGGNILRMYQILVAYTTQNPIDYHDAIVPLHSFIYTRII
                     IFLFGTMGPSLSFSKNVNSPFVYAEAVFGGALIAIGHCTRPSAIIVYLLLVHAVGRVS
                     TFAGWRAWVGRTKKPPQDPGLLVKILKFVGFFKDHEDWADEKVASSHETPQIGNLPMD
                     KLGHQYTRLGFEG"
     exon            complement(1014059..1014242)
                     /number=1
     exon            complement(1014348..1014681)
                     /number=2
     exon            complement(1014747..1015098)
                     /number=3
     CDS             complement(join(1016003..1016076,1016131..1016559,
                     1016610..1016694,1016766..1017053,1017118..1017287,
                     1017339..1017465,1017516..1017726,1017794..1017817,
                     1017886..1018015,1018075..1018105))
                     /codon_start=1
                     /locus_tag="AO090003000380"
                     /note="catalase"
                     /old_locus_tag="AO070341000328"
                     /protein_id="BAE57564.1"
                     /transl_table=1
                     /translation="MAERYYTLAEGCPFASNSTTVQLRNNSGGGLSLLQDTQLIETLA
                     HFSRERIPERVVHAKAAGAYGEFEATSDCSDITSASFLSKAGKKSPVLLRVSTVGPEA
                     GSADTTRDVHGWAMKIYTDEGNLDWVFNNTPVFFVRDPIKFPSLNRSHKRHPTTHLPD
                     ANMVSNARGCFSASVQLVQAYNNSCINTLSFHVGNPEGIHELLHLFSDRGTPKSIRHM
                     NAYSGHTYKLTKEDGSFKYVKFHIKTAQGVKNMTAEESLKIAGEDPDYLIRDMFEAIE
                     KGDYPVWNVYVQVMDPADAEKYRWNIFDMTKVWSHKDYPLRQIGKLTMNRNPKNYFTD
                     IEQAAFSPSTMVPGIAPSADPMLQARMFAYPDAARYRLGVNYQQLPTNAAKAPVYCPY
                     QRDGAMRFDDNYGGDPNYVGSSLQPTKFYQEVKNSGAARLSGLTEHEKWVGEVTNFQS
                     HITDDDFVQPAALWEVIGREPGHQDRTIANLSGHIKNVRSPQLRNAVYELFAKVNADL
                     GERLKKATEAAVSA"
     exon            complement(1016003..1016076)
                     /number=1
     exon            complement(1016131..1016559)
                     /number=2
     exon            complement(1016610..1016694)
                     /number=3
     exon            complement(1016766..1017053)
                     /number=4
     exon            complement(1017118..1017287)
                     /number=5
     exon            complement(1017339..1017465)
                     /number=6
     exon            complement(1017516..1017726)
                     /number=7
     exon            complement(1017794..1017817)
                     /number=8
     exon            complement(1017886..1018015)
                     /number=9
     exon            complement(1018075..1018105)
                     /number=10
     CDS             complement(join(1019613..1021114,1021169..1021643))
                     /codon_start=1
                     /locus_tag="AO090003000381"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000329"
                     /protein_id="BAE57565.1"
                     /transl_table=1
                     /translation="MSLYLGRILPRTHRLKYRSPCQLRQLPGAQFSRSFFQQPRVLPV
                     RNANGLINEPQRRLLSSGPSLSAKSSELTERVLPVCCPGCGAYAQTIEPGEPGYYSKT
                     RKQTRKLLSETERATGVQDGETGEVADLKTEGEKAAGTIQQLIKESEEEAAAPKPIHG
                     ALLENAAATAKEYIEKSRPPVQVCDRCHDLVHHNKAVPAISPTIYSIGAYLDESPYKY
                     NRIYHVIDAADFPMSLVDNIYEALSIEEQRSRNRRASTEKYRGGKKLPTISFIITRSD
                     LLAPTKEQVDSKMEYVRSVLREALAKSTENFRLGNVHMISAHRGWWTKKVKEEIKNHG
                     GGVWVVGKANVGKSSFIEACFPKDSKNLEKIAELVERRQAESDISPRDATAVDSDGLL
                     PPAPQEDLYPILPVVSSLPGTTVSPIRIPFGRGCGEMIDLPGMDRGDLADYVRDEHKR
                     DTIMTKRRKPERYTIKSGQSLLLGGGLVRITSVNPDDVLMAACFIPIEAHVTKTEKAV
                     EMQAEQRPYPGENIMIEGIGSQITSAGIFDLKWDVTQSHLPTTIAKAVEDKGIKPPPL
                     PYKVMSADILIEGCGWVELTAQIRAKSTDGESARSLPQVEIFTPNGRHVGVRRPIECW
                     KYVAEKQAVEKRKKGARGRQSIGQKKRAHHSSKV"
     exon            complement(1019613..1021114)
                     /number=1
     exon            complement(1021169..1021643)
                     /number=2
     CDS             complement(1021953..1022888)
                     /codon_start=1
                     /locus_tag="AO090003000382"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000330"
                     /protein_id="BAE57566.1"
                     /transl_table=1
                     /translation="MAPQNVNVLLSTFPGLSLPSTLSFSLPSTSSISDLTEKVSSYIP
                     SSVPLLSLILTTTNNKQILPSSDLPISHLVAPNGELTATSNLLPLRLSVPLCGGKGGF
                     GSQLRAAGGRMSSKRKRNQGDDNGSSRNLDGRRIRTVNEAKALAEYLAVKPEMDRKEK
                     EERRRRWQAVVEAAEKREEELKNGGGKQKIDGQWMEDKEEMSEKAREAVLAAMKDGMW
                     TDNLYDAIRDNILGGSSTSASEGSAQDSASASDEESEDEQEMKDAPGPSEPAPKSAVP
                     RKFIGFDDDDEFMSDSEEEEIDQNDETEGKGKAKA"
     exon            complement(1021953..1022888)
                     /number=1
     CDS             join(1023080..1023097,1023152..1023276,1023337..1023386,
                     1023482..1023639,1023709..1023963)
                     /codon_start=1
                     /locus_tag="AO090003000383"
                     /note="40s ribosomal protein s10"
                     /old_locus_tag="AO070341000331"
                     /protein_id="BAE57567.1"
                     /transl_table=1
                     /translation="MAIKTEESRTFNLTASRSTRSHSSFKPTTTLFALLERFPEERQE
                     LATMLIPKDDRKKIHEYLFREGVLVAKKDFESKHADIDTKNLYVIKALQSLNSRGYVK
                     TQFSWQYYYYTLTPEGLDYLREWLHLPAEVVPATHIKQQRSHAPPRGMMGGEERERRG
                     PRPTREGGYRRRDQEKEGGAPGEFAPNFRGGFGRGRGAPSS"
     exon            1023080..1023097
                     /number=1
     exon            1023152..1023276
                     /number=2
     exon            1023337..1023386
                     /number=3
     exon            1023482..1023639
                     /number=4
     exon            1023709..1023963
                     /number=5
     CDS             complement(join(1024299..1025235,1025293..1025607,
                     1025779..1026029))
                     /codon_start=1
                     /locus_tag="AO090003000384"
                     /note="acetylornithine
                     deacetylase/Succinyl-diaminopimelate desuccinylase and
                     related deacylases"
                     /old_locus_tag="AO070341000332"
                     /protein_id="BAE57568.1"
                     /transl_table=1
                     /translation="MASFIFSKSATVSLKRLPAKSRVLPFTRIGLIQPRRTFSLSLKQ
                     AMLTTELSEAEVSALRANKDRLANDLHHSCQWGFGIRWGDGPTDTGMQRLTLSEEDKS
                     VRDWFIKTTKALKCDITIDEMGNIFAVRPGRRKDVPPTFIGSHLDTQPTGGRYDGILG
                     VLSGIEALKVIDEMGLETEGGIGVVNWTNEEGARFPISMVASGVWAESIPLSRAHGLI
                     EVPTVASLPTASSAPESLKSALEKIGYLGDVPCSYKATPMAAHFELHIEQGPHLISAG
                     QRVGIVTAVQAYRWYRVNVTGRDTHTGTTAFQHRADALYAFAQMMVRAREVASSHGCL
                     ASVGIVEAKPGSVNTVPGLVSFSLDIRGPETELVATVEEKLRKEFDAIAAEEGKGIGK
                     PCRVEWTVEFDSPAVKFHPDCIDCVQQSAEAVVADAPEPKSLVRTIMSGAGHDSVFTS
                     KRVPTSMIFVPCKDGLSHHPEEFCSADDCATGASVILQAVVRYDRKRFSS"
     exon            complement(1024299..1025235)
                     /number=1
     exon            complement(1025293..1025607)
                     /number=2
     exon            complement(1025779..1026029)
                     /number=3
     CDS             complement(join(1028723..1029237,1029293..1029371))
                     /codon_start=1
                     /locus_tag="AO090003000386"
                     /note="phosphatidylinositol transfer protein PDR16 and
                     related proteins"
                     /old_locus_tag="AO070341000334"
                     /protein_id="BAE57569.1"
                     /transl_table=1
                     /translation="MIKCFEANYPECLGVVLIHKAPWIFSGIWNIIKGWLDPVVASKI
                     NFTKNISDLEKFIPKDRIYKELEGDENWEYSYVEPKADENKTMEDTAKRDELVKERQQ
                     LAQELQDATIEWITVSRKKDEEAIKAAVEKRQALIERLRAQYWQLDPYIRATSLYDRL
                     NILQGGGKIDFYPAEAKVNGAATNGTTTNGATNGTSN"
     exon            complement(1028723..1029237)
                     /number=1
     exon            complement(1029293..1029371)
                     /number=2
     CDS             complement(1029491..1030303)
                     /codon_start=1
                     /locus_tag="AO090003000387"
                     /note="phosphatidylinositol transfer protein PDR16 and
                     related proteins"
                     /old_locus_tag="AO070341000335"
                     /protein_id="BAE57570.1"
                     /transl_table=1
                     /translation="MPIQAAPGTVGNLTPEQEVKLQEFWVLLLKVCGVNVEGIESNGD
                     VATPPSPSSQKKAAPKRRFTFFGGKSNDEEEDTTANGVTTSIASINITDGDDKYGQSK
                     EFQQAITDMKPEEIRVTLWNMVKQDNPDSLLLRFLRARKWDIKKALIMLVSTIRWRLQ
                     DVKVDDDIVKNGELAALEQSKSSDPEEKRKGEEFLKQMRMGKGYIHGVDKDGRPICVI
                     RVRLHKPADQSTDTLDRFTVYTIESARMMLSPPVETAVSFLSLHERIFKHLT"
     exon            complement(1029491..1030303)
                     /number=1
     CDS             join(1031160..1031480,1031532..1031689,1031764..1031944)
                     /codon_start=1
                     /locus_tag="AO090003000388"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000336"
                     /protein_id="BAE57571.1"
                     /transl_table=1
                     /translation="MDPTAFSRSSSRPRPSSRPTTPLRPSSRSSLREAHGYGGSISNA
                     GYTQPAINALEPQFAELADSMADLEANFMHLQLMHESLTRFSESFASFLYGLNMNAFC
                     VDFPEAPIPESFKRAKQAEAQKGINVTLHLMELYGTNTLQEAEVEQTRQANEGETTFM
                     TTDTTFVENPSSTTPPKPVRKTPTSSRGTTRGSSTRGRYTTRGTSRARPSALPRGRGL
                     R"
     exon            1031160..1031480
                     /number=1
     exon            1031532..1031689
                     /number=2
     exon            1031764..1031944
                     /number=3
     CDS             join(1033772..1033784,1033882..1033982,1034038..1034463,
                     1034517..1034720,1034801..1034917)
                     /codon_start=1
                     /locus_tag="AO090003000389"
                     /note="ubiquitin-specific protease"
                     /old_locus_tag="AO070341000337"
                     /protein_id="BAE57572.1"
                     /transl_table=1
                     /translation="MLFESCAVAEAFADFNSSDKAEGFAALSLLLASWRASSALAGYQ
                     QQDAHEYYQFLVDKLHSSTDGHHENHEKGCPCFFHKTFYGKLRSSVTCDKCGNVTRTD
                     DPMVDLSLDVQVQAKKRAMGGAGPSSTPTLSGCLESFTSPEKLMAGVYNCSGCGGSAQ
                     KATKQLRIKKLPAILCMQLKRYEHTFSVSEKLEGRIDFPLSINMLPYTTNPNSHVDKS
                     RYIYDLSSAVVHKGKLDAGHYYAYCRQGDEWILFNDDQVTSVTEADVLSADAYLLFYN
                     LRSLAGAPSQ"
     exon            1033772..1033784
                     /number=1
     exon            1033882..1033982
                     /number=2
     exon            1034038..1034463
                     /number=3
     exon            1034517..1034720
                     /number=4
     exon            1034801..1034917
                     /number=5
     CDS             complement(1037257..1038165)
                     /codon_start=1
                     /locus_tag="AO090003000390"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000338"
                     /protein_id="BAE57573.1"
                     /transl_table=1
                     /translation="MSDQTRPSSPDSYSGFFYHKPWSEPWALSDFSPDQGIVKFYDRL
                     ESQPWWGRTLSRQFLKRSVHWGHGWPWGYFIYRTAYSSDEDWNQALAKLNRYIHCAIR
                     YDDDPEPAEIVWEGCKNVIIDDQRLLEGASPVKVRQLFQDWVERHPDCNHRSTPRSAF
                     CLMIDGHALQSILASPEPCLENKNWITKKTGYVILIDRYFPDKGYRHEPYNVGWVRLK
                     ICGIWPFSRSWDVVEFDERYPAIGRPGLIPYYDGYETWVEDVNGQKLTDVDSSGDEDE
                     DEDEDDLDSGYGVHDIYQYLREGGHI"
     exon            complement(1037257..1038165)
                     /number=1
     CDS             complement(join(1038287..1038314,1038375..1038703))
                     /codon_start=1
                     /locus_tag="AO090003000391"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000339"
                     /protein_id="BAE57574.1"
                     /transl_table=1
                     /translation="MAGIPPENSYFVAQDAQDMRDRLPQTGNLQILLFMDVVQGVCVE
                     PGTHFFLEPVTPTIARGGKYPTPVREARGQIVALGGHGGKELFGELRSITPAAMKQDG
                     CVRVRTLRLSHDHIIH"
     exon            complement(1038287..1038314)
                     /number=1
     exon            complement(1038375..1038703)
                     /number=2
     CDS             join(1044050..1044311,1044376..1045022,1045084..1045785,
                     1045837..1046016)
                     /codon_start=1
                     /locus_tag="AO090003000392"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000340"
                     /protein_id="BAE57575.1"
                     /transl_table=1
                     /translation="MWQKASHAAIAAASLFASLASAIPHGDDHAMNMDMGMGMNSTQK
                     QPESHAAASDDSPMSYFAYGKHSSTIIAHIGLMVLAWCFILPVAVMFSVARSRFALPS
                     QFLFLVFNALGLLLGIIYNSQTPDLYENNAHHKIGWIATWVISAQVIMSLIFAYAGRG
                     ESDATSYERAAFLPVSTDEMAETPTHPTGIHHEYRWSRDSGQDTEVNSASLHSRPSSS
                     TCASPSEEYDTFVKPEAQYPEQPAQSRGWLHSTFVNRFLASRVPCMVSSRALRILTIF
                     YLVIDRIILPFGFIAIATGAVTYGGIMRGREIFNGLAHFIKGGIFFWYGLLTLGRFMG
                     CWADLGWAWNVKPSSDIVGKWKAKIPTGEFTESFVIFLYGASNMFLEHLTSWGGKWSA
                     TDLEHVSISIMFFGGGLCGMLFESKRVKSWLNSTVVQYPSNLRRHGPSDTAWQLPDTQ
                     GVSLNPMPALVILLLGSMMGSHHQSSMVSTMVHKQWGNLLVGFSFARCMTYVITYLKP
                     PTSYLPSRPPTEIVAAFCLISGGLIFMLSTRNVVDAMEFYELDAMFIFTVAMGVTAFI
                     MACEILAIAIKAWATKKETRPQLPPFQFPA"
     exon            1044050..1044311
                     /number=1
     exon            1044376..1045022
                     /number=2
     exon            1045084..1045785
                     /number=3
     exon            1045837..1046016
                     /number=4
     CDS             join(1047053..1047140,1047207..1047650,1047720..1047922)
                     /codon_start=1
                     /locus_tag="AO090003000393"
                     /note="predicted hydrolase related to dienelactone
                     hydrolase"
                     /old_locus_tag="AO070341000341"
                     /protein_id="BAE57576.1"
                     /transl_table=1
                     /translation="MASNPPGPCCATGFKHEGNPVGEIKNVNGVDTYIVYPQDKSTEK
                     VVVFLSDIFGIYVNAQLLADEFAANGYTCVIPDLFQGDAIKLSDMESGKADLPAWLPN
                     HQPSHVDPVVESTVKYVREELGAKRVAGVGYCFGAKYVCRHMKEGKIDVGFNAHPSFV
                     THEELGAITGPLSIAASEIDQIFTTQLRHESEETLKKTGQHWQINLFSGVSHGFAVRA
                     DLSNKHFKFAKEQAFCQAINWFRQYL"
     exon            1047053..1047140
                     /number=1
     exon            1047207..1047650
                     /number=2
     exon            1047720..1047922
                     /number=3
     CDS             join(1048917..1049109,1049164..1049301,1049365..1049446,
                     1049623..1049744,1049801..1049929,1050080..1050164,
                     1050189..1050204)
                     /codon_start=1
                     /locus_tag="AO090003000394"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000342"
                     /protein_id="BAE57577.1"
                     /transl_table=1
                     /translation="MATPAALPPLPFNPARVRSYLLRLPLFTRLVVLAIIVFWLLELQ
                     TVWSVVQWGALAPDEIGFGSMYRLNTYPFIHNGFFHAFLNLVALTPLVERFEAEHGTL
                     TAVALFLGPLSTFPAGLYLLVEKFLLHRNTAVLGASLGNYKIPTWTSPLFACIVVSIL
                     MSNTSFLGHLCAILIGYLFGLGYLKVFVPPEKVLRWIEGKLNLLGRLPHYVSVDQKTY
                     GRYVIMCYSSLVGEEVFWLIKCISVVFWHDVDGRRK"
     exon            1048917..1049109
                     /number=1
     exon            1049164..1049301
                     /number=2
     exon            1049365..1049446
                     /number=3
     exon            1049623..1049744
                     /number=4
     exon            1049801..1049929
                     /number=5
     exon            1050080..1050164
                     /number=6
     exon            1050189..1050204
                     /number=7
     CDS             join(1050452..1050753,1050818..1051056,1051111..1052042)
                     /codon_start=1
                     /locus_tag="AO090003000395"
                     /note="glycosylphosphatidylinositol anchor attachment
                     protein GAA1"
                     /old_locus_tag="AO070341000343"
                     /protein_id="BAE57578.1"
                     /transl_table=1
                     /translation="MTAAIRKLRNNPHFLFVHLPHILSFLCVLAGVVWLLLLPLNDYS
                     RRTYISENALLPGQVHAYFSGSEQNIFRGYRKELEGLLPNGAPGEGPERNDIELTPEI
                     SDKIQSVLRASGLKVATQKYEYTSAGITHQGQNVYAIIQAPRGDATEAIVLVTAWKTA
                     DGELNLNGVTLALTLARYFKRWSLWSKDIIFLITPDSKSGTQAWIDAYHDMQPPSVQP
                     LPLKSGALQGGLVVEYPFDHRFESLHIVYDGVNGQLPNLDLINTAVSIAGGQMGIDAN
                     LQEMWDHNDSYEARLQTILRGMAKQGFGYATGAHSSFMPYHIDAITLQTKGDGWQDEM
                     ALGRTVESLCRSLNNLLEHLHQSFFFYLLMQTNRFVSIGTYLPSAMLIAGNFTIMAIA
                     LWLRTGYYMGSKPQPSVQTGASQDEKKEQAASSQDKNKTEATSVEQKSDANSIIERQL
                     ALPLSFVVGLHLLGLVPLFIFNNLSHKVSHIFPSSPSYIL"
     exon            1050452..1050753
                     /number=1
     exon            1050818..1051056
                     /number=2
     exon            1051111..1052042
                     /number=3
     CDS             complement(1052672..1053229)
                     /codon_start=1
                     /locus_tag="AO090003000396"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000344"
                     /protein_id="BAE57579.1"
                     /transl_table=1
                     /translation="MDEDPETTLQNLTTQLTTTPQAFPTCCLSLSTPLLSTLTTLLPK
                     KPNYTLSIGSGSGLLEALLTHTTPTLQIEGVEVNPTVNRYIAEQDMHVVSGTWDLLSS
                     RVPGAKAWMFVYPREPRLVERYIEGFGETGMVEVILWLGPRADWGDYVGCFEGRGFGV
                     ERVVGVEGGLEGFEMLGVVRRVGSF"
     exon            complement(1052672..1053229)
                     /number=1
     CDS             complement(join(1053502..1054143,1054201..1054460,
                     1054504..1054771))
                     /codon_start=1
                     /locus_tag="AO090003000397"
                     /note="26S proteasome regulatory complex, subunit
                     RPN9/PSMD13"
                     /old_locus_tag="AO070341000345"
                     /protein_id="BAE57580.1"
                     /transl_table=1
                     /translation="MENQKISDFLADQLQQAPEQCQAYFLTFEDYWERKLWHQLTDSL
                     IEFFRLPESAPQRLPIFKAFVLSFADKINQLKFVSLGLMASTECAAVLNHYLPDDKER
                     LSFLTSLADKVNKPDTQEAYIYALADVANVKQRLNDLDGAQKDLGTCQKVLDNFDSVE
                     TVVHASFYKVNADYYHKKQEFASFYKNALLYLACINLEDISESERVSRAYNLSVAALV
                     SDSIYNFGELLLHPILDSLTETPHSWLRDLLFAFNRGDLTAYDVLAGNISKNQLLEQH
                     RFFLYQKISLSALTEMVFRRPPHDRNLTFEAISSETKVKPEEIEHLIMKALSLGLLKG
                     AIDQVAGVAQINWVQPKVLDMTQIEGMRNRLKDWDAGVNQLGHWIEGVGKDVWAA"
     exon            complement(1053502..1054143)
                     /number=1
     exon            complement(1054201..1054460)
                     /number=2
     exon            complement(1054504..1054771)
                     /number=3
     CDS             join(1055433..1055470,1055520..1055691,1055767..1056288)
                     /codon_start=1
                     /locus_tag="AO090003000398"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000346"
                     /protein_id="BAE57581.1"
                     /transl_table=1
                     /translation="MSEFTEKNKEVWGNLAKTYKTRFEKGTKLIYRLTQEKRLWGSDV
                     WTDTEAGQGKEIKVLEYACGPGVVSTALAPFATKVVGIDVADGMVDEYNASAREAGFE
                     DKMIGFKGDLLAEPMPEEFSRPEYSDFDVAFVSMALHHFEKPDLAMKRLGERLKKGGV
                     CLIIDVLPHGKHDHNAHEMHNPDHETTHTIKTHGFTLEDMRKLYETAGLGVGFDYQVI
                     EEPLVFERDGKAISKTIFIARGQRQ"
     exon            1055433..1055470
                     /number=1
     exon            1055520..1055691
                     /number=2
     exon            1055767..1056288
                     /number=3
     CDS             join(1057915..1058010,1058061..1058396,1058452..1058550)
                     /codon_start=1
                     /locus_tag="AO090003000400"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000348"
                     /protein_id="BAE57582.1"
                     /transl_table=1
                     /translation="MFGFEDNLLHKLAKVTNLLTSNHMQERYWPVHAPDVGNALERML
                     HDDSTAGQTFELYGPKEYSTAEIAELVDREIVKHRRHINVPKPILKPVAHYLNKLLWW
                     PIISPDEVEREFIDQVIDPNAKTFKDLGIEPVDLATLTFHYLLGYRSASYYDLPPATE
                     RERQEEKKYLHVLDDQ"
     exon            1057915..1058010
                     /number=1
     exon            1058061..1058396
                     /number=2
     exon            1058452..1058550
                     /number=3
     CDS             join(1058826..1059111,1059212..1059855)
                     /codon_start=1
                     /locus_tag="AO090003000401"
                     /note="uroporphyrinogen III synthase UROS/HEM4"
                     /old_locus_tag="AO070341000349"
                     /protein_id="BAE57583.1"
                     /transl_table=1
                     /translation="MPPQFTFNTSSTPILLLKTKSSPTDSYEEYFSAHSYNPTFIPVL
                     EHNFHTPNLTTVKQLFQSGALNPGPGRKYGGLIFTSQRAVEGFATILNDIGESTKQTS
                     SQSLILYTVGPATSRSLTSIRDDHLPHATILGSETGNGENLAHFILSHYNPLYDSQDG
                     PKPPLLFLVGEQRRDIIPKTLMAGSLPPEQRIGVDELVVYETGVMEGFEKSFGEAVRA
                     SEEFLGGGVERAVWVVVFSPTGCDAMVRVLKGLGDGERRVFVATIGPTTRDHLKNKYG
                     FEADVCAEKPSQEGVGMGIVEFMENRRKNRAGQ"
     exon            1058826..1059111
                     /number=1
     exon            1059212..1059855
                     /number=2
     CDS             complement(join(1060213..1060241,1060299..1060646,
                     1060699..1061080,1061135..1061330,1061377..1061486))
                     /codon_start=1
                     /locus_tag="AO090003000402"
                     /note="mitogen-activated protein kinase"
                     /old_locus_tag="AO070341000350"
                     /protein_id="BAE57584.1"
                     /transl_table=1
                     /translation="MVQQLPPQGGSRKISFNVSDQYEIQDVIGEGAYGVVCSAIHKPS
                     GQKVAIKKITPFDHSMFCLRTLREMKLLRYFNHENIISILDIQRPRNYESFNEVYLIQ
                     ELMETDMHRVIRTQDLSDDHCQYFIYQTLRALKAMHSANVLHRDLKPSNLLLNANCDL
                     KVCDFGLARSAASTDDNSGFMTEYVATRWYRAPEIMLTFKEYTKAIDVWSVGCILAEM
                     LSGKPLFPGKDYHHQLTLILDVLGTPTMEDYYGIKSRRAREYIRSLPFKKKIPFKALF
                     PKANDLALDLLERLLAFNPAKRITVEEALRHPYLEPYHDPEDEPTAPPIPEGFFDFDK
                     NKDALSKEQLKILIYEEIMR"
     exon            complement(1060213..1060241)
                     /number=1
     exon            complement(1060299..1060646)
                     /number=2
     exon            complement(1060699..1061080)
                     /number=3
     exon            complement(1061135..1061330)
                     /number=4
     exon            complement(1061377..1061486)
                     /number=5
     CDS             complement(join(1064237..1064812,1064877..1066523,
                     1066585..1067103))
                     /codon_start=1
                     /locus_tag="AO090003000403"
                     /note="vesicle coat complex COPII, subunit SEC24/subunit
                     SFB2"
                     /old_locus_tag="AO070341000352"
                     /protein_id="BAE57585.1"
                     /transl_table=1
                     /translation="MAAPQGGYPPQEGYGQPAGYESPSQQAAGLAPAPAQHGGRKKRA
                     YAGEAFELGSGANAGLGGQLPAGGTYGGYPAQPQAAGYQQPVYGADPTQMQAAAQGYA
                     APAAPAVAQMTQQFGAMGVTDPHLMPPQPVPQAAQAPRPVLNHLYPTDLLTQPFNVAE
                     LDYPPPPIVLPQGTSVYPSPTANCPPKYVRSTLNAVPTTHSLLKKSKLPFALVIQPYG
                     ALHDSEDQVPVIPDQVISRCRRCRSYINPFVTFLDHGHRWRCNMCNLTNDVPQAFDWD
                     TTLQRPADRALRPDLNHAVVEFVAPQEYMVRPPQPLVYLFLIDVSYASVTNGLLATSA
                     RCIKESLERIPNADRRTRLGFIAVDSSLHYFSIPRDGSENSDPRMLVVSDLDEPFLPI
                     PGDLLVTLSECRENIETFLDKLQEMFQNTQNNGCAMGSALRAGYKLIAPVGGKMTVLS
                     SSLPNIGHGALTMREDKKVLGTSKESGLLQTANSFYKSFAVECSKAQVSVDMFLFSSQ
                     YQDVASLSNLPRYTGGQTYFYPGWNAARGEDAIKFAREFSEYLSSEIGLEAVLRVRAT
                     TGLRMSTFYGNFFNRSSDLCAFPAFPRDQAYVVEVAIDETVTKPVVCMQTAVLHTTCN
                     GERRIRVLTLALPTTQSLADVYASADQQAIATYFSHKAVERALGSGLEPAREALQAKA
                     VELLATYRKELAGGSVSGGGLQFPANLRGLPVLFLALIKNLGLRKSAQIPTDMRSAAL
                     CLLSTLPLPLLIQYIYPKMYSLHDMPDNAGLPDEQTGEIVLPPPVNLSSERVVPYGLY
                     LIDDGQTQFLWVGRDAVPQLIVDVFGLPDKSQLRVGKQNLPDLDNDMNQRVRAVIEKS
                     RDHRSKGCGSIVVPHLYVVKEDGEPGLRLWAQTMLVEDRADQGVSLVQWMGNLQEKV"
     exon            complement(1064237..1064812)
                     /number=1
     exon            complement(1064877..1066523)
                     /number=2
     exon            complement(1066585..1067103)
                     /number=3
     CDS             join(1068586..1068853,1068913..1069322,1069379..1070938)
                     /codon_start=1
                     /locus_tag="AO090003000404"
                     /note="kinesin-like protein"
                     /old_locus_tag="AO070341000353"
                     /protein_id="BAE57586.1"
                     /transl_table=1
                     /translation="MSVRVVARVRPLLKSERELDIILRTGSTTQAAPSKTEKQSSQEK
                     KLAALRDRDTIVRIPNPKNENEEYSFQFNAVYDADSPQQELFDAEVAPTVKHLFNGFD
                     VTLFAYGVTGTGKTHTMRGGKSLADRGVIPRLLSSIYRRSRKLEKDGDGETTVNVSLS
                     YYEIYNDKVFDLFEPPEKRTLAGLPLRDNGGKTVVVGLTERPCTSLKEFESLYDQANT
                     NRSTSATKLNAHSSRSHAILCVKVAVSSGGKTRISTASAIDLAGSEDNRRTDNDKERM
                     VESASINKSLFVLAQCVEAISKKHHRIPYRESKMTRILSLGQNNGLTVMILNLAPIKS
                     YHLDTLSSLNFANRTKKIEVREVENEPMFKGPPRPAARPSVTALRQPLRPLTATANVN
                     LPALANKDKDASKAGEKPVKAFHVYSDKPRSRDSTQFRKPEPPKRPSLDSNHRLLKLS
                     RITQPLQSQKQYEDISAAKIEEMVEKKVEEILAVRAVSEKSRQTQVRELNEQVQKRLE
                     MLEQRIEGTEDARAEGLSFLLMAKQHQARGEDSFALKMYQLALPFFPDNEKLARKIST
                     LKQRIQSKSCPDADTTGNHTLTASKREFGSLLSIKRQSVGTNLKRQAEDSDGEYNPED
                     RAEELSDDDIEEITQTRRKKRTKTSSPSDEGSSVDCYEAPSPRTIHLLSIINSRDVSQ
                     IKLLKGVGVKKAEAIVDCLCEMDQHLEEQDSDRQVQINSLAELSTLRGVGVKTVESMR
                     NGVLA"
     exon            1068586..1068853
                     /number=1
     exon            1068913..1069322
                     /number=2
     exon            1069379..1070938
                     /number=3
     CDS             complement(join(1071321..1071753,1071863..1072389,
                     1072452..1072558,1072643..1072976))
                     /codon_start=1
                     /locus_tag="AO090003000405"
                     /note="monocarboxylate transporter"
                     /old_locus_tag="AO070341000354"
                     /protein_id="BAE57587.1"
                     /transl_table=1
                     /translation="MPSIPEIQHSAESVVTESIEQSPSTTPVYSSSAHLNPEDAKQEH
                     PHKEIQPGPQTILEDESSQTGDPEKSGATTQSVPAKAPDAPPDGGLKAWMVVLGAFCG
                     LFVSFGWINCIGVFLDYYKTHQLQDLPTSTVTWITSLEIFMMFFGGPIVGVFFDNFGP
                     RWVLIAGTFFHVFGLMMVSISKEYYQFILAQGVCSPIGTSAIFHGCLTSVSTWFRRRR
                     ALALGVTTCGSSVGGVIFPIMVARLIPIVGFGWTMRICGFLSLGLLVIANLTVQSRLQ
                     HHRKPFRPLDFVRPLRELPFVLTTAGTFFVYWGLFLPFAFIPTQAERILGRLVPPYLA
                     DLFGRFNLMMLTSLFSVIIVLALWLPSRSNAPAIVFTSLYGFSSGAAVSLAPALVAQI
                     SDLREIGVRSGTYFCIVSFAALTGMPIAGALLPDPLHGSYLKLEIFCGVVMFGGVVFY
                     ILAKGRISGWGLMHKV"
     exon            complement(1071321..1071753)
                     /number=1
     exon            complement(1071863..1072389)
                     /number=2
     exon            complement(1072452..1072558)
                     /number=3
     exon            complement(1072643..1072976)
                     /number=4
     CDS             complement(join(1073759..1074085,1074139..1074339))
                     /codon_start=1
                     /locus_tag="AO090003000406"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000355"
                     /protein_id="BAE57588.1"
                     /transl_table=1
                     /translation="MTNNPPRPYRFKSTTLKFQVPGLKGWPSFIQDSKFIRDMSGSDT
                     WKTAMNIFHKIRTWSRMTIWGDRLFLQFDGPATILIQTRGPRINEVLTSHEVNEIASA
                     PRGLTIGPAKPAEEKKPSADEEYRKAAEEAVNAAPAPTRTVEQLEQEIRGSAQSIATL
                     TKEGKVIFEKPGQQN"
     exon            complement(1073759..1074085)
                     /number=1
     exon            complement(1074139..1074339)
                     /number=2
     CDS             complement(join(1074581..1074760,1074817..1074888,
                     1074963..1075081,1075179..1075365))
                     /codon_start=1
                     /locus_tag="AO090003000407"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000356"
                     /protein_id="BAE57589.1"
                     /transl_table=1
                     /translation="MTMSQPLRRGVRAVSWTRVLPPRARQGQTRCLQIRAAAAEQPSS
                     ANGNNLPVVGTPSSAESADARFDVIGAPYSLLSVSLSASQNLFTRRGTLVGLSGKADN
                     VVSTLSVLEPFRRAVVGVPFLYQKVSSASPVTALVSVRSPTTSFAVVHLDGSVDWMVA
                     QRRALLAWTGRSLSIKPTINTSLVC"
     exon            complement(1074581..1074760)
                     /number=1
     exon            complement(1074817..1074888)
                     /number=2
     exon            complement(1074963..1075081)
                     /number=3
     exon            complement(1075179..1075365)
                     /number=4
     CDS             join(1076057..1076124,1076193..1076386,1076416..1076582,
                     1076668..1077367,1077407..1078218,1078276..1078380,
                     1078433..1078551,1078604..1078683,1078757..1078913,
                     1078976..1079402)
                     /codon_start=1
                     /locus_tag="AO090003000408"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070341000357"
                     /protein_id="BAE57590.1"
                     /transl_table=1
                     /translation="MESSIQRLLNDKLYDRRKQGALELEKVVRDAVFKGAHEDIQRIV
                     DQLCHDYAYAVHQPHARNGGLIGLAAASIALGSVSMPGMQHLHCVAPYLKEIVPPVLA
                     CFSDQDARVRYYACESMYNIAKVAKGEILLFYNEIFDALSKLASDSELSVKNGAELLD
                     RLVKDIVSESAASYVSVLQLSEKQETDPEALEDPDLPTAFSLPKFIPLLKERIHVISP
                     FTRMFLVSWLTLLDTIPDLELVSYLPEFLGGLIKFLGDPNRDVNVATQNLLDRFLSEI
                     KRIARLKKGIEESRKGQGSENRQSTTSDSVSTTIDQTVAAETETETEAETNDIAIEDS
                     EFGSTVDEDGLHADGDWIPGQDVQIDYPKILDILVGFVDTSYDLQPVEEEMQLTALRW
                     IDSFFEISPEDILPFVPRLLTQVLPAMSSGSDQVRQAANRVNTSLLEYIVSLSEDTLS
                     DETRQSSSSKLASTPNKETERRESAPNAKPSDVSITASRKQSVQESTQEQTPRSSVMS
                     TPVPPADLDYASAVNSLTLQFLNENEATRVAALSWLIMLHRKAPKKVVAFNDGTFPAL
                     LKTLSDPAEAVVTKDLQLLSQISRNSEDSYFKSFMVNLLQLFSTDRHLLEVRGNLIIR
                     QLCMNLSPERIYRTLADCLEKEEDLEFASIMVQNLNNNLITAPELSGLRKRLRNLDTR
                     EGQMFFVALFRSWCHNSVSTFSLCLLAQAYEQAYNLLQVFAELEMTVNNLIQIDKLVQ
                     LLESPVFTYLRLQLLEPESYPYLYKCLYGVLMLLPQSSAFAALKNRLNSVSNIGLLHT
                     PRLSTMVSASGSGAYDRSTGSRSKREENSIRWVELLEKFKTVQERARRALRARERPFD
                     DGVAGFQGQSLAAALSAADQARNKERATLPDTPRTGLGLGAGAEGRRSPADVGNQKGG
                     SILGAAHRHKTSLPNLGRLGIGSRKSKR"
     exon            1076057..1076124
                     /number=1
     exon            1076193..1076386
                     /number=2
     exon            1076416..1076582
                     /number=3
     exon            1076668..1077367
                     /number=4
     exon            1077407..1078218
                     /number=5
     exon            1078276..1078380
                     /number=6
     exon            1078433..1078551
                     /number=7
     exon            1078604..1078683
                     /number=8
     exon            1078757..1078913
                     /number=9
     exon            1078976..1079402
                     /number=10
     CDS             complement(join(1082174..1082274,1082346..1082562,
                     1082617..1083663,1083718..1083986,1084042..1084156,
                     1084219..1084278,1084337..1084690))
                     /codon_start=1
                     /locus_tag="AO090003000411"
                     /note="mitochondrial Fe/S cluster exporter, ABC
                     superfamily"
                     /old_locus_tag="AO070341000360"
                     /protein_id="BAE57591.1"
                     /transl_table=1
                     /translation="MLPRAARPPCLRVPGHFAHRGPAVPRSTPRISTRHSIQFRVFST
                     SKGLLNKNATSEPKTPISGSPLAPQSADQKTKNAQNAAGTPKRDLLSETMVGKQEQRK
                     ADWAIMKEMAKYLWPKDDWGTKLRVGTALSLLVGAKILNVNVPFYFKSIVDSMNVDFA
                     AIGGTAYTVAGSMIIAYGVTRIGATLFQELRNAVFASVAQKAIRRVARNVFEHLLRLD
                     LNFHLSRQTGGLTRAIDRGTKGISFLLTSMVFHVVPTALEISLVCGILTYQYGAQFAA
                     ITAATMVAYSAFTITTTAWRTKFRKQANAADNRGATVAVDSLINYEAVKYFNNEKFEV
                     ARYDKALKAYEDASIKVTTSLAFLNSGQNMIFSSALAGMMYLAANGVASGSLTVGDLV
                     MVNQLVFQLSVPLNFLGSVYRELRQSLLDMETLFNLQKVNVNITEKPNAKPLQLHRGG
                     EIKFENVTFGYHPDRPILKNASFTIPAGQKFAIVGPSGCGKSTILRLLFRYYDVQEGR
                     ILVDGQDVRDVTLESLRKAIGVVPQDTPLFNDSIAHNIRYGRIDATDEEVRKAAQRAH
                     IHELIEKLPEGYKTAVGERGMMISGGEKQRLAISRLILKDPELLFFDEATSALDTYTE
                     QALLQNINSVLKDKARTSVFVAHRLRTICDSDQILVLKEGRVAETGSHRELLELDGIY
                     AELWNAQEMSFAQDPESEGNAELEEGAGQEVLPDSRQK"
     exon            complement(1082174..1082274)
                     /number=1
     exon            complement(1082346..1082562)
                     /number=2
     exon            complement(1082617..1083663)
                     /number=3
     exon            complement(1083718..1083986)
                     /number=4
     exon            complement(1084042..1084156)
                     /number=5
     exon            complement(1084219..1084278)
                     /number=6
     exon            complement(1084337..1084690)
                     /number=7
     CDS             complement(1085625..1086569)
                     /codon_start=1
                     /locus_tag="AO090003000412"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000361"
                     /protein_id="BAE57592.1"
                     /transl_table=1
                     /translation="MRSLVFTAVSCLPAIIAAANPPDLGFDKLWSLENNIWTNFLYPA
                     NLKQINATDDSVFTEDVRSKPQPRVPYLCIDTNRNKVQGRVDITRTFPGRELNNEYIF
                     GLFSQPESLSLTGVAINYTITQFVANQNMASATTVITFNSTSFGVLLPLTVDSWMAFN
                     EDGKVTQYDATFRWFDWFVKTLFEAAAVKFNTTDPIVVKSTLTELLAKAICETSDKYC
                     TGDNKQYDSQEQCMQVLTKEKRFGDPYELGRDTLLCREVHKHMVQYRPTEHCPHIGPS
                     GGDMCVDDKSYVQTVLESYFPQSWIANGYGDDNIWVKK"
     exon            complement(1085625..1086569)
                     /number=1
     CDS             complement(join(1088404..1089950,1089997..1090120,
                     1090170..1090253,1090317..1090995,1091359..1091372))
                     /codon_start=1
                     /locus_tag="AO090003000413"
                     /note="DNA repair protein, SNF2 family"
                     /old_locus_tag="AO070341000362"
                     /protein_id="BAE57593.1"
                     /transl_table=1
                     /translation="MAPLRYRPRPSVREDGGSTPSSKNLQTPSSKSIDRLSKPFKCPG
                     SATPTRTSDKPARKRRKVNYAGADETVDDNSEKPYTNEERLALATRDVNRFPVFKPKD
                     KETTFKQRFKIPLINKAVDSYNGARAAPTLGMRQGATFVVKPLHDPSGEFAIVLYDPT
                     VDDADENSETKLPEDGKPEEQQPKLDAPLVHKSLADILGLKKKVETGPRVPVVIDPRL
                     AKVLRPHQIEGVKFLYRCTTGMVDKNAHGCIMADGMGLGKTLQCISLMWTLLKQSPEA
                     GKTLIQKCIIACPSSLVGNWANELVKWLGKDAITPFAVDGKASKTELTSQIKQWAIAS
                     GRAVVRPVLIVSYETLRMYVEALKDSPIGLLLCDEGHRLKNKDSLTWTALNSLNVQRR
                     VILSGTPIQNDLSEYFALLNFANPDLLGSQNEFRKRFELPILRGRDAAGSDEDKKKGD
                     ECLAELSTIVNKFIIRRTNDILTKYLPVKYEHVVFCNLSQFQLDLYNHFIQSPEIRSL
                     LRGKGSQPLKAIGLLKKLCNHPDLLNLSTDLPGCEFAFPEDYVPPEARGRDRDIKSWY
                     SGKMMVLDRMLARIRQDTNDKIVLISNYTQTLDLFEKLCRSRGYGSLRLDGTMNVNKR
                     QKLVDKFNNPDGEEFVFLLSSKAGGCGLNLIGANRLVLFDPDWNPAADQQALARVWRD
                     GQKKDCFVYRFIATGSIEEKIFQRQSHKQSLSSCVVDSAEDVERHFSLESLRELFQFK
                     PETRSDTHDTFKCKRCRPDGAQFIKAQAMLYGDTSTWNHFVNDGEKGALSKIQDLLIR
                     QETGERDVSAVFQYISH"
     exon            complement(1088404..1089950)
                     /number=1
     exon            complement(1089997..1090120)
                     /number=2
     exon            complement(1090170..1090253)
                     /number=3
     exon            complement(1090317..1090995)
                     /number=4
     exon            complement(1091359..1091372)
                     /number=5
     CDS             join(1092015..1092314,1092374..1092445)
                     /codon_start=1
                     /locus_tag="AO090003000414"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000363"
                     /protein_id="BAE57594.1"
                     /transl_table=1
                     /translation="MASKDDDAQQTAMKVLLCGGVAGVATWASVYPLDMIKTRLQAQG
                     LGAHPEDQPLVRSQNDRRALNSFQLAREAYRTEGLKAFYRGLGVCSVRAFIVNAVQWA
                     SYEWLMRYLNNPWNQTHAQVS"
     exon            1092015..1092314
                     /number=1
     exon            1092374..1092445
                     /number=2
     CDS             join(1094624..1094659,1094899..1094976,1095079..1095098,
                     1095201..1095799,1095863..1097469)
                     /codon_start=1
                     /locus_tag="AO090003000415"
                     /note="aconitase/homoaconitase (aconitase superfamily)"
                     /old_locus_tag="AO070341000364"
                     /protein_id="BAE57595.1"
                     /transl_table=1
                     /translation="MISTRLARMGALFLGARGLATASEHPLDKKVEMSNVEKGNYINY
                     KKMSENLEIVRKRLSRPLTYAEKILYSHLDNPHEQDIERGVSYLKLRPDRVACQDATA
                     QMAILQFMSAGMPSVATPTTVHCDHLIEAQVGGEKDLARANEINKEVYDFLASATAKY
                     NIGFWKPGSGIIHQIVLENYAFPGGLMIGTDSHTPNGGGLGMAAIGVGGADAVDVMAG
                     LPWELKAPKVIGVKLTGELSGWTTPKDIILKVAGLLTVKGGTGAIVEYHGPGVNSLSC
                     TGMGTICNMGAEIGATTSLFPYNDRMYDYLKATKRQHIGDFARSYQKELREDEGAEYD
                     QLIEINLSELEPHINGPFTPDLATPISKFKEAVEANKWPEELKVGLIGSCTNSSYEDM
                     SRAASIARDALDHGLKSKSLFTITPGSEQIRATIERDGQLQTLEEYGGVILANACGPC
                     IGQWDRKDVKKGEANSIISSYNRNFTGRNDANPATHSFVTSPDLVVAMTVAGTLKFNP
                     LTDTLKDKDGKEFKLKPPTGEGLPAKGYDPGRNTYQAPPVDRSTVNVAVSPTSDRLQV
                     LQGFQAWDGKDATNIPILIKCQGKTTTDHISMAGPWLKYRGHLDNISNNMLIGAVNAE
                     NGEANKVKNAFTGEYDAVPATARDYKARGVKWVVIGDWNYGEGSSREHAALEPRHLGG
                     LAIITRSFARIHETNLKKQGMLPLTFAEPADYDKIQPDDKVDLLCTELEVGKPMTLRV
                     HPKDGKTFDIKLNHTFNESQIEWFKDGSALNTMARKGGN"
     exon            1094624..1094659
                     /number=1
     exon            1094899..1094976
                     /number=2
     exon            1095079..1095098
                     /number=3
     exon            1095201..1095799
                     /number=4
     exon            1095863..1097469
                     /number=5
     CDS             join(1098498..1098581,1098680..1098735,1099056..1099156,
                     1099231..1099652)
                     /codon_start=1
                     /locus_tag="AO090003000416"
                     /note="glyoxylase"
                     /old_locus_tag="AO070341000365"
                     /protein_id="BAE57596.1"
                     /transl_table=1
                     /translation="MATQLVPLPEVERLSASVVRILGGNPGKLDEIRTHVNLNLHIVY
                     TAGVEGATLKAFHTPGHTVDHMIFVLEEEDAIFTGDNVLGHGTAVFEDLKVYLSSLQR
                     MQDRVSGRGYPGHGAVIDNATAKITEYIKHRQQREDEVIRVLRYGKLDVPDDEPSPER
                     KASWTPLEIVKVIYHNVPESLHLPASHGVLQVLMKLEAEGKTIHDTESGKWRLETGKS
                     AL"
     exon            1098498..1098581
                     /number=1
     exon            1098680..1098735
                     /number=2
     exon            1099056..1099156
                     /number=3
     exon            1099231..1099652
                     /number=4
     CDS             join(1100983..1101286,1101372..1101744,1101800..1102170,
                     1102221..1102560,1102612..1102753)
                     /codon_start=1
                     /locus_tag="AO090003000417"
                     /note="trehalose-6-phosphate synthase component TPS1 and
                     related subunits"
                     /old_locus_tag="AO070341000366"
                     /protein_id="BAE57597.1"
                     /transl_table=1
                     /translation="MPSLEDSSKNDSRLLLISNRLPITIKRSEDGKYDFSMSSGGLVS
                     GLSGLSKSTTFQWYGWPGLEVPEEEIPVVKQRLKDEYNAVPVFIDDELADRHYNGFSN
                     SILWPLFHYHPGEITFDESAWDAYKDANRLFARAVAKEVQDGDLIWVHDYHLMLLPEM
                     LREEIGDQKQNVKIGFFLHTPFPSSEIYRILPVRNELLLGVLHCDLIGFHTYDYTRHF
                     LSACSRLLGLATTPNGIEFQGKIIACGAFPIGIDPEKFQEGLKKEKVQKRIAQLEQKF
                     QGVKLMVGVDRLDYIKGVPQKLHALEVFLSDHPEWVGKVVLVQVAVPSRQDVEEYQNL
                     RAVVNELVGRINGKFGTVEFMPIHFLHKSVNFDELIALYAVSDACIVSSTRDGMNLVA
                     YEYIAAQQKRHGVLVLSEFAGAAQSLNGSIIINPWNTEELAGAYQEAVTMSDEQRALN
                     FSKLDKYVNKYTSAFWGQSFVTELTRISSQSAEKFQSKRASLTGTYHEQVNGVESEGS
                     A"
     exon            1100983..1101286
                     /number=1
     exon            1101372..1101744
                     /number=2
     exon            1101800..1102170
                     /number=3
     exon            1102221..1102560
                     /number=4
     exon            1102612..1102753
                     /number=5
     CDS             1103461..1104105
                     /codon_start=1
                     /locus_tag="AO090003000418"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000367"
                     /protein_id="BAE57598.1"
                     /transl_table=1
                     /translation="MRPSYLFRAMQPLRSSIVRPTSTSTPAAHIYSAISTPIRRLNST
                     TATPTETQSSTAPSTPSVAPPSLRNYPYTLKTGTVVSVGRMDRTVRVAHRHTMWDSHI
                     RKTYPKVTTYLVSDPKNSLREGDVIEFSSGYPKSRHVRHVVERIIAPFGEAIEDRPAV
                     LTREERDAERVAKRTVKWERREARRAEGGEGQSLGGQEHVGRIRRLVYERTRAQ"
     exon            1103461..1104105
                     /number=1
     CDS             join(1106373..1106658,1106720..1107231)
                     /codon_start=1
                     /locus_tag="AO090003000419"
                     /note="dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /old_locus_tag="AO070341000368"
                     /protein_id="BAE57599.1"
                     /transl_table=1
                     /translation="MSSNPIVLITGANTGLGLETVKALLRSPKAHTILLGGRNIDKAN
                     AAAKAVQEEYPQSRSVVKTIQVDVEYDDSISKAFEHVADEYGRVDILINNAGALLDTQ
                     FYSGDLTMREMWKKSWNVNTVGTHILTHTFVPLLLKSSDPRLLFITSGTSALGETEDT
                     SYRFNKSPAKGWPKEEPTFGAYRSSKTGMNMMMCEWVRILREDGVKVFGISPGFLATG
                     LGGNPELYKKLGALDPVVGAEFVRDVVEGARDQDAGKVIRRDKIQAW"
     exon            1106373..1106658
                     /number=1
     exon            1106720..1107231
                     /number=2
     CDS             1107496..1109562
                     /codon_start=1
                     /locus_tag="AO090003000420"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000369"
                     /protein_id="BAE57600.1"
                     /transl_table=1
                     /translation="MSDIARFTGKFRARTNPNPSQKASTAKVTKSQRASLVCEQCRKS
                     KLRCDRGQPCSSCIRRHESDACSYRQRLGPTVNSGDHSTIESRLTHLESLLNALMRNK
                     ELPSEHEVVPPDLSRCSVDAATIQFQGDSIDDTAYVGSTHWSAILDDIHELQVALSGS
                     IDSQGVNKLATPGAPTLGTELIFGSAHIYSLQQVMSRYLPSKLDIDRYLSLYFQGETF
                     VIPFIHTYHFQRQYRGFWADPTKVDPLWLSILFSICCLSSLTRETAGPGRPLQRDTLP
                     ESPKFHTAAGQCLVIGEYHRPQKLAIEALAVYAQCKNLTTLDPSREAGMILGMVVRMA
                     YELGYHRDPDSFGSLSVFEGEMRRRFWAACKHMDIMISFQQGLPSNICLESCDTKSPR
                     NLLDSDFDVDTQVLPESRPETEPTKLLWFIVKDRQITSFSKVCKYMLSFKEHSEADLH
                     RLDEEIRQTYATIPDILRTRPLSESIADPPFLIITRLYIEFICLKNLCVLHRGYMVQG
                     NVNSTKACVEAAKRLVSQFINMYKEFSPGGQLHTEQWMLTNFTMNDFLLGVMVLCLVI
                     HIHRKQASWTGTIDSAIQKEVLSLLEQSYEVCVENSQASRDARRVSHALHLILNSAKT
                     SRAPELQPANGATSGTNSALLATQTESTIGQTNLAPFDVFDPFNIMGMDFENIDWDAF
                     VPQLSI"
     exon            1107496..1109562
                     /number=1
     CDS             join(1111840..1111899,1111966..1112174,1112239..1114642,
                     1114697..1114735)
                     /codon_start=1
                     /locus_tag="AO090003000421"
                     /note="microtubule-associated protein"
                     /old_locus_tag="AO070341000370"
                     /protein_id="BAE57601.1"
                     /transl_table=1
                     /translation="MADGEEDFSSLPLPERFTHKNWKVRKGGYEDAKQQFEKSPDESD
                     PVFTPFIQDAGLWKGAVADSNVAAQQDGLAAYCAFLKFGGVQACTRSRATTVFPIVEK
                     GLPSARPAAKTNAQEALLLLVELDKADPVIEEMLPGLSHKVPKVIAATLTGLRTIYHN
                     FGCKIVDPKPVLKALPKVFGHADKNVRAEAQSLTVEMYRWLKEAIKPLFWAELKPVQQ
                     TDLEKLFENVKQEPPPKQERLTRAQQDAMATASAAAEDGEAEDGGEDYGDEDGEEVDA
                     FDLAEPVDVMPKVPKDLHEQLSSSKWKDRKEALDALHSALNVPRIKDGPFDDIVRALA
                     ARMKDANIAVVTVAANCVDLLAKGLRSGFGKYRSTIMAPILERLKEKKQSVAEALGQA
                     LDSVFASTTLTECLEEILEFLKHKNPQVKQETLKFLIRCLRTTRDVPSKAEVKSIAEA
                     ATKLLTESSEVNRSGGAEILGTLMKIMGERAMNPYLEGLDDIRKTKIKEFFETAEVKA
                     KDRPKPIVGAPKAVPAAGKKVVGGKKPALGMKKPAPAAAAPPPEEPAPAPSPPKKAVP
                     SRLGGPKTGGLPAPGSGLKKKLGGPGGIASPQRRVVSPPSEEQPAAPAAPKFGLGRGL
                     AGRPIAKPAAPREPSPPPAAPPLTGMSAIERAELEELRLEQEKFTRLVEDLKSERTKL
                     KSQVTELQDQNAQLIEDHTRDVLSIKAKETQLVRARSDAETAEQTVQKQQREIDRLKR
                     ELARALRASAISPPNTLPEGISMAYGDAGSVYQDTASNGHGPLARGYHSGSRFESSRP
                     RSYASASPSEEKENSGLESPGLGSRDGGLGRRKLSPTFGTGYSGMGSPTRSSMLGSSN
                     ASGDDQPTRSTEPAENWKRAAEVTSQLKARIEQMKARQGLTRPPAQR"
     exon            1111840..1111899
                     /number=1
     exon            1111966..1112174
                     /number=2
     exon            1112239..1114642
                     /number=3
     exon            1114697..1114735
                     /number=4
     CDS             complement(join(1115541..1115741,1115797..1116306,
                     1116369..1116443,1118209..1118232))
                     /codon_start=1
                     /locus_tag="AO090003000422"
                     /note="60S ribosomal protein L7A"
                     /old_locus_tag="AO070341000371"
                     /protein_id="BAE57602.1"
                     /transl_table=1
                     /translation="MPPRRLLLPPKSGKKAAPLPYPQGKAGSKKAPKNPLIEKRSRNF
                     GIGQDIQPKRNLGRFVKWPEYVRLQRQKKILNLRLKVPPAIAQFQSTLDRNSAAQTFK
                     LLNKYRPETKAEKKERLHAEATAVAEGKKKEDVSKKPYHVKYGLNHVVGLVENKKASL
                     VLIAHDVDPIELVVFLPALCRKMGVPYAIVKGKARLGTVVHKKTAAVLALTEVRSEDQ
                     SEFSKLLSTIKEGYTDKYEESRRHWGGGIMGAKAVARQEKKRKAVESAVKI"
     exon            complement(1115541..1115741)
                     /number=1
     exon            complement(1115797..1116306)
                     /number=2
     exon            complement(1116369..1116443)
                     /number=3
     exon            complement(1118209..1118232)
                     /number=4
     CDS             complement(1120123..1120869)
                     /codon_start=1
                     /locus_tag="AO090003000423"
                     /note="3-polyprenyl-4-hydroxybenzoate decarboxylase"
                     /old_locus_tag="AO070341000372"
                     /protein_id="BAE57603.1"
                     /transl_table=1
                     /translation="MGWIGSAIIVLVGSLLYLTNRFPNLRISPFSHKWDTKASASAAT
                     EPSPQSTRLQTQPNPPTRPMRIIVAMTGATGAILGIRLLERLREMNVETHLVISRWAV
                     ETIKYETKYTANDVRALATRCYPVNDAAAAISSGSFQADGMIIVPCSMRTLSAVRTGF
                     ADDLICRAADVTLKERRKLVLVVRETPLSGIHLENMLDLTRYGAVIFPPMPAFYTMPE
                     SVDDIVTQSVGRMLDMFGLDAGNFERWDGF"
     exon            complement(1120123..1120869)
                     /number=1
     CDS             1121474..1122985
                     /codon_start=1
                     /locus_tag="AO090003000424"
                     /note="3-polyprenyl-4-hydroxybenzoate decarboxylase and
                     related decarboxylases"
                     /old_locus_tag="AO070341000373"
                     /protein_id="BAE57604.1"
                     /transl_table=1
                     /translation="MDHTAAAKDFRRFIQELEDEGELLTITKEVDPHLELAAIVRKVC
                     ETGERAPLFTNPKGRKDDGLFRVIGASIGYSKRPGMQLCRLAKSLGLPSSATGHEIVQ
                     KINEAKTKPPIPCRKLESGPVKDHIIHGDDIDLTQLPVPLLHEHDGGKFIETMGMHVV
                     QSPDGKWTNWSISRGMVHGKRELVGLVIPKQDIGTIFNLWKEKGEDMPWAVCFGVPPA
                     AIMVGGMPIPKWTNEPEFIGALTDAPVDIVKCETNDLWVPANAEIVLEGVVSISETAP
                     EGPMVEYNGLVFPGHKTQCPIFKVNTITYRHDPILPICVAGRAPDENSTIWCTMQAAE
                     VLNICQKAGLPINMVWCPFESHCLWFVLQVNHSKLVDMGTNMEEFCRKLGHVVFGSKP
                     GWFIPKIFLVNDYIDPTNLPDVIWAEATRCEPGRHEFIFNEYSNIPLIPYVTHGLPSK
                     TGMNGKVVKCCMLPNEFTEKTLPWKEGSFQGAYPEDVKKKVLDNWTAYGFQPL"
     exon            1121474..1122985
                     /number=1
     CDS             complement(join(1123168..1123653,1123722..1123790))
                     /codon_start=1
                     /locus_tag="AO090003000425"
                     /note="clathrin adaptor complex, small subunit"
                     /old_locus_tag="AO070341000374"
                     /protein_id="BAE57605.1"
                     /transl_table=1
                     /translation="MINAVLVFNNNGQPRLSKFYTQIDTQTKQSLIQQIYDLVAQRPP
                     SACNFLPLPPLLSRGASSGAEGPSDAPTQVTYRTYATLSFIMISTSTESPLALIDLIQ
                     VFVEALDRIFENVCELDLIFGHETMHAVLSEMIVGGVVVETNIDKIVSGVRSQEGSLG
                     KKKAIQAASSSVGRGGFPGIGAWR"
     exon            complement(1123168..1123653)
                     /number=1
     exon            complement(1123722..1123790)
                     /number=2
     CDS             1124110..1124643
                     /codon_start=1
                     /locus_tag="AO090003000426"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000375"
                     /protein_id="BAE57606.1"
                     /transl_table=1
                     /translation="MKHTIYRCTACSRQRLPFPLRRALSTAITPNTPSNPNKVPLHDL
                     TPADISYYWDTQVPNETDLTYADKFFAPSRHSPIKIWSASKFRTTPMSSVEPEVAFLG
                     RSNVGKSSLLNAIMGKEICWTSSKPGRTREMNAFGIGGTKGGESKIVLLDMPGYGKAS
                     RTEWGIEIMKYLQGRKQ"
     exon            1124110..1124643
                     /number=1
     CDS             complement(join(1126143..1126268,1126326..1128562,
                     1128713..1129067,1129144..1129440))
                     /codon_start=1
                     /locus_tag="AO090003000427"
                     /note="Cdc4 and related F-box and WD-40 proteins"
                     /old_locus_tag="AO070341000376"
                     /protein_id="BAE57607.1"
                     /transl_table=1
                     /translation="MDDQDNNSGLDNVPNTGSVGQFSFAPATRTTVVTTTTTTTTTFP
                     PLFIKPPRATRELDPKLYPLASSPTPSSLRNIKFEIGGHSVVFNEPDDTTSAVNELRE
                     KDDALRASNGLVRSVTSICSDDTQLPRRFAPPKGSSQPSSQQSSSKQRRALAAPETRH
                     GYLRPYPARVPSEQSIRSTRSHGPTSTHPVVAGLATPETESNNYSAGESVLPRRRIHE
                     GDPSRLAIPQEIETDGGPEDESGTSTSQDTGYETSQEAPQQSSLGSTSQFTAVGGVAV
                     QDMCLPSPSLSPVAAMNAMNVDSSFDSAEDPEADTDSSFDNNDHRIVSSLRAEDPRTT
                     APHRSRPNILPASSDTLRPTSLMDIPSVLDFFDSVPEGLKTYLMYQFLRRCPKPTLHF
                     VADVVNPALKCDFLALLPLELSLNIVKYFDAQTMCRAAQVSKKWRHIINSDEKSWKEL
                     FDRDGYVLPEGELERAIREGWGWQFPNGGEDYEKDLSVSSPVIKPDPESGSPSMQPLP
                     GPSDRPSSAHRRPKRKACTRVSSRKLAKRKISSSGTDHSESSDWRKSVTAAEGPYGAA
                     NAAAAAVPYPDIGLPSLRGLHLYKSLYQRHHSIHNGWMKPSVKPRHIAFRAHDRHVVT
                     CLQFDTDKVLTGSDDTNINVYDTRTGALRATLEGHEGGVWALEYYGNTLVSGSTDRSV
                     RVWDIERARCTQIFHGHTSTVRCLQIVLPVEVGKKADGTPEMMPKEPLIITGSRDSNL
                     RIWKLPKPGDPVYYQNGPHVDDTDCPYFVRALIGHQHSVRTIAAHGDTLVSGSYDCTV
                     RVWKISTGEALHRLQGHSLKVYSVVLDHKRNRCISGSMDNMVKVWSLETGSILYNLEG
                     HSSLVGLLDLKCDRLVSAAADSTLRIWDPETGQCKNMLSAHTGAITCFQHDGQKVISG
                     SDRTLKMWDVRTGECVRDLLTDLSGVWQVKFNDRKCVAAVQRDSLTYIEVLDFGASRD
                     GVPEDQLGRRIVVNRWGQEVSDADEDYDLSDA"
     exon            complement(1126143..1126268)
                     /number=1
     exon            complement(1126326..1128562)
                     /number=2
     exon            complement(1128713..1129067)
                     /number=3
     exon            complement(1129144..1129440)
                     /number=4
     CDS             join(1132099..1132305,1132362..1132384,1132507..1132738)
                     /codon_start=1
                     /locus_tag="AO090003000429"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000378"
                     /protein_id="BAE57608.1"
                     /transl_table=1
                     /translation="MARIKFTTAPTSAVQVQSARVLHEKKSATSTRKKTQAEVENPAK
                     SAVSEGLFLKQQQSLEMVQIMLHVSFGTLFYLRYSYREFLDSKSRHDTNGGDPDIAFG
                     NGKRGQPLKVMIRGTDPKADMILDVLVRSTDYSCPSLSQWPVHLPFSACFH"
     exon            1132099..1132305
                     /number=1
     exon            1132362..1132384
                     /number=2
     exon            1132507..1132738
                     /number=3
     CDS             join(1134379..1134399,1134455..1134904)
                     /codon_start=1
                     /locus_tag="AO090003000430"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000379"
                     /protein_id="BAE57609.1"
                     /transl_table=1
                     /translation="MVKIEHLYVLKNPNEPDNLDPTSTSQELGPIDVPTVQAGNMPFD
                     GLRPSGHETQNSSGGLQDLPIKSRDNKRKSLSDNDKNESYESDDLDKNDRAAEEQLHN
                     SFLTEESMNSKARGSSQRTSSSQGPRRSGRKRRKISNYSKLIDVGAETSDHESV"
     exon            1134379..1134399
                     /number=1
     exon            1134455..1134904
                     /number=2
     CDS             1140830..1141513
                     /codon_start=1
                     /locus_tag="AO090003000431"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000380"
                     /protein_id="BAE57610.1"
                     /transl_table=1
                     /translation="MVSQVRKPSQRARLQQSQQNRRSRVIAVTRQEEHLLEAMRQRKG
                     KITPSLFHEARYQDSLEPDRNSMLSVPSRDSFYGSDISFLRLSPGLPPNMLRKDQGAN
                     NFDKDGSISQGTASDAEQKTTNSSASPRVSLIYSESLPSPATSGASPLTPTLPIHRFS
                     PLPSQKPPPRNPPPAIPSVQRRHSRRRTDSSEAIVLGDSEERKETDDFPIWALGWGGN
                     DNANLTAVH"
     exon            1140830..1141513
                     /number=1
     CDS             join(1143632..1143700,1143854..1144858,1145275..1145316)
                     /codon_start=1
                     /locus_tag="AO090003000432"
                     /note="predicted UDP-galactose transporter"
                     /old_locus_tag="AO070341000381"
                     /protein_id="BAE57611.1"
                     /transl_table=1
                     /translation="MGESAQRPSSGPGPVGKNFSWILTVNPLLSGQLLHYSRVMPSTN
                     GKRYLTSTAVFFNEVVKLAISLTIALYEVSKTAPPSVPATSLFFSLTSAVFSGDSWKL
                     AIPACLYTLANSLQYVALSNLQAAPFQVTYQLKLIATAIFSVILLNRSISLRRWGLLL
                     LLLVGVGLVQMPISSSGDISLQEEAAAHHAFPRSLEEWKAAKLDRPNLHKRSATYEGI
                     EEDMMTAFPRMNAVVGLLATLGACVASSLASVYFEKVLKDSAKSTSLWVRNVQLAVYS
                     IFPALFIGVVFLDGEKIAANGFFGGYNWAVWSTVVTQAIGGIATSFCIGHAYRDAKNV
                     ATATSIFLTTLGSIWLFEFELTGNICMQCVHYALHLD"
     exon            1143632..1143700
                     /number=1
     exon            1143854..1144858
                     /number=2
     exon            1145275..1145316
                     /number=3
     CDS             join(1145765..1146008,1146437..1147268,1147317..1147498,
                     1147572..1148245,1148297..1148872,1148918..1149072,
                     1149130..1149227,1149283..1149498,1149558..1149744,
                     1149802..1149989,1151306..1151532)
                     /codon_start=1
                     /locus_tag="AO090003000433"
                     /note="DNA/RNA helicase MER3/SLH1, DEAD-box superfamily"
                     /old_locus_tag="AO070341000382"
                     /protein_id="BAE57612.1"
                     /transl_table=1
                     /translation="MRRKPYSSFPASRQGASYRRTAGTQLRTPIRSDVRTALDQRFSE
                     GARNSSSLGGSRREELPISTPRAEALCRDDDLLFDAFDHQLRPEQFEKSHIAAILEQR
                     TPFQDMPVSIRGIVLVSVHELPDKYGSLFHFPAFNAIQSKCFQSVYKGDDNIVLAAPT
                     GSGKTVVMELAICRLLNNLKDERFKVIYQAPTKSLCSERFRDWNRKFHSLGLQCAELT
                     GDTDYTQMRSVQNSQIIITTPEKWDSVTRKWKDHARLMQLVKLFLIDEVHILKESRGA
                     TLEAVVSRMKTIGSNVRFVALSATIPNSEDIATWLGKDATNQHVPAHREHFGEEFRPV
                     RLQRFVYGYQSQGNDFAFDKMCSSKLPDILAMHSCRKPIMIFCCTRNSSVATAKELAR
                     LWSMSNPPARLWKGPSKSFEFNNIDLKSVAFHHAGLNPGDRQTIENGFLQGQINIICC
                     TSTLAVGVNLPCHLVIIKNTVGWLDGGCKEYSDLEIMQMLGRAGRPQFDKDAVAVILT
                     RKERVDYYERLVSGSESLESCLHLNLIDHLNAEIGLGNVTSVEFAIRWLAGTFLFVRL
                     RRNPTHYQLREGAKREDEDEMLRQICEKDIRLLQESNLVTTESLRSTQFGDAMARYYV
                     RFETMKTFLTLKRHATMSQILSVISQAEEFRDVRLKAGEKSLYKEINRETGIMFPVKV
                     DIALPAHKTSLLIQSELGAVEFPNDEQFQKHKFAFQQDKGFVFSHVNRLIRCIIDCQI
                     SLQDSVATRNALELARSFGAKVWDRSPFQMKQIEQIGVVAVRKLAAAGITSLEALECA
                     EPHQIDMILSKNPPFGLKLLGRLSEFPKLRVSVKMIRKEAKHGNPVRIHFKAEVAFMN
                     EKCPTTFQRRPVHVCFLAETSNGLMIDFRRMSASKVQSNQEIPLHIEMNSPDQYITCY
                     AMCDDIAGTLRSAELRPALPSSLFSFCSNKESDETNQKHMMNMSRRRSNTSLRAIPNK
                     EYNPDSFDSDDSLFNDFLQDDKATNWATMEYIACPTSKNKPQEKTSKKSKKSKEAKDV
                     NKAEEPTQLRNGRWSCNHKCKDKTMCKHLCCREGLEKPPKMNRKHSNGGADRSNRLNQ
                     LTLSASITKHNTQIGNPGKRRTRKDSMTDITSIICLSVRAYVLSEAFVSHASTLYLIC
                     TEIFRLFEAAMSCVTGNPVAYQHVCVLYTVLYCVIRVVLFPDIIGS"
     exon            1145765..1146008
                     /number=1
     exon            1146437..1147268
                     /number=2
     exon            1147317..1147498
                     /number=3
     exon            1147572..1148245
                     /number=4
     exon            1148297..1148872
                     /number=5
     exon            1148918..1149072
                     /number=6
     exon            1149130..1149227
                     /number=7
     exon            1149283..1149498
                     /number=8
     exon            1149558..1149744
                     /number=9
     exon            1149802..1149989
                     /number=10
     exon            1151306..1151532
                     /number=11
     CDS             join(1151579..1151602,1151755..1152382,1152443..1153561,
                     1153656..1153717)
                     /codon_start=1
                     /locus_tag="AO090003000434"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000383"
                     /protein_id="BAE57613.1"
                     /transl_table=1
                     /translation="MGKLNYSAYYALTRTQRKRLPDGPGFKAAARDPTLEIDIANKTL
                     TDQDLSIFIDDLLECIREDLAKVVEFHIQGNSLTIKSLPKLGEAIALNAGEMRELDIS
                     NNNINISPSPEDKAMWCQFLNSFKNCYMLKKLDLGGNPLGPVGLEVLARVYIKSDLHF
                     LEDDAYAIVEPKHEERSFNEDSTAVKVTAGKENERSTRGSRLEKSPNKGKKALRQNFG
                     QFKSNPAKGTALDDLKRFACTRGLRSIAYLILSNVYMAKSGTVHLASMLSMQRTSDQL
                     LKFLPEGKSPALPETANSKSIIWLPNDTLPQVASEFLGKAEAINEIKTNIDSDDDLSN
                     DDEAQGPVSTIAQTNAEPNQKIDTAAQRELQNKKNTAYARLTKRVRMEALHDEGVHGT
                     DLWITALRMMNVSRILLWQGKESSVCSPNKEQGQQEDDDRDDPYPSAVHIEDITQQFD
                     DLETAEHPSSSESPSSPVEIHITEPDRMGPFHPGTDSFDANFPILHPSNTENADTSLT
                     RNDEEQHIVAARNELSASPQPARSGKGNSRTTYGSRALRKEKETWRFGFTLEIWRRII
                     ADAAGAEGILDLEQQTQIMRYATDILCRAYTGNCLGKYSFYEES"
     exon            1151579..1151602
                     /number=1
     exon            1151755..1152382
                     /number=2
     exon            1152443..1153561
                     /number=3
     exon            1153656..1153717
                     /number=4
     CDS             join(1156013..1156212,1156257..1156746)
                     /codon_start=1
                     /locus_tag="AO090003000435"
                     /note="magnesium-dependent phosphatase"
                     /old_locus_tag="AO070341000384"
                     /protein_id="BAE57614.1"
                     /transl_table=1
                     /translation="MNMMRAKRTNTQPLEDASTAPATFNDGLPLPKLIAFDLDYTLWP
                     FWVDTHVSAPIKPRDNNSRCTDSTQGSSCDRWNESFAFYPAVSAIIYACKTRSIPLAL
                     ASRTHTPDLARDMLKALHIIPTFSDNPAAKAKSVRALDYFTYVQIFPANKTQHFSKIH
                     QASGINYEDMLFFDDEARNRNVETELGVTFCLVRDGMTKEEVDRGVWAWRKRNGIKPT
                     APKEHNGEQAN"
     exon            1156013..1156212
                     /number=1
     exon            1156257..1156746
                     /number=2
     CDS             join(1157140..1157475,1157561..1157593)
                     /codon_start=1
                     /locus_tag="AO090003000436"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000385"
                     /protein_id="BAE57615.1"
                     /transl_table=1
                     /translation="MDPRQSQVHLKPPPPQHVRPSASASSSPAPTPRAPVTIHPTTTV
                     ADTVILHGTHPISIGAGTIVHPRAKFYSYEGPIIIGENCIISEKSTIGAAPTQPPSFL
                     RESRTSDGLPHSRPSIGAYR"
     exon            1157140..1157475
                     /number=1
     exon            1157561..1157593
                     /number=2
     CDS             complement(join(1158274..1164080,1164130..1164421))
                     /codon_start=1
                     /locus_tag="AO090003000437"
                     /note="uncharacterized conserved coiled-coil protein"
                     /old_locus_tag="AO070341000386"
                     /protein_id="BAE57616.1"
                     /transl_table=1
                     /translation="MASVTIELPYLSSHYSIAESTLTTLTQAPTVELVNQLLEAITKK
                     AREYDDLKSDKLRLEVELENAVRSSESKVKVLKSSVEKGHAEVEESRKKLHESENIRS
                     SLESEIASLKSSSTSNESEVSSLKSRISSLEASNRDTLALLESKSAAYDKLAEELSTQ
                     HKKTIELRRELSSAEQNLQAANSASASARFREQSLQQDLDLTKKNNEWFETELKTKSA
                     EYLKFRKEKSARIAELQRENEEASATIDSLRRSENALKSRLDEVEQRYEESLSSIQQL
                     KEEAIQTAESFRIELDSANRLAELQGNAAETAKQRVQECQLALEKARDDAAEEISRLR
                     VEVETEHSDKEAAERRIAELELTVSQLESEGVAGRRSMSPAPGLNGGPSTPVRPGTPV
                     GTFSPRASRGKGGLTLTQMYTEYDKMRTLLAAEQKTSQELRSTLDEMVQDLEASKPEI
                     DELRADHARLENAVVEMSNILETAGKERDDATKEARKWQGQVEGLAREGDILRQQLRD
                     LSAQVKVLVLEIAVLKEGEGSYDREELEKIARKEVEDAAAELTPTGRFISQNLMTFKD
                     LHELQEQNVTLRRMLRELGDKMEGAEAREKDAVRQQEQEELKELRIRVQTYRDEIANL
                     VAQTKSYVKERDTFRSMLTRRRQTVGDSSAFSQSLPLGAAPPGAADEHMKDAPDYAEL
                     LRKVQAHFDSFREESATDHSALKQQVNELSRKNSELMSEISRSSSQLGAATQRAELLQ
                     SNFNMLKSENAELQKRYAALFENANRQDIKTQQAAEDLVETKGLVESLQRENANLKAE
                     KELWKNIERRLIEDNETLRNERSRLDSLNANLQTILNEREHTDSESRRRLQLNVESLE
                     SELQSTKRKLNDEVEESKKAALRREYEHEQSQKRIDDLVTSLGSTREELVSIKTTRDH
                     LQSRVDELTVELRSAEERLQVMQSRPSVSAAPTEAPTTMEDGAQESGLTREQELGIQV
                     AELKRDLDLAKGELEHAKEQVEDYRAISQGAEERLESVTETHEQYREETERLVEEKDK
                     KIQDLEKRIEEISSELSTTNSELSKLRDEQGDVARRLEEQKSHLEAEITRLKDENERQ
                     LAAAQYHQADLKAQAEISQHAQQNYESELVKHAEAAKNLQLVRSEANQLKLELVESRA
                     QADTYKKDLTQKEESWNELKDRYESELSELQKRREEVLHQNSLLHSQLENITNQISAL
                     QRDRANIAETEDEAESSAPNLEGLQEVIKFLRREKEIVDVQYHLSTQESKRLRQQLEY
                     TQSQLDEARLKLEQQRRAAADSEHTALSHNKLMETLNELNLFRESSVTLRNQVKQAET
                     ALSEKSARVDELVQQMEPLETRIRELENVVETKDGEMKLLQADRDRWQQRTQNILQKY
                     DRVDPAEMEGLKEKLETLQKERDEAVSSRDTLQEQAAAFPEQLKHAEERVQELRAKLT
                     EQFKARSKELTGRINAKQLELNTVVQEKEVIQEELKTTKEELSGLKAKLAEKPAAPAV
                     EEKPAGSGVDSTPASQFPGPTTQLPVPSDDERVKALEEKVQRLEAALAEKEAALAEKD
                     AAIAAKDAEHETKAKERIEKLKETFNNKMAEVRTAHRQEIEKLRTNQQAASQPQEPGT
                     PVSKPNQAPATPAKTEGELPQLTDEQAKALVAKNETIRTIIRNNIRTMLAKEREKQGA
                     QPSAGVSQETLASMEQKFNEEKEAIKKAHEEGVEERIKSAVELSDKKTLVKISMLDTR
                     CRNAQAKIDVVQKAATETPQKPVVEVWEIAKTTKAPPQTQKLASAASPAQVASPAPAP
                     TPTPTPAAGVVPTPSPAPAPTPVPTPAPVNQQQGPAATGSVVTATQAKGPAPAEVQGQ
                     GNVQQKQEQQPPQQSTEGTAPPAANAPVNPFGQSQNKQPTSLPSKPPAGANSGVLRAL
                     QSGLPVARGGRTGGRGGHQQQNPFGGQAQQQEQPQQNQGQPQQQQQGQPSQRGTGLPR
                     GRGGRGGHGRGGHQNVQTANLPQGQGQSSPRGNLNAQARQFVPQGNKRARDDGGEGGN
                     EGAGKRMRGGGHARGS"
     exon            complement(1158274..1164080)
                     /number=1
     exon            complement(1164130..1164421)
                     /number=2
     CDS             1165056..1165931
                     /codon_start=1
                     /locus_tag="AO090003000438"
                     /note="transcription initiation factor IIE, beta subunit"
                     /old_locus_tag="AO070341000387"
                     /protein_id="BAE57617.1"
                     /transl_table=1
                     /translation="MSHLQQQLKSFNAGVVAAAARMPQQRRFVHNNSASSSQVPSSTS
                     TPTPSGDVKRKRQDADIVYSQPANTGTGKDIMTQVIFAIEHMKNKGIPLRFTDIVSYL
                     SLQHRANDQGYVQALRSILQMHEKVLYDPSGANGEGTFSFRPPHNIRTAEQLLQKLQS
                     QSTAAGMSVRELREGWPNVEDTINQLEKEGKLLVTRNKKDDHAKMVWANDPSLIQHFD
                     DEFRQIWEKIRVPDQQAVKEELEKAGITPTNKNKVTKARPKIEHKKVKKPRRSGKTTN
                     THMMGVLRDYSHLKR"
     exon            1165056..1165931
                     /number=1
     CDS             join(1167076..1167139,1167262..1167379,1167477..1168002)
                     /codon_start=1
                     /locus_tag="AO090003000439"
                     /note="bifunctional GTP cyclohydrolase II/3,
                     4-dihydroxy-2butanone-4-phosphate synthase"
                     /old_locus_tag="AO070341000388"
                     /protein_id="BAE57618.1"
                     /transl_table=1
                     /translation="MPADTDPSLQFDSIEDTIKAFKNGEFIIVLDSQDRENEGDLIIA
                     ADSITPAQMAFLVRFTSGLICAPVSPEIASRLSLPQMVIENADPKGTAYTISVDSSDP
                     SVTTGISAQDRALACRTLASPTARAEDFRRPGHIIPLQARSGGVRERRGHTEAAVEFC
                     RLTGKVQAGVIAELVEDGELVPGVPEIGGNNGMMRRDGCLKFGKKWGIKVCTIEDLVD
                     YVEKTEGSSSVVTNGKQ"
     exon            1167076..1167139
                     /number=1
     exon            1167262..1167379
                     /number=2
     exon            1167477..1168002
                     /number=3
     CDS             complement(join(1168816..1168828,1168942..1170883,
                     1171026..1171068))
                     /codon_start=1
                     /locus_tag="AO090003000440"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000389"
                     /protein_id="BAE57619.1"
                     /transl_table=1
                     /translation="MEKLPVEILAKIIDYLTPHEQVQLQSVSKRFFGLARDNNLWRLH
                     CYEQSWAAANASYSGNRASARRVTDSTTPLSSLGQTSLRSLIQPDISLSNGDQNVSFA
                     ERSRAAATWDPSYEGEDIDWYSEYIARNGPISFNWLQQPFTKEDEGKKTHREVKGMGL
                     LRDWSSARQNKAIAPLDDGSVCIWDLNHSHSIGSQSTKGRILGVSQPGILMANLSGRR
                     DNSAAKLGLEFINLGECVSVDSIRRRAYLAVSNVLNEVDLETLSVISQQRYPWSIFAL
                     SQETDYSVPLTLATTLSLHIYDGRLSATEEEEAINLRCEKPTLSLVPKSRIYAPPDSP
                     LLQLQPNGQPPHRIRSPNPLETGEDYAPLFQPGPLALLHPPAPHVNSIFLAGRFPSIL
                     QYDRRFFPRLQNTIHSGGRLCGLASVPAPQFPLSSGLSCPDSHKVVACGEYKGKGSLE
                     LYSLTPLGVQGENGPSDLSSSLSQVYQNRQSSASLKVLSVESHGTRIVYSDGDGNVKW
                     VERDGRAEVRRFNINDYKPRRKNEQDSSGFNTNMQGESEEEARGLWNDSSSPRSNDEV
                     ARKILPTGGNLTGDELLVWTGERVGRIRFADTHDYDEDEEEDDLIDVSEDMDSAKREE
                     LRNRRRELRMREREYSSMMRRALERQADEVRRMGGLGLQHH"
     exon            complement(1168816..1168828)
                     /number=1
     exon            complement(1168942..1170883)
                     /number=2
     exon            complement(1171026..1171068)
                     /number=3
     CDS             complement(join(1171529..1173044,1173132..1173217))
                     /codon_start=1
                     /locus_tag="AO090003000441"
                     /note="checkpoint kinase and related serine/threonine
                     protein kinases"
                     /old_locus_tag="AO070341000390"
                     /protein_id="BAE57620.1"
                     /transl_table=1
                     /translation="MHHSQLAPLPNDLPFRIVSKTIGQGAYACIKKACPSHTDNPVFA
                     VKFIHKEYAARHGKISSRQLQMEATVHKHIGDHNNIISFFQTGEDGVWRWIAMELAEG
                     GDLFDKIEADEGVGEDIAHVYFSQLVSAVGYMHSKGVGHRDIKPENMLLTADGNLKIA
                     DFGLATLFEYKGVTKLSTTFCGSPPYIAPEVITCSNKNNMKGLGYRPDLVDIWSCGIV
                     LFVLLAGNTPWDSPTENSYEFHEYVATNARTTDELWQQLPVATLSLLRGMLNIDPASR
                     FSLEDVRRHPWYTRQNRFLSPDGRLRDPINMATTMFESLHIDFSQDPLARRANSGVEP
                     CRMDMDIGDLDTDFRISSTQPEMPSGHMLVDWDTPHLTDVFSSTQPMGQPLSVDNSYV
                     ADTLEDEPSMSQFSPHPSVPLSRTQKAQQFRDIVPSRPLTRFYSIWELKILVPLICEA
                     LHRLGVPVPSVPAVSASDASAMIRIVTRDGRMCTLQGKVIIECVSEGLFEIEFMKVKG
                     DPLEWRRFFKRVAVLCIDAVYMPEG"
     exon            complement(1171529..1173044)
                     /number=1
     exon            complement(1173132..1173217)
                     /number=2
     CDS             join(1174514..1174872,1174927..1175032)
                     /codon_start=1
                     /locus_tag="AO090003000442"
                     /note="ubiquitin-protein ligase"
                     /old_locus_tag="AO070341000391"
                     /protein_id="BAE57621.1"
                     /transl_table=1
                     /translation="MLTSIHPHSLQSELMQLMLSPSPGISAFPDADGNLTSWTATISG
                     PNETPYEGLTFKLSFAFPNNYPYSPPTVLFKTPIYHPNVDFSGRICLDILKDKWSAVY
                     NVQSVLLSLQSLLGEPNNASPLNAQAAELWDTNQEEYKRHVLARHRDVEDIE"
     exon            1174514..1174872
                     /number=1
     exon            1174927..1175032
                     /number=2
     CDS             complement(join(1176175..1176450,1176510..1177761,
                     1177847..1178148))
                     /codon_start=1
                     /locus_tag="AO090003000443"
                     /note="concentrative Na+-nucleoside cotransporter
                     CNT1/CNT2"
                     /old_locus_tag="AO070341000392"
                     /protein_id="BAE57622.1"
                     /transl_table=1
                     /translation="MVDEKKPVDNDTMPTMEEATPQHHGAVPNAQRDIEEDITYTKDV
                     HSEKRELPESDSLNSCGQKKDEKDEEAGENVPSRSWRRYRPWLKHVVYAVIWLLFTGW
                     WIAGLILHRYDLGWLIPFLIYLAITLRLIFLYVPISIVTRPVYWVWNQTASRFVSLIP
                     EKLRIPSGALLTIAVIIVGSFASPESADNTRANRAVSLFGLVVFLFALWLTSRNRKKI
                     IWHTVIVGMLVQFIVALFVLRTKAGYDIFNFISTLARELLEFSKQGVDFLVETGWANK
                     HSSWFLVSVVPAIIFFVSIVQLLYYTGVLQWAIGKFAVFFFWAMRISGAEAVVAAASP
                     FIGQGESAMLIKPFVPYLTMAEIHQIMCSGFATIAGSVLVSYIGMGLNPQALVSSCVM
                     SIPASLAASKLRWPEEEETLTAGRIVVPEDDSHKAANALHAFSNGAWMGIKIAGMIAT
                     TLLCIISLVGLVNGLLTWWGHYLNIYEPDLTIELIVGYICYPIAFLLGVSRDGDLLKV
                     AKLIGTKLVMNEFIAYDYLQNKEEFQSLSPRSRLIATYALCGFANIGSLGNQIGVLAQ
                     LAPSRAGDVSRVAVSAMLTGAISTLTSAAIAGLLITNEKQYIS"
     exon            complement(1176175..1176450)
                     /number=1
     exon            complement(1176510..1177761)
                     /number=2
     exon            complement(1177847..1178148)
                     /number=3
     CDS             join(1180009..1180132,1180199..1181781)
                     /codon_start=1
                     /locus_tag="AO090003000444"
                     /note="adenine deaminase/adenosine deaminase"
                     /old_locus_tag="AO070341000393"
                     /protein_id="BAE57623.1"
                     /transl_table=1
                     /translation="MSSNDIDWELEEGIPQVDDPFIQQYLKGRTSLVLEEQKQRYDTN
                     LRKALSPVAARACEIVSKIRARDLTSLGLNEGNPRQLNTPSQTSRMSHLNRGEVQKTE
                     LWRILQKMPKGSLLHAHMETMFDIDIVIEEAFKTPGIHIYAPKPFTTQRDYEEGIFYF
                     RYSPPVQNSENEPTLWDPSYEPSILISLQKAAASFPDGGEAGFRDWLKKRCIFASEHS
                     YHEHGSDDMLNAYKTLSSVVNSLLSYEPILRSCLRWMFSRLADDGISYVEIRNSFTFP
                     YRREGNSTPEEDYSAWCQAFQEELELFRSTEEGRTLCGARIIWTASRTLSNREISGSM
                     INCILAKQDFPEVICGFDVIGQGDDARSLVDLVPILFWFRKQCAEEGVDIPFLFHVGE
                     KLCEGKQTEHDLFDAILLGTRRLGPGEPLYKHPLLLELIKEKKILVEVCPIVKGMTSR
                     TDFTLDDPLSVLLSRGVPISLSSYFPDLSERGLNSLTFEFWQALQGPDNLELPGLAMM
                     VENSIRWSCYEDQSTVEWLSDIREGILGEGIKATRLRDWYACFEKFCEWVALEFAEVD
                     IS"
     exon            1180009..1180132
                     /number=1
     exon            1180199..1181781
                     /number=2
     CDS             join(1182798..1182959,1183208..1188352,1188408..1189337,
                     1189400..1189417)
                     /codon_start=1
                     /locus_tag="AO090003000445"
                     /note="cytoplasm to vacuole targeting protein"
                     /old_locus_tag="AO070341000394"
                     /protein_id="BAE57624.1"
                     /transl_table=1
                     /translation="MAYFLPSFFQKRLLRYALSRLELVDTEALDLDSLGIRWGQRSTV
                     ELRDIGLRLETRRAETHDATTDQKTSGRVDPGSGDEPILPNPTDLAESFLQAEPKEEK
                     EELQAAISSQSQVLQHTSTSSSDDEEELGLGNETVSLPSFVAAFLKGVVDRLQVQVDD
                     ISIRVDVETKQEGSSKRHPEEKPDLITGLLSVRQVSMGAVSTHSESGEASSSERRRLV
                     SLSDINLALISEPVVFSNYSRFAAPASPSTPVQPKSSRPPSRAQSPSPETSSESSLAL
                     AMTRSTIFEPPQDLTRQELEEQHTPRLEGSVYTYDGRFSDADTEDGKRSYGSLEDSRQ
                     FEDDEKLLDNPAYLDSVIDYQFQDDDPERLDDMQTRVDGLFRRSRDTPRSQSPEHTAE
                     LTDQNSHPEGALIPLNDRHELEVARLPSHQHFLEAPEAITEPGSSGLTPEKDFRPGYK
                     QQLPLVCAPSSEPDSSGSASESFKESELSESRLFSNEEAQSMYMSAISQGSTSHSFMP
                     NIPGAWDSPESTYVRDTGFHETPTAMEQDAYSEQDETITTPKLTAQEGIYLSHASSID
                     NLQKTTTGTTGRESIQTSPGFNRLTDVAKRFVSVDKVLIWIPSVNHEKVPGDSQSASH
                     QEMSSDGLKDSTAYLQDSVIDDDLLASRIHGFPGPRSGANDPSSPHEGVDHKASGYQE
                     KTKHDAGFSSERDEATVEIHSAEVQFDIAIGWLVIKIGKRIVNAFGHGDGEPPKKHNS
                     ESKAPEQVQPKESFGLILNKFSIKFVEHVPGHANPFGESRQYSPTFFGLMHEDIVLQT
                     TASGLKAHFSSTNDQTKLRLDITKFTLGVASEDLISFNQDLKMRESMRDVLSPMHGDI
                     SLSMSKSLESARIHVTTLPLHLNLNIQRLEEVVGWIGGLSTILELGSSISSASGAKTP
                     KKDPPKRPRGVHFEAPPSPEKLPQDTSLPWKVNARIGGVALNIVGESHYLKLRTTAVK
                     VVSRFEGVGVQIDKAKLSGPLPLDDSKDAPAKINLSNIRIEYLFAPKEVDLDRLLSLI
                     TPSKDKYDEDDDIMLDTLFRQRRQGSVLRTTIAGADIMISRITDFDSLPQLGDELSRL
                     SNVAKYLPEDDRPGLLTLNLIRDFEARVNVGGKVGDITARLKNAEVAYISIPSLVAAQ
                     VGSATVLRNGTEELLGEALPLSAEQRSGQIPHPMLMARFIADEMEPTIKVKMHNLRAE
                     YTVPAAIAFLGLNESSTTSDFAANMAQSIGNLAELQPSKESQSAIKPGSPKSPVRPTI
                     LALALRDCVIGLNPRGSEAKGLVVLTNANFSGAMDDGASSEATLDLRKASIMIIDDVR
                     NMGSTDDSHRRNSTAPPTNQVQSFIDMGFVTVSSISSATASVKLLRSGEDGTQSLDVE
                     LRDDLLILETCADSTQTLISIVNGLQPPTPPSVTKKYRTEVLPLQDMLASFSGDAFAL
                     NSSSSLEGVSETAGDSAENIQDKEGHIEDEVEYVSDFYPAKPTSGGGSLHEAMTASGS
                     NELLDSFHSQYYVSSSISDLEFRDDHFATQSAVGGTAHRWDSTENTYGLSDDTKLQKS
                     PLRIRVRDAHVIWNLFDGYDWQRTRDTISKAVKDVERKATDRRARANRASPSFDEDEE
                     SVIGDCLFNSIYIGIPANKDPRELRSDINRNIDDLVSETGSYATTTTVTGATVRQSQS
                     PSFRKKLRLSRSKYHKMTFELKGICADLVVFPPDSGETQSSLDVRVNDLEIFDHVPTS
                     TWKKFATYMHEVGEKESGTSMVHLEILTVRPVPELAASEIVLKATLLPLRLHVDQDAL
                     DFLCRFFEFRDDSAPASSAPQDIPFLQRVEINAVPVKLDFKPKRVDYTGLRSGRTTEF
                     MNFFVLDGADMVMRHVIIYGVSGFDKLGQTLNDIWMPDIKRNQLPGVLAGLAPIRSLV
                     NVGGGVKDLVVVPMREYRKDGRIVRSIQKGALAFAKTTSNELVKLGAKLAIGTQTVLQ
                     GAEDLLTSPNTQLAGAEEELGDEEEAKKISLYADQPVGVVQGLRGAFRGLERDLLLTR
                     DAIVAVPGEVVESGSAKAAAKAVWKRAPTVILRPAIGVSKAVGQTLLGAGNTLDPSNR
                     RKMEDKYKRH"
     exon            1182798..1182959
                     /number=1
     exon            1183208..1188352
                     /number=2
     exon            1188408..1189337
                     /number=3
     exon            1189400..1189417
                     /number=4
     CDS             1191265..1192515
                     /codon_start=1
                     /locus_tag="AO090003000446"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000395"
                     /protein_id="BAE57625.1"
                     /transl_table=1
                     /translation="MCMPGNRSLHEYRQYLSSCDSATSDSPDIKKLRRKNAALNLNQS
                     QMSLDDHYEYPFSVSSAASSPPPLSPSQSPSALSEQPESLDGFLRMGYHRHISPVDQC
                     LLADLAPGTPSSVDDHICLQQNPHKILVSRHLIRALMDGRYFGSRSDFHTHMQDTFRD
                     RLEKYPDPYPKPIPRNPPASIHSHTKRYSDSMLLNIKKPTTTIIHQGTSFEILNPHES
                     LHFARIVSYIEDVDSFSTGHNRDSYISFTEDTVIIESDPWSYDPPPQPHIHTQSHAEE
                     AFEDENRKSQLDIGDTQGLHHHLMPSINELLEETTLNMTRYLASKPRECASPTNESDL
                     GEPGDPVYDDNHPMNPHEGLWQFDIGINPATKPPSNEQTMTPRTEIKLHRRPTRRSTS
                     SRKRRGPLRKLYGLFRRKTGKQAK"
     exon            1191265..1192515
                     /number=1
     CDS             complement(1193083..1194057)
                     /codon_start=1
                     /locus_tag="AO090003000447"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000396"
                     /protein_id="BAE57626.1"
                     /transl_table=1
                     /translation="MFEDFSFSSPSSTKPPRLAFDGDDNLMVDCDSSLISPLSSRCPS
                     PRSTATHRIPRSLPRSRSSYFRSAQPPTSVPLSAYDDHQKRLSISTLTRKLHEHTIKT
                     SDNETQFGRPATPTSPQSLDTSGRFPGYFLTPPDTDHDDEGSLDSPSLTSGSLSPQPQ
                     SPFLSPTSVPCDLFPQTADMDPLSHSQDSWNIRAQRQNISRLQCNHSELEAIRRALIS
                     DDEKLTTTFDPDACHPSSIPPQKSPRRRAATLQRSRFRPQLGPSLLDPPSSDSKGRRM
                     SSVIPVQTTRIEKNYHSSSRDLRKKSEQGLRRKSLVSAALASMVEKEC"
     exon            complement(1193083..1194057)
                     /number=1
     CDS             join(1195413..1195467,1195553..1196376)
                     /codon_start=1
                     /locus_tag="AO090003000448"
                     /note="carbon-nitrogen hydrolase"
                     /old_locus_tag="AO070341000397"
                     /protein_id="BAE57627.1"
                     /transl_table=1
                     /translation="MAALLKQPLKLALVQLASGADKAVNLAHARTKVLEAAQAGAKLI
                     VLPECFNSPYGTQYFPKYAETLLPSPPTEDQSPSYHALSAIAAEAKAYLVGGSIPELE
                     PTTKKYYNTSLVFSPTGSLIGTHRKTHLFDIDIPGKITFKESEVLSPGNQLTIVDLPD
                     YGKIGLAICYDIRFPEAAMIAARKGAFALIYPGAFNMTTGPMHWSLLARARAVDNQLY
                     VGLCSPARDMEATYHAWGHSLIANPAAEVLVEAEDKETIVYADLDNDTIQSTRKGIPV
                     YTQRRFDLYPDVSAEK"
     exon            1195413..1195467
                     /number=1
     exon            1195553..1196376
                     /number=2
     CDS             complement(1199792..1203670)
                     /codon_start=1
                     /locus_tag="AO090003000450"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000399"
                     /protein_id="BAE57628.1"
                     /transl_table=1
                     /translation="MTAGSTTQSSDGGSFSGFKGNMFNVPPAGSSAPAQQPLPSGGLF
                     GTGSQQNNTTGGLFGSSTTSGSSGQPATAAPATTGSIFGQNSASSSAPSTNVFGQSAS
                     NKPSPFGQSTAFGESMQTSPDAKNNGAQSKPPIFGGGASQTGFGTSTNFASPGAGSLF
                     GGSASKPAETPKPLFGAKPTEQSTPSTSLFGATTQPSSTPSPASSTPAASSTTAAPSP
                     SIFGTSSSAKPTTSFQNPFQSTNLFGTPASSTAAPALEDKEKQEKKPEESQPKTGFQF
                     TPSTGGPSLFSKSASSAAPLAPSSGLFQPPSTGSLFAPKPSVEQNTSSVDQDKAKPAE
                     GNPFSSLFAPKPATPAKPAGEQKPSTEQKPLSSSGNAFGNLFAPKPSTPSEGSKTSQP
                     EKAATPTPLFSTPTSGPDAPKSSGLFAQSPLFSAPTVGNKTPAPAVTAPTPSQSPFKV
                     NGTSTASSASSASATEKSSTTSFEDMRPSGLPDDLDKASKEEVETLYRMRMLNECFKR
                     EASRLDPTKDDFDALVQFYMRVRDTIGAPAGPQKRKAADESATADGHSVKKVKPFGLN
                     AASNKEDSSPATTTTATGSVATNIFGASQATPTTSKRKVADEDENTASPGKRVSEDST
                     TASIFAQSFSKSINSGSSDEPTKPNSTQSVTSSARPSTPDSDKPALFSTTPISSPPKP
                     LFAASTTTKDNSTSTSLFSQSGPSFKPTFTASTNGTSTNSNPFVLKPSGDKEASSAPA
                     PIPGMPKFGAGATNFFAQFKAQVDKDAEKEKEKRKAEDFDSDEEDEAEWEKRDAEERR
                     KKLEALESQAPKRSKFVPGKGFSFEDDEETSDLDKKEETAPTSDASTSSIFDKKTDSS
                     AKPNNIFGHLSATPSEAEENDDADDTEEASAAGDEPEDMSKDTSLAPASEDESNEYVD
                     AKAGAGSGAENSANDSSDDGDLTKALKKSKQEKTATNEQSASDTGASGRSLFDRVEYK
                     QDGTLKRQDDEEQKPLSTFFNSSKYASSFNSPGTPNPFAPTPSKSDAEKDDAPTSKPA
                     TPNPFASLFGSPSPTPAAGTPSIFAPSAAKAGADNTWKMNSPIKFASDSNAASTSKLD
                     SASATPAADSSKPFSTLFGAASATKPASSGTGSPSPGFTFGGPAQPPSFLAPSTVSSA
                     AASRASTPGITSDTGAEESGDGDAAEALPQANLAQSRAGEENEDVVIETRARGLKLTK
                     DGWNSQGVGFLRVLKDRTTSRGRVILRADPSGKIVLNASLIKQLSYTVKGTSVHFLVP
                     QADGPPEQWAIRVKKEEAERLGTAMEETKA"
     exon            complement(1199792..1203670)
                     /number=1
     CDS             join(1205656..1205775,1205821..1206006)
                     /codon_start=1
                     /locus_tag="AO090003000451"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000400"
                     /protein_id="BAE57629.1"
                     /transl_table=1
                     /translation="MSHTKYALWINESVGFMSGFWSYTKEKARKQEKIHKMDGNLGLA
                     LGLLQDGLHLGRLHNVTLDLELASHEESLGVGLAADQGSEVRVGEGQSHCLSPTRYG"
     exon            1205656..1205775
                     /number=1
     exon            1205821..1206006
                     /number=2
     CDS             complement(1207601..1210912)
                     /codon_start=1
                     /locus_tag="AO090003000453"
                     /note="helicase-like transcription factor HLTF/DNA
                     helicase RAD5, DEAD-box superfamily"
                     /old_locus_tag="AO070341000402"
                     /protein_id="BAE57630.1"
                     /transl_table=1
                     /translation="MSPPSQPFQSAKRLAEQSQPLGPLTIRKRGREKDYDPNHAHDDS
                     VETDWTDDLDLPLKRIATKKPSSSPSSLSIRSLQGQGQDDGFDDSIDELRRVLGLDSQ
                     DILELQDEQRKAEQWLESRKEQERLDEEYARRLEGLQESPRPTSARSTSSTHYSESSL
                     LSPPRVNNGTPFPDINRLMPGAIQTPDIYRSPFVPPPLPETNRPGPQRLQPTLIPDSD
                     DSDIAEISAQDFELLIGPSSKRPFPSHHSIGSSRYSLQDSFQQQRPYSSLYPYLESMP
                     GPSGIGGPGPAYGPHVLQNTMARLSAGKQLLEHAGRSIFGGVPNPFSSYDSSVPPYPG
                     PTGYDMNKLPEWMSDYYGADPTKVNEEIKQLLETIRPDSDISTENREGTPEALKVTLL
                     EHQKLGLAWMKSMEEQEQKGGILADDMGLGKTIQAIALMVSRPSTDEERKPTLIIAPV
                     ALMQQWKREIGRILKPGRHQLSVYILHGEKRAVSFRDLKNYDVVLTTFGTLSSELKRR
                     EKYDELQSSGANEQTLSREIAKSLPCLGPSSKWYRVIIDEAQCIKNRNTKAALACCRL
                     NATYRWCMSGTPMMNNVQELHSLLRFLRIKPYSNLERFNHDFTRPLKGSSVSAQRKAM
                     RQLQVLLKAVLLRRTKDSKIDGKPILQLPRRISEKVHAVFSEDELELYSSLEARTQLQ
                     FNRYLEAGTVGRNYSNILVLLLRLRQACCHPHLITDFSVKLNANTDELDLIANAKEFD
                     QEVVIRLKSNNDDLECPICMDAVENPIIFFPCGHSTCAECFSRISDPSLAVRQGHDGA
                     VEVKCPNCRGKVDPKKITDHVSFRKVHDPDHSHDPVEEEPIKPAEEQDESDDSDDDDS
                     LNRFIVNDEEDEESSSKRSRHKGKGKMAKAKKTLAELKKEASKNQKSKRKYLRRLEKT
                     WVSSAKIEKAMDILRGIQEGEEKTIIFSQFTSLLDLLEVPIVRQGWGYRRYDGSMKPG
                     DRNSAVLDFTDSPDCKIILVSLKAGNSGLNLVAASQVIIFDPFWNPYIEEQAIDRAHR
                     IGQVREVQIHRILVQNTVEDRILELQDKKRELIEGALDENASKNISRLGTQELAYLFV
                     CASNLFPRLNCVVQS"
     exon            complement(1207601..1210912)
                     /number=1
     CDS             complement(join(1212614..1212745,1212798..1213003,
                     1213058..1213211,1213284..1213376,1213561..1213620))
                     /codon_start=1
                     /locus_tag="AO090003000454"
                     /note="GTPase Ran/TC4/GSP1 (nuclear protein transport
                     pathway), small G protein superfamily"
                     /old_locus_tag="AO070341000403"
                     /protein_id="BAE57631.1"
                     /transl_table=1
                     /translation="MAAPVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATLGVEV
                     HPLNFTTNLGQIQFDVWDTAGQEKFGGLRDGYYINGQCGIIMFDVTSRITYKNVPNWH
                     RDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLW
                     LARKLVGNATLDFVAAPALAPPEVSVDPEVLKQYEADIVTASAQPLPDEDDADL"
     exon            complement(1212614..1212745)
                     /number=1
     exon            complement(1212798..1213003)
                     /number=2
     exon            complement(1213058..1213211)
                     /number=3
     exon            complement(1213284..1213376)
                     /number=4
     exon            complement(1213561..1213620)
                     /number=5
     CDS             complement(join(1214142..1214267,1214376..1214662,
                     1214782..1215082))
                     /codon_start=1
                     /locus_tag="AO090003000455"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000404"
                     /protein_id="BAE57632.1"
                     /transl_table=1
                     /translation="MVIHMDDNIHAPTVASGPTTTGGPDRDPAKLSMVELMQEKERIE
                     EELSALSSILTSVSNQMAPTLENISNHLNLLQHGVNMNSSLTTFDDFPRADIDVAQSI
                     HDHFANLQRAQGDTSSVSNTNGSSGTQSNLTGNPSSDAAMLGPPFARVNSVAAASPAD
                     RAGLKPGDKIRSFGTINWINHERLSKVAESVQQNEGRTLIVKVLRQDGGDATELDLEL
                     VPRRDWGGRGLLGCHLVPL"
     exon            complement(1214142..1214267)
                     /number=1
     exon            complement(1214376..1214662)
                     /number=2
     exon            complement(1214782..1215082)
                     /number=3
     CDS             join(1215578..1216208,1216300..1216459,1216730..1216901)
                     /codon_start=1
                     /locus_tag="AO090003000456"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000405"
                     /protein_id="BAE57633.1"
                     /transl_table=1
                     /translation="MGHDFLLQHVLYCFLPYELHIFLLKGWSVSLPTVDYPILYKIVV
                     LSITMEGLKEEGAEKHHLVMGDFELEAKRRNLTDSHAPEEHTPSFLPFKRWVKSFRAK
                     KSYSPCQRLRYVEGWSDTTQAHCENTNALPCGGGQDLQWECLSGHSSNLETIKTSTLS
                     VASQSVVRSRGTTQSTNRSFGSDLRGSIESLRPALSPSIDEEAHNRAVKRQSASKLTD
                     WSSQVLFLFSARPEIYYNLHQIRELHEDLLARIRKVTPMSSLAAVDNYEQLTEDVDIL
                     RQSVPNWSVLENGIEALSKSVASIENQALENNKSMLLHDLLIKV"
     exon            1215578..1216208
                     /number=1
     exon            1216300..1216459
                     /number=2
     exon            1216730..1216901
                     /number=3
     CDS             join(1219179..1219342,1219412..1219535,1219599..1219658)
                     /codon_start=1
                     /locus_tag="AO090003000457"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000406"
                     /protein_id="BAE57634.1"
                     /transl_table=1
                     /translation="MTRANEQTAKVFYKGSSEDFVVFVDDIEILNNWRKDRSIPLADV
                     VNGFKIFVTHKHGAQGIMDGASKGILETEFGTSNEDECIKKILENGEYQSSVTKERQG
                     GTNDAKDSPVVGR"
     exon            1219179..1219342
                     /number=1
     exon            1219412..1219535
                     /number=2
     exon            1219599..1219658
                     /number=3
     CDS             complement(1219940..1220965)
                     /codon_start=1
                     /locus_tag="AO090003000458"
                     /note="G/T mismatch-specific thymine DNA glycosylase"
                     /old_locus_tag="AO070341000407"
                     /protein_id="BAE57635.1"
                     /transl_table=1
                     /translation="MSPPASTTLINEDIHVETTFATDDSEDVPVNKKTSFNGRLNQYF
                     HTSKNISNSSIQDTSSKRKSESESNGQSSNDNDSNSKRRKKAISTTVLNLPQRITRSR
                     SASSSPASFASPSPSPATEPSTPGRSRARRQPSSRKSTPASSSVSLLRDTIPPNLTLL
                     LVGVNPGIMTGATGYVYAHPSNLYWKLLHWSGITAIRHPPSDTYRLPELYNIGNTNIV
                     ERPTRDASMLSKAEMDAGVPVLEEKVAKQQPEAVCLVGKSIWEAVWRVRKGRAIRKEE
                     FRYGWQDESENMGRSERWNGAPVFVATTTSGLAAGMSMAEKQAVWNELGKWVNSRRAA
                     KKNNLPE"
     exon            complement(1219940..1220965)
                     /number=1
     CDS             complement(join(1221779..1221838,1221945..1222322))
                     /codon_start=1
                     /locus_tag="AO090003000459"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000408"
                     /protein_id="BAE57636.1"
                     /transl_table=1
                     /translation="MYDGSSLSDRGQANAFHRSTDQVGSAIEGFIWPKIFWDFMTKNL
                     NGAVKPIPVLQILNLLMGLLGLAWEWPLKYFAGTLPHRSIEFRLILYPLSALLSMLLY
                     QGTDPAIYYLVGIGVYFWAYSEGEYNDACSALELRPNDLKRHN"
     exon            complement(1221779..1221838)
                     /number=1
     exon            complement(1221945..1222322)
                     /number=2
     CDS             join(1225287..1225381,1225434..1225688,1225736..1226145,
                     1226201..1227090)
                     /codon_start=1
                     /locus_tag="AO090003000460"
                     /note="ferric reductase, NADH/NADPH oxidase and related
                     proteins"
                     /old_locus_tag="AO070341000409"
                     /protein_id="BAE57637.1"
                     /transl_table=1
                     /translation="MSYTWGSLFTGSKILFYILFWGSHILVFALGWYFQANNSRLDAL
                     NALKYSVWISRGAGLVLTFDGTLILLPMCRNIVKTLRPRIRWLPLDESIWFHRQVSYA
                     LLIFTILHVAAHYVNFYNVEKDNIRPVTAVQIHFTEAGGITGHVMLLCMMLMYTTAHH
                     RIRQQSFETFWYTHHLFVPFMLALYTHATGCFVRDSTDPYSPFAGKDFWNHCIGYEGW
                     RWELVAGGLYLLERLYREIRARRGTVITKVIRHPYDAMEIQFQKESMRYKAGQWLFIQ
                     VPEVSSNQWHPFTITSCPFDPYISIHVRQVGDFTRALGDALGCGPAQARDLEGLDPLG
                     MYEVALENGQKMPQLRVDGPYGAPAEDVFENEIAVLIGTGIGVTPWASILKNIWHMRA
                     GPNPPRRLRRVEFIWVCRDTSSFEWFQALLSSLESQSAYEAANEGRAEFLRIHTYLTQ
                     RLDDDTAANIYLNSVGQEVDPLTELKSRTNFGRPNFQRLFTAMRDGLQDGTYMPGLYA
                     EFSTQIGVYFCGPNAAARQIREAGALSATKDIKFKFWKEHF"
     exon            1225287..1225381
                     /number=1
     exon            1225434..1225688
                     /number=2
     exon            1225736..1226145
                     /number=3
     exon            1226201..1227090
                     /number=4
     CDS             complement(join(1227385..1228362,1228413..1229579))
                     /codon_start=1
                     /locus_tag="AO090003000461"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000410"
                     /protein_id="BAE57638.1"
                     /transl_table=1
                     /translation="MREAGFAEHAVGLWQAILELTLFQSGTIDSATAREEVLSAFMDF
                     WDSEVARVGEVGAKGWRSGHNTLLEPRSFTPRLRVNSKSIFASWMSCEREHIHNARLP
                     ARSLDEENDDPYRVVLSTDLREVLSLVWGLASTDVLVDSFLYFCHLPPIAFSNDSKKT
                     NHWMGDSFLRNEFMSSSDPALDRWVHKWNTNTRTTASVPVYFQNFVHSFDTLFADHEA
                     WFSSIGPWATAVLNSQSDVDPEWVSKVLRSLVEAMPRNDHLAAYSIAVEFACDRIKAA
                     KYAKSLLKKRPSSLWLYNVYALIERRSGNLEAADRVWETTLSMSQNSKTFTEREKADS
                     VLLWHTYIWEMLEAGSLDYVSYLFNSIPQSSPSLKAPVDPKQYIFSPTSLLKTHNLLS
                     DIQEALLAAGNANTFVACVDCLAILAYLSKSRDLNKALQPYSNAFDRLATLPVQFESF
                     RSVSIELLHQARARLLYYHARTSSIYKPSQIRALLADSISLFPHNTIFLSLFAWNESR
                     FRIEERVRDTIMDITTKAHNRADQILTTQVPITSHLFSIFTELNRPIYAGSTPHSVRA
                     AFEKAIGDQDPSTPTHYNTVSTARSSLTLWKLYILFELSQHDINRAKDVFYRGMRACP
                     WSKELIMLAFSHLRADIIQERYPGASRKGDGMNFLELRSVYNVLIEKELRIHVDIEDE
                     LDEFVAEMQQKTAALGLPIAMPEDADSEDERM"
     exon            complement(1227385..1228362)
                     /number=1
     exon            complement(1228413..1229579)
                     /number=2
     CDS             join(1231230..1231606,1231664..1236107,1236169..1236313,
                     1236376..1236818)
                     /codon_start=1
                     /locus_tag="AO090003000462"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070341000411"
                     /protein_id="BAE57639.1"
                     /transl_table=1
                     /translation="MASSLAAQLSQIAANSTNQLNLKAQRISHSQSLIFDRKVAGSQD
                     FDTIYDICNEGFQELCELDPRFAQFERTIFSEQSKVQERTEMNAAQNKELDAVLETFL
                     ALVGGKLLLSPAVKAVEWLVRRFRIHEYNTEFTILTFLPYHTTPLFLNLLSILPEDLT
                     PTFKILNPYKKSSVNPPRHPLVHSATTNKPFFAALNRYTIQVSKEQAGHHALLTFWAG
                     IVTESVAGMLDSARSGRRNIEKENHDDIIMRVLPVLNDGLAMKDVAELVIGCYMVCVA
                     IAQKASLHDKVLDSLMEAVAESWTEETVNSGLVCLAVLAQKKPDTTLPKRVFKAILRL
                     ENPLQQLSETSKQHRASQLLLGLVAGCVQDLSKQKDTARLDFLSLMFESELLGEAELG
                     SGMAIVLRASSNSHKDGAMSLDAQTHLADLVQHFSRSESLRPIFQKTVAESSFDIVAI
                     EQNLQTVIESAPAPKALEDIEMEDAEKEEEQDNFAPALKSLTGSSFKGSYLSTQSIPV
                     YDNLVRAFALGIGAQEKLDAFANLPALDKGNAAKSPQYLSFFVRVFSGSYPIGTRVAA
                     LNMVSSFLTTASIDMDLQALLPFVLVTLADPSERVRREAAGILTIIGSLHKNKKGDAP
                     GGVWARDTIYGQDKQPKNIQWTPGRDLQKVFERALLPGLEEYVIDPDHIGRVLEATLR
                     GSSVSDSESSELKKAVRLSFFTCLCSHAVHVPLYAPKLGLLKLLNRVEKAGGTTRTKE
                     LGSLLKSWREMDGQQAKDVCEKERVPVSEMESQIVLTVTPKERDAITVLLSNVSPYSG
                     SLSPSFVGAIFGRMKDVWAKVPEDRQALAAENLFEISLEQSDSPLVDGCKDVLRSVEL
                     PGAVLSQFLQKIPSTVTDMEGLGPAPKRRRTSQSNMVAMTVKDEAALSELMEKMTFIL
                     ELVDSSSPETHPELADGLFQTLAALHHFKSQVQSGMSYLLSLALGSLLAIVNRSKTIG
                     KPQFDTSVIRADLVVDCVRTTDSPQVQNAALLLVAGLSVIAPELVLHSVMPIFTFMGS
                     SVLKKDDDYSVSVIDQTIDQVVPALIQSLRNQKRDVVSGTSELLLSFTAAFEHIPSHR
                     RLRLFHALITKLGTQDFLFAVLSMLANRYSMDKDVLILMTGLVSDANAPVELATYSKY
                     LGLVSDSLKAKPGISQVLLGIGSDDGREPQKVAVDLLRALAYLFRHSSLKSKMAKAFA
                     IVEGDEPQQIRALFSQILEQTLAIGDNMQDMKSVGQASGEVLSALFGTLSLVDFLDTI
                     EVLLQRPNDELRRKVLRLLEGRLRQNPERDSPSQTRMLDFLSVLVKIVESSPDILLKH
                     AAVACIDRIADKYGKKDPSKVIPAARVVASEVCIGQEDDRIRIMGVLCLASMAEVLGQ
                     AMIPALPDTLSRSLALLGLSLEDGKENTRLHDAVYSLFSALFVHLPYMISASHLDKVL
                     VLSYKSAMNDEFEEESRQEALRLMAKKVDASATFGAVDRNWQHAVQAGPEATKETLEV
                     VSMAIEKHPKSSTAKNLPVITNILFKAFDLRREQLALGSDATFDLSDVDEIEETINEV
                     TIKMIYKLNDSTFRPIFTKLLEWATTGVSKKDTQGSLARHTTFYKFLQVFFGTLQSIV
                     TGYASYIIENVVSVLSKASPSNPNTKSLWLATMRLLKNAFEHDQDEFWQSPSHLTKIA
                     TPLISQLAHATHPTTATLVINEAIPAITELAVAADSTDNHKELNTVLMRYLRPSAGPT
                     GKAAGGENPHTRLAALKTEQSLTEQLGEEWLALLPEMLPYISELMEDEDENVEKEVRK
                     WVKQIEDVLGEKLDDMLT"
     exon            1231230..1231606
                     /number=1
     exon            1231664..1236107
                     /number=2
     exon            1236169..1236313
                     /number=3
     exon            1236376..1236818
                     /number=4
     CDS             complement(1237163..1239121)
                     /codon_start=1
                     /locus_tag="AO090003000463"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000412"
                     /protein_id="BAE57640.1"
                     /transl_table=1
                     /translation="MGSNNEGRVGVYSSAHFIPRFQPAVPPVLERLRPRRRSRAPVPQ
                     KRSHTTFPYEPLDPAKHEIRLFELWPGKPGSKVVGRLFHVSLDENPSFEALSYTWGPP
                     KPTYNISINGYKAFPVQRNLRKALDDLRQPDKPRVLWTDAICINQGSKEEKEHQIKLM
                     GSIYSSAQVVCAWLDHSVRPMDVSFDDLARLGEEIQISDYDPSHWYPVADIFRNPYWR
                     RLWIQQELILAREINIYCQRDVFDGQQLLEFQRRVNDDSFFKRSGEAGRLAKYIDRER
                     MPHQSLGSNILQARADRLLGSQLHHQQSNDGVTHYEVTRRYLGSSLLQLFLQTAGLNM
                     TDPRDRVYGILGLVWDTDVSKVRVDEAAPVIEIYLQVFSLFIERHKSIDFLCFSHKRP
                     YRTASRGDDFPTWMPHDSVDWSAVNASRASGSITARSASIDLKSRILFAQGRLVDTIE
                     NIGPKWEFPELPILEWYRNLEGYLRRLWPEDAGHGPLYEREDVIMLLHPWVSEKRYRQ
                     HYQHQHERPTHETTVALLRAIRVAAEQVDQDKLTLWDLASRPRSDFLTKYQFMCKELW
                     NLISIRVFVGTKCRRLGTMKNNVRAIEPGDQVWILHGCRMPVVLRPVPSKKARFTVIG
                     PAIFPGLMRGEAMSHCEAELTSTVVELE"
     exon            complement(1237163..1239121)
                     /number=1
     CDS             complement(join(1240404..1240520,1240611..1241146,
                     1241201..1241270,1241371..1241427,1241486..1241854,
                     1241931..1242076,1242305..1242332))
                     /codon_start=1
                     /locus_tag="AO090003000464"
                     /note="chitinase"
                     /old_locus_tag="AO070341000413"
                     /protein_id="BAE57641.1"
                     /transl_table=1
                     /translation="MRLIGAVEEASLTMKTFFFLLWGLACFASAALIPHANDKHDTSK
                     PENGYISVAYFASWAIYNDHYPQHIPADKLTHVLYAFANLTETGEVRLWDQWADYDKL
                     FPGDPEERDMANIYGCVRQLGLLKKKNRHLKVLLSIGGYTNSQSWAGILNVEANRKNF
                     AESAVKLMHDVGFDGLDIDWEYPKEDSAKDMVSLLKEVREELDRCSKEHANGNHFLLT
                     IACSAGASNYKVLPMSEMDQYLDFWNLMAYDYVGSWANTTGHAANLYPNTSNPETTPA
                     NTDDAIKYYTSNGVPAEKIVLGMPLYGRSFINTTGLGQPYVEVGTGMGDPGVWHYKVL
                     PLANAKVVELPRTGASYSYDEKNKMYVSYDTVNMTKVKAGYIKMKGLAGGMWWETSMD
                     RVGENSLIGTLVKELGGTGALNKTENYIDFSWSKYANVRKGFKEDEKS"
     exon            complement(1240404..1240520)
                     /number=1
     exon            complement(1240611..1241146)
                     /number=2
     exon            complement(1241201..1241270)
                     /number=3
     exon            complement(1241371..1241427)
                     /number=4
     exon            complement(1241486..1241854)
                     /number=5
     exon            complement(1241931..1242076)
                     /number=6
     exon            complement(1242305..1242332)
                     /number=7
     CDS             complement(join(1242923..1244253,1244318..1244513))
                     /codon_start=1
                     /locus_tag="AO090003000465"
                     /note="predicted protein"
                     /old_locus_tag="AO070341000414"
                     /protein_id="BAE57642.1"
                     /transl_table=1
                     /translation="MTSFVTRSSSTLESLTQSRPKVNIELAGQTEGLVNSYTTKDRIE
                     GTAVITVDHDTRFDEVEITFEGTSRTSVERVAMPGRTGAYQTFLRLRQPIEDSAYPMP
                     RVLEAGRTYKFPFTFVVPDRLLPHVCSHAKTNAHVERSHTLLPPSLGDPMLANDGKSL
                     LNDLAPDMCRISYLIRVSVQRKPENAPSKALASVGKKVRIIPAVDEEPPLNITDDDSY
                     CVRKEKDVKRGFMRGKLGRLVVASSQPKPVQLCPPNSEATDSVSTAATVHLRFDPVGN
                     EEPPRLGTIWSKLRASSLFSAEPWGDYPSPRNVPWAQIGQGCYTETVPLSTMCVASAH
                     WTKHTSPRGLSRCDSMESTSSSESLTGPSASFTGETYYTASVVVPITLPKTKAFVPTF
                     HSCLISRIYCLELSLSYHTPNANILTPTATLKIPIQLTSRARSDAKTKDSEHEITQHE
                     VNAEFFSPRSVAPPTLVQVAPPEYSENQGPILPPDRSIDLMSTARVPRVHAGSVGTAF
                     "
     exon            complement(1242923..1244253)
                     /number=1
     exon            complement(1244318..1244513)
                     /number=2
     CDS             complement(join(1248592..1248801,1250132..1251416,
                     1251610..1253683,1253858..1254101))
                     /codon_start=1
                     /locus_tag="AO090003000466"
                     /note="splicing factor 3b, subunit 3"
                     /old_locus_tag="AO070239000031"
                     /protein_id="BAE57643.1"
                     /transl_table=1
                     /translation="MATTSHMFMYSLTIQPPTAVTQAILGQFAGTKEQQIVTASGSKL
                     TIHRPDPTQGKVTPLFSQDVFGIIRSLAAFRLAGSNKDYIIIGSDSGRITIIEYVPSQ
                     NRFNRIHLETFGKSGVRRVIPGQYLAVDPKGRACLIASVEKNKLVYVLNRNSQAELTI
                     SSPLEAHKPQTLVFAMSALDVGYENPIFAALEVDYSESDQDPTGQAYEEAEKLLVYYE
                     LDLGLNHVVRKWADPVDRTSSMLFQVPGGADGPSGVLVCAEDSVTYRHSNQDAFRVPI
                     PRRSGPTENPERKRFITAGVMHKMRGAFFFLLQTEDGDLFKLNIDMVEDDNGQLTGEV
                     KRLKIKYFDTVPVASSLLILKSGFLYVASEAGNHHFYQFEKLGDDDEEIEFSSENFSA
                     DPSVPLEPIYFRPRSAENLNLVETINSLNPLIDSKVANLSEEDAPQIYTISGTGARST
                     FRTLKHGLEVSEIVDSELPSVPSAVWTTKLTRADEFDAYIILSFANGTLVLSIGETVE
                     EVTDTGFLSSAPTLAVQQLGEDSLIQIHPRGIRHIMADRRVNEWPAPQHRSIVAAATN
                     ERQVAVALSSGEIVYFEMDADGTLAEYDERRQMSGTVTCLSLGEVPEGRVRSSFLAVG
                     CDDSTVRILSLDPDSTLENKSVQALTAAPSALNIMSMSDSSSGGTALYLHIGLYSGVY
                     LRTVLDEVTGELSDTRTRFLGSKPVKLFQVSVKGQTAVLALSSRPWLGYSDIQTKGFM
                     LTPLDYVPLEWGWNFSSEQCLEGMVGIQGQNLRIFSIEKLDNNMLQQSISLAYTPRRF
                     LKHPEQPLFYVIESDNNVLSPSTRAKLLEDSKARTGDETVLPPEEFGYPRGSGHWASC
                     IQVVDPVHAKAVVSTIELEENEAAVSVAAVPFTSQDDETFLVVGTAKDMNVNPPSSAG
                     GYIHIYRFQEDGRELEFIHKTKVEEPPLALLGFQGRLVAGIGPMLRIYDLGMKQLLRK
                     CNAQVVPKTIVGLQTQGSRIVVSDVRESVTYVVYKYQENVLIPFVDDSVSRWTTSTTM
                     VDYETTAGGDKFGNIWMLRCPKKISEQADEDGSGAHLIHERGYLHGTPNRLELMIHVY
                     TQDIPTTLHKTQLVAGGRDILVWSGFHGTIGMLVPFVSREDVDFFQNLEMQLAAQNPP
                     LAGRDHLIYRSYYAPVKGVIDGDLCETYFLLPNDTKMMIAAELDRSVREIERKISLRV
                     TRMSHYRFFQPVVIYRTAHVDDERPLYYLVRVIQKCRLQIIDTTDMAHSVFAQNRADL
                     ESFSQLKA"
     exon            complement(1248592..1248801)
                     /number=1
     exon            complement(1250132..1251416)
                     /number=2
     exon            complement(1251610..1253683)
                     /number=3
     exon            complement(1253858..1254101)
                     /number=4
     CDS             join(1254778..1255239,1255298..1256245)
                     /codon_start=1
                     /locus_tag="AO090003000467"
                     /note="ubiquitin-like protein"
                     /old_locus_tag="AO070239000030"
                     /protein_id="BAE57644.1"
                     /transl_table=1
                     /translation="MADDTATAEDSPVTFNIKSSNDAKYTITLPVSTQVSELKEKLAT
                     SEYADTPAERQRLIYSGRVLKDNETLATYKIKDGHTIHLVKSAASNQRQAGTSQTASA
                     STPSGTSATPAAGVPTNLAAGTGNNPLAGLTGARYAGFAQLPGAGMFGPDGGMGPPPD
                     ADSMLNMLENPQFQSTINEALQNPAMIDMMIQQNPMLREMGPGVRQMMQSPEFRRMLT
                     DPNSLRQAMQLQRAMGGGGGLGGGSAFPAPGVTNTTPEESQNGQNNNGATPAPGAPAF
                     NPFMPPGLGAGNPFAALFGGNPAMGGANPPSTSTATGTGQTETAQRAAGDAAGGDTTT
                     GEGQNQQNAQNPFGLLFNPAMFGAQGGQVNPFNPQQNPFLRDPALLSQMMQAMGAPPG
                     EAGAGGLGANPLAALLGGSGFGTPPPQDNRPPEERYAEQLRQLNDMGFYEFERNIEAL
                     RRAGGSVQGAVEYLLSHPS"
     exon            1254778..1255239
                     /number=1
     exon            1255298..1256245
                     /number=2
     CDS             join(1257275..1257356,1257424..1258772,1258845..1259297,
                     1259347..1259567,1259622..1259640)
                     /codon_start=1
                     /locus_tag="AO090003000468"
                     /note="endosomal membrane proteins, EMP70"
                     /old_locus_tag="AO070239000029"
                     /protein_id="BAE57645.1"
                     /transl_table=1
                     /translation="MELRCLWCPQWALWLLFVSYSCAFYIPGYSVKRYADDESIPLLV
                     NKIFSDHTQLQYAYYDLPFVCPPSGKTHGGSPFGSGHSVSLNLGEILRGDRLMTSDFE
                     LQMGKNVECQALCTAEVGRKDVKWAHQLINEGYVAEWIVDNLPGATSFVTVDRSRKYY
                     ATGFKLGSRDPSPIDGKPHYYINNHFTIVIRWRSAPEGGKLIVGFEIYPKSIRAEDHV
                     ENGCPKQVHEHHDGLELYIPPNTSKLREMYPGSSYIPEDDGVDDGTTLKIPYTYSIYF
                     KEDNSIDWSSRWDLYFSNQDDSSMTHWFAILNSLTISSVLGVAVYVIWGRTVQGDIKG
                     RGDGAMDEAKLKARSAAKAKTLERKGDGLLDHGSDLERDADISSDDEGLEDVSGWKLL
                     HGDVFRVPEYSGLLAPLVGSGMQLLFMTSGLLLLSCLGILNPSFRGGFVSVGMGLFVF
                     AGLFSGYFSARLYKTFGGANWRKNTLITALFIPGLTFCLIFILNLFVWAQASSTAIPF
                     GTLIGLLALWLLIQVPLVYMGSWYGYVRTAPWEHPTKTMSIARQIPPQPWYLHNTYGP
                     VLTGLAPFAVLFIELLYVFKNLWQDKSGYYYVFGFLSAVSTILMVTVSQVTIIATYSQ
                     LCSENYHWWWQSFLTGGSSAFWVFAYCIWYYFFHLHITGFVSSLLFFSYSFLACAVYG
                     LLTGTVGFLTAYAFVRRIYSGVKVD"
     exon            1257275..1257356
                     /number=1
     exon            1257424..1258772
                     /number=2
     exon            1258845..1259297
                     /number=3
     exon            1259347..1259567
                     /number=4
     exon            1259622..1259640
                     /number=5
     CDS             join(1264323..1264733,1264787..1266136)
                     /codon_start=1
                     /locus_tag="AO090003000469"
                     /note="arylsulfatase A and related enzymes"
                     /old_locus_tag="AO070239000028"
                     /protein_id="BAE57646.1"
                     /transl_table=1
                     /translation="MATKKPNILYIMADQMAAPLLAFHDKDSPIKTPNLNRLADEGVV
                     FDSAYCNSPLCAPSRFVMVTGQLPSKIGAYDNAADLPADIPTYAHYLRREGYHTALAG
                     KMHFCGPDQLHGYEQRLTSDIYPGDYGWSVNWDEPEIRLDYYHNMSSVMDAGPVVRTN
                     QLDFDEEVIYKSTQYLYNHVRQRGDQPFCLTVSMTHPHDPYAMTKEFWDLYEGVDIPL
                     PKNGDMPQDQQDPHSQRVLKCIDLWGKEMPEERIKAARRAYYAACTYVDTNVGKLLKV
                     LDDCGMTDDTIIVFTGDHGDMLGERGLWYKMTWYENSARVPMIVHAPKRFAPKRVPQN
                     VSTMDLLPTFVDLVGAQLVRELPLDGVSLLPYLTGEDGLKTDTVLGEYMGEGTQSPVV
                     MIRRGRWKFVYSLIDPPMLFDVKTDPEEKVNLAAGLPIPAQLSAAKHISGSQLQPASL
                     PTPAESPRISPRPQRGAS