LOCUS       AP007154             2005935 bp    DNA     linear   PLN 16-DEC-2016
DEFINITION  Aspergillus oryzae RIB40 DNA, SC001.
ACCESSION   AP007154
VERSION     AP007154.1
DBLINK      BioProject:PRJNA20809
            BioSample:SAMD00067075
KEYWORDS    .
SOURCE      Aspergillus oryzae RIB40
  ORGANISM  Aspergillus oryzae RIB40
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Eurotiomycetes; Eurotiomycetidae; Eurotiales; Aspergillaceae;
            Aspergillus.
REFERENCE   1  (bases 1 to 2005935)
  AUTHORS   Sawano,T., Tanaka,T., Machida,M. and Yamada,O.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-JUN-2004) to the DDBJ/EMBL/GenBank databases.
            Contact:Toshihiko Sawano
            National Institute of Technology and Evaluation, Genome Analysis
            Center, Department Of Biotechnology; 2-49-10 Nishihara,
            Shibuya-ku, Tokyo 151-0066, Japan
REFERENCE   2
  AUTHORS   Machida,M., Asai,K., Sano,M., Tanaka,T., Kumagai,T., Terai,G.,
            Kusumoto,K., Arima,T., Akita,O., Kashiwagi,Y., Abe,K., Gomi,K.,
            Horiuchi,H., Kitamoto,K., Kobayashi,T., Takeuchi,M., Denning,D.W.,
            Galagan,J.E., Nierman,W.C., Yu,J., Archer,D.B., Bennett,J.W.,
            Bhatnagar,D., Cleveland,T.E., Fedorova,N.D., Gotoh,O.,
            Horikawa,H., Hosoyama,A., Ichinomiya,M., Igarashi,R., Iwashita,K.,
            Juvvadi,P.R., Kato,M., Kato,Y., Kin,T., Kokubun,A., Maeda,H.,
            Maeyama,N., Maruyama,J., Nagasaki,H., Nakajima,T., Oda,K.,
            Okada,K., Paulsen,I., Sakamoto,K., Sawano,T., Takahashi,M.,
            Takase,K., Terabayashi,Y., Wortman,J., Yamada,O., Yamagata,Y.,
            Anazawa,H., Hata,Y., Koide,Y., Komori,T., Koyama,Y., Minetoki,T.,
            Suharnan,S., Tanaka,A., Isono,K., Kuhara,S., Ogasawara,N. and
            Kikuchi,H.
  TITLE     Genome sequencing and analysis of Aspergillus oryzae
  JOURNAL   Nature 438, 1157-1161 (2005)
COMMENT     URL:http://www.bio.nite.go.jp/dogan/Top
FEATURES             Location/Qualifiers
     source          1..2005935
                     /db_xref="taxon:510516"
                     /mol_type="genomic DNA"
                     /note="SC001"
                     /note="phrap>=30:1-2005935"
                     /organism="Aspergillus oryzae RIB40"
                     /strain="RIB 40"
     repeat_region   1..23
                     /note="II left telomeric region"
                     /rpt_family="Telomeric Region"
     CDS             join(350..481,558..1289)
                     /codon_start=1
                     /locus_tag="AO090001000001"
                     /note="predicted protein"
                     /old_locus_tag="AO070180000001"
                     /protein_id="BAE56567.1"
                     /transl_table=1
                     /translation="MATPTTKPAWYQTSVTAIDPAAQSMLENYSGLKPEEVIPHVLTL
                     RDEAFQIFPYPCIGQMRFLSCHLSRLPFYQHVLARLRVSPANGFLDAGCCVGQELRHL
                     VYAASIPGSQLYGFDLEAGFFELGYKLFRDNADAFPATFVGADLGGSDEDWEKAEIVG
                     TMKGKIDVVWAGSLLHFWEYEGQLRGVERLIGLTRGEPGSIVCGRQMGSTVAGVYDLN
                     GLTDKTMLHYRHNVESLVEFWKEVGVRTGSKWEVQAELEIGETTTNMRDKAKFMDDNT
                     RVIWWCATRVE"
     exon            350..481
                     /number=1
     exon            558..1289
                     /number=2
     CDS             complement(join(1445..1874,1935..2449,2528..2731))
                     /codon_start=1
                     /locus_tag="AO090001000002"
                     /note="predicted protein"
                     /old_locus_tag="AO070180000002"
                     /protein_id="BAE56568.1"
                     /transl_table=1
                     /translation="MSSSSSAHFSTLTAAELVAWSQSLKPVVLGLCITMLALGNLGVI
                     LRIWAQWRIQKRPMQEDYWLVMAVLFANVVSIATIVAVHYGLGYHIFRVESEDPSRQA
                     LKWIFLCVWLTAAFNGPSMLATKVALLLYYRRLFIVAQIWLRIFWWTNMVYVVLWGIG
                     STITYVLSCVPPSFYWERFDSQSTMHGTCHNTTIADGLPLILDLVSDVAILILPIATI
                     ATLQMPLARKSGLMIVFSVGFIAIVSAVARVVVLYKETNLHSDFTYAAAPFELLDVIQ
                     LNMAIVCATAVPIASGFRVAFSKKFRSSKSWTAGGVGGNTYHSRVSTGAARAARLRRE
                     EEASSSTEQLHMGHFTTSCASKDPEDRARAGALVSANGIVVKIDVDIR"
     exon            complement(1445..1874)
                     /number=1
     exon            complement(1935..2449)
                     /number=2
     exon            complement(2528..2731)
                     /number=3
     CDS             3284..6199
                     /codon_start=1
                     /locus_tag="AO090001000003"
                     /note="acyl-CoA synthetases (AMP-forming)/AMP-acid
                     ligases II"
                     /old_locus_tag="AO070180000003"
                     /protein_id="BAE56569.1"
                     /transl_table=1
                     /translation="MSKDQLQSNSPESIHETRPHGEATSLLELLQRAATTSAGVTFYK
                     TSPSDTEAGERLSYYQLLDQARHDAHWLQTSMPNLKRDTVFLLHFDTHEENIRWFWAC
                     TVAGYLPCIVPKLAVSTDRRIAQAKHILQMLDDPVVLSNSRMACAFQGVDTPRLYRMD
                     QESALTSTTTSSSSSASIRLPMGRNQRADDLGALMLTSGSTGFSKAVCLRQPQMLAAA
                     AGKTAHCRATSQDVFMSWVALDHAVNLVEIHLQAMRLGAEQIQVATDLMVAEPRRFLD
                     LVDRHRISVTFAPNFFLALLRDLVCYPTPEQKAKPAPTWDLSCLRCVFSGGEATVRQM
                     TVQLIRALEPYGAQTFIRAGYGLTESCAGMAWDLVDRTLDDLRDATSEFMSCGRPIPG
                     VEMRVLRETDKSEAATGEEGMLQLRGTVLFSQYYRDPAATRAAFTSDGWFITGDNAYL
                     DVHGQLYVTGRTKDTLLLNGLTIFAVEVEHSLEQARIPGLTPGFTLAFAHRPAGAVTE
                     SYCVVYLPSYALDDAAARVATNEAIERIASLAVHVKPIAILPLPHNYFERTSLGKLSR
                     AHFRRIFESGALDSEREAHETSIHAHRQAHRQAPSSPTEQTILTLVCRRLNIDPDSVS
                     VTTNLFSLGLSSLDFYTVTQDLQQTFEVVFTVPDLLMDPTVTGLARRLASKQQASPIP
                     ALSLVSDTTNEYDPVVPLQLSGPKAPLWLVHPASGNVLIFTNLARAFHERPIYAFRSR
                     GVQPGESLFATITEMADTYAAAMRRTQPSGPYAIAGYSLGSSIAFEIAKRLESAGEEV
                     RFLGALDGPPDIADLVGRLTWNEGLVMVGYFYELIDEPRCVALMRQLRDVDAELALDV
                     ILGEADKERLKVLRLDRAGLKHVTDVIAGFSSAAKGYAPRGSVEVPVDVFAVDPLLTV
                     TDDRVCWVERYLGQWNKLSKKGMVVHQCVGRHADMLGAKYVNELQLVLRSVLEERGA"
     exon            3284..6199
                     /number=1
     CDS             join(9327..9587,9644..9841,9939..10145)
                     /codon_start=1
                     /locus_tag="AO090001000006"
                     /note="predicted protein"
                     /old_locus_tag="AO070180000006"
                     /protein_id="BAE56570.1"
                     /transl_table=1
                     /translation="MSAVDVEDDYNIQEAWERACGAFAQTTKVDLTTSPQFTVDEVLD
                     QIRIKQDEGDEKNKKFKTAKDVIGKTLTLITVLGGIAAQGASMVFAPSSLCFNAVSYL
                     IATGAKYKRIFSSLAELFRRISDVLERCKIYMRLPADAVDISLRKIINEELGSAANWI
                     VWLCWWNVNLRCEQLWDLSHRRPAKERSSKPEMELRRSMPRLTSCSPSRGRETRTMRR
                     SGS"
     exon            9327..9587
                     /number=1
     exon            9644..9841
                     /number=2
     exon            9939..10145
                     /number=3
     CDS             join(10406..11844,12269..12296)
                     /codon_start=1
                     /locus_tag="AO090001000007"
                     /note="predicted protein"
                     /old_locus_tag="AO070180000007"
                     /protein_id="BAE56571.1"
                     /transl_table=1
                     /translation="MTCTAISYYIFDQQELKDPSLIQALEVLAWQIAKVDMVYRKELG
                     SVKTAGSNQIGSLCRQLFGKCYKTDSTFFLLFDGIDQMDKQHLKEFVQLLEEWQSTAC
                     TWPRFTLRILLIGRTETMNKINAQIEDEISVIDVASANRDDMINFINDRMNKMEILGG
                     SSDQVAALRGDIVETLTKETKGDFVNVGLLLDEISRKKRPREIRDILARSGENRSDTI
                     ARKIEMLSDTLSDDDISDLNYLLTWVVFAEYPLTLGQLEAALFLKSREPSLRPLAETI
                     KDQYSSLLCIEGVHVYLVSSSMKDFFRTKSDSEGTRDHQDLDTVGDVSEAEVRIVKRF
                     LESVCDPELFNKFGFDEFFKRKMKRKTVRIAVDAETAHLMIVSACLEIICSKASLDLN
                     PLLRYAENNLGYHLKQADPSLTQPHQKIAIGPQLVKIFTDDEVIDRWWRASSYRLRVL
                     WIYHDDHVEVTLKWLQDSAVTKNISEEERKITGAHSGD"
     exon            10406..11844
                     /number=1
     exon            12269..12296
                     /number=2
     CDS             join(12836..13425,13883..14015)
                     /codon_start=1
                     /locus_tag="AO090001000008"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000287"
                     /protein_id="BAE56572.1"
                     /transl_table=1
                     /translation="MYHLALLYYDNSAGDLNRVELAINQWLQILHMNASDDWIVADRQ
                     ARTASELAIVCFEKARQYPDTAAIYLEHLENVVALKLGDDTIHGTYPARLLARYHALH
                     GDEQKIKNVLRRYIKLNLDLLSDDDPLNDWQGYNGLAMHFMFAGHDADALAAWSLITP
                     NDTTENTETPTTSDTSERKIEGPLRDICDGDCGTYWTSRRLSSSCSRTPILDHYDQDK
                     TQNVALWHGSAYYLRGCSLNPS"
     exon            12836..13425
                     /number=1
     exon            13883..14015
                     /number=2
     CDS             complement(join(16084..25080,25153..25587))
                     /codon_start=1
                     /locus_tag="AO090001000009"
                     /note="non-ribosomal peptide synthetase modules and
                     related proteins"
                     /old_locus_tag="AO080501000008"
                     /protein_id="BAE56573.1"
                     /transl_table=1
                     /translation="MLSPAVCYHTDEGKNGYTFPNLETPKNGVVQTPVQYLIQTAPLH
                     DFCSHQMVDLRTLLQCAWSRVIAQLDSTTDLKADAIYGTKSKSLLEGFISEVKKSQQS
                     TQLENERILTEKLLLPLNPRGTSSLSWLQNDLLCATGGEHGEQSTGGFELAQCGSWIA
                     ISASFNPLIDSTRWVNDYIEVFRSFLVALVVGDDELSAPENYLTPEDCARIRNWNSAV
                     PPEINASILDVFSEQVKAHPGSTAVSGWDASFTYHELEDCADQLAYQLQSRGVGPGML
                     IPLCFEKSAWTVVAIIAVISTGAAFVLLDASQPEARLRSIVMQTRATLMITSSQKKDL
                     GRRLAPEVVSVQPTKSTKNSERSRTLRPVIKPDSLLYVVFTSGSTGQPKGAMISHSNF
                     VSAVHYRRSELYTVTPRVLDFASYSFDISIESTLAPLLLGGCVCVPSDASREADPSDA
                     IKVFNVNQVMLTPSVARLVEPENVPSLRLLHLGGEQISRFDIERWPSTVKLINGYGPA
                     ECTVVTTANTVSPSSPEAHTIGRGLGAVTWVVDPADTGRLVPVGAVGELVIEGPLVGS
                     GYLHDEGRTLAAFIVDPPWLRAFGRRGRLYRTGDLVSYNSNGTLTFIGRKDTQVKVNG
                     QRVELGEIEHNLQQEIYNQGNCVVDVVVDLISVNSNSGKQSILLAFLGLERAAQERFA
                     ASGTPSVQELTSAMWEILEPINLFKVLPRYMVPSIYIPLWRMPLLPSGKINRLKLRSM
                     GESLSVDDLAAFRKPQVATVDTQGRITPQEKLLQSLWGQIFPHRAGSIQPDDNFFSLG
                     GDSLTAMKLVGLIRKHGIENKHSETIRIADILQWPRLADMARCITRVDDKQGDVQDAL
                     FDLLPDHIAPSNARQIAAPQCDVQPEQIVDIYPCTPLQEGLMALSAERSGAYIAQNIF
                     ELSDRTNIDTLRMAWTHIVVSSVIFRTRIVQLDSQTLAQAVVTVPIEWECYDGKLNDF
                     VAIDRHRPMGIGKALMRLTVVTERSEESLLKCFLVWTAHHAVFDDWILNLITSLVGKM
                     YHGRPPSSFHLTPYKRFIRHLQELNRESFSNYWRQELEGTNAAIFPHLPSAVDKPVAD
                     ATANFAFSLNDSKLNVHASLPTILRAAWSILVSRHTQTDDVIFGETLTGRNAPVAGVE
                     EMDGPTLTTIPRRVKVQNEMRVAEFLEEIRRHEINSIPYEGFGLQNIQKLSDDARTAC
                     QFATLLVIQRDPEVSFDSPMINVTEKVLHEDCGEDGKPYASFFTTYPLMVTISIKDNQ
                     INIYASFDSRIIERSQMQVLMHQLEVITRQVIQEPHEVVGGINCLTRKELHQIWSWNR
                     LPWVPVSGSVHDSIAEVSNTRPTAPAVCAWNGSLTYGELDNLSTRLGSYLFKVGVEAE
                     SLVPLCFEKSVWTIVSMLAVIKAGGAFVLLDPTQPKQRLGEIIVRAKANYVLTSPLQY
                     DMVSDLASEFNLTIVLVSKSPLDALTDDATVTDRMPQHLDSDRPLFVTFTSGSTGKPK
                     GVISTHGSYLSGVNYRRSILQLPNLDMRVFDFASYSFDVSTDVILSTLLTGGCVCVPS
                     DFDRKNNIPGAINALRVNAADLTPSVSRLLSPESVPGLKVLKLGGEANTAADHALWLG
                     KTTLVNIYGPSECLVVTAKTVLPGTDPCNIGRGLGANTWVADPTNHDRLAPIGSIGEL
                     LVEGPILGRGYLDDQKQTDAVFIHNPTWLVKGLPGFQPGREGRVYKTGDLVRYNPDGT
                     LHYIGRKDRQLKVRGQRVEPAEIEGAIKRHIQSKLGMTIDVVADLVTSNRDQRKRLIA
                     FLGLNQVLESRGYSEKDHLGDTVLRDIMWEVTAGLEVLLSQTLPPYMVPSVYVPLRHI
                     PLLPSGKTDRRKLQSAAASLSPEDLSFFRERPKAQNRAIATPKEEKLQKIWADALGVK
                     SIQAEDNFFTIGGDSIAAMRLVGLARDQGLLLSVADIFQRPRLYEMAEKAAETGTELL
                     DIPAFSLLPGANPYVIDEREVAAAQCGCSIELIEDIYPCTPLQEGLMALSTKTPGAYI
                     SQNVFQMGNATNTDLMKEAWDYVVRSNPIMRTRVILSARQDLVQVTVQEGIHWASHDS
                     LDCYLKYDRNTSMGLGMPLTRLAWVDDEMTKRSFLVWTAHHAIFDGWVLSLVMENVIR
                     VYHGKSLHVGPPFKGFIKYLKELERAEMDTFWQDEFSGITATPFPALPSSTYQPKADV
                     ETKLEMSFTWSTTSNVTSSTFLRLAWAVLVARLTASSDVIFGETLNGRNAPIPGIERM
                     IGPTLTTLPRRIVLEDGLPVADLLHRLKDHEIAMMPFEHVGLQHLQELSADCQAACKF
                     QTLFVVQRGMDHDMSEMSLTISGDVSNFNSYALMLTCAPESDKILFHASHDSNVISPE
                     KMQDVLNQLQNVVMQLSKKMDRPLREINCLSEIDTQQIWKWNHQLPESISIPVHEIIA
                     QQAREHPATEAVCAWDGTFTYRELDTLAGQLAYHLKELGAVSTPGYHIPLCFEKSAWT
                     VISILAVMKAGGSFVLLDVSQPQDRLQHIVSHIKANYILSSPRQSDLASSLAANVVVV
                     SSDFVRSLRQLHTPGPLNPNSALYVVFTSGSTGKPKGVIITHLNFASGVHYRQNVMHM
                     PGFRLLDFPSYSFDASVESNLVPLMIGGCVCIASDELCQNNLSAAISSTNANAVMLTP
                     SSATLISPENAHSLKQLHLGGEKLTAANIETWADKLKLVVGYGPAECAVTTTGRIVKG
                     MVPQKENIGPAFGAVTWLVDPASHDRLVPLGTIGELLIEGPIVGQGYVNDPERTAAAF
                     IENPPWLLAGGGMFAGRQGRLYKTGDLARYDSDGTLIFIGRKDTQVKIRGQRVELQEI
                     EHHVYQYLRDLTGLGLSIVADLISTCSDIANPTLVVFIELEAVMTQKGHLPDPGPAVL
                     YNEMKSMVPGLDEALRNALPRYMIPSAYVPRWKLPMMPSGKLNRKQLRSDAESLTAEQ
                     WNHFRSLISAVSPAARGREVATNDEAAVQRLWADILRIAEKQIKADDSFFTLGGNSIT
                     AMKLVELARRRGILFNVADVFAHPVLSDLASRIGRVETTPLNQDDLAYAPLQRLMSSN
                     PTLIQGQSSNIPLVMIHDGGGTTYAYHRMGPVNRPLYGIHFPGYASGTAWKGGIKSLG
                     RHYADLIQKSLLSGPIILGGEFYHF"
     exon            complement(16084..25080)
                     /number=1
     exon            complement(25153..25587)
                     /number=2
     CDS             join(26017..26072,26127..26407,26490..26695,26742..26871,
                     26946..27263,27319..27369,27465..28285)
                     /codon_start=1
                     /locus_tag="AO090001000010"
                     /note="2-polyprenyl-6-methoxyphenol hydroxylase and
                     related FAD-dependent oxidoreductases"
                     /old_locus_tag="AO070336000285"
                     /protein_id="BAE56574.1"
                     /transl_table=1
                     /translation="MGSRSNYVDVLIIGAGPAGLTAANCFLGSRLNVRIIDKKNGIVE
                     AGKADGLKSISLEVLDSFGIGDGIRNEAHRVEEITLWNSDPAGGLSRACIIPDRIPEL
                     GKPREVSLHQGRIEHHMIENLRKRSTIEVEWRKQPVHMDIDLDQVDNPEAYPITVSVE
                     TSEDGSDPGLLWQPMHAERDSIRRPEIVKETIHAKYVLGCDGARSWIRQRLGVSFIGD
                     LTDSTWVPKTSFPDIRKVAVIHSSKGTVMSVPREDKLVRFYIQIDAVNPNAASGLARR
                     DLKVEDLLDAARAIMFPYTMEAAECAWWSAYRVGQRVANEFARHGRIFLAGDSVHTHS
                     PKAGQGMNTSIQDAYNIGWKLRACAEHHCGREILATYEGERKPVAEALINFDRDYLKH
                     FAKQHASNHAEFLDAYLKGQKFTTGIGIRYPPSLLISEDVDARSLHGGLVPGLRLPDF
                     QVVNQSDGVPIRIHQRLRADGKFRIVVFPGDVSQEHAMSRLNQFGAWLARSQLDVEVS
                     HSDGGSEEFFIETITVHAARRADVELEDFHEALHPWSSRWGWNYWNIYADDESYHDGH
                     GEAYQRCGLGRNHDCVVVVRPDGYISVVCELENTGAITSFFDALQPIKSVRPRL"
     exon            26017..26072
                     /number=1
     exon            26127..26407
                     /number=2
     exon            26490..26695
                     /number=3
     exon            26742..26871
                     /number=4
     exon            26946..27263
                     /number=5
     exon            27319..27369
                     /number=6
     exon            27465..28285
                     /number=7
     CDS             complement(join(28776..29424,29487..29673,29727..29875,
                     29915..30052,30071..30223,30277..30457,30510..30705))
                     /codon_start=1
                     /locus_tag="AO090001000011"
                     /note="H+/oligopeptide symporter"
                     /old_locus_tag="AO070336000284"
                     /protein_id="BAE56575.1"
                     /transl_table=1
                     /translation="MTAPAGSTEKSETSETTTLQTTEVSTVDVDPDLPRVLAKVPGTV
                     WVVAFIAAAERFTYWGITTPWQNYMQNPPGHQSLPGALGLGEAKASTIYNVFMFFSYL
                     TPIPFAIISDVYLGRYRTLRLSLIFYLIGCVILIATSVSSATEYRVTFGGLIAAMVLI
                     GLAVGGVRATVTPLMSDDTLLTILESVDQYAPTEVKVTTLPNGKQVVYDRGLTTQYIY
                     NAQYWYIRLVNIASLSAIPTTFIEKNVSFWAAYLLPSCFLAAGLVLLIIGQKRFRKLP
                     PTGNILPKAGSVLSCAIRGRFQLDAAMPSYQREHFAKEVSWDETFVNEIRRGLVACRV
                     ILGFILFFTCLSQASNNLISQAGQMKTYGIPNDTITAMNPIFCVIMGPVIQKGLYPLL
                     NKNNVKFQSITRMATGFIMMSASMAFAAGVQKIIYDTGPCYDRPLTCPGAENGRIPNQ
                     VNVFLQTPTYIILAVAEIFSFVTLSEYTYTKAPTDMKAVVQALGQLGAAAGSAIGIAI
                     TPLAHDPSLIWMYTGLAVAMFLVAVVFWILFKKYNAIDREDK"
     exon            complement(28776..29424)
                     /number=1
     exon            complement(29487..29673)
                     /number=2
     exon            complement(29727..29875)
                     /number=3
     exon            complement(29915..30052)
                     /number=4
     exon            complement(30071..30223)
                     /number=5
     exon            complement(30277..30457)
                     /number=6
     exon            complement(30510..30705)
                     /number=7
     CDS             join(31355..31552,31598..32509)
                     /codon_start=1
                     /locus_tag="AO090001000012"
                     /note="isopenicillin N synthase and related dioxygenases"
                     /old_locus_tag="AO070336000283"
                     /protein_id="BAE56576.1"
                     /transl_table=1
                     /translation="MLSDLPKIPTLDWADFAEGDTDQRLKLAQGLVQGFKRFGFVKLV
                     NHGLSDELIQQLFAEVSRHSLLVKRFYRLPDELKQKAAHPPGPNPQRGWSGIGVESTS
                     KLYGEQTERPSGKLKDAKVGTDFSSSKSSRELTHMKEHYDIGPPTDTQFPTRWPDEQD
                     IPGWRAFMESYYARGQSFCLDLMEALEIGLELPKNTLRSMCIPDGSELRLLHYPEIPA
                     AELRTGDTARIWPHTDFGLITLLFQDGVGGLEVEDPLQQGHYIEVAREQPYEMIVNVS
                     ATFERWMNGVIKAAVHRVNITPEGKHVEDAVVPERWSAAYFFKAHKMAHAGPLPAFVT
                     PERPALYDDITALEFQKRRTDLVYTGQQLKVEEAA"
     exon            31355..31552
                     /number=1
     exon            31598..32509
                     /number=2
     CDS             join(33046..33407,33464..34167,34262..34344)
                     /codon_start=1
                     /locus_tag="AO090001000013"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070336000282"
                     /protein_id="BAE56577.1"
                     /transl_table=1
                     /translation="MMTEAQGPVVSIGSATVTYDHPPIISPVSYPKARPTQILDIRKR
                     TSRIDLYHEILAGLRAKDKELPSLLLWNDRGLDLFSEILNSDEYYPRRRETQLLQTHV
                     NEFTRSISSGERLIELGAGNLQKTVSVLRCLEQSRKHVEYCALDVSHAALQASITELK
                     AQLPFASYVTIRGLLGTYNDCASWLKQSGATVRTTFLWLGNSIANFEPEDATSILADF
                     LQTKASPSHSPQMIIAVDGCQDVEQILEAYDMPNKLSQKFVFNGLSHANQILGSEVFR
                     PQHWTFEGKWNPVKSMHESFYVAKKPMSLDIGNERFHVHAGEKIRAITSGKWPKDKVT
                     SICQSAGIKVLKGWTDEEGSYAMKGAGWKVLLCAFAALDLRLRTKQVL"
     exon            33046..33407
                     /number=1
     exon            33464..34167
                     /number=2
     exon            34262..34344
                     /number=3
     CDS             34552..35250
                     /codon_start=1
                     /locus_tag="AO090001000014"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000281"
                     /protein_id="BAE56578.1"
                     /transl_table=1
                     /translation="MPHSHLYLNFENADSVKICCTIHLTTLSTSLHHCHQKPVVALLT
                     QSLQNNSINPVVLAYILDRPARSPHIDIILDIVFLHELSSSHHIIHDNTGPWATHLHS
                     IVKVIPPVIFIGVNEGETKTFLLSTFHLCLKNWKQVNGCADQNFNSVLIPCCSNILFR
                     NFCAFRIYFNADNPNVRIETRDVDCRVATQCTHFQGVLHTTKLALKGHELCLRGKGGD
                     VLESALGGVRERLV"
     exon            34552..35250
                     /number=1
     CDS             complement(join(35648..37035,37111..37159))
                     /codon_start=1
                     /locus_tag="AO090001000015"
                     /note="FAD-dependent oxidoreductase"
                     /old_locus_tag="AO070336000280"
                     /protein_id="BAE56579.1"
                     /transl_table=1
                     /translation="MPAPKSIIIVGSGVFGLSTAHAMSQNNEFASSKITLIDSWNFEP
                     SGPSASAPNPSAANFDTSRIIRSDYSHRIYATLAREAQQKWKAEWGADGRYRNQSIVM
                     IGEGHSMKQPMKALESINYVKHAYAQSYERAGRNSDIVHILDSESAVWEALGLGTPDE
                     ASKAGPNASELRGYRNHNCGWAESGATMAWLRQKTIHSDRIDIHIGQVVGLRVCSDSP
                     SESHVNAEPRVCGVILDDGSQLTADLTVLAAGAMTPRLLGSPTLCDVYSETVAYVQLT
                     EMERRELVRREFPLIVNVARKIFAIGPDNQGFLKLARFSWSGYRDVQKFAGVDVGPRS
                     QAAPQGEDGYGACGDLDQTKLSPDVESTLQDYRGFLRELFRSRDGGDLGCLRNIATRP
                     FAQVRRCWYADTVSTDFIVDYHPAYGKSLFIATGGSDHAFKFLPVLGERICELILQSY
                     NGKAGPSESIQELQRLWKFPGGDSHAKL"
     exon            complement(35648..37035)
                     /number=1
     exon            complement(37111..37159)
                     /number=2
     CDS             join(37603..37882,37930..38296,38353..39319)
                     /codon_start=1
                     /locus_tag="AO090001000016"
                     /note="H+/oligopeptide symporter"
                     /old_locus_tag="AO070336000279"
                     /protein_id="BAE56580.1"
                     /transl_table=1
                     /translation="MSSGEPTTMTPSPSERTPLLSNGSGGAADDGGTTVTISKHNDGV
                     RRIADSLPLSVWLISTIELCERFAYFGTIAPMQNYIQNPRNDPLRPGGIGLGQASATM
                     VNQAFMLWCYITPVLGAVVAEQYIGRVKTIIYSSSVYLCGLVTLFLSSLPTAYAMGIS
                     LPGLLVSLFLIGIGTGGIKTNVSSLIAEQYTGPKESRRILKSGEEVIVDRDLTIQRIF
                     TTFFLYINIGSFSPLLITIIEKEYGFSAAFSLSAITFSIGFIIVLVSRHLYISRDPDS
                     SIIFNACKAFWIAIKHKGNLDYARPSYQTEQAATRRLSWDDSFIDDLRRAIASCKIFI
                     LYPIYWAAYSQFLTNFISQAATMETHGVPNDIMTNIDPITVLILLPVLDRIVFPFLRR
                     QGVPVRHVDRITIGFLVCGISMLYAAFVQRTIYAAPPCYDHPRAPDCMGGQVPNRVSV
                     FLQSPAYVLVAISEILASVAGVEYAYTQAPKSMKSLIMAVYLSAVSAGALIAITVSPL
                     TVDPKLPWMYFTLGVENFLAGAFLWIFPA"
     exon            37603..37882
                     /number=1
     exon            37930..38296
                     /number=2
     exon            38353..39319
                     /number=3
     CDS             join(40029..40190,40261..40410,40544..41188)
                     /codon_start=1
                     /locus_tag="AO090001000017"
                     /note="iron/ascorbate family oxidoreductases"
                     /old_locus_tag="AO080501000016"
                     /protein_id="BAE56581.1"
                     /transl_table=1
                     /translation="MTLRTVDFSGFLHGTEEQRRQVAAELVDCLKSLGFVRLINHEVP
                     EKTIEGLLEQSKRFFTLPTSEKVKIANDPGPHPQRGWSRIGMEQTAKLREENLAEAAG
                     REQYPNKWPESMPDFQPFVQESYQICQRTCFQIISAIELGLGLQAGRLTQCCQPAASE
                     IRLLYYPPTTKNLFDEGLKKRAWPHTDLGIITLLFQDMVGGLEVEDRAAGKPRSFIPV
                     KRVSPNEMIVNTSDSLQRWTNNVIRAGLHQVTAPDAAKLSNGVDMLPARCSSVFFFKA
                     GRDTSVGPLPEFVTEDRPAAFEDMTALQYQQLKTRILHGVEG"
     exon            40029..40190
                     /number=1
     exon            40261..40410
                     /number=2
     exon            40544..41188
                     /number=3
     CDS             complement(41615..43270)
                     /codon_start=1
                     /locus_tag="AO090001000018"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000277"
                     /protein_id="BAE56582.1"
                     /transl_table=1
                     /translation="MEPDTTRRSACDRCRGQKLRCVRLPGPAREDSPRSARSVNQPCE
                     RCKRAKVVCYTTKPVSRRLPQSYTRRRSTAYADDVMHSELDLDEGMIGSNRLRDEPTI
                     KRTPPAIADRLAHDPFPTELWSGLDISHASLDSSAVLSHVPDPGNMVESAAAQRANSN
                     TLPSHQHGWPEDPHGALNYFEERAHDLPDVMSVSSPTDVRLGLDTVDRRPAAATSRTN
                     QAIHSDTVNMHSQAPGSGETSERGLYSRASNTVADAAQLCTTQLSELNMRLMKDIEST
                     TSFRQGMSAASDPNYPASGLGETSPSSSMVKFTNTMLANCQSFLDILQRLRSPTVELR
                     GSSNSECSYGDLEYSSNEYSCSRSQSRNHSTSASSRSKDGRISAGGGLQSVLNSDTIG
                     LSPSLDPIKADSSALDFSAFLSILSCYTHILRAYDALFTEILEMLMESSCIQLDLKIH
                     NLVPEVSLGGFRLSGHGDLQIKCLLHMSFIILEKIESMLGVNAPEKDPYGSNGGLLNN
                     SQLRGLLEALYHQKEFDYIRADGTRAARVKKTMKSIQRILDSI"
     exon            complement(41615..43270)
                     /number=1
     CDS             complement(45356..46156)
                     /codon_start=1
                     /locus_tag="AO090001000019"
                     /note="predicted hydrolase (HAD superfamily)"
                     /old_locus_tag="AO070336000276"
                     /protein_id="BAE56583.1"
                     /transl_table=1
                     /translation="MSRDGFPSMIFFDVLGTIVEWRSCIGNELNATARKALQDQDRHL
                     SADVRARVSDMSTSSWQEIAEEWHRSYMNFGDTYDSSKPFISVDEYNRLSLEKILIKQ
                     RLRDLFNDDDLKHMTLAWHRLDSYSDSVPGLSLLNTKFETSTLSNGNVKLLEDLQEHN
                     SLPFKHITSAEHFGAYKPSPEVYHGAARRFGFRSSQCCLVAAHLEDLQAAKKCGFQTV
                     YLERHLEEAWDSREIARAKEEGFVDLWVEVGGSGLIEVARHFGIEPEF"
     exon            complement(45356..46156)
                     /number=1
     CDS             join(48190..48485,48531..48824,48870..48894,48951..49123,
                     49169..49612,49658..49973)
                     /codon_start=1
                     /locus_tag="AO090001000020"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070336000275"
                     /protein_id="BAE56584.1"
                     /transl_table=1
                     /translation="MRRLTSGNAMHSYKTTVNPLDRVLPPIQALNMTKPEAQAEYHEH
                     VQKVEQSEQDVIYQTYASQSPEWHRKMTKQLLRKVDFHLLPCLIVMYLLNFLDRNSNL
                     SQARLGTLEKDLKMKGTDYNLATSILFVGYLLMQLPSNLLLTRVRPSLFLGITMAIWG
                     VISACQAATQSFTGLVLSRFFLGFVEAPFFPGAIMLMSSWYTRQELSHRIAWFYAGSS
                     LANAFGGLIGAGVLGNLDGAHGISGWRWLFIIEGCITVGISLMSILLLPNYPATTSWL
                     DETEKLYAQWRLIQDAGEADEARSNSLREALWLVFSDKRIYLFILLQHSSLLSQNFQY
                     FFPTIVQTLGYGNIETLLITAPVWIATFMVSLLVTWSSGRTNDRSLHIISLMLVSVVG
                     CVICTATTNIGARFFGMFLMPMGAVSAYQIIIAWVANSFPRPLVKRSAAIATANMIGN
                     TASIYGSYMWPSSSGPRYIAGGGATAAIAFLVAILALVIRMVHSQMNKRLDLAQESSQ
                     SGIRYIL"
     exon            48190..48485
                     /number=1
     exon            48531..48824
                     /number=2
     exon            48870..48894
                     /number=3
     exon            48951..49123
                     /number=4
     exon            49169..49612
                     /number=5
     exon            49658..49973
                     /number=6
     CDS             complement(join(50816..51502,51589..51779,51835..51950,
                     52018..52547,52637..52806,52900..53642,53711..53871,
                     53931..54210,54294..54950,55014..55417))
                     /codon_start=1
                     /locus_tag="AO090001000021"
                     /note="multidrug/pheromone exporter, ABC superfamily"
                     /old_locus_tag="AO070336000274"
                     /protein_id="BAE56585.1"
                     /transl_table=1
                     /translation="MIVRINQREAEGAVGVGNDTEILIEPEKEDVPAGKKGGTNGFLV
                     SLAGKVMTEYLMVRVVADELGRSTLQRVLTFGETKLYVLEGIAFIAAITSGVAVAMVN
                     LVMGNFLTLLSDFSFSDARSMPENLMSAVRTSALYFIYIGIVRLMATYIYASLFTYVA
                     YHLTRNVRQSYLRAALSQEIAYYDRGATGSISQQATTNGKLIQSGIAEKLGIAIQATA
                     TFVAAFIVAFVTQWKLTLILIFIVPTLLIVVGMVGGIDATIETKILQIYAHASSYAES
                     VFGGVRTIQAFSLQPRVLAKYDSYLQHAYTQGMRKNKLYGMVFGGQYFVVYAGMGLAF
                     WQGIAMFDRGEIPDLGTVFTVLFSVIMAANTVTQIAPHMVTFSRAATAASELFALIDR
                     QSEINPFDELGYQPDKTTGFIDLYGVRFSYPTRQDVSVLEDFTLNIPAGKVTALVGPS
                     GSGKSTVIGLLERWYNPQAGSICLDGKDIGQLNLKWLRTNIRLVQQARHLNVFETIAN
                     GLVGTQWEAASQEEQMQRVQVAAKLAFAHEFIQTLPQGYHTRIGERGGLLSGGQKQRI
                     AIARSVISEPKVLLLDEATSALDPYAEGIVQKALENASKNRTTIVIAHKLATIRNADN
                     IVVMSKGKIIEQGRHEELVSRNGIYATLVKAQDLAPANIENEDRLESSKTSDRISEKE
                     NYHVGRIQSLARMRTPKTQQLAALSNPEDHDLYDKTDIIRNIWKLLRGTRDIWLWFAV
                     TIATCIGGAVINPGQALLLGNIMSVFTSSNVVTRGNFISLMFFVMSLGILVIYFVMGW
                     STNTIAHRLSRKMRREILESFLRQDLRFFDRPENTVGALISRLDSYPQAILELMGFTV
                     AIVFMSVLNILVSSILAIVVSWKLGLVGVLVGLPPMMLGGYVRVRIEADMDDKMDKRL
                     SASASVASETITAIRTVSSLALESTVLRKYVYELDLAIYQMRRPMFHMMIWFSLTQSV
                     EYFVLALGFWWGSKLINDEEISLYQFIVSFMGVYFSGQATALAFSFASSLTKANQASN
                     YYFWLDSLHGTIRETGGKREEGPKHGCRSYDFHDVHFSYPLAPDHRVLKGVSLSIQRG
                     DFVAFVGASGCGKSTMISLLERFYDPVSGAITIDTSAPLSSINPLLYRKHVALVQQEP
                     TLFPGTIRENISQGLPDLGVTEAASDEALEEACRAANVWDFILSLPEGLDTPCGTSGS
                     QLSGGQRQRIAIARALVRKPNVVLLDEATSALDTESEKLVQGALVGAASSRDRITIAV
                     AHRLSTVRDAKCIFVFYAGKIVEAGTHSELVARGGMYAKMCEAQKLEGAA"
     exon            complement(50816..51502)
                     /number=1
     exon            complement(51589..51779)
                     /number=2
     exon            complement(51835..51950)
                     /number=3
     exon            complement(52018..52547)
                     /number=4
     exon            complement(52637..52806)
                     /number=5
     exon            complement(52900..53642)
                     /number=6
     exon            complement(53711..53871)
                     /number=7
     exon            complement(53931..54210)
                     /number=8
     exon            complement(54294..54950)
                     /number=9
     exon            complement(55014..55417)
                     /number=10
     CDS             join(56288..56337,56415..57184,57271..57290)
                     /codon_start=1
                     /locus_tag="AO090001000022"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000273"
                     /protein_id="BAE56586.1"
                     /transl_table=1
                     /translation="MPNWTKYPTKSTSSARGQEESCSPPLFGPTPSTPSLSSTPHQGT
                     LPYNPTSAGVHEVHDSSSEAEYEGESLLFAHAVFASRFLQNAIDSTTNPELAQEMQAA
                     LDGLKTAVHSGNQQSHTLGTLYPHAKAIPSGSTTRNLPLPSMDKVFMCLRMARECPQV
                     ATLWLGDYIRPSQFNDYFIKIASPGSATEADMIIVHCGLYWLFCECSKAVPDEDTKRD
                     YDAQAFLCAANLETVLANLRFHQPTDLDFAYAMGMAVSTLLASCKTPSKGSIPTDRSW
                     LAT"
     exon            56288..56337
                     /number=1
     exon            56415..57184
                     /number=2
     exon            57271..57290
                     /number=3
     CDS             join(57665..57975,58037..58595)
                     /codon_start=1
                     /locus_tag="AO090001000023"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000272"
                     /protein_id="BAE56587.1"
                     /transl_table=1
                     /translation="MELSRSLLEATLTADCPQNQYGANKGHVLGLDFHEIARRSDRVI
                     GLSMLTLIYRSIPPEKPSMSAFCQECIDAARDTLREHDLCVALITRARGKTVFLEAYI
                     NWTITQSPFIPFIILFCHIIETSEAADLQHMKGLVETLESASNSRVHSTCSKQRRLFR
                     ALYDVAAQYVEIRSRANGGRGGMSWSVTRQQYADAFASATSNGLGFSTLGSGETVGAL
                     GTMNPADASGPMASHDKANGDRVGLVDGLVEPMELQNTAFGDIDIEMDYSGAQLWDWF
                     NKNQAFMRMLEDT"
     exon            57665..57975
                     /number=1
     exon            58037..58595
                     /number=2
     CDS             complement(join(59595..60019,60074..60610,60673..61098,
                     61152..61191,61251..61472))
                     /codon_start=1
                     /locus_tag="AO090001000024"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000271"
                     /protein_id="BAE56588.1"
                     /transl_table=1
                     /translation="MSIPNRCTVLVVGGGPAGSYAAAALAREGVDTVLLEADVFPRYH
                     IGESMLPSIRHFLRFIDLDSKFDSYGFVNKNGAAFKLNSKPEAYTDFIAAGGPGSHAW
                     NVVRSEADHLMFKHAGENGAQVFDGVKVNSIEFEQIDGLTVDPSLSELGRPVSATWSC
                     KATGGKGSITFEYLIDATGRAGLVSTKYMKNRRYNQGLKNVASWGYWSNAGSYGVGTP
                     REGDPYFEAIEDGSGWVWLIPLHNGTTSIGVVMNQEAATAKKRETGATTKDLYLNTIK
                     NTPGVWQLLDKAELQSDLKSASDWSYNASSYASPYLRIVGDAGCFIDPFFSSGVHLAL
                     ASGLSAALTIRAAQRGDCDEQAAVSWHSKKVAEGYTRFLLVVMSALKQISDREKPVLT
                     DFDEDSFNRAFDFFRPIIQGTADVDKNLTQAEIAQTIEFCVQAFQTASTDEQDAVMTK
                     VAAINSQNGTEGALRELHASLSADERRTLTTIQARQIIRSEDQMNIDNFTIDVIDGMV
                     PRLERSSLGLARFVPKAQTSREDGLRATLGLPEKQKSIFSY"
     exon            complement(59595..60019)
                     /number=1
     exon            complement(60074..60610)
                     /number=2
     exon            complement(60673..61098)
                     /number=3
     exon            complement(61152..61191)
                     /number=4
     exon            complement(61251..61472)
                     /number=5
     CDS             complement(join(61728..61977,62033..62135,62146..62237,
                     62298..62392))
                     /codon_start=1
                     /locus_tag="AO090001000025"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000270"
                     /protein_id="BAE56589.1"
                     /transl_table=1
                     /translation="MQRPLDSSRVVELAEMRQLLEGVAKIEPDRDCERESLCTVTIPT
                     PRWKHSAGWCLRLGTIYDDDSLWTDPTSFDGYRFEKLRTIKGNELKFQYASTSTSELN
                     WGYGTHACPGRHYASNQIKLMIVSLLSRYEFQFDHEQTDKKAIVERPPNVVDGVRIMP
                     NPQTLVMVRSLGNVNEGCE"
     exon            complement(61728..61977)
                     /number=1
     exon            complement(62033..62135)
                     /number=2
     exon            complement(62146..62237)
                     /number=3
     exon            complement(62298..62392)
                     /number=4
     CDS             complement(join(62523..62849,62904..62975))
                     /codon_start=1
                     /locus_tag="AO090001000026"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000269"
                     /protein_id="BAE56590.1"
                     /transl_table=1
                     /translation="MVKLVSLHISRSFIQSPLSRNQEWIDLTLDYAISTVTVAGKMSN
                     THWALRPFKGHFLPETADMSRQFTRARELLRPTLEARLQQRDKVPNDLMQWIINNYPD
                     QEDDLTLHTRLQLEAVQAATYNLAFQVRVT"
     exon            complement(62523..62849)
                     /number=1
     exon            complement(62904..62975)
                     /number=2
     CDS             join(63753..63791,63849..64080,64138..64230,64293..64727,
                     64777..64890,64962..65361,65413..65572)
                     /codon_start=1
                     /locus_tag="AO090001000028"
                     /note="cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies"
                     /old_locus_tag="AO070336000267"
                     /protein_id="BAE56591.1"
                     /transl_table=1
                     /translation="MLFSLGPLTIVYGLVIFVVAKTIYNLYLHPLRSYPGPLLARATR
                     WYYSYYVKIGLLPQKTKELHDQYGPCVRIAPDELSYNTAEAWEDICGHRTGQRTESFE
                     KDLTFFPPAPNGVDSIVRIDDVHRRFRRLLSHPMSDKALGSQQEIITGYVDQLIHELR
                     QRSERSEVVDMVRWFNFTSFDILGDLAFGESFGCLGSGLMHPWIELIFTSIKSVMDMQ
                     IIRRIPGLFSLILTIAGLQQKQDLQEQFMFCQKKARERYTKETTRPDFMTYILRATEE
                     KGMTPEEIEANAQILIMAGSETTASALSGTLFYLLKNSMAMQKLRQEIHATFQAEAEI
                     TMRSTQSMEYLHAVLQEAMRVYPPVPCTFPRTTPPGGAMVCGRFVPGGYIVGVNQLAA
                     MTSEKNFKDPLKFIPERWCGDERYQEDSRKAYQPFSYGPRNCLGKNLAYAEMRLVLTR
                     LLWNFEFDLLEESKDWHAKQKVWMMWDKGDLKVRLKPLRH"
     exon            63753..63791
                     /number=1
     exon            63849..64080
                     /number=2
     exon            64138..64230
                     /number=3
     exon            64293..64727
                     /number=4
     exon            64777..64890
                     /number=5
     exon            64962..65361
                     /number=6
     exon            65413..65572
                     /number=7
     CDS             complement(join(65676..66953,67008..67066,67129..67216))
                     /codon_start=1
                     /locus_tag="AO090001000029"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000266"
                     /protein_id="BAE56592.1"
                     /transl_table=1
                     /translation="MSFIPVEHIACSTAKLPSSRCPLLLLQPNGSSTKPVRWRSACNQ
                     CHAAKVRCSGERTGCDRCNNLQYQCVYAISRVGKVPGVRARGNKAVRTTTEALQRPAT
                     ASTLPDADSTGEFQTDQRSENDPLSRSDFGEQDAAHDALSPKSHSALFPDWTEASDKS
                     LNAYETADLFILPSQLMSSDQDPSRSRGHSLQAPSHSGHSIADSHTAAMPDGGLFCPF
                     NKPTTPIPALPDLDLHIQDFHPMDVPVSPLDNGPPVKRRPYSDASCGHSGHSSKGYMS
                     STFPYSELLSQIGCQTDCGRQPHHYNYRSWTVLICNRIVEFLEHRIQGGVVALDVVMQ
                     TNKVTLGEISRILSKGAHKEGSNCAMLLLIAIDQIVTLFECGVKQGSPGDSDRASIGG
                     RDLSALGDDLTGGNVLPNLRFGLFQINQDEQLALRSYLLQRELQRCLQVLTNLRDAIP
                     LEPNPCTALEARVKKLCSAIADSH"
     exon            complement(65676..66953)
                     /number=1
     exon            complement(67008..67066)
                     /number=2
     exon            complement(67129..67216)
                     /number=3
     CDS             complement(join(68462..68803,68881..69360))
                     /codon_start=1
                     /locus_tag="AO090001000030"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000265"
                     /protein_id="BAE56593.1"
                     /transl_table=1
                     /translation="MASSLELPKFEPDRDRLVWYLAYGSNLSSQTFREDRQITPQAAV
                     TITVPGWRLTLSSAGFPYREPSFASIVNVGSAGPTDEKHDGPCELPLHGTAYLITWSQ
                     WIKIVASEGGGIVYKEALLRGQPIQPQDQQRWGAELSVLTLVSTMERWPEPRPSQRYM
                     GLILDGARAADFPASYIAQIRHKHPCYQPPSTTWERIGATLFLGFWTPVLTLLSLLTH
                     AAARAGPGDDGHVPEGVRALVRFAMFTMWWVHDLIWSRIWGRGDGLFPGAMQLNG"
     exon            complement(68462..68803)
                     /number=1
     exon            complement(68881..69360)
                     /number=2
     CDS             69827..71482
                     /codon_start=1
                     /locus_tag="AO090001000031"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070336000264"
                     /protein_id="BAE56594.1"
                     /transl_table=1
                     /translation="MDQPSPSAEDSQPERQSTGTRGTRFWAVFVSLCFASFVASLDIT
                     AITTALPTVTRELDGGENYVWIANSYTLASAVVQPLIGQISNIVGRRNPMIILMCLFA
                     LGSGICGGATSTGMMIAGRTVQGLGAGGILLLLEVIVCDLVPLRERAQYVGIALSTCA
                     LGISLGPLVGGALVQHATWRWVFYINLPCAGVALVALVLCLNVQHKREVSWGRALARV
                     DWVGNTIFIAAICAIMYALVIGGSVHPWSSYQVLVPLVLGAFGWVLFHIFEASPYCLE
                     PTMPPRLFRNRTSMTAYVLAFLAAMLMQWVVYFLTLFFQTVKGQSTTMSGVDVIPFTG
                     FMIPSAIVGGAIMSKTGVYRPLHWAGFALLSICMGVFSTWDAGTPRAEWVILQCLVGL
                     GHGLLLTSVLPAIQAALPESDNAAATSAYAFLRSFGFVWGVEIPAVVFNGQVDRFISR
                     VHDATVRNKLAHGGAYSLAGTSFLSQLGDEADAVRSTYTDSLRTVWQVGMAFALLGFA
                     LVVVEKHIELRTTLETDFGLEGSENRAATSVEGVETGPVSKAQ"
     exon            69827..71482
                     /number=1
     CDS             complement(join(72083..72266,72322..72464,72522..73022,
                     73080..73422,73480..74052,74103..74494,74544..74624,
                     74680..74877))
                     /codon_start=1
                     /locus_tag="AO090001000032"
                     /note="heavy metal exporter HMT1, ABC superfamily"
                     /old_locus_tag="AO070336000263"
                     /protein_id="BAE56595.1"
                     /transl_table=1
                     /translation="MQLAVLTLALCWAYPVTIYISYLLSRLGIALYRKHKDSTTGAWY
                     EKHRKAAFTAIFWLQLVQCFDLAISITITGYAMNISPQVEAWWVDKEFLASNIAVFMF
                     LAAGLLPDPDVPFSPSLSHSHAWIAGIIMEALQLAMFCNQQSPVSVLSRVEYLQLGLV
                     MVRLVLFVAMVALYFQPMYAWSRIQLDETEPLLGEVDSKPVRDAQHGGWLDYVVGFST
                     LFPFLWPSDSRRLQLRAIFCFVLLVIQRVVNILVPHQLGIVVAHLGSGTIPYQKIAIY
                     IALRALQGQQGVIGSIRALLWIPVSQSTYRRLTSSAFEHVLSLSLEFHLGKRIGEVMS
                     ALSKGSALNTFLDGLVFQLFPMVADLWIAALYFLIQFDAFYSLIVITVTWLYLFVTIY
                     MAKYRGRARREMVNREREMEAAKTDALMSYETVHHNSAVPHEINRFNRLVQAFQKAEY
                     FVFFSLNLLNATQNLLFTAGVAIVCLLCAYQISADMQQVAMFVTLLTYLAQLQAPLNF
                     FGSFYTQVQNNLVDAERMLALFKEKPLVQDRDGAIDLNTCAGRVEFTHVNFAYDERRP
                     ALQDVSFTVEPGTSTAIVGESGSGKSTILKLLFRFYDVAAGSVRFDGVDARDMTIASL
                     RSHLGVVPQDTILFNDTLLYNLLYARPQATMEEVYAACRAASIHDRIMSFPDGYETKV
                     GERGLRLSGGEKQRIAIARTFLRSPQILLLDEATASLDSQTERQIQGALDNIAKGRTT
                     ITIAHRLSTITKANQIIVLHQGRIVEKGTHEELLAANGMYSQMWAKQTKAKEKKDSNA
                     TLVEVA"
     exon            complement(72083..72266)
                     /number=1
     exon            complement(72322..72464)
                     /number=2
     exon            complement(72522..73022)
                     /number=3
     exon            complement(73080..73422)
                     /number=4
     exon            complement(73480..74052)
                     /number=5
     exon            complement(74103..74494)
                     /number=6
     exon            complement(74544..74624)
                     /number=7
     exon            complement(74680..74877)
                     /number=8
     CDS             join(75116..75316,75372..75576,75634..76046,76104..76547)
                     /codon_start=1
                     /locus_tag="AO090001000033"
                     /note="1-aminocyclopropane-1-carboxylate synthase, and
                     related proteins"
                     /old_locus_tag="AO070336000262"
                     /protein_id="BAE56596.1"
                     /transl_table=1
                     /translation="MASAGAGLSKRGASNVDAIMPGIRAALLERTRPTVPRIDLSTAE
                     NWLLRNEVIELTKDAIRDGLKPHHLSYPNEFAGDADLIKALAAFVNEYFHPHIPVEPD
                     HIATAPGAATCLNTFLYNLCEPGEGILVPAPFWNGFDWLFTARSSAVPVMVHVERSAD
                     TLTAKLIPALEKAYEESKIPIRGLLLTNPQNPYGQCYPRSVMEDCIRFCHSKGIHYIS
                     DEVYALSNFENPELPDAPPFVSALQIDVKGIGCDLSRVHTFWSTSKDFGSSGFRVGCS
                     ITQANEAMHVALALASNTESSSLSAVASTALLTSPRLPELLQLNAQRLQEAYCLMTNF
                     LKKHQIEYIPANSAPFLFARVAPQAQTWEDEKAVIAQLKEAGVNVSGGKAYHVNEDQK
                     GWARLTFALETSRAEEAIKRMETVLGKQ"
     exon            75116..75316
                     /number=1
     exon            75372..75576
                     /number=2
     exon            75634..76046
                     /number=3
     exon            76104..76547
                     /number=4
     CDS             76702..77472
                     /codon_start=1
                     /locus_tag="AO090001000034"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000261"
                     /protein_id="BAE56597.1"
                     /transl_table=1
                     /translation="MSSTAFTSSLSNWDLYPTNGSITPHLLLVGAQILFLSGPHFHGR
                     RTLAATTILSLAAIAQYNRFTNNPGVANLFALAWPHWLSAVEKIVFASPEGPEADLWR
                     VDRVPREAMSWPVFGWRKVKWAVTLLLNLRGIRWSFQVKNVPKMPERMTRGQFLRWRL
                     GELVWVLLMTDLVSQMMLRFFFTDAAGALGNLDSKYITIRDARWGWSLLKALTFGLGP
                     YFFINMQYLVVSILAVAMGISRPEVGSCPPRRSNRQPC"
     exon            76702..77472
                     /number=1
     CDS             complement(join(78250..78460,78512..78716,78789..79397,
                     79467..79535,79586..79673,79733..79867,81077..81343))
                     /codon_start=1
                     /locus_tag="AO090001000035"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000260"
                     /protein_id="BAE56598.1"
                     /transl_table=1
                     /translation="MASESSIPLYDCLIIGGGIAGLSSALSLVRTLHTAVVFDEGIHR
                     NDQAPHLATVPTWDSQDPKRFRDAAKLNILSKYSTVEFANVKLEKFNKALGKPFLTKV
                     FGHDYVVLPSKYFDDIKRASPQSLSFFQALSDGLNMEASVGHLYASTTEIDVVVKHLN
                     PRLTQLTPLLCDEAEYAIEREVGALPDWKKFNVSNLIAAIVHRTTNRILVGKELCRNE
                     EYLAITTKFSRSLFISGIFWNFVRLGPLRKLVAWLTIGLHLRDRNAAAKVLLPHVLAR
                     RQEKEAGVDVATKYPDALQWTIDTAPSFPGDDEPLHQVYHMLHLTFAASSASGVGVTQ
                     CLLNVLAYPEYLEPLRDEISTVVARHGGWTDKALSQMALLDSFIRETMRLHPAGSFMD
                     DHFRFHDGLTLPKGTNIIAPALAIHYDPDNYEDAHRFDGFRFARYRQKQGENHRWLAS
                     TIDQKFLQFGYGNHACPGRFYAIRKIKLVLAKLIMDYDFKWAQPRPVHDRPEDFAIEA
                     QLVAAPDAEILIRSRNLSN"
     exon            complement(78250..78460)
                     /number=1
     exon            complement(78512..78716)
                     /number=2
     exon            complement(78789..79397)
                     /number=3
     exon            complement(79467..79535)
                     /number=4
     exon            complement(79586..79673)
                     /number=5
     exon            complement(79733..79867)
                     /number=6
     exon            complement(81077..81343)
                     /number=7
     CDS             join(81752..82035,82150..82236,82289..82530,82586..82689)
                     /codon_start=1
                     /locus_tag="AO090001000036"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000259"
                     /protein_id="BAE56599.1"
                     /transl_table=1
                     /translation="MSRSTMLAHSAIPSSLIRMDLLSPWILTATAPKFLRLFAPATRR
                     RSARSTIPSWSRSSSGKQAHHAWLSSITPCDGARSPWLARIPMAASSLQAQSPLGARR
                     RVYQHLPEEADRLLKGRAQIVNVWRPLRGPVQDWPLAVMDCSTLAQAHIHPTKLYRNR
                     FELRGETVSISHDESQRWYYLDGQQTDECTLIKIWDSKEGISGHMCAHCAFQHPNTPV
                     DAPLRESVEVRCLVFYENQE"
     exon            81752..82035
                     /number=1
     exon            82150..82236
                     /number=2
     exon            82289..82530
                     /number=3
     exon            82586..82689
                     /number=4
     CDS             complement(join(83116..83662,83716..84113))
                     /codon_start=1
                     /locus_tag="AO090001000037"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000258"
                     /protein_id="BAE56600.1"
                     /transl_table=1
                     /translation="MAAPLFDCLIVGGGPAGLAAALGLCRAIRTAVVFDSKSYRNPTE
                     HMHNVSTWDHANPHDYRLAARKELTEGRYNTVTLADVALRKIWKLDSGEFEATDAVGK
                     VWKGRKLILATGVKDEIPELPGYADCWPKSIYHCLFCHGFEERGAPSVGVLAIGPVAN
                     PKPAEHLSRLAHNLAKTVTIYTNGNEELAAQLRPSIEKDQWLTLDNRVIKQLHKTDGI
                     PVRVELDDGTTKEEGFLVHAMKTTPRLDFEHNLNLELSAQGTEFVASPPFSETTTPGC
                     FATGDCGMAIKAASMSMSNGSLAAVGVVSQLAFDEKAK"
     exon            complement(83116..83662)
                     /number=1
     exon            complement(83716..84113)
                     /number=2
     CDS             complement(join(85077..85650,85704..86134))
                     /codon_start=1
                     /locus_tag="AO090001000038"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000257"
                     /protein_id="BAE56601.1"
                     /transl_table=1
                     /translation="MCDSSQSTADVLIIGGGPAGSNAAWELGQAHHRVILFNASIDRL
                     RDPDVNTASTRPALDLLLHSRRKTPDVFRPFRQEIGKESSEVSVHNQRITQVQRLPNG
                     FFQAEDDVGHVWTAKVLVLADGAEEILPDIDGYDTCWEQQRILTHPAEDEPRSLISSC
                     LAVLAVGDLAELTMALHTVWQARQFAASVRVYTHGDEDLARALETRISPDARIAIQTT
                     PIQSLQPGSDSPSQVVVHLADGSSIVESHVYHRPASQLQGPFARQLNLELTESGAIRI
                     SARVPYMTSLDGVYAGGDCASLGQRTLFKALAMGQGLAAAVAARLERGNWGNAVEEQD
                     "
     exon            complement(85077..85650)
                     /number=1
     exon            complement(85704..86134)
                     /number=2
     CDS             join(86398..86650,86706..87754)
                     /codon_start=1
                     /locus_tag="AO090001000039"
                     /note="predicted protein"
                     /old_locus_tag="AO080501000038"
                     /protein_id="BAE56602.1"
                     /transl_table=1
                     /translation="MDAPLTDAERTALQTSLEALNRQVEATRNILRSNSQKALLQTLH
                     TDQELPDPALEALAGKTINLLHETQQLLEPGHLVLADHFLGYVSTKCLCAAVELKLVD
                     ILADADEAGMTVDELADASGAHPDRLQQVLRVLRNDNIFDYDAVSHRYRNNRVSALLH
                     SEHWTQWHNWVDLYGNEFYDIARGIPRSIRREEARWAAQINFDTNDDMFTYFQAQGWL
                     PRLHRTLGGGAIAQAPGIVADYPWHEIGSRTVLDVGGGGGGFLASLLREYPQMRGGIL
                     DLPRTIEHACTLFHEPQGPYFDLRERVPRENLIAGDFLKAVPAFEIYTMKWVLHDWKD
                     PDVLTILRCIRASLIPGPDSRLVILESNLSDGQMGRLSRYGDINMMMTANGQERSEEQ
                     WRALAAASGWEVSRIYPMRRAWVCAIDLRPSASESGDRKHS"
     exon            86398..86650
                     /number=1
     exon            86706..87754
                     /number=2
     CDS             join(87949..87988,88038..88344,88404..88487,88568..88802)
                     /codon_start=1
                     /locus_tag="AO090001000040"
                     /note="predicted protein"
                     /old_locus_tag="AO080501000039"
                     /protein_id="BAE56603.1"
                     /transl_table=1
                     /translation="MEYDGRVILYIIKADETSYINYIKPLILAEEIQFPHVLSVIDTR
                     DEWFYSIHPERMVPSLKDQDPVTGEKVIVFESTACLQYLVDRFDTDGTWSGRTVAEKG
                     AVLSWTAYQTAALGPTAKYWLYFKRGYPTRANPVQLPRTIEKQWDILEKRLKEPGQQY
                     IALKDRPTLADLSYFPFAMPWMFTFLGVDIKDWPHIQRWSERMLSRPAVARVLQRAPT
                     LGH"
     exon            87949..87988
                     /number=1
     exon            88038..88344
                     /number=2
     exon            88404..88487
                     /number=3
     exon            88568..88802
                     /number=4
     CDS             complement(join(88933..90148,90199..90390,90667..90719))
                     /codon_start=1
                     /locus_tag="AO090001000041"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000255"
                     /protein_id="BAE56604.1"
                     /transl_table=1
                     /translation="MLPMAILPNGDRWCHGCRQRYLRSRFPIFSVDGSRTLPTCPYKW
                     PNGQGDVAKFLQGIENRDLWEKEHGQIYRIWSGMKSEVVLTQPSHLQAVFRDSNKHSK
                     AENNNSGYLMSELLGQCVGLVSRERWRTLRAVTEIPFQHDKMPSYLELIQRHTRHHFD
                     RLLASGDLRQERIHPAQDLKMLPFWVVAEIFYGECDAEMKTELQQLCVLREDLFKRMI
                     QGGIVRWQWSKYLPTATNRALAEFQRRWRAFNQRAYDRACQQQRILPIVLMIEAAREG
                     STSVEQIYQTIDEALFANLDVTTGGISWNLVFFAAHSDIQERVRQEVLSATDHDAYLL
                     SSSTLLAACISESARLKPLAAFTVPQSAPTDRIIGGYNIPAGTNLVVDTYALNIRNGF
                     WGADSQCYRPDRFLEHRATELRYQYWRFGFGPRQCMGRYVADLVIRTLLAHLVAHYEL
                     GWVEPDPGKNSTWQRDLESWITIPDLQLRCVQRRND"
     exon            complement(88933..90148)
                     /number=1
     exon            complement(90199..90390)
                     /number=2
     exon            complement(90667..90719)
                     /number=3
     CDS             join(90812..91034,91086..91245,91297..92182)
                     /codon_start=1
                     /locus_tag="AO090001000042"
                     /note="renal dipeptidase"
                     /old_locus_tag="AO070336000254"
                     /protein_id="BAE56605.1"
                     /transl_table=1
                     /translation="MAMDKKGDLEWMPPRPEPVHWRNRQRSLAYSVTLTLVALFFTFA
                     LRPEAFPSFLVRKGLHKSPLEQVLTRVPLTDGHNDFAIWTRAFYQNHIYRANFTDHDE
                     LYGQVDFPRLRKGRLGAQFWSVYVECARNPNEPGVQYEIVRDTFQQIDLVHRMINHFP
                     DFLVPASSVADVHHNFYHSPGRISSLLGIEGLHQIGGSASVLRMYHELGVRYASLTHT
                     CHNEYADSEAPEEPRHGGLSTAGEAIVAEMNRMGMIVDLSHTSLATQRAVFNVTRAPV
                     MYSHSSAYALCPHSRNVPDDLLQMLKENDGIVMISLYPEYTNCQDADAASLADVADHI
                     QYVGNLIGYRHVGLGSDFDGMSHGPKGLEDVSKYPDLIQELLDRGVSVDDLVGVTGGN
                     VLRVLGDVEHVARSLADTLPLEDDVKPFFE"
     exon            90812..91034
                     /number=1
     exon            91086..91245
                     /number=2
     exon            91297..92182
                     /number=3
     CDS             complement(join(92485..94782,94832..97411))
                     /codon_start=1
                     /locus_tag="AO090001000043"
                     /note="non-ribosomal peptide synthetase modules and
                     related proteins"
                     /old_locus_tag="AO080501000042"
                     /protein_id="BAE56606.1"
                     /transl_table=1
                     /translation="MPLSGWPKGGYEVRLWYVHVPERYFIYMAADWNPRHAPINIGYP
                     SRTTMNPSSQLLVQQLAAVLEVDTAELDLNSGFVHNGGNSLSAVEFVSRSKSLGVSLS
                     IASILSSTNLRALFTDLLSSESNLIPIPDPSDDSDDLSNPSSSTGGSPRVATPISSNV
                     STAAEDDYLTQGSVLTQYATQSLSEMQASLLHGSLKSPGTNIIYHYETYQTDVIPVLK
                     RAWKTVIEGEPIFHSSLLDGSARNQEYFTWSEVTVETEAEYREQLQTLWLKSVSSSFK
                     VVHWKRSPPASSQSTVIWAVHHALVDGYSAMLLFCKVRRAIKGLPIVPGPSFSDVEKR
                     IRVWRQEHKSQGDEYWAGHAAQLDQAQGELLLPAPTPEGTSSAITESEEVYVAPSVSN
                     TQLHCVAKRLGVTLSTCYYAAWSLVLSLYADSASVVFGAVLAGRNLPLEGVDEVVGPL
                     VNTLPLCLTLSRQQSAQDFLKNLFSRMVELAEYQWTTPDNGYTRNFSSAMAMQVPGPE
                     CKDGVSPIEPPYTRQTTDVPLSINILTDGAARFVYHTSQYSRADIVRLGKYFQRALQL
                     LLRPHRPIEECLQGLLGCVDLQTLMGFGNCSSSLTTTVAIKEDLVTLFESAVSRNPMD
                     VAVQKGNCHLTYQELDTHAGRVAATLRGYIQDGDVVCLHADRSVNWIVGIMGILKAGG
                     VYCALDKALPQEARETIFSASGSRLFLVPSLSDQSFCPTDCDRLLVVEDLVKDDNVPI
                     THRDSPRPQTDAYLCFTSGSTGKPKGVMCLHQGLVAFQRDLEVRLFAQPGRRVAQIMS
                     VAFDGSIHEIFSALSYGAALVLQSGDDPFAHLSDVDSAILTPSMARVLNPADFERLST
                     VSTKVYLVGEPVTQDVCDRWSEQKTLYNMYGPTEGTCGATIKQLHPRQRVTIGPPNPS
                     TRIYIMNQHQELVPPGVIGEIYIAGVQVARHYIGMPEQTAQRFVADPIIRIGERMYKT
                     GDRGYWSEDGEVVCLGRTDRQIKLRGFRLDLDDLETRMIRAFPAVTAVALTRQGNHLI
                     AAILPASTDVDAFSARVAQVLPPYATPRKILALDEFPTTKAGKRDYLAIAKLSAQAPV
                     STGRTLTSPMEKLVGDAFRDILQLGKDVALHTHSSFRELGGHSLLQLLLATRISQGVN
                     RQVPLYVVAQHDRIDHLAAAIDSGLGLQQLVTTDPMGLGESAIAPIEREWWHKYQINE
                     STSSFNVNFMAKIDDCLVDRARLVHACNEVMARHRVLRSRYIFSRAAGRVVRQYSPLA
                     PRVQAVKTVNPWVEVNRPFSLSRSAPIRAVVSDSYFILTISHIVADLTTLQILLREIS
                     SHYQGGSLPSIPHTYMNSTLWYEKPTSCDLDFWSDCLGQLPDTTHLLGHGGYRRGYRG
                     RSALCEVPPTTYQSMRHFLRQSSITAQQLSLATIALCLDDPSVPMPTETDIVLGIPYI
                     NRKSQEDLDVVGLFLEPLPVRISFGQETHNHEKASYLDTVQRSVRSSVGHAVHWDQLL
                     EHLQVSTTPPDHPLFDVVVTFHSQSHSNGLELSAPGLRTCYTYAEGAKFRLLCEFSAL
                     SEDRLLLRLEYDTDCFTEENIQLLQARIPLALSLLVQNVPYDMIRQTLACPPETQPVK
                     VLKPDVVFGTPLSDI"
     exon            complement(92485..94782)
                     /number=1
     exon            complement(94832..97411)
                     /number=2
     CDS             complement(join(98216..98963,98985..99697,99713..100075))
                     /codon_start=1
                     /locus_tag="AO090001000044"
                     /note="uridine permease/thiamine transporter/allantoin
                     transport"
                     /old_locus_tag="AO070336000252"
                     /protein_id="BAE56607.1"
                     /transl_table=1
                     /translation="MTTVIRYGTRLEHLHEAVKLSPHGQTALSVWINDDIRPLPPSRR
                     TWSTMTFIGWWSVWQLSLTNWQLGGSLVASSLSVWQTMVAVVLGRTIAAIVAILIGYI
                     GAEWHIGFPVYSRAIWGVFPYSCHRTVPRQSNVGVILKGAFFPTLLRIGLTVVGFAFQ
                     SYTGGLCVTAILSGIFPTFFRMSNTLPASAHVTTQQIIGWAIFNIISIPVLYRRPERS
                     EKLMIGMNIMSFAALLGIMIWSLSHAHGAGDLIHQPSQLQTSDSLGFGIMQGITTVVG
                     TLSIALSRSPFVYPYLKYVSDLDSASQMDFSRFARKPSDQVFGQWFTFIIIGSIMPLF
                     GCLTSSATQAIYGEALWNPPTILAISTSRAAAVFAGIGLVSSQLALNVVDNGKSSPSQ
                     SVKGFSNYPVGYSVGMDLSGLLPKYINIRRGCYVGLILGMALCPWELLASATTFVSVI
                     SSFSIFMAPFCGIHISDYWFIRQRRLKLSDLYHARPEGIYFYTMGFNWRGVLPWLVGW
                     VPLLPGFMHSINPAIKVSVGADHLYALGFPYGLLSSMAIHTLVNKCFPPPGIGEIDRD
                     DTYGTFTVEEAAKLGVNKDSTEEDSDRSLRRESREVVETKV"
     exon            complement(98216..98963)
                     /number=1
     exon            complement(98985..99697)
                     /number=2
     exon            complement(99713..100075)
                     /number=3
     CDS             join(100323..100754,100813..100933,100994..101541)
                     /codon_start=1
                     /locus_tag="AO090001000045"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000251"
                     /protein_id="BAE56608.1"
                     /transl_table=1
                     /translation="MSKRIRLGIVGLSADPSHCTNYIHKIPLTTTPLKEKYEITAVSM
                     SSPEKAEAAAIAHGLPRERGYHSVESLAKDPDVDLVVVSVKVPRRAELAMAAIEAGKD
                     VYVEWPFASNLAAAEALAQRARERQVKSMVGLPTRLAPQVLKMKEILRSGSLGRILAT
                     NLLVTDDLFLKFHADKRHSHDKTNGANIVTIAGGHLLDAMAFLLGEFTTLHAHTSMLF
                     PKPVLCDTDGNLKTGQFNDSPDTFTMHGKIGISEVPVSVCMYSHPPTTPNLFQWVITG
                     EKGSLKMEGPSLMIHAIPPKLMMTSFGSETVCWEEISLENTIVSGAEYQAWLDNDTER
                     IVTLDEAVVRYRMVDAILRSAESGQCTSYRYD"
     exon            100323..100754
                     /number=1
     exon            100813..100933
                     /number=2
     exon            100994..101541
                     /number=3
     CDS             complement(join(101804..102513,102575..102895,
                     102947..103337))
                     /codon_start=1
                     /locus_tag="AO090001000046"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000250"
                     /protein_id="BAE56609.1"
                     /transl_table=1
                     /translation="MNDYIRVNCTELRWPELVCAEPGSNSRGHSPPFHIANASITQLK
                     AIDLLFLIDFSISKIMESLLQLETALRAVVEETKRPNAAAAFASLRRADPNNDPALTA
                     VASRVVDLASEVTQLLEPAYLALADHLFGYQHTQCLAAVVELRIPDYLASGPQTFEQL
                     SISSGTRRDRLRQVLRLLYNNGVFSYDAESDSVRNNEASEMLKQDHWTQWHRWASVCS
                     KQFYQMAQGLPRAMSAGVTRSPAQVHYDTDESMFSYLERNGTMVQLRECMGAAAIAQT
                     PGMITGYPWAELSNHTLFDLGGGDGSLIAGLLRAIPTLQGGIMDTPRVLPFLQEAFHH
                     PSSKYADVALRIPPERVIAGDFLQEVIPSEAYVMRWCLHDWNDEQACQILRNIRRSII
                     NSPVSRLIVLESVLADGRWGRMSRLGDINVMVTAEHGQERTETQWRQLAACTGWKVVS
                     ITQLPGAWPSAIDMRPVERPENV"
     exon            complement(101804..102513)
                     /number=1
     exon            complement(102575..102895)
                     /number=2
     exon            complement(102947..103337)
                     /number=3
     CDS             join(103395..103763,103839..103922)
                     /codon_start=1
                     /locus_tag="AO090001000047"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000249"
                     /protein_id="BAE56610.1"
                     /transl_table=1
                     /translation="MDSDSETAPLLSERVSTDNPPIHNEAPSQHHVTASQFLPVSLLA
                     SLGMAATVATTIYAYADLLCTDPTACEDTEQSAYAAVVAIANGIAHTVAILILGPLQH
                     LASKYLKAGLFMWIICRAASVSPSGVCRLQYRVVSLKDWHRTICCTSI"
     exon            103395..103763
                     /number=1
     exon            103839..103922
                     /number=2
     CDS             104000..104836
                     /codon_start=1
                     /locus_tag="AO090001000048"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000248"
                     /protein_id="BAE56611.1"
                     /transl_table=1
                     /translation="MLGTAVAPIAVTVFRSYTASFTTSLVIFALTMAYLVIFVRQPVS
                     HGTGTLSNESAQPGWHKSPLGVLLSPLRPFYTNRKVIPYGLSLLLYTAVQGHLFPVIM
                     VFASIRFHFGTLENGLIVSTAAICAAFQISLQIYVAPMLVRLSHRFGWGAQDASRVRH
                     QDHNAVVGALLLQMVALSAITQVRSPVQLYLAVALSSAGLAVPAFFKAHFVSFMPDAP
                     QAISALTFMESVGGLLSPFVLGAWQAVIPGTSVFLLAVALLGTTLCLFLVAGLFHSSG
                     RV"
     exon            104000..104836
                     /number=1
     CDS             complement(join(105634..106019,106090..106567))
                     /codon_start=1
                     /locus_tag="AO090001000049"
                     /note="dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /old_locus_tag="AO070336000247"
                     /protein_id="BAE56612.1"
                     /transl_table=1
                     /translation="MGSHKLTWLITGCSSGFGLSLTRAAQAGGHKVIATSRNPSRTPD
                     LVAEIEGKGGKWVQLDVESPQSGNVISELEKGGEQIDILVNNAGGSIYAPIETSTEEE
                     IRAQMETMYFGPLRLIRTVLPYMRQRRSGIIVNMSSGASLDGIPTMGVYGGAKAGLDA
                     LTKVLAKEVAPFNIRTLTVVLGTFNTNMLNSVVLGKTPLPDDYKGTFTEQVQGLLLNG
                     KIKPNGDKDKAMQALYQVVVGEGVGEGHQEEKLLALGSDMTPRLKGTQDYLGHALEVF
                     GSVTNGVDLDK"
     exon            complement(105634..106019)
                     /number=1
     exon            complement(106090..106567)
                     /number=2
     CDS             107948..108412
                     /codon_start=1
                     /locus_tag="AO090001000050"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000246"
                     /protein_id="BAE56613.1"
                     /transl_table=1
                     /translation="MRLLNHLLPVVPLLQTASSSGPVAIIARPSPANETRVVLGDTFT
                     GDAYIDASHADNEIWIGNVLFTPSARTHWHTHEKGQLLRVIAGSGWVCDKGASPRHLR
                     VGDTAWCPRGVTHWHGAEEGSFLVHEAIAYGATEWLGAVGNEEYGQAGCVDC"
     exon            107948..108412
                     /number=1
     CDS             join(110140..110581,110689..111038,111121..111195)
                     /codon_start=1
                     /locus_tag="AO090001000051"
                     /note="dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /old_locus_tag="AO070336000245"
                     /protein_id="BAE56614.1"
                     /transl_table=1
                     /translation="MPSSPKTILITGCSAHGIGAALAIKLAEQGHFIFATARTIRKIP
                     ESITSLANVHPLPLDVTDPTTISDAVCAVTERGHGLDILINNAGAGYTMPLLDADLDQ
                     AKQVYEANVWGLLRLVQACSDLLITSKGRIINMSSVGAVVNTPWIGVYSSSKAAVTQL
                     SETLRLELAPWGVTVVCLMAGTITTAFHANEPEVVLLPTSRYAAIRQTISDWATGRAG
                     PKGCSADEFAASTVDDVLGSTGGLVWKGPNSAAVQFVSRWCPTWLLDRIMSSGQGFNE
                     LSKSVTSAERHP"
     exon            110140..110581
                     /number=1
     exon            110689..111038
                     /number=2
     exon            111121..111195
                     /number=3
     CDS             complement(join(112370..112765,112840..113009,
                     113067..113220))
                     /codon_start=1
                     /locus_tag="AO090001000052"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000244"
                     /protein_id="BAE56615.1"
                     /transl_table=1
                     /translation="MVDIIELIGKIKGYEDIPLRIQEIYFANVQFKIIKHDDHPAAQP
                     YLGMVSNEELLERPEAGGGNFSRRAMRHVLTKSHSREEHLDSSLEVLALKNQLVWEGS
                     NGTTARFKFGTLYPMRFSVWNRQTDERALYAVRRTTTAEHYQNENVLYAGMNEEPNVL
                     VRFSKLKNEKKPNGVSFQMDFDAATRADKIGAHDWVRMDFYDIQTKENVGWLQNNGGI
                     AKLNELGDLQMDASVFKFMYL"
     exon            complement(112370..112765)
                     /number=1
     exon            complement(112840..113009)
                     /number=2
     exon            complement(113067..113220)
                     /number=3
     CDS             complement(join(113875..114034,114098..114225,
                     114285..114373,114435..114561))
                     /codon_start=1
                     /locus_tag="AO090001000053"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000243"
                     /protein_id="BAE56616.1"
                     /transl_table=1
                     /translation="MNERQWGIVMRNNDLLNGKFFEGGNTNSKIAVPTSISRARYTAF
                     ALKERSIPDYDVTFEAPKDIPGNTKKPEIKFRIPRFQICDSSRVEVFETKSAIADSMA
                     SNAFSQTTVEASVGGGAFGVSVGVKAGATTSGSSSFAQSSSKDESRMHVAYLVRSYHT
                     YLKERGI"
     exon            complement(113875..114034)
                     /number=1
     exon            complement(114098..114225)
                     /number=2
     exon            complement(114285..114373)
                     /number=3
     exon            complement(114435..114561)
                     /number=4
     CDS             complement(join(116394..116429,116618..116989,
                     117051..117101))
                     /codon_start=1
                     /locus_tag="AO090001000055"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000241"
                     /protein_id="BAE56617.1"
                     /transl_table=1
                     /translation="MKLTQFASILTAGFVAAAQALDESPIPGYGIQEPSWEVETTPGG
                     PKVILNGTVQQVHAQLLEINPNYDDDFATVLDKRDATVFGKRDDIKCNNFPQARRGDI
                     EAGIKHLRGVSGQPSNGPGPGNCGRVSCSWGTAIWWCNDGGQLLERKGRR"
     exon            complement(116394..116429)
                     /number=1
     exon            complement(116618..116989)
                     /number=2
     exon            complement(117051..117101)
                     /number=3
     CDS             complement(join(118981..119802,119859..119900))
                     /codon_start=1
                     /locus_tag="AO090001000056"
                     /note="O-Methyltransferase involved in polyketide
                     biosynthesis"
                     /old_locus_tag="AO080501000056"
                     /protein_id="BAE56618.1"
                     /transl_table=1
                     /translation="MIRVTPGIPRFRPRTLLVTLIARAHDFRTPRPILGDPYAQHILD
                     RLDFDVTKMTMAPNQMASIAVRTSNFDRWTSDFLQHNPDTTVLHLACGLDSRMDRVNW
                     GDNTRWMDIDLPEVIELRRKVQPTSLPGRDYSLLGIDVLDEYWMHELSTDGPVLVVME
                     GLLCYLPEDDVKRLLQRLCQTFRRGELLFECINSMTLQALNGTKPIQPVSGIGAEFHS
                     YVDDPKTLELLHPGLKLMESIRLAEAPGVEMLPLGFRALMYLRSWIPGVRDAARFLRF
                     QFGEIGEVANE"
     exon            complement(118981..119802)
                     /number=1
     exon            complement(119859..119900)
                     /number=2
     CDS             complement(121392..122738)
                     /codon_start=1
                     /locus_tag="AO090001000057"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000239"
                     /protein_id="BAE56619.1"
                     /transl_table=1
                     /translation="MFSQPFLFAFLSAGAAWATQAPLGSASGNGCLSLSSGNHRTAYD
                     TCCSGGSTSGKGSVNGVEFTYSCGKWATGSNKSPIKGVDARECAKHCAADTNCFATSW
                     TPRGQCFLVTTQGYSTASGSNFLLIEKTGGIVDEPEPESGCGKPVEAAKTQCEKDAAA
                     RCEVEKAALSQAEKVECEKEITEKCNDAAVAVEASKAQCEQEKATLGHAAKAECDKRI
                     AETASAAETSNAQCEAQKAAVARIEKAECERRTAEKCKTHTSSAVEALKAQFERTKAD
                     ITKDMENKCEVEKSNQAKEWEIAKAKLEAEKAELQKALDALKVTGVGGTASHEHDGSD
                     VARRLAEVGPTPQYNICPQFGGREFTTATSSGNTARWRVNCNMFVKGHWYVDRHCPPG
                     SIVQILRERQENREYKGLFWNHVNICHEVIPTPGTGGMYLIKTPNFPNHAFIERID"
     exon            complement(121392..122738)
                     /number=1
     CDS             124509..126590
                     /codon_start=1
                     /locus_tag="AO090001000058"
                     /note="fibrillins and related proteins containing
                     Ca2+-binding EGF-like domains"
                     /old_locus_tag="AO070336000238"
                     /protein_id="BAE56620.1"
                     /transl_table=1
                     /translation="MVKANGLLALLVGISAYHVEARGSSRGKTKYTLDNILPLTDPSS
                     GLVKCCPEGTEFDGQACVLGVPTCPEDFIRKDNKCVSKFKPICPDGSEYDGNLCVSDG
                     LPTCPPPTTLKGNSCVAGPPTCPSGLEYNGKVCQSKQLPACPTDYTFNGKTCVSVKKP
                     QCPEGLKLGDGKCISVGSPVCPAGAEYNENLGLCASVVEPGCDEGSQLKNGECVSDTP
                     PSCPEGGNFNPTTAKCTSAEKPTCPPGSELDLHSQKCVLSEEADCPPGSVLSTDLASG
                     VARCCPNGMAWNGDVCLFETDSSGKCPPGLTQVGKYCHKQATKIPQCPPGAKLDGSRC
                     VLTELPECPPGHILEGSTCVMIEKPECPPGLTLSGGNCISTVEISCPAGTRFEKGVCT
                     SVTPPTCEDGFVFDGTNCVSTTHIPICPEEGHTLDGEECLIPLMPTCPENTAFDGTRC
                     VSTISPSCPSGSVHNGQGDCLTTSVPQCPPGSTLLGGGCVVGVPACPKGTVWDSKQCI
                     SPKDPECPPDHKWSNGKCLNLVTVECEPGYALVNGECVSDSKPECAPGTTFNGQECVG
                     DVPNCPEGLVFDGEDCAHPEEPACPAGMKFNGKKCVAEKPPSCQSGTTFDKKTKECVA
                     VEPPQCPPGQVFNGKNCALASGDCMSFEYCPVMGGLSNGGLTTGGPSTGAEECPEGTV
                     YDKYTGMCADW"
     exon            124509..126590
                     /number=1
     CDS             join(130971..130978,132323..132388,132449..132906,
                     132966..133327,133384..133533,133598..133809,
                     133873..133965,134015..134279)
                     /codon_start=1
                     /locus_tag="AO090001000061"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070336000235"
                     /protein_id="BAE56621.1"
                     /transl_table=1
                     /translation="MRRFFGFRGRALNLAISSLGSLDFLLFGYDQGVTGGLLDLPSFI
                     KYFPDINDKAEGIDQALKSQRSLNQGIAVASYNLGCFVGAILTIFIGNPLGRRKTIFI
                     GCCTMATGALLQSTAFHLPHFIVGRIITGIGNGMNTSTVPTWQSESSKAHDRGKLVMI
                     EGMLITGGITLSYWINYGFSFIPNSEVAWRFPLAFQILFAVVIFISIMNLPESPRWLV
                     MQGRNDEALEILEYLNEKPRDDPYVINEFRSIQETVKEMSKGSYRSLFDMSEYREFHR
                     VALAYVNQMFQQISGINLITYYAPSLYAEIGLGEGNLPKLLAACNGTEYLMAAFIPIF
                     IIEKAGRRPLMLFGAAGMSISMAVLAGTNYRLTHLGDSQAGIGQAVFLFVFNTFFAIG
                     WLGMTWLYPAEIVPLRIRAPTNALATSANWIFNFMVVMITPVSFTNIGYKTYVIFAVI
                     NAFMFPCVYFFFPETRYRSLEEMDNIFKKSTNVFNAVTISIKEPYRYDKHGQLKPEYL
                     EEAIRRESVTAPAPVKPFESDDSTTEVKA"
     exon            130971..130978
                     /number=1
     exon            132323..132388
                     /number=2
     exon            132449..132906
                     /number=3
     exon            132966..133327
                     /number=4
     exon            133384..133533
                     /number=5
     exon            133598..133809
                     /number=6
     exon            133873..133965
                     /number=7
     exon            134015..134279
                     /number=8
     CDS             137092..138699
                     /codon_start=1
                     /locus_tag="AO090001000062"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000234"
                     /protein_id="BAE56622.1"
                     /transl_table=1
                     /translation="METYLCCFPIGDQGQVAYEIDKRRGRCTNICVSPDSDTEDDDVD
                     HLAIELAQKATIAAQRADTYADINEDAKEIVTIDPGHGIEPFEQKRIFEPIGDCVNGD
                     TRAVERYLETSSEAQLFIRGRDYDGKTTLISAAAEPSSEMVSLLIKHGAEVNAVDKRG
                     RSALMEAALFGRAENAKVLLQNGADKNTRDSDNRMAIDFARDHYKNRRERYERTGGNL
                     ISSSNRLPGRHEDTFKRDIDRQDIVRLFSGENRKSKIVFGSPPTLSGSKSYSFTPSPR
                     QDSLVLHGPIEEYPISSSYKTVARLERGGKFPSIGAMSGWAHGSVQSLRVDGRQWTDD
                     VFYISNVAGHALASHSCDQGKDGRYNACHAEKQLIAYFIDRHVFLPRDADPDSELEKR
                     IECIEDELQEFLSGTEIGRKVASLRKRKEDLKHQIFDGDEKLVGKHDEIKALNLELKS
                     VETALNLLIADSQARPLLKLESQLKVLNKRLDRHADLTEMASAPPPASLVEAVILISS
                     RPCQDCIVFTDKVNKRFGLSIQLFAAL"
     exon            137092..138699
                     /number=1
     CDS             complement(join(139178..139629,139719..140337))
                     /codon_start=1
                     /locus_tag="AO090001000063"
                     /note="predicted unsaturated glucuronyl hydrolase
                     involved in regulation of bacterial surface properties,
                     and related proteins"
                     /old_locus_tag="AO070336000233"
                     /protein_id="BAE56623.1"
                     /transl_table=1
                     /translation="MRSSIALLAATAGTTLASSNNYTEWMASSWLSKSVPVSRNYAYG
                     VLYRGIELAHNKTNNAEYLDFIESQLSGVVSDSGELIDYNLTDKISLDDLRIGTNFLA
                     AWAATGQEKFKLGADTLRRQIDITPRNEGGGLWHRDPTYPNQMWLDGIYMSTNFYALY
                     TAWFDADNSTAWDDIMLQFDLIEEHCLREDGLLVHGFDYSKAAVWADPETGAAPLVWN
                     RALGWYFMSLLDILDYFPKSHPGWETNLSRFQKLAQALKQAQDESGGWYLIMNDQYPS
                     DPRNYIESSGSAMFTYGFLKGIRNGFLEESEYSQVADKGYKLLVDRFVSKNDNGTLNW
                     EGTVEVGSLSSNGSFEVSPDVY"
     exon            complement(139178..139629)
                     /number=1
     exon            complement(139719..140337)
                     /number=2
     CDS             complement(join(140806..141049,141102..141529,
                     141587..141710,141758..141926,141978..142079,
                     142132..142186))
                     /codon_start=1
                     /locus_tag="AO090001000064"
                     /note="iron/ascorbate family oxidoreductases"
                     /old_locus_tag="AO080501000063"
                     /protein_id="BAE56624.1"
                     /transl_table=1
                     /translation="MPAKLIDRYDHVPVTKENLDWAELVTLDLSQYDQPGGKEDLVKQ
                     LDHAVRHVGFFYVKNFNISQDEIDRQFALGREFYALPLEEKLKYHSASDLEKGEYNGY
                     RPAGHRALGNGVKDNVQVYNIPKFDGYHQRQQPPILGDHLEEIEAFSRKCHTEVVEKL
                     LRLFAILLELPDEDQLVKDHQYDVKGEDHLRYMHYAARGAEENKIVGGMYVPGHTDLG
                     TVTLLFRQPVAALQILNSQGQWKWVRPQDGTITVNTCDALTALTGGLIKSSIHRVHVP
                     PADQAHVDRLGVLYFARPNNHVVLDPIQNSPLLNRLGLTQNVFTELGQHLTTEQWVKV
                     RQTQQQRRTRDAKISEDGKYTYQPKDLEIIPGLHAKVYN"
     exon            complement(140806..141049)
                     /number=1
     exon            complement(141102..141529)
                     /number=2
     exon            complement(141587..141710)
                     /number=3
     exon            complement(141758..141926)
                     /number=4
     exon            complement(141978..142079)
                     /number=5
     exon            complement(142132..142186)
                     /number=6
     CDS             complement(join(142632..143419,143485..144604))
                     /codon_start=1
                     /locus_tag="AO090001000065"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070336000231"
                     /protein_id="BAE56625.1"
                     /transl_table=1
                     /translation="MSPSDQITQVTGLDKNYELTLKPTIGDPQQSQGVTRMEAVYREA
                     KSDRKTLWLIGVSVLVCAWAYSLDSSTTSYYSVDASSYFKQHSSVLSTLSIATSIISA
                     VSKPFIAKISDITSRPYTYTLVLFFYVLGYIIVATCRTIAGYVVGEVFVAIGSSGLDL
                     TNDIIVADLTPLEWRGFASSMLSTPFIINTWFAGKIVDAIDSKGQWRWGYGMFAIIMP
                     VALGPAVATLIYLDRKAKKNGIVNIASSNAARRAAGNLSEREGRDIPHGTVSARAAGP
                     SEPWMRSARRILDEIDALGLVLLGFGWSLLLLPFSLKTYADGGWRNQSLIAMMIVGGL
                     LLIAYVIYEVKWAPVPSAPRRLVFNKTFTMAIIIDSFYMLAGSVRGLYWDSYVYIAKP
                     WSYQNWVYYGNTLTLALCIAGPFVGLLQRWTHRYKAIQIAGLVIKIIGMGIILDGNMA
                     TANTGAMVMAMILVGFGGSMSVVGSRVASQASVPHQDVALAISLLALWSKIGRAIGSA
                     IVAVIWADQMPKQLRKYLPSNATEADVKKLFGSPTSIRKLYGFDDPMRVGAVLAYRHA
                     LYYCLATALGLAFIPLIASLFQHNYFLGKSQNAVTNVGNDGLPLAETRRSELEPPKNK
                     KEAFLRFWAGK"
     exon            complement(142632..143419)
                     /number=1
     exon            complement(143485..144604)
                     /number=2
     CDS             join(146665..147049,147105..148342)
                     /codon_start=1
                     /locus_tag="AO090001000066"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000230"
                     /protein_id="BAE56626.1"
                     /transl_table=1
                     /translation="MLVMQLLLPFLASTAAAAAAIDSTSSSNGSDHHGSSFQAECESF
                     KAKINVTNANVHSVTYVPAGVNISMADNPSICGGDEDPITSTFAFCRIALNVTTSSKS
                     QIFMEAWLPSNYSGRFLSTGNGGLGGCVKYDDMAYAAGYGFATVGTNNGHFGNNGVSF
                     YQNTEVVEDFAYRALHTGVVVGKELTKNFYPQGYNKSYYLGCSTGGRQGWKSVQTFPD
                     DFDGVVAGAPAFNFINLTSWGARFLTLTGDSSAETFVTETQWTAVHNEIIRQCDSLDG
                     AKDGIIEDPDLCQPIIEALLCNATQSSTSGTCLTGAQVKTVNGVFSATYGLNGSFLYP
                     RMQPGSELAAYSSYYSGTPFAYAEDWYRYVVFNNTNWDVATWTVQDAAIANAQDPYQI
                     STWNGDLSPFQKKGGKVLHYHGMEDAIISSESSKVYYKHVADTMNLSPSELDSFYRFF
                     PISGMAHCANADGPSAIGQGTGTFAGNNPQDNVLLAMVQWVEEGVAPDFVRGAKLNGS
                     TVEYRRKHCKYPKRNRYVGPGSYTDENAWECV"
     exon            146665..147049
                     /number=1
     exon            147105..148342
                     /number=2
     CDS             complement(join(148608..148895,148962..149688,
                     149760..149788,149842..150201))
                     /codon_start=1
                     /locus_tag="AO090001000067"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000229"
                     /protein_id="BAE56627.1"
                     /transl_table=1
                     /translation="MSTTKNAKGNRVEYHYWDYSFEWTDEHRPASEFESWIHSCDGLA
                     DECNQILNDLPAPVDDEGGNVSKRDRYALLTGNREKDPKLEELWNQINTVPEWVNWAQ
                     IQRGQDVYWRYMLPIMNSLTYNSLLGGMGAIRVGETLSRTGGFSATVVRRRLLETAQH
                     AFQVNSSVDSMKPGGAGHLACVRVRLLHSTVRLKIMSLVERDPSYYDVQKYGLPINDL
                     DAFATINTYSSTVIWLGLPRQGIHLSNQEMEDYIALWRLVAWYMGAPAEPFESAAKAK
                     IWSESLLINEFAPTDTGRILAKNIVIGMENTAPTYASKEFMDALARLLNGDQLSDELH
                     IPQTSLYYRMLMWGYCLSVKLQAKALPNIGFIEKYVFESRRRMMWKGLMDEKHGLGKE
                     TIFDFKFVPSLNRTTHEGKRKSYRFKRPGLEVLSYMGLLTAFGSVAALSTALYLAAAK
                     VLLGSQVVPDLSYLIRA"
     exon            complement(148608..148895)
                     /number=1
     exon            complement(148962..149688)
                     /number=2
     exon            complement(149760..149788)
                     /number=3
     exon            complement(149842..150201)
                     /number=4
     CDS             complement(150874..151578)
                     /codon_start=1
                     /locus_tag="AO090001000068"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000228"
                     /protein_id="BAE56628.1"
                     /transl_table=1
                     /translation="MHLDLQSAHFGVSKLHDGLDLEMFAHQVESAPAIDDFRTIQDAW
                     IVRDRIFIQFCMFGSLCESFSADEISANYSVLCTEQRKQQAQLAGFAAALDRFEEASL
                     RHRCLTPKEQRAMAILRMHHAALSVVTDICLIKCSETIRSISTERFNNVVDQAKSITT
                     SLKEIAPRSTPRRPTLLMETGTIAPLFFVIAKCDNPGVRQRALKVLKSWPHREGLWDS
                     QLAATLARQMMFAEAR"
     exon            complement(150874..151578)
                     /number=1
     CDS             join(153544..153688,153744..153796,153849..154121,
                     154171..154248,154297..154692,154740..154780,
                     154889..155178,155228..155313,155372..155615,
                     156950..157062)
                     /codon_start=1
                     /locus_tag="AO090001000069"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070336000227"
                     /protein_id="BAE56629.1"
                     /transl_table=1
                     /translation="MAGGMASQGISAKRAELAGGRVGWRGLVSSKKAFGIALFASLGG
                     LVYGYNQGMFAQILTMRSFIDATQGYAEHTGTAQGMLTSILELGAWLGTLANGYLADA
                     LGRRVTVVVAVVVFCVGVIVQACTTNPDFVYAGRFVTGLGVGNLSMIVPLYNAELAPP
                     EIRGSLVAVQQLAITFGIMVSFWIGYGTNFIGGTGEGQSIAAWEIPVCIQILPALVLA
                     VGMMLFMPQSPRHLMNQGREEECLQTVARLRDASVDDMLVRIEFLEMKALRMFEEETA
                     RKKYPQYQDGSFKSRFMIGVHDYMSLITDKSLFKRTTVACLIMVFQQWNGINAPQIFK
                     DLELGGTTTSLLATGVAGIFEFVFTIPAVLWVDNIGRKKILIAGGIGMAVCHFIVAGI
                     IGSYQHTFAEHKAPGWVAVVFVWIFIINFAYSWGPVAWIVVSEVYPLSMRAKGVSIGG
                     SSNWLNNFAVGLSTSPFLSASNYGTFIFFGCITTIGVFWVWFLVPETKGRTLEEMDEL
                     FGSGGMAAEDEARKRRIEREIGLLALLAGGGWSAGGNLGKALPGTSIGVTASEGPGAG
                     HEIRWV"
     exon            153544..153688
                     /number=1
     exon            153744..153796
                     /number=2
     exon            153849..154121
                     /number=3
     exon            154171..154248
                     /number=4
     exon            154297..154692
                     /number=5
     exon            154740..154780
                     /number=6
     exon            154889..155178
                     /number=7
     exon            155228..155313
                     /number=8
     exon            155372..155615
                     /number=9
     exon            156950..157062
                     /number=10
     CDS             159560..160372
                     /codon_start=1
                     /locus_tag="AO090001000070"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000226"
                     /protein_id="BAE56630.1"
                     /transl_table=1
                     /translation="MRFLLPFAIGLTPLASALSINKPGANSTYAAGSTVTVNWSTVDT
                     DPTEISLYLWNFVSWPPSYVPLAQNVPTADQSYSVQIPCDTNPEWGYQISAINGTNVY
                     IIYAQGDRFTVSDPVNGTSCSDPVTPPPASTCGPTNAVSTVYVTVSPTGSSSRLIHHS
                     SLGLPSSHLPQSTHALPAPSSTVTASSKYVKPGIVPKTIGWCSDYSHPVTLDKVPTPT
                     AVPAGPNDAGHDTSSAVVTAAPSVVTGEAKVVTITTTVSVPAAPGDEQCLFV"
     exon            159560..160372
                     /number=1
     CDS             complement(join(161263..161327,161382..161506,
                     161557..161801))
                     /codon_start=1
                     /locus_tag="AO090001000071"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000225"
                     /protein_id="BAE56631.1"
                     /transl_table=1
                     /translation="MQLPQAIAILTLVASASAHAIRREEDKPKADFSRTCDKISVPKG
                     GNHLEAECTRSNGEVLKSSLDLNFCIQHTYGGMEFHEDGHFYGNPGCTGCQVLKDSPN
                     MLQCVCGTSQVGAFKKAELDLDIMVWNNDGLLQCYSRRADSV"
     exon            complement(161263..161327)
                     /number=1
     exon            complement(161382..161506)
                     /number=2
     exon            complement(161557..161801)
                     /number=3
     CDS             complement(join(164913..164994,165166..165830))
                     /codon_start=1
                     /locus_tag="AO090001000073"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000223"
                     /protein_id="BAE56632.1"
                     /transl_table=1
                     /translation="MKNIFVATLGLFAAVSSALPYTTPVNDNPISALQARATTCSAKA
                     TDNLIFKVSMKTFQKARKAKNPSKCNWSSDNCSKSPDKPDGYNFIPSCQRHDFGYRNT
                     KKQKRFTKAMKKRIDDNFKKDLYKYCSQFSGWSSWKGVECRRLADVYYTAVRHFGKRD
                     EALEFDPEVEFEKRDEVADVQPDEFDNFDGSEVDPDIEGQVIPEVLEDDGVDVENLDD
                     IENLFLRCCHLKMDRSICEIFDLKSVAVNQ"
     exon            complement(164913..164994)
                     /number=1
     exon            complement(165166..165830)
                     /number=2
     CDS             join(167924..167941,168100..168183,168533..168929,
                     169070..169686)
                     /codon_start=1
                     /locus_tag="AO090001000074"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000222"
                     /protein_id="BAE56633.1"
                     /transl_table=1
                     /translation="MNGMLNILIEAPPAWLPLPLRQQSRLRISIKGWKVIVGLAASFC
                     LPVLSASRLTSSLPIAARAVAASPSRPWWWSGCWLWIGPRAGRRVFGHNWLALGVFCY
                     RDPQQRSAGPGTVGNLKSADGGPLGKASLTRVHRDVDWIGALLISACLAFLYELAVAT
                     GSDADQTVCITVFLVWGTLNASEQLTVLYLQDVRGTSTLTASLYFMLAPVCGLLMNAA
                     IGLSFPYLKSSIAVPAGCLLSGIAPLLLATLCGVDGPGYWRGVFQAMALNSLGADLVY
                     TIAKLVITDSFPAKTQALAGGVFNMLAQVGKSVGIATSALIARQITSQMDHAESATAM
                     LKGYEAGWWYNCGLGFVSVAVSFGGMRSVKVIEIKRD"
     exon            167924..167941
                     /number=1
     exon            168100..168183
                     /number=2
     exon            168533..168929
                     /number=3
     exon            169070..169686
                     /number=4
     CDS             join(170617..170955,171005..171070,171121..171579)
                     /codon_start=1
                     /locus_tag="AO090001000075"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000221"
                     /protein_id="BAE56634.1"
                     /transl_table=1
                     /translation="MPRLLPISAATLALAQLTYGWGNLGHETVAYIAQSFVASSTESF
                     CQNILGDDSTSYLANVATWADTYKYTDAGEFSKPYHFIDAQDNPPQSCGVDYDRDCGS
                     AGCSISAIQNYTNILLESPNGSEALNALKFVVHIIGDIHQPLHDENLEAGGNGIDVTY
                     DGETTNLHHIWDTNMPEEAAGGYSLSVAKTYADLLTERIKTGTYSSKKDSWTDGIDIK
                     DPVSTSMIWAADANTYVCSTVLDDGLAYINSTDLSGEYYDKSQPVFEELIAKAGYRLA
                     AWLDLIASQPS"
     exon            170617..170955
                     /number=1
     exon            171005..171070
                     /number=2
     exon            171121..171579
                     /number=3
     CDS             complement(join(173991..174205,174297..174531))
                     /codon_start=1
                     /locus_tag="AO090001000077"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000219"
                     /protein_id="BAE56635.1"
                     /transl_table=1
                     /translation="MLQSTVRNYLSSSSLLQIERSELIDSPGEEPDGFKFKKGSVFVV
                     ESLGHEIGMRTTFPTSLVRKYTIEINRPVNWALGRRMNRGLKRHTLTRMVQDVVRCGL
                     ITKGQLAGHVVGSLVAGGRWNDTISRSITSIGSGSSAQRQALANERI"
     exon            complement(173991..174205)
                     /number=1
     exon            complement(174297..174531)
                     /number=2
     CDS             175510..179493
                     /codon_start=1
                     /locus_tag="AO090001000078"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000218"
                     /protein_id="BAE56636.1"
                     /transl_table=1
                     /translation="MASEIPNVKPPQGMPDEARRFSFYKDAEAKFKAPHWVEDEVKRL
                     TLYKEAVAAIEFTKEELDNIMSELKSNPEEGEKDDRQAKLHRMLAHYIAPTVGSDFEI
                     FNDSKIQRWQTAEIPDREKWHVMPAPAPSTPLRMIDVDTGDLVNTTSCGPLDQYCILS
                     HTWKGDEITWDYLVKAKKSNFKSQSSEGDIEVAKDRSDIEAVSARSDKKAYKALERLQ
                     KCIATCRKPMDLKVPGLDFLENPSVDVVLQKYFQVQAAERDHARTSKEVQQVLDYYVS
                     ASWEASYYKSNWKSLGGKSSSHPDQHNTNEQDRNSLPRELKAVIDHLLSDAEQRQYAV
                     SKDYDTAQGTLSECAAIKDFFRINRELVYAIEKLLRALYYRKSARKLQQTVNKAKGIF
                     DECWSSKSGGRRYVWLDNCCIKKSDAGELTEALARMGEWYANAAFCLVHIDTPRSDTE
                     WIQECNQILLPNGERPGDSAQSSVVKTYEGLWNKTKLKIEWATRGWTLQELVLSRVTY
                     YFNENWEPLRRDVDAIGPYYYLVPFIEQYLRRPSTSPKVKGDVNLQDGIQKARELISK
                     LGDIGLEVPMNLQKTTARGQIGRMVNLAAEKMAEDGRGALQTLCPHLDMSKVTARIDA
                     LNSVLGDIVAHLKPAIEADREHVRKIGRLSRLQNWWDGTDPVNSSARSIIAIASERNV
                     TVPVDQVYSLMGILGVRFPVFPAEDIPKALCRLIDEVVVTSNDVSVFNWSGRYLGSPI
                     RGRSLYPRSIEAFHQTDAAITEVRASIAQYLRGERLKRGRVTKSVLVRLRELMDTTTS
                     IDRGCRILEKLQQLFECIKNAPFEAMVDCVNDMINIREELETNINREKANATRIKDLR
                     QAQRDEQVEKVSARLRETVQEQGQKLKKVVPSSVMGIGRSMSKRLPRGILYDPYGGKN
                     EASQDPPNPSSPSEKLEPVEWDGLRQSLEDFMKRLKQPKQEQQENHQNMQPAAEGKEP
                     SQKPDRKMVCPNPIIVTSAGVRGVFDVQRVVVQMESPLTLRAKVHQAVDGEMIEGCCT
                     ISTGFSRVFVSFTCEKEILEEQLDITEVIERQLSKTRKGTGREKNAQSTQPGANDNPS
                     PVKPNQEDTSDKAADDLEEWSTSEEPTRRHLYRMVQFVQEDNLRAIAGEWVLARFSDV
                     EGADWFLCRFELGSGDEFYARRIATDAFTFENGIPEAGLIDIWQDYMAEQKRLMCSFL
                     ISSLKGKQHLHETDEALRKLEEKVDERWGEAFKNVREKDLPAKLVKELISKSTITEAG
                     LLFNSIRPAIAGTPYLVFASYLQTKIHEDAIRKVPPILRGAVKAMGEERQRFPMMYHP
                     SQNIHMF"
     exon            175510..179493
                     /number=1
     CDS             complement(join(180290..180743,180853..181659,
                     181716..182042,182086..182099))
                     /codon_start=1
                     /locus_tag="AO090001000079"
                     /note="cytochrome P450"
                     /old_locus_tag="AO080501000077"
                     /protein_id="BAE56637.1"
                     /transl_table=1
                     /translation="MDGDSCPSCCSTCTSLNVFLCPHIPILTLGLLLVYYVTGYLKRW
                     HLRDIPGPFIAGFSRIWLIVQVRQGYRSLVVHDLHRRYGKIVRLAPNHISIADESAIQ
                     AIYGHGNGFLETDFYNAFLNVDWSIFTTRSRAEHTRKRKIVSHAFSARSLAQVEQHAH
                     NNMEHLVRQWRKMIDSEEGLDDPYAVIDARVWCNYLTFDIIGDLAFGAPFGMLERENA
                     TVSMRKAPENPEVTLDAVEVLNHRGDVSAAFGICPDLIPYAKWLPDPFFRQGAEAIAN
                     LAGVAGAAVDRRLKMDTSMTEKRGDLLALLIDAEDQAGAKLGHRELTGEAVTLIAAGS
                     DTSSSTLCALLYWVSSTPRVLWKLQNVLDEVIPVDIEVPYLAMVKKITYLQWVIWEAL
                     RIHSTFGQGLPREVPPERGPVEICGHTFYPGDVLSVPGYTMHHSADIWGIDVEDFVPE
                     RWDPRRLTQRQKDSFIPFSEGPRACIGRNLAEMELFVGCATLFRLFEFRVEGQGPLKV
                     RERWLRKPVSLQVGIRRRYLDARSS"
     exon            complement(180290..180743)
                     /number=1
     exon            complement(180853..181659)
                     /number=2
     exon            complement(181716..182042)
                     /number=3
     exon            complement(182086..182099)
                     /number=4
     CDS             complement(join(182759..183088,183142..183402,
                     183445..183627,183686..183925,183975..184061))
                     /codon_start=1
                     /locus_tag="AO090001000080"
                     /note="flavonol reductase/cinnamoyl-CoA reductase"
                     /old_locus_tag="AO070336000216"
                     /protein_id="BAE56638.1"
                     /transl_table=1
                     /translation="MIPQMKKQHVLLTGANGFAASHILSNLLERGYAVTATVRSQEKA
                     AAIIRSHPSWEGRVKFVIVPDFTKSQPFDEVFKSAEVPFAFVIHTASPVTLQAEDMQK
                     LVIETAVLSVTKILGSAHRHGGMDLKRFVLLGSAVIVLNSFEDPARPGPPYTEEEWNP
                     VRIWHRQFPAALECGDGVLGYMVSKVQAERAAWEFMKMNSPAFELTLMNPHIITGPMI
                     HPISGMSSINATNYFVIAKFIDSVHKDELKDMRFPFYHFVDVRDVARSHVDALTNPAA
                     AGRRVYLISELTTPQLVLNIIRKHFPSLRERVPEGNPAQTLPDGVHPTGWDTRISQDI
                     LAKGAVDGQWGYISLEKSVLDTVQFMIDNNLI"
     exon            complement(182759..183088)
                     /number=1
     exon            complement(183142..183402)
                     /number=2
     exon            complement(183445..183627)
                     /number=3
     exon            complement(183686..183925)
                     /number=4
     exon            complement(183975..184061)
                     /number=5
     CDS             join(187965..188157,188315..188514)
                     /codon_start=1
                     /locus_tag="AO090001000083"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000213"
                     /protein_id="BAE56639.1"
                     /transl_table=1
                     /translation="MQFRSVIALVAFATAVTAAPCDSCDGGNSGDSGDSGKCSPNQEL
                     KCCTGLTQGLNLGILPALCLRTPELSHHPALSSSHFTTASNDTRAMSGGGVMRDSVNG
                     YVLLRLGGDSLLPASRCTRIVLGPRCGN"
     exon            187965..188157
                     /number=1
     exon            188315..188514
                     /number=2
     tRNA            189237..189308
                     /locus_tag="AO090001t00001"
                     /note="tRNAscan-SE"
                     /product="tRNA-Glu"
     CDS             join(189581..190127,190222..190283)
                     /codon_start=1
                     /locus_tag="AO090001000084"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000212"
                     /protein_id="BAE56640.1"
                     /transl_table=1
                     /translation="MAQKGLCWKEDEMGELVHTGTSSPDISVIRSLAMKHLPGSYDTM
                     DVAFFAEGSFNKLYCVSSPHLPQDYLIRVALPVDPFFNRESEVATLAYIRKYTSIPVP
                     KVLAFCSSSESELGFEWILMEKIGGVPLSDIWDEMPVEAKESLPTEICGYLKSHQDLQ
                     FIKIGSLYFSLVRERVGTRDFGETSAYPSLPIVVLSHLHINS"
     exon            189581..190127
                     /number=1
     exon            190222..190283
                     /number=2
     CDS             join(193516..193590,193652..193689,193746..193771,
                     193836..195289)
                     /codon_start=1
                     /locus_tag="AO090001000086"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000210"
                     /protein_id="BAE56641.1"
                     /transl_table=1
                     /translation="MKLSIVLLGTVLGTALADVPTIVAKGSKFFYSNNGTQFFIRGIA
                     YQQEHTGAGDMKYTDPLADPAACERDVPYFTKLRTNVIRTYAVDPSKNHDECMKKLAD
                     AGIYLISDLSSPTESIERENPKWDLDLYKRYTDVIDAFAKYDNVIGFFSGNEVANAKN
                     NTAAIAFVRAAVRDMKAYIKQKKYRDSLAIGYSTDDDQWMRADVANYLVCGDKDSQID
                     MFGYNIYEWCGKSSFKESGYEERTKEFSNYPVPAFFSEYGCNNPRPRPFNDVPVLYSD
                     QMNDVWSGGIVYMYFQEDNDYGLVTLDKSKISTLSDFNSLSSQIQKATATGVKSADYR
                     PTASARTCPKVGDDWQANAKDLPPTPNADLCKCMEEGLTCVVKDSVSEQEYGKLFGMI
                     CGNEGVCDGLARDAIKGNFGAYGMCSARQQLSFVLNQYYQQQSKENQASACDFKGAAS
                     TKKASKPTGTCSSLLGQAGSAGTGTVSSKPTGSGSGGSSSSTSDSAAGLMIAPRSVQA
                     GAWQIGAYLVTAMVTGAGMIVL"
     exon            193516..193590
                     /number=1
     exon            193652..193689
                     /number=2
     exon            193746..193771
                     /number=3
     exon            193836..195289
                     /number=4
     CDS             join(196302..196341,196402..198194)
                     /codon_start=1
                     /locus_tag="AO090001000087"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000209"
                     /protein_id="BAE56642.1"
                     /transl_table=1
                     /translation="METPLADLAIIGAGWHGLAAAKTALALDPSVNLVVLDSAASVGG
                     VWAEERLYAELRTNNRLGSYEYGDFPMRDIIPGLVKPGEHMAGRAMHEYLKAYAAHFG
                     IRDKIKLNCKVDSVEYCERGDGGGKEWVIKCTTTTEPGHEKSNTIRTRKLILATGLTS
                     QPRIPTFSGQQSFGAPLFHAKEFARYQGTLFAKPSNDNTGDQHEGASDDHRPITVLGG
                     SKSAWDTVYACASKGHRVNWVIRPSGTGPAWVSPAAVFSPINLLLESLPVVRALGWFS
                     PCAWVSHPIRNFLHGTWLGSIIVRLFWASLEWDMVRVNRYSDHEETAKLRPWFKPIWI
                     GTAVSIINFPGDIFRLIRRGLVKVHIADIERLQPYKVVLSNGGDMLDTRALILCTGWK
                     VSPGIRFLPGGTEQEMGFPWAADPIDQELVRQARKDIYTRLPMLHSGPERRTYHTKDA
                     EGQTHTNETILHPFRLARFIVPPGLWDDHCIAFLGTVTTFNTPLVAEVQALWALVYLN
                     HGSELHHHHQGKESIINETALHTEFCALRSPAGHGVRTADFVFEIMPYLDLLLGDLGL
                     KSARKGSWWKNLFVPHQPKDYAGLVEEWKRRRSISQDGRKVKVT"
     exon            196302..196341
                     /number=1
     exon            196402..198194
                     /number=2
     CDS             complement(join(198579..198654,198755..198993))
                     /codon_start=1
                     /locus_tag="AO090001000088"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000208"
                     /protein_id="BAE56643.1"
                     /transl_table=1
                     /translation="MSGLLKEAFMLTPLNRNQHSMAHWTSTSQEYAPQGGKAQPTTPA
                     RLDPEAKTFTNPVFEAVSPGGYRRVFSLGYLILCTLVYLLCLFFVNILARKRLSLDPD
                     VA"
     exon            complement(198579..198654)
                     /number=1
     exon            complement(198755..198993)
                     /number=2
     CDS             199600..200388
                     /codon_start=1
                     /locus_tag="AO090001000089"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000207"
                     /protein_id="BAE56644.1"
                     /transl_table=1
                     /translation="MSFDSTEEKTRGFSHPIYSSHKFKMSQQQQHYPSHNAPAPPPYT
                     GQYQPMPPNPQYGYPPQPYASHPQPMMGNPQYPPQPHHTQSAMRSLKIEFSSWTSRHL
                     AINDVGQGSLLYTVDLHNRNPQMEFKNVATNNTIATVHMRSLKPEMDIKLHGRDIHLR
                     VHRSMKPETTYHSIAFPTMSFTWKTTSAWKFLSFECVDQNKVTVARFTPASSCSMRKF
                     GQLDILLPQATSGAAMDELMLTGVSFMYYQYLSHTRNTTVAVTA"
     exon            199600..200388
                     /number=1
     CDS             join(200915..200971,201030..201560,201611..201745,
                     201798..202508)
                     /codon_start=1
                     /locus_tag="AO090001000090"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000206"
                     /protein_id="BAE56645.1"
                     /transl_table=1
                     /translation="MPGVPSGRACEGCRRQKKKCDEKQPTCGRCLRLNIPCIGSGQRR
                     FKFQQEYTIPIMVKKGKIKGQSPKDQTSSSSDEERTEVSRVSPHPSSALTVLTQAFVQ
                     AIHPSTDIRWNLAWMYGGFLRDVPARLGTNEALDTAADAVICMHREFCTSRKVSVKGL
                     SKYGRALNTLHTYLDDPVKAASTDTLCAVTILLLCQGFLPGQGKVQSGHAEGAAQILK
                     ARKNFRPRDDFEAKLLLTLRGPVLFEGLFVSSIDLSGEEYESLVESDLDAGTPDGHMM
                     RCLARVPGIRDRIASTMPGDAEFESLRHETRALYESYQPILTALQARTTSIETPLATG
                     SMYRMCTLLHAQYQRMYGLGLTVAIILNCLARALDPDDPTLPVESTYFAQEIVLLSDT
                     QVAFRPLGSFYMLVCLLTARVGTADKIIRATVEKALDDYQRDFDGGCAAETIAEFEEK
                     VRHVSVFSANEEDNAVSRLEYTTLVEV"
     exon            200915..200971
                     /number=1
     exon            201030..201560
                     /number=2
     exon            201611..201745
                     /number=3
     exon            201798..202508
                     /number=4
     CDS             complement(join(202665..203119,203182..203284))
                     /codon_start=1
                     /locus_tag="AO090001000091"
                     /note="peripheral-type benzodiazepine receptor and
                     related proteins"
                     /old_locus_tag="AO070336000205"
                     /protein_id="BAE56646.1"
                     /transl_table=1
                     /translation="MAWSIALPREVFTSPILSVTTPTTVGMLVGYLVNRAGGTKQTYK
                     SLQKPAFYPPAWLFAPMWTVLYGVMGYAAHHATVAGYSALTSSTAAQSLGTNWETLYT
                     TQLALNYLWMPLFFGIRRPAWALADILLLGGNVAALMQTWWKTDRTAFWLMVPYAGWL
                     GFATYLNAGVGVLNKWTIGEKPKDQ"
     exon            complement(202665..203119)
                     /number=1
     exon            complement(203182..203284)
                     /number=2
     CDS             join(203835..204433,204489..204745,204917..205028,
                     205077..205503,205529..205543)
                     /codon_start=1
                     /locus_tag="AO090001000092"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000204"
                     /protein_id="BAE56647.1"
                     /transl_table=1
                     /translation="MNHRSPDVQRQEIDRVLQLKRKQREAKACYPCRQRKVKCDSGHP
                     CRTCQKRGHPHICAYDVSKDSSRHSFPRSGRVDPVHASPSHRPAGIASPLTPSPSALN
                     GAETERAQPLDGPSPSGAAPRSGSTSRDRSSDYVFSGKNSVVSILRLQDPDGSIAREA
                     GSVLGLQNTYEYYPFLDIKTPTDRWCALLDILPQRTEILKFFHHYRLSAHPFNPILVD
                     IDGVESAICTYLESVASGELSNPNKISERWSSDKSIGHISLLLATLASGAHFSDLENP
                     QRSEVCQDLAWALLGTTVRLAQALGLHTERGTSHLPESVRSKAKKLWSMTVWQDCLLS
                     LCYDRPPVVSISGWQQSIGPTPALALSFTDVMHFLCQLGLDIAKVQEPEHWDLTRATE
                     LLSALDNVYSRAQPHLLSREHCHCLQEHQEHLALRMHMSFCVSVLCRPTIRSSPSRLD
                     DPHYSRLRLRAKDSLIFKL"
     exon            203835..204433
                     /number=1
     exon            204489..204745
                     /number=2
     exon            204917..205028
                     /number=3
     exon            205077..205503
                     /number=4
     exon            205529..205543
                     /number=5
     CDS             complement(206634..208145)
                     /codon_start=1
                     /locus_tag="AO090001000093"
                     /note="3-polyprenyl-4-hydroxybenzoate decarboxylase and
                     related decarboxylases"
                     /old_locus_tag="AO070336000203"
                     /protein_id="BAE56648.1"
                     /transl_table=1
                     /translation="MAAINEVDHSFRAFVEALKADDDLVEINTEIDSNLEAAAITRLV
                     CETDDKAPLFNNLKGMGKNGLFRILGAPGSLRKSKRDRYGRLARHLALPPTASMKEIL
                     DKMLSASQLPPIDPKIVETGPVKDNSLEGDEIDLTALPVPMVHKSDGGKYLQTYGMHV
                     VQSPDGKWTNWSIARAMVKDKNHLTGLVIEPQHIWQIHQMWKKEGKDVPWALCFGVPP
                     AAIMASSMPIPDGVTEAGYVGAMTGRALELVKCDTNHLYVPANAEIVLEGTLSITETA
                     DEGPFGEMHGYVFPGDSHKCPVYKVNKITYRTDAILPMSACGRLTDETHTMIGSLAAA
                     EIRKICQLAGLPITDTFSPFEAQVTWVALKVDTAKLRQMKLAPKELQKWVGDVVFNHK
                     AGYTIHRLVLVGDDIDPYEWKDVMWAFATRCRPNADEMFFEDVRGFPLIPYMGHGTGS
                     PTKGGKVVSDALMPTEYTTGADWEAADFEHSYPEEIKAKVRANWEALGFRKQD"
     exon            complement(206634..208145)
                     /number=1
     CDS             209204..209926
                     /codon_start=1
                     /locus_tag="AO090001000094"
                     /note="3-polyprenyl-4-hydroxybenzoate decarboxylase"
                     /old_locus_tag="AO070336000202"
                     /protein_id="BAE56649.1"
                     /transl_table=1
                     /translation="MLSSFLPSGTNTSNSGHHSPDNASETQSTTQSAPLEHISTAMPP
                     VPTKGRRKRIVVAMTGATGSILGIKVLIALRRLNIETHLVISKWAEATIKYETDYHPR
                     NVRALADYVHNINDMAAPISSGSFKTDGMIVVPCSMKTLAAINSGFCEDLISRTADVM
                     LKERRKLVLVARETPLSDIHLRNMLSVSQAGAIIFPPVPAYYIKAASVDELVDQSVGR
                     MLDLFDLDTADFARWEGWKKDN"
     exon            209204..209926
                     /number=1
     CDS             complement(join(210590..210680,210739..210958,
                     211021..211333,211398..211487))
                     /codon_start=1
                     /locus_tag="AO090001000095"
                     /note="amidases related to nicotinamidase"
                     /old_locus_tag="AO070336000201"
                     /protein_id="BAE56650.1"
                     /transl_table=1
                     /translation="MQLSKIFQTIALLGASVPALAWNRIDKDNAALLVIDHQVGLAQL
                     VRDYSTNDFRNNMLAHAAIGNVFDLPTVLTTSSDTGPNGLLLKEIRDMHPNATLVQRQ
                     GEVNAWDNEEFRAAVRATGKKQLIIGGIVTEVCTAFLALSLVDEGYEVFANTEASGTF
                     DARLAEDANRRMEKAGVTLMGIFGIVTDLMRDWRNTPGLTEVLPMLDKYQFAYGLVAR
                     HHAGAIENGTLATVESTLI"
     exon            complement(210590..210680)
                     /number=1
     exon            complement(210739..210958)
                     /number=2
     exon            complement(211021..211333)
                     /number=3
     exon            complement(211398..211487)
                     /number=4
     CDS             complement(214083..215816)
                     /codon_start=1
                     /locus_tag="AO090001000097"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000199"
                     /protein_id="BAE56651.1"
                     /transl_table=1
                     /translation="MGESTPPSDSEFTICWVCTLLKEYIASRQVLDDIYDETTPASKG
                     ICNYYTLGRIGGHKVVICCCLPADQSAMVSVPRVMEYMQKRFTSMRFVFNVGIAGGAP
                     SSKYDVRLGDVIIGTRVVQHRFRKGTSDGYIFAGHSLSPPRALLHAVTALKTRLFYGL
                     DLSESFENAYTRSPTIEATFRRPEARTDRLYKSQFVHTNGCDCLKECPRQSSEIIERQ
                     ARQDHRIEVHDGVIALVEKDIKDAVARDQLTSELDALCFDRETSELCDSVSCIPIRGI
                     CSYSDSHGNEQWNGYAAAAAAVCARELLLTIPPVQLTSMESVNEPEQWAFNFPDFTQL
                     LEKVPSRIATTMHSALIGICVLLAIFGQLIWSFYVWMLSVAADIRSPAFNPPVKAAQL
                     VEGHTQKLEGAPIHINIYVDQQAVSHARRQSEANWIDSPHQCPTEFSKVQWNGAGRDK
                     VSGSTAELLQGVRALIGKEISRNISISIPHDIGDPLSPIDSSCDPLERVPIERTESVS
                     SASKPPVPPRSKKPRGYISRRNTQIPVPNSMAKRNKLSAENENHKLSESGEEVPEIVA
                     LINEFRGRASV"
     exon            complement(214083..215816)
                     /number=1
     CDS             219881..220312
                     /codon_start=1
                     /locus_tag="AO090001000098"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000198"
                     /protein_id="BAE56652.1"
                     /transl_table=1
                     /translation="MRFFGGVIATFVVCSSLADAFCHDSISCMVGGDNVCNNVCVRQG
                     NPNGGRCLPRDGCPGNDICACYPQSKRSDGVIDGDASIREVLKDFGIDGGAEKELNAR
                     EKRSISCNFPDPFGGLICENHCAYIGKPGGQCSDQKVCTCN"
     exon            219881..220312
                     /number=1
     CDS             222379..223500
                     /codon_start=1
                     /locus_tag="AO090001000099"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000197"
                     /protein_id="BAE56653.1"
                     /transl_table=1
                     /translation="MKAVGGNVTLSDGGKLLLERLQSQSETPLWVLAWGGTNVLAQVL
                     YKIHQNYSSEDAAAMRSKLRVYAISDQDDTGPWIRRNYPDIFYISSTHGWNQYGMATW
                     IAISGETYYNKDEGVPNSTTVTHEWLRDNIQIGPYGSVAYPDFKFIMEGDTPTFLYLI
                     QNGLGDSENPGYGSWGGRYTKVDPSTAVDYNHYSDAADRVVGCNNKTFSSNYATIWRW
                     RDAYQNDFAARMQWTLPANSSMANHHPVVSVNGSKELAAFKVTAAAGSTINLDTAGTY
                     DPDGDKLSYNWFQYEEPGSDDWNVAGQVPALNLTTVQNGQQVQVKIPASEDSCNGKGD
                     NPSGCWLLHLVLEVKDNGIHPLTTYRRVLIQTTNQTIST"
     exon            222379..223500
                     /number=1
     CDS             complement(join(223679..224524,224604..224828))
                     /codon_start=1
                     /locus_tag="AO090001000100"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000196"
                     /protein_id="BAE56654.1"
                     /transl_table=1
                     /translation="MRGCRTFQSLVPRLDSHIQEPDDLDIERRSKIILTGIDDASLPE
                     RDDSNHTPTPVDWLPARHAVSNGRIVNPFVDDYNISDAEFAFHPWCFGTYMQLSRLRL
                     GYIEVDRLPSFFQNIGRYPRDFYYSPGSDVEEAWFVDMWSCNAGSEWLAANPYHVPKL
                     RELLDRAMTTDASFNLQAGVFNSQAALRNTVNGPAVTPDNFCRLPQEIRNMILSYLNS
                     RDIATLRLVSRTFYRLPVFLWYRLLKEEMPWLWEIWSDESPYFWATVTGEDIKNNGHR
                     VLDSHTSHPTIVSHTIDVQEHLSQWTLPKPPYGRTNWYMLYLDIKRNWKELRGLRNRE
                     RIWNYQEKMLVSLKMHIQDVAI"
     exon            complement(223679..224524)
                     /number=1
     exon            complement(224604..224828)
                     /number=2
     CDS             complement(226075..227787)
                     /codon_start=1
                     /locus_tag="AO090001000101"
                     /note="phosphomannomutase"
                     /old_locus_tag="AO070336000195"
                     /protein_id="BAE56655.1"
                     /transl_table=1
                     /translation="MASPSASDPLRCHLTYEPVPLKFGTSGRRGKVVDLTQLEIYTNV
                     LAEIRYLQSLDQQEGGIKRGDDFYFAYDLRPSSTSYVEEGRGGLSQAVEQALKDEGMH
                     PINLGAIPTPALTYYALKHGKGSIMVTGSHIPFDRNGYKLNTSKGELLKKDEQPINNN
                     VQVTREELLSQPYAESLFNQQGMLRSAPSNLPPVAPEGRAAYIQRYTDFFRGETLKGK
                     KLLVYQHSAVGRDVLVEILEKLGAEVVTAGRSDTFVPIDTEAIDQAQLDTVQNLYDST
                     GQQFDAVVSTDGDSDRPLILAPEGGKLRFFGGDLLGMTVAEFLGADSVVVPISTNDAM
                     DRGSLASVTEPKTKIGSPYVIAGMQHSLSKGRRRVCGWEANGGFLTGSDIERNNNILT
                     ALPTRDAVLPLLCALFAAGNRGITLPELFATLPKRASRAALIRNFPRATSLKIIDRFS
                     PPESTIQEVSYQADHVVAYNGSRAQLEVTESHAKKLEQIRQELETVFSPEYGFSSIAR
                     LNYTDGVRIIFASGDVAHFRPSGNADELRIYAVADTQERADAIASQGVAEPNGLLRSL
                     ERTV"
     exon            complement(226075..227787)
                     /number=1
     CDS             join(229123..229376,229836..229977)
                     /codon_start=1
                     /locus_tag="AO090001000102"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000194"
                     /protein_id="BAE56656.1"
                     /transl_table=1
                     /translation="MARRFGLSNPQVVMTSKRETGTPQCMFQSGKRCYIWNEMDDMVW
                     QITKPVGVMAILRTMVTKGEKALKVKEVEPAEDYNDEDDNDTPAAFVVKRRQGKVQSF
                     SSGLVRRGIGQAKLPQGPGALCSTGPCTI"
     exon            229123..229376
                     /number=1
     exon            229836..229977
                     /number=2
     CDS             join(232903..232952,233069..233140,233191..233331,
                     233386..233428)
                     /codon_start=1
                     /locus_tag="AO090001000103"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000193"
                     /protein_id="BAE56657.1"
                     /transl_table=1
                     /translation="MADAGEMLMGPLGRELLWAYCFALDVAVADVGKDVLALIGLVYK
                     YLQRGYDCYDRDRHSETRSCYYCCQSPEPGNRSDFGLEYRPILCHQRKSSLTKHSEP"
     exon            232903..232952
                     /number=1
     exon            233069..233140
                     /number=2
     exon            233191..233331
                     /number=3
     exon            233386..233428
                     /number=4
     CDS             complement(join(236092..238119,238291..238602))
                     /codon_start=1
                     /locus_tag="AO090001000105"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000191"
                     /protein_id="BAE56658.1"
                     /transl_table=1
                     /translation="MRLNRHVALLGLLHATGGAVYGSPAPALAYTAKTYTSSEGTPMI
                     FDEGTLIKLSCNGTTPSVVILDYGRNVEGYATFHVSKRSGDTSAFEMTYSETRALLDS
                     DMKLNLSSAGEVELSGIGFKPTVSSTPIAALPGSFSCSDPVLNRIWQVGARTTQLTEI
                     PANSLPDFWVITDEEAFIESLAPQPLNADFATSMTAYDLEFSVRPIMNGFGFTVLSDT
                     IASGVYIFVNAANSSISAHAGSTERSKPIASAKLTSNITLNQWHTVHSTVKMADISVR
                     IDGVPVFSFSQSAAFYGSFGLGASLGHSALFTNVSLGVSGKKMYNSPLNDSSVLQDFL
                     LGTNPLPVSVDGSRRDRIAYMGDLDIATATSFASTYGREYINGTIELLGSFQMPPGFF
                     VPTAKVQQAPRATEINANITGLIGYSFSIVSAMARFYEQTGDTDFLSHWAPKTARMLD
                     WAHSQTLPNGLFNISNPALGGDWNHYDPALDGVVSKFNLIYAYALKQWLPFMDNAGLN
                     TTLYAERLDNLQNAINTHLWSHTLQAYYVSDSHKDFLSQEANALAVLADTATYGNRTS
                     ATVLSTLSRELYVPSGALAFSNKSVASGWAQKISPYASGYHLKAAFHANDSVNANYLL
                     HSVWGPMSDPLHTNYTGCMWEVIAADGTPGLGSGTSLCHVWSSGPTADLSRYVLGVQP
                     VTPGFKEWKIVPQSLDLNWAKGAYPVPGGRIYVDWSFDSSDLLHMNVTAPNGTKGTVY
                     LPTPLRKSLNKYNATGFLSNEKGSFTVQGGETFSIHQTN"
     exon            complement(236092..238119)
                     /number=1
     exon            complement(238291..238602)
                     /number=2
     CDS             join(241388..241475,241533..241688,241771..241955,
                     241983..242341,242410..242503,242553..242880,
                     242940..243048,243094..243462,243523..243832)
                     /codon_start=1
                     /locus_tag="AO090001000106"
                     /note="UDP-glucuronosyl and UDP-glucosyl transferase"
                     /old_locus_tag="AO070336000190"
                     /protein_id="BAE56659.1"
                     /transl_table=1
                     /translation="MDSHLYDEPPPSYDVAVSGDCMDASTLVRNDGRVDVTVVAKQAG
                     LNDFLPSNLPTETRPLPDVPLSAITPLNIVIQIVGSRGDVQPFIALGTRLQKNGHRVR
                     LATHGNFRDFVHKAGIEFYPIGGNPEELMSVSIFLTLDRDKFMVKNPGIIPKMSTIAG
                     GEIGRKRQMIAEMLDGCWRSCVEPDPETKIPFVADAIIANPPSFAHIHCAQALGVPLH
                     MMFTMPWSPTKEFPHPLANVKGSGTDASLRNYMSYSMVELLTWSGLADIINRWRVKAL
                     NLEELSPRTAAGLMEAMQIGHHILVHNPSPSCYALTDLCPSIDVCGFFFRDEPLYTSP
                     EIQEFINRGSMPVYIGFGSIVMDDPAAMTAMIQGACQELGIRAIVSKGWSKLGQGCND
                     PNILFIDDCPHEWLFKHVAAVVHHGGAGTTACGLLNGCPTAIVPFFGDKKLTMTSQPF
                     WGKMVAAAGAGPSPIDHKVLTVKLLSEAVAFCLTRNAQQAAASIAARMKSEDGVSNAA
                     ASFHRHIPWKDVKCDLLPSEAAAWLVDKKRGLKLSHKAMVILSQHKQIDMQHLKPYRA
                     KEMRIEKIYTDPFSSTSAAVLNTMTDFTVGLGKLSTSPTKGMTQMTSSLVKGTLVNAP
                     TALAEGLRNVPRLYGERPEKPVPIEGWKSGMTHAGKVSREP"
     exon            241388..241475
                     /number=1
     exon            241533..241688
                     /number=2
     exon            241771..241955
                     /number=3
     exon            241983..242341
                     /number=4
     exon            242410..242503
                     /number=5
     exon            242553..242880
                     /number=6
     exon            242940..243048
                     /number=7
     exon            243094..243462
                     /number=8
     exon            243523..243832
                     /number=9
     CDS             join(243958..244114,244169..244356)
                     /codon_start=1
                     /locus_tag="AO090001000107"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000189"
                     /protein_id="BAE56660.1"
                     /transl_table=1
                     /translation="MICLVQSLYTGFADGLTGFVTKPYREAKTDGAAGFAKGFAKGSV
                     ELFSKPGAAMFGLMAYPAMGIYKSIKKGNLNPTERKIVEAQIELGDYMLQSFPASPAE
                     IEMVLSRFNTLS"
     exon            243958..244114
                     /number=1
     exon            244169..244356
                     /number=2
     CDS             complement(join(245686..246115,246180..246566,
                     246640..247022,247161..247286))
                     /codon_start=1
                     /locus_tag="AO090001000108"
                     /note="metal-dependent
                     amidase/aminoacylase/carboxypeptidase"
                     /old_locus_tag="AO070336000188"
                     /protein_id="BAE56661.1"
                     /transl_table=1
                     /translation="MHLTKPCHLIFFHCSTATALKVVISEENDYHSCNHILEQRGPTW
                     SNPELAYEEHKAHDAICDFLEGQGFTVTRHAYGVDTSFECISGTEGRLINLNAEYDAL
                     PDIGHACGHTLNATSSIAAFLALSQLQKKSGIKGRIQLLGTPAEEDGGGKAKLIDAGA
                     FQGVDISLMAHRGPENLGGPTGDGVAGVLMNARKELHVEYFGKNAHAGGNPWDGVNAL
                     DALVQAYNGISTLRKQILPEERIHGAFLDVPKVANVIPAYTNSYWQVRSPTLQGLNKL
                     IAQVRQCIEGAAVVTGCTAKIDEDGLYADIILNETLCERFTRPMAAYGKKFVQKLDQV
                     LTGSSDVGGFCKATISILLNRVTNILQGNVSYVVPTLQAMFAISTSNGSFPHHPDFTA
                     CAGTDEAHDAAVLTGKGLALLGWNMLTDDTLYTSARVQCEGQIPKEAAH"
     exon            complement(245686..246115)
                     /number=1
     exon            complement(246180..246566)
                     /number=2
     exon            complement(246640..247022)
                     /number=3
     exon            complement(247161..247286)
                     /number=4
     CDS             join(248272..248420,248475..248581,248620..248752,
                     248806..248964,249036..249405,249460..249867,
                     249928..250128)
                     /codon_start=1
                     /locus_tag="AO090001000109"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070336000187"
                     /protein_id="BAE56662.1"
                     /transl_table=1
                     /translation="MGTEKEPHNDDEKAVYATQETEQDLSTEECTDFQVSPEAERRLL
                     WKLDLLQISMLPTMGICYMLQYMDKLALSQATLLNLRQDLVTWQGLIGNQYTWCSVVF
                     YFGYLAGSIPTSYLMVRLPLGKYVSTSVFLWGGILMCHAACQNYGGLVTARFFLGVGE
                     AAVAPGFGLITGMFYKREEQPARQAAWFIGNCIANIIGGVVAWGIGNSASGLQSWRLL
                     FLVLGGITSGYALILFFILPDSPAKASFLSESERTIAVQRTLQNKTGSAAVTEEFLWD
                     QVIDAILDPQAWLLILYTFCVNLANGGLTSFSTIIIAGFGYSNFESLLLQMPMGLCQL
                     IFLILTALIATYIRSSRIMSMILNVVVSVIGVVLIYTLDDSQKVVKLVGLCFVATFAA
                     NIPLSLSIITSNVAGTTKRSMLSVSLFIAYCVGNIVGPQFYYASQEPVYSSGIEATLC
                     GLVLGVFFLGCLFVYYIWENKRRDRQHGVMNEGLDVHDLVEEQNRKTDRQIPGFRYTI
                     "
     exon            248272..248420
                     /number=1
     exon            248475..248581
                     /number=2
     exon            248620..248752
                     /number=3
     exon            248806..248964
                     /number=4
     exon            249036..249405
                     /number=5
     exon            249460..249867
                     /number=6
     exon            249928..250128
                     /number=7
     CDS             join(251040..251062,251139..251442)
                     /codon_start=1
                     /locus_tag="AO090001000110"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000186"
                     /protein_id="BAE56663.1"
                     /transl_table=1
                     /translation="MGVTEIKTPAEFQEKVIDSNEPVVVDFFATWCGPCRMITPAIER
                     LSNENQGVKFYKVDVDGLNTVAADLGIAAMPTFVFFKDGQQIKELTIRGANPGGVQNS
                     VKALLA"
     exon            251040..251062
                     /number=1
     exon            251139..251442
                     /number=2
     CDS             join(254163..254428,254491..254890)
                     /codon_start=1
                     /locus_tag="AO090001000111"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000185"
                     /protein_id="BAE56664.1"
                     /transl_table=1
                     /translation="MVSFSSLLLAVSAVSGALAAPGDSTLVELAKRAITSSETGTNNG
                     YYYSFWTNGGGDVEYTNGNGGQYSVKWTNCDNFVAGKGWNPGSAKTVTYSGEWESNSN
                     SYVSLYGWTQNPLVEYYIVDKYGDYDPSTGATELGTVESDGGTYKIYKTTRENAPSIE
                     GTSTFNQYWSVRQSGRVGGTITAQNHFDAWANVGLQLGTHNYMILATEGYKSSGSATI
                     TVE"
     exon            254163..254428
                     /number=1
     exon            254491..254890
                     /number=2
     CDS             join(255532..255706,257597..257984,258058..258839,
                     258891..259147)
                     /codon_start=1
                     /locus_tag="AO090001000112"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070336000184"
                     /protein_id="BAE56665.1"
                     /transl_table=1
                     /translation="MELIERCVYNPPTPPKRTREKPMKVLALGMSRSGTESLSRALRI
                     LGYDHVFHGFEMWESVMSGLVGADNRFGRDFNNPDANMQGNITALYDIGCVIGSIVSY
                     FIGERMGRRTMLMLGGFIMVIGTIILATSNTVAQLIVGRIVTGVGNGMNSSTAPVYQS
                     ECSPASYRGTLLTLQGTVTILGVVIAYWMDYGTSFYESSFQWRFPLSFQAVFAILLIL
                     QVIGLPETPRWLVQHDRHEEARAVVAAIEDRPLDDALVSKTILDIQVGLEEEQRGGPF
                     SFKELFTWGEVQNLRRMLITISIELGQQFTGSNMINYYGPVMFQETMGMDRNMAMILG
                     GCIQCTYLVGSAIPVFLMDRFGRRTLLIICSAGLCLCFVMVSILLSLNRMDCAYGATA
                     FIFIFQIFYGVGWLPVPWFYPSEINTTRVRTRMSAIASGWNWMAVFAVVKITPIAFDN
                     IKWKTFVIFAVLNAAFIPMVYFFYPETKGLELEDIPLLFTKGGITGGVYSSKGGRTVM
                     PGQHAQETRVNEKVEGVVQQVEDVS"
     exon            255532..255706
                     /number=1
     exon            257597..257984
                     /number=2
     exon            258058..258839
                     /number=3
     exon            258891..259147
                     /number=4
     CDS             complement(260436..261683)
                     /codon_start=1
                     /locus_tag="AO090001000113"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000183"
                     /protein_id="BAE56666.1"
                     /transl_table=1
                     /translation="MHLTSLIVTAGVVAAAPSFSRRGAASHKPNVTNIQVGPRPYFLV
                     DDMDEGPLKSKLESCAETPIRHAPQFSIAHRGGPLQIPEHSRQGMMAAARMGAGIIEC
                     DVAFTKDRELVCRHSQCDLHTTTNILTIPELAAKCTVPFQPATDSTPAKAKCCTSDIT
                     LAEFKSLCAKMDSSNSSATTPEEYQYGGPAWRTELYDTCGTPVAHHEYIELIESLGLQ
                     FSPELKTPQVTMPFQGNYTQEMYAQQLINDYKRHHISPSRVWPQSFLDKDIFYWIQHE
                     PAFGKQAIYLDERTDTEEGYKAAVASLPELAEKGVKIMAPAIYALLNATEDGELVPSE
                     YAVAAKEAGFDIITWSLERFPPLAQAAAEKDYYVQSFTSAVGKDGDMYRIVDALAQKV
                     GVRGIFSDWPATVTYYASCMGLN"
     exon            complement(260436..261683)
                     /number=1
     CDS             complement(join(263926..264210,264222..264752,
                     264831..265010))
                     /codon_start=1
                     /locus_tag="AO090001000115"
                     /note="voltage-gated shaker-like K+ channel, subunit
                     beta/KCNAB"
                     /old_locus_tag="AO070336000181"
                     /protein_id="BAE56667.1"
                     /transl_table=1
                     /translation="MPLPVHPPPRSPLDRHRQLAPSASVRVTPLCLGAMNFGDAWKDS
                     LRECPKETAFKILDYFITQRQNRDQLVLASKFSSSYKNHESDKLQSTYGGNGGKSMRV
                     SLELSLQKLQTSYIHLFYLHWSDYTVSIPELMHTLPIWWSAARSFTSGFLITRPGWLL
                     RPINTFVITVYANSPCTKVVSFRGFEREILPMYRDENMGEVLWGTLSQGQFHTEAGYK
                     EREQNNPGGKGRHPQMAREVLETIANSKQTDLTSIALAYVRHKAPYVFPVVGGRKVEH
                     LRGNIAALDLSLSVEEMAQIEAAYPFDHGFPHTFLSGTLFDGSTPRTPDGPGACG"
     exon            complement(263926..264210)
                     /number=1
     exon            complement(264222..264752)
                     /number=2
     exon            complement(264831..265010)
                     /number=3
     CDS             complement(265369..265788)
                     /codon_start=1
                     /locus_tag="AO090001000116"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000180"
                     /protein_id="BAE56668.1"
                     /transl_table=1
                     /translation="MDWLEEEEAISPWCTSGFESEISLCPTSLRPTLLQQEIPHHPWI
                     DLFPIPQMRDNLLQRYGDFDETALCNDLVDFYDVSNDETGLIVWRTPWHPTGWEVSET
                     FLRKWSWVVRGCDDLANSTNYWRGLRGEEPLVFDTGL"
     exon            complement(265369..265788)
                     /number=1
     CDS             join(269805..270137,270209..270553,270606..270923,
                     270976..271097,271168..271464,271527..271806,
                     271862..271907,273411..273586)
                     /codon_start=1
                     /locus_tag="AO090001000117"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000179"
                     /protein_id="BAE56669.1"
                     /transl_table=1
                     /translation="MPYLITGIPKDPKHPLPIRKDIDDWYLEQTSAGSNRIQLTLFVE
                     ALTVIQNRPLNDQLSYFRLAGIHGAPWTEWDGVPGGQKDSKGNPTGFCVHNNYTFPTW
                     HRVYVTLYEQVIYEAMLDFIKQNVPQNGKADWENEAKQWRLPYWDFARFARHGHDNTQ
                     GDELRLPILVTMPMVKVLVPGQPGKQLSKPNPLYRFQMQTLMGTLERPYAITSQKTEE
                     HGWSFDLPFDKCQSTTKYGLLENYNADVWADGGQNWLRANLALNEHPWYQNLDGWASV
                     PTLQDMTFRLLTTGGLNWGEFSSTRYDDKKEEAQPKNNEQAPKNWMNLEAIHNNVHNW
                     VGGFMFSRPGRHDLKLWGAGHMSSVPVAAFDPIFWLHHWLTAIWQTVNSGSWFNDDKS
                     KVSKDDDLRPFHRFCEKTRKVVFFRSDDVKDWRSLNYDYAITKDASRIRKEISDLYGQ
                     RTKEVYKDFGEEDYILSIRYSRYALGGKPFQINIFFGDVDGKDFYDARSQNFVGSVFN
                     FSGSLEDSNCDKCAQQEQEGVLSVSQLPARLAVHYYKKQNKGEVPTPRYVVVNSQGKA
                     EAEVKVEVALHKTEVFHSVDSESWDLRMEHTHCFSTHGMGGHYHYDTTAEVVEYEAWL
                     NTAKVIYRIDQPGQ"
     exon            269805..270137
                     /number=1
     exon            270209..270553
                     /number=2
     exon            270606..270923
                     /number=3
     exon            270976..271097
                     /number=4
     exon            271168..271464
                     /number=5
     exon            271527..271806
                     /number=6
     exon            271862..271907
                     /number=7
     exon            273411..273586
                     /number=8
     CDS             join(273896..274016,274076..274476)
                     /codon_start=1
                     /locus_tag="AO090001000118"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000178"
                     /protein_id="BAE56670.1"
                     /transl_table=1
                     /translation="MPENRSVKAALALIEDPTKILGMTVGPHADVKPGQYIPKAEAQS
                     HPTLSFDAASPSATYMVVSLDIDAPFPSFGVLGPILHWIQPGLKARNGQLEVTEPFVA
                     NYIGPAPPPGSSPHRYIFFLYEQPEGFDGRRYAPPNGQNLSNWYRMRYDLDAWEKEIG
                     LGKVLAVNYFTSN"
     exon            273896..274016
                     /number=1
     exon            274076..274476
                     /number=2
     CDS             complement(join(275227..276356,276448..277370,
                     277431..277594))
                     /codon_start=1
                     /locus_tag="AO090001000119"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000177"
                     /protein_id="BAE56671.1"
                     /transl_table=1
                     /translation="MSASFNSPLRRRPLACMRCRRRKVRCDGGTPACSNCARAGVECF
                     EGTPGSAVSKSRLQYLENRVRELEAREETETSANIRAQSTPWRQEQHHHASPTRLPQQ
                     GVHSLGPTRTIHPVDVQSPLSRTAQTDDTSGASPAVSSSSRITRDQPLAHEVGLLSLT
                     NASDPKYLGPSSGVTFARLIYESVPQSQGLPLAYSRQNDQDQGLNDPGQCPVLCEALQ
                     VDLPSMAECQQYAEMYFAASTFYPFISQGVFYTLLGQVFHLSKTSTWESRLPVKLALA
                     QVFLVLSLGARSLEIKLSGTFGSRELFTTGMSYGTQIKLHDSIEGVQILLLLVQHSFY
                     SPEGLNAWYLLHTILASCLDLGLQRRDNSSKENESPYQRNIRHLRSAIFWSAYSMDRT
                     LTTILGRPLTLRDEAIDREFPGFDSNDEVEEAATYWDRNPNSQEEAPISRRAPTSYIA
                     CIYSLRFDRIVAEIKLMLYRVSRSPSRFPWPADVGAWQREAQRACVALLQEVQDQQPG
                     RLQSGSSPLSGVAVQRLELKYHQCIMLLYRPSPQMPRPSLDAVQECFTSAMEIIAIYA
                     DLHRFLNMECSWLSAHSIFVASITVLYCVWTYPVVRGTTPMDVCLKRAELALQLLSFL
                     GQTWTVAQEAGQKLAKLIKSTSEAYDVLTGAPVDPQSLDNNVWTGNDSTGFAQRPNAD
                     RTYSNQEGSATNAPPADGKSFLIDELGILRDLFDLGWLDDVPDGNQSFFGLQTDMA"
     exon            complement(275227..276356)
                     /number=1
     exon            complement(276448..277370)
                     /number=2
     exon            complement(277431..277594)
                     /number=3
     CDS             complement(join(278004..278889,278943..279040))
                     /codon_start=1
                     /locus_tag="AO090001000120"
                     /note="fructose/tagatose bisphosphate aldolase"
                     /old_locus_tag="AO070336000176"
                     /protein_id="BAE56672.1"
                     /transl_table=1
                     /translation="MGSDNSTYPASNLTWQILNHANENNYAVGAYNCYNNDGIMAVIR
                     AAERKRSPAIIQLFPWTMYFQGPEFIRYVVRAAHAAAVPIAVHLDHCIKSEDVELALS
                     LPLDSIMVDASTLDEEANIRYCKEIVDRAGALNITIEAEMGRIEGGEDGLPTVDMEAV
                     MTRPEDAETFVRRTGVHFLAPSFGNIHGGYPAGGAEKAWDLERYVQNYFFLRRPLAIY
                     ALELFHIHADRLTFVWCDSSLAAIGKLVSGTTPLALHGTHPVSDELFQRTITCGVRKI
                     NLNRTVRDDYTDFVAKKASSLELTALKVQAVEIYAKSIERMMDVLGSSGRY"
     exon            complement(278004..278889)
                     /number=1
     exon            complement(278943..279040)
                     /number=2
     CDS             complement(join(279612..280553,280625..280728,
                     280810..280846,281795..281821))
                     /codon_start=1
                     /locus_tag="AO090001000121"
                     /note="malate/L-lactate dehydrogenases"
                     /old_locus_tag="AO070336000175"
                     /protein_id="BAE56673.1"
                     /transl_table=1
                     /translation="MTAAECSRLKSLPIQLLHNGLPAGKFASELLVKAGLSPEDAKSM
                     ADCLVMADVRGVDTHGLARLPQYLDRVSNGRVKANPEFKLTEKTPVVAQLDGDNGFGF
                     VVATRAMEEAVKRAEIYGIGMVTVNHSNHFGMAATYVIQALEKNMISLVFTNSAKQMP
                     PFGGKETLLGISPFAAGAPSNNEVPYILDMAPSVVAKGKIRRAARRGESIPLGWALDA
                     DGNPTTDANIALNGSMAPIGGPKGSGIAILMDVMSGVLTGAAFGGEVGDQYKDTKPQN
                     VGHCFIAIKPDIFMTTDQFKARMDTLVQRVHGVTPAPGFNEVLFPGEPEHRLGMQRRK
                     EGIPYADAEKQMFLEAAKQYGVSELPLSESPLSLS"
     exon            complement(279612..280553)
                     /number=1
     exon            complement(280625..280728)
                     /number=2
     exon            complement(280810..280846)
                     /number=3
     exon            complement(281795..281821)
                     /number=4
     CDS             complement(join(282747..282894,282966..283192))
                     /codon_start=1
                     /locus_tag="AO090001000123"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000173"
                     /protein_id="BAE56674.1"
                     /transl_table=1
                     /translation="MFKFRPEVTQEHKDTFVRELRKLKELDCVKGHRLVVGGPSVTDP
                     IERTKGFEIALLSFHENLGELEKYQASKEHHWVTSTYMFPYKEDLVRFDFEVAPEDEY
                     MWHFLPVKGMNGANGVNGHETQ"
     exon            complement(282747..282894)
                     /number=1
     exon            complement(282966..283192)
                     /number=2
     CDS             join(284384..284584,284713..284986,285052..285836,
                     285915..286172)
                     /codon_start=1
                     /locus_tag="AO090001000124"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070336000172"
                     /protein_id="BAE56675.1"
                     /transl_table=1
                     /translation="MSDKVKHSLQHDEEAVPTEKGMSNRVAAAQQMSAEEFAAAEKSL
                     KRKLDARLLLSVWIMFVMNYLDRNNIAAAKVAGIAKSLNMTSEQYATAVAILFAGYVL
                     MQLPSNIFLAQMRPSWYLPGVMTIWGMLSALVGVTHNAGGLYALRFLLGFVEAAFYPG
                     ALFLISSWYRRDEMGVRSAFLFSGSQLGSAFSGLIAAGIESGMNGVRGLESWRWIFII
                     EGSATVFIAICAAFILPDWPSNTRWLSPTERAVAEWRLIADAGQVDEDDGRWSYGFKR
                     ALADWRLYVFALTFLCIQVSSATSNFFPSVVQTLGFNRVNTLLLTVPPYIVALLISIG
                     NNWSADRLQNSSFHIIWPLALAIVGFVIAAASLNTGARYFAMIAMVAGGHGSNAVLLA
                     WVQKTMLRPRIKRASAVAFVNAVGNLSQIFSSYLYPDDSAPRYVLAMSVNAAFSLAVI
                     ILTLFMRTVLLRANKRLARGETTVEQEMKGGSQAMVPGVTEEERAIRREDFRFIA"
     exon            284384..284584
                     /number=1
     exon            284713..284986
                     /number=2
     exon            285052..285836
                     /number=3
     exon            285915..286172
                     /number=4
     CDS             complement(join(286568..287020,287076..287246,
                     287349..287405))
                     /codon_start=1
                     /locus_tag="AO090001000125"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000171"
                     /protein_id="BAE56676.1"
                     /transl_table=1
                     /translation="MSSDPKDIIARLQQWGACDVADGLSKLKYPNGGFLEGLTMYSPQ
                     FQAGETKIVGQAMTVKFVPKSDVSSPKVQGNYIDKIPEGAVVFISQPLPHVNAVYGGL
                     MTLRAQALNATGVVIDGRVRDLNEHRALNFPLFAKSVGTTAGGEVCRPSEVNVPVRLN
                     SENQDAWINPGDYIIADLNGVVRLPQELAEQVLDAIPAIADADAKCAEAIKAGRSVED
                     AFREFRGR"
     exon            complement(286568..287020)
                     /number=1
     exon            complement(287076..287246)
                     /number=2
     exon            complement(287349..287405)
                     /number=3
     CDS             287922..288896
                     /codon_start=1
                     /locus_tag="AO090001000126"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000170"
                     /protein_id="BAE56677.1"
                     /transl_table=1
                     /translation="MGSITTEHKSSFPKKPVPSGAWDTHHHIFEPDRFPFAEGRHFTP
                     ARASLEDLQKFEKSIGVDHVCIAHGLSYGPDCKSLLYYLKQFQGQARGICVLDLDTVS
                     NELLDEYHAAGVRSVRLDFFRHKAMDNVQIQAELMEATAQRLAKWGKPGWSIQIQQPH
                     LEFWPRLRDVVDRSPVPVVVDHCALIAGSSYRVNDYVTNIQDGSYLAEGERIDLAALC
                     ETLRNGNLWMKISAPYRCSNLAPGYDDLRWLVRRFVDANPRRVVWGSDWPHTQRHKDR
                     VGKSSSSEEAFLQIDDKAWIESLSKWMSEDEWQLLWVENPATLYDYHE"
     exon            287922..288896
                     /number=1
     CDS             complement(289110..290162)
                     /codon_start=1
                     /locus_tag="AO090001000127"
                     /note="isocitrate/isopropylmalate dehydrogenase"
                     /old_locus_tag="AO070336000169"
                     /protein_id="BAE56678.1"
                     /transl_table=1
                     /translation="MRIGVLKGNGIGPEITAATIRVIEATGIQPEWDFIPIADEAVRL
                     YGHALPPQVIQRIKDVKFCIKAPLLAEKLHGRISCTQTDGSVVTYPSINNAIRRELNL
                     FVNPRPIRGYVGISGRHEKMDMVIMREITEDTYIGWEKPLEDGAAAEAIKRVTRSASW
                     KVSQYAFEYARKHGRKKVSCLHKANVLHETDGLFLRTFQEVARLYPDIVGDDMMIDAA
                     CYSVVRDPCWFDVVVTVNQYGDIFSDLAAGLAGSLGLAPGANIGDSASTFEAAHGAAP
                     DIAGTGAANPIALILSGAELLAHAGYGKGSEAIREAVTRVIEAGRTLTPDLGGRSTTE
                     QVADAISVEVRAILGH"
     exon            complement(289110..290162)
                     /number=1
     CDS             complement(join(290730..290904,290964..291102,
                     291164..291499,291570..291753,291819..291848))
                     /codon_start=1
                     /locus_tag="AO090001000128"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000168"
                     /protein_id="BAE56679.1"
                     /transl_table=1
                     /translation="MRKAHLEASGVFDGPSRGDRAEVKLDLKKAFQKDRVSVNDLSNV
                     SIAVLPPHNPSIDTQWSAVLQGGFKIQVTAHHVGLGRDLQNKQFNGLNEWLTPKLQWT
                     PGIGQIVWKGELGLDKWLDQDQKPLSIDEPSSGVGSCPRFIGKGGTIGKRQNDDENTP
                     PEWDVWGAFEEAKKHLEANTQVGRNRYPHQFNNREALQIPEEFRNRRLQEFPILRGQI
                     YSGQAPGAMRVILAQVGNNWLLAGVMRHPTGRGNAFELCQEWGNAYMAQCWPNGLDTL
                     QHLEYPGCDRA"
     exon            complement(290730..290904)
                     /number=1
     exon            complement(290964..291102)
                     /number=2
     exon            complement(291164..291499)
                     /number=3
     exon            complement(291570..291753)
                     /number=4
     exon            complement(291819..291848)
                     /number=5
     CDS             join(293579..293911,293977..294040,294114..294550)
                     /codon_start=1
                     /locus_tag="AO090001000129"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000167"
                     /protein_id="BAE56680.1"
                     /transl_table=1
                     /translation="MSLGLRVTNIHDEMDQMEQNIVRAVGRALADSNAESARVAADTI
                     DRLIRMKYIEERGNGNAEDLETFLWQLWDIVIQGAREILHDHPLQDRLVELVSALTEI
                     PPVTVELWESKTCLWTDLPLLGPSMREAWISPTHNNSRPTSEEAVEWINLNAFAARLL
                     NLDAISWTEFAVWELRVALEEPCEGQALECNVVVAMVWIKHAGHILYALAVSTGEDTD
                     ILEAANGLFYEGRSMLCLERWEFWKRRFSELSGHLEGNAYQVAFEAGKEMEAIERSHK
                     G"
     exon            293579..293911
                     /number=1
     exon            293977..294040
                     /number=2
     exon            294114..294550
                     /number=3
     CDS             join(295112..295302,295443..295579,295651..295751)
                     /codon_start=1
                     /locus_tag="AO090001000130"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000166"
                     /protein_id="BAE56681.1"
                     /transl_table=1
                     /translation="MGGFHVYCAICGSTFSSRSFISIDSDDEMGDHTYSGEVIGDSDL
                     GWLDDLRALGFNPDAVGERKVLSMPTQVKVVFDIPIKLFLRSNIKKIQTFPLVQTVNR
                     RIASTPICSGMMGIRNIYLFSLFISCATRRFSFGALRMKQ"
     exon            295112..295302
                     /number=1
     exon            295443..295579
                     /number=2
     exon            295651..295751
                     /number=3
     CDS             join(295917..296415,296521..296525)
                     /codon_start=1
                     /locus_tag="AO090001000131"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000165"
                     /protein_id="BAE56682.1"
                     /transl_table=1
                     /translation="MIVLQLLVTNPVEISPLTKYLDEIRDIANSEKDTSEPQEVPQSF
                     DIFNTLPYELRQQIFSLLPLSSVLALRAASWSMHTTQLPEKSWKARLEYDLPWLWEVH
                     GIDLTGSQKLEARLSKTIVELEGKSQYRSDKVDYIPGLANRRRIWMVCEDIKDMYHET
                     LAERAKI"
     exon            295917..296415
                     /number=1
     exon            296521..296525
                     /number=2
     CDS             join(297131..297985,298036..298088,298136..298258,
                     298306..298588)
                     /codon_start=1
                     /locus_tag="AO090001000133"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000163"
                     /protein_id="BAE56683.1"
                     /transl_table=1
                     /translation="MKLSGSSALLLLGFGLLGHASPLVHVQGKNCTVKPLGHGQDDVP
                     NILHAVEKCGQTPGGRISLPAPYTYRINQRMTTHLESSTLEVGGMLLFSDDITYWVNN
                     SYRIDFQNQSTAWRITGHDYVVDGGPERGGIDGNGQLWYTWAKGGSNVFGRPMPLHVL
                     NSTRAVLRNIAIRQPQFWAVLVESSSHVELDNFYVNATNSDPNATEDTVWIQNTDGID
                     TYRSDHVTITNWVYEGGDDAVAFKPNSTNIHVENVTVYGGPGIAFGSLGQYPDRYDIV
                     ENITVKNANFQPSSQRAMNSGIYFKSWIGVNFGVPPNGGGNGHGYVRNVTVEDITFKD
                     VQLPIYIDTCLSYLFDQNVTQYCDTSTFRFDDLHFRNISGNGLATPTNYTGRNITFAV
                     SMICSKEAPCTDITFEDVDIKLPESYSGKSVLCENAGVQGLECNS"
     exon            297131..297985
                     /number=1
     exon            298036..298088
                     /number=2
     exon            298136..298258
                     /number=3
     exon            298306..298588
                     /number=4
     CDS             join(299421..299610,299716..299867)
                     /codon_start=1
                     /locus_tag="AO090001000134"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000162"
                     /protein_id="BAE56684.1"
                     /transl_table=1
                     /translation="MYISKGLFLLSTPFALGGLAAAGGCGDADACVGTEYCTTATFTT
                     PTATTITTCVPTPTCLGVYSTKCRPTDPKWPGCSEDLGVCLADENCCYKNKCIDGLCR
                     RVKTEKRAVLF"
     exon            299421..299610
                     /number=1
     exon            299716..299867
                     /number=2
     CDS             complement(join(300140..300159,300215..301024,
                     301073..301304))
                     /codon_start=1
                     /locus_tag="AO090001000135"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000161"
                     /protein_id="BAE56685.1"
                     /transl_table=1
                     /translation="MRFISVSSLLLALAPALNAVPVEVAGSAQGLDVTLSQVGNTRIK
                     AVVKNTGSEDVTFVHLNFFKDAAPVQKVSLFRNATEVQFQGIKQRLITEGLSDDALTT
                     LAPGATIEDEFDIASTSDLSEGGTITINSNGLVPITTDNKVTGYIPFTSNELSIDVDA
                     AEAASVTQAVKILERRTKVTSCSGSRLSALQTALRNTVSLARAAATAAQSGSSSRFQE
                     YFKTTSSSTRSTVAARLNAVANEAASTSSGSTTYYCSDVYGYCSSNVLAYTLPSYNII
                     ANCDLYYSYLPALTSTCHAQDQATTTLHEFTHAPGVYSPGTDDLGYGYSAATALSASQ
                     ALLNADTYALFANAVNLNC"
     exon            complement(300140..300159)
                     /number=1
     exon            complement(300215..301024)
                     /number=2
     exon            complement(301073..301304)
                     /number=3
     CDS             304523..305617
                     /codon_start=1
                     /locus_tag="AO090001000136"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000160"
                     /protein_id="BAE56686.1"
                     /transl_table=1
                     /translation="MTSDAKILLTGATGFIGGSVLTALLQSSASSLQSGPITCLMRGA
                     DRAALLTSTYGERVKPTVYGGLDDLETTTAVAAQHDVVINTTLGYHSASTKALLRGLA
                     QRKAQTGRDVWLIHTSGTSNIGDKPIAKPVGVREFDDLVDAIYAHEKALEAAEPYAQR
                     TTELGVIDTGLELGVKTLVIMSPIIYGNGTGLFNRNSIHTGYMKAMLQIGHAVVVGDG
                     TGLWDHVHIEDLANLYRLVVLDILERQGKSLPTGKKGIIFSANGRHSWLEYSQLVADA
                     CYERGLILEKKVTHLSLEEAVATLIPHLDFAKEVFAEEDLKSAAEMFSSNEITVATIA
                     RNLGWNPVKGDEAWTQAFRDDVNSIIKSKG"
     exon            304523..305617
                     /number=1
     CDS             join(306057..306476,306531..307081,307202..307225,
                     307258..307276)
                     /codon_start=1
                     /locus_tag="AO090001000137"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000159"
                     /protein_id="BAE56687.1"
                     /transl_table=1
                     /translation="MRQIHGVNRPTHIKHACAHCRKTKSRCQGDPPCSECLRRGIHCS
                     LDRQVEALSPPTSGLNIPPSSAGRSEPRRRFLNLYFEKFNPYWLLIHRGSFDEDIEAP
                     FLVQAMIVIGMWMSDEPNARSAAIDLHNTLASAIGQQREAWDVSAKEDIDGASWPIPT
                     YQGILLHIIFALVNAGAGNLGIDLKPSLSRTNTDLLNSLVGSCKRLDMLYYPSILARY
                     SQRDSRPYIWLGIEETKRFNLALYRVYRAASVVGKRADDADTHARLTARDLRFPFPTH
                     TRLWKTMSMAEWGSAAGRGVFDHLLDDTMEEMWISRAHEALGIDWELEIDSDIRLSSN
                     RRI"
     exon            306057..306476
                     /number=1
     exon            306531..307081
                     /number=2
     exon            307202..307225
                     /number=3
     exon            307258..307276
                     /number=4
     CDS             join(307897..308244,308314..308363,308398..308662)
                     /codon_start=1
                     /locus_tag="AO090001000138"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000158"
                     /protein_id="BAE56688.1"
                     /transl_table=1
                     /translation="MAAVDGQVLEAVPWDEMLGAIGYPEEDRDRLVQAIGLDQFNDTG
                     THGLVGYHLHDSCWELLTHHTIGEAARQSLVLVVRNLKDFLRTLGNISMGCALWKVSI
                     LCVVVQPISTALNEDTCAVSHWRPCQSSTQPVMDYLSPDDVEAVQIAMKYYLGDAYWR
                     TRVPTSLFPEVKSIWHETLDWQFLCLELEWLWETDDLAFRRYVLDRLDEMQASLRQLA
                     NE"
     exon            307897..308244
                     /number=1
     exon            308314..308363
                     /number=2
     exon            308398..308662
                     /number=3
     tRNA            complement(309118..309198)
                     /locus_tag="AO090001t00002"
                     /note="tRNAscan-SE"
                     /product="tRNA-Ser"
     CDS             complement(join(312417..312633,312685..312902))
                     /codon_start=1
                     /locus_tag="AO090001000140"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000156"
                     /protein_id="BAE56689.1"
                     /transl_table=1
                     /translation="MSTIPSTQTLMADYKGQPLPELGTLIVLDGLPVVDKAHRPTLIR
                     FLLRKLDSPGPTDTRKVYMPVDSQQRTIGSAIIRYLDASQAEDTITRFNGSHLDSNHQ
                     MTLEKIEVSERYRHMQNMVTGIEQQLGLVFPIDMETELFQEG"
     exon            complement(312417..312633)
                     /number=1
     exon            complement(312685..312902)
                     /number=2
     CDS             join(314332..314550,314619..315113,315169..315876)
                     /codon_start=1
                     /locus_tag="AO090001000141"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000155"
                     /protein_id="BAE56690.1"
                     /transl_table=1
                     /translation="MSSMEKTTSQGHTPGKASSEFFEKSEANIQSVDATSLLSDQHRD
                     YLLQRHGTLDLDPIPSMDPADPYNWPLWKKVTNLGLVAFHACMGTFTAAAIIPAYEAI
                     SEDLGVTLQRVSYLTSLQIAILGGAPLFWKPLSHRFGRRPIFLLSLILSCVCNIGCAK
                     SPDYASMAACRALVSFFLCPAMAIGSAVVTETFFRRERARYMGIWTVMVTLGVPVGPF
                     IFGFVAQRVGYRWIYWVLAITNACQFFLYIFFGPETRYIGTEVQSGGSPFKREYLSFG
                     RIDPTPFRFSEFVHPLSLFTNIPVLLASVAYAMVFLFASVLNSVEVPQLLQSKFGLNA
                     EQLGLQFLGLIIGSLLGEQLGGFMSDMWMNARARRIGHKPAPEYRLWLSYIGYLLTIA
                     GSVVFLVCTEQATEGTWTVVPVVGTGIAAFGNQVITTVLTTYAVDTYPQDAGSIGVFI
                     NFVRSTWGFIGPFWYVNVPWLRV"
     exon            314332..314550
                     /number=1
     exon            314619..315113
                     /number=2
     exon            315169..315876
                     /number=3
     CDS             complement(316211..318628)
                     /codon_start=1
                     /locus_tag="AO090001000142"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000154"
                     /protein_id="BAE56691.1"
                     /transl_table=1
                     /translation="MKVRTFKYESLPTPTSIRVVTLLHGESEITVFGVPLIPLSIQIV
                     DLNDNPRFQALSYTWGSPFPPELERSKNYGPKNKFPVAINGQLSFLTRNLFEFLQRLK
                     TEKLNVDRRTKPYNKTRLIEAAEAGSVNDVYFWMARGADLAAQDMFGETALHYAAENG
                     YFEVVKILVEAGSDVQRRDSSRRTPLDCAKMRKRRKYAEVIEYLERPDIHQIVGSKPR
                     PLSPMDSQQFWIDAICINQDDIAERNAQVAIMSMIYTKSSGVFVWLGVDDESTMRAAE
                     ATHLPSQEGMDMWYNDVLNNHVMEDPETRVAKQGSNEAALKYQAVVNLFRRTWFQRVW
                     IIQEIALAKQIRIFCGRVEFEYHKLFNLFHNPNFTSHVTSRSLSQALELARWKGIGGS
                     ELSTLTDIRLRTSKQVFERRVMDEYVKKNGITLVSTWEHKLSLSLLASKVWSFRATDP
                     RDKVFALIGISRLPDDPKKRIVADYSKSTSEVFIQFAKIFMQGAPDEPLQTWHTGECE
                     VFECLEGLSFVQESPDVSRTFNGQELPSWIPNFTAPLITTRLWSPRFRAGVSPDTPAV
                     ILPDDDAHTLRLNGIFHDEIVSVEPQIGTSTATSFRPPNWLELILSLDKTYLPTGDNR
                     VEALWRTLMTNKLSSTSDNPVQDARSSFRFFIQKALWSLTHKSDKDTITNLNLIRETD
                     DNNTLPTWEEVQQYGEKDEVGKPRGRVRIDDRDFDQTFVHFYRGRLLYRTKRGYLGLG
                     PWSVQPGDEVWVTAGARTPFILRKPSSDDSSRTERRSLVGETYVHGIMDGEAISGGQT
                     FQPVSLV"
     exon            complement(316211..318628)
                     /number=1
     CDS             complement(join(319572..319877,319929..320265,
                     320320..320485,320549..320627))
                     /codon_start=1
                     /locus_tag="AO090001000143"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000153"
                     /protein_id="BAE56692.1"
                     /transl_table=1
                     /translation="MFSLARLGTVAGLFLLAQAAPASLRRDVSSSLLNNLDLFAQYSA
                     AAYCDENLNSTGTKLTCSVGNCPLVEAASTQSLDEFNESSSYGNPAGYLAADETNKLL
                     VLSFRGSADLANWVANLNFGLEDASDLCSGCEVHSGFWKAWSEIADTITSKVESALSD
                     HSDYSLVLTGHSYGAALAALAATALRNSGHSVELYNYGQPRLGNEALATYITDQNKGG
                     NYRVTHTNDIVPKLPPTLLGYHHFSPEYYISSADEATVTTTDVTEVTGIDATGGNDGT
                     DGTSIDAHRWYFIYISECS"
     exon            complement(319572..319877)
                     /number=1
     exon            complement(319929..320265)
                     /number=2
     exon            complement(320320..320485)
                     /number=3
     exon            complement(320549..320627)
                     /number=4
     CDS             join(323687..324234,324304..324316)
                     /codon_start=1
                     /locus_tag="AO090001000144"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000152"
                     /protein_id="BAE56693.1"
                     /transl_table=1
                     /translation="MQRDMMFARRHSGQTALRAGRSLLPQYHPMTQPVLPASLRTMQT
                     VINLQSKETKEQAIDFERQILNPERTETCKSGSDDEVGHHKCSYDPSTTTPESEYLAD
                     EAESLLDGKGHHPLFVSPANLEVSHYIDPMSEGAVQGAARLGPSGKGWTRKHREVHIK
                     DVPGSQYERYEKLLQELRKPKQSETR"
     exon            323687..324234
                     /number=1
     exon            324304..324316
                     /number=2
     CDS             complement(324766..325851)
                     /codon_start=1
                     /locus_tag="AO090001000145"
                     /note="glutaminyl cyclase"
                     /old_locus_tag="AO070336000151"
                     /protein_id="BAE56694.1"
                     /transl_table=1
                     /translation="MHSKLPRFSILLQTALTLLLTVTHTLAYRPISNKTLTHLPRPNT
                     DFNIHNGTLLSPNLQTRVPGSPGSEATRSHFTNFFAKTLPHWKIEFQNSTAKSDTNEI
                     PIINIIATRDPPGIPAGNISRLTLVAHYDSMNSPEGFIGAIDSAAPCAIIMHAVRSID
                     AALSRKWGTLPTVQKAEGIQVIFTDGEEAIYPDWMEILFGARSLAAEWENTRYPPASR
                     YSSRLKAISLFVLLDLLGSREPKIASYFNTTHHVYKRAAVLEKRLRGLNQFKSTGTRP
                     WFVDVDRDTIGANRFPIYDDQVPFEERGVDVLHLIDANPDTGRFPNVWHTLEDTGENL
                     DLDVLGDWSVLLIAFMVEWLESEGYMI"
     exon            complement(324766..325851)
                     /number=1
     CDS             complement(join(326185..326717,326772..327472,
                     327527..327831))
                     /codon_start=1
                     /locus_tag="AO090001000146"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000150"
                     /protein_id="BAE56695.1"
                     /transl_table=1
                     /translation="MPHQDLDEKPPLHVQDAEIDEEVEALEGYVVDPSQYPDNAARLK
                     TSPDGRFVLIPQPLDTPNDPLNWPSQKKWFLVAIVAYIALLADYTGGTAIITVIPQSM
                     QWELSQATVQRAVVGNLFTIGACGLFVVPLAHYFGRLPVTLFFQCVMVGTCAWSAAAT
                     SFPSYLAARIINGFFCSVGQGGALMWIKDLFFFHEHPKVINYVEFSIIMSPYLGPLIT
                     SFIVSGVSWRWAFWLCTIMSGVGLILILFLDESLFDRKHPPSSRGSYISRLTGAQQSK
                     DWKHKSLVQCLALPVIAITKIPVLTILVYYFLNFAWVIGVNTTIGIWLTNIYGFSTRG
                     IGYFYFFGIVGVLVGWFAGHFLHDGVGQYYIKRHNGRLDPEARLIITYPATIICCISL
                     IILGLAFQYHWHYMVIAVFAATQCIGVMIVTTAINAYLLDSYPEGSGVVGAWVTASRN
                     WAGFMATYIQIDWVTRLGPAKALGIQAAITFASVFCMVFLQVYGKRLRQWQGRMVFSW
                     EGKK"
     exon            complement(326185..326717)
                     /number=1
     exon            complement(326772..327472)
                     /number=2
     exon            complement(327527..327831)
                     /number=3
     CDS             join(329534..329550,329607..330042)
                     /codon_start=1
                     /locus_tag="AO090001000147"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000149"
                     /protein_id="BAE56696.1"
                     /transl_table=1
                     /translation="MSGGLIAGIAGINKTIAIASITHDDLTYGIYKLNTWVLTEMWFI
                     IIFGSIPVLRPFFVRFTQDIKSAAGYGHSRSRTNPSDYLCSGRNNRESWMQLDDRSHS
                     TYVTPVSTYAKTDSYLQRGENGDCTFGQQQSGRQILMTRHTSVESERC"
     exon            329534..329550
                     /number=1
     exon            329607..330042
                     /number=2
     CDS             join(330926..331081,331131..331260,331323..331450,
                     331583..332015,332071..332390)
                     /codon_start=1
                     /locus_tag="AO090001000148"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000148"
                     /protein_id="BAE56697.1"
                     /transl_table=1
                     /translation="MAVSRELAEVQRLVAAEAAGDKNAHGELLRAIRQLQLAVETPVE
                     TTSRFNFQIMQNISIRVAIEKQFLHIIAARDGAPITASEIASKTGENLLLIVRVMRVL
                     TAIGLCDEVGNETYAANEKTHFKILPGSIAAEKHQYGGRLVEYMRGPGIQQFVDEPGA
                     ITLFKYAHGTDVIFGLLEKNPEQKQAFDDYMASRRVANLPQWFEIYPAVEKFSDAHQD
                     PNATLMVDVGGGPGQELIRFKERHPDIPGRLVLQDLPLTLQRIEKLPDGIEPMEYDFF
                     TPQPVKGARAYFLRDVLHNWSDAKSTQILSRIVEAMDPEYSTLLIDDYVLPDTGAELR
                     AAEMDILMWLHTAGLERTVSQWESLFRTVGLELVKIWHSVRGNESVLETRVQRK"
     exon            330926..331081
                     /number=1
     exon            331131..331260
                     /number=2
     exon            331323..331450
                     /number=3
     exon            331583..332015
                     /number=4
     exon            332071..332390
                     /number=5
     CDS             complement(join(332928..335076,335132..335559))
                     /codon_start=1
                     /locus_tag="AO090001000149"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000147"
                     /protein_id="BAE56698.1"
                     /transl_table=1
                     /translation="MEPLSALGLATAVIQITQFTGQLIRGTSHASQAADGLLLTNANI
                     KDVAGTLLSLTEQLVFPPSFVTLSGEERLLHEICLECRKVSESVLDRLGKLQRQQPLN
                     RWDQVRQTFGQLLGQGETNALATKLSNIREQLNTALLICLRNQLSEVFSRQTDPGALR
                     FLSQIQQVWNAGKPWYSELLLAIHRNDWDAHNQHDLIDFAAALDNGTEGDRESDFCVA
                     ILTLLKFRGLPDRHEAIPVAHKNTFEWTFHNQAEFPKWLLRGQNEIPFWITGKPGSGK
                     STLMKFLYNEPRTRGYLKRWAGSQPLIMGGFFFWNSGTVNQMSQRGLLQSLLFQVLHE
                     HRQYIRQVFSERWQRYNHLRRGLHDWTIAELQQALEMIISEELFRFAFFLDGLDEFDG
                     NPQVLVEFVGRIAEKDNVKLCVASRPWNLFQDAFEQSPSLRLEQLTYGDIRLYVSERC
                     RQNRRFVNLLQREPDRARDLETAVVDKASGVFLWVYLVVGSLLAGIQNGDSIADLRKR
                     LAALPSDLEQLFEKLLNTVDAFYFESLCHLMQLVRHAYQPLNLLTFYYTDEAVENALT
                     DPIRPLGPDQVIDFHEEARRRLNSRSKGLLEAPSSPKGTIQYLHRTAKDFLHSPKVWV
                     RITAGSNARFDANYTLASAYLRHLKTLKSSRMGTEEFWIPAIGCLEHSVRAMLQSATG
                     EQHNQVLLLMELDRSSRAIWTATTPGDQCALNGRVPRRAERWPCTLGIDYTFDALCVR
                     LKILPFVRYQLEQNHPGQAAYVALLLAALGCTPLPPHFAAAHTLLEVRTQDPDTVALI
                     LSSCPNPDWIRDILCEFKKNCNNKELQAVVSAYLRNTPKVDSRLGPKAWVQGFTKKRG
                     MM"
     exon            complement(332928..335076)
                     /number=1
     exon            complement(335132..335559)
                     /number=2
     CDS             join(336475..336925,336979..337424)
                     /codon_start=1
                     /locus_tag="AO090001000150"
                     /note="1-Acyl dihydroxyacetone phosphate reductase and
                     related dehydrogenases"
                     /old_locus_tag="AO070336000146"
                     /protein_id="BAE56699.1"
                     /transl_table=1
                     /translation="MTTETSFLPSVLITGCSAGGIGSALAETFHERGLHVFATARSTS
                     KMAHLEKLPNITLLELDVTDPKSIESAVEVVTAKTGGKLNYLINNSGQSLVLPALDTS
                     IEDAKRLFDVNLWGVVAVTQAFSPLILATKGTIVNVASLAAFFRSPWLSFYNASKAAV
                     DAYTHTIRQELAPFGVKVVTVTAGTVQTNIFRPVEEISLPPDSIYKAASKQMVGIANG
                     KLIQGAMAPAEFAKRVADDVLGGATGVIWRGTMATIGRIMYTILPTWLMVSWCPLFRD
                     LGSTVLTSGCLGSFDIPWFRFG"
     exon            336475..336925
                     /number=1
     exon            336979..337424
                     /number=2
     CDS             complement(337631..338779)
                     /codon_start=1
                     /locus_tag="AO090001000151"
                     /note="GTPases - translation elongation factors"
                     /old_locus_tag="AO070336000145"
                     /protein_id="BAE56700.1"
                     /transl_table=1
                     /translation="MPSPGKPLINVGTIGHTDHGKTTLTAAITAKFGTTCMADDQTDN
                     TLKEIAHVEYETKARRYRHIDWADQAEYTKNMLSGAAQMDGVILVVSAEDGLMPQTRE
                     QILVARQAGVSYILAFINKCDMVDDTDQLELVELEVRDLLNSHGFQGDNMPIIKDSAR
                     QALEGGLDESDLGERAIVHLVEALDAYIPVSVPAVDRPFLMPVEDVFSVAGRGTIVTG
                     RVERGMIRVGDDVEIVGFGAVVRTTCKGVEIFRKSLDQGRVGETVGVLLRAIRPEDVI
                     RGHVLAKPAQIRMCTDFTAHMYVLRKEEGGRHTPFFNHYQAQFLIRMTEMTGSIMLPE
                     GMVMIVPGDSPSITVKLIAPTAMEEGLRFTIRESGRTVASGVITSILE"
     exon            complement(337631..338779)
                     /number=1
     CDS             join(341069..341162,341234..341813,341870..342305)
                     /codon_start=1
                     /locus_tag="AO090001000152"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000144"
                     /protein_id="BAE56701.1"
                     /transl_table=1
                     /translation="MPATVQPLTPPAGSDINFAAVIDNVDLENITDETFSTIHSALYN
                     HQVVIFKNQHHLTPKAQYHLTQRFDPSSTQYGHGKTIDAKRSILHPDLKTVPHQPQVQ
                     IIGHGSIDSYEGLSNFQLKHPHHKTFHRDAIPPEEDYDFTRFYRWHIDAALYEYYPPK
                     VTTLLAVKVPKGRRQTLRYDDGSDETLDVPLGTTAFVNGERMFEMLSDEDKEFVLGSR
                     VEYAPHPYIWMSPARSLPTGLGLYSEGLELSESELPPIDQSKIMILPMVWKNPVTGKP
                     ALQIHPSAVRKIHQKDGSVIDDLARVREIVYRLQRPAISPKHVYVHDWEEGDLVLFHN
                     RGVLHSVVGAFGDDEVRLFRQCNLAAGEAPVGMSD"
     exon            341069..341162
                     /number=1
     exon            341234..341813
                     /number=2
     exon            341870..342305
                     /number=3
     CDS             complement(join(344159..344231,345166..345318,
                     345373..345678,345734..346223,346318..346570))
                     /codon_start=1
                     /locus_tag="AO090001000153"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000143"
                     /protein_id="BAE56702.1"
                     /transl_table=1
                     /translation="MSVAVQTLVQPDIQYHPDYEKYTARKARRQATEQLSKTLPDGFP
                     QKLDSPLVWEGKDVEKRDDWIYRLNDAHREEIDAALKSFQAQNLSLGNINQDTFPLPT
                     LRPTLRSLSNEIHNGRGFFVLRGLDIDRYTREENIIIYAGVSSHIGNIRGRQEDRRYT
                     PGGGSVVLSHIKDLTRTSAANAIGAPSNTADKQVFHTDSGDIISLLCLHPAAEGGESQ
                     ISSSWLVYNILAKERPDLIRTLSEPWPVDGFNDPEKPYTTRPLLYHQKATDTTPERVL
                     IQYARRYFTGFLAQPRSTNIPPISEAQAEALDALHFLAEEHSAALDFQKGDVQYINNL
                     SIFHARKGFRDEPDKERHLLRLWLRDPENAWATPEPLRERWENVYGNVKVEEQIFPLE
                     PKLRKTVGRVCLGTHGFGSVFGAQWKTADFRC"
     exon            complement(344159..344231)
                     /number=1
     exon            complement(345166..345318)
                     /number=2
     exon            complement(345373..345678)
                     /number=3
     exon            complement(345734..346223)
                     /number=4
     exon            complement(346318..346570)
                     /number=5
     CDS             complement(join(347040..348455,348508..348681))
                     /codon_start=1
                     /locus_tag="AO090001000154"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070336000142"
                     /protein_id="BAE56703.1"
                     /transl_table=1
                     /translation="MTSKAADKQTTLVQTVPASAIEDAELSFLFSKDEHNQDFWTAMR
                     LHWPAVGWGLFMNLATILKGIDGGVVKGLVGLDAFKETYGYNHNGTYMIAARWLSAFN
                     YANLLGAIVGALCSGAAYNRFGPRIMIAMCSCLSIAFIFIQFFSHTPAQLFVGQLVNG
                     AVIAFYPICASAYVGEVTPLVLRGFAATMTNLAFSIGSLIASGILKGTQSMESELSYK
                     IPIATQWALPCIMLFLVSFCPDPPYWLCRKGRYDAARASLRRLATPSIDVSRKLAHIR
                     ETLRLEEEFQGDRPHYRECFRGPNFRRLMICVMAYSMQAFTGNVFFINYAVHFMELAG
                     LDSSDAFSMNLGLTAIGLLGTCISWFLLSYVGRRTMYLFGCSSLALLLFIIGAVDLAP
                     RQTNTVWAQCGLMLVCTFVYDLSLGPFCYVLLAEVSSAALRGFTIALATVACFVWSVV
                     FAVAIPYAMNEDEADWKGKIGFLFSGLSVLCVIYVYWCMPETKGRTFEELDILFERKV
                     PSRKFKYYKIDIDIDGRRLEE"
     exon            complement(347040..348455)
                     /number=1
     exon            complement(348508..348681)
                     /number=2
     CDS             complement(join(350479..350483,350611..351006,
                     351063..351585))
                     /codon_start=1
                     /locus_tag="AO090001000155"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000141"
                     /protein_id="BAE56704.1"
                     /transl_table=1
                     /translation="MVYLPDPKKMKKDDDPAGRDLIMVANYNIRVEVHPPGSKFRPDN
                     EEGIKVLYGRVTDIDGEWKPLGNKKFPKRYSLTTKDKYLSVSETTGAVILRLKHNGEL
                     KRQWCPQENVPVKNLFDMNDVGLGTLDLKFIRVKDTWWGADFKDAHFFNMTGFHFRFL
                     ENKQNIAHMQFWIAGPNVDCRLHDHSDNSFKELHTCLSQGSSEHNETCQGGMWAPKEI
                     YYNEPLDEIKRLRDKCSRDRHKGCQGACLEEYLEHCPLQPLQEHGRIWHADHYGQTVY
                     RKNKTVSYPGHTWIAGPGPYVDVWMALEFDV"
     exon            complement(350479..350483)
                     /number=1
     exon            complement(350611..351006)
                     /number=2
     exon            complement(351063..351585)
                     /number=3
     CDS             complement(join(352062..352186,352423..352632,
                     352705..352723))
                     /codon_start=1
                     /locus_tag="AO090001000156"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000140"
                     /protein_id="BAE56705.1"
                     /transl_table=1
                     /translation="MRFLLEGPKDRLDSTLCWSLRERVFLGFTTMMADGNENRLEQES
                     RGFQTSWMTPSVPDREITGEPVAQTLAKLVVTRDGNDEILVSLFGPLNRDDDGKPTDV
                     SNPLPMVLILSFTFL"
     exon            complement(352062..352186)
                     /number=1
     exon            complement(352423..352632)
                     /number=2
     exon            complement(352705..352723)
                     /number=3
     CDS             complement(join(353071..353336,353463..353530,
                     353591..353712))
                     /codon_start=1
                     /locus_tag="AO090001000157"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000139"
                     /protein_id="BAE56706.1"
                     /transl_table=1
                     /translation="MPVSRAPEFSEKIAIQDGREDGYWVSSFKFAETDKVPGVVASGL
                     NSGKIEFLDNPRNTSADPNAWTVYQVAKLNTPVAVVPMDITQNGLMDIVVCHDFGDTM
                     IQANMQGGHISWFENPGRDKLEQDVKWTQHYIGRWPAMHRLQAGYFTQR"
     exon            complement(353071..353336)
                     /number=1
     exon            complement(353463..353530)
                     /number=2
     exon            complement(353591..353712)
                     /number=3
     CDS             join(354370..354484,355323..355410,355484..355555,
                     355614..355763,355816..355914,355971..356556,
                     356608..357387)
                     /codon_start=1
                     /locus_tag="AO090001000158"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000138"
                     /protein_id="BAE56707.1"
                     /transl_table=1
                     /translation="MSMTSGRQAFTSECRDSNTTNSFWLANSPTLTLGSTMQVVGSGP
                     IGATYAKILADAGKDVLMVETGTQESKIAGEHKKNAINYQKDIDAFVHVIKVISSRIS
                     TFECISLTFDLLLFQGSLHYTSVPTNKAAVPTLAPISWKANGQIFNGQNPRQDPNVNL
                     DANGVARNVGGMSTHWTCATPRQKEKVERSDIFSGDEWDSLYKEAEKLIGTSKTVLND
                     SIRQELVMEILNDEYGKRSAEPLPLAAKRNGNTAYITWSSSSTILDAMNCKKKFTLWP
                     EHHCEKFKVEETDNGPQVTKAIIRKLATDKLITVKAKVFIACGGPILTPQLLFNSGFV
                     PTKPNRDPRTQIPLEDDEKGIPPPPDTLEHLKLPALGRYLTEQSMCFCQIVLKKEWIE
                     AVANPKKNPYQSDGVKRKKWEKLKEGWKERVQEHMKRFNDPIPFPFDDLDPQVTLPLD
                     YHHPWHTQIHRDAFSYGAAPPAIDKRTIVDLRFFGTVEPDWKNYVTFETDIRDAYGMP
                     QPTFRYKLNDEDRKRSHQMMKDMEEAAGALGGYLPGSEPQFLAPGLALHVCGTTRAQK
                     KEKECDPDPKETSCCDENSKIWGIHNLYVGGLNVIPGANGSNPTLTAMCFAIKSAKSI
                     LEGNS"
     exon            354370..354484
                     /number=1
     exon            355323..355410
                     /number=2
     exon            355484..355555
                     /number=3
     exon            355614..355763
                     /number=4
     exon            355816..355914
                     /number=5
     exon            355971..356556
                     /number=6
     exon            356608..357387
                     /number=7
     CDS             complement(361639..362496)
                     /codon_start=1
                     /locus_tag="AO090001000159"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000137"
                     /protein_id="BAE56708.1"
                     /transl_table=1
                     /translation="MAPQSKSSFTITHLTTATAILNIDGINFLTDPYFGAEEGTAYDE
                     TAELINADLSPLGLTSPPPPPHLVNRKGPSVRLHDLPPIDAVLLSHEDHIDNLDPEGR
                     KLLDGRRVFTTMDGAKNLSPRPGVIGLRPWQTVTSVIGGKEFRITGTPCKHFPVGEVT
                     GFVLETDSFGNNAESGKPNAIYFSGDTVYIDELQEIGKRWHITASLFNLGNATFTFPV
                     GTFQITMDGKQAVRLMRDIGTEVMIPIHFESWDHFQEDREGLEKVFTEEGVIDQIRWT
                     EPGVPKRIY"
     exon            complement(361639..362496)
                     /number=1
     CDS             complement(362852..363334)
                     /codon_start=1
                     /locus_tag="AO090001000160"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000136"
                     /protein_id="BAE56709.1"
                     /transl_table=1
                     /translation="MALFLAKGNSSTDISLRHQLSADDSYTLVTLVRTCRASGMFHYL
                     KMIEQYSPATPLAMIWVNVEEIKRFGLALYKVCRLSNLAVTAKKSRNTRQDLLGLADL
                     NFCIPDSDRIWGAPAVMDEQDRQLLIALVERRDNSDQKVWISNATRILYDDQVDFEWA
                     "
     exon            complement(362852..363334)
                     /number=1
     CDS             complement(join(365131..366826,366878..366882))
                     /codon_start=1
                     /locus_tag="AO090001000161"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000135"
                     /protein_id="BAE56710.1"
                     /transl_table=1
                     /translation="MQDQAYFNLGSHQRPITTSSKDAQLWFNRGLVWAYSFNVGEAER
                     CFERAVKYDTDCAMGLWGIAYSAGPNYNKAWRYFDPKDLRDSIQRANDAIARAAELSN
                     QVTPAEKALVKAVAARFPPTDNIPNDLSPYDRAYADAMRPVYREFGTDPDIAALFADA
                     LMCITPRGLWDLDTGEPTGPHTLEARKVIETGLASTVGRAHPALCHLHIHIMEMSPNP
                     ELALPAADRLRYLVPDGSHMLHMPTHIDAAVGDYRRAIDSNSEAIMADDKYFAQESGT
                     ISYIGYRVHYICAKLYAAMMCGRFTDAMAAAMKLEEVITDDLLSIASPPVADSIESFL
                     GSKAHVLIRFGRWEEILRLELPANRQLKSATTAIILYSRGLAYSALGRIEEAETTQRE
                     FELARAAVPKSRLNSIPCRQVDVLQVSSAMLHGELEYRKGNHEIAFTSLREAIRREDA
                     LPYSDPPPWMQPVRHALGGLLLEQNRVEEAEVLFREDLGFAEEFPRRRAKLNNVWGLH
                     GLRECLVRLGKTKDLAFVEPAHAIAVASADVPITASCYCRLSAVKVTRCCSAKSGCCE
                     "
     exon            complement(365131..366826)
                     /number=1
     exon            complement(366878..366882)
                     /number=2
     CDS             join(369133..369150,369202..369981,370034..370660)
                     /codon_start=1
                     /locus_tag="AO090001000162"
                     /note="NAD-dependent aldehyde dehydrogenases"
                     /old_locus_tag="AO070336000134"
                     /protein_id="BAE56711.1"
                     /transl_table=1
                     /translation="MSLDITTFYNVINNELTTTAETRHGINPANQQPNPEVPVSTAAD
                     LDKAVSAARQAFKSWSRTSVEERRKALSAFADAIEANKDSLAKLLTQEQGKPLDQASG
                     EVDNAVIWARAIPKIEVPETVIEENEERKVIQRHIPIGVGGAIVPWNFPIMLAVGKII
                     PAVYTGNTIIVKPSPFTPYCNLKLGELAARCFPPGVVQVLSGGDDLGPMITEHPGIDK
                     ISFTGSSLTGRRVMASCAKTLKRVTLELGGNDPSIICEDVDIDAIIPKVGVLSFLCSS
                     QICMMIKRLYVHEKIYDEFRDKLVAFVKNLKLGEGTEPDVFFGPLQNSMQFGKARNLI
                     EHIASEGLNSVLGGSIPDSKGFFVPPTIVDNPPENSRVVQEEPFAPILPILKWSEEAD
                     VIARANDTEYGLGASVWTNDFERGQRIARQLEAGNVWVNTHFMVQPNVPFGGHKSSGI
                     GSEWGVTGLTGWCNTQALYFNKKA"
     exon            369133..369150
                     /number=1
     exon            369202..369981
                     /number=2
     exon            370034..370660
                     /number=3
     CDS             complement(join(370773..371544,371596..371840,
                     371893..372264))
                     /codon_start=1
                     /locus_tag="AO090001000163"
                     /note="atrazine chlorohydrolase/guanine deaminase"
                     /old_locus_tag="AO070336000133"
                     /protein_id="BAE56712.1"
                     /transl_table=1
                     /translation="MLYTHATIITVDSNRRIIEDGAIRVENDLIADIGKTAALKTKYT
                     DDEEYDLTGRIIIPGLISTHMHTAQTLLRGAADDLELVSWLCERIWVLQGNFTAEDGY
                     AAARLSIGEMLKSGTTCFLESMFADRYGFDGLARAVEESGIRGCLGKIVMDIAKYAKD
                     DAWAMHPGLVEDRETSLLGTVKMWEKWNGKANDRIRVWFGARTPGGVSDTLYREMTSI
                     SREKGIPITMHCAEVRADREFFSSVNHTPMSYCDSVGLLSPSTVLVHMVHLDDDDIKR
                     LAGSGTHVAHCPTSNAKLASGICRVPDLQRAGVNIGLGTDGAPCNNTCDLLQEMKLAG
                     IIHKSLSYDPTAVPAESVLEMATINGARALGLEERIGSLEVGKKADFVAIDTRRIHLQ
                     PWFNPVSAVVYTATGRDVDIVVVDGKMLVRNGELLTMDEEEIVREAQRRSEEVVARAG
                     LKDRVKARWPVE"
     exon            complement(370773..371544)
                     /number=1
     exon            complement(371596..371840)
                     /number=2
     exon            complement(371893..372264)
                     /number=3
     CDS             complement(join(372877..373393,373452..373462))
                     /codon_start=1
                     /locus_tag="AO090001000164"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000132"
                     /protein_id="BAE56713.1"
                     /transl_table=1
                     /translation="MLRKSGVTYTSIREGIYTEAFPVLLNWYPDSTTVPLPADGPMAL
                     TLRSELGEATARLMIAGGHENEIVLLTAEDTIRPSEIVDIINQTTGREVKFERVSPEG
                     YIRIYGENDRGGKPKAFFQQTLTWYEGIEKGELATTHSLMRELLGREPTKPRDAIQGL
                     LLENPNYTWHQNYVN"
     exon            complement(372877..373393)
                     /number=1
     exon            complement(373452..373462)
                     /number=2
     CDS             375722..376162
                     /codon_start=1
                     /locus_tag="AO090001000165"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000131"
                     /protein_id="BAE56714.1"
                     /transl_table=1
                     /translation="MGDQIPPQDRSKLRGRFKDTLKATFALKSIHDLYRKSPVLVDPD
                     HAMKAALVTSWGKPPQYISIPDLPPPAPTQLQLIVLTTSVTRVVRSRAASAHSTAFKT
                     PSPYDPSVDGVAIDEITGDMYFITQLAALFFRAHECRPETCYKA"
     exon            375722..376162
                     /number=1
     CDS             join(376221..376534,376610..376808)
                     /codon_start=1
                     /locus_tag="AO090001000166"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000130"
                     /protein_id="BAE56715.1"
                     /transl_table=1
                     /translation="MTLRCRVIGGCQGRTVLIIGATTASGRCAAIVACSLGATRIIGM
                     SRNEETLAAVEGLDDRVVLREHFALPPSVGPVHIILDYIGNGPAASGILQTAQSAYGE
                     NLQPLCILGTGIGCFTVEDWRKELPEIMKMISHMHIPFTIFTAPLSQVASAWESEDTL
                     TKRLVLMPGA"
     exon            376221..376534
                     /number=1
     exon            376610..376808
                     /number=2
     CDS             complement(join(377333..377568,377630..377952,
                     378013..378129,378188..378302,378361..378967))
                     /codon_start=1
                     /locus_tag="AO090001000167"
                     /note="sterol reductase/lamin B receptor"
                     /old_locus_tag="AO070336000129"
                     /protein_id="BAE56716.1"
                     /transl_table=1
                     /translation="MAAAQLIDGLSGFASGKGHIQKTVITGQKALWGRRANVSGFSSL
                     PSMLLMIGAPLLVLLISVALTHYDGSIARVLDDLYSHGALPFLMRYCPSLTTQGIIAY
                     ISWLVFQALLYQVLPGRIVSGPPTPGGYSLPYKVNGLWSWFASLAVFIGLVKAGRLDP
                     TFVAVHQGELIIIANIYGFLITAASVAKSHLLTQNTRDIRFSGSIIHDFLSGVELNPR
                     LGKYWDLKLFQIGRVGMNSWVLVDLSFAAMQYQKFGYLTNSMIVVNLLHALYVVDFFV
                     NEDWYLSTIDIALDHFGFNLAWGSAVWLPVVYTTQAHYLAYHPVQFSGLQCTLLLVAG
                     ITGYVIFRSANHQKYRTRQSNGTNLIWGQKPSLIQATYQTADGSSHSSMLLHSGWWGL
                     VRHPNYIGDLIFSFCTCAGCGFSHIVPWTYFFFMASLLIHRALRDDARCSSKYGDRWS
                     IYCKIVPWRLIPGIF"
     exon            complement(377333..377568)
                     /number=1
     exon            complement(377630..377952)
                     /number=2
     exon            complement(378013..378129)
                     /number=3
     exon            complement(378188..378302)
                     /number=4
     exon            complement(378361..378967)
                     /number=5
     CDS             complement(join(380846..380871,380982..381010,
                     381106..382028))
                     /codon_start=1
                     /locus_tag="AO090001000168"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000128"
                     /protein_id="BAE56717.1"
                     /transl_table=1
                     /translation="MYRDFESNLSLLLVDTLPWLTCRKAWKGREQLVQAFIQFYQADG
                     HLSASSLAYSRWKAQQEAGASLEDIARLEILTGIGILSNTVPSCFWLLFDILSRPELL
                     SAIQDEIHQNALSIDSTGTHTLDLADIRGKCPTLLSSFQETLRTRSNSGQVRVIYQDT
                     LLNDRWLLKAGSTLLIPAPSINKNNSTWGSDAGDFDSQRFTKIAHQTHKKSKASGFLS
                     FGLSPHICAGRHFATGEILALVALLLVRYDIRPIQGSWTEPKTNAKAVAASLPPAAEK
                     FMVTAVERPEYKGLEWRTTVTPGKGTYGLIIGLDIYLQLSSVGEEMRRG"
     exon            complement(380846..380871)
                     /number=1
     exon            complement(380982..381010)
                     /number=2
     exon            complement(381106..382028)
                     /number=3
     CDS             complement(join(382270..382527,382638..382760))
                     /codon_start=1
                     /locus_tag="AO090001000169"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000127"
                     /protein_id="BAE56718.1"
                     /transl_table=1
                     /translation="MSGSTTIVGLSVVAILASLLFTQRAKLDPREPPLVSSTIPLWET
                     LSANFHHEYSQAKSLYHCISRLTPFRATESQHHVIQPALHSYGTAGRGYSKAWSAASP
                     GGRTGRPGTCQENGGSDASCAPRQ"
     exon            complement(382270..382527)
                     /number=1
     exon            complement(382638..382760)
                     /number=2
     CDS             join(383260..383399,383500..384397,384455..384795,
                     384851..385028)
                     /codon_start=1
                     /locus_tag="AO090001000170"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000126"
                     /protein_id="BAE56719.1"
                     /transl_table=1
                     /translation="MDEFTISAGSLCLLSLVVGFIIQSVYRLFFHPLRKFPGPKLGAI
                     SHLVQGLCFANNPKGPVVRINPRELHINDPYYYEQIYAGSSRIREKDPRFIGVFTTPL
                     PMVATVGHEHHRIRRGLLSSYFSRRALKKAELIIDQKVDRLLVRFHSAFKCHAVLPLQ
                     RVFAALAADIVSEYCYGASQGYLEQKVFQNQMIDAVNYVMSMCHINKSIPIIPKLLRC
                     VPVGLMEKLGLQMADVIGVRNLIRRQAAKSLDKEWLSHDTNMLSKNVFDAIAAADVAP
                     QEKTLRRLEEEGAALFGAGIETTARALTVAMFHLISDETMIRKLRDELKQVMLSPASR
                     PTWAELEQLPYLTGVVNESLRLSFGLVARSPRVSPIESLAYGEYVIPPGVSRRHKSYN
                     EVSQLLTFFMYQTPVSQSAYFVHMNPQVFPEPESFNPERWIKAAEKGQYLSRFLVAFS
                     KGSRQCLGMNLAYAELYLTLARIVRLVDMKLVGTTIDNIRVGRDLGHPAPKAGNFKVK
                     VEVMGIASKS"
     exon            383260..383399
                     /number=1
     exon            383500..384397
                     /number=2
     exon            384455..384795
                     /number=3
     exon            384851..385028
                     /number=4
     CDS             complement(join(385560..386147,386207..386299))
                     /codon_start=1
                     /locus_tag="AO090001000171"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000125"
                     /protein_id="BAE56720.1"
                     /transl_table=1
                     /translation="MIGLWIKGDQAARDSAMNFHRKLLSAIEAQRSQWYISNSTPRCS
                     NDTPWPMATYQSILLQLIFAVLVAKQEAPLDLNLRFQLPDTKYQLLTSLVETCRELGL
                     FSYPNMLAKHHSSAPIALVWVNVEEIKRFGLALYKICRLCTRSALAGTTDSDSSDMRS
                     ELLTLSDLDFCMPDSDEMWNAPSSIGAESIRSAIFHQACRDNRDTDNWISQTSGKLYD
                     SRVGLDWI"
     exon            complement(385560..386147)
                     /number=1
     exon            complement(386207..386299)
                     /number=2
     CDS             join(387203..388110,388175..388823)
                     /codon_start=1
                     /locus_tag="AO090001000172"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070336000124"
                     /protein_id="BAE56721.1"
                     /transl_table=1
                     /translation="MGFARDSEATDIFVNEPELTRSYTADAEGCTAQALEPAISKLPS
                     LENSSGYEVYWEPEDPENPRLWPLWYKSVSIVTMSLGATVVSLFSTLYTSGIPGLEDE
                     FHISKIIGLLGVFTYLLGMGLGTIITAPLSEVVGRRPVYLVSMTIFLLLILPSALARN
                     IEAILISRFFGGLFGSAIMGNSPASVNDIVSDQHRALAFSIWSIGPTNGPVYGPIIGG
                     FVFQYLGWRWTNWIVLIIGGAVLALMCLIKETYPPVILRKRAAKIRKETGDPKWWTRY
                     DGGDDLSKRLKIGLSRPFIMLVTEPICIFWNSYIAIAYGILYLCFVAYPIAFQTERGW
                     SPGIGGLSFIGIGSGVLITIACEPIFRKAINSHRKDPETGEIPPEAIASVVILGAILL
                     AVGQLWFAWTCTPNVHWIVPILSGVPFGSGNACIFIYATSYMARSYGIYTASALAGNM
                     FFRSIMGACLPLAGPSMYSALGLNWASTLLGLVETVCISIPVVFYFYGRRIRKASPMI
                     QAMERMQAAT"
     exon            387203..388110
                     /number=1
     exon            388175..388823
                     /number=2
     CDS             389741..390538
                     /codon_start=1
                     /locus_tag="AO090001000173"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000123"
                     /protein_id="BAE56722.1"
                     /transl_table=1
                     /translation="MAPTLNITHIGTATAILEINGVNFLTDPFFSPAGTTWDLGIAVL
                     KVTEDPALRLNQLPVIDAVLLSHEDHPDNLDDLGRQLLDGRRVFTTVDGAKNLAPRPA
                     VHGMKPWEEIDSIIAGKKFKIIATPTKHVPGDECTGFIITGEDFGHHHDGLPNAIYFT
                     GDTVYIEELDSIADRYHVCAAVMNLGNAHAPNKEDPNGPLMQITMGGKDGARLFRALK
                     ADVLVPMHYESWGHFTQFGDELRQAFEDEGISDKVCWLKGGEEVSVL"
     exon            389741..390538
                     /number=1
     CDS             complement(391245..392345)
                     /codon_start=1
                     /locus_tag="AO090001000174"
                     /note="predicted unsaturated glucuronyl hydrolase
                     involved in regulation of bacterial surface properties,
                     and related proteins"
                     /old_locus_tag="AO070336000122"
                     /protein_id="BAE56723.1"
                     /transl_table=1
                     /translation="MSSNTSPPQVRDTVNRLIHNLVNIKDETGRFLMPLADGRIIDTK
                     SWHGWEWTHGIGLYGIWKYYEQTGDPELLKIIEDWFAARFAEGGTTKNINTMAVFLTL
                     AYVYEKTGNITYLPWLDAWAEWAMHDLPRTRYGGLQHATYLTDNYQQLWDDTLMMTVM
                     PLAKIGKLLNRPEYIAEAKRQFLLHIKYLFDTKTGLFYHGWTFEDGGHNFAQARWARG
                     NSWITIVIPEFIELLELEPTDPIRVHLIDTLEAQCEALQRLQNESGSWHTLLDHSDSY
                     VESSATAGFAYGILKAVRKRYISAEYKPVAEKAIAAVVGHVDGDGELQNTSFGTGMGD
                     TLQFYKDIPLTSMPYGQAMAIMALGEHLRGFL"
     exon            complement(391245..392345)
                     /number=1
     CDS             join(393030..393383,393455..393732,393813..394331,
                     394389..394600,394658..394902)
                     /codon_start=1
                     /locus_tag="AO090001000175"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070336000121"
                     /protein_id="BAE56724.1"
                     /transl_table=1
                     /translation="MTDARPPSAGEPQVHQATSPNPEMNDLKKDISHVERVLSPNDKD
                     AVDYSRVDNELQDYANRGRVEIDEATSRQLRRKIDRRVLVIMIITYFLQALDKGTMSF
                     ASIMGIREDTHLRGQEYSWLTTCIYIAVLIVEYPTNWILQRVPIAKYLGINICLWGAT
                     LALHAACHNFAGLVTVRTFLGIFEAVCQPSFVILSGMWYKREEQADTVTYWYMMNGGQ
                     QIVGGLLAYCFGLIGKDKAIHSWQALFISYGCLSVLWGLFVLWWMPDSPMRAKCFTEE
                     EKHLMVERVRANQTGMQNKKFRSYQMWEAFCDPQMWCYCAIQVFTTLPTSGLGSFANI
                     IITGFNFTELQTQLLAMVLGFYIIIVLMSSAWLVKKTQQNLLVMLGFMIPSYVGTIVL
                     MTVENKNLATKAGLLISYYITLSFWSAQGLCLSMVSRNIAGATKKSTVVAATFVSWAV
                     GNAIGPQVFLSNDAPRYFIAFGVHLGCYTAMCLAVIFLRFYLMAQNKKKDRMLQEAGV
                     NPAMADNLDHAFEDRTDRENLHFRYIY"
     exon            393030..393383
                     /number=1
     exon            393455..393732
                     /number=2
     exon            393813..394331
                     /number=3
     exon            394389..394600
                     /number=4
     exon            394658..394902
                     /number=5
     CDS             complement(395521..396327)
                     /codon_start=1
                     /locus_tag="AO090001000176"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000120"
                     /protein_id="BAE56725.1"
                     /transl_table=1
                     /translation="MSTDTPPDSPQSFTTALPPSSLMAVHKDRFEAEFGREKRSDRAH
                     RAHVYEDTQWIEDDLEDRIQLIGSSLNRDMNRLNLLLQKDRSDARQISDWQAHIDHLE
                     RELKASNAERDALRIALEESQNRSTQEKDIARHHETLQKQLSEMQNEVQTLNKKAESQ
                     AAMLTKKDSLLQKHTKASNLKVQKEKTQLEEALEKAKRRAADAQKKARIAESERDEAQ
                     KTLEETRNKLVSSRYKRSIVEEQRKALEKQVKELKDELSKKKDKKRRYFW"
     exon            complement(395521..396327)
                     /number=1
     CDS             399568..400542
                     /codon_start=1
                     /locus_tag="AO090001000177"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000119"
                     /protein_id="BAE56726.1"
                     /transl_table=1
                     /translation="MGDSLSQVPEGLVGGYQGGLAVKILMVVFSSIALYNAIELIILI
                     FLVFNQYAGLYFWAMLLSNVLGVIPHAVGFLLEFFAKGPLWFAVTLATIGFYFMVPGQ
                     SIVLYSRLHLVVQNPKVLRQVRYMIIFNTIVLLIPTTILTYTTIYVRTEPIIRGYNVM
                     ERMQLAWFCAQEMLISCIYIWETTNLLRLRPDKDPGRRKIMYELITINVIIVLLDVAL
                     LVLEYVGFYALQTTLKAAVYSVKLKLEFAVLRKLVLLVNTRPSDTSSTDHEEYPNFVD
                     PEQLTGDITHAAPVRARTRSRYPWSAISMDSLDRSERRGYSSETTRPP"
     exon            399568..400542
                     /number=1
     CDS             join(402943..406419,406476..406784)
                     /codon_start=1
                     /locus_tag="AO090001000178"
                     /note="bacteriophytochrome (light-regulated signal
                     transduction histidine kinase)"
                     /old_locus_tag="AO070336000118"
                     /protein_id="BAE56727.1"
                     /transl_table=1
                     /translation="MESNADPTPAVKQGSREGACEIAQLVQEVPAADISAKYGSENEV
                     SLGVAERVYPIRSMVFVDPSSTTASSDDPISPVRGARQYSIIDSRTWDQLQSQRKSDT
                     EGIAPSIEAAQLLPTEAPGSGSETLVQSPATPTNASLGSPAENNGTSHLVTTRFKHVE
                     TDDGHAVLTGRTVDSFRACEDEPIHIPGAIQTFGAMLALREESEGKLVVRVVSENSES
                     ILGYSPHSLFALENFCDILDEDQTETLLDHVDFIRDEAYDPSADGPEVFIMSVTNPAG
                     QAVRLWCAIHVNSANPGLIICEFELEDDRINPISGSSGPSPSVPVDTLGVEFTPEQFA
                     ESTINISQPLRLLRNARRRKGEAAAMEVFSIVSQVQEQMNRAETLDLLLNTTVGIVKE
                     LTGFHRILIYQFDSQCNGVVVAELVDPRVTVDLYKGLHFPASDIPKQARDLYRINRVR
                     LLYDREQVTARLVCRTTEDLERPLDMTHAYLRAMSPIHLKYLANMEVRASMSISINGP
                     NELWGLISCHSYDTGMRVSFPLRKMCRLIGETLARNIERVSYASRLQARKLINTVPTD
                     ANPSGYIVASSDDLLKLFDADFGALSIRDETKILGGSTHQEMLALLEYLRMRRINSVL
                     ASHNIRKDFTDLKYPPGFKCISGLLYVPLSADGTDFMAFFRRGRLTEIKWGGNPYEQK
                     EKIGRLEPRQSFQIWKETVLDQSREWTDSDVETAAVLCLVYGKFIKVWRQNEEAMHGS
                     QLTKLLLANSAHEVRTPLNAVVNYLEIALEGALDKETRDNLTKSYSASKSLIYVINDL
                     LDLTNTEKGQDLIKDEPFDLEATFKEATGMFESEVERKGINYTVLPHPGIPQKVIGDQ
                     RRVRQAMSNLISNAIQHTSGGDITVELWRQPGRSEDGSATIQIAVLDTGSGISQARLE
                     TLFQELEQVSAESDNRGLGDGQDTLREVVDETEKQVLGLGLATVSRVVRNMQGQLSVR
                     SEEGKGSRFQITLNFPLPADAASAKDESEIPVHNVVPTAPLQSKEEFVLVDTRSEGRS
                     NGGSDTNSESGKATQKPATSQPSLDETSKLNPETDGLPTQALAPVDQPSETKTESTSP
                     IKEPPSESDPSPLPDTFCVLVAEDDPINSKIIQKRLTKLRHTVRLTVNGEECASAYRA
                     DPAQFDAVLMDIQMPIVDGIGSTKMIRQFEQETPPESLSRISRLNGRIPVFAVSASLF
                     EKDAEKYISAGFDGWIMKPINFERLNTLLAGLRDDDVRNSTTYQPGKWENGGWFQGR"
     exon            402943..406419
                     /number=1
     exon            406476..406784
                     /number=2
     CDS             complement(join(407019..407034,408455..408509,
                     408571..408636,409060..409635,409698..409790,
                     409843..410035))
                     /codon_start=1
                     /locus_tag="AO090001000179"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000117"
                     /protein_id="BAE56728.1"
                     /transl_table=1
                     /translation="MIEDYLHKGCHALVKGVNPAYGYQPSLAAGIVFCVLFGTSMVAH
                     TAQSFWSRKWWCLLFAIGCLTEVLGWAARTWSAECPYQTDAFLMQISTLIIGPTFFTA
                     GIYVLLGQLIALLGPESSILRPSWYLWIFCTCDIVSLVVQAVGGGMASSAASEVDGDT
                     APGTNTMVAGIVFQMAAITAFAFCGIDFLVRCRRPQLRARFTPRMRLLVLATTFFVVC
                     IYVRSIYRTIELLEGWSGYLITREWFFIGLDGIPMVLAVVVFNIFHPYWLLPREKEAR
                     KAESWVSLTRPENEYPRPQSTTSNRYTRYPSPNSTPNRPPLLKDLTRSLIRESLNI"
     exon            complement(407019..407034)
                     /number=1
     exon            complement(408455..408509)
                     /number=2
     exon            complement(408571..408636)
                     /number=3
     exon            complement(409060..409635)
                     /number=4
     exon            complement(409698..409790)
                     /number=5
     exon            complement(409843..410035)
                     /number=6
     CDS             complement(join(410759..410794,411097..411421,
                     411995..412083))
                     /codon_start=1
                     /locus_tag="AO090001000180"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000116"
                     /protein_id="BAE56729.1"
                     /transl_table=1
                     /translation="MQQTNISGIELSGLSTSWRKLFLFITAIPRILAHLPLSALFILF
                     DLVIHNPTHPETASNLALLEVAGGHFSRLEYATGGSLPSSVLAEFAYIARTFVRTYRV
                     EGNDGSTIAVPTNVNIDLPRRQDDSLPSAASFLENENTEAGAGSCSE"
     exon            complement(410759..410794)
                     /number=1
     exon            complement(411097..411421)
                     /number=2
     exon            complement(411995..412083)
                     /number=3
     CDS             complement(join(416124..416261,416424..416458,
                     416918..416981,417240..417494))
                     /codon_start=1
                     /locus_tag="AO090001000182"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000114"
                     /protein_id="BAE56730.1"
                     /transl_table=1
                     /translation="MPFTGGYSRSEVNRRRCIHTNGFLPGTAKNIQSDFNTYRQCEIR
                     SSDDFPLELENRFNVRCKARGFISLRLHGIQDYFPALDGKSIPLLMLNANSPPKLKLA
                     LAPQLPTKFLTAAASFFSLASWISSCSSVSSARTVTQLSSKVGWDAMKNERYSPVRRP
                     QPT"
     exon            complement(416124..416261)
                     /number=1
     exon            complement(416424..416458)
                     /number=2
     exon            complement(416918..416981)
                     /number=3
     exon            complement(417240..417494)
                     /number=4
     CDS             join(418809..419001,419060..419158,419216..419324,
                     419382..419502,419553..420136,420190..420360,
                     420412..421396)
                     /codon_start=1
                     /locus_tag="AO090001000183"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000113"
                     /protein_id="BAE56731.1"
                     /transl_table=1
                     /translation="MACRWIGVNLPILSAKCQAAKWLINLRAPLLPKILLGNGFPGCY
                     QTQETSSRSGGEPQEVLQSVRATVVRQERASVLNQTLADASGASLITYPATFNDRPKS
                     PPPSGDSSTELTQDATLVTPTDTGKVTAQSTSVLAGEAAGGSWPKVLSRLREAFCLDP
                     QGGLEEQRMAVGQTHMSHPTALHHAELERLESAVHAFPPQPIASFLLSVLIKHATDTF
                     FYVDQAAFASEIHHFYTDPASPLRSDSSFVCLAMAAFALASQWTTLEKPEGHQTTIGL
                     ERSDLGRVFFDHARMLIPDIIERPCLRSVQAPFVLGVYLMPASAIGSSYAYLGLALRK
                     ALALDLHQDVDDQKLNEREIEVRRRLWWSLYSLERCTTVKLNRPRSISVAAITTPIPS
                     GLPALDRSQKFDNLSFQLAYMRLVQILDHISDPELGSTGDELALLAKYESDLKEWKRS
                     LPLEFKLQDTDPHDSRYRAIFHLYLNYYYAWITIGKTSLISVVRAKLRSCATGSQPAQ
                     VSKVARNLSRSCAKAARKLLGLFETVSTSHKITRFSFTDFQGCSIATIVTLLDGIPER
                     DSGYEARVASGLEHLRQMAIGNATAKMGVRFVEAIQLITNEAREKVTQSAYAAGRTSQ
                     GNSGISSTAEYSQWALWLAQQEQSQGFSERTSSLSVVPETMTPLSQVGQWPPTHSAAG
                     LRPPWAAYERQMFSPTYVSMQNLAQEPQVYPEEQDADYEFLPALHHDEQTFLMELTGL
                     GVLDVSGLSNPLE"
     exon            418809..419001
                     /number=1
     exon            419060..419158
                     /number=2
     exon            419216..419324
                     /number=3
     exon            419382..419502
                     /number=4
     exon            419553..420136
                     /number=5
     exon            420190..420360
                     /number=6
     exon            420412..421396
                     /number=7
     CDS             complement(421594..422928)
                     /codon_start=1
                     /locus_tag="AO090001000184"
                     /note="imidazolonepropionase and related amidohydrolases"
                     /old_locus_tag="AO070336000112"
                     /protein_id="BAE56732.1"
                     /transl_table=1
                     /translation="MTQTTQVPGTDIKPWLQPAPQSYVFTNANIVDVEAGTILENSSL
                     VISEGKIQSISQGEHQPTDLHVIDCQGRYICPGLFDAHVHLCAVPGFTDLSKAFGNPN
                     DVHLLRQPYTAAQMLHRGFTSIRDCGGAQLALKEAIEDGVFPGPRIFLSGHALSQFGG
                     HGDLRNSHEHGQCCGGVHNQNSLGRMCNGVPECMAAVREEIRCGADFIKIMGSGGVAS
                     PTDKLEHLQFTDAEIQAMVECAANAGTFVTAHAYTVKAIRHCIDNGVRGIEHGNFVDK
                     PTAQLMAEKGVYLTPTLITYAQMASDRWKGYLSPESQTKNSQVLESGLGALKIASDAG
                     VTMCYGSDLLGPLGAAQTQEFQLRSQVLSPLEVLRSATINPARMMSCDDSLGQIKEGF
                     EADLLVLSKNPLENVTIFDKPDEHVLAVMKAGRVYKSRWAALPEDGATPVRL"
     exon            complement(421594..422928)
                     /number=1
     CDS             join(423675..423815,423882..424087,424142..424904,
                     424963..425331)
                     /codon_start=1
                     /locus_tag="AO090001000185"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070336000111"
                     /protein_id="BAE56733.1"
                     /transl_table=1
                     /translation="MDIPKSPCADIKDEERRVGELVNLPASYSDEEEKAVVRKIDMII
                     LPFLCFVFFLQYLDKQSLSYAGVFGLMGDLNLTSSQYSWCSSIFYVGQLVSEYPFIYL
                     MSRLPLTKFVGVTVIVWGGMCMCLAAPKTYNGFAAVRFLLGFSEGAVSPAFVTITSIW
                     YRQKEHTTRTALWISMNGLAQVIGCLLMYGIGKNTALSIAPWRVLFLICGAMTSAAGV
                     CFLVLMPSGPKDAWFLNAREKEVLRQRMAQDHEGGDKTSFSIPQLKEALTDPKAWLVF
                     WFGVLVTMQSPVLTFASLVIESLGYSKLDTMLYTAPSGAVQMALLWIGVALAAILPRQ
                     RTLVALMLIIPPLVGTVFLFKLDLSAEWGMIAMSWLASCITASMSILLSLSASNVKGN
                     TKRAIVNTMFFIGYCAGCIGSPQLWTNRPRYTEGVITSIVTWCLLFVAVIVYRLLCMQ
                     DNKQREAKAGASVDMSGDMLEENGLHGADMTDKNDPSFRYAL"
     exon            423675..423815
                     /number=1
     exon            423882..424087
                     /number=2
     exon            424142..424904
                     /number=3
     exon            424963..425331
                     /number=4
     CDS             join(425775..426012,426100..426272)
                     /codon_start=1
                     /locus_tag="AO090001000186"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000110"
                     /protein_id="BAE56734.1"
                     /transl_table=1
                     /translation="MAIDHTTLFVPEAKFQECLNFYLSALKPLGYEVRHQYGEFVVGL
                     GSINEDLDSYKRADFWVFGTKTVPERAAHIAFTSHDHASVDAFHAAAIEAGGKDNGLP
                     SLREFYHPKYYAAFVLDPAGNNIEVVDHGVSLDA"
     exon            425775..426012
                     /number=1
     exon            426100..426272
                     /number=2
     CDS             complement(join(426598..428723,428836..428929))
                     /codon_start=1
                     /locus_tag="AO090001000187"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000109"
                     /protein_id="BAE56735.1"
                     /transl_table=1
                     /translation="MSSIAEASISSRSLVLSVPEDDRLSLSSDIHNFEYVGFHDSAEY
                     ASNNYFFQREFPTLLSSSKSCIFCRKLVSIIKDWFAANPGDRTNELDISRTHVVVSLE
                     TDWHTVTRNKDGLVDEKAHSDRIRINCSIPRLDDNDPGQSQHLTFFLQRYEESSDDVC
                     YHCPSEDAISPKLQPYAGRQRPIVADLTLFKRWKEMCQEIHGAKCSQIFKGTPNIRPR
                     VIDVERRCLTFAEENDQWVCLSYVWGKAKTLRLLKENIQTFSQPGALSPEVLPNITED
                     ALQVTKGLGERYLWVDSLCIVQDDDQDKAQFISRMDSIYTLATVVIISSTCTDANTPL
                     AGVKPGSRRQEQEPFKIRDVILVQSLDPSLGVKVDLRTGRAAGYLGETIWDTRAWTLQ
                     ERFLASRSLVFTAEQVFWECEEAFWCEDSFREIPNISPDPHRTSLCAGELNLSWNSDI
                     VTFDHFYRVLLEDYSGRALSFDSDGLNAFLGIIGALERSTAERFFWGMPTAFLESALA
                     WGHRSHALRRRHGVQTLSQDQSQFPSWSWVGWTSDGQTKLANQNLTMEALGLRFYRVS
                     DDGSTMTEMRQNANFNSEVDLLVEGSKLPNRSSRPHEVSMQDLPTNPSISPSSLLCFW
                     TASAHLTVTSRHSVDDASDSSTWEATLSQGSDRFIQVSWSHTAPSLKTGDSVELVAVA
                     QNRGNWDAGHIDNGAIGVMLISWDSKGDIASREGFAWIAIRDWTSLREREWKLVVLG"
     exon            complement(426598..428723)
                     /number=1
     exon            complement(428836..428929)
                     /number=2
     CDS             complement(join(429475..429900,429911..430648))
                     /codon_start=1
                     /locus_tag="AO090001000188"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000108"
                     /protein_id="BAE56736.1"
                     /transl_table=1
                     /translation="MSAVTEPPVFDRETSLAAIPLLAIAAYNSVELFYWIFSFFRRYN
                     GCYFWSLLVTAMGIIIFVTAVVLSLADMGPSALIKIAYSLGFLVMVTGSATVLYARLH
                     LVTMDKTPEHVLCFIIFTTCTLHLPLTILYLVRAFIEFTTRPALESFSRKYEHFVIAC
                     SCARELVLSGIYLWVAFRNLKPILDAKGQEGCRVKSELIVMNAFVLASTVCLVVLDHT
                     DHDAIKHGYGSMATSIKLKMEFAILNKLFRARCISTISQRCTTPPTTIPFESMTWNTL
                     PIPINAYDLPTTNLLVTLPLLSGLSRALLMRSLVTVFFTAVQDIVTLRRVRAEAEGDP
                     LGEEADNLPYVLSGRYRRARHGQFKLAYIIYNELKYLPGLCPVHSYAPCRVML"
     exon            complement(429475..429900)
                     /number=1
     exon            complement(429911..430648)
                     /number=2
     CDS             complement(join(432676..433081,433144..433246,
                     433301..433514,433565..433743,433794..433827))
                     /codon_start=1
                     /locus_tag="AO090001000189"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000107"
                     /protein_id="BAE56737.1"
                     /transl_table=1
                     /translation="MSTPGAQEVLFRTGIAAVNSTNHLRVYFQDSHGSIRESLYESGW
                     ANGTAKNVIAKAKLGTPLAATSKELKNIRVYSLTEDNVLQEAAYDSGSGWYNGALAGA
                     KFTVAPYSRIGSVFLAGTNALQLRIYAQKTDNTIQEYMWNGDGWKEGTNLGVALPGTG
                     IGVTCWRYTDYDGPSIRVWFQTDNLKLVQRAYDPHTGWYKELTTIFDKAPPRCAIAAT
                     NFNPGKSSIYMRIYFVNSDNTIWQVCWDHGQGYHDKRTITPVIQGSEIAIISWEGPEL
                     RLYFQNGTYVSAISEWTWGKAHGSQLGRRALPPAE"
     exon            complement(432676..433081)
                     /number=1
     exon            complement(433144..433246)
                     /number=2
     exon            complement(433301..433514)
                     /number=3
     exon            complement(433565..433743)
                     /number=4
     exon            complement(433794..433827)
                     /number=5
     CDS             complement(join(436716..436794,436837..436864,
                     436977..437060,437166..437286))
                     /codon_start=1
                     /locus_tag="AO090001000191"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000105"
                     /protein_id="BAE56738.1"
                     /transl_table=1
                     /translation="MIIELLSTLDIETRSLLSIHQQLKKENKSTPVRLRDKPTINDFA
                     LHSAICVQAIGTMYTNCLENSNGLYGDIIILKIASYVINSMSSAMILRKKELVNAEKA
                     V"
     exon            complement(436716..436794)
                     /number=1
     exon            complement(436837..436864)
                     /number=2
     exon            complement(436977..437060)
                     /number=3
     exon            complement(437166..437286)
                     /number=4
     CDS             join(437572..437595,437670..437905,437967..438912)
                     /codon_start=1
                     /locus_tag="AO090001000192"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000104"
                     /protein_id="BAE56739.1"
                     /transl_table=1
                     /translation="MVSLWPFKGEDNSPASFERALETLSGKITRANTRLDTHRQNARR
                     FKALWTLYTTFAYLLYSIILALVLGWQNFGVVEYAAIAGGPVVIYAVRTAGSKYFEYR
                     INSNQRYLDDLQKQRDETIEKLKVATKYNSTQQLLEKYGGVPKRTKSKGGDDKRKSES
                     KRKSSNPQQQQPPVQRTGLPPPPTANIRRPTPVQSPGAPSPDFPAPPSPYPPQPQIQQ
                     QPVPPPGPAFDEPGFAPNAFPSAPQYIEQSHWYDRLMDVLLGEDETQPKNRIVLICSS
                     CRLVNGQAPPGIKSLEELGRWRCGSCGAWNGVESEAKKVLDGIRNEPQPADGAWEPVS
                     KTDAENQSSVSDATDEGVMVATSEDDQVESHDSDADTADKEPEQVKEEQPEPETKTRP
                     VRRSNRKKA"
     exon            437572..437595
                     /number=1
     exon            437670..437905
                     /number=2
     exon            437967..438912
                     /number=3
     CDS             complement(join(439439..441914,441964..443037,
                     443109..443256,443315..443567,443636..443684,
                     443806..443834,443907..444011))
                     /codon_start=1
                     /locus_tag="AO090001000193"
                     /note="dsRNA-specific nuclease Dicer and related
                     ribonucleases"
                     /old_locus_tag="AO070336000103"
                     /protein_id="BAE56740.1"
                     /transl_table=1
                     /translation="MAQLNGSNGTGLLYKPRQYQYEMFEASLKENIIVAMDTGTGKTQ
                     IALLRIAHQLEGGGPRKLTWFLTPTVALCLQQYEVIRSHLPAVRACTITGLDKVERWK
                     SQYIWDELLKDKQVVVSTHAVLFEALTHGFVRISQLGLLIFDEAHHCMRRHPANMIML
                     DFYHPTLRKHGRDSVPCILGLTASPVVRSKSQEMKTLESNLDSICKTPQVHKQELTTY
                     AHRPELLPIICKAIDEGPGGRALQALEHAWDTADIDGDPDAIPQNGSLLNGSGEYKAL
                     MVRKTLCNEQIKRFVDRSRHIFAELGEWAADYYICTSVEQLRTTIRDQSLTMDWEDEE
                     RAYLSNFLSKLPVAEVQANLADPNNFTMSPKLAALINFLDKFDDPEFSGLIFVKQRVT
                     VSVLARLLSLHPQTRDRFRCAAYVGMSVGSCRQDMVGDWHNAKKQRGTMDDFRSGRKN
                     LIVTTSVLEEGIDVTACRVVVCFDKPANLKSFIQRRGRARQQKSTYAIMFSTADEHGD
                     LRRWQILEQAMVEAYQDEERRLREAEAQEAVDENVPEMITVEATGAVITPDSVVTHLY
                     HFCAVLPEERYVDNRPEFSFEKDRQGLIKGTVILPSCVHPKVRRIQGKLWWKSERAAV
                     KETAFQAYRALYEFGLLNDHLLPLTKNPEMRPTDHTTLPSLLDVSEQYDPWTDWANSW
                     SCPDVHQMRIALESNGHPADGLIMKLIGPTNLPPLAPITLFWDRDTRLTLSFDVPERI
                     TTVTDNCIANMRTVTALYIQAPRSRNLLNNDDFVTLFGPDLPSTELADWLLRNAGYET
                     AHEAYSRGTMPGAMGIIRDLSRYDEPFFCHRWIESETGLIEIECRPIPRRRNFLHPPA
                     LDNGQADAIVESEHGSAKVHMVAAESCTVDKLPVSTAIFGLFIPHIVDRLESTLIANR
                     LCATILCDVGFADIQHVITAIMAPSAQGVTNYQRYEFLGDSILKYIVSCQLFFQNLNW
                     PEGFLTEGRTTIVQNPRLTRAALDAGLDSFIITKALTPRRWIAPLISTRVGAAPVKRQ
                     MSAKVLADVIEALIGAAYLDGGHSKAQICTHCFLPEVNRQPLDIPSLITQTEHGRTAR
                     HIIDGDLQRHLGYTFKNEDLLIEALTHPSCQHDQTTQSYQRLEFLGDAILDMVIVPII
                     FQYSNKISPGDMTLIKHAVVNANLLGFFCMEFSIEQDKTKVEKTPDGRFAVKSETQHV
                     ELWRFMRFNSLDLQTSRDAALDRHRRLRNKILTSLYHGPSYPWQSLSQLYADKFFSDI
                     VESVLGAIYVDSGGDLSACERFLEQIGLLSYVRRVLLDGINVTHPRNIAQRLSKGDAL
                     FNLRRVSDEKGRSMYRCTVTMNDAQIVLVEGCQCGEEAEVRAANETIEFLQRRQEVV"
     exon            complement(439439..441914)
                     /number=1
     exon            complement(441964..443037)
                     /number=2
     exon            complement(443109..443256)
                     /number=3
     exon            complement(443315..443567)
                     /number=4
     exon            complement(443636..443684)
                     /number=5
     exon            complement(443806..443834)
                     /number=6
     exon            complement(443907..444011)
                     /number=7
     CDS             complement(join(445068..445574,445624..445812))
                     /codon_start=1
                     /locus_tag="AO090001000194"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000102"
                     /protein_id="BAE56741.1"
                     /transl_table=1
                     /translation="MQPNTTSPRDQNNIDPAISGAAMLSGPPQTPPQPEPTGQESPKT
                     YGKRPLSTSKRAAQNRAAQRAFRQRKESYIRKLEEQVKEFDTMSEAFKALQAENYQLR
                     EYIINLQSRLLESQGEVPELPGNIDLSQPRTDLNVPQPGAGPATTSSSAPAPPSGAQQ
                     AQPPQGAASNDDMNSLNRIAVAGLGMRKHPNEEANYLGNNFTGRRTRPDETQADSEVT
                     KTEQAPHGLPMVS"
     exon            complement(445068..445574)
                     /number=1
     exon            complement(445624..445812)
                     /number=2
     CDS             join(446379..446467,446559..446588,447046..447274)
                     /codon_start=1
                     /locus_tag="AO090001000195"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000101"
                     /protein_id="BAE56742.1"
                     /transl_table=1
                     /translation="MLGCGAGANVGCMESIEVQTRRRAERVRNTGIGMERRAMRQNLA
                     KGINHNNPRTLRVADSGADSSFRLFRSAVTGSACDASGPAYNNEVACTEDRELGGGLE
                     IFKSLSLKNSVLF"
     exon            446379..446467
                     /number=1
     exon            446559..446588
                     /number=2
     exon            447046..447274
                     /number=3
     CDS             complement(join(451431..451763,451811..452446,
                     452531..452760,453460..453493))
                     /codon_start=1
                     /locus_tag="AO090001000196"
                     /note="NADH:flavin oxidoreductase/12-oxophytodienoate
                     reductase"
                     /old_locus_tag="AO070336000100"
                     /protein_id="BAE56743.1"
                     /transl_table=1
                     /translation="MPVKVFPPLLRSSKLFQPLDISNGKIKLSHRVVHAPMTRNRGVP
                     VNATSTPENPNRTWYPGDLMVEYYRQRATPGGLIISEGIPPSLESNGMPGVPGLFTEE
                     QIAGWKRVVDAVHEQGGYIFAQLWHAGRATIPQMTGSPAVSASATVWDSPTECYSHPP
                     VGSTEPVRYADHPPIELTVPHIKQTIQDYCQAAESAMKIGFDGVELHGGNGYLPEQFL
                     SSNINKRTDEYGGSPEKRCKFVLELMDELAKTVGEENLAIRLSPFGLFNQARGEQRVE
                     TWTFLCQTLKQAHPKLSYVSFIEPRYEQIFSYEEKDDFLRSWGLLDVDLTSFRKIFGD
                     TPFFSGGGWNQTNSWGVLEEERYDALLYGRYFTSNPDLVQRLKKGIPFKPYERSRFYG
                     PFEDNAVCYVDYPPAEAQ"
     exon            complement(451431..451763)
                     /number=1
     exon            complement(451811..452446)
                     /number=2
     exon            complement(452531..452760)
                     /number=3
     exon            complement(453460..453493)
                     /number=4
     CDS             join(455101..455537,455591..455960)
                     /codon_start=1
                     /locus_tag="AO090001000197"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000099"
                     /protein_id="BAE56744.1"
                     /transl_table=1
                     /translation="MSLFVKYALLSILIRIFSPYRGRIMFIYVLLGCLTIYYIIAEIV
                     KIRMCDPVPAYWTGEPANCLDQRAALIADSVISVVTDIMILVLPLPLTWSLQMSRSKK
                     LRVIGMLSAGGLATAFSVYRLILVLKDGSSPNATVMFMCVILSGNAEGGVGLICACLP
                     TMNILINKIRKAGYSYGSNKYYRDESSMHLSKMKGANAKGFSTIGSKTSRTEPEFGTD
                     QSHLISYAGAVDMNATGDGGIHKTVDVSQTVEVLSGEASSSHSDDHHMRF"
     exon            455101..455537
                     /number=1
     exon            455591..455960
                     /number=2
     CDS             460384..461391
                     /codon_start=1
                     /locus_tag="AO090001000199"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000097"
                     /protein_id="BAE56745.1"
                     /transl_table=1
                     /translation="MSKRIQSFFQPIPKKPKVGTSSPDPSQPSDPLYIQQQHEQNQEE
                     QQPPPTNHQTYPFPIPNLPPDLSKSLTTISTTLKAPKPITNHPHLDLLYFQPLLPPQT
                     ANALFHFLRNSLPFYKVQYTIHRGKTPTKITTPRFTTVFGVDATSIFTTDQEKTLHDA
                     KTNTPIPPRTKYKHTPRPIPPCLTHLLQTIQTTTNTPPDYYNFILINYYATNTDSISY
                     HSDDERFLGPNPSIASLSLGAKRDFLLKHKPGVEAGKPLKFPLASGDMVVMRGETQGN
                     WLHSIPKRAGEGGGRINVTFRRALVPGGTENYYRYNVGDGGVWRWDEREGRMVSVDGE
                     K"
     exon            460384..461391
                     /number=1
     CDS             complement(join(461690..462242,462296..462720,
                     462790..463224,463287..463424,463651..463782))
                     /codon_start=1
                     /locus_tag="AO090001000200"
                     /note="acyl-CoA synthetase"
                     /old_locus_tag="AO070336000096"
                     /protein_id="BAE56746.1"
                     /transl_table=1
                     /translation="MHLIGPAVSTKWHWMNCHPFSGEVVTTHYDSWSSLPCGDGPITW
                     IYIDASDSSRSISYNQAKVIVRKLIAGLRAWGVQKGDCVAIHSFNDIYYSMLVLAING
                     AGGVYTGTNPSYTPMELGHHIRASHAKFIISEPEIIAPIQAAMKETGIPESNLLVFDV
                     QGQTVPAGLKSWKGLFSAGEEDWVRFDDLKTCEETAAARLFSSGTTGLPKATTLTHRN
                     FIAQHELVFEIEKRPYQIRRLMALPMFHAAAAPSTHWSPLKGGHVVHVMRRFDLVSFI
                     TNVEKYQITDLAVVPPIAVALVMSPQVQERPYLKSVRVASCGAAPLSKEVQEKLRVML
                     ADGAPCTQVWGMTETCCIATRFGAYEQDDTGSVGRLIPNVEAKLVDDDGNNISAYGVR
                     GEICVRGPTVTPGYFENAAANASSFDQDGWYHTGDIAYCDKDTQKWYIVDRKKELIKV
                     RGFQVAPPELEAVLLSHPLIVDAAVIGLSGVLPDSELPRAYVTRRPGTGDKLTEKEVQ
                     DYLGQRLAKYKALTGGVRFMDAIPKNASGKILKRVLREEAQKEVKAGFRPKL"
     exon            complement(461690..462242)
                     /number=1
     exon            complement(462296..462720)
                     /number=2
     exon            complement(462790..463224)
                     /number=3
     exon            complement(463287..463424)
                     /number=4
     exon            complement(463651..463782)
                     /number=5
     CDS             complement(join(471848..471875,472027..472631,
                     472685..473056))
                     /codon_start=1
                     /locus_tag="AO090001000203"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000093"
                     /protein_id="BAE56747.1"
                     /transl_table=1
                     /translation="MLIAVVPASPKTGQAAIRALLNSTQTTTPITVKGVYRDLSRVPE
                     EFLSNPHFQASKGDVSDATSLDLTGVDAVLAITPPRYDGSDFLACARTASENTRLAIQ
                     KSGSVKRLVLLSSMGAEHESGTGEIMTNHIAETILKDAAPEVVICRCAYFMENWAMGV
                     QTAKSEQPHLYSYITPADFEVPMVCFLSLYVQHEILMLINPLNQVAVKDMGQAFATYL
                     LKPDIPERPHIVDVHGPRSYTPKDVQKAFEEAVGKEVELRLVERKDLSQFFAGFLPKN
                     VAEAFTEMTDAFLPGGIMAPANAENSSSDRVWRGKTELREAIRELCEGSGYKLSQKPS
                     "
     exon            complement(471848..471875)
                     /number=1
     exon            complement(472027..472631)
                     /number=2
     exon            complement(472685..473056)
                     /number=3
     CDS             complement(join(473620..474444,474496..474952,
                     475005..475222))
                     /codon_start=1
                     /locus_tag="AO090001000204"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070336000092"
                     /protein_id="BAE56748.1"
                     /transl_table=1
                     /translation="MTEPIPSVLEKGGKAEESNRSSGEYNDLENVPKEDDTTLVDWDG
                     PDDPANPFNWSTPKKARQLVFMAFNTFVSPLASSMFAPGVQYVMRDFHTTDQMLGSFV
                     VSVYILGYMLGPFLIAPLSEIYGRVPLYHACNVIFLVFTIACAVAQTLPQLIVFRLFA
                     GIAGVCPITIGSGTVADMVPVEKRAGIMAIWALGPILGPVVGPIAGGFLAESVGWRWV
                     FWVLAIATGVMTIGCLLSYRESYAPVLLRRKTERLRKETGNPNLRSARGDTKITKELF
                     ITALSRPMKLLFRSPIVFLLSLFAAVTYGYLYLMFTTLTPIFRNTYGFSSGLAGLAYL
                     GFGIGSILGLGICGVVSNRIAVSHTARGCFKPESRLTPMLFGSWAIPAGLFWYGWSAQ
                     AHTHWIVPILGTGVFAIGLMVVFMASNTYLVDSYLRHAASVTAAATVLRSLIGAVLPL
                     AGPSMYDALGLGWGNSLLAFIALAMCACPLLFWKYGEFIRTHPRFQIAL"
     exon            complement(473620..474444)
                     /number=1
     exon            complement(474496..474952)
                     /number=2
     exon            complement(475005..475222)
                     /number=3
     CDS             complement(join(476703..476716,476867..477302))
                     /codon_start=1
                     /locus_tag="AO090001000205"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000091"
                     /protein_id="BAE56749.1"
                     /transl_table=1
                     /translation="MQFSLSFAAFIALSGQTLAQSATGSYVITESDNILTAKGTSPAV
                     FSPFNGSYDQIWSFNGVGFGTVVIQCQDSPDYLNCDEDGSPCTPSTEPQIFEPIKRGQ
                     ELYQISDDSGDLFLAESSDKTIHLVYDVQDDEKALFTLTRPAEFKET"
     exon            complement(476703..476716)
                     /number=1
     exon            complement(476867..477302)
                     /number=2
     CDS             join(480389..480849,480931..481315)
                     /codon_start=1
                     /locus_tag="AO090001000207"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000089"
                     /protein_id="BAE56750.1"
                     /transl_table=1
                     /translation="MKNFFSMHAILLACSAGAGLAAITQGISEGTYSRIVEMATISQA
                     AYANLCNIPPAITSAGKIYNAETDINGWVLRDDSRQEIITVFRGTGSDTNLQLDTNYT
                     QAPFDTLPQCSGCAVHGGYYVGWVSVKDQVEGLIHQQASQYPDYSLVVTGHSLGASMA
                     AITAAQLSATYNNITVYTFGEPRTGNQAYASYVDETFQATNPDATKFYRVTHTNDGIP
                     NLPPTSQGYVHHGTEYWSVEPHGPQNMYLCLGDEVQCCEAQGGQGVNDAHVTYFGMAS
                     GACTW"
     exon            480389..480849
                     /number=1
     exon            480931..481315
                     /number=2
     CDS             join(482729..482960,483016..483056,483108..483329,
                     483376..483521,483574..483662,483712..483730,
                     483779..483795,483881..484059,484110..484199)
                     /codon_start=1
                     /locus_tag="AO090001000208"
                     /note="beta-1,4-xylanase"
                     /old_locus_tag="AO070336000088"
                     /protein_id="BAE56751.1"
                     /transl_table=1
                     /translation="MVHLKSLAGILLYTSLCIASSQQAPASINNAFVAKGKKYFGTCA
                     DQGTLSDGTNSGIIKADFGQLTPENSMKWDATEPSQGKFSFSGADYLVNYAATNNKLI
                     RGHTLGMLQTQQRLYAEKLISTVWHSQLPSWVQGITDKNTLTSVLKNHITTVMNRYKG
                     KVYAWDVVNEIFNEDGTLRSSVFYNVLGEDFVRIAFETARAADPQAKLYINDYNLDSA
                     NYGKTTGLANHVKKWIAQGIPIDGIGSQTHLSAGGSSGVSEVAITELDIAGASSNDYV
                     NVSRGIVYYPELSNWTQVVEACLEVSKCVGITVWGVSDKNSWRSAESPLLFDGNYQPK
                     SAYNAILNAL"
     exon            482729..482960
                     /number=1
     exon            483016..483056
                     /number=2
     exon            483108..483329
                     /number=3
     exon            483376..483521
                     /number=4
     exon            483574..483662
                     /number=5
     exon            483712..483730
                     /number=6
     exon            483779..483795
                     /number=7
     exon            483881..484059
                     /number=8
     exon            484110..484199
                     /number=9
     CDS             complement(join(484996..485717,485763..485955))
                     /codon_start=1
                     /locus_tag="AO090001000209"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000087"
                     /protein_id="BAE56752.1"
                     /transl_table=1
                     /translation="MSTQTEVFTGTEGSYLLPHHVTEADRLQRQHRHFAAASDEAYFG
                     FTLPPSTGRPLRILDSGCADGVWLHDMAKRYPEHSWDLHGVDIASHLFNDGVDIDFRY
                     HDIRQPFPSDWNWEGSFDIIHQRLLVWALKKEEWPQVVRNLQALLKLGGTIQLVECQW
                     LRPEFWDTHPQQRLLGMVQVWATEGNGMDIHLADKLEPLLKELGFEDVTTVRYPLPYG
                     AKVKDPANRDRSAELWVESFRHLARLMGGKYFFCSLHGWTLTGVDEGIPGVAKTPEEY
                     FAFLDRLVVEMKEKGYIPELRLVSGRKA"
     exon            complement(484996..485717)
                     /number=1
     exon            complement(485763..485955)
                     /number=2
     CDS             486416..487840
                     /codon_start=1
                     /locus_tag="AO090001000210"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000086"
                     /protein_id="BAE56753.1"
                     /transl_table=1
                     /translation="MTIRMANTSLSEASIYSCGPPGICQPESAITPPDRRRGSPACWS
                     IPAGVYTARELVRRFAPLLDTVVHHLGPDPPNTKPARIVLLDNVAANLSTDTRESSLP
                     LYDLSDISRREVRDQARRIGQVLVQWAREYTDEPYDPDLYLRGPGDGHLLLQSSLALM
                     YARCTRPHHMQLLSEYMRQMVVLRDALLPFQNFYAVPIPVDGRARGIRHLEAPRERFL
                     TTVFAGHITQASVVSLARAVLAPDLPVTMTGGYGFQYTHGLILPAILAGGVVPYHLLR
                     YVPSKMDSSAVEVLFDYHFPDYHEAPRGDIPAGPPTILTRYPIDLPNQKEELQTAGIG
                     LQAGSSTSAIRGLELRLEFKSGDTARVDVGQIARGLRHSYEAREETRDSTTNHTVFLH
                     SASEILIQPGWGLSTAETAGFHVIPVDDPTIALALLGKLYPRNVILLPNDEQLGQTDD
                     VGEDSEAKFVIWGGFKRGGLKGVF"
     exon            486416..487840
                     /number=1
     CDS             complement(join(489624..489632,489674..489979))
                     /codon_start=1
                     /locus_tag="AO090001000211"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000085"
                     /protein_id="BAE56754.1"
                     /transl_table=1
                     /translation="MYRSHDATVRHDKVYALLGLCADDPKASALEPNYGLPWSDALKK
                     GTTYILGGKCSVQTWPDTDIAVIKGKGWILGYIAQVRPRSSEDDQAYVSIQFNHTAEW
                     SS"
     exon            complement(489624..489632)
                     /number=1
     exon            complement(489674..489979)
                     /number=2
     CDS             complement(join(490312..491769,491825..492064))
                     /codon_start=1
                     /locus_tag="AO090001000212"
                     /note="acyl-CoA synthetase"
                     /old_locus_tag="AO070336000084"
                     /protein_id="BAE56755.1"
                     /transl_table=1
                     /translation="MIFESKLPLPPVPSCDAFNYIFHHGRRNYSTDRVLYRVDGTDET
                     LTFEELEQKSRQFADAIREYYDIMPNDVVAILAKDKIQYPIAYYGILAAGAVVALIPV
                     QKEVSETDVAARLEQAKAKLVITDSELLRLTEVASMLAGCISVMTLDANDQNWPCVDS
                     LLPMGNPDAQTFELKTPQEVDQHNAFINRTSGSTGTMKSVLTSHAHYIATMEATVGTI
                     PADTNPDRDVWVSPLSLGFFINAKLHMGLNILLGIPVVLMKQTLDETTVDVVARHHIT
                     FLFITPPIAARLARADLRHINVSSVKWLLTAGAPMHENLRRTVSRQFGGVHLTLEWAT
                     SETMLLAMQVDECSKQPGSSGTLVNGIQAKVINVETGRECSYGEEGEILVRNAIARFK
                     GYKDNEVANRDFDSEGWFHTGDYGYLDQNCNVYIVDRIKELLKVGEGYGSHVSAAEIE
                     AILFEHPAVSSVVVVGVRNTETQVDEPTAFVILRTEYRSRTAQVTRDIERYARAKLTG
                     LRRLTGGVHCISSYPTTGFKINRRALKSMVPSKMPKMPVVPSCLLPTMSAISAMRMV"
     exon            complement(490312..491769)
                     /number=1
     exon            complement(491825..492064)
                     /number=2
     CDS             complement(join(494621..495061,495126..496163))
                     /codon_start=1
                     /locus_tag="AO090001000213"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000083"
                     /protein_id="BAE56756.1"
                     /transl_table=1
                     /translation="MDRNGISDTSSAMALDDVPHSGPNGSHPLSVTGQQCNTTTPTHF
                     DPMSATGWNPFGTTSMDSMVRALDGSLFSPGGSLPWGDDYTPLTDPMSVGNTFAGAMD
                     ESTNPGSSYFLPLHEISKPVGPLDAPQPGALTANSYNANSPYNVPSLSSSSSDSHYRD
                     SSSRGEENDPTQGLLRGDHSPRLTLGYHFVPKVGPFAMRDYDETYRDLFTVLRDYPGM
                     ILEREFWSPFVHHRLYRCSMGGMAEPMGIALACVSAHASSVESSYGFVDRMINEERDK
                     LVRNFHKHVDTPETCLAAVHAVCLYQILGLFGDNFLPAAIVRPQVPKEINDKRREENE
                     RAAELHSSFLMKMARRLYKMHQEKLLTHHNDETDWNRWKYAESLRRNFFFVNMINILG
                     AKARLLNEQYFEPLGDDIVLQLPLPATEHMWRCCDEEEWAIAREHAMRRPANSPPVAR
                     TLRELLEQDKAGTLDASTLLPVTRLIFACAKVAPKGDSLGDL"
     exon            complement(494621..495061)
                     /number=1
     exon            complement(495126..496163)
                     /number=2
     CDS             501305..502612
                     /codon_start=1
                     /locus_tag="AO090001000214"
                     /note="3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP)
                     synthase"
                     /old_locus_tag="AO070336000082"
                     /protein_id="BAE56757.1"
                     /transl_table=1
                     /translation="MTHHIHDTWTPQSWSRKPVVAQDVEYDDPKALESVINTLSTLPA
                     LVNPMKIEIARKSFAAAARGKAFIIQGGDCAESFDDVHPHAIQQKVKLLQEQSHLLGQ
                     GLNLPIITVGRIAGQYAKPRSSPLETLEDGTLTHTFRGHNINGPGVEERRPDPYRLLL
                     GDFYSRTTLEMIRHTQSTPSTTGKTFVPAPSSFPLTPEETDVTPLETPTGTIFTSHEA
                     LHLPYESAMTRDRYNTSASFIWIGERTRQLDGGHVEYIRGLRNPIGVKIGPNTGSSTL
                     IALLNTICPEPHLLENIGRVTIITRLGADKVTTVLPPLIKAVQEAGHTPVWMCDPCHG
                     NTQTSEAGLKTRHVGCMLLEAIGTYQAHRENHSLLGGLHLEQTGDFVTECQDDDTLDT
                     ESNLSSNYHTLCDPRLSHVQALSLVRQFVDFVRSWERKEKLGY"
     exon            501305..502612
                     /number=1
     CDS             join(503317..503502,503566..503602,503684..503779,
                     503835..504809,504870..505102)
                     /codon_start=1
                     /locus_tag="AO090001000215"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070336000081"
                     /protein_id="BAE56758.1"
                     /transl_table=1
                     /translation="MKPAETEVVNIMAEQVVVCPKLSTNEDEAMRAFDNGRDLDVRDI
                     DDATNARLLKVIDKNLLPLLCLIYGLNFVDKTTLSYASVMGLQTDLNLQGNEYQWLGS
                     IFYFGYILVEYPSSYLMQRFPLAKYSSFNIILWGVTLTCFAAVNNFAGAATVRFFLGV
                     FEAVVTPGFTTLTSRWYTKHEQGRRVGFWFSCNGVANVVGGLIAYGISRGVEQHGASI
                     QPWRILFLSFGLFTIAVGMAFLYYVPDNQWNCRFLSPADRVLAVQRIRGNQQGIGNRH
                     FKMYQFKEALTDPITWAFAFFGIAVNIPFGGITTFFSQIIRNSGYTSQQSLLYATPGG
                     AFQTIVVILNGIISDRLQQRIYVSFVGMIIGLLGAILLAALPLSNSPGRLAAYFLTQA
                     SPTAFIALLSFISTNVAGATKKTTVGAIYMVAYCVGNIIGPQTFQQSDAPRYIPAEIG
                     ICCCWGACLLDLFLIRYLYCKRNAEKARIRSAPGYEKAEKSEFKDLTDRENPELVYVV
                     "
     exon            503317..503502
                     /number=1
     exon            503566..503602
                     /number=2
     exon            503684..503779
                     /number=3
     exon            503835..504809
                     /number=4
     exon            504870..505102
                     /number=5
     CDS             join(506160..506844,506903..507228)
                     /codon_start=1
                     /locus_tag="AO090001000216"
                     /note="isopenicillin N synthase and related dioxygenases"
                     /old_locus_tag="AO070336000080"
                     /protein_id="BAE56759.1"
                     /transl_table=1
                     /translation="MSTPIFPVIDYSRIISSNPMIAAQEKDKLFQSFKDVGFIYLKGF
                     NFPPEFIDTLFSHLHKFFSLPEEQKLAIEGGEKQAFRGWFAPARTAKNPEKADQKEAF
                     GLGNDKDETRPNRWPSNWPEFRRDFTTFYEECYKMHLELLRALTEKVGLDRESLIPSV
                     KAKDCYSALLHYYETSLESFDTRVRSAPHTDFGTLTLLFNDSNGGLQVKNQEGQWVDA
                     PPMRGHAIVNVGDLLSRWFNGQLKSTQHRVVQPPAETRETENGTTTVIPSRYAIAWFG
                     HPNRDAVVEPLKECVTAEWTQKFKAVVAGKHVKERMARLLEHGYLPEKWTDDMHRKPI
                     AV"
     exon            506160..506844
                     /number=1
     exon            506903..507228
                     /number=2
     CDS             complement(join(511560..511592,512222..512716))
                     /codon_start=1
                     /locus_tag="AO090001000217"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000079"
                     /protein_id="BAE56760.1"
                     /transl_table=1
                     /translation="MPPKRVRKTVSTTHKPPSPPLSEKNASVADENADVEPPEAQDKG
                     SMGSPRSPRHDEGNGPPVMMDEDEEMPEESGNTIQHARPEYAVGAGGYNMLKSYKGQV
                     YSGMAVGGSHTWNYDQGVWKETKEEPDLWRIDYQTNKRRARKAPEGSGAPVGTEYHWL
                     IVAHQQRGTSDATRK"
     exon            complement(511560..511592)
                     /number=1
     exon            complement(512222..512716)
                     /number=2
     CDS             join(516535..517571,517627..517732)
                     /codon_start=1
                     /locus_tag="AO090001000218"
                     /note="RRM domain"
                     /old_locus_tag="AO070336000078"
                     /protein_id="BAE56761.1"
                     /transl_table=1
                     /translation="MSAEQNVANTEAEKDVQNVLAELKGEAETNGAEKKEEPSTEDAE
                     EARIVAAAAQLGEKSAKAEEDKERENRGRGPRRNNAKFDPSSQKETDDPVEIRKQVEF
                     YFSDSNLPMDKFLLSKVGGSQNRAVPLELLHSFKRMRRFQPFSAIVEALKTSEVLDLV
                     DNETAVRRKTPLPENVTEAHDPNVVKVFEDKAMDRSIYAKGFGEEGPTTQLEIEEFFA
                     PHGPVNAIRLRRANDKTFKGSVFVEFESEEKQKAFLALAPKPQWKGQDLIIKSKREYC
                     DEKVRDIEAGRIKPSGHRPRGRGGFRGRGRGRQNDNRDWRERRAEDQKRGFNGDKKEE
                     SKEPREIQKDARGVPVVQSTADAGQKRARENEANGDHPAKKVDAKE"
     exon            516535..517571
                     /number=1
     exon            517627..517732
                     /number=2
     CDS             complement(join(518070..518083,518117..518392,
                     518518..518536))
                     /codon_start=1
                     /locus_tag="AO090001000219"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000077"
                     /protein_id="BAE56762.1"
                     /transl_table=1
                     /translation="MPVYHIVLFRLKQGVTPAQLANWTKISQAMVGQIPGLRSLKTNP
                     PLPISVPRAKGFDMGLVAVLDKKEDVAVYAAHPAHLEYVFPLPFLFSLLLDLFWGFIS
                     "
     exon            complement(518070..518083)
                     /number=1
     exon            complement(518117..518392)
                     /number=2
     exon            complement(518518..518536)
                     /number=3
     CDS             complement(join(518869..519953,520006..520855,
                     520961..520981))
                     /codon_start=1
                     /locus_tag="AO090001000220"
                     /note="filamentous baseplate protein Ligatin, contains
                     PUA domain"
                     /old_locus_tag="AO070336000076"
                     /protein_id="BAE56763.1"
                     /transl_table=1
                     /translation="MFKKKPTIKNLSPLRSSDRRKIADQIISDYKIEIPSSAPAGEDS
                     TPSNPAPNLSSIRNALLPDNSLSARFTTTAGPQLREVQGTVYVGTHPGGEERILWFKL
                     EHGPGADGRLYPTVYTLWNNPDLVPLLYTPEMVMRKLHGGADLMTPGLANEPPFPKRA
                     VEGAVVAVASLDRHTVPLFVGVCEIDVSALGEVQGTKGHAVRGLHWEGDELWAWSSSS
                     RPGQPAPEYLPGWDEEELEGDEEVEAIEEKVDELALNEAGSPQAAGNEEPVEAAEAPL
                     DEPAPIEEKEPSTKEIDEAFTKAFIYSLYKLKQDNPSAPNHGLSLPVQPSFLISNMIT
                     PYLPIFSAQQAQYYQIKKTSWKNVKKFIKYLDKQQLVKSKDRSGQETIILDVDFNDRL
                     VEQFVPYRLPSKSALENAKKPAAGANKKPEATGGDPAVGQTLTVQTLYRPTQKLTPTI
                     FPALSSTNPQNYYKYSDVSNHLDQYLQSQNPPIIDQQNRRIISLNPFLANTIFTTSSP
                     EDKSTIARGKTTRDGLLKRIVEDNSLMTAHYAILRAGQTLADVKPKPGATPKVTVILE
                     RRTGSKTVTKVSNLEVFGIIPSLLAEELQKKCASSTSVAQANGAPKGVMEVLVQGDQR
                     RALETALVRRGLKTQWIDVVDKTKKKK"
     exon            complement(518869..519953)
                     /number=1
     exon            complement(520006..520855)
                     /number=2
     exon            complement(520961..520981)
                     /number=3
     CDS             complement(521694..522806)
                     /codon_start=1
                     /locus_tag="AO090001000221"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000075"
                     /protein_id="BAE56764.1"
                     /transl_table=1
                     /translation="MSIAKIAGVVLGSAALVAGHGYVSGAVVDGQYYSGYDMSYHYMS
                     NPPQVIGWSTDATDLGFVDGSSYADADIICHKNAKNGAISAEIAAGKQVELQWTAWPE
                     SHKGPVITYLANCNGDCATVDKTQLEFFKIDEKGLISGSDNTWASDNLISSNNSWTVT
                     IPSSIAAGNYVMRHEIIALHSAGNKDGAQNYPQCLNFKVTGGGSDKPEGTLGTALYKD
                     TDPGIEINIYQTLSSYTIPGPALYTGSSSSGSSGSGSSSAAPSPTASASASATAAPVQ
                     TSTATAYQTSTAVASVTVTGSAPAQTHVQATSSSAAASTPTASSGASTGSGSGSSSSD
                     LTSYFNSLSADELLNVIKQTLSWLVTDKIHARDISA"
     exon            complement(521694..522806)
                     /number=1
     CDS             join(527239..527323,527377..527415,527535..528375,
                     528430..530917,530976..531107)
                     /codon_start=1
                     /locus_tag="AO090001000222"
                     /note="HLH transcription factor EBF/Olf-1 and related DNA
                     binding proteins"
                     /old_locus_tag="AO070336000074"
                     /protein_id="BAE56765.1"
                     /transl_table=1
                     /translation="MDGAFPDLESSNKAMDAAFDFESAASSPIPQYISIKTIRLSVSA
                     LPSQGKSPMNQWAGRSPSSLLEESFGGINMNASSPLNSNLNFVPNNFTNFGLSFAPSP
                     PQSNMKSETTQRHVLTVHPTSLKSRVETQIPIRLTLFPLPSGVKKIRLPSHTISKPKF
                     LAPASADRAPDTVELHTSLVCTSAMQDQEKLKKAFARARGEPRYRSSSSSPHPVDDVQ
                     EDDKPLDGGEVKICSGCIQRERKRAFRKKQRKPEEDELFQKDEEKRVIVFNTNEIKDW
                     TEPSKNALPNYGDIPIPAVPAGAMQVELPMRIACYCRHQNEKLGFQVIFTVKDYKDNV
                     IAQAITNSIMITDDHKTHAPPAPPAPGPSPSLPDGTQLPGVGVFPSGPVLDSGKSSAS
                     SQPSSATDLQGLQQRFNTQYQLNSGSFAMPQNSSTSSTSRNLSRQTSPNDFQGPMSKR
                     RKHSNSGRLPSELTMTKLDNAQPSTGVSGTPALNNEPPFSAPRGFASPVERPFVTASA
                     MSGQFPNSPPTPNSGDSNPFFNPNSQQQQSLDSFIQQQLMSAPNSAQPSRPGTPGPST
                     RSNFQEQNLSLPLGPNTSTPMWPPLTNAGNRLPSVIHKLVPAEGSITGGTEVTLLGSG
                     FYPGMEVVFGDTLATTTTFWGDKCLNCLTPPALQPGLVAVVFKHEHPTFGQVQTPQPL
                     MPKQQQFFRYVDDRELQMYRLALGILGQKLGSQADAFQTAQQIMGSDPKSVFGLQKDF
                     QGGSGGGYQRQVPGLESQGKLGDMDSKMLTYLEFVDLDDSPRPPKYNSRCATGQTLLH
                     FAASLGLTRFVAGLLARGANPDVQDNTGNTPMHLAALNGHAHIVNRLRLAGANVNNRS
                     IRGFTPADIASTLPAHQAALVPAQHRRSRSVGSLASSRRRHSSSASLHSLWESSSGSF
                     DEAIDDSSDLDEDDSDDLEFTVSRRSSMHHDVPAPLPNADQASAPEDARPFSPPAALV
                     AWRNQLQTQINQFQQSVANAFPNLPALPPMPALPDYQAHPMMRRITNLVPHRPSTARS
                     AKEGWWDLLTGNSAPNATDLPSYEELYPQQDEQGGEDVTRMKKSSMLQAATDAVLDQH
                     FEAQASAQASTSRTVTAKQENEDLKDIRIGKRVISREQQKHLREQQAQRMKGLGSDRN
                     LYFIWIPLLVLVICAWARSYVPGIWQGFSSGVEFVKTRYAQRALDLGA"
     exon            527239..527323
                     /number=1
     exon            527377..527415
                     /number=2
     exon            527535..528375
                     /number=3
     exon            528430..530917
                     /number=4
     exon            530976..531107
                     /number=5
     CDS             join(531759..531798,531855..534379,534452..535528,
                     535605..536237)
                     /codon_start=1
                     /locus_tag="AO090001000223"
                     /note="putative transmembrane protein"
                     /old_locus_tag="AO070336000073"
                     /protein_id="BAE56766.1"
                     /transl_table=1
                     /translation="MDPSPQAGSSSVTVEYTDPSGLFPLVQPVLANKLPLKNLHWKSP
                     TRPVRSIESLRIGFVPAQNEANERESSGDSAVPHRRHQIPGLRQTPYLKIFLLRCDDN
                     DTYKSTSRKALREWIKSHASMSQSTTSQEKHDACEWLILHVVQDGDGAEKAMPSSKWG
                     RATTTVLEKVKADFNGTSKSAVDRVAQLRLPKQGTTQKPPDLADQLEDLIEKIKNGIL
                     ASFDLRVAQYEEDIKEKDSQRSLPGWNFCTFFILKEGLARGFENVGLFDDALLGYDEL
                     SIGLDTAIDEQLEGSGEPHGSTFLMHTEDWQKKAKAALESPVAPKDEEDEEPTPIPEL
                     DVDDFPIDSNKKAYREMILGSNISIFDFRIYIFSRQLTLLLRAAKAPSLLNKEPDAGQ
                     TRANTIKKPENLMLLSEICERATEFISFSARNLRCDLESGLADVDNAGKAEVINNLVS
                     SWAYAAASQILSQTSTPTLTLPESSLHAITSPADTARDFRPELPRRSSSLVSPPKTRP
                     GRSNTDILSPDALSSVHSGLGQGIAKLALAPAPKTGSEQLASARGELLLMARRVMEEI
                     AGRCGWREKWDDLGLLFDSESAGNSDMTEVSLDDGISQSAEKPQTTHYLSGIELPRLK
                     AALRSRKSFRSHFEELTDDMYRHHITANRTYSAQMALADMALVRFRQSDYGAAASYFH
                     QITPFYGSKRWTILEGVMLEMYARCLKELQRSEEYVRMSLRLLAKFASHKQSCLSTRQ
                     KTLDASSIFAEEELVSQYIEELFEASDALQKEVTAPLTDFFADLHVKPAIIHYNDKDG
                     FQLQLSLRFLLGKRIEVDSMKIRLVGTEGSQSNEHWLELSSKTTIKSSSTKILVDSSM
                     TLQGKYYVDRVEMRAGSILFTSGSGNHSVLPLGFREAVDAEEDSRPYIYCYPPPKGLQ
                     AKIVSPHLVNLEEMRTLELELGSGWNDIKSATLRVRPATAGLRLRIAEAEVVEGDIKI
                     SANSETGYIEFSQLGPNSFVRFRIPYTTEEHHPTLSARAEVGYETTNGRFSYSSLHSI
                     VSGLPISVNVQDTFKDQVLFSRFTVSPAMMIPLRILKCSIPSSDVYQVQSNIGDSVAM
                     NIFPKQPASLLYKIQQREEAVMSPGSRRSLRLSVDFTCVDDECLNAVERTFKESIAAS
                     EYQQYSTLLTSHIVDTFRTQLSTSDMEVIGLVREVETLPYSSVKWEMLLSALKEPLDG
                     LKTWLQEWHRNHPIIGLPEQPSIPRRHIIIPVDIPEIQVVHTAELRLCNLADQPPHAA
                     VGQMIAAELSLRHTRRWCSPENRENAGGPLEFSYEIHANPELWLVGGRRRGNFTADEG
                     ETKTFAVMLLPQKAGHLLLPGLEIKTFVPVSSTPPPKPPAPATGPAGAAPVLQRRQIA
                     CEVDYRNHGETVLVLPDLRSTTVSLSLSGGNHGAAWLIDSERRVLA"
     exon            531759..531798
                     /number=1
     exon            531855..534379
                     /number=2
     exon            534452..535528
                     /number=3
     exon            535605..536237
                     /number=4
     CDS             join(540352..541345,541404..541810)
                     /codon_start=1
                     /locus_tag="AO090001000224"
                     /note="fatty acid desaturase"
                     /old_locus_tag="AO070336000072"
                     /protein_id="BAE56767.1"
                     /transl_table=1
                     /translation="MSSTAIPKRMALNRNPGTDSSVPSVSVSPFDSPRHSPSSTSLSS
                     LASESENKGKMLDTYGNEFKIPDYTIKQIRDAIPAHCYERKALTSLYYVFRDIAMLGS
                     IFYVFHNYVTPETVPSFPARVALWSLYTVVQGLIATGVWVLAHECGHQAFSPSKVLND
                     TVGWICHSALLVPYFSWKISHGKHHKATGNIARDMVFVPKTREEYASRIGKTIHDLNE
                     LMEETPIATVTNLILQQLFGWPMYLLTNVTGHNNHERQPEGRGKGKRNGYFGGVNHFN
                     PSSPLYEAKDAKLIVLSDLGLAITGSVLYYIGSTYGWLNLLVWYGIPYLWVNHWLVAI
                     TYLQHTDPTLPHYQPEVWNFARGAAATIDRDFGFVGRHILHGIIETHVLHHYVSTIPF
                     YHADEASEAIQKVMGSHYRTEAHTGWTGFFKALFTSARVCHWVEPTEGARGESEGVLF
                     YRNTNGIGVPPAKLSK"
     exon            540352..541345
                     /number=1
     exon            541404..541810
                     /number=2
     CDS             complement(join(542600..543899,543962..544378,
                     544486..544537,544597..544626,544727..544760))
                     /codon_start=1
                     /locus_tag="AO090001000225"
                     /note="DNA repair protein RHP57"
                     /old_locus_tag="AO070336000071"
                     /protein_id="BAE56768.1"
                     /transl_table=1
                     /translation="MDIDIQIHHSIQLMETWAPGGGMFAMQENRCSGFKLYNFIDLTS
                     THMDLLSVLPDFHTKPYAHILPPLERSKISTVDLITLDTLEIAKRAHVPPADVRRLCA
                     SITKALHHDIGFEHIEESASAEPSSSINDDPPITLGPTTKLDLSQWSAISTLDTALDE
                     LLGGGIPTGYVTEVTGESGSGKTQFLLSLLLAVQLPSPKGLGKNAVYISTEAPLSTPR
                     LSQLINSNPYLSTLPRDRAPTLENILSINAMDLESQDHILNYQLPVAIQRYNVGLVVI
                     DSITSNYRAEHTSHNILGLSTRSGELTKLGQMLRNLAVQEDIAIVVANQVSDRFDAMD
                     NPSVFPRIGGGAGNGSPSTQPQQIPSARESGTASPLPRVRATESGNVELSQYNAMLPS
                     SPSHFPSSPYTTEEDPQRQHFDGSYLVGNPVRSEILSLLHQQRFFTGWGDSPQSFLPS
                     SYPGFQRPAEKTPALGLVWSTQIACRIALKKERQTAMDPLLPGSTPIPSTAKLLPEPE
                     VPGSLGEREKPEPDPPTETVTEGKDAEAKASSETVPVPAPISENKPSNSQLPPPSSQT
                     PERLVRRTMKLVFAPWTAGSVNEQNQIQDEVSFTIWKGGLKSCE"
     exon            complement(542600..543899)
                     /number=1
     exon            complement(543962..544378)
                     /number=2
     exon            complement(544486..544537)
                     /number=3
     exon            complement(544597..544626)
                     /number=4
     exon            complement(544727..544760)
                     /number=5
     CDS             complement(join(544808..544876,545062..545309,
                     545370..545943))
                     /codon_start=1
                     /locus_tag="AO090001000226"
                     /note="hydrolases of the alpha/beta superfamily"
                     /old_locus_tag="AO070336000070"
                     /protein_id="BAE56769.1"
                     /transl_table=1
                     /translation="MATAGIERRVEIKIASSSEDFMCGWLYSSQKFTVSNLGPAIVLA
                     HGLGGTKELKLDVYADSFNQMGYTCVVFDYRCTGGSEGLPRGLIDWHQQQEDWKSAIK
                     YTRQLENVDPNQVGLFGTSFSGGHVIQLAATDRKLNAAISQCPFTSGWQSTLCTGSAA
                     TPRLAGIGLLDILFGSERKPITVPLTGRPGEAALMNAPDMLSTFPLLIPKGHPFQERV
                     PARLTLKLPLLRSGSYASRVECPILFGICGKDSVAPADTTLAYAKTAPKGVIKWYDLW
                     DCWGSIMLGNLEFLMTVLVS"
     exon            complement(544808..544876)
                     /number=1
     exon            complement(545062..545309)
                     /number=2
     exon            complement(545370..545943)
                     /number=3
     CDS             join(549181..549277,549754..550013,550084..550113)
                     /codon_start=1
                     /locus_tag="AO090001000228"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000068"
                     /protein_id="BAE56770.1"
                     /transl_table=1
                     /translation="MTTAGNNAHHFPHPHKRHSLNLIVSYPLTRCRCHWDSFELEARR
                     HFRSVGFSNKVLDYAPAKEDDHEFHIKKEQLLCGDEHSVVARFGQNVGHVMTSVLRGG
                     VGTKLRFGDYKCVKPPEQKHHGSMIL"
     exon            549181..549277
                     /number=1
     exon            549754..550013
                     /number=2
     exon            550084..550113
                     /number=3
     CDS             complement(join(553597..553803,553901..554188))
                     /codon_start=1
                     /locus_tag="AO090001000229"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000067"
                     /protein_id="BAE56771.1"
                     /transl_table=1
                     /translation="MWLGSSFTNLKPVQAAKFLRQFTQEGVLQTGDFMLIGIDRCREV
                     EKVTAAYSDTSERWQQYIQNGLYTAAHTVGDASLAEDWTYVARWDAEEGRHLRFVRSD
                     RHRTVLPDIEISAGEHVLLAQSYKYTRQDALAVFDLSGLTVRYEWVNQPDDCSLFLLE
                     KTGR"
     exon            complement(553597..553803)
                     /number=1
     exon            complement(553901..554188)
                     /number=2
     CDS             555714..557099
                     /codon_start=1
                     /locus_tag="AO090001000230"
                     /note="FAD-dependent oxidoreductase"
                     /old_locus_tag="AO070336000066"
                     /protein_id="BAE56772.1"
                     /transl_table=1
                     /translation="MSTQLNHSTPIIIVGAGVFGLSSAWWLARAGYHNIKVLDRWPVP
                     SPSSAGYDRNKIIRTEYPDDIYSILSQEAIQLWRDPLWKDVFHPTGWIYGTDGSQDQD
                     REKTFLTAVSNTHALGDPSKIVELPNWDAAFRLYPGLAFAHDRRQAQVGIYTDGLSTP
                     KGKKPTFRGIYNGNAGWVESTNAMLILKRECERLGVEFVAGESGAVVEFVRDPANPAQ
                     VVGVRTANGTIWRAEKVIVAVGAYSETLLDFQGQLHASGYCVSHIRMTEEQYQRYKDL
                     PVLNIARRGYCFPPNEDRIFKICNLDITVVNRERWPEPSCDWGVRSLPRDQAYHPTDS
                     QPRVGREKTLEFARYILPEFGDAKIESSKVCWDVETHDDNWIVGYHDSAPDSLFIATG
                     GSGYTFKNLTNIGKYVVQALEGQLDPEWKDLWRWRPDRVGVFPDRETRNARFKFDLRD
                     CDGWKHLAPRL"
     exon            555714..557099
                     /number=1
     CDS             complement(557226..559313)
                     /codon_start=1
                     /locus_tag="AO090001000231"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000065"
                     /protein_id="BAE56773.1"
                     /transl_table=1
                     /translation="MAPWTEQCEPQLGPDSIIDSDPQDYRHAEIILNAGYSQVRLAVQ
                     YRAFVTCHWYRTIDIILEGNPHTFYPGLCLAPTEEQKAFVGEKGPDGKVTQYDQISAA
                     NPAIALVRLAASRSNTQSGLKFILPVNSGYLRRADILEERFRGCDQVECVNGFAVSTE
                     QRLNACNEVGRLSDILLSACGGIIVREPQTGTTIDTVLSQVESEIRRRLSFQWLSSEP
                     VRPKRLAVVQARKEHHTIERFYMAARSLNISLIAVDSPGHWLEADDGPSASLREEFIP
                     FDMTVDETFSIRLYHALKDHNLDGIITSNDRHLVGVAEAAEMLGLPTMPSKGLKVATD
                     KYATRAAEEADTLVPASFQVQSLEELDDLFTRPNAPALTFPLIVKPCLGWSSDCVTRV
                     TTIAELRDAVHRASTRHLGSMSTSTGVVIEPYIDGPEVDTNIILLDGECLFFEISDDF
                     PCTGDAPDANAQTSNFQETQIMYPTALPEAEQWTLRESIQNSLIRLGLKTGVFHVEAR
                     VRNSVASYTTDESGLFDLRVGSDKSDLQAEQPSCWLIEINSRPPGGFSDWATAYIHGV
                     CYHAQAILAAVGDQERFKALATPFQQQGAATACPEPQFHCMLVYLSPERSGILANSPC
                     EDTRAQAPDLMKHVLRSQCWYRRGEKVSGPQDPSLGWLSTYLVFARGEDFGREEVLHL
                     GDRVRKEFRMEIE"
     exon            complement(557226..559313)
                     /number=1
     CDS             join(560282..560703,560774..561034,561109..561248,
                     561304..561490,561540..562182)
                     /codon_start=1
                     /locus_tag="AO090001000232"
                     /note="H+/oligopeptide symporter"
                     /old_locus_tag="AO070336000064"
                     /protein_id="BAE56774.1"
                     /transl_table=1
                     /translation="MASQAKDSQVESSSPSLTVTEKQAGDIVPINHTGDETSCRPTNQ
                     ELKELVHVADNVPYPVWLVILVGSAERFVFYGASTCLQNYLQNSPNDLVPGALGMGQS
                     NATAVNYAFMVLVNFAPVPLAVVADGWLGRYKLILLSTVIYLVGSLVLFTTALPSALH
                     QAGASAAGLGVSLVLIALGIGGVKASIYPFIADQYPHHEPFIRELPSGERVVVDRSLT
                     IQYMYNWYFWFINVASLSGIATTFMEKYSSFWSAFLLCFCFLWVGLVLMLVFKNKYYK
                     APPAGSVVPKVLRVIWLGIRGGMSLSAAQPAVQQEKYGRQVPWDDEFLQGVRNALIAC
                     QICLAFPVVWLCWGQTYNNLISQAGQMETYGIPNDVMPNFNPIICIIAGPLIQQCLFP
                     FLNRRKIPFRPIARISVGFFLMGASLAWATGLQAFIYRAGPCPDHPLACPDSKNGTIP
                     QHINVFLQVPCYVLMAIGEIFCVTTGSEFCYSKAPRSMKSIVQALFVGTASISYALGI
                     AISPAAKDPYMTIFYGCLTGVQLAITAGFWLMFRKLDKNIIV"
     exon            560282..560703
                     /number=1
     exon            560774..561034
                     /number=2
     exon            561109..561248
                     /number=3
     exon            561304..561490
                     /number=4
     exon            561540..562182
                     /number=5
     CDS             562562..563941
                     /codon_start=1
                     /locus_tag="AO090001000233"
                     /note="lysine-ketoglutarate reductase/saccharopine
                     dehydrogenase"
                     /old_locus_tag="AO070336000063"
                     /protein_id="BAE56775.1"
                     /transl_table=1
                     /translation="MSSAIGKKALLLGAGFVCEPAVQALSEAGVQVTVACRTLSVALA
                     LAANYKSTTAIALDVANEPENLRAAISQTDIVISLIPYVHHALVISAAIQYSKPVVTT
                     SYISPALWALDDQAKAAGITVLNEIGLDPGIDHLYAVKTIDEVHKAGGQVKAFTSYCG
                     ALPAPEHSDNPLGYKFSWSPRGGLLALLNSAQWYRDNDIATVDGKDLMAAASPQRIFP
                     GFNLVGYPNRDSVGFRDFYNIPEAHTVFRGTLRYAGFPEIIRALVSIGYFSQERMAAL
                     ERSGTTWVQLTASLLGLSESSSPKDVQNAVRRKIEAFVTDKDDVDRALSGLRWIGLFD
                     PTPVVGHGTPLDTLCAVLETRMAYQPGERDMIVLQHIFDIEHADGSVEKRSSTLVEYG
                     EPLGPGYRSAMAKLVGLPCAVGVLAVLEGRIPATGMVAPWSSAEIASLLRDELKDKFG
                     IELKERVIT"
     exon            562562..563941
                     /number=1
     CDS             complement(564710..568189)
                     /codon_start=1
                     /locus_tag="AO090001000234"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000062"
                     /protein_id="BAE56776.1"
                     /transl_table=1
                     /translation="MATLNSLKEALGQKAVTTPSSSRQQLSDTQYSAGFDIFAGGPEY
                     QDFIIPQLPQLLAPLFNSRLHVSVLEIGPGPKSVLGYLPHSLRKKVRRYAAFEPNELF
                     ATKVEKWLCTSLEAEFPLPCLASPPGIHRLPFVLNSNINSDASTSTNISDERFDLVLF
                     CHSMYGMKPKDKFIEQALEMLVEAPQGGMVVVFHRDGTLSLNGLVCHRTACFPTGAIR
                     VLDEDEVLDNFASFVAGFVMEDTEADKATRLEWRKVCRALGRREEAYPDHLLFSSPSV
                     MAAFTQHATTLPELTAQVPLVKDKTVKNREAFHHGSASIVRPTEVQHVQQCVQWARKH
                     EVGLTVVGGGHSGQCLWPNVVSVDMSAFDHIHILTAGKDGGESSSASVVIAGAGCKTG
                     DIVRKTMAAGLTVPLGARPSVGAGLWLQGGIGHLARLYGLACDAIIGAVVVSVDSGEA
                     LCIGHVPSQHRPAGAVRPKNEYDLLWAIKGAGSNFGIVVSITFKAYVAPVHLIRSWVI
                     PLSDSLEARRRLSDSDNLIASKLPRNCSADAYLYWEFGQLHLGITMFEASTTRLISDT
                     STPTPPPVDVDTILGLDGKIDVVDGIGLFDAEMYMSQMHGGHGGCKTSAFKRCVFLKN
                     IGAVNVADILTTAVGTRPTPLCYLHLLHGGGAVSQVASGATAFGCRDWDYACVITGVW
                     PRDQDGTEIAHAVERWVYNVARDLLPLSSGVYGADLGPDPRDAILAAKAFGPNRPRLA
                     RLKHCSDPHNVLAYACPLPRVSMKQRLIILVTGDSCAGKDYCADIWVSALLAYNHKGL
                     TARAVSISDATKREYATATGADLNRLLSDRAYKEQHRPALTAFFQDQVRHRPRLPEEH
                     FLNVVDSAADVDVLLITGMRDEAPVATFSHLVPDARLLEVRVQAGEEMRRARGGCHGS
                     DDDSNDNKNNDNGRLNLTALDHHPDLIFHNDTTGDKAAKAFADYYLLPFCHEDLQRLT
                     DMVRQVPDFPRLGIEFRHVLDISQQPGGLTLCTSLLQSHFTGDWAKVDAVACCEAGGF
                     VYASALASQVGVPLALIREAGKLPPPTISVAKSPSHVSLSTSNGMNEKRIEMARGLIP
                     RGGSVVVVDDVLATGNTLCAVLQLLDEAGISSKDVTIMVVAEFPLHRGREFLRQRGFG
                     GVKIQSLLVFDGA"
     exon            complement(564710..568189)
                     /number=1
     CDS             join(568972..569123,569212..569464,569524..569832)
                     /codon_start=1
                     /locus_tag="AO090001000235"
                     /note="GTP cyclohydrolase I"
                     /old_locus_tag="AO070336000061"
                     /protein_id="BAE56777.1"
                     /transl_table=1
                     /translation="MTSSKSDVLVSPVQDDRKPVSSERPVIEETVASMNGTNHVNTDD
                     HDSKSGTEARMAASIRSILEDIGEDPNRDGLLKTPERYAKALLFFTKGYEESAYDIGK
                     DAIFNINHNEIVLVRDIEVFSMCEHHLIPFVGKVHIAYIPNGRVLGLSKLARIAEIYA
                     RRLQVQERLTKQISQAIEELLQPQGVAVVMESAHMCMVMRGVQKSSAMTTTSCRTGVF
                     KTDKEAEEELHFLLKLNQD"
     exon            568972..569123
                     /number=1
     exon            569212..569464
                     /number=2
     exon            569524..569832
                     /number=3
     CDS             join(578183..578330,578395..579971)
                     /codon_start=1
                     /locus_tag="AO090001000237"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000059"
                     /protein_id="BAE56778.1"
                     /transl_table=1
                     /translation="MATRAPLAPPPNETEASVSRITREGKKLTYKLNVMQQPERARAC
                     GAGAKSSADRRPVDPPPVVELRVYESDPNDDLNKTDITFAYNANFFLYATLETARPMA
                     QGRFAPNPTCPVLTGVPVAGVAYLDRPSQAGYFIFPDLSVRHEGVYRLNFHLYEETKE
                     SKDANENAPIQSLSNPMPSKPMAPKSFLEFRLEVVSVPFTVFSAKKFPGLATSTSLSR
                     VIAEQGCRVRIRRDVRMRRRGEKRTDDYDYDEERVYRSSDRISTPDTHGYAGTPVERP
                     RSTSTSTVDPSFPYGVDAQRRSSGATEYGFQGAQPYQRPLPPAPGPAPAAVSTPAPPA
                     PPAPPSHNPGYQSHLSFGSTQTQYPAPQLPPTPQTASTLAAPYSPHPSYSHARNPSTS
                     AEYETPGYSYPPSRMSTERSSYPKNGLPPLRLEPPKPLNMPSGEPRSSDPNAYHSVAQ
                     SAAPRSQTPSSSLVPSLPPLKALSGDYPNNLSQSSSSTSQSPSHDLGAGKKFFWDTGA
                     SLSKRSYEDSFGHDDRPLYNGMRPDTESYPRRLSDASRNFYNETRDEMAYKRANGRMA
                     TKISPALQ"
     exon            578183..578330
                     /number=1
     exon            578395..579971
                     /number=2
     CDS             582238..584343
                     /codon_start=1
                     /locus_tag="AO090001000238"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000058"
                     /protein_id="BAE56779.1"
                     /transl_table=1
                     /translation="MSTDDTQADRQLHQTLESACRRRDPITTHGSRKHSRTDDYNDYD
                     DDEFSSDYSSDVSGRFDDADEEYAISAHPASSPRSTHSAKRRRSNDWPVEELLPPPPL
                     KETGSTGSRWRSPFHSRNNSRTDHGSPRNASGRHGRQAGPSGRGRRSRFIEGMMNDSV
                     SEKPPSIFLRDGKSANGQEGPTHRSSGIFRFGKAIASAFNPFGGWGSVAVWKGSPSAE
                     ANKEPVDDDIARVEKAYAELKKAGYRGAVKGEYMAGAGSQSSNNLADQTWKSIQEKMD
                     YKAPTGRHSRQNSGEVHESGSSLRNSFQEIRRAKSSLGITSSFIPLGRRSEDTEQPQL
                     RKQKSKREKLLRRVSTLEEKLEKARRELQELMGDDAPPVPERSQCQESTHPRKFVPGA
                     LPTLPSERLLNSHDPVSPISPTSDSAPMSLLENIQRSMQSQDPTQMTTIEPESTIKTP
                     AKSPSLRTTQSLTVDSPSLKRKSPDPESASAANTPKSQKEGATNHTEEGNQSDSSRRS
                     KLPKTFRGDSPGSVERKQPPRHREENSTRRSPSEERGRRRRSSQPLRSHSKRSPSARR
                     RASNSRNRGTPSLRLKKGRADLRSASTQAMDIDNHDKENQHASQSRQDQQQSDSVDLN
                     QTDPSPNSSPAKRKDQRFTYNYIPPVPPLPKNIAATAAKVDRRLAKEIGRRERNRKSK
                     AQGKTNGTEDGFSWPDDIF"
     exon            582238..584343
                     /number=1
     CDS             complement(584616..585335)
                     /codon_start=1
                     /locus_tag="AO090001000239"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000057"
                     /protein_id="BAE56780.1"
                     /transl_table=1
                     /translation="MEYVHTTPTPIPKQTPYIYYTILTKKQTTSTDIEPGPNSTTKCG
                     IHHWATHGIATRALLLDYRHYAKTHNISYDPYTRHPITMSSLHACAKTQGLDLRPASQ
                     GGDVRVGDILLIRSGFVERYNELSPAERQAGATRAHEDLTWAGVNQEEEILDWLHDCY
                     FAGVAGDSPTFEAWPPEKEGGFIHQNILALWGMPLGEMWDLEGVARRCRELGRWTFFL
                     TSAPANVVGGVGSHANATAIL"
     exon            complement(584616..585335)
                     /number=1
     CDS             complement(join(587158..588479,588674..588993,
                     589067..589102,589172..589194))
                     /codon_start=1
                     /locus_tag="AO090001000240"
                     /note="uncharacterized mRNA-associated protein RAP55"
                     /old_locus_tag="AO070336000056"
                     /protein_id="BAE56781.1"
                     /transl_table=1
                     /translation="MDMNHLIGQRFNLISKSDIRYVGTLHEINPEASTIALENVVSFG
                     TEGRRGKPEDELPPAPHIYEYIVFRGSDVKDISVAEDKKEDAPQEPQQVPDDPAILGV
                     SRTTISEILPIVVARVSSPPTFAVGPAPQGIPPQSQTPQQSQMPRPPPPGYPQPQFQG
                     GFYPPYGQRFGGPGFPPGPGFPNMPYGAPPGWFPPPGQGFPPPGQFPPQMPMGPGGQH
                     QTPPPPRPMPGAGPMNMPKNTSELPSDKPSSKPGSRNGTPAPSNAAQNAPTPPVESKP
                     PVSEALQAATGPTQVTAGTAKAPPTGPRSGRVQPAIPIAAPGKPPVPQVPGPAGVPQG
                     QAQAAITEATRAATAAVAAAMAKLPQPGAQKKPGDVSVEGVTKQMAEMKPYEHRAPRG
                     GHHPRGGRGGGHRGQHQGKKIEVPETDYDFETANAKFNKQDLVKEAIATGSPVHEVEP
                     HIPNGEPETPDSYAAAYNKSSSFFDNISSEAKDREEGSAARAGGREWRGEEEKRNIET
                     FGQGSVDGYRGGYRGRGRGRGYGRGRGGGYGRGYGGRGRGGMRGGRNMSQSTGVPAQN
                     "
     exon            complement(587158..588479)
                     /number=1
     exon            complement(588674..588993)
                     /number=2
     exon            complement(589067..589102)
                     /number=3
     exon            complement(589172..589194)
                     /number=4
     CDS             join(589574..589614,589696..589861,589945..590610,
                     590660..590911)
                     /codon_start=1
                     /locus_tag="AO090001000241"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000055"
                     /protein_id="BAE56782.1"
                     /transl_table=1
                     /translation="MSRSSHRDDFFQTTAALDEQKRKDAKSKNTNGDPIRLQSKILAV
                     EADPLNPGAVFVAQSGGTVRKIILETGETAALYKGPTAPITSICFSPDGRLLFAGCWD
                     KYVWCWDVASKEVKQKYDGHTDFVRAVVTTRLQGKDVLVSGGADAQILVFDIASGERL
                     SVMKGHAKGIQGLVVDPVSLDSDSQELVVFSSGSDREIRRFDIASGSKDLTGTDAILV
                     HDTNVYKLFFDRDADLWTASADKSAKCLVREEGWKPNLTLTHPDFVRDVVVYEQGGWV
                     VTACRDEEVRVWNRSTGQLYHTFSGHFEEVTGLVLLGSTLVSVSIDATIRRWSLRPED
                     LQVAVERAKNTSIDEEPEPNPGSMLTEEEERELAELLEDD"
     exon            589574..589614
                     /number=1
     exon            589696..589861
                     /number=2
     exon            589945..590610
                     /number=3
     exon            590660..590911
                     /number=4
     CDS             complement(join(591163..592084,592465..592541))
                     /codon_start=1
                     /locus_tag="AO090001000242"
                     /note="iron/ascorbate family oxidoreductases"
                     /old_locus_tag="AO070336000054"
                     /protein_id="BAE56783.1"
                     /transl_table=1
                     /translation="MTSSHICRAPPAESKPQMSDEGLCKLPGFFYVTNFGLSPEEIDR
                     QFAIGQELFELPESEKLKHRADLEAGNYNGYRPLGAIEILPGLRDNIELYNVFKFIPR
                     YARSHPEVILRHYEEIERFHRFIYDHIVTKLFRLIAILLELPEDYLVNGHPYDGPSDC
                     HLRYMIYRARSAEENARHQNLWSRGHTDFGSLTLLFRQPVAALQVKTPEGAWKYVKPY
                     PNSITVNIADALQFWTNGYLKSSVHRVIAPPPDQAHIDRLGVLYFVRPGDGLDLKTVD
                     SPLLRRLGLKKDEGDEAQVSAGEWVRARVRRNWDKPPKANDENIELGGVKTTIFHE"
     exon            complement(591163..592084)
                     /number=1
     exon            complement(592465..592541)
                     /number=2
     CDS             join(594989..595247,595310..596484)
                     /codon_start=1
                     /locus_tag="AO090001000243"
                     /note="FAD/FMN-containing dehydrogenases"
                     /old_locus_tag="AO070336000053"
                     /protein_id="BAE56784.1"
                     /transl_table=1
                     /translation="MGNAPSSPAHQCLLSAVGNDSSLVAFPSQPFYESAAANPYNLNW
                     PVYPAVVASPKTSEQVADIVKCAVEYDYKVQAKSGGRSYANFGLGGVDGEVAIDMKNF
                     RQFSLDDSTYIATVGPGLRLSDMTQKLGAEGRAMPYGEVPEIGVGGHFTIGGLGTYSR
                     LWGSALDNIVEAEVVLANSSIVRASKDSYPDVFFAIRGAAASFGIVTEFKVKTYPSLS
                     ETVQIKYEFSIGSSAERANLYMAWQELCAQKNLTRKFDTRMVVTQGTMIILAQFHGTK
                     EEYEQLGFDKALPASNAGNVVVLTDPLASVGYDIEKLATGIVGGTPINFYEKSLSFET
                     DKLPSNSTAQELFHYLDTADKGTATWFVVISIAGGATNDVPVDATAYAQRNVMFYVES
                     FGINLLGRVSQTTVDFLDGINNLVNETVPGSDRNVYPGFVDPFLPNAQEAYWGPNLPK
                     LQEIKAAIDPKDVFHNPQSVRPAGKGT"
     exon            594989..595247
                     /number=1
     exon            595310..596484
                     /number=2
     CDS             complement(join(596889..597041,597096..597322,
                     597564..597755,597803..597850,597929..598063,
                     598317..598438,598485..598594))
                     /codon_start=1
                     /locus_tag="AO090001000244"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000052"
                     /protein_id="BAE56785.1"
                     /transl_table=1
                     /translation="MFILSSSLCVSSALPHLGPGGVIWVLPLPVPGIVCLGADCSSQE
                     TESTFLRRDFPLSLGARGLGTSAVAAAEPNDKALTIQLLALIIFLLPVYILGVRPPCI
                     CLELYSSIDCPGNFTMPKNPLIRDGSCDPLAFLELSYPLSQTIPLRLEDVLRTFLSSL
                     SQLPLNLEGQKSPANLVDPSVSNIMVSDLITHDVYPFSPFPNIFRQLRVLPGRPSGRP
                     LPSHALHSGLRCRGKFSIYYVLYPLYSLLWKFAYALQQQQQQQQQQQQQQPAQKSKKR
                     KKNAAAAAAAATAATTTTAAAPAAAPAAAPAAPAAAPAPDAAAAEEPLLYIV"
     exon            complement(596889..597041)
                     /number=1
     exon            complement(597096..597322)
                     /number=2
     exon            complement(597564..597755)
                     /number=3
     exon            complement(597803..597850)
                     /number=4
     exon            complement(597929..598063)
                     /number=5
     exon            complement(598317..598438)
                     /number=6
     exon            complement(598485..598594)
                     /number=7
     tRNA            complement(602403..602517)
                     /locus_tag="AO090001t00003"
                     /note="tRNAscan-SE"
                     /product="tRNA-Thr"
     CDS             complement(join(604595..605074,605124..605302,
                     605609..605792))
                     /codon_start=1
                     /locus_tag="AO090001000246"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000050"
                     /protein_id="BAE56786.1"
                     /transl_table=1
                     /translation="MALANHGASIPDLIAMGDEQENVTDWQRRCGINKDSQIRLVKLT
                     HMRYQHPDLDQITTFLQGGGFLVTLTDPEEFPVNLMFGQKPAEKGAIPEKLTINYEEE
                     KPRIRKFQGFTPGPAAVHKLGHFGLCTGKFEELVHFYTTTFNIVPTDFLYVEKDGRRK
                     NVALFAHIDRGDDYVDHHSFFMSTNASSHVHHCSFEVHDFDTQKLGHQWLTDKKYKSV
                     WGVGRHILGSQIFDYWWDTTGNMIENYTDGDLVNNQTPIGYGPAGDESLAVWGPEVPA
                     WFLK"
     exon            complement(604595..605074)
                     /number=1
     exon            complement(605124..605302)
                     /number=2
     exon            complement(605609..605792)
                     /number=3
     CDS             complement(join(607491..607583,607675..607853,
                     607963..608353))
                     /codon_start=1
                     /locus_tag="AO090001000248"
                     /note="threonine dehydrogenase and related Zn-dependent
                     dehydrogenases"
                     /old_locus_tag="AO070336000048"
                     /protein_id="BAE56787.1"
                     /transl_table=1
                     /translation="MAETHSKNRTMRSVVFDGQPFEVYVRDIPKAKVVRRTDAVVQVT
                     SAAICGSDLHNYHGVFGSDQVPYSIGHEAMGIVKEVGADVASVKIGDRVIIPDFPDDV
                     GLDLEPTINPAIALYGEGHQFGDLGGCQAEFVRVPLADKSLIVLGKEFDGIKDEDLVL
                     LSDIFPTAWAGVTWSGFEAGDTIAIFGAGPLLLEPFRSTSRRANRRRRFWPGNQVASS
                     AP"
     exon            complement(607491..607583)
                     /number=1
     exon            complement(607675..607853)
                     /number=2
     exon            complement(607963..608353)
                     /number=3
     CDS             join(611681..611938,611947..612080,612330..612834)
                     /codon_start=1
                     /locus_tag="AO090001000249"
                     /note="acyl-CoA synthetase"
                     /old_locus_tag="AO070336000047"
                     /protein_id="BAE56788.1"
                     /transl_table=1
                     /translation="MSLSLTGFKPGRLLQLQGFLCKNQKIREQTAKKKEERRKKREER
                     REKKERKKERKEGKKEGRHLHRYPALIYNHIRRYLQNIYPCLCKDFSLQHLMETLILA
                     LFHSVYNCIICACTIPIISSIDPISGRSNPVHSRLGIGIKQGYGLSEASPVTHAQPWP
                     EWHESIGSVGKLLPKMEAKYMTTPDDGSDPREVQTGEVGELYLRGPNIFLGYHKNPSA
                     TADSISKDGWFRTGDVGYQDFKGNFFITDRVKELIEYKGFQVAPAELRGILVGHAAVN
                     DVAVIQLTSKMDVRKVVILTGP"
     exon            611681..611938
                     /number=1
     exon            611947..612080
                     /number=2
     exon            612330..612834
                     /number=3
     CDS             complement(join(614780..614797,614854..615261))
                     /codon_start=1
                     /locus_tag="AO090001000250"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000046"
                     /protein_id="BAE56789.1"
                     /transl_table=1
                     /translation="MAPDQVERVLQGRWAIINVWRPLKPVPCDPLAVADARSVPDEDL
                     FEVHVGKPQNVQATFYNPKTSRQGSGTLLGKYGPGHKWYYMSDMTQYDILLLKIFDSK
                     DDGKTARRTLHAAFIDPHTSEVQEARESLEIRCLKIHRR"
     exon            complement(614780..614797)
                     /number=1
     exon            complement(614854..615261)
                     /number=2
     CDS             complement(join(615329..615437,615505..615776))
                     /codon_start=1
                     /locus_tag="AO090001000251"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000045"
                     /protein_id="BAE56790.1"
                     /transl_table=1
                     /translation="MRPQTIQTFLDYHHSSAFASGEITAGTLKFCRIAPDRQPVQIED
                     VRGRKEEFRLDEHGFQFLRHESPSFASFRDEDLSTVQQESVEILQRLRKQRANILDLD
                     PQSDGQRIIQIDRFLRTRFFRSSV"
     exon            complement(615329..615437)
                     /number=1
     exon            complement(615505..615776)
                     /number=2
     CDS             complement(join(616105..616434,616492..616860,
                     616961..617198,617250..617398))
                     /codon_start=1
                     /locus_tag="AO090001000252"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000044"
                     /protein_id="BAE56791.1"
                     /transl_table=1
                     /translation="MILDVARTKRFFRRLRPRAKDQDNTPKCQPRKAFPAGLKFLCGP
                     NDGTIDIVFVHGLTGDRDATWTAPGAEEPWPKTLLPSKLPTARIFTFGYDAYVADWRG
                     VVSRSLIANHAYNLLASLSSYRENDATSVRMYALAWFWGGNCTNCASQALFTSKQRPE
                     PHLHNIIQSTRGIIFLGTPHHGASLAKWADFVCRSISLVKQTNPEIVKVLKRDSEVLA
                     RIQDGFHTMVRSVGPPPIEVTCFYEEVPVLGVGLVVPQDSAVLPGYVPIGIHSNHMDM
                     TKFASVDDPGFVAICGELRRWSKGTGGATKSCPGDSSRTAQAGLARQYGANSQQYNQF
                     GGGSQNIVGSHQYQAQGDMNFGMVPSK"
     exon            complement(616105..616434)
                     /number=1
     exon            complement(616492..616860)
                     /number=2
     exon            complement(616961..617198)
                     /number=3
     exon            complement(617250..617398)
                     /number=4
     CDS             618690..619367
                     /codon_start=1
                     /locus_tag="AO090001000253"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000043"
                     /protein_id="BAE56792.1"
                     /transl_table=1
                     /translation="MADSDVSHQITRLIEVTEGIVEAYNPIKDLRGLPEAFQEVNNLL
                     PFIRQILRDANRPRRRILSVNDAEALKTALCSCSEKANRLLEIFKKIVKKTNGQYSSS
                     VYRAIVIQHGKHRVETLADGILQDLGALVAHHIFSADMQRQVELLENARETLAKVSPS
                     LTDSDPAEQPRAVAQYGDYSRQYNLLGEGGQRIADGHYFEAQGNQNFGMFPPKSFMES
                     SEIAAGQ"
     exon            618690..619367
                     /number=1
     CDS             join(621183..621280,621487..621582,621619..621771,
                     622137..622284,622426..622491)
                     /codon_start=1
                     /locus_tag="AO090001000254"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000042"
                     /protein_id="BAE56793.1"
                     /transl_table=1
                     /translation="MPTHPTWKRKSHIRRIHQSPFRKKQPNFAEYVLTYPPIEASWTI
                     ATTTYPFLSAEVQRVIAIYTSTDDLKGFLARLCGGKPQPNPLLQHKLRFIGEEIRKFY
                     GTFASDMIWKSIIDDVVSTLHASATQVFHGYVVYHCSSSRYRLSELNLPNIRADRVGN
                     GVLLNVDGWTSRPAGGIDSFEYSSSE"
     exon            621183..621280
                     /number=1
     exon            621487..621582
                     /number=2
     exon            621619..621771
                     /number=3
     exon            622137..622284
                     /number=4
     exon            622426..622491
                     /number=5
     CDS             623341..624168
                     /codon_start=1
                     /locus_tag="AO090001000255"
                     /note="NADPH:quinone reductase and related Zn-dependent
                     oxidoreductases"
                     /old_locus_tag="AO070336000041"
                     /protein_id="BAE56794.1"
                     /transl_table=1
                     /translation="MPGFEGVGVIESVGAGVSELHVGQRVLPLGSAGAWQDMKVTEER
                     WCFPVPPDLTDQQAAMAYINPMSAWMMVRQYAPNPPAVVAVNAATSAIGQMIIRMLNR
                     AGIQPIALIRRPDGKRQLSDQLDLSAVICTSETGLRRKLSELSGGRGLAVAWDAVGGT
                     EGDDLVRSLAPGGTLVHYGLLSGIPLSYRLREECPDARIELYRLRDWIHTAKRHELQR
                     ALDDIFELVRDGTAASKVAAVFPLSDIRQALECEATPGRQGKVLLSMSNAMEATHYD"
     exon            623341..624168
                     /number=1
     CDS             join(626435..626800,626851..627372)
                     /codon_start=1
                     /locus_tag="AO090001000256"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000040"
                     /protein_id="BAE56795.1"
                     /transl_table=1
                     /translation="MSITERLSLTAKYMSELKSWRREMAGFLDRPSLNAAPLVLIYQR
                     QRNVLNLAYWHTVILTNRPLLLTNFARLTNITRRLLREQNERREQIDESISECLHAAM
                     EIVTVVDAIIQAKQLFRCFWFTPYFAFSASVILYVYTIQHSKEPGDVYGPFFAAAERC
                     QQQIMNIAEEGSLTSRYCLVLEELHAEAVRQITPVQPSVDQQTQTHYAMEMRSGDIEN
                     LTSNVGDFATEFAMAAPNLVGLGPLDDFHVSPSASLEDLTGWDQFESMVSAHEIEKVF
                     WYQSANQDYRQVFSGFNNL"
     exon            626435..626800
                     /number=1
     exon            626851..627372
                     /number=2
     CDS             join(628006..628456,628503..628813)
                     /codon_start=1
                     /locus_tag="AO090001000257"
                     /note="dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /old_locus_tag="AO070336000039"
                     /protein_id="BAE56796.1"
                     /transl_table=1
                     /translation="MSLQGKVYAVTGGASGIGFATAKLISERGGTVCIADVNADCLGN
                     VESYFSAKSPSVEFMITQVDVSNKQQVENWIADIKTKYHRLDGAANIAGVIGKDHGIK
                     TVAELEDDEWNKIISVNLTGTMYCLRAELNHIVDGGSIVNMASIHATTGVANHGAYAA
                     SKHGVLGLTRVAAKENGHREVRVNAVAPGPIYTPMMQGFYDRIERPSDAPFDDPIAFK
                     RQGTPEEVAKVVVFLLGPESSFVSGSCYPVDGAWV"
     exon            628006..628456
                     /number=1
     exon            628503..628813
                     /number=2
     CDS             complement(join(629120..629894,629919..630054,
                     630117..630226,630273..630472))
                     /codon_start=1
                     /locus_tag="AO090001000258"
                     /note="L-alanine-DL-glutamate epimerase and related
                     enzymes of enolase superfamily"
                     /old_locus_tag="AO070336000038"
                     /protein_id="BAE56797.1"
                     /transl_table=1
                     /translation="MGKIVSMEYFRVPPRWLFVKITDETGACGWGEASLEGHTNAVEG
                     CLDAWFERYKGLDAESVGSFERPDIENIWQLSWRGSFYRGGPVFMSALSGIDIALWDM
                     KDIQADAQVARKLGVPIYHLLGGKVRDKIRVYAWIGGDRPDDVQVQANVLMLMSHRQA
                     RKQQGFHAVKMNGTGDTAWLDSPSVLHEVVGRVKAVKAMGIDVAIDFHGRVHKPMAKR
                     LARALEPHEPLFVEEPLLVEHIGGIKQVSELTTVPIALGERLYSRWDVRPFLESNCVD
                     ILQPDICHIGGISEMRRIAAMCETYDVGVAPHCPLGPIALAACVHANATMGNFAIQEM
                     GIGMHYNNTGQDITSYITNPEVWAVRDGHIDVLSGPGLGIEINEAEVRQMSQNTKAWP
                     TPEFRGPCGELREW"
     exon            complement(629120..629894)
                     /number=1
     exon            complement(629919..630054)
                     /number=2
     exon            complement(630117..630226)
                     /number=3
     exon            complement(630273..630472)
                     /number=4
     CDS             join(631077..631869,631903..632208,632263..633012,
                     633067..633254)
                     /codon_start=1
                     /locus_tag="AO090001000259"
                     /note="beta-galactosidase"
                     /old_locus_tag="AO070336000037"
                     /protein_id="BAE56798.1"
                     /transl_table=1
                     /translation="MTAVNVYMLYGGTNWGNIGFPEVGTSYDYSAPIHETRLIGDKYN
                     EAKLFGLFMRVARNFSKVERVGNSTQYATDQDIFTTELRNPDTGSAFYVTRHEYSPST
                     ELTKFRLHVSTDIGNLTVPTKGSITINGTESKVLVTDFPIGSSGKKITYTTLEILTVA
                     DLGDRQVVVFWAPEGEEGEFLLKDAKSGKVMTGNADNKTVTTTRYGVVTSVGAGNEKT
                     VIDYNHDVQAVVVDRQSAYKFWAPTLNNNPLAWENSTGNCAPMLREFLVHGPYLVRTA
                     EIDGDTIYITGDWDEETDIEIWAPKNVKNVFFNGSKLKITKSKYGTLVGSLPAPEVTA
                     DSLLAELPPLTNWKVAENLPERLVDYDNSKWTDANHMTTPHFVPPDTYPVLFADEYGY
                     QAGNILWRGRFDASEESMPSGAYLRVIGGLASGFSAYVNGEFLGSWLGSMANKTGELE
                     VSFKDVKLNTGDDNILFVIQDTMGKEQRDAAPDPRGILNATLIAADGSPTNFTSWKVA
                     GNAGGNHLLEPVRGTYNEGGLHAERLGWHLPGFDDNDWESGAPADGFTGADARFYRTV
                     VPLNIPEGYDASLAFQLSTEKKAKLRAQLYVNGYQFAKTLPYISNETTFPVFPGILDY
                     NGNNTIGLSVWAMDEAGGRVDVAWKVMGVHRSAFDPLFDGEYLRPGWKDRSQYA"
     exon            631077..631869
                     /number=1
     exon            631903..632208
                     /number=2
     exon            632263..633012
                     /number=3
     exon            633067..633254
                     /number=4
     CDS             complement(join(633887..633970,635444..636916))
                     /codon_start=1
                     /locus_tag="AO090001000260"
                     /note="cytochrome P450 CYP4/CYP19/CYP26 subfamilies"
                     /old_locus_tag="AO070336000036"
                     /protein_id="BAE56799.1"
                     /transl_table=1
                     /translation="MEHHTWALFVDKLDYKAVFGLLLTIIIAVVTTQILHVYTKCCPG
                     IPSIPFHISVYDAYRRVSEIGFHNSRLRPVLETHGAVNIWNSGQWAVLVTKPEYVVRI
                     LRNERVVAKGGFYGKVPHSTLAGLFGENIIDSHGELWKQFTGVMKPGIQRPHSISSLK
                     VASSKLIATFKREQQHAPSDRGVVIDDIIERWAIDVFGESFFDVDFGALNGGTVRAQD
                     ALLAILWNLGGHLIHHFPMFERIGWPLRPTRPHCFSMIRELEEALIDITEKLKYPETP
                     PDRFEKVIYRLKRARDDGLMTDFHYRSNLKMMFFAGHENVKFAFIATLWELSQNPQMQ
                     EKLYREIAAHIASSSDGDDLKSLPYLTAVLAETLRLYPPVSQLINRKTLEPVYLGNGI
                     TIPQGMWVGWTAYGVHTDPNTWGPTAHEYQPERWGDDVHAIQRAISQQQVRGSYIPFN
                     AWTRSCIGSEFALLQLRVTLYEIVRHFEITSAPDYRYSIKVIWSCAFLLRHRIYGRCS
                     RVYGSSEGGC"
     exon            complement(633887..633970)
                     /number=1
     exon            complement(635444..636916)
                     /number=2
     CDS             complement(join(637265..637939,638031..638192,
                     638245..638397))
                     /codon_start=1
                     /locus_tag="AO090001000261"
                     /note="isopenicillin N synthase and related dioxygenases"
                     /old_locus_tag="AO080502000044"
                     /protein_id="BAE56800.1"
                     /transl_table=1
                     /translation="MFPSLDFSRFHDPSQREEFCRQFVSTLKEYGFAKLINHGISCAQ
                     IDLAFAAARRFFQLPLEQKLKSPHPATAHPHRGFSPVGLENIGAVSDYGSAAGSPYLK
                     DMKNIWPPKGVDDAFQPTFTAFFEAGYRAELTILKALSIGLGLPEHKLGQLHADQTNE
                     LRITHYPAVARGEFAHSTRIATHTDFGTITLLFQDAVGGLREFFFFFFVHLSGHVGHV
                     VVLMQVAEMEVPPHSGQFADIESGGPYECILNVGDCLQKWTGLHSARHRVHLPDRSKE
                     EQINGIVPERFSIAYFAKPDRAAILRPLLLEGVPEEKYLTANEFQHMRIAGTY"
     exon            complement(637265..637939)
                     /number=1
     exon            complement(638031..638192)
                     /number=2
     exon            complement(638245..638397)
                     /number=3
     CDS             join(638748..639277,639331..645023,645072..650979,
                     651064..651125,651185..652276,652327..653269,
                     653392..655090)
                     /codon_start=1
                     /locus_tag="AO090001000262"
                     /note="non-ribosomal peptide synthetase modules and
                     related proteins"
                     /old_locus_tag="AO080502000045"
                     /protein_id="BAE56801.1"
                     /transl_table=1
                     /translation="MKSHILGLDQIWSWNAEVPKTVPGCVHDLIATVAVHHPDALAVC
                     AWDGDFTYSQLNALSHRVAQRLIALKIPRQSSIPLLFSKSRWTCVAMLAVIQAGCAAV
                     ALDATQPDTRLRSIVQQTQPRVVISSPMHTTRASGLTDALILQLDDAFFDNEIVEPTD
                     ELPVAFPSDIVYISFTSGTTGLPKGACISHANVRSAVHYQGKKLGFDSKSRVFDFAPY
                     SFDVAWSNFFHTLCAGGCICIANEEDMLNDLSAAIDAFRATLINVTPTVLRTINPTPT
                     TLETVLLSGEMPYRDNITRWADKVKLLNTYGPTECTFKCAFSLLSPHFEGRPDIGRGV
                     GHCTWIVDVNDSNRLATPGATGELFLEGPLVGQGYLGDPEKSAAAFINDPPWLLEGSS
                     NVPGRRGRLYRTGDLVKYKSDGRLMFMGRKDATQLKIRGQRVEIGDVEHHVRACLQED
                     ISVIADVVMPRGSDTTSLALFVQTQPDNREWVKREIDKLEGKLREVLPSFMIPTVYLP
                     VDVIPVASTGKADRRRLREMGNALDWNQIVKLQSTIVSAVDYREPTTDTERQLRHIWA
                     QVLELDVNRISTGDSFLRLGGDSIAAMYLVAEARKEGLSLTVADVFRFPILNELATKV
                     KNVVQSEVVLPFSLLTGRRSKKDLCKEAATLCGVEVGEIEDIYPCTALQQGMLAISAR
                     EASADYTSRTVFDLPEDINMTQLERAWTDTVAAMPILRTRIVELRGEGLVQVVVKTPM
                     TLLRYECIRDLMNTSSQASHLGRPLCRAGIIQDEFPRLLLMIHHSIYDGWTTRLILDT
                     VEMAFRETRAFSAPVPFQLFVKHVVAMDTAKAIEFWRDQLIGSDATAFPSSQYSPRKK
                     LDFNHVISGVQWPRTSATPSSVVRSALAILLASLTNKDDVKYGATVSGRQAPVLDIER
                     IAGPTIATVPVRVKLNWDQTVEDLLQQIQRQMVETTEYEQFGLQQIRRIDEDIEAAAQ
                     FELLLVIQPAHHGKSQQPGGLFSRAHSVALPGLLDAHSQGGPVLVAKDGQSDSIGIYN
                     SYAMMIICQLEESGAELKINFDSGAIEEDEVQRLARQFEHVLRQMCSEQFAQVKLRDL
                     SPMTSEDLLDIWAWNRNLPAAATELVTSLIEQRAATQPGKIAICAWDNEHTYRQLQER
                     STALACRMRERGVAPGSIVVLSFEKSSWLPITMIAVLQLGCIVLPVSVPTSSQRASQI
                     INALQPTLVITSNASHLCPFTGMVPVTTHDELMKAHIENSPGLPLPELRASDPAFLLF
                     TSGSTGTPKPIQWSHETLSSNIAAAQTCFGIDSNSRAFQFAGYDFDVSTVETLSVLVA
                     GGCVCIPSESERTNRLSESIAHYNANWICLTPSVAESITPKDVPLLKKITFAGERLQQ
                     RTASQWSEYLDVVYNWYGPAEACVATSYKFDPRNWQSGIIGRSQAACTWLVDPKNPNI
                     LAPVGAIAELLIEGPIVASYAGSCGAALNEKQFISPSWLHQGHWKVSGRDGTLYRTGD
                     LVKYTSGGSLLFVGRKQDSQRKLRGQRVDLENIEGLVQGFLKSRNEVKTVAEIFTPSL
                     SDKDSLALFFSSRGMASKPALPVDELEAYLATVLPAYMIPKLYIPLVTIPVGKTGKTD
                     RRRLRQIGSSFTTEQLAAMQPSRQKARQPSGENEKQLQGLWAEVFGVAVDSIYATDNF
                     FRLGGDSIMAMRLVALARNDGAALTVSDIFEAPTLENMSKRLVKGTKYIEEVPPFSLL
                     SPRVGKEDSRRYAARQCRIPEEQVLDIYPCTALQEGLLALGEKDPGQYISRSVLEIQS
                     TVNPDRLRQAWVSTLQKLPILRTRIIDLPGQGLVQVLLDNVPWRFGTDIATYVREDEQ
                     EPMGMGTQLCRAAIVEGSFILTIHHCTYDGASLKMVLDEFEHQYLGQCGAEFTPFRNF
                     IQYLQKTDPHDSTEFWKGQLSNAELQQFPVLPSSTYIPQANEEMDHPISVEWPRAGMT
                     PSTILRSAWAILEAQYVASNNVVFGVTTSGRQANMAGIERCSGPTIATVPIAASIDWD
                     QTIQTFLGQIQQQSINMIPHEQCGLQNIQRAVENTDSVLFQTLLVIQPVAEGKSLQDD
                     RTDPFNVYPLMLICELIGSGLKLHISFDNHILDHRQIRRIASQFETVLQQLCTTDPGT
                     TKLKDVQTASNFDITQFWGNNSKAPAEPQASVPDQISLVAGKQPDSIAIDAWDGQLSY
                     RELDELSTDLAHRLLGLGIVKGSTVALSMEKSKWVPIMQLAILKSGAVCLLQSVAVPE
                     HRVGTVLKTLDVVLAVASPSRVGVMKHFSKCLTIEEVLESPILYNPLPSPGMADPAIV
                     LISSGSTGEPKQILWSHRTLSANIQGAGEVFSMSSLSRLFQFASYDFDVATVETLSTV
                     AYGGCLCIPSESERLSDMPRAINRFKANVLHCTPSTGRLLSPEAVPTLSTLVQAGENL
                     TKEDAKRWSGKCDVINWYGPAECSLASVSPATLPSWYTGVIAGPSELIGSQYLPLCWL
                     VDPYNHHRLTPFGAIGEIALEGPGCAVAYIGNPSLTKRMFCENPTFLCHGQRGNERGR
                     MRRIYRTGDLARYDSNGNLVFIGRKDAQLKIRGQLVAPEEVEHHIRQCVDIADFPVVV
                     DGIIEKGGIHLTLVAFIVTEEVGSITNGLNEKLQKSLPRYAIPSYYIPVPAIPTGPTG
                     KVDRKKLREIGSAFTPRVQSEIQQRKPTTPAEVKLQSLWAIALGIEVSNISANDSFLR
                     LGNSIEAMRFVGLARDQGILLTVGQVFEKPVLAEMATVIQSTTNDMVEKASPFTLLDK
                     SVDIQLARQQVASLCGISEESIEDIFPCTPLQEGLLSLTTKHDGDYTGRNILELRSSV
                     DIGRFKAAWEQTVARIPILRTRIVDLPGQGLVQVVIEETNVWTEAKGAEDYIEKEKQI
                     PIALGSPLMRCSLFTTSSGENSRFFFALTMHHSIYDGVSTGLVLETLDSLYHHTTSRE
                     LSTFQPFVQYINRQDKKAESDFWASQFAGLEASQFPTLPYSAYEPHPSSNLEHSIRDI
                     RWRGDGITPSTTVRLVFALMCSRYSDSSDVVFGTVVNGRNAPVQGIDRLAAPTIATLP
                     IRVKLKDHENIRAMLIGLQNQATQMIPYEQSGLSRIQKINDEARQACQFQSFLMIQPP
                     ETKMDEGGLFSPQESSPQSERDRYRGFNSYAFSVGCTLLENGIQLQFTFDSKVIDCAT
                     IGTMAHHFEHLLRKVASHEVDQVAANDLEMITTQDLNQIWQWNSHRYESINRCIHNLI
                     SDTAKSQPTATAISAWDGELTYKALDYLSTQLAHQLVDLGVGRGMIIPLYFEKCLFSF
                     VAFLGVVKAGAAGLFLDPALPVSRLHAIVQQVKPILMLVSPSNETLGCSMVEHVIVVS
                     HDSMRLASEGRGKTTPLPSVHPSDLLYAVFTSGSTGTPKGVLIQHRHFCSAIVHQQPV
                     FNLGPSTRMYDFSAPSFDVTYGAVLPTLVAGGTVCIPSDEERKSHLSESLRRFGATDT
                     LLTPSIARCLDPSRVPTLRNIYLGGESPTHDDLALWTPHVPTVNCYGPAECSVGTLYW
                     KVPSPIPSKIPIGKGYGVSTWVVDPQSSERLSPLGTVGELYLEGPLVGQGYFMDEEKT
                     ASAFIESPSWLHRGSPNGRVPGRDGLLYKTGDLVKYDPVDGTLVFIGRKNTQVKLRGQ
                     RIELGEIEHNLQQVLIDMSIEAAVVAEVATPEVTGRAALVAFIESDPTRISEIAGDLE
                     NEMAARVPMYMVPVTFVPINPMPLTPSGKTDRRRLREIVSQFTLEQLGGGRQSNGRPP
                     ATERECLLQKWWTSVIGVPANQIFIDSSFIRLGGDSISAMRLASLARSQGISLTVQNI
                     LNQPRLCDMVQAMAPLDANRDDADQVEVTPFSLLRHPEDKEMTLNYIAQQCDISKSEI
                     QDVFPCTGVQKSLLSMTAKSHTSYIARFALRLAKNIDIPRLQRAWEKVSQTKAPILRY
                     RIVDTPTEGLVQVEVNEPLEWETGDTVSSYIQQDRRSMGLSTSLTRLAIVGNAAEHDT
                     YCLLTQHHAIYDGYSLNLLIQEVSRVYAGLIDPTPVAPFQAFVKHIMAIDQEKARDTV
                     RREFVGFHWPKRNATASTIIRAAWSILTARYTDTDDVVFGALVTGRQGPLQGLDRMIA
                     PLINAVPVRVKLDPEQDVESFLNSIQQQSIDMIAYEQSELLDTRRINTDTEQGSRFNT
                     LLVVQPTQQSGDSRIIDGPFDQRKIVSANDDLDDYNPNAVMILCQLTEDNSLTMEVSF
                     DSRVVDVEQMERIASQFEHVLRQLAMLTTDTVESIEVVSPEDIKQLWQWNAAVPHASE
                     RCVHELIDDTVKQQPESPAICSWDGQLSYRELDILSTSLASQLVALGAGAGTIIPLCF
                     EKSMWHSVAALGVMKAGAACVAMDSTQPESRLRSIVEQVHPNFLLTSSKNYDLARSLS
                     DATLLIVDRYHLLDSPVVHSTAPLPQAHPSDTIYVVFTSGSTGTPKGVVTTHRNFASA
                     AKHQQEILNIRSTSRVFDFVSYNFDVSWSNHLQTLICGGCLCIPSESERRNDIPGAFN
                     RMKCDYVYFTPSVARSLDPSSMPGIKCLAMGGEPIQRSEVVRWTQAEAIIGIYGPAEC
                     AQALSFVRLDSNCHNSHVGLPYGANMWLAQPGCPDRLAAIGAIGELLIEGPTVSKGYF
                     GDLEKTTAAYIKDPSWLLQGTPGHPGRSGTLYKTGDLLRYNSDGSFDFIGRKDGMIKL
                     RGQRIELAEVEYHVRVCLEDASVYDGVAAEIIRPQNSNPLLAVFVSLTDRLGKSENPS
                     AMIPGAYIPVEQIPMTTTNKTDRRALRDLGNAQSLERLAELQSHGKKHREPSTEMEKN
                     LQVLWSSVLGVAPASVSADSNFLRIGGESIAAMRLVAAARLQGLSLTVAQIFKAPRLS
                     QMALLVTQKAEEDEASQPQPAFSLLKTNDHKTFLQDHVEPFLYEDTGIVKDVIPCTDF
                     QKCAVIDALQDPPGRLPIWIFGLPHNVDFARLEWACKALVNHFDILRVVFIQADGRFW
                     QVLLDGFKPIYDTLDVDDDVESFTHTLCEEDLKRSRQLGQSFIRFVAIRHQGGKHRLV
                     FRIAHAQFDGYTWSTMIQTLAALYYQQSLPMQPTFRQFIAFNERKKEQSLSYWTSRLR
                     KSCHPTWSPANCSDTVYSTSDRMTVTTSFPMPNVQRHEGISSATFFHAACAIALSQQF
                     GRKDVVFGRLVTGRSMLPGSLQNVVGPTMTEVPIVVSISPNDTIVTVANQLQAQFLDD
                     SLHESAGMEEIIRNCTDWPEQVVDFGWRTAFQQADEMEFTFLDSGSTITVHEHDLLPR
                     RRPEVYATPRNGRLHLEFEGNRQLISADIVREVFARIQSVLGEV"
     exon            638748..639277
                     /number=1
     exon            639331..645023
                     /number=2
     exon            645072..650979
                     /number=3
     exon            651064..651125
                     /number=4
     exon            651185..652276
                     /number=5
     exon            652327..653269
                     /number=6
     exon            653392..655090
                     /number=7
     CDS             656686..657222
                     /codon_start=1
                     /locus_tag="AO090001000263"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000032"
                     /protein_id="BAE56802.1"
                     /transl_table=1
                     /translation="MLGASSETEYGLAQSSSNFTYIKQHLGVKWESYKCWVVKHIDAQ
                     AEGGCSYTVKSGGWNAIRDYMNWIRAGLEHWNLWDEASIESFVQQAEDVLREHSNDSG
                     NDWNYSVDEYWKDRNGQTQDDEEFEEEPDEEPQKQPPKAQDRRTEEFHFPGPWHTHLV
                     FLQLQCPLGGNVSDVNCN"
     exon            656686..657222
                     /number=1
     CDS             657634..658704
                     /codon_start=1
                     /locus_tag="AO090001000264"
                     /note="NADPH:quinone reductase and related Zn-dependent
                     oxidoreductases"
                     /old_locus_tag="AO070336000031"
                     /protein_id="BAE56803.1"
                     /transl_table=1
                     /translation="MPVPDTFLAATVNKPYAQHVVSNRSLQPLESGEVAIKITATAIN
                     PVDWKIRDYNFFIKEYPAVLGSDAAGEIVAVGADVSNFAVGDRVFFQGIIGRYDSSTF
                     QQYCKMPAALVSKTPSNISDDQAAGISLATVAVVTAFYDKSGQGLTPPWDPNGPQVGN
                     GKAIVIIGGASSVGQYAIQLAKLSGFEKIVTNASAQNHEWLKKLGAHVVLDRAPSSPE
                     DFKAAIGGLPLEFVFDAISVKETQALGVGIVQATKGADKIVTVQGADSDAIALGQSKE
                     PKVAVKQVLGLGSSPALRYLSEPLVKHLGGEDGYIAKNVFVPNRVHLVEGGLNTVEQA
                     LAKNKEGVSGEKVVFRPNEGAN"
     exon            657634..658704
                     /number=1
     CDS             join(659394..659598,660635..660771,660823..660905,
                     660963..661060,661106..661226,661282..661663,
                     661720..661850,661901..662231,662282..662387,
                     662444..662514)
                     /codon_start=1
                     /locus_tag="AO090001000265"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070336000030"
                     /protein_id="BAE56804.1"
                     /transl_table=1
                     /translation="MTPSRPSISWDEVNNAPHEVEWSEGLIGAPAAYQAAEKYEEHVA
                     ANGKYFPYSIFLSNLRMEPSNLLLSVFLASADESLVISTWSSIASQFNRLSQGSWLLV
                     AYNFGYCVSLPVYGTLSDIYGRKNVLLWAYFLFALGCLACGASGSLIQLILARVLAGI
                     SGGGMVALVSIIITDLMPSNEVALFRGYANVVNVAGRSLGAPVGGFLIATLGWRWAFL
                     GQLPLIIICILVAYYGLPSSLNQSKADSDQDDSRSRASDLDYGGIISLATAILILLFL
                     IQSLSTTDDQPGLPYVLAPAFAIAIAVFVLTEAYWARKPLIPLSLLKCSLGGYCVGQL
                     LLITGRSALSSNMVPYFVRIEKVTDFLASFTYVVTAVGVSVGGLISGAIIKRTKQYKT
                     MTVIAVVSTVLLSILIFIRYRDGCYTWELIYLFPSGLSNGILFSTQFIGMSLAAPKER
                     LATSIGIYYLSQQLGFIVGPAASVAVVQRLFAHRLSESLEGLEEKQCIGKVINDLRYS
                     ESLPERLQSIVRSSYLYGFQFVPLLGTVSTLILLPIVLLQKERRIE"
     exon            659394..659598
                     /number=1
     exon            660635..660771
                     /number=2
     exon            660823..660905
                     /number=3
     exon            660963..661060
                     /number=4
     exon            661106..661226
                     /number=5
     exon            661282..661663
                     /number=6
     exon            661720..661850
                     /number=7
     exon            661901..662231
                     /number=8
     exon            662282..662387
                     /number=9
     exon            662444..662514
                     /number=10
     CDS             join(663368..663464,663518..663951,664019..665255,
                     665342..665832)
                     /codon_start=1
                     /locus_tag="AO090001000266"
                     /note="beta-glucosidase-related glycosidases"
                     /old_locus_tag="AO070336000029"
                     /protein_id="BAE56805.1"
                     /transl_table=1
                     /translation="MRFVSLAVGAALLGAAGASSISSNVGLLKANGVALGNWEAAYEK
                     ASAFVSGLTTDQKLALITGSNVESANGNFTPLYFLDGDMGLQDFYYVSAFSLSSALAM
                     TWDRDAIYEQAKAVGSEFYNKGVQVVAGPTSQPLGRTPWGGRGVEGFGPDPYLNGLAT
                     GLTTKGYVDAGVIPGGKHFLLYEQETNRTSSFGSSGEGSPYSSNADDKTIHETYLWPF
                     YDAVKNGAGAVMCAMTKVNGTMACENSDLLMKMLKTELGFPGMVWPDMNGQNSAKGSA
                     LGGEDYGSSSIWSTSTMESFLSNGTLSEARLNDMAIRNLIGYYYVNLDNGRQPTRQTT
                     DVYVDVRANHSKLIRENGAKSMALLKNEGVLPLSKPHVMSIFGAHAGPIMGGPNSNVD
                     VMGSGPTYQGHLATGSGSGMASMPYLITPYDALTNKAAQDGTVLRWVLNDTYSSGGGS
                     SLVPSSTSSTAVEPSFENFATGSDICLVFINALAGEGADRTELYNADQDAMVNTVADN
                     CNNTVAVVNTVGPRLLDQWIEHDNVTAVLYGSLLGQESGNSIVDLLYGDVNPSGRLVH
                     TIAKNESDYNVGLCYTAQCNFTEGVYLDYRYFDAHNITPRYPFGHGLSYTTFHYSSLA
                     IKAPSSITKAPKGNLTVGGPSDLWDVVGTVSARIANNGTLSGAEVPQLYLGFPDSADQ
                     PVRQLRGFDRVELSAGQEAVVTFNLRRRDISYWNLKTQQWMVAGGKYTVFVGGSSRDL
                     RLNGTFFLWVGS"
     exon            663368..663464
                     /number=1
     exon            663518..663951
                     /number=2
     exon            664019..665255
                     /number=3
     exon            665342..665832
                     /number=4
     CDS             join(666525..667616,667672..669463,670629..670738)
                     /codon_start=1
                     /locus_tag="AO090001000267"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000028"
                     /protein_id="BAE56806.1"
                     /transl_table=1
                     /translation="MKLIWPTSLLFTALVAAEPYLLFSSGTSEYQLASNTTAPAVWVA
                     QNEPVGVLRAAHDLANDFGRVLGVNGTVNVFDTDISESPGKAVIITGTVGQSTPIDQL
                     VSDGKLDVSLIEGKWESYVSRIVENPFPNVTWSLVVAGSDRRGTIYGLYDISEQMGVS
                     PWYWWADVPVKTKTGIWVAPEGTFQKSPSVKYRGFFINDESPALSGWVAENFGTKFNS
                     AFYRHIFELCLRLKGNYLWPAMWGKMFYVDDVDNGQLAHEYGIIMGTSHHEPMARSEQ
                     EQKTYLDGEWNWNENQANITTFFQQGIDRAKHWDTIWTMGMRGEGDVASPTLTAADLE
                     ELIHAQQKLLVESFNASDPASIPQTWVLYKEVSDYYAAGMEVPESVTLLWTDDNSGNL
                     IRVPIANETSRVAGAGVYYHFDYVGSPRSYKWINSIQLVKTWEQMHLAYQKSARQIWI
                     ANVGDIKGLEVPLTHFMDMAYDMDRFTSTDSTTKWLKRWAAREFNERIADRTADILNH
                     YGTLVARRKYELLSQLPFAFSTIYYDEAEANLAQWESLLAQTQSVYSSLDQATRTPFF
                     EMFLHPVLAGKTVVDLYTKTAFNALYHQQGRISTNRLAQKVHDLFTEDSAITERYHGV
                     KGGKWRPVMDQVHIGYSSWDDPVDNTNVMPALSYIAAPQGAGGIGIAVQGSAASYPEQ
                     KTLRLLSMDPYMPPSESRYIDIFARKNTTVTYSISSNTSYVTVSNASGSVSASSNISD
                     VRSTITVDWASAEPGLSHTELQVRAGDGFTAALVLPVNNTFVPTNFTGFVESNGVISI
                     EASHYTSAETKSNVSYVEIPHYGRTLSAVMPWPVTMGTQHPNTGPALRYSLYTTTASP
                     SARLIISLGASHNHDPTRLIKFAYSLDGSVPVTVRPVSTVPPYKEGQAWQQAVIENGW
                     TSVIELPGEVGTGEHELSLWLLEPGVVLQKIVLDMGGYQDSALGSPERAVVTEADVLR
                     AEVVEEGSDISPLSRVWRLPSSHDL"
     exon            666525..667616
                     /number=1
     exon            667672..669463
                     /number=2
     exon            670629..670738
                     /number=3
     CDS             join(671670..671688,673204..673385,673521..674090,
                     674141..674458)
                     /codon_start=1
                     /locus_tag="AO090001000268"
                     /note="geranylgeranyl pyrophosphate synthase/Polyprenyl
                     synthetase"
                     /old_locus_tag="AO070336000027"
                     /protein_id="BAE56807.1"
                     /transl_table=1
                     /translation="MPRAALEPECVLVNGVFQWKHALANGHQEENFSVPVKVAVAANG
                     VRSSQANGAVAVGTPPAKITDYKAVKAPYNYINTLPSKNIRETFIDALNSWLEVPAAS
                     STSIKSIIGMLHHSSLMLDDIEDNSVPRRGSPTAHTLFGVGQTINSANYTFVCAFEEL
                     QKLQSPNAIGVFIEQLKNLHCGQGLDLYWKYNTHVPTADEYMTMIDHKTGGPFRLCVR
                     LMQGESSGKTEHIDARRFVTLLGRYFQIRDDYQNLTSAEYTSQKGFWEDLDEGKSSWP
                     LIDCLTGSDPEQTMIKGILQHKGVGEMPMAMKRLILGKMRKGGALDSTFLLLQDMQED
                     ILKELELLEAEFGSENPILELVLRRLCL"
     exon            671670..671688
                     /number=1
     exon            673204..673385
                     /number=2
     exon            673521..674090
                     /number=3
     exon            674141..674458
                     /number=4
     CDS             join(675348..675405,675498..675537,675586..677824)
                     /codon_start=1
                     /locus_tag="AO090001000269"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000026"
                     /protein_id="BAE56808.1"
                     /transl_table=1
                     /translation="MAELTVGYVSGIIAAAVFLVIGHLPEENTIVSWSVVSRLIHSSY
                     WPTILNSDTAASTGVSRAINACNWLQLGALGLVAITGIVTPLGLYDTIGPDDTPTNIP
                     FRYASDTSAFGKATRSRDGYRSLRVCYADEDPNTDEGCPGAPPNINDIEDPAEAYSIW
                     PSSVDLFTSGKVPSTVSSLFDIQWRSFRSTTNVALGVNGSAFSEGYYRQISQFIMEEG
                     IIAVEGLIVDTKAGRIGFRNHTVPVDVPTGARWTEDILFIEPEARCVNTNLTVDYRYN
                     PSSETYDSFEDTRDPVLVDHGGFSNLPHAVYEIDTANFQNNVALYERAYSAAWRHNMA
                     LMQFFNVTTNGSDGLAPFAYMNSEVGKKFDLRSIGSSYIAPVTVQTDSRYAGFLELPF
                     PNQSTSSSLRDRPEGPNPVNLTAQDTYAIAQEACHYPSMEDLSNLSFVGVSCGTVFAA
                     PGRLDGDPLIPDTNSTWSTPIYSCAAAAKAAIRKVTFRFNGTGELDNLEIERIERSSK
                     PQLWGVERLANHTIRNVRPLWGIVSPEVGTRDDISTVERDHLWLPGYPDTSVSDLYTG
                     QANMPGSQFYMDRLLSLFGVRNMEKSTSRYTGLNDLALYSQWLELSNSSSGVEHMLKL
                     MWTDMAANTVVGTRGWHSPKNGERLSKRDSGEVNVPVTLWSQHIEYRLPYAIPAFILL
                     ALCIALGAWSIWLLILRRVGLKQMRTYLARTSPGRILGHALHEDQGNILASTDVWLQQ
                     IGLRKVTLPGRNEDSEIPLLDVQRTLTHEDGGGDKSSK"
     exon            675348..675405
                     /number=1
     exon            675498..675537
                     /number=2
     exon            675586..677824
                     /number=3
     CDS             complement(join(678923..678938,679038..679260,
                     679641..679917))
                     /codon_start=1
                     /locus_tag="AO090001000270"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000025"
                     /protein_id="BAE56809.1"
                     /transl_table=1
                     /translation="MALRQKKSRHNPPSPKLSLISRSTKGRITHNHKTNNGWEYKVSS
                     ATTTRERRWGLQAIPAIINRVIVLWQPAELLTETGFQVLITRHRRPGYGTKFNVPFFI
                     TTQEVKQAVRLGCKGFALTIDPVRAGKIERDLRVRMSKRSPKGTNPDDDEEEADGFAG
                     EPSVGRPFENH"
     exon            complement(678923..678938)
                     /number=1
     exon            complement(679038..679260)
                     /number=2
     exon            complement(679641..679917)
                     /number=3
     CDS             join(680648..681082,681135..681182)
                     /codon_start=1
                     /locus_tag="AO090001000271"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000024"
                     /protein_id="BAE56810.1"
                     /transl_table=1
                     /translation="MAMVHVRSSTNGLTLNLSNAWWSTDEDVYALVTEYFAPEPHGRW
                     QDFRVDQSPSATASPWLEVLPLLLDRSRSTSRGASLLSASLKTLGYSIASKGGNGSTR
                     SQWEISRAEYYSKAVHCLKHDLNEGTGVCDESAAAIMCLSMAEQAVDSHLQRRLDRSC
                     "
     exon            680648..681082
                     /number=1
     exon            681135..681182
                     /number=2
     CDS             681516..681968
                     /codon_start=1
                     /locus_tag="AO090001000272"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000023"
                     /protein_id="BAE56811.1"
                     /transl_table=1
                     /translation="MAGDILTALIVTLQELDAWEQSMQSTVSGPLFWSSPASATSPGT
                     VQTTKSCIWFPSLSMATALTYLWAFRAVCFSQVAQVLSFDQALASRTDWIWTCLDISG
                     TQNCREKALAFHTMICQSIPFFMQDKMKFYGAASVTLPLMVTQTVLFS"
     exon            681516..681968
                     /number=1
     CDS             join(682448..682469,682585..682860,682975..683066,
                     683161..683787)
                     /codon_start=1
                     /locus_tag="AO090001000273"
                     /note="NADPH:quinone reductase and related Zn-dependent
                     oxidoreductases"
                     /old_locus_tag="AO070336000022"
                     /protein_id="BAE56812.1"
                     /transl_table=1
                     /translation="MATMRAIAIQGSKGPATAMYVTDIARPVPIPGQVLVKIRAFGLN
                     RMDILQREGLYPLPSYAPETMGVEFSGVIEQLGDEATAMESGFKCGDEVFGLAYGGAY
                     AEYIVVSTKTLFHKPAQLSWEEAAGIPETWMTATQALLLIGEFQSGQSVLWHAGASSV
                     SIAGIQLAKARGASAIYATAGSPEKIHFLEQELGVTKAFNYKTDKWAAELQKLTTGVN
                     LVVDFIGAPYFQNNLDIAARDGRIILLGLMGGAKLPEGVNIAPLLYKRLRLEASGLRS
                     RDLEYQKTLRDMLVDYALPKFCDRSFKVHIEKVFQFEDIVEAHQLLEKNQTKGKIICM
                     IGSQ"
     exon            682448..682469
                     /number=1
     exon            682585..682860
                     /number=2
     exon            682975..683066
                     /number=3
     exon            683161..683787
                     /number=4
     CDS             complement(join(685610..686887,686941..687366,
                     687381..687413))
                     /codon_start=1
                     /locus_tag="AO090001000275"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000020"
                     /protein_id="BAE56813.1"
                     /transl_table=1
                     /translation="MRNPFFRRVQVIPRARIEGELELDEGALLFGAASTPNLSGLHPN
                     PVHIFKLWQTFLENVNPLTKIIHVPSLQQHILNASGNLDSMPSELEALMFTIYCAAIR
                     SLSDEEVLQGFGKSRTALLAQYQQASQSALIKAGLLKTSNMVVLQAFVIFILSVRGEY
                     NPHTLWSLSGIAVRIAQRIGLHRDGSRLGLSIFETEMRRRLWWQITVVDAAISRMSGS
                     TSSLYPLADTRIPLNVNDSDLDVKMKETPPESSSATEMIFCLIRYELGQWLERQSRSK
                     PAGFDGYWESISGGSIPIEEKDRMIEELEDAIERKFTVHCDPSIPLHLMTMIVAWSVP
                     LILRLAAHHPRVYHEKGELPTQAEKDLVFKTCLSVLEYGNILLTTEEMRKYLWHVDSQ
                     FPWDSLIYILDELRHRAIGDETAKAWHLIDVTCSRQYHQPGPRARSPLHFALANLAVK
                     AWTAHVAECERRHMSTIPQPNIIPTFIELTQQKILYSLSASTRAATSSSQDQDQRSIP
                     ARAATLDASPFSAVPQLREVVLQSTNPVEDNAHFSSSVGLGPAESSPFDWAQWDASLQ
                     EYQQRSNSCGYF"
     exon            complement(685610..686887)
                     /number=1
     exon            complement(686941..687366)
                     /number=2
     exon            complement(687381..687413)
                     /number=3
     CDS             complement(688720..700560)
                     /codon_start=1
                     /locus_tag="AO090001000277"
                     /note="polyketide synthase modules and related proteins"
                     /old_locus_tag="AO080502000061"
                     /protein_id="BAE56814.1"
                     /transl_table=1
                     /translation="MGSLSDVRVEPIAIVGSACRFPGGANSPSKLWDLLHSPRDVLMD
                     FPPSRLRLSNFYHKDGEHHGSTNVINKSYLLAEDPNVFDAAFFNINGLEAQAMDPQHR
                     ILLETVYEALERGGCSLDDIQGTKTSVFVGVMNADYYDIQLRDSETMARYNATGTARS
                     IISNRISYFFDLKGASMTIDTACSSSLVALHQAVLSLQNREAEASIVAGANLLLDPTM
                     YIAESNLHMLSPEARSRMWDKDANGYARGEGFAAVYLKPLSAALRDGDEIECIIRGTG
                     VNSDGRTKGITMPSSVAQTELIRDTYRRAGLDPSVDRPQFVECHGTGTAAGDPVEARA
                     VHDAFFPPSSKRDNERPLYAGSIKTIIGHLEGCAGLAGVLKASLALQNRIIPPNMHFN
                     DLSPSVKPFYGMIQIPKQPMPWPESTTFRASVNSFGFGGTNAHVILEGYYKGGECLNG
                     GCQQARLDSFVGPMLFSGNTQTTLRAMIKEYFDYLSANPSLDLEGLARALADRRSMFP
                     VRAFFSGSNREALLKYMGQALISSEGSDIGTRSLASSDTPGLLGIFTGQGAQWATMGK
                     ALIHSCLLFRVSIENCEESLSTLPDPPSWSLMQELLADDKESRIGQAAFSQPLCTALQ
                     IALVDLCSAAAITFDAVIGHSSGEIAAAYAAGILSAKDAIRIAYYRGLYAKLASGPDG
                     QPGAMMAVGLSMEGAMSFIAECGLYGKVCLAASNSPSSVTLSGDKDAILQAKGFLDER
                     KVFARQLQVDTAYHSHHMLSCADAYLKSLEACNIKPSLPRAGCVWVSSVRGDIEILEK
                     GDFTSLNSQYWVDNMVKPVLFSQAVECSLWAGGPFDMVLELGPHPALKGPATQTLKSA
                     LGTSLPYAGIMRRATNEVEAFSGAIGYVWSHLTDYHIDFASYRESFFKEADRAPATLK
                     DLPSYPWQHDKAYWKESRISRQFRLRHSPLHELLGRRAPDDSDSEMRWRNVLRLSELE
                     WIRGHEFQGQALFPAMGYIAMALEAVTIATKGQQISLVDIEDFHVLQAVVLEEEHPGV
                     EIVFSLKQTGDCKWDFNCYTCSDEWKDLTKTSTGRLILFKGEGSASELPSRPKKRANL
                     SPLDREMFYRKLSSLGLSYHGLFKPQSSFQRSQSYATGSASWPLDQLGQEYVVHPAVM
                     DVALHSIFVAFASPVSHELWATYLPVAIDRLSFNPNISLYGTDGALTIEIDTFITESS
                     SSTMKGDVYLLSPDATPSILIEGVRLQSFTEAKALNDRLLFSKIVWGADIAHGFSSRA
                     VECANKDQFELCDAMERTSLFFLQRAFAELAPCEIEQSEPQFRHLHTAFLKVIEQIKG
                     GLHKSIHSEWLGDSWNDVNSLRRSFESSIDLEMMHAIGQSLPDVIRGRRPLLEVMMRD
                     NLLNRFYTDGRLFVPLNLYVAKTVKAMIHKNPHMKILEIGAGTGATTKAILDTIGDTF
                     DSYTYTDISPGFFAQAQERFALHRQQMRFQTLDIERDTVEQGFERHSYDLVVAANVLH
                     ATSHLQETMGHVRSLLRPGGYLLIVEVTGETLQLMYVMGGFPGWWLGVDDGRTDGPGI
                     PAVQWEGLLQMTGFSGIEATVSDLPSDGKHSCSALVSQAIDDKLELFRDPLPRVGDVP
                     IRDPILILGGGTLPVAKLVTGVRKLLRPFRWNIQHAPSVDHLTVPLEGSRSVICLSEL
                     DNPLLSEPLTDTRLSKLQAVLGSATNVLWITRDRLTDYPHSNMITGLGRTLQFELPDI
                     NIQFLDIRSGISIGADQVVTKFLQLCLVNSPEYLQDDVPWKIEPELSFDGGEWQIPRI
                     IPYKALNDRYNATRRQIMKPLDASRQSVELACFDGRIIIREGKRVTGTSTGSVRLRTI
                     LATRLVSSRLASFFLCMGVEADNGRTAVAITTRMGSLMDIPSTDAWFLPQRSQCDPAL
                     LYFIAGQVLAVALSFASPRSGSVILYEPTEALAEAIILSRSWVQEQPYFITSRSGTLQ
                     KGWTYIHPRVSHNIARDVLPGDTAALIDCSDDCPHWAVPTTVGKLIPLASCVVEYLTR
                     TPSTFSSIIEHAYSESLLAALPSTAQLSASILSVEDSAGQSSSLLSYPNIVNFDCNNA
                     VLATVAPLDCTGLFSSAKTYWMIGLNSELGLSICRWMIVQGARHIAITSRSGKVDAPW
                     LDEIQSMNGNIKVYPMDVADREAVHSVHQEILRTMPPIAGVCNGAMVLSDKLFMNMKA
                     EDMNKVLKPKVDGSIYLDELFCTTQLDFFILFSSLASVVGNGGQCNYHAANMFMTSLV
                     SQRRSRGLAASVIDIGLVVDVGYVARAGQSLIDHLVNLFYTPLSESDIHKLFAEAVMA
                     SPVDSGLCPDIIMGVEPVHDISASLKKPPWYNNPIFSHLRLGTEASSQDSDQSNSTSA
                     SIRDQVSSASSVEEGTDVLLRCFAAKLEAMLSLATNSVNVNMPLLDIGVDSLLAVEIR
                     QWFFTKLYVDIPVLKVLSGDTVVEICAEAIQKFAQMSPSAFQGTSSAASKIKQATASP
                     PEIGREEAQSTSRAGILPTDQDNDNSSDSESQRKSGASSSSGSGTRTPTSIDEYFETN
                     VNMLSRSGPMSYAQSRLWFQQQLVKDPTALNIVVRFDVKGYLDVDRLAAAVTATVNRH
                     DALHSAYFAHLDTQEPLQGVIEAPGDIFQHVKVHDDNAASAIFLEMQNRHWDLERGDV
                     FKVTLLTFPTNVQSLIIAYHHIVLDGFSWHVYLRDLSMSYQQQALPPVGPQALDFALI
                     EAQETKNEEYNAQLEFWREELSPVPETFPLLPFSSSKVRQDMQSFQSTTATRELHFDI
                     LARAKAASQRLRVTPFHFHLAIAQVLLYKLTNIGDLCIGVTDVNRTNRKFAETVGFFL
                     NLVPLRLRVKPTDSFTEVLHRTSKKALSAMEHSGVPIDVVLRELNIRRSSGHSPLFQV
                     VFNYRVGDMLQVPFGGGRLELHSSIEARSPYDVVFNVTQCPSGASYLQVTSRDALYAP
                     EVSGVICDMYIRLLEDFAGDTSMQIQDGLLNDKSEPGIGLGPRLEFGWPRTMSELFSQ
                     RAATDANSIAVKDCRGAVSYAELQQRVADITQDILGCNPPPNARVAVCIHPSRDTIAA
                     MLATLAAGCVYVPIDITLPEARRRAILDSCRPSVILCDSTSADSIDQFAPQECRKVDL
                     GDSPTRATTTAMPEPVADDPAFLLYSSGSTGIPKGILLPQKGYMNYLASKGHHLCLGR
                     EVVLQQSSVGFDMSIAQIGNALAHGGTVVVVPQSVRGDPVATAQLMLQEKVTFMIGTP
                     SEYLMLLQHGGDYLRQYRDWRHACLGGESVTEPLKREFRRLSPNCPNVTDCYGPTEIS
                     AATSFNTLDLDRGAANEYSTVGRPIPNSTIYILGDNGDIVPPGLVGEICIGGVGVALG
                     YWNLPDLEKQKFIHDPFASSADRRRGWTRLYKTGDRGRLGPDGGLIFMGRLDGDTQIK
                     LRGLRIDLEEVANSLLQVAAGLLSETVVSVRGDPEFLVAHAVPARGQKVTNSDLESFK
                     RSLPLPQYMCPAAIVLLDRLPTTPNGKVDRKALQDKPLPTEPDSSFPTEALSLAEGEL
                     RLVWQDVLQQTAQTGRIDSRTDFFMAGGNSLLLVKLQGAIKNAYGLSIALKDLYRCST
                     LGRMATLIDAEKKNQPIFEKIDWEDETRVPGSLARGQRLREPKKTDLHIALTGSTGFL
                     GMEILKALLEQPTVSKVHCLAVDAQHGQSLPKSHKIVIYPGSLNVSALGLSTREVDFL
                     KSTVDALIHAGANGHCLNNYFSLRMPNLGSTRFLTELALSRGVPLHYVSSNRVTLLSG
                     DVALPPGSMSAFPPPETGSDGFTASKWASERYLENVAEATGLDVCIHRPCALTGDQAP
                     SEDALNAILRFSVLMKVVPQFPNVRGFFDFEKVGVVATNIVKKALQSVQVTRVHATSV
                     ASFAHHSSGVKVPVDKIQDRMQDLYGGVFGRLALADWVQRARTLGIEPLVASYLEAME
                     SRGEEMAFPFLGMPSD"
     exon            complement(688720..700560)
                     /number=1
     CDS             join(700845..701130,701304..701323)
                     /codon_start=1
                     /locus_tag="AO090001000278"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000017"
                     /protein_id="BAE56815.1"
                     /transl_table=1
                     /translation="MDESAKPMTILWKRNEYRRYDVETDMTTRPAMVGPVKEQRTGRL
                     VAYMSPRLLRTVAAETENAPQDDGRRSSGSPPRRLSGTGGRGAGVLGKTSEGCLGLQ"
     exon            700845..701130
                     /number=1
     exon            701304..701323
                     /number=2
     CDS             complement(701653..702618)
                     /codon_start=1
                     /locus_tag="AO090001000279"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000016"
                     /protein_id="BAE56816.1"
                     /transl_table=1
                     /translation="MRVNYPRNLDDRDLDRYNPQYSRPLSQPTAMTYTLLRIQLADIC
                     RSAIDALPPPFSDWGEVNYDRFISLDQRFEAFIRSLPVFFRLDEASRHQSRDVEHQYP
                     QIIVQRYILWSTLQGRRSKLNQPFLTRVSMNPRYQYSRKVCLQSARCVIELKALMDHD
                     MASLASAHVRLATFLHNYFLATAVLVMDLCLNKEGGSSEDRRQEIVDACRVLQEAEAT
                     SPMASRFLKSLMDILQKYQIQVLPATTVPDVRPLSANTGASGVPDPNLSDRDLVNPNQ
                     ILPSTYDPLENANIDDLWQNFINLDQNCSPGSWDHLFSALDSRIV"
     exon            complement(701653..702618)
                     /number=1
     CDS             complement(702754..703431)
                     /codon_start=1
                     /locus_tag="AO090001000280"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000015"
                     /protein_id="BAE56817.1"
                     /transl_table=1
                     /translation="MSNGVSVRVLAVQQALETEFSLVEASGNPSSVGSCVARVWLPPK
                     NEATWLLKRYAEDVTYLHHILHLPSVRQQMEDLYKQLSLGLRIEPCHVALILSIFAST
                     AYTLTPLTGGDAVFTNEQTAVKCAFLWSKMALDVLEHSSRSTPGSIEDIQATIILSFV
                     IFNFEGFTMRFRALSASALTMARDLSLHRLDARPDRLPGPHAPLDSDIGREIKRRVWW
                     HMVSTDW"
     exon            complement(702754..703431)
                     /number=1
     CDS             complement(703506..703928)
                     /codon_start=1
                     /locus_tag="AO090001000281"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000014"
                     /protein_id="BAE56818.1"
                     /transl_table=1
                     /translation="MQRRRRRQLPVSCQLCRSMKLKCSRDQPCSNCVSRGVTCERAYR
                     MEPTTSSIASPITTSPVQAQTTYLQPGWPANPSAGTGTGSNTEILSRLQRLEDIILRT
                     HGAAAPRPSTEPSYISEGEGDSKWLEGVGTRDTSVVSL"
     exon            complement(703506..703928)
                     /number=1
     CDS             join(704562..704617,704670..704886,704942..706072)
                     /codon_start=1
                     /locus_tag="AO090001000282"
                     /note="monocarboxylate transporter"
                     /old_locus_tag="AO070336000013"
                     /protein_id="BAE56819.1"
                     /transl_table=1
                     /translation="MSATVDNTEANASPPKEFTLRSTIALIGAFMALFCTLGFQNAFG
                     VFQAFYHATILRDHSEFDIAWIGSLLTFMIFFFAAPAGVLVDRVGPTPLLTFGAIATI
                     LATFMISLCKELYQFLLAQGILLGIGNAFLLCPAMATVTRLFDHHRGAANGIMIAGSS
                     IGGIIWPIMLDQLLNKDGVSFGWTFRIVGFVVLPLCLFMVATIRPAPKTLHDSDREGI
                     ELSHGESESDHKAQGAEGPAAIIKNPTFLILCAGLSVATFGLFSPLFFISTYATDQGL
                     SVSLAFYLVSMLNGASMVGRVSTGFLADRYGNFNLCFLTIASSGLIAMCWTKATNTVG
                     IIFFALAYGYTSGVSPSDLKKNPPGPNTAVAGHVQSPNPVCRPALDARVEGGCRRHSL
                     CRASNSVSIVFFSRIARSCRLTHSYSGLVGTPISGRLLKHGYLALSMYSGAALLAGAG
                     LVLIARLRQNTKLMAKV"
     exon            704562..704617
                     /number=1
     exon            704670..704886
                     /number=2
     exon            704942..706072
                     /number=3
     CDS             complement(join(706986..707044,707133..707376))
                     /codon_start=1
                     /locus_tag="AO090001000283"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000012"
                     /protein_id="BAE56820.1"
                     /transl_table=1
                     /translation="MPFQFLQSLDEMLFTNIDITGSILALIFQHLAKDQAMQKKLRAE
                     ISAHRAQPGYTVGDYISKQNTLLHFSLLESIRVTPAMSPSALGDSTFLLTRQRSWT"
     exon            complement(706986..707044)
                     /number=1
     exon            complement(707133..707376)
                     /number=2
     CDS             complement(join(707482..707695,707772..707896,
                     707902..708034,708092..708268,708325..708398,
                     708475..708600))
                     /codon_start=1
                     /locus_tag="AO090001000284"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000011"
                     /protein_id="BAE56821.1"
                     /transl_table=1
                     /translation="MASPMKSDFLAGSHMKLPKIGIAAAVAVVASIVIYLALSNFFEF
                     KNDESQSIKEYPDNTRFMRFTHGKQLSKAGEDLAGSEPYLIHNGKLKELVIFAPEHLQ
                     EFHRKDANSHYKPENMNMGDYAGQLLGQCVGQLGGTKWKLARSHMDPEFSYRASRSMM
                     KRFSQEIDSWSSVREPNQKEHPERCVCAGCEEAVQGSVPEVHRDQHLWRDVHTMNELH
                     EKIIFVAFLNKRVMSKWYNKLPTAEKRLMDSFQTQWKAFNLAQIKLAREVPSSQCYIQ
                     EYLISL"
     exon            complement(707482..707695)
                     /number=1
     exon            complement(707772..707896)
                     /number=2
     exon            complement(707902..708034)
                     /number=3
     exon            complement(708092..708268)
                     /number=4
     exon            complement(708325..708398)
                     /number=5
     exon            complement(708475..708600)
                     /number=6
     CDS             join(711106..711525,711615..713267,713319..713417)
                     /codon_start=1
                     /locus_tag="AO090001000285"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000010"
                     /protein_id="BAE56822.1"
                     /transl_table=1
                     /translation="MDMATSHPNHGHDRVPTDSGIGHSPPAQVEPIPSEGEMYGDFWD
                     PLFVIHNTISTHKHRDPASTPASLGHVPRHTPAQAPTEVQVLIQRVRQLEQKVFSQQE
                     PESSLAAPHIQQRHPQARRTVCQANLLGKSHWLVGFAQDNDVEFRALFVKCQRLSRAI
                     QQQYSLRASSLQALDGSLPSQEACDVCVNAYCRTFESVLRILHVPTFRQVYNEMWTGS
                     QPTSRLFLLKLQLVIAIGARVVNQSDMLGTPDMASRCVAWIQEAQQWLHAPGESLQAS
                     VDGIQLYCLVLLTRIVCAVDASLVYVSTGALLQKAQQLGLHRDPSHFPAMPVFQAEIR
                     RRLWCTVCELVLQSSTDSGTPPLISCDEFDCRPPANLNDTNLGTASEPEPSNILTQTS
                     FSILLMRCLPVRVQVAKVLNSVQLDPSYSEVLRLGEELTAACHYNTQMIKSMSPDHEQ
                     PTLFQLELLNLLTYRFLLCLHQPFAMKARKNLAYYFSRRVCLETAIQILAGHPTTPSG
                     QNVNDYLNVKRYSSGLFRDPYLLASVTVGHEILCVTEGDWFSCQPVSPLTNNLSSTPN
                     KSQQVPRTVLEEYVGLSECRLKDGAQIDIKTYVLLSCIIAQIKAAETGSPQDDAVLSA
                     AVDSLEKCHIVLVDRYKSLAQSRESPQPLQVYGGSNVPCRLGKGSNDILDINETGEGE
                     AWSDFDVSQAEWSLQVEYPDLDWNLLNTWSACVPGSDSGAS"
     exon            711106..711525
                     /number=1
     exon            711615..713267
                     /number=2
     exon            713319..713417
                     /number=3
     CDS             complement(714133..714879)
                     /codon_start=1
                     /locus_tag="AO090001000286"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000009"
                     /protein_id="BAE56823.1"
                     /transl_table=1
                     /translation="MLIRDLKDTPEGLEELTSLAYYGRLRFTVNLLPLLERTAKTNYP
                     DEPSNRRPRVFSVLNGGNERALPFVPEDLQSEKSYTMLNHVAHTTLMNTLALEHLAHK
                     KPSVDFVHESPGKVQTEIVASFLQSPERTRSRLVLWRWLKGMLMLVLQAVLLPVFYVV
                     AMPLAESGERRLYEATVDLSQQWQKQLQSPPHNGIVAAPGFYRMKHTSDIVMDDTVLQ
                     AYRALGMPERAWEHTMAVFRSVLDKGSGKK"
     exon            complement(714133..714879)
                     /number=1
     CDS             join(715634..716121,716253..716775)
                     /codon_start=1
                     /locus_tag="AO090001000287"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000008"
                     /protein_id="BAE56824.1"
                     /transl_table=1
                     /translation="MPASIHFEISATQRAIKIKGPGQASVEKGCPVPACQPEDILVRV
                     VCVALNPVDWKSADLSPSLDATWGTDFSGEVVVVGEACQSRFALGDSVCGAAFGNNPE
                     DATQGAFAEYVAIPGELVYKIPPDMSFEQAATVGTGLATAGLTLYQTLGLSWPDQPVQ
                     DAQSGYIPVTTCSAKSFDRVKQLGAAEAFDYHSPGCGSEIREYTENSIKYAVDCITNI
                     DSMKCCYTAIGSSGGQYVALDPFPIRGHTRRNVKARWIIGYTIYGRPINWKHPFKRDA
                     QPQDREFAKRWYPVAQRLLDEGKLQLHPLQVETGGLPGVIEGANRSRKHQVTGVKLVY
                     CV"
     exon            715634..716121
                     /number=1
     exon            716253..716775
                     /number=2
     CDS             complement(join(717010..717993,718067..718670,
                     718771..718895))
                     /codon_start=1
                     /locus_tag="AO090001000288"
                     /note="predicted protein"
                     /old_locus_tag="AO080502000072"
                     /protein_id="BAE56825.1"
                     /transl_table=1
                     /translation="MNNAISEPRITPSLRPSPKMQAPTLTSASAEGSDTTAHGCGGCT
                     HFACQPIIMFTLTEYFIAACVWLVLYKVGNLLWNRHHYFKQQKARGCGEIKHYRHRDP
                     ILGLDFVYTLSKAFKEHRWLPWQQELFAAQGVKTFQANFLGSRAIYTSESENMKAMST
                     TYWREFGLEPLRRGSGAADPVAGPGVSTVDGPMWDFSRNIIKPYFTRDGYSNLARLEV
                     FVNRLLDLVPTDGSTFDMQPLLQRWFLDTSSEFLFGKTVDSLTHPENVKVAKAMVDTM
                     RGIRVRLTMSKLMFLHRDPVWMENVKIVRDFVDERIDASLTQLQDVKSGKGTSCTENQ
                     PDGRTDLLWDMVQQLQDKEALRGQIMAVFIPSNDTTSILISNAIYALARHPHVYQTLR
                     EEVLALGDQEITFEKLRGLRYLRYVINESECMSANPLGRTSRLTSWQPIVCTRTASRW
                     YGLLWKTLRCRSEEAQIKANPSSSKKETSSMPTGTSCTGTQTTGALMPRSSARSVGEM
                     SGLCGSSSPLEEARASALRMCSSIRRHHTCSCALCSGFALWSPEMSGHTRPSCGLGRA
                     ICMG"
     exon            complement(717010..717993)
                     /number=1
     exon            complement(718067..718670)
                     /number=2
     exon            complement(718771..718895)
                     /number=3
     CDS             join(718972..719121,719172..719298,719356..719479,
                     719546..719994,720052..720365)
                     /codon_start=1
                     /locus_tag="AO090001000289"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000006"
                     /protein_id="BAE56826.1"
                     /transl_table=1
                     /translation="METVAAIKTLIQQLAESTDQFGRAEINDALRELQHSLETPFDTV
                     MRMSLDTCQVAVARIGSDLGLFKHLSQCASPQSAEELADHLGCGRELMSRLLRYMASV
                     RMVQQTDDIKYISSNITQTLAVPGLEAGMRHAFENLWPVLMALPDFLAERKYPDIVDA
                     KDTAFQKAFNTDQDCFHWLATQPTRIANFKVLLTDERTPNFLSTFPLEKELGSWSAEP
                     EKALFVDIGGGMGHACIRLREKYPNQPGRVILQDLPPVLQAAQATQPLSGIESMPHNF
                     HTPQPVQGAKFYFLRLILRDFPDHQALEILHNIVPAMDAESRIVIDDGVPPEKGARWA
                     ETGTDICIMSALGSKERTQRQWEELAAKAGLQLQALYQYTWPVVNAAMVFSLQ"
     exon            718972..719121
                     /number=1
     exon            719172..719298
                     /number=2
     exon            719356..719479
                     /number=3
     exon            719546..719994
                     /number=4
     exon            720052..720365
                     /number=5
     CDS             join(720892..720918,721031..722261,722363..722379)
                     /codon_start=1
                     /locus_tag="AO090001000290"
                     /note="2-polyprenyl-6-methoxyphenol hydroxylase and
                     related FAD-dependent oxidoreductases"
                     /old_locus_tag="AO070336000005"
                     /protein_id="BAE56827.1"
                     /transl_table=1
                     /translation="MTPPKSAIIIGGSISGLLQALQLKRAGTDVLILEQDPSPTRASH
                     ESGVSIGPSVLALLKKYDATGTPPAIPAGFLSVAWQTRPRVLNTAWHHDMSNWGSLYL
                     ILRANVDGFASDVVPYPPPGRKGDGTAEYKAGRRVVGVEFDRGDGAMNVLHVEAEASR
                     GSRQGMEVKRERAEMVIAADGVHSTIRRFLQVPTTWTYAGYIAWRGTVREDQLSPETV
                     RYFSDRLNFTLLAGSYFITYIIPSETGSVEPGRRLVNWVWYYPVPEGSVAMDTIFTDI
                     NGVLHNSTVPGDLLDPKVWSVQKRRYISDGTTPHLAEVVSQTRRPFVTKVGELEASAA
                     SYFDGRLVLVGDAFATFRSHLGLASEQAARHCLQMDRVWSGEISQAARDREARLYAAK
                     LLLLNRLMGFLGLGWWWSALKTGLAYASPHHH"
     exon            720892..720918
                     /number=1
     exon            721031..722261
                     /number=2
     exon            722363..722379
                     /number=3
     CDS             complement(723350..724381)
                     /codon_start=1
                     /locus_tag="AO090001000291"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000004"
                     /protein_id="BAE56828.1"
                     /transl_table=1
                     /translation="MEALVAQAIKDTATFRKTSVPWTLDEPYTQTYYGFDPATSTWVS
                     KSPSALGSSSKNDNDSLATTAIALYTWNIDFMVPFAAARMRPALAHLYQLTRLLPLHV
                     APVIFLQECTPSDLETIAATPWVQANFHLTDIDTTNWATTQYGTTVLVGKHLPITSVF
                     RVHYSHTRMDRDALFVDVSTELEEKRIRLCNTHLESMALDPPYRPPQMQLVAQYMHHD
                     GVHAALVAGDFNAIQPFDRTLHVDNNLKDAFLELGGAEDTEEGYTWGQQATTKQRAQF
                     GCSRMDKVYFRGSVKLLKFEKFGEGILAEGDEERRQIVELGFEKPWVTDHLGVMAVVE
                     VLPSTKGQL"
     exon            complement(723350..724381)
                     /number=1
     CDS             complement(join(724896..725436,725486..725715))
                     /codon_start=1
                     /locus_tag="AO090001000292"
                     /note="predicted protein"
                     /old_locus_tag="AO070336000003"
                     /protein_id="BAE56829.1"
                     /transl_table=1
                     /translation="MSSSGFSPEYLAEDSSGASFAQITALPALATLFVVLRIGVHLWR
                     KVGFQLDGWLTLVSIVRDHLYNLVLDYADCSHLNVRVGRHVAVLNRDEITIMQMYFFI
                     SYHLYATVLATTKWSILAMYYRMFPTRFMRWSTLAIGLVVTAWWLACIFVSVFGCHPI
                     RRNWDPFVEGWCIDNVKGFIGKAVPNFTTDFVMLALPIMEVRKLHMKTTQKIALGTVF
                     LTGGLGCAASIVRFAQIRELSKDNADPSCERPTVPTPD"
     exon            complement(724896..725436)
                     /number=1
     exon            complement(725486..725715)
                     /number=2
     CDS             join(726483..727263,727319..727941,728007..734003)
                     /codon_start=1
                     /locus_tag="AO090001000293"
                     /note="polyketide synthase modules and related proteins"
                     /old_locus_tag="AO080502000078"
                     /protein_id="BAE56830.1"
                     /transl_table=1
                     /translation="MYCNILLDCTGRACLLCLPTFTCAWLDISRTLEAIYSKFIDTMP
                     ESIAIIGYGFRFPGGCDTPSKLWSLIKSPRDIASNPPPSRFDIDPFYHPVSNHHGTTN
                     ATKSYWLDDSPRINIAEFDAAFFNIQSREADAMDPQQRVLLEVIYDALCAAGQPMEQL
                     RGSDTAIYVGMMCDDWHMMLSRDWQALPRYTATGVERGIMANRVSYFFDWHGPSMTID
                     TACSSSMVALDLAVQALRSGKSKVAVAAGSNLILSPGTYSSITMYVSESNLGMLSTSG
                     RCAMWDIAADGYARGEGVAAVIIKTLSQALADNDPIQCIIRETAVNQDGRKPGLTMPS
                     SRAQAALISECYRRAGLDPANNINDRPQYCHAHGTGTQAGDPQEAEAIAFALFPVGSR
                     AAREAHKLLVGSVKTVICHTEGTAGLASIISTALALKSKVIPPNLHFHTPNPSVAPFL
                     DQLEIPTTAVAWPVATGQLIILDSFGFGGTNAHCILEEYISTGEQSANSTPHTLFTPL
                     IFSAASRTALKQMVLEAHTYLRDNPGVNMRDFAYTLQHRRSTLPYRTAVAAPNTQDAI
                     DTLANVGLEDSGVRHGTSRQPPRILGIFTGQGAQWPRMGARLIETSPFIVTRIAELDA
                     ALQSLPNPDHRPGWTIHDQIVASPESSRLTEAAVSQPLCLAVQIIIVDILRAAGISLC
                     GVVGHSSGEIGAAYAAGFLSATDAIRIAYLRGMHANKAASPNSRVSCGAMIAVGIPAA
                     EAKRFCKAQFAGRLEIAAENCASSVTLSGDEDAALEAIQFFHMQGVFARLLKINTAYH
                     SCHMAPCASPYLASLDACGIEPCQQGNTKHPVWFSTVFEGQTMTASSVANQYWVDNMC
                     KPVLFGGGLARAVEQIGPFDLVIEIGPHPALKGPASSLLNCVREMPYISLLRRGTDDV
                     HALCSALGYIWAQLGPNSVQFAEVDMLLSSTTRSPVMLSDLPPYPFDHGRNYWHHSRL
                     SDHFRPRTQIHLSNPILGFRCLEAATPGSFQWRNILQPTEIGWLSGHQLQGQIVFPAM
                     GYVSMSVEAIQLVLADIRPNDSIRLFRLTDLEISRAIVFNTDDAAIETIFSLFLIAKT
                     EYSVRAEWRCYSSTSSSSMTLNAKGCVSAQFGSPSAEALPFKTTESFGLVSVKDADFY
                     SNLSHLGYNYAPPFRGVSSIRRKPKYSVSTVVDQSASRWEDNLTLHPGMLDSALQTIF
                     AAWSYPGDTQLWSLHAPVSVASIVINPYFSALGPGGKQRYLCSETLIHWKKPTDVLAD
                     VAMRTADAEYAFLEFDGVKLIPISPAASEDDRAIFSRFKYASAVPDTQLVSTSGRLLM
                     PRDGCPLSRDTGEFDLVGSPSKRVSACPIDDCAGRIVLAISHRYPQADICEICGETGA
                     TPSAVLKALDGRYGSYTFTDVSCDFAKSAKERFHRETRPMSFKAFDVERDPQSQGFPE
                     CSYDVIIALNIRSGLGGVGGPLSNIRRLLKPGGFLIASGGTSVKSPAVEMAAIGTMSE
                     WSSGTRSARSGGPLLTLAQWDTVLKMTGFSGIDTASTEIKASQRADIIVSQAVDYRIS
                     WLRDPLSFEQMPPGVRIGTLAIIGGTTWPVHKLVQDILKLVAGRFRDTLAFDTIEEYA
                     VSELARSVAGPGGVSILSLTDLDRPYLEEMTGEKFEALKACTSARTLLWVTCGSLEDR
                     PYSYMMTGITRTIKSENPAMHVQMYDLDPNLASCIQPTTAVDLANSLLQQITLHSWGN
                     DASLLWTAEPEVYIRDGRQLIPRLVPDHEKNDRYNSQYKSLLTTVDPSNARLELAAGD
                     GGMLELRQLSPLQLLPGPSTECRTLRVTHSVLQAVFVGSAGFLRVCIGIDMSAGETVL
                     ALSTCETSPTRVPATWCIPFATPPTPVALVDVAANLIATRIFSFTCWNGALMIYGSDA
                     ALQRAIQSRASDNNVHVVFTTTNACQKHMQSPLSVRGKPTVPNNTTLFVNFVEGVIPE
                     VVECLPPACLRLDKAALVSHTAEKEVDAAEIAHVSDLLQQAVSSIPSTSLSMECIPLS
                     EASSCDPLQKPLSVVDWNATAAVSARVQPIDTGTLFRADRTYLFVGMASELGQSLAGW
                     MIAHGARHIVLSSRTPKLQPKFVEEMHDKYSANVTAIALDITSRTSLYSVHAMMQATL
                     PPIAGILNGAMVLQDALFTSMTHEQFDAATMPKVQGTVLLDELFYSDTSLDFFIVASS
                     ISSVIGWSGQANYSAANQFMTALVTQRRNRGVAGSTMNIPAILGIGHAARSGTFDFAY
                     FQSLGHVNIGEEDLHTLFAEAILSGRPCPLRASYGTTQVVMGIDYITAAANLNSPLTH
                     RRDVKFAHFITPDTQAGRAHLANEAHPTKQLRVQLQSHIPREPTTTYTVVCNSFVKHL
                     KRVLRLPPDHLIDESIPLNEQGVDSLVAMDIRAWFLSELEVDSPTLLIMGGGAVSDLV
                     WMAVERVHGDDREECASGDQTGFSNKLSTPSPRSPSSLERGSEK"
     exon            726483..727263
                     /number=1
     exon            727319..727941
                     /number=2
     exon            728007..734003
                     /number=3
     CDS             join(749752..749783,751121..751210,751265..751554,
                     751616..751686)
                     /codon_start=1
                     /locus_tag="AO090001000294"
                     /note="predicted protein"
                     /old_locus_tag="AO070218000001"
                     /protein_id="BAE56831.1"
                     /transl_table=1
                     /translation="MGRDTIPDDLRNHSASSLEWDASLEASAQTLAARCVYQHDTTIN
                     GGGYGQNIGYGVSSEKIGEMITNLMYNNEMGYFEALYGEANPSMDNFDAWGHFSQIVW
                     KGTTHVGCATVTCNSLGNVDSSVAVPFTVCNYSPAGNYAGEYADNVLRPLGQAMYVVS
                     "
     exon            749752..749783
                     /number=1
     exon            751121..751210
                     /number=2
     exon            751265..751554
                     /number=3
     exon            751616..751686
                     /number=4
     CDS             join(753677..754004,754076..754105,754161..756092,
                     756142..756269)
                     /codon_start=1
                     /locus_tag="AO090001000295"
                     /note="carnitine O-acyltransferase CPT2/YAT1"
                     /old_locus_tag="AO070218000002"
                     /protein_id="BAE56832.1"
                     /transl_table=1
                     /translation="MATPRSQPTMETKIKPTSVDGVNGQGVASEQPKKKGSTFANQDS
                     LPKLPIPDLESTCKKYIEALSALQTPREQEETKASVQDFLKSDGPILQEKLKNYASSK
                     TSYIEQFWYDSYLNYDSPVVLNLNPFFLLEDDPTPARNHQVTRAASLVVSALSFVRAV
                     RREELEPDTVRGTPLCMYQYSRLFGTARLPTENGCVISQDPHAKHIVVMCRGQFYWFD
                     VLDENNDLIMTEKDIALNLQVIIGDAEQTPIQDAAKGALGVLSTENRKVWSGLRDILT
                     KDEGSNNAECLNIVDTALFVLCLDYTEPSNTSDLCANMLCGTSEVVKGVQVGTCTNRW
                     YDKLQIIVCQNGSAGINFEHTGVDGHTVLRFASDVYTDTILRFAKTINGQAPTLWASN
                     SPDPAKRDPRSFGNVSTTPRKLEWDMLPELSIALRFAESHLADLLKQHEFRVLEFEGF
                     GKNFITSMGFSPDAFVQMAFQAAYYGLYGRLENTYEPAMTKFFLHGRTEAIRTVTNEC
                     ANFVQTFWGENPAEQKVEALKKATEKHTATTKECSKGQGQDRHLYALYCLWQRSFEEG
                     SSSSGNSVVSSSNGYSSPVENGSTIDSPKSPLSDDGVSSTTSYGLRAIRPAPPTPALF
                     SDPGWDKINNTILSTSNCGNPCLRHFGFGPTSADGFGIGYIIKDDSISFCASSKHRQT
                     ARFLYTLESYLFEIRKLLRATNRTTASPRTSRAREMEIIAERLQGDHRRGRLVRGDPG
                     AVRRGADTPTTDSGEIEDDGMGGYGFFDAGMLLHALKGLNTDRERNGEKPERRRFVGK
                     KLRLNEY"
     exon            753677..754004
                     /number=1
     exon            754076..754105
                     /number=2
     exon            754161..756092
                     /number=3
     exon            756142..756269
                     /number=4
     CDS             join(759207..759458,759521..759618,759678..759865,
                     760019..760597,760651..761708)
                     /codon_start=1
                     /locus_tag="AO090001000296"
                     /note="DNA damage-responsive repressor GIS1/RPH1, jumonji
                     superfamily"
                     /old_locus_tag="AO070218000003"
                     /protein_id="BAE56833.1"
                     /transl_table=1
                     /translation="MATALDQPLFESVAGPATAAASITPPHSANGKKEVPDGVPSELS
                     DLELDPNAVGVPEAASVEEEEEDIEPDHYYGGGKIPVFKPTMDQFRDFQSFINKVEKY
                     GMRSGILKVIPPKEWTDSLPALDEAVKKIRVKNPIMQEFHGSHGTYTQANIERQRSYN
                     LPQWKGLCEESSHQPPARRDTIDKIKPEGPPTPVSPESNPVEAKTEELSDGESLPAPK
                     PKGRQPKSVTSRRKHNKGDAIDYVDEEAFKDFDYRIHDNEEYTQERCEELETAYWKSL
                     MFNNPLYGADMPGSLFDENITTSWNVARLPNLLDVLGQKVPGVNTAYLYLGMWKATFA
                     WHLEDVDLYSINYIHFGAPKQWYSISQEDAPKFEQAMKSIWPSDAKNCDQFLRHKTYL
                     VSPSLLKSQYGITVNRLVHYEGEFVITYPYGYHSGYNLGYNCAESVNFATEKWLDYGR
                     VAKKCHCESDSVWIDVDEIERKLRGEATPEYYPEFESDLDEFEGASDLLTPPRSVPEK
                     SNRGRKRKHDGDTTKAKRMRVNVHVPRKIPCVLCPNDLDYEDLLPTEDGKNHAHRRCA
                     LYTEETSILRDETGKEVVCDIDKIPKARMGLKCLFCREVRGACFQCNFGKCTRSYHAT
                     CALLAGVQVEQGEIAVIADDGIHYSIPSVDLKCKYHRQKKPSWMTGGDSPDFDRKLIE
                     SAQRMVAGDLVQFQADKEINGAVVLENRPAERTLLVKVLPRG"
     exon            759207..759458
                     /number=1
     exon            759521..759618
                     /number=2
     exon            759678..759865
                     /number=3
     exon            760019..760597
                     /number=4
     exon            760651..761708
                     /number=5
     CDS             761793..763682
                     /codon_start=1
                     /locus_tag="AO090001000297"
                     /note="predicted protein"
                     /old_locus_tag="AO070218000004"
                     /protein_id="BAE56834.1"
                     /transl_table=1
                     /translation="MTLTPVPRFRDVIELPYRWMLVVRRSNFSPLAPGTKPLPAHLAR
                     KPEARKELESALPVVGNPFGDGRSPYQWAEFETVDTTNHRFAPPPVQVKLDKGDQIWY
                     YLGQSSTECRAQYTHNPSVPVHNPRSNFLDSVKSLGAVMARIPSYPHRHLPQYATAPP
                     HHLSPAAAAAATAAAAASRPSLLQRPTLAPPPRTPSSAAPPASTAMPSAYRSLPTQSA
                     RHAPYPQIAKTHQSHHLSQQQHSPQQSQQQQQQQHSHHLPANTFANVRELIARRRLAQ
                     ITDHANVFAGYTIVSPELVVETLLGPMGSVPPPTGLEKLELAMAQQRVQPRAADGTLL
                     PLQPLNMRSEEVTRLLQMLRFSLVSHRDRLDVLQKKETENNKQESAHKGSVAAVKLPR
                     KFAYLEQQQEQSPTVYQSPYNMPSGFSEYAQKTFGLTPSEPELPKPSLANDYFASLSP
                     EDQEKILKTCGSFVQRAIERSASHSRQSSASNLRLASALAQQTENPTIDITTVEDMPL
                     SGLDFPLHADSPCSSFSRPHLRFQSPNDYNAHGPETHHDHHDLFGDQQANTRFWQHGP
                     WAAGDGNTPNEETRPFFGPHERLKHDYASSDISLGRGPGSLHSVDMAGFGMDATDDLC
                     NVLSP"
     exon            761793..763682
                     /number=1
     CDS             join(765735..765838,765908..766468,766531..767437)
                     /codon_start=1
                     /locus_tag="AO090001000298"
                     /note="amino acid transporters"
                     /old_locus_tag="AO070218000005"
                     /protein_id="BAE56835.1"
                     /transl_table=1
                     /translation="MRQNSTDANADAALARMGYKSELPRNLSMLSILGLSFAIMAAPF
                     GLSTTLYITLTDGQCVSIIWGWVLVTLISIGIAASLAEICAVYPTAGGVYYWSAMLST
                     KEWAPMMSFVDGWLTLVGNWTVTLSITFSGGQLILSAISLWNEDFVANAWQTILMFWA
                     VIWFCAMVNIFFSRWLDIINKVCIFWTAASVVIILITLLSMADHRNDGAYVFGHYDAS
                     QSGWPTGWAFFVGLLQAAYTLTGYGMVAAMCEEVQNPHREVPKAIVLSVVAAGITGVV
                     YLVPILFVLPDVKTLLNVASGQPIGLIFKTVTGSAGGGFGLLFLILGILMFAGIGALT
                     AASRCTYAFARDGAIPGFRMWRKVNDRLDVPVYAILLSTVIDCLLGLIYFGSTAAFNS
                     FTGVATICLSTSYGVPILINVIRGRQAVKESTFSLGRFGYAINIITICWIVLSVVLFC
                     MPVSLPVDASSMNYASVVFAGFAAISITWYVGYARKHFTGPPVTGDDVADVIPGKAVD
                     AENAYPDEAAMGEKK"
     exon            765735..765838
                     /number=1
     exon            765908..766468
                     /number=2
     exon            766531..767437
                     /number=3
     CDS             join(768289..768304,768387..768500,768560..768632,
                     768700..769594)
                     /codon_start=1
                     /locus_tag="AO090001000299"
                     /note="predicted protein"
                     /old_locus_tag="AO070218000006"
                     /protein_id="BAE56836.1"
                     /transl_table=1
                     /translation="MSDSVDRVFVHALNTVKRIPRTGTARPPASERLKLYGLYKQSME
                     GDVEGVMDRPVGNTADVYAECEKWDAWFAQRGLSRTEAKRRYISTLIETMHRYASQTP
                     EARELVSELEFVWDQVKMNTSVSSASSGSPVQAVAPPLSHSQPSYASIGGRLARSDYE
                     HLVATARGDSRLRVLSPVSQPEEVFQRRRGSLGNRGQDEDEEEEEEYAEAQDNLDEDD
                     DAHDNDDGSYNHATTEDGSQHDVDEAVLRSGRGKKPPDVDSRRWRRRVEQALTKMTAE
                     IAAVREQMEARAVAHHRRNSVWAWLKWLVWVTLRQVIFDLAILGMLLIWMRIRGDRRL
                     EGKLKVGWAEVKTRLSKLKGLRRVSKVHKCP"
     exon            768289..768304
                     /number=1
     exon            768387..768500
                     /number=2
     exon            768560..768632
                     /number=3
     exon            768700..769594
                     /number=4
     CDS             complement(join(769929..770027,770091..770223,
                     770301..770528,770627..770646))
                     /codon_start=1
                     /locus_tag="AO090001000300"
                     /note="predicted protein"
                     /old_locus_tag="AO070218000007"
                     /protein_id="BAE56837.1"
                     /transl_table=1
                     /translation="MAAREPQFNQQVLVDTTPMPADIPSVQEVGATSAPLTSAAYFIG
                     DRCKAFNDDYMKCKQEANGRGEFDCLKEGRKVTRCAASVIKDINTHCLKQFTAHWECL
                     ENNNHHLWECRKPEMELNKCVFDKLGLKKTIPGAPEGQTPVHLRPKQIYAQFPGPQY"
     exon            complement(769929..770027)
                     /number=1
     exon            complement(770091..770223)
                     /number=2
     exon            complement(770301..770528)
                     /number=3
     exon            complement(770627..770646)
                     /number=4
     CDS             join(771237..771708,771876..771945,771978..772656,
                     772712..772819)
                     /codon_start=1
                     /locus_tag="AO090001000301"
                     /note="nuclear pore complex, p54 component (sc Nup57)"
                     /old_locus_tag="AO070218000008"
                     /protein_id="BAE56838.1"
                     /transl_table=1
                     /translation="MSLFGNQTQTQQSGGLFGSSTTANKPSPFGGAATGGSLFGSNTT
                     GTGTQQSSGGLFGQTQNQGATGAAPASGGLFGSSTATSQPQQSGGLFGNTTTQNQPQT
                     GGLFGNTATQQKPAGGLFGGLGQSTQQQQPQQQQTGGGLFGGALGQQKPQGSLFGASI
                     GPVGATAGVEPLVAWSRRHWRCIALTLVVHRTVPTQIAIVKDKWDTASRNSPFRAYLY
                     NHVGEEAAPFYQPGPDDDESKWEEALRKRPAPGYVPVIVRGFFELGKRAQRQKDFLTM
                     MQTRLHEINNCLTELLSRHDLKISVRIADCRRKHLVLSKRCLALAAKTQVLRNRGYAM
                     DDAEEELKKKLALLERSVFDPSLNGREEEIWARMLAIREHSKRLQLEMEKAGPGAAAQ
                     ADDELDEQTMKTAKKILDDYHTQIKHLQKELESVRKDFDEAEKLQGRVDH"
     exon            771237..771708
                     /number=1
     exon            771876..771945
                     /number=2
     exon            771978..772656
                     /number=3
     exon            772712..772819
                     /number=4
     CDS             join(773986..774445,774521..774603,774666..775144,
                     775199..775454)
                     /codon_start=1
                     /locus_tag="AO090001000303"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070218000010"
                     /protein_id="BAE56839.1"
                     /transl_table=1
                     /translation="MSASPEIKPVEEDPVQAPTPGAGDDEAQGVEETAAADLDAADEK
                     DNGSDDESILSEVDEAQFEDFDPENVDVEDRPQLAIDEDNLKLIGRHKRKRTEDGERS
                     TRKREGRREKKSRRMRELEEGGDDGDGKAKKRERKRREPTPEDDETLDPATRRRRALD
                     RAMDEALKKPTKRRFRKADGIDLEQMADAEIEDMRKRMTHAAQMDAISRREGKPAMHK
                     LKMLPEVVSLLNRNQYVNSLVDPEINLLEAVKFFLEPLDDGSLPAYNIQRDLMTSLAK
                     LPINKEALVASGIGKVIVFYTRSKRPEAGIKRMAERLLAEWTRPILQRSDDYSKRVYQ
                     EAEFDPRLSRKVQRTTQSAQATAAEARARELLPPRLANRARAEITHTSYTVVPRPTMV
                     QESKFARPLGASGEDRFRKMRARQIAASKGSRR"
     exon            773986..774445
                     /number=1
     exon            774521..774603
                     /number=2
     exon            774666..775144
                     /number=3
     exon            775199..775454
                     /number=4
     CDS             join(776107..776147,776265..777009)
                     /codon_start=1
                     /locus_tag="AO090001000304"
                     /note="predicted protein"
                     /old_locus_tag="AO070218000011"
                     /protein_id="BAE56840.1"
                     /transl_table=1
                     /translation="MKLLTKEEEDAHYRAVLKGGTIGTVLGLIGGYAGVLAASRRYHT
                     IRNLTLPMKAFLVTSSGTFVGIIAADNSSRNFEVERNADQQWYQNREQRLREESLQGM
                     SFMERSLAWARKEKYTIVTATWVASMIGSFVLVGRNPYLSGQQKIVQARVYAQGLTLA
                     VLVASAAFEISDQRKGKGILKKKLEEKEAADGKSGVVVEEEPVRHQQNEGQGDLWKDM
                     VAAEEERLKKKHQSVWEHPELHKEGQQQQQQQAKEVKEEKTQQ"
     exon            776107..776147
                     /number=1
     exon            776265..777009
                     /number=2
     CDS             complement(join(777269..777318,777488..777715,
                     777786..778217,778269..778402,778501..778820,
                     778880..779124,779182..779295,779344..779587))
                     /codon_start=1
                     /locus_tag="AO090001000305"
                     /note="H+/oligopeptide symporter"
                     /old_locus_tag="AO070218000012"
                     /protein_id="BAE56841.1"
                     /transl_table=1
                     /translation="MSDTISRGKSNALETLKAPLSEQETIVLSAAPSPHDDGYATPTG
                     EELESLRRVAGSVKWTAYTIAFVELCERFSYYGTTAVFVNFIQQPLPPNSSTGAGHAG
                     QSGALGMGQRVSTGLTTLNVFWCYVTPIIGAWVADEFWGRLKTIQVAIAFAMVGHIVL
                     IIASLPQVIVHPNGALGCFIVGLVLFGIGVGGFKYRLTFLIHKETRHYIKRLPKTGER
                     VIVDPAQTITRIFLYFYFMINVGSLLGQIVMVYAEKYVGFWLSFVLPTIMFALCPLVL
                     YVCRKNYEVTPPTGSVVGRAFKLWAFALKGRCDFWENVKPSNVQRKPVWMTFDDKWVD
                     EVRRALKACAVFLWYPLYWLAYGQMTNNLTSQAATMELHGVPNDIIMNLNPVTLIIFI
                     PIMDQVVYPGIQRLGVQFTPLKRMYAGYMLAAISMVSAAVIQHYIYQTGKCGKYPGEK
                     SCKTPAPINVWVQAVPYVLIAFSEIFTSITGYEYAFTKAPKNMKSLVQSIYLFMHAFS
                     SAIQQGLTLLSTDPLLVWNYGFVAVLSFIGGNLFWITHHKLDKEEDELNSLEASSYLG
                     RGPRAQNKRIIDIPGAHIVNKT"
     exon            complement(777269..777318)
                     /number=1
     exon            complement(777488..777715)
                     /number=2
     exon            complement(777786..778217)
                     /number=3
     exon            complement(778269..778402)
                     /number=4
     exon            complement(778501..778820)
                     /number=5
     exon            complement(778880..779124)
                     /number=6
     exon            complement(779182..779295)
                     /number=7
     exon            complement(779344..779587)
                     /number=8
     CDS             complement(join(781747..781800,781854..782516))
                     /codon_start=1
                     /locus_tag="AO090001000307"
                     /note="predicted protein"
                     /old_locus_tag="AO070218000014"
                     /protein_id="BAE56842.1"
                     /transl_table=1
                     /translation="MSTTYVLPPLQAPLATGCSPRIRRVLKAPQRPIALRREYMTEAK
                     SLLTFRPQGDPKSAIGYSIQDDDGIVLFTASGRKFNDRPCREFRDSSGLPLFEIYRKS
                     FRNSWSISLPGSSSAKIATVSPRRTSGISGWGDFTITFDNVAAFESKRKEDKELSLEV
                     QSRGNVLALYDIVDGDRKVAEVRESIQHNEKLALMKRFPSSKHGYRPVLDIIITAHVD
                     QSLIAAVAVIISDTVFSANV"
     exon            complement(781747..781800)
                     /number=1
     exon            complement(781854..782516)
                     /number=2
     CDS             join(783730..784272,784360..785160)
                     /codon_start=1
                     /locus_tag="AO090001000308"
                     /note="predicted protein"
                     /old_locus_tag="AO070218000015"
                     /protein_id="BAE56843.1"
                     /transl_table=1
                     /translation="MKIWRQRASRPVRVLLYLLALVLLLWIVLPYDHPIRLSARFNVT
                     AFGTALTSYLGGRWWFSERSTFPIVLSDDVAVLMKSGFGTKDRIAAWLEAHEHDKFNN
                     LLLVGDFATPSGQLFNYNGRRLPVSDLVAWMLEKGYLSAELAHPRLMKHSNLSTAISN
                     GDVDIAKELSKSFGWELDALKFISGLELCYDQMPDKKWYIMADDDTYLMQPALKLLLE
                     HLDPEVPLYVGNAVGDYKGRFAHGGSSVILSQATMRLLFSHREVVTSAHLESLEETWG
                     DKLLATTLLKLGIYLDERYAIFFNGGPPRAIRVTEDRLCAPIISFHSLTPSEMINVGR
                     RFQHTDEVLLWIDLWDIYGAPSLDSPVLESGRKDWDHVGGLDESTMTVNEVSTSQRCI
                     QICQNYSKSCLAWTWESEKQLCHISNWMVPGEQAEGKTSGINVPRAKNLVSMCRS"
     exon            783730..784272
                     /number=1
     exon            784360..785160
                     /number=2
     CDS             join(787237..787320,787386..787647,787766..788442)
                     /codon_start=1
                     /locus_tag="AO090001000310"
                     /note="predicted protein"
                     /old_locus_tag="AO070218000017"
                     /protein_id="BAE56844.1"
                     /transl_table=1
                     /translation="MSQHVLLLGATGQTGNSILNGLLEHGEYEVAALVRPSSAGTPKV
                     KAVAERDVKIIAADITGPVDDLASILRDFDVVISAIDALSMHAQENLVTAAKQAGVKR
                     FVPCAFITVCPPGGKSLTAIPQKEAIYQHIRKLHLPYTIIDVGFWHQVSFPTVPSGRV
                     DYASMYAPNTTIHAGGNAPNLLTDLRDIGPFVARIIADPRTLNRSVYTWSDVLTQNEI
                     FDMMEEMSGEKIERTYMSAETIETAIATFKETLEKEPENIPARLALTMFQYFLSKAIR
                     GDNRPEYAKYLGYLDARELYPDFEPRSFRSYLKEVLDGKAEKVYKDNEGIEQLKKWFF
                     ESGLPL"
     exon            787237..787320
                     /number=1
     exon            787386..787647
                     /number=2
     exon            787766..788442
                     /number=3
     CDS             complement(join(790972..791176,792831..793138,
                     793190..793780,793829..794109,794156..794335,
                     794390..794672))
                     /codon_start=1
                     /locus_tag="AO090001000311"
                     /note="sulfatases"
                     /old_locus_tag="AO070218000018"
                     /protein_id="BAE56845.1"
                     /transl_table=1
                     /translation="MVLKYIFWLWMAATAVVAKEEADKPNFIVILTDDQDQQLDSMKY
                     MPKVKKLLTDEGVYFNHHYATVALCCPARASLWTGKAAHNTNVTNLRPPYGGYPKFVE
                     EGWISKWLPVYMQKSGYKTYFTGKLMNNHNANNYMNGLKEMGLDGHDFMIEPGTYQYT
                     NTTIQHNFEKPRSYPGVYATDLLANKSMAWMDDAAKEKKPFFLAINPVNPHNNYQWGK
                     GWTKPVPAKRHEGTFPDAKVPRSVSFNPDRPSGAAWVHELPQLSDAVIKDNDLYYRRR
                     LQALQAVDDLVETTIDTLKRHKMLDNTYIIYTSDNGFHISQHRLMPGKRCPYEEDVNV
                     PMIIRGPGIPKGKTADIVTSHLDIAPTIVEWAGGKGPGDFDGSVIPKEGTTTPDEPWE
                     HVEVEHWGAVSDKRDIPLSGKVNTYKAIRVIGDTYNLFYSVWCEGDHEVYDMSADPHQ
                     MNNLYNSTEKILGVSMKKLEHRLDALTLVLKTCKAKTCQSPWEALHPDGKVKTLVDAL
                     DSKYDEFYNKQNRVKFNECSRGYIVSNEYPIKYHIYGNHSPEAPFPGLNYKDLVKKVL
                     SFKVLRWTTPSQGYSSGYRHSCSDSSFKELFEMLLSDTIQGLDLHDLIP"
     exon            complement(790972..791176)
                     /number=1
     exon            complement(792831..793138)
                     /number=2
     exon            complement(793190..793780)
                     /number=3
     exon            complement(793829..794109)
                     /number=4
     exon            complement(794156..794335)
                     /number=5
     exon            complement(794390..794672)
                     /number=6
     CDS             complement(join(795390..795492,795666..796095,
                     796157..796317,796374..796624))
                     /codon_start=1
                     /locus_tag="AO090001000312"
                     /note="predicted phospholipase"
                     /old_locus_tag="AO070218000019"
                     /protein_id="BAE56846.1"
                     /transl_table=1
                     /translation="MASGTVDAAIAELLSTFNELNSHVVEELSEEPSPLEFMRFVARN
                     TPFVVRGGASSWKACQEWNSAYLLKALKDQTVNVAVTPYGNADAPTRHPDHESPVFAK
                     PHYEDQPFDTFLEYVVRHETDPNFPQDAEVRYAQTQNDNLRDEYMSLYSDVQKDIPFA
                     RIALDKAPDAVNLWIGNSKSVTAMHKDNYENIYVQVLGRKHFVLFPALCYPFVNEKPL
                     QPATYVRTEDGLVLQMDENDEPVPFPIWDPDRPSENTTPFSQYAQPLRVTLNPGDMLY
                     LPAMWYDMEFSGPLFPTSAFIRDISLANTSQATQRSDV"
     exon            complement(795390..795492)
                     /number=1
     exon            complement(795666..796095)
                     /number=2
     exon            complement(796157..796317)
                     /number=3
     exon            complement(796374..796624)
                     /number=4
     CDS             join(800152..800405,800459..801283,801313..803968)
                     /codon_start=1
                     /locus_tag="AO090001000313"
                     /note="multidrug resistance-associated
                     protein/mitoxantrone resistance protein, ABC superfamily"
                     /old_locus_tag="AO070285000098"
                     /protein_id="BAE56847.1"
                     /transl_table=1
                     /translation="MDYTKLKGDKFGLLKVLVRTLWVQLLLPIPPRAALIAFYICQPL
                     FIESLVTYLSHSEPDPNVGYGLIGAAILIYSGIGISYALYWYCHHRLRTMVRSILVTE
                     TFKAATRARLGSGDDSAALTLMSTDMERIKMGLRCVHETWASMIQAGLAAWMLYRQLG
                     AVFIAPVGVVVVSFVGLGILINFTGDSQRSWMSGVQKRVGLTATVIASMKSLKISGLA
                     GPVAEYVQQLRVDELAAGARYRRIMIIAAIFAFLPQLISPPLTFAFAQSTLNASTMFT
                     SLSFLTLLTQPLSQLFQSIPDFVSGLACLSRIQAFLELEPRQDYRQSLAETQSCGMEK
                     SSKQLDLKHTDCIFIQDANFGWKADNPRLVPDDGHRSCRLGKSTFCKALLGEIPFSQG
                     SVMTSTSPRHVGFCEQTAFLWNGTIRENIVGFTPFDRKRYDQVIEATSLRFDLATLSQ
                     GDQTNIGSDGVALSGGQKQRLSLARALYLPTDLLILDDVLSGLDADTEEQVFRQVFGP
                     NGLLRRRGSTVVLCTHSVRHLPTADYIIALENGSIAEQGAFVDLSTRAGYVHRLEVRL
                     KQEGEDTTADNEPGACYEHKGQTGARKNLEPAITVNSTQGPTPIAPAVAAARQVGDTT
                     VYRLYLKSMGWFVAACGLFFAALWGLLTNYPTIWLTYWSDATESVHPAHSNSYYAGIY
                     ALLQICAIIALLLLGITLFIVSVKKAGANLHQQALRTLIRATLSFFTNTDTGVVTNLF
                     SQDLNLIDTELPEATLNTLFCASQSIGQAAVMLTSSVYLGISYPILGALLYFVQKFYL
                     RTSRQLRLLDLEAKSPLYTHFLDTLKGIATLRAFGFIPDDIHKNARLVDSSQRAAYLL
                     LMIQEWLNLVLNLVVMVIAAVLTTLAIRLHSNSAFAGASLYSLMTFGESLSGIVIYYT
                     RLETSIGAIARLKTFNETVTSEDRDGPGEEDTVPGTNWPDRGLVELRSVSARYKSTTV
                     SESESLSVVSGATNEPPLALKNITLTIHPGEKVAICGRTGSGKSSFLALLLKLLDPLP
                     STVNNHNQEPPVLIDNIPLHRIHRATLRQRLIAVPQDPVFLPDGSSFRANLDPTNTAT
                     PAECQRVLEAVRLWGFVQERAEGLHAPVTAGTLSAGQRQLFSLGRAVLRAMIRQRSTS
                     PSPEEEGYDKQDQGGILLLDEVSSSVDRETERMMQEIIRAEFRHYTIIAVSHRLEMII
                     DFDRVVVMDRGEVVEVGNPAALKERGAGSRFGELVAAAGA"
     exon            800152..800405
                     /number=1
     exon            800459..801283
                     /number=2
     exon            801313..803968
                     /number=3
     CDS             804586..805416
                     /codon_start=1
                     /locus_tag="AO090001000314"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000097"
                     /protein_id="BAE56848.1"
                     /transl_table=1
                     /translation="MATAVFTLFPNLPPELRNQIWRDTLPDKVRQALYFYKRGCWRTR
                     RLTEDDEDYSHDNDQLNICHEFRHDLLDPMKFEVPLLFVNSEARGVALTWMQGQGLKI
                     RFCEDRQNPIVIRSFDPDHDTLYISLKTWDDFSNEPYDIVFPPDHGSGYYNCAPPAFT
                     RIAVPEAFFQHDIPLSDLFHFYCSLEKVFIIPDAQSDIQSEMNDLKMQRRWELQSTQG
                     PMLFWNNDRDCFEWKHNAGDSNNAMNSVIEKACDGLDEALEFYEMKSFEVRAVYAVRK
                     "
     exon            804586..805416
                     /number=1
     CDS             complement(join(805596..805600,805612..805930))
                     /codon_start=1
                     /locus_tag="AO090001000315"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000096"
                     /protein_id="BAE56849.1"
                     /transl_table=1
                     /translation="MVTWMKEQDNIDVHFGFDVNMGYFLIVYDMRLAAYIPDGTEFDD
                     VRYAVSADGTGAYFTAYTGTHRQGRRVSVETMRKLWRAYGVYEEAMRGLAMTDLENIH
                     GIEDR"
     exon            complement(805596..805600)
                     /number=1
     exon            complement(805612..805930)
                     /number=2
     CDS             807512..808267
                     /codon_start=1
                     /locus_tag="AO090001000317"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000094"
                     /protein_id="BAE56850.1"
                     /transl_table=1
                     /translation="MATPTHALSVNIYGRGDATLGDGPSHMGIAVYKIGSPTCSMHHI
                     RNPSDTDFIYDPRTQPLEDDPVLRGRCELTTFTSVEQKNQAESLLTNFGCDDTSIPEF
                     GVGNCQDWVAGAIQMLENAGFVPPGEGQFWEEMINLSAAAMQDRCERTGRAWILGPEH
                     VLEGEADARFVDKGELKPVGRLMENSALRERMLALVGNLPVSDSMGVNEGLAGERPFY
                     VSSPFFSRAREVPGSEGASFPAGTVEGRTPSAS"
     exon            807512..808267
                     /number=1
     CDS             join(808817..808955,809157..809300,809443..809573)
                     /codon_start=1
                     /locus_tag="AO090001000318"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000093"
                     /protein_id="BAE56851.1"
                     /transl_table=1
                     /translation="MDPSTSLSFLPLSITIHYLPKHPTSRLRLPNVPVSDQFWLRRTC
                     HRVFGEDENATFPTLTLSLIEDSYQECLKRLSTSDDSILAVDLDDIVLWDSYWNTWRS
                     LSYDLSVPKQITDMFSRSYIHGMAADLAENKSNDA"
     exon            808817..808955
                     /number=1
     exon            809157..809300
                     /number=2
     exon            809443..809573
                     /number=3
     CDS             join(810352..810533,810602..810718,810790..811348,
                     812472..812507)
                     /codon_start=1
                     /locus_tag="AO090001000319"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070285000092"
                     /protein_id="BAE56852.1"
                     /transl_table=1
                     /translation="MDLSDVEGQMKDISSHEIEHVNNEAASFTEEEEKALVRKVDLTL
                     LPTIWVMYLLSYLDRTNIGNAKISGMEVDLELTSNQYSIALVVFFIGYVVFEVPSNLV
                     LGRSRPSVFLPSIMIIWGALTCVMAVVKSFTHLVVLRVILGCVEAGFAPGVLLVLSSW
                     YKQTEQSKRFGVFISAAVLSGAFGGLIAAGIVDGLEGVHGIRGWRWLFIIEGAATVGF
                     AIISLFILPDFPATSRHFSEREKQVAVARLATENVTATTEDTEHLSPLEACKVACQNW
                     RTWAFIIGYMEVYPLFADRPT"
     exon            810352..810533
                     /number=1
     exon            810602..810718
                     /number=2
     exon            810790..811348
                     /number=3
     exon            812472..812507
                     /number=4
     CDS             complement(join(812760..813640,814747..814900))
                     /codon_start=1
                     /locus_tag="AO090001000320"
                     /note="dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /old_locus_tag="AO070285000091"
                     /protein_id="BAE56853.1"
                     /transl_table=1
                     /translation="MFLRSSPFSVRLRESSDSDSGKPPSPSVESFAKHSNHIEGATRA
                     VTELSVSEMLDTTTSSGNSSSAVAPAQTTSDTSPTFLNTQPGPDHDWRITLKDKVIAI
                     TGANRGIGLALAEVCLANEAAAVFSLDVFEPGEEFAALQKANPKRLSYVHCDVTSEES
                     VNTAIDAVIIARGAIHGFIANAGMTKHQPAFDFTRAQLDQLFNLNVFGAYFCATAVAR
                     RFIELGIKGSIVFTASMTSYRPNRAAPSAPYGATKGAVRNMTHTLAMEWAKHGIRVNS
                     ISPGFIKTAMTYFVDQAPDWDLKMQYYGGMPRLADPKELGGAYVYLLSDGASYTTGID
                     IPIAGIVGAW"
     exon            complement(812760..813640)
                     /number=1
     exon            complement(814747..814900)
                     /number=2
     CDS             join(817272..817393,817462..819176,819322..819368)
                     /codon_start=1
                     /locus_tag="AO090001000321"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000090"
                     /protein_id="BAE56854.1"
                     /transl_table=1
                     /translation="MDNPNAVPRKLTTDGITTGPGTKRRRIRPSRARGLRTRTGCLTC
                     RERRVKCDDGKPTCVRCSKSDRICRYAQVADERHATGAGAGADYESPKVQSDSREARS
                     QEALPSVGSAAYYRQVTYSGPTEHPDGSIETPQNDRLNEAGDQRLSSLDPCFSASPLS
                     LSQISLLNISPFEWYDLLARDAISNIHRLNDASTGDSRWKFPEIALSRRQSPAPECPE
                     THVEQSNRHSEQQQQQIEPPLLNYQQVFEPWNTTSRIELSETDVKFFRYYIEVVGPIL
                     DLFDPARHFSNVVPHLALRNTGLLKSILAVGAKHMSLGHMHMPGEDVPGDHATPNVNS
                     PTSLAAATGLPSEPDPAPAHMATQFYYETLQYLSQTLLYPSYADSHEILATATMISTY
                     EMFDADSATTSGDWEKHLRGSFWIQRSQDNDGESVDGLRQAVWWAWLRQDIWAAFRAG
                     RPTLTFWRARKGLEELDSDELATRIVYICGKCVAYAASNETSNHDPRHSIEQGDRLLY
                     ALDDWYRALPASYQPVTVATDTASNTTVFPPIWIHPPSHAGAMQMYNFARATVLLNQP
                     TMGGLNAYCLRDKQLSECVKMVCGIAKACQDHESAMAFVNVQALFGGGLLLNSKRCGR
                     NEL"
     exon            817272..817393
                     /number=1
     exon            817462..819176
                     /number=2
     exon            819322..819368
                     /number=3
     CDS             join(820690..820880,820946..821055,821115..821597,
                     821653..822170,822236..823147)
                     /codon_start=1
                     /locus_tag="AO090001000322"
                     /note="transketolase"
                     /old_locus_tag="AO070285000089"
                     /protein_id="BAE56855.1"
                     /transl_table=1
                     /translation="MAPTLELLEEPAGNLPVKAVSAIRNGNSADDLKLESPEKHQRVM
                     NVFRAFIADICQQYGEGHAGSPMGMAAIGIALWKYVMKYSPNNCNYFNRDRFVLSNGH
                     ACLWQYLFLHLVGVKSMTLEQLKSYHSTKLDSVCPGHPEIENEGIEVTTGPLGQGLAN
                     AVGLAMATKNLAATYNKPGHEVVNNMTWCMVGDACIQEGVGLEALSLAGHWRLNNLCV
                     IFDNNSVTCDGTADVANTEDINTKMRATGYNVVDVYNGDSDVAAIVNALVAARSSDKP
                     TFINIRTTIGFGSALAGTADVHGAALGVDEVANVKRSFGLNPDEHFHIPQDVYDFFSD
                     IPGRGEAHEASWQAALVKYHEEDPVLAAEFELRVMGKLPEDWSKCIPRKEEQPTASTA
                     SRKSAGVITNALGQNINSFLVGTADLTPSVNVAYKNKVDFQSPELRTACGLNGNYSGR
                     YIHYGIREHAMCAISNGLAAFNKGTFIPMTSTYFVFHLYAAAAVRMAALQGLQQIHIA
                     THDSIGVGENGPTHQPVAVAALYRAMPNVLYIRPCDAEEVAGAYIAAIQATETPTIIS
                     LSRQGLTQYPQYSSREGTLKGAYVFVEDNDFDVTLIGVGSEMGFAMQTRELLFKEHGI
                     KSRVVSFPCIRLFEQQSREYKHSVLKPRAGKPTVVIEAYPSYGWERYADASVSMNSFG
                     KSLPSKEIYEHYGFSPESIAPKVKDLVEEVRRDGIEILRGDFRDFNGGLRIGLEH"
     exon            820690..820880
                     /number=1
     exon            820946..821055
                     /number=2
     exon            821115..821597
                     /number=3
     exon            821653..822170
                     /number=4
     exon            822236..823147
                     /number=5
     CDS             join(824469..824624,824708..824898,824965..825031)
                     /codon_start=1
                     /locus_tag="AO090001000323"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000088"
                     /protein_id="BAE56856.1"
                     /transl_table=1
                     /translation="MSETNQRLIVITINGYRKPGLTEEELHHHLCEVHAPKASPFLEK
                     YGILEYNVIDNFSAARPHAEYLQMSKKLSDHDYIVQFVMKDVEDFKKVWEDPEFRKNV
                     MPDHETFADTTRSGVCIGYLNSFLNGKDSQGRLKN"
     exon            824469..824624
                     /number=1
     exon            824708..824898
                     /number=2
     exon            824965..825031
                     /number=3
     CDS             complement(join(826461..827312,827462..827596))
                     /codon_start=1
                     /locus_tag="AO090001000324"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000087"
                     /protein_id="BAE56857.1"
                     /transl_table=1
                     /translation="MGLPVSLRADTIRDLLLGVSSIMTWKTLALVLAVINLKNLPLVW
                     HPGDPHFPRGKALVTHTGKPTHPVFVPYAITSRTPILETDYNFHKSNSTYFSDLDISR
                     TALVTRLYTPGLRVVSKELDVELGEAARREGKKPPAHKNIYVALGSVFCSFKREIKPF
                     ELYEIETKVIAWDQKWMYVLSFFLRPAKAGGKRTLFATAVSKYVVKKGRLTVPPERVL
                     RASGFLPERPEGDVLVVPDSSVEGSGVGTPAGEGITATAGVDGALVREVLKVSESDIL
                     ETKLEEEKKANAESWSAGDWTWEMIEEERRRGLEVVEGYINMDVKLHDEWER"
     exon            complement(826461..827312)
                     /number=1
     exon            complement(827462..827596)
                     /number=2
     CDS             complement(join(827986..828758,828856..829066))
                     /codon_start=1
                     /locus_tag="AO090001000325"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000086"
                     /protein_id="BAE56858.1"
                     /transl_table=1
                     /translation="MTVGIDDLPEKYDDLPNKRQYWPAAAGSPEEGLGMLRILTPEIV
                     ADAARTQIQTGLRVCLNWDLEQLNPPGFGRKPFEHRIKWVAPGIAFDDEYHFNPQQSS
                     QWDGLRHHSAPAPTPEDQARRVFYGGTTAEEIQDSNSPRIGIGYWAKKGIAGRGVLID
                     YLSWAEKKGITVNGLSQHVVPLDDVLAIARECNIEFQRGDIFFLRVGLTKTWSSLSDA
                     QKQEYSQQTVPKHAGLEQSENVLRFMWDNHFAAVASDAVSFEVFPPLNPEFDLHHHML
                     AGWGLPIGEMFDLEELAETCKQLGRWTFFISSSPLNCANGVSSPPNCMAIF"
     exon            complement(827986..828758)
                     /number=1
     exon            complement(828856..829066)
                     /number=2
     CDS             complement(join(829457..829755,829821..831565,
                     831621..832055,832098..832147,832193..832297))
                     /codon_start=1
                     /locus_tag="AO090001000326"
                     /note="GTP-binding protein"
                     /old_locus_tag="AO070285000085"
                     /protein_id="BAE56859.1"
                     /transl_table=1
                     /translation="MATNGHFASIGNSASDTTAYEHGVQVIDENKEFKYLPMHTRVAP
                     RCASSRIIPNLSQYLSLENVTPSGFNYHLISVFGSQSTGKSTLLNHLFGTHFSVMSEL
                     ERRQTTKGIWMSKNKNESSSMASNILVMDVEGTDGRERGEDQDFERKSALFALATSEV
                     LIVNIWEHQVGLYQGANMGLLKTVFEVNLQLFLKDKNTTHRSLLFFVIRDYSGMTPLQ
                     NLQKTLMEDMARLWDSISKPGGLENSNVHDYFDFQFYGLPHKGYQPEKFVEETQKLSL
                     RFCDGQRDPNLDARKGEFSDGGVFLPEYHRRIPADGFSRYAEGIWDQIVNNKDLDLPT
                     QQELLAQFRCDEILREVMVAFDETIVPFEDKQSQAARLGEPEILGGLGAAMRSSRTKA
                     VKAFESEASRYHKGVYQRKRAELESKADTRLKTLFQGQLNAAHKSGISEFSEAVTAAV
                     KSGQKKGTGYDFAEIVNEEAKKAVDKFEEVARATVVDGTSWSDYKQELALYEKELAEV
                     SARLRRDEMRRLASRVERWVQSRLGESVGLEFNALGSGRAGGGAPEKGDQPTEKKFWD
                     RVWNVFVETVLDAERRFTDRASSFDASLEEVDVGLWRLRRKSWGVLRAKIDEEMIEGN
                     LLLKLRENFEDKFRYDDAGVPRIWRPTDDIEGIYTRARESTLTLIPLLSKFRLDETSA
                     PPPLDRWIGHTPSSATSADEEDLAPIGGVDEEEGKSLEEEMTIVSDAKRQELTVRFKK
                     AADGVYVEAKRSAIGGMTQVPLYFYGLLLALGWNEIIAVLRNPAYFFLLFVCAVGAYI
                     TYQLNLWGPIIKMTEAASNQAVTEGKKRLREFLESSDTGRQAIAMSTPGGSGRGGEEH
                     EMSRLNQQGKSAAADEDVDDL"
     exon            complement(829457..829755)
                     /number=1
     exon            complement(829821..831565)
                     /number=2
     exon            complement(831621..832055)
                     /number=3
     exon            complement(832098..832147)
                     /number=4
     exon            complement(832193..832297)
                     /number=5
     CDS             complement(join(833656..833843,833904..834583,
                     834647..834909,834979..835007,835118..835238))
                     /codon_start=1
                     /locus_tag="AO090001000327"
                     /note="mitochondrial translation elongation factor Tu"
                     /old_locus_tag="AO070285000084"
                     /protein_id="BAE56860.1"
                     /transl_table=1
                     /translation="MSSISRTANLLFRASRASLLRPRAVNPVQHVLGKDRLAARGTIG
                     HVDHGKTTLTAAITKHQASKGLAQFLEYGAIDKAPEERKRGITISTAHIEFSTEDRHY
                     AHVDCPGHADYIKNMITGAANMDGAIVVVAASDGQMPQTREHLLLARQVGVQKIVVFV
                     NKIDAVEDPEMLELVELEMRELLSSYGFEGEETPIIFGSALCALEDRRPDIGAERIDE
                     LMKAVDTWIPTPQRDLDKPFLMSVEEVFSIAGRGTVASGRVERGILKKDSEVEIIGGS
                     FDATKTKVTDIETFKKSCDESRAGDNSGLLLRGIRREDVRRGMIIAAPGSTKAHDQFL
                     VSMYVLTEAEGGRRTGFGSNYRPQVFVRTADEAADLSFPDGDESRRVMPGDNVEMVLK
                     THRPIAAEAGQRFNIREGGRTVATGLVTRVMDGK"
     exon            complement(833656..833843)
                     /number=1
     exon            complement(833904..834583)
                     /number=2
     exon            complement(834647..834909)
                     /number=3
     exon            complement(834979..835007)
                     /number=4
     exon            complement(835118..835238)
                     /number=5
     CDS             complement(835767..836468)
                     /codon_start=1
                     /locus_tag="AO090001000328"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000083"
                     /protein_id="BAE56861.1"
                     /transl_table=1
                     /translation="MKHIRGFISTTQALRRIFLAPIETPRPQCLRPAFLPTFTQSRLL
                     SIRRKPQQQDAQPQARARQVKDEEIRSEYIQLVNEDGKLDPPVRLHDALLTIERPDNF
                     ILQVSPGFRGRAPVCKVVNRLEIREQERAKAKAAHVNKNSLKQIELNWAIDAHDLSHR
                     LKQLTNFLDKGRKVEVILTKKRGKRSPTVEEVKHVMDSVLQATKDANAMQVKPMEGEP
                     GKHVVLVVKRKDLGQ"
     exon            complement(835767..836468)
                     /number=1
     CDS             join(837021..837294,837350..838694,838762..838819)
                     /codon_start=1
                     /locus_tag="AO090001000329"
                     /note="nucleoside phosphatase"
                     /old_locus_tag="AO070285000082"
                     /protein_id="BAE56862.1"
                     /transl_table=1
                     /translation="MSTGFDGRHINHAPSIQKPGSRVSRRSNSRASQPANNTPSYSPD
                     TCQSPSTDIMAQSQRSRYLKTGAIVGALFLMILWLSPSKPAVTGFGREKSPTGVAPLT
                     DKCTKPHDPSKPLIQYALMIDAGSQGSRIHVYRFNNCGPTPELEHEEFEQTEKRKGGS
                     GLSSYKEDAEGAAKSLDPLMQVAMRTVPEEYKSCSPVAVKATAGLRMLGPEMSQNILE
                     AVRHRLETVYPFPVVSREKGGVEIMDGSDEGVYAWITTNYLLGKIGGPDETPTAAIFD
                     LGGGSTQIVFQPTFEKSKSGGMPERLADGDHKYELQFGGRGFDLYQHSHLGYGLMAAR
                     EAIHKAVVEGKMASSGNDMAWLNQPIPNPCIAPGMERDVEVKFDKEHPLGSKVTVKMV
                     GPQDGSSSPALCRGFAEKILKKDAECKLAPCSFNGVHQPSLEKTFSREDVYIFSYFFD
                     RTKPLGMPDSFTLEELHQLTSTVCAGESSWKIFEGMGEAMAELRDRPEWCLDLNFMLA
                     LLHSGYEMPLSREVKIAKKIKNNELGWCLGASLPLLSQESGWTCRVKEVS"
     exon            837021..837294
                     /number=1
     exon            837350..838694
                     /number=2
     exon            838762..838819
                     /number=3
     CDS             complement(join(839245..839454,839515..840045))
                     /codon_start=1
                     /locus_tag="AO090001000330"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000081"
                     /protein_id="BAE56863.1"
                     /transl_table=1
                     /translation="MADSDRKRPQADDPQSQLACDAGSPSQRSKSHSNQNNGVGDESD
                     ERRVFSLALRDNAQKAHARPDKIDDDSDDDDYTSSSGSDSDEDDVVDDDEDAQDRDVK
                     SDNGSDHSLPRIPAPQKPQIHRIEKNPDLLSRLSAFLPQMKSANDKLQQEIEAGRGKD
                     LRLDEVDDEADGQFIEMNLGLGVLEEKRPADGVAPSAKSEGSDEGPAYSYAESHPNAP
                     SESNVLETLMGNKDTTSSKKPTIEEMNE"
     exon            complement(839245..839454)
                     /number=1
     exon            complement(839515..840045)
                     /number=2
     CDS             join(840965..841442,841512..841750)
                     /codon_start=1
                     /locus_tag="AO090001000332"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000079"
                     /protein_id="BAE56864.1"
                     /transl_table=1
                     /translation="MALPRVHVNDKSPLSENSNPKDSDINKRPSAQIIAPTRKSLHQN
                     IFGKLRPLPFQYHWTVWYDKHSDSTDYDNRLYVLHEDVADIATFYRVYNNYPWDKIRL
                     RDTVHIFRKGVRPVWEDQENLKGGCWRFRVPKSKAQEFFHEIAILCMANEFQAVLEQE
                     HDHVLGVSTSVRFNTHLISVWNKLGSNERSIKALERTILDRLSPELRPTGTGSNAYFY
                     KRHDENEGYQEAVERTALKD"
     exon            840965..841442
                     /number=1
     exon            841512..841750
                     /number=2
     CDS             complement(join(842060..844021,844070..844318))
                     /codon_start=1
                     /locus_tag="AO090001000333"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000078"
                     /protein_id="BAE56865.1"
                     /transl_table=1
                     /translation="MAGPEEMPDVQPTDVKRPSVDIESLQRKKFKTEELPLSPTQHRT
                     IEDLLHAFKKRGGFDTTRKKLWTEFDEGVCLVVNSFYILEGKVEFTNLLVELAESEIT
                     REPELLSRERGKAATLIEGAVDRSDIYKTVEASLDALASKHLPAILESIREIRREQIG
                     EEAAAREEQAGNKTDEDYAAHVKAKREEREKVWQETLRKQKEAEEEEARRKAEEKRKQ
                     RELDRQKEEEERARRREREEQRRAEQRAQDEQREKERQERYERRRREEREKYRDWRDR
                     SRTRDRDSERDRDRDRSRYRRDRSLGHRSDRGLSPRLRDSRRDTSATPKEPTPAPPPP
                     PPPPVDEKSLEEAALQLLLKEGEELAAKARQKPEFDFEEAEAIENGLKPPPTKPKGIA
                     ESKFSNTPTKSGSPAVETDQSRRRGSTADERNRTRRRDDSRSRSRRRFTSRFDEDRRS
                     SRDMSARPRDRASDDRLAIRDFREDRYGDRSYRPNRRSRSRSTTRGQDRDRDRDRNLD
                     RTRSRPRYRERSTERDRERDPEYRRNRSRDRDRERRDRDRDQDRDRDRERDRERDRER
                     ERDRERDRARDGDRDDYRRRRYSRSRSRARYRSRSRSRQRHREREHDRDRDRDRGRER
                     DKESDSKRERDKSGSRVSASSRRGSRSRRRSPSVLDIDRYVPPTSNRSRSPRRRVRSP
                     ERAERDDRPRFVEIDRYIPGGERDREREKDADRSREPNDQRTRRKSPTRRSRSR"
     exon            complement(842060..844021)
                     /number=1
     exon            complement(844070..844318)
                     /number=2
     CDS             complement(join(845740..846810,846882..846937,
                     847424..847532))
                     /codon_start=1
                     /locus_tag="AO090001000335"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000076"
                     /protein_id="BAE56866.1"
                     /transl_table=1
                     /translation="MENKYYVVEVNATRVQDVNKAVMNDDTDRLGVDDAMTGPFNFKT
                     TTMAKSPVVKSNIGQRRGHKYKHSSISHQIFLEPPPRAPLALPNSLPIPTFKECRASM
                     SKEQKTRFWWSVCHMFVAAYTLWSAHGSLAMTALSHLILFDSLGALLCVSVDVLSNFE
                     VWKRSSVRHPFGLERAEVLAGFAMCVLLLFMGMDLISHNLQHFLESSGHEPHHSHAHE
                     RVSVGSVDVTALLAISSTLISAIGLKNHGRIGKAMRFGYIESLPSVLSNPSHFLTLSC
                     STLLLLLPLVSVRLYNWLDVLLSSTIAISMCVIGVRLVKTLGSMLLMSYSGPGVKDVI
                     RDIEADPSVFGVDDARFWQVHYGLCMANLKLRVSGSEESIIRLRERISSLIRNRLGGG
                     YGSGGQRWEVSLQFTIEKS"
     exon            complement(845740..846810)
                     /number=1
     exon            complement(846882..846937)
                     /number=2
     exon            complement(847424..847532)
                     /number=3
     CDS             847627..850032
                     /codon_start=1
                     /locus_tag="AO090001000336"
                     /note="predicted E3 ubiquitin ligase"
                     /old_locus_tag="AO070285000075"
                     /protein_id="BAE56867.1"
                     /transl_table=1
                     /translation="MDHRGSFFFFLVVFYLLLSSQSHPPLISQDRERQREIAREKDAL
                     RLLNESKYGDFNPPTDRWLPFPGVRKNDSYAWELLSEVQDRARYQLRSAISNAGLEVP
                     KGLDDPAESQALNLTELLLPVYRNATGKLRGDWVRRKLEKAHRPLNTTAIALENEYFT
                     HEFSHNVTGNTGSFYLDLREGGGEELRLRNGHVREIRATLAVENGDFWGNTWYLPLFG
                     IHFPETGGIILTTTSEKFGGIFTLPHLALTSDAYDLSHQLLMKSLSDAISEKQNRAPT
                     LFPWSSLVGAEQVEFPAPKCEHIVYLQQHPIAVHDYLADRQVIEQIEQELRYPMGAPI
                     PSPPLMVMSAVVFSPDCGYVLETKGAPDYPPTEALYLSGPKLEELGKYSARLIFVICG
                     ISVAQIALLMRQVKEASTPSTRSRISFYTIALMAFGDSFLLVFMLLELYPAVSFLLLT
                     TASFLTFLSVSYIGMKFMMEIWAVQAPERREQDRRSNPSATTARPATLPLPATTRLRD
                     TGATPIILTPDQDPPEEEDEPPPNRSTTPTARETRSDVGAMYARFYFILFVMLIISIW
                     SFLWPNRLGALYARALGFVYLSFWTPQIYRNVMRNCRKALRWDFVVGQSFLRLFPFMY
                     FLTVSGNVLFIRPDTTTALALAGWVWIQVWILASQDILGPRFFVPRGWAPPAYDYHPI
                     VRDAAGSDADLESGGVLPIGALRADERDFDTKEDDKQRPKDKKKAVFDCAICMQEIEV
                     PVLAAPGGAGGSSMTDGATSILSRRAYMVTPCRHIFHSTCLESWMRLRLQCPICRESI
                     PPV"
     exon            847627..850032
                     /number=1
     CDS             complement(join(850566..850882,850956..851018,
                     851105..851246))
                     /codon_start=1
                     /locus_tag="AO090001000337"
                     /note="glycine cleavage system H protein
                     (lipoate-binding)"
                     /old_locus_tag="AO070285000074"
                     /protein_id="BAE56868.1"
                     /transl_table=1
                     /translation="MSAIARSVRPFASRVLSQKLPLAAACRVSPATAFPRGSVRNFSQ
                     SPFMELKKYTESHEWIELAADGKTAKVGITEYAAHSLGDVVFVELPEVDAEVSAGEPV
                     GAVESVKSASDVNSPVSGKVINVNSILEDKAKFINESPEGDAWIAEIEVKDASELDNL
                     LDAKAYKETLGDE"
     exon            complement(850566..850882)
                     /number=1
     exon            complement(850956..851018)
                     /number=2
     exon            complement(851105..851246)
                     /number=3
     CDS             join(851515..851538,851607..851638,851755..852064)
                     /codon_start=1
                     /locus_tag="AO090001000338"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000073"
                     /protein_id="BAE56869.1"
                     /transl_table=1
                     /translation="MLYELIAVVRPGSLHEVREIARNAGIQVLRSGGVVRGYTNWGTF
                     RLPKPTTKHQARYTEGHHFIMRFDASGPVQMAVRRTLGLDPRMVRFSVVKLGDKLEDI
                     KDVQGKVEWNNARNISESI"
     exon            851515..851538
                     /number=1
     exon            851607..851638
                     /number=2
     exon            851755..852064
                     /number=3
     CDS             join(852852..853112,853172..854023)
                     /codon_start=1
                     /locus_tag="AO090001000339"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000072"
                     /protein_id="BAE56870.1"
                     /transl_table=1
                     /translation="MLPDRSDDDPQLVASPPTFAELMALKQLDSPSHLHGISSDEPEK
                     IERFQSLASPYPPGEGKMAFGGHVYAQSAYAASKTVEKGFVIHDMTGTFILAGRLDVP
                     YVYTVRHVRDGKMYCTRAVDARQEGKVCFSCLCSFKRDEGPETFAHQPPSAQERFKSI
                     LQAKRVEDQIVSPSVDADWWIEVVEQGGVTEREFPGLDMRKTDMQGYNLTEDIKQNPE
                     KYRQLHQYSLKGSPQDSTVSVSREELKVKEQSGEYDNLYACAHMYASDRNSLLLIPRA
                     LGHKNWTAMASLTLTVIFHQRGNALRMIDWDAVSSHDGTDLPKKWFVQEGWTPRSGEN
                     RAIHESWLWSPDGKLVATSYQDSLLRLRKHDREGKL"
     exon            852852..853112
                     /number=1
     exon            853172..854023
                     /number=2
     CDS             complement(join(854318..854465,854522..854634,
                     854689..854751))
                     /codon_start=1
                     /locus_tag="AO090001000340"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000071"
                     /protein_id="BAE56871.1"
                     /transl_table=1
                     /translation="MTSGEFYNIVKLVPKPGKFNELLEAFKSFSEHVQANEPKTQIYC
                     ALRPDKTEELVFIEKYTDLDNLKAHGTSPEFKKFSKAIGPLLAGAPEMTKADFVGGFE
                     GRSKL"
     exon            complement(854318..854465)
                     /number=1
     exon            complement(854522..854634)
                     /number=2
     exon            complement(854689..854751)
                     /number=3
     CDS             join(858176..858210,858287..858794)
                     /codon_start=1
                     /locus_tag="AO090001000341"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000070"
                     /protein_id="BAE56872.1"
                     /transl_table=1
                     /translation="MEVFIYTQEAKQKHAVILKRHKPRQEIDGNGNRTGHLRGLSVGN
                     RAVEFIWLRFMGYSANTFTQIIPARKFQDMLQHDQLLSAPLAALYWTAQGRSVKDVFG
                     PFYLKPDLDTAYIETGSDGTRAILATDFVDKVQDPLPLCPRSNLRRLCHVISDIAGFS
                     ALVGLEVEVIFMRPVTGGQH"
     exon            858176..858210
                     /number=1
     exon            858287..858794
                     /number=2
     CDS             858868..859671
                     /codon_start=1
                     /locus_tag="AO090001000342"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000069"
                     /protein_id="BAE56873.1"
                     /transl_table=1
                     /translation="MIECIVRELSAVGLFVDNVHAECAPGQWEFVLPPADPVQAVDDL
                     AKARHTITCVAESFGLRATLSPRPHTGKSPTGSHVHMSLNPVTQATQPLSDAFFAGVI
                     AHLPSILVFCMSQVASYERVAAGCRACGVYATWGWYNKETPLRRMRDNRFEIRVMDGL
                     ANPYLALSSILAAGILGIQTKASLGTGVANGMDPAKLSADERDATGAHKVLPASLEES
                     LAALECDQELIDLLNEQLVRVYLMIKRREADDFKAMDPSEQKRWLISEF"
     exon            858868..859671
                     /number=1
     CDS             join(860108..860149,860257..860405,860491..861646)
                     /codon_start=1
                     /locus_tag="AO090001000343"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000068"
                     /protein_id="BAE56874.1"
                     /transl_table=1
                     /translation="MKKTLLLVFIHGFKGDDDTFGNFPGHVRALIGRALPAITVATVV
                     YPKYQTRGDLKECVGHFREWLQDQVIDLEVANRTASPTVDPSVHVFLVGHSMGGIVAG
                     ETLLLLASEQPIPAKISPANSETAANSQILESGSFMFPHIQGVLAFDTPFLGIAPGVV
                     SYGAEGQYKNVTTAYNAITEVAGLFGFGDSSGSSTKAASANQGATSNKSLPPQQASAA
                     SPSSDAAATPSWQRWGRYAMFAGAAGAVAAGGAAAMYSQRQRLTDGWGWVSSHLAFVG
                     CLARPSDLRHRISLLSEVQRERGIGCTNFFTALGKNATSLVETSSQGKTSLTQRIIRS
                     KYRTFCTLPPEVENEDAAYDPKAGLGWVKAVNDKAADEIKAHVSMFLPKENPAFYELV
                     NEACKIVVASVDQGWYSTATGPVEEVDGDLPRTETARTPADHDSGFMDGDDVVIVE"
     exon            860108..860149
                     /number=1
     exon            860257..860405
                     /number=2
     exon            860491..861646
                     /number=3
     CDS             complement(join(862657..862842,862916..863487,
                     863559..863796))
                     /codon_start=1
                     /locus_tag="AO090001000344"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000067"
                     /protein_id="BAE56875.1"
                     /transl_table=1
                     /translation="MGFGDFDTICQKAALPLCSLVGPASSISGATGIIPNCYARNIEL
                     ANTIIFEGAASFVHIIALAMTVIMILHIRSKFTAVGRKEIITFFYIYMLLTMCSLVID
                     AGVVPPRSGPFPYFVAVQNGLTSALCTSLLVNGFVGFQLYEDGTALSVWLLRLTSTAM
                     FAISFVISLLTFKSWGGLSPTNTVGMFVVLYILNAICIAVYLIMQLLLVMNTLEDRWP
                     LGHIAFGLLVFICGQVLLYAFSDTICENVQHYLDGLFFTTICNLLAVMMVYKFWDYIT
                     KEDLEFSVGIKPNTWEVKEFLPEEDRRATVYQDTNSEYAGSMYHHRASAYNNHNY"
     exon            complement(862657..862842)
                     /number=1
     exon            complement(862916..863487)
                     /number=2
     exon            complement(863559..863796)
                     /number=3
     CDS             complement(873054..873815)
                     /codon_start=1
                     /locus_tag="AO090001000345"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000066"
                     /protein_id="BAE56876.1"
                     /transl_table=1
                     /translation="MPGTQFNKQRNYDSLAARCLWGINNALFHVAKETGENGVDRVVG
                     VSCWLPPHAASEPESWYSWCQGWVLSWRQMLNNVWHLGRGGLRTNRYWIWKERQQEAQ
                     SVIWDDPRGYYFCNIVAVSPKAQGGGIGRKLFEAVTDMADREGVKCYLESSRNVPNVQ
                     IYEKMGFRMKKEMECRDGEDVCMVGFFSLIFALHLERWMSDNVFDSFIAWFVSLIRRS
                     EGSGGFYLFLLYAVFDGESGWQGLRRPAALQFLRL"
     exon            complement(873054..873815)
                     /number=1
     CDS             complement(874629..876026)
                     /codon_start=1
                     /locus_tag="AO090001000348"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000063"
                     /protein_id="BAE56877.1"
                     /transl_table=1
                     /translation="MASLSLSKICRNALILSSVLSTAQGQQVGTYQTETHPSMTWQTC
                     GNGGSCSTNQGSVVLDANWRWVHQTGSSSNCYTGNKWDTSYCSTNDACAQKCALDGAD
                     YSNTYGITTSGSEVRLNFVTSNSNGKNVGSRVYMMADDTHYEVYKLLNQEFTFDVDVS
                     KLPCGLNGALYFVVMDADGGVSKYPNNKAGAKYGTGYCDSQCPRDLKFIQGQANVEGW
                     VSSTNNANTGTGNHGSCCAELDIWESNSISQALTPHPCDTPTNTLCTGDACGGTYSSD
                     RYSGTCDPDGCDFNPYRVGNTTFYGPGKTIDTNKPITVVTQFITDDGTSSGTLSEIKR
                     FYVQDGVTYPQPSADVSGLSGNTINSEYCTAENTLFEGSGSFAKHGGLAGMGEAMSTG
                     MVLVMSLWDDYYANMLWLDSNYPTNESTSKPGVARGTCSTSSGVPSEVEASNPSAYVA
                     YSNIKVGPIGSTFKS"
     exon            complement(874629..876026)
                     /number=1
     CDS             complement(join(877808..878464,878525..879594,
                     879668..880388))
                     /codon_start=1
                     /locus_tag="AO090001000350"
                     /note="thioredoxin binding protein TBP-2/VDUP1"
                     /old_locus_tag="AO070285000061"
                     /protein_id="BAE56878.1"
                     /transl_table=1
                     /translation="MTTAHITPLQQDLSVTTTSPVVQLHCSPPESLSSGHTSPSAEHR
                     RSVDPSAVVGANFPKQTNRRASIFRKLAGPRENAKRFLRLGGSVRAQSPPSIRSMSRT
                     QRPRPVSEIVLSPEDARMLASTSLGAGLGTGRMRSHSSSTGSVNQSSAGSVTSAPSSD
                     SMGPFPTLRHEKIVATGSGITVGIALTEPVLYLQGYDHNDPSTKKFAILRGQLHLKVT
                     KSVKIKKISICFRGHAQTDWPEGIPPKKVHYHDKKDLVTHGMMYFNHGDSVLPQNDYG
                     ANFYQHAKPVASVTGKDGSPVTITREIFSKSGSSTSLGNGHPTSKELKRLSLQSNHSR
                     SFGKNDPPPSVVAHPQRNYRMFPVGDYLYNFEFTIDGSLPETIKTDLGYVRYDLEAIV
                     ERSGAFRPNLLGNLEVPVIRTPAEGSLEQVEPIAISRNWEDQLHYDIVISGKSFPLGS
                     QVPIAFKLTPLAKVECHRIKVYVTENIQHWTADKSVHRFQPAKKVLLFEKRADSASTS
                     TYPGSSMRVTAGGGIDWDHRAAAARGDEIVDRNRTNLLGNLASDSGVGPTEMEFNVQL
                     PSCHEMKNRDESHKLHFDTTYENIQINHWIKIVLRLSKVDERDPTKRRHFEISIDSPF
                     HLLSCKATQANIYLPAYTSPNSDPAPPAQEYECGCPGAAALNRASSNGHSPCSEAEEP
                     PTRAVNRSFTNGSGGLARPPQAHLAHEPSDRADEPPPRPMHLLRAPSFAPPAFEDVPP
                     PPPLITPPPEYTSIVGNNDRETVLEDYFSRLSCYEETADDPRGLGRVDVPLTPGGRVN
                     RSMDVPREWVRLDQSTV"
     exon            complement(877808..878464)
                     /number=1
     exon            complement(878525..879594)
                     /number=2
     exon            complement(879668..880388)
                     /number=3
     CDS             complement(join(883618..884394,884464..884589,
                     884644..884709))
                     /codon_start=1
                     /locus_tag="AO090001000352"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000059"
                     /protein_id="BAE56879.1"
                     /transl_table=1
                     /translation="MATSNFSNPDSLAVLTAMVNQTLIETGRFFRSGGSTQSRAQLKR
                     SIPVAHEQFQSALDNLSEQIFIAKTFLERDYEAIAAQKAALQPAEDVVMSQSETIQDP
                     ETAPQAEATAVDTNQIQSEPCKADTVQSHTSVDAGQQNSSETLVKEEKPAESAALGPN
                     QSQSGPNDINFDSVLDDTGGANDFDLNLDFGDDDLGNENFLSGSNLGTTNTAGAAEQE
                     KGVDQSGNTTTEVPDMENGAANIPTGGDMFDLELQKTEAFSAPAGAPEGQQGNTTEDI
                     MGPGESSFDDLFMDNDNFGSGDVGDPSMLEGDSLMNMNELDDSWFT"
     exon            complement(883618..884394)
                     /number=1
     exon            complement(884464..884589)
                     /number=2
     exon            complement(884644..884709)
                     /number=3
     CDS             join(885935..886312,886388..886492,886549..887196,
                     887250..887382,887442..887611)
                     /codon_start=1
                     /locus_tag="AO090001000353"
                     /note="RRM domain"
                     /old_locus_tag="AO070285000058"
                     /protein_id="BAE56880.1"
                     /transl_table=1
                     /translation="MADNVPAQTPSTLPPPPQTSAAPGQQYDGAQGNGQANPSHMPPP
                     PRPPVVIPQNTNPIPTAITSPMSGNMMSPTSAGGYVRRAAPEPNKRALYVGGLDQRVT
                     EDILKQIFETTGHVVSVKIIPDKNKFNSKGYNYGFVEFDDPGAAERAMQTLNGRRIHQ
                     SEIRVNWAYQSNSTNKEDTSNHFHIFVGDLSNEVNDEILQQAFSAFGSVSEARVMWDM
                     KTGRSRGYGFVAFRDRADADKALGSMDGEWLGSRAIRCNWANQKGQPSISQQQAMAAM
                     GMTPTTAFGHHHFPTHGIQSYDMVVQQTPQWQTTCYVGNLTPYTTQNDLVPLFQNFGY
                     VLETRLQADRGFAFIKMDSHENAAMAICQLNGYNVNGRPLKCSWGKDRPPTGQFDNFS
                     GQQGNSPFNNSPAPYFPQYGGPGGPMTPQGPNPAGRGWDQSGMGGQNYGQVPGNAGYG
                     RGQAAPASGWNQANNANFGNGFGGYQA"
     exon            885935..886312
                     /number=1
     exon            886388..886492
                     /number=2
     exon            886549..887196
                     /number=3
     exon            887250..887382
                     /number=4
     exon            887442..887611
                     /number=5
     CDS             join(887976..887981,888147..888467,888559..888570)
                     /codon_start=1
                     /locus_tag="AO090001000354"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000057"
                     /protein_id="BAE56881.1"
                     /transl_table=1
                     /translation="MNYVCLAYEWALVSLRSHAKFLFWFDSGLAFSAHLFSDLSRFKF
                     INTSLTSLTRPRNPEAFLCVASRRYFFSCLLYDTILETIVILGPDYDLMPWSFGYLFS
                     FTALDHLFSE"
     exon            887976..887981
                     /number=1
     exon            888147..888467
                     /number=2
     exon            888559..888570
                     /number=3
     CDS             888862..889992
                     /codon_start=1
                     /locus_tag="AO090001000355"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000056"
                     /protein_id="BAE56882.1"
                     /transl_table=1
                     /translation="MENASDNSREALSLDNDDQLSGRTRSESASSGHKRSSSGSLLSK
                     LSFLRVIQATHNTPERAHSGIDRDDGDGFGSSARGGRAMASALQQRRTRRRRGSLRKT
                     ALLGTRFEYRDKKATRAPIDMPRADVIGHQQQMDQQQQLVTGSRMQQPLPGPVSLDQA
                     VVPHGNAEQDSHQDDMVWEGFMNASPKSLDQSAQHHRQNHSQNSILGGEITTDDEDVV
                     SFPRAKNTNAAVAAAAGLHLQSASSSSDSYYALSADSTYRSMHRTKSPLATHAVDITS
                     SQDMNWDYSETEWWGWIILIVTWLVFVVGMGSCFGVWSWAWDVGETPYAPPELEDDPT
                     LPIIGYYPALIILTAVMSWVWVVVAWVGMKYFKHANISGDDT"
     exon            888862..889992
                     /number=1
     CDS             complement(join(890275..890564,890614..891346,
                     891433..891528,891585..891599))
                     /codon_start=1
                     /locus_tag="AO090001000356"
                     /note="glucosamine 6-phosphate synthetases, contain
                     amidotransferase and phosphosugar isomerase domains"
                     /old_locus_tag="AO070285000055"
                     /protein_id="BAE56883.1"
                     /transl_table=1
                     /translation="MCRFLVYKGRHEIRLSKLVTEPSHSILTQSYDSRLRLDNRRPVN
                     GDGFGVGFYTDPKLGPEPCIFTSTLPAWNCENLERLASKTCSNLIFAHVRATTEGALS
                     DNNCHPFQHNTLMWMHNGNVGGWQYIKRPLGDSLADRWYLGVKGGTDSEWAFALFLDL
                     LEKEGVDPSSDPGPEGFGQALLRRVMVKTIAKINEFIRDIPKRHNVSGIETRSLLNFA
                     VTDGHTVVCTRYISSKTDEPASLYFSSGTKWKEGKVKGHFKMERHDKGADIVLVASEP
                     ITFERHNWVSVPANSIVTIHKQTVLLHPIMDEFYSEDLNHDRSSCYAVSKGLVSTAPG
                     TTVQPQNTESKAPAISVNGARVDDHAGLAQHQLELANKCAISH"
     exon            complement(890275..890564)
                     /number=1
     exon            complement(890614..891346)
                     /number=2
     exon            complement(891433..891528)
                     /number=3
     exon            complement(891585..891599)
                     /number=4
     CDS             join(892186..892483,892542..894563,894619..895055)
                     /codon_start=1
                     /locus_tag="AO090001000357"
                     /note="vacuolar sorting protein VPS1, dynamin, and
                     related proteins"
                     /old_locus_tag="AO070285000054"
                     /protein_id="BAE56884.1"
                     /transl_table=1
                     /translation="MSGRILSHRLVPLLRTGFLARHVHNAGARTGGLLRSDGSAALRG
                     RAWPVGANSIHNVPAVRGISFARILPKLALKLVKVPAMLGTATVAGLAYIQYQTTQAG
                     NYAIDVLKRAGESAGDAASSIFSEIQNVAEQTQRGWQRTTDSVEVPEWLQNILGFSEG
                     SQNDGSGGGGGGGGGQPPRESRAGAAAAAGAAALGYDQGDEHARLTRNAEDDQMMLLT
                     RKMIEIRNILQAVGQSNTLTLPSIVVIGSQSSGKSSVLEAIVGHEFLPKGSNMVTRRP
                     IELTLVNTPHAQAEYGEFPALGLGKITDFSSIQRTLTDLNLAVPERDCVSDDPIQLTI
                     YSPNVPDLSLIDLPGYIQVSGQGQPPQLKQKISDLCDKYIQAPNVILAISAADVDLAN
                     STALRASRRVDPRGERTIGVITKMDLVDPERGYSILTDKKYPLRLGYVGVVSRIPQTT
                     ALFSSRGSGNITSAIIKNENAYFSSHPSEFGPQSEVSVGVGTLRTKLMHVLEQTMASS
                     LAGTRDAISQELEEATYEFKVQYNDRPLSAESYLAESLDSFKHSFKAFAENFGRPQVR
                     EMLKNELDQRVMDILAQRYWNKPIDDLNPPMPELDPLIDLPKADPESMYWHRKLDAST
                     SSLTKLGIGRLATTVVANAIQNHVESLLANSTFASHPYAQKQIVDACSSILNDRFFST
                     SDQVENCIKPYKYEIEVEDPEWAKGRENITRVLKDELKACEAALKRVEDSVGRRKIKD
                     VMSFIDKVRKGEVVLEGDGAGGAGGFSSALLATGRESAFLRDRADLLKMRLLAVRSKQ
                     CASKKNKYHCPEVFLDVVADKLTSTAVLFLNVELLSEFYYNFPRELDMRLGRHLSDAE
                     VERFAREDPRIRRHLDVIKKKELLELALQKIESIRQLDGRSKHRNADRPLSKEQRNRG
                     WNLF"
     exon            892186..892483
                     /number=1
     exon            892542..894563
                     /number=2
     exon            894619..895055
                     /number=3
     CDS             complement(join(895956..896029,896090..897061,
                     897118..897456,897532..897850))
                     /codon_start=1
                     /locus_tag="AO090001000358"
                     /note="NADH-dehydrogenase (ubiquinone)"
                     /old_locus_tag="AO070285000053"
                     /protein_id="BAE56885.1"
                     /transl_table=1
                     /translation="MATPSVMSSLSRRSLSTRPQVLRSARPLRSSGFSQQPVQRTARR
                     SYADAAPAPKPKKGFRFLRWTWRLTLLSGLGLTGYVAYSIYELRHPIEQIAPDPKKKT
                     LVILGTGWGSVSLLKKLDTENYNVVVISPRNYFLFTPLLPSCTTGLVEHRSIMEPIRN
                     ITRQKNAYVKFYEAEATKIDYEKRVVYISDDSEIKGDISQTEVPFDMLVVGVGAENAT
                     FGIKGVKEHSCFLKEVGDAQKIRTRIMDCVETAIFKDQTEDEIKRLLHMVVVGGGPTG
                     VEFAGEIQDFFEEDLKKWVPEIKENFKVTLVEALPNVLPMFSKQLIDYTESTFKEEAI
                     TIRTKTMVKNVTDKYIEAEVTKPDGTKELETIPYGLLVWATGNAVRPVVRDLMSQLPA
                     QKNSRRGLAVNEYLVVNGAENVWAVGDCAITNYAPTAQVASQEGAFLARLFNTMAKTE
                     AIEDDLKQLSEAQAQAKSPEERNQIFDEIRERQKQLRRTKQIGPFQYSHQGSLAYIGK
                     ERAVADISWLSGNIASGGTMTYLFWRSAYLSMCFSTRNRVLVAVDWVKAKMFGRDVSR
                     E"
     exon            complement(895956..896029)
                     /number=1
     exon            complement(896090..897061)
                     /number=2
     exon            complement(897118..897456)
                     /number=3
     exon            complement(897532..897850)
                     /number=4
     CDS             complement(join(899805..901394,901442..901507))
                     /codon_start=1
                     /locus_tag="AO090001000359"
                     /note="beta, beta-carotene 15,15'-dioxygenase and related
                     enzymes"
                     /old_locus_tag="AO070285000052"
                     /protein_id="BAE56886.1"
                     /transl_table=1
                     /translation="MASSVKESTTTTHYNDWPNTQGFDVRYQELEPTELSVQGTIPPY
                     CAGVLFRNGLGPRDIQTEKQTTYRVSHWFDYFAQVHRFQIHTPTPEQPRVRVTHNSRL
                     TCDGLIRRIQRTGYRGEITFGAKYDPCMTLFQKAQSVFKTIPQGVPDEVDISVSLNVN
                     FPGLSATGSKQEKMPEPGIQTLCNRTDNSTFQMLDPQTLEPIGIADQTVLHPSLRGPL
                     SAAHCKTDLTTGDVYNYNLDIGLTSTYRIFHVSRATGKTSILATFTHAATYVHSLLLT
                     EHYVVLCLWNARFRAGGMSLLWTHNFVDALADYDPTQRSTWFVVDRTPGGRGLIARYE
                     SDPFFSFHTINAYEEHSSTNPSKTDIIADVCAYDSLDVLKRFYIDNILSDSATARHFG
                     ESRNHSARGAFRRFRLPAVPEASSPKTLTAELVFSMGKGLGPELPHVSPRVRGRKYRY
                     VYGVTDSGKSVFLDGLVKHDVVTQTSLYWSQHGQTASEPIFVTDPDSEDEDGGVLLSV
                     VLDGIEGRSYLLVLDAKTMTEVGRATVHGVVGFGFHGAHVRDA"
     exon            complement(899805..901394)
                     /number=1
     exon            complement(901442..901507)
                     /number=2
     CDS             join(902581..902990,903049..903263,903319..903495,
                     903583..904260,906202..906275)
                     /codon_start=1
                     /locus_tag="AO090001000360"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070285000051"
                     /protein_id="BAE56887.1"
                     /transl_table=1
                     /translation="MVRPTLNRIATILWGREPKDRALLAKLDLTLLPYFSLIWFLFGV
                     TRASYSSAYISGMREALNFQGKDYNYMNTAYLVVYAVCQIPGTSLLTVVRPKYVFVAA
                     NLTWSVLTLITYKMTQAWQVILLNAIEGGFSAIAYVGAHFILGSWYRKSELGTRAAVF
                     CCFGHVGSMAGGWIQAGLLKALAGHGGLPAWRWIFIIVSVMTIPVALFGWFFIPDLPA
                     HRAAWYLNEAEKEHAAHRLGQTSKQTWDRTVLKRVLLSWQFYLLPLIFMLYSLCVQSL
                     SNNVMALWMSSRGYTTIQQNNYPTGIYATAILGTILYSTISDRLQSRWECSLLIGLTF
                     IIGSAILVANPAADAGHFFAFYLLGTTYAPQALWYSWMADVTGHDLQLRAITTGFMNS
                     FDFAFVTWWPLVFYPVTDAPHFEKGYVASLVTGSLTIPFIGLVAYLDRRDTARGVIGR
                     VGPRVVVEDSVVDDGDQVRYEREIEDGDDHPDDPIPTTEVTVASLPVGCQLVPLVLDT
                     RKLKEQWAQ"
     exon            902581..902990
                     /number=1
     exon            903049..903263
                     /number=2
     exon            903319..903495
                     /number=3
     exon            903583..904260
                     /number=4
     exon            906202..906275
                     /number=5
     CDS             join(916926..917411,917467..917740,917799..918931)
                     /codon_start=1
                     /locus_tag="AO090001000363"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000048"
                     /protein_id="BAE56888.1"
                     /transl_table=1
                     /translation="MSLPVFSTQSYSSVPHPFTPTLPLYSRTEDSTCAKKRHLETVLE
                     DPDHHWTAPFRDGLPTPPNDMAGVAYNSIPPSGYGAKFGGVTLPPYAKAPNYTRMASG
                     HHSTASVPQSKPPSQPSLQDAPSSEPTSQKKGSSKPVASYLQIPSSINNSKGNLADFA
                     AQMTCLFWFETTAKLNDIEERKNPLLYIVPEAIPSAGFQKWVTNILSTTQVSQNVILL
                     ALLFIYRLKKFNHRVRGKKGSEYRLMTIALMLGNKFLDDNTYTNKTWAEVSGISVQEI
                     HVMEVEFLSNVRYNLFVSEEGWTQWHSKLSLFADFFNKASLAPEAKELESTTSAPRTS
                     PSLGASQVSPSQRLPSPPNSDVLRAQNWSFPSNAPAYAPPAHLGKEFPPMPSKKRTLD
                     DYVEDQPSKRVAMPTTLPTSMSTLPSAALAGVPTLPPVLAATSAPSANSLSGSISRLP
                     RPNFPPSSNIAPGIPTSVLPFPSVANRAMHSVYNPSTNWVPQLPPTQVPPITNGLYNP
                     SVSLPDPARQHNSPFGITSATISPAISAYSSHTPQTNLSPSFFLANRNSPYRPVRNVN
                     TLLIPPPSSSLQQQQRAVPFEHMHYQPLGKTAAERKTGLLPYLHHEAWPQAPFLQPTF
                     HSTPHY"
     exon            916926..917411
                     /number=1
     exon            917467..917740
                     /number=2
     exon            917799..918931
                     /number=3
     CDS             join(919783..920102,920216..920822)
                     /codon_start=1
                     /locus_tag="AO090001000364"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000047"
                     /protein_id="BAE56889.1"
                     /transl_table=1
                     /translation="MPPRLQILPTQWQRPLSRPLSAISSLSLLFPQIQQQSRNAHILA
                     SLSDTPGAYNKRIRRGRGPASGKGKTSGRGHKGQKQHGKVPARFNGGQTPEIIVHGER
                     GFNNVFSLDLAPVNLDRIQEWIDQGRIDPARPITIRELAQSRCIHQTKEGVKLLGRGA
                     ESTLEQPIHIVVSRASATAIAAVEAAGGSVTTRFYTKSAIARIMRREMHPFVSTAWTK
                     ESGSEGLNNAEGAENLTESAIMKEMGFQYRLPDPTKRKDIEYYRDPAHRGYLSHLLKP
                     MEGPSLFFRSPVERKTAAGVKKEKVLPENRLW"
     exon            919783..920102
                     /number=1
     exon            920216..920822
                     /number=2
     CDS             join(921692..921731,921872..922402,922455..922996)
                     /codon_start=1
                     /locus_tag="AO090001000365"
                     /note="dimeric dihydrodiol dehydrogenase"
                     /old_locus_tag="AO070285000046"
                     /protein_id="BAE56890.1"
                     /transl_table=1
                     /translation="MGDEIELLHWGILGFTGNLNYHVGREDPNGPHHALVGVASSRSR
                     DVAKEFLESFDVPECTLTFHDYSELVRSDLIDVVFIATPHSHHFQNALLALEAGNHVV
                     CQKSLTVNAAQAKKLFETAKREQLFLMEGWWLWWPQASRQTCRLLRDGEIGQVNRIVA
                     NFGIRNNYCMFGSASDRLTSKELAGGALLELGSLALHWILRALPGGACRPTQVTSTMK
                     KCPESGVDETTTINMGFSIGGREIRTKAIASLSTPASPDGQLAHVIIEGSNGKIEIRG
                     WEALPTELYLFKNSYSLSKPYDVTFHEEEPLFVPEADEVARCIREGLLESPEMPWAES
                     LLVMEIMDFVRKQNDLQYPPEIEASEPSVMLPSRLL"
     exon            921692..921731
                     /number=1
     exon            921872..922402
                     /number=2
     exon            922455..922996
                     /number=3
     CDS             complement(join(923679..923733,924337..925388))
                     /codon_start=1
                     /locus_tag="AO090001000366"
                     /note="Ca2+/calmodulin-dependent protein kinase, EF-Hand
                     protein superfamily"
                     /old_locus_tag="AO070285000045"
                     /protein_id="BAE56891.1"
                     /transl_table=1
                     /translation="MFLSMWSSGEEPAPQPDDEGQMVGTEYVLGKQIGFGGFSTVKEA
                     YKADETGGTKRLAVKIVRKQVSGKNEKENDEVQAEFDHEVRVWRYLNHPNVLTLDAVY
                     ETDYATFCFTKLAIGGTLFDLIRQNRRGLDIKLAKKYTYQLACALRYLHEDARVVHRD
                     IKLENCLLDPIELPDGTKASNLVLCDFGMAEWMNIDNGGVSPDPYDDAADRPPPKTIG
                     PAGSSTSVAGSLEYASPELLLSTSGLIDASVDIWAFGVIAYTVLVGSRPFQDPFTPRI
                     QSQILSGNWDRTAVLGDETDLPARKDREHALELIEGCLDMSVEKRWTIRDVLSSRWLR
                     ELSEKGEDGEADSIWKLYNSIRLLEGGLKNQKLI"
     exon            complement(923679..923733)
                     /number=1
     exon            complement(924337..925388)
                     /number=2
     CDS             join(927502..927529,927597..928036)
                     /codon_start=1
                     /locus_tag="AO090001000367"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000044"
                     /protein_id="BAE56892.1"
                     /transl_table=1
                     /translation="MTRPRIVRADTLDLQDQHAPSAKDHSKQNIVVGSGFGPHQEQSI
                     RHADQDTRTEVMHGPGAEENIIDEHRDGIDIYDDDDDLDDDLGHSQHVGGSEDGDLAD
                     GEGDDDLLDDDLMDKISSSPSIDDGALYLLIKPMDIEGGPMLLIFYQSSRTKF"
     exon            927502..927529
                     /number=1
     exon            927597..928036
                     /number=2
     CDS             join(928429..928735,928847..928971)
                     /codon_start=1
                     /locus_tag="AO090001000369"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000042"
                     /protein_id="BAE56893.1"
                     /transl_table=1
                     /translation="MRRRNAKTVTFTSPTYIEASDIEFSTDDELDEVASLTDADGLRG
                     DVDDLQESEHEDIVVEPLRPKSQRDKASEDLETVHEAKESDRASPEKQRSSAELLESE
                     DSFFKDDTVETKKISLTPNLLRDEVGSSSVANDAREVGYTS"
     exon            928429..928735
                     /number=1
     exon            928847..928971
                     /number=2
     CDS             929396..930112
                     /codon_start=1
                     /locus_tag="AO090001000370"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000041"
                     /protein_id="BAE56894.1"
                     /transl_table=1
                     /translation="MQSQRNEQTIRQVPSEDNIPQSPVSTSIQQDQPLSSPIRTSSPL
                     KKLNTAQPNSGGTVASPIKPHYSQHSVASPPQKFPPRQDVGYQGLRGDSPVEVSSVDI
                     SPVEGPSSPGAPEMTMDPSSPGGFSVSPVFPPLSPAVESNGSRNLDAERTSFDVGSAD
                     TPTWSDASLRSYLDDESDIRDLFIIVHDNSNVPPAGPDHPITGSLFKEESKRLKEMNS
                     QLDSMLADWVGRKMRKSISQ"
     exon            929396..930112
                     /number=1
     CDS             join(931050..931155,931247..931908)
                     /codon_start=1
                     /locus_tag="AO090001000371"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000040"
                     /protein_id="BAE56895.1"
                     /transl_table=1
                     /translation="MAASNLHTVAFFGATGGCNLACLVHALEAGICCSALVRDPAKLQ
                     NLLRQRGISDSVTAEKLCIVKGNVTDLDAVKQTLMYNGRPVDIIISGVGGKPVFTNPL
                     RPRLDNPTICQDAVRTILAASRALGAKPVLIAISSVGLTTKKRDWPIALAPLNYWLLR
                     EPHADKKVMEETIFEEMSKPDEDRAIRDYTLVRPSWFTNGEGVGLGKIRAGTEMNPAV
                     GYTICRNDVGLWIFENFLRRPLQLDNPYLGRPISITA"
     exon            931050..931155
                     /number=1
     exon            931247..931908
                     /number=2
     CDS             complement(join(932473..935042,935126..935152,
                     935585..935615,935692..935805))
                     /codon_start=1
                     /locus_tag="AO090001000372"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000039"
                     /protein_id="BAE56896.1"
                     /transl_table=1
                     /translation="MRRANPLYTGFMSLAKLMVLLADIMCRSPTKELSSWASLNLKYN
                     FQVSHAVNMETQTRTSGLRQSCIFCRGRKIRCSGGRICNACRDRNINCVYGPEARKGR
                     PKRKRTEDKCTLNPGISKRDRKQSILLTNTTIASALSDESPLSASVALKKVRTLGNEL
                     EQMFDDYFISKTGSESNLLQLSITSFQRHRRPYTSTPSSHPTQHQVNYDGLLSSIAQE
                     MLELLLLRVGSLRCGQPENGNRNFFIASLVADTTSSMFDPPQHQNPLTALGKHRILQL
                     VDMWFSAHPLSPLVSKTLLTSDVKDGTVDEALLAIILADAYHVLGGTSEQYGAISDES
                     QKLFEFATTQIKQRQLPLGDSEALSTAQTLFLIAWRELCLGHARRATCIVGYTCYMAS
                     RLAKTGKNTDMKRVKLNGVEIDLVKKEVLQNIHWLCLTTTTWAFMQFDQALALFGPDE
                     IPEFPCLDETTSALIRLDQASDNISTLSAQIQALRRLWPLSHIASTVSHIYILYFDMP
                     AKKVPNASWQEQHIHQLYDLLQSCADFPTLSVKIRDVLLQAVQAVERRITMLSSQLYL
                     LTAYHIIITHMLFSQNKTDQESLSLSSTAINAFCQSASALLALSYRSLDPSKGLMPVQ
                     RDDGVEFINMLVLGLDTCSRALVHIYDHLSRGSIGNQKEKAAFKKQLADYADKFHQIC
                     KSDAVSRCGSVMRPVKKRLKWAKLAFQHLQILPEPEQVLSSAQHRTPDSSIALNLDLP
                     HIEGLLLDPAFATARLGDLSSSDIVPDALLVDRQPVSGITDPFFVDDPIIGTLLGLSG
                     VTDTREQLYQDYTRLQQSKQSMGSEQDLLHIQNPMRLLPGDGESLDLVYRGPRGSPLS
                     LANTTDRPSELNSPYEMTEPIRSDMDNFTLSEQPLDNDLLLQLLSNSDDNMGTLYGN"
     exon            complement(932473..935042)
                     /number=1
     exon            complement(935126..935152)
                     /number=2
     exon            complement(935585..935615)
                     /number=3
     exon            complement(935692..935805)
                     /number=4
     CDS             join(938581..938885,938936..939314)
                     /codon_start=1
                     /locus_tag="AO090001000373"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000038"
                     /protein_id="BAE56897.1"
                     /transl_table=1
                     /translation="MSDPYAQHPHYAPPGPGPEANFYAPADSVYQNPPYDYEPQNPYT
                     QQSPPNQNYQYGSQYDLAQTPRSYPPQMSGPQQDYLNPASAGGFEQENNHRESNADYY
                     NAPTDEQDRHHPPDSRPQEADNTSDNEGTERNLAGALAGGAGGYVLGRQSNHGLLGAV
                     GGAILGNFVGDKMEDKPDDEEDGHHHRHHHHHGHHHHRHKHRHGHRHHSHHGHHRSHS
                     RHSSHSGSY"
     exon            938581..938885
                     /number=1
     exon            938936..939314
                     /number=2
     CDS             940562..941842
                     /codon_start=1
                     /locus_tag="AO090001000374"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000037"
                     /protein_id="BAE56898.1"
                     /transl_table=1
                     /translation="MPPPLIQHLTQALPQHCEPSSPFFATISAYLHTCIPTPLALISS
                     VLGTLSIVSWLFAQLPQIYKNVQLQSTSGLSIFFLVEWCLGDTSNLIGALLTRQATWQ
                     VIIASYYVLVDVTLVFQFFWYTHIKGRQGGYSSLSHSHNEGGTGGVLEGVSFSENNSV
                     NQTPSETTADSDAKDVKGRKEPIFGSYNGQSLSYSNEKLSSSRRSMLRKSSGPSLPIA
                     STRTVLLASMLCAVVANAAPTEPATEPHSHFLSLGFLGTLFSWMSTFLYLFSRPPQLY
                     KNYKRKSTSGLSPLLFMAAFSGNFFYSSSLLTNPNAWYDYHPYGGGGWADSDGNNRAE
                     WLSRAIPFFLGAFGVLFFDGFMGVQFLMYGTRDDESIIEIEDPKCGRSRWMRVRGWMR
                     GWIPSVSPTRDAHRRTPTESQALLEEDCDRYGTV"
     exon            940562..941842
                     /number=1
     CDS             complement(942999..945020)
                     /codon_start=1
                     /locus_tag="AO090001000375"
                     /note="serine palmitoyltransferase"
                     /old_locus_tag="AO070285000036"
                     /protein_id="BAE56899.1"
                     /transl_table=1
                     /translation="MPRRSVNSSANNPSNSQSTSSNSGKGGITFKAPTTKPSLLSQLF
                     STSPKSKSDSQSANVAARGASGNAHPTSISSASLSLPTISLSTATAGNPNMDEPPTTL
                     FQPPSPEEARRQAKANAQFGTIGHPSHRYSSQHPGGVFPEPIMDEPPYYYLLTTYISY
                     LILIAFGHVRDFFGKRFREENYRHLKPRNGYGALNSDFDNFYVRRLKLRINDCFERPV
                     TGVPGRYITLIDRATDDHNKHFYFTGTTTDTLNLSSYNYLGFAQSEGPCADLAEESIR
                     KYGITAPSTRAEVGTQDLHMEVEDLVAKFVGKEASMVFSMGFGTNANIFPALVGKGDL
                     IISDELNHASIRFGARLSGASIGMFKHNDMKDLENKLREAISQGQPRTHRPWKKILVV
                     VEGLYSMEGSMCNLPGLISLKRRYKFHLFVDEAHSIGAIGPKGRGVCDYFGIDTNEVD
                     ILMGTLTKSFGANGGYIAADKNMIDQLRAANSGVIYGESPAPAILSQISSALRIISGE
                     IVPGQGEERLQRLAFNSRYLRLGLKRLGFIVYGHDDSPIIPVLLFNPAKMPAFSHEML
                     KRKISVVVVGYPATPLVSSRARFCVSAAHTKEDLDRVLTACDEIGNVLQLKFSTGVAG
                     GALPSNEDVTPPPEMEKEWHRKRDPVAPPRWRIEDVIRRGVQDAKGPLY"
     exon            complement(942999..945020)
                     /number=1
     CDS             join(946666..946887,946985..948835)
                     /codon_start=1
                     /locus_tag="AO090001000376"
                     /note="acyl-CoA synthetase"
                     /old_locus_tag="AO070285000035"
                     /protein_id="BAE56900.1"
                     /transl_table=1
                     /translation="MSSNGVPTGSKELWRHSSPQDTQIYDFMMKLNAEHNLSLKSYND
                     LWRWSISKPALFWERIWHYTAIKSHKPYDRVLESDGDLFPRPNFFEGSRLNFAENLLY
                     PASALDENEVAIIAATESEREYVSWKELRERVRQCASSLKEAGLQSGDRVAGFLGNHT
                     NTVVAMLATSSIGAFWTGVSPDTGVHAVLERLKQIEPKILFADNASLYNGKVHGAEAK
                     IRQIVPGLPNLELLVVFETIKSHQINLEELSPAQGKVSTYESFLSAASDPSAPLEFAS
                     LEPGHPVYILYSSGTTGAPKPIVHGSLGTLLQHKKEHMLHCDIRPGDRLFYFTTVTWM
                     MWHWLVSGLASGATIVLYDGSPFRPFDSEGGNGEMAMPRLIDELKITHFGTSAKYLSI
                     LEQASLNPRKHPHRPVTLQTLRAIFSTGSPLAPSTFEYVYSSFHPDIMLGSITGGTDI
                     LSLFCSCCPILPVYKGEIQCRSLAMAVSVYDYAGNDISASGEPGDLVCTKPFPAQPVM
                     FWPPGAVGEEKYRKSYFDIFGPSVWHHGDFVRLDPQTGGVVMLGRSDGVLKPAGVRFG
                     SAEIYNILLKHFAEEVEDSLCIGRRRDGIDTDETVVLFVKLASQEKTIPQELAARIQA
                     TIRKELSPRHVPGIVDACPEIPVTSNGKKVENAVKQILCGLNIKIGASVANASCLDWY
                     RAWATANS"
     exon            946666..946887
                     /number=1
     exon            946985..948835
                     /number=2
     CDS             join(949291..949395,949469..951115)
                     /codon_start=1
                     /locus_tag="AO090001000377"
                     /note="mitochondrial processing peptidase, alpha subunit"
                     /old_locus_tag="AO070285000034"
                     /protein_id="BAE56901.1"
                     /transl_table=1
                     /translation="MRRSVLRAVESAKPLARAPRSVSRSFATVNEAGSKDPVELDQIT
                     TLPNGIRVATESLPGPFSGVGVYVDAGSRYEDESLRGVSHIMDRLAFKSTKKRSSDEM
                     LEVLEGLGGNIQCASSRESLMYQSASFNSAVPTTLGLLAETIRDPLITEEEVLQQLGT
                     AEYEIGEIWAKPELILPELVHMAAYKDNTLGNPLLCPEERLGEINKAVVDKYREVFFN
                     PDRMVVAFAGVPHDVAVKLTEQYFGDMQGKKSSNGPVLSGTGIETTLSNSQSAVEEGQ
                     VPTIPQFTPSSTTSTTPASPKSESSLLSKLPFLKSLSGSQKGSVSPLDPSLVEPSTFN
                     LTRPSHYTGGFLALPPIRPPANPMLPRLSHIHLAFEALPISNPDIYALATLQTLLGGG
                     GSFSAGGPGKGMYSRLYTNVLNQHGWVESCIAFNHSYTDSGIFGISASCSPTRTPEML
                     EVMCRELQALTLDNGYSALQAQEVNRAKNQLRSSLLMNLESRMVELEDLGRQVQVHGR
                     KVGVKEMCDHIDALTVEDLRRVARQVFGGNVQNKGQGTGKPTVVLQEGELEGYKLRSF
                     PWEEIQERIARWKLGRR"
     exon            949291..949395
                     /number=1
     exon            949469..951115
                     /number=2
     CDS             join(951564..951678,951891..952180,952432..952488)
                     /codon_start=1
                     /locus_tag="AO090001000378"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000033"
                     /protein_id="BAE56902.1"
                     /transl_table=1
                     /translation="MVQLQEVEDEHYAQEKPQVTKNNVLLASDDEDDDYTDTESEISE
                     DSDIELDGETFYERLSALKDMIPPSARRQVNNTVSSITSFTKSSLMFSGRALWVISTS
                     AFLVGIPFALAYAEEEQYVQMEREQGMIKGANEMLTPGAISEEQKQAQPTL"
     exon            951564..951678
                     /number=1
     exon            951891..952180
                     /number=2
     exon            952432..952488
                     /number=3
     CDS             complement(join(953430..953463,953845..954437))
                     /codon_start=1
                     /locus_tag="AO090001000379"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000032"
                     /protein_id="BAE56903.1"
                     /transl_table=1
                     /translation="MQPRFRQRNEDSDVESSVASDEDLDRYEDDFVLEDGTLGAPSSL
                     PDMPFEFTRHAYKQLKDYFQDAVEWMVFNQLNPAFERSSPVYQVAFSKLEDEVKGRTG
                     SQLISSVWNANFRNALMARPHMEVTGYPTLENHPCDACNRSGHPASSDMKLHGKAYSL
                     ETFEPLSDEASDAEEDGQERDRNGHVLPDENTRFLLGRRLDSASSKSP"
     exon            complement(953430..953463)
                     /number=1
     exon            complement(953845..954437)
                     /number=2
     CDS             join(957548..957679,958654..959125,959190..959392,
                     959506..960007,960060..960460)
                     /codon_start=1
                     /locus_tag="AO090001000381"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070285000030"
                     /protein_id="BAE56904.1"
                     /transl_table=1
                     /translation="MTERRLRRLGLFNREPRKGVRDVFDLESHGCIREGSRLPKERIP
                     SGILIEAATQQSWRSTSWALKEPITGSCISVSIFRFNTYLGDPRYISCVAAACMVLYG
                     YDASVYNSVQGSKNWVLYFNDPDDNMIGAVNTAYTVGAIFGGFFLGGPVADFLGRKYG
                     MAIGCVMVIASTFMQTFAPRGNIACFLAGRCIIGIGQGIALTAGPIYIGELAPAEIRG
                     KIMTFWQMFYSVGSFICFWVNYGCTEHKENLGEWDWKMVVIFQLLVPCLILKARKALQ
                     RVREPHEVEEELLKIREAIEYEKEAISGSYSALWKDKSLRKRMALALVINAGQQITGQ
                     GTLNTYSTKIYQKVFPNAGQIALINALNATFGIIFTLNAVWIIDRFGRKFLLIVGGIG
                     MGICMIIVAAVETETPSIGDPGSDVKSTPVGISIVFLLFLFIFFYKPSWGATVWIWTS
                     EIFSMNVRAQAVGMASQTQNVANAIVQQFFPTFLNNCGFYAFYMFAGINFLLSVFVFF
                     FIPETKQVPLEEIDALFGGANHVTHGEELVAGEKQLQVMQSNTGTEKAEAVTIENAPT
                     RQH"
     exon            957548..957679
                     /number=1
     exon            958654..959125
                     /number=2
     exon            959190..959392
                     /number=3
     exon            959506..960007
                     /number=4
     exon            960060..960460
                     /number=5
     CDS             complement(join(961379..961820,961881..961979,
                     962040..962114,962164..962218,962278..962383,
                     962436..962470,962532..962661))
                     /codon_start=1
                     /locus_tag="AO090001000382"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000029"
                     /protein_id="BAE56905.1"
                     /transl_table=1
                     /translation="MHLNFATQGIYMWAIGLVKISIGLFLLRFAPRKGYKIFIWVIIV
                     LMLLYTTICFLTLVFQCKDIRSIWDMSVKSKCFTPTQLLELSYTNTALNILTDLIFAI
                     LPAFMLRIHNRHLQVNRRVKASLVCILGLGIFACAAAFVKLSVLPNYGRTGDFLWDYS
                     TLTIWVVVESNMGIIAGSLPTLKPLFKQVLGSYGSRSKTRPYNTYGSKQYRLRSLSRS
                     RQGQSQTLHSAPRSRTEAEADQKLPTSRHFATTTTTTTTTYPGNDSSNSSEEYILSPT
                     GPEGIMCTTEVMVSHTSEARNSARGKKAAHFGRDDMV"
     exon            complement(961379..961820)
                     /number=1
     exon            complement(961881..961979)
                     /number=2
     exon            complement(962040..962114)
                     /number=3
     exon            complement(962164..962218)
                     /number=4
     exon            complement(962278..962383)
                     /number=5
     exon            complement(962436..962470)
                     /number=6
     exon            complement(962532..962661)
                     /number=7
     CDS             join(965091..965501,965560..965645,965706..966435)
                     /codon_start=1
                     /locus_tag="AO090001000383"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000028"
                     /protein_id="BAE56906.1"
                     /transl_table=1
                     /translation="MVALQALSLGLLASQALAFPAASQQAATATLPTTASSSTAVASS
                     QLDQLANFAYNVTTDSVAGGSESKRGGCTLQNLRVRRDWRAFSKTQKKDYINSVLCLQ
                     KLPSRTPAHLAPGARTRYDDFVATHINQTQIIHYTGTFLAWHRYFIYEFEQALRDECS
                     YTGDYPYWNWGADADNMEKSQVFDGSETSMSGNGEYIPNQGDIKLLLGNYPAIDLPPG
                     SGGGCVTSGPFKDYKLNLGPAALSLPGGNMTAAANPLTYNPRCMKRSLTTEILQRYNT
                     FPKIVELILDSDDIWDFQMTMQGVPGSGSIGVHGGGHYSMGGDPGRDVYVSPGDTAFW
                     LHHGMIDRVWWIWQNLDLRKRQNAISGTGTFMNNPASPNTTLDTVIDLGYANGGPIAM
                     RDLMSTTAGPFCYVYL"
     exon            965091..965501
                     /number=1
     exon            965560..965645
                     /number=2
     exon            965706..966435
                     /number=3
     CDS             complement(join(967337..967556,967658..968172))
                     /codon_start=1
                     /locus_tag="AO090001000384"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000027"
                     /protein_id="BAE56907.1"
                     /transl_table=1
                     /translation="MDSFDLAKAPPEIRAYATPIILLNLYTNASWLYVYFGMVYRSVK
                     DKSYAMPLYSQCLNIAWEITYGYIYGDDWMLFATFLVTFPTDCLVIWAAIYHGAKEWD
                     RSPLVQRNLLWYYVIGTGIAVALHMCAASELGVEKAFFAGAIGCQAVLSVGYLGNLIQ
                     MGSTRGFSMHLWFFRFTGSLTLVPEFYLRVKYWPERFGFLGQPLMLWCCAVFLGFDLV
                     YGILFWYIRRQERETGMLLADGRKRK"
     exon            complement(967337..967556)
                     /number=1
     exon            complement(967658..968172)
                     /number=2
     CDS             complement(join(969149..969791,969885..970156,
                     970224..970324,970382..970477,970571..970922))
                     /codon_start=1
                     /locus_tag="AO090001000385"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070285000026"
                     /protein_id="BAE56908.1"
                     /transl_table=1
                     /translation="MSTDPEKVDECTIEDIKSPSEAPDRSDRDAERRLLRKCDLHVVP
                     ILTLLFMFAFLDRINIGNARLMGLEDDLGMSGHQYNIALFVFFIPYILFEVPSNMILK
                     KVKPSWWLSGIMFAWGTITICQGVTASFSGLVVCRVLIGLFESGFMPGAVYLINMYYR
                     RHELQWRLNLFFSASIIAGAVSGLLAYAINNMSGLAGYEGWRWIFIIEGLATVVIAAI
                     SKFIIVDWPESATFLNDDERALLLARLKEDQGEARMNRLDKKSMRRTFSDPKIYLGPI
                     MYFGIVNTGYAVSFFTPTILHQLGWTAVRAQVMSIPVYVVATITTLSAALLSDLLRHR
                     YLFTLTGCLVATMGYVILLAQSTVPVGARYFAIFAITSGGYLTQPILMGWLSNNMAGH
                     YKQSIASAMQIGFGNCGGLVASNIFFEDEAPGYRTGYGVSLGMTWICGIACALFLGYL
                     VRENRVRGRGGRDSRYQLPREELENLGDDYPGFTFTY"
     exon            complement(969149..969791)
                     /number=1
     exon            complement(969885..970156)
                     /number=2
     exon            complement(970224..970324)
                     /number=3
     exon            complement(970382..970477)
                     /number=4
     exon            complement(970571..970922)
                     /number=5
     CDS             complement(join(971340..973245,973295..973727,
                     973808..973838))
                     /codon_start=1
                     /locus_tag="AO090001000386"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000025"
                     /protein_id="BAE56909.1"
                     /transl_table=1
                     /translation="MSRPKKVAIIGAGPSGLVAAKTLLHNYPKGTFSPTIFEKGHEIG
                     GLWPIEPRDITTETTTPGQRPHNGFVDPSMPTNQSRFTVTFSDLAWESVIDGADIPMF
                     PQAWQAGKYLQAYAERYIPKETLRLGHKVVGSTREMSGGSRPLWTIQWVLERWDNEKG
                     KISTDEEVESETFDYLIVASGYFSTPYTPDIPGLPSFVEKTFHSSAIHTKEDIYLMLE
                     KCGATKDGSGKLVVIGGSISGAEAASALALFLSSMSATAFQYRGYEVHHICTRPFWTI
                     PYYLPHAAPQDDIQEKTVQFIPLDLVLHDLARRPPGPVQYNFGPVSQQQETKVNEYFL
                     SLLGDQHAGYGNIGGGSRGGTNNTQPSLIAISDDYAEYVQSGSVRPTIGRVCAINRTQ
                     SGQANVDIKSPDGEMTTLQNVTAIVTATGFTPFASLSFLPEDVLSRLEYSAEDSYFPL
                     ILDEKGTSNAEVPDIGFVGLYRGPYWGVMEMQARRVAESWYRADSEQGIQFSTEELKN
                     KVQERQRMRDYKNADPDSRGQFPMGDYVGLMETFARDMGIPRAPLPEVGERLGPVLPT
                     RYMAEGQTKPSMLAESHRALASLRDTLTYDSDTSRTGLTRAIFRALHGTWNFSRVSSR
                     YDGEVTGTARFSPTYPTYPKDEREYTYDEVKRVDRTPRSPDRSIFRLGQTSAHSGEMQ
                     ISILNSNSDVELGEAPQILHELRFVGPPRLEYEGSGREEYVVRVGGCMSSEDNNRRGF
                     EHSYEYVFRLEGVAISSWECNVEYKKTRTDSFGDSDGRVNEWRRTVYRR"
     exon            complement(971340..973245)
                     /number=1
     exon            complement(973295..973727)
                     /number=2
     exon            complement(973808..973838)
                     /number=3
     CDS             complement(join(977274..977462,977752..978348))
                     /codon_start=1
                     /locus_tag="AO090001000387"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000024"
                     /protein_id="BAE56910.1"
                     /transl_table=1
                     /translation="MSRSRLPPTPAMSGELIVKDQVSVDAVDSFALPPAAMSPAKMES
                     ASRRSSKSDQSAYFPASPTSPNLNMGRGANPPRQTGIKRPLEDFDLPPPPTRTRKIIQ
                     MKPKTQTQSQAKPAPTTNKPSKESGKSTSNNNNVSPATSKKKQPSATSAAGRKIARKT
                     AHSLIERRRRSKMNEEFATLKDMIPACRGQDMHKLAILQSYPLNKHSYRFLFDPAESS
                     VGSDSPLRQHSTVVPWILGSNVNQPLAGAPTTDSSCVFSRDGP"
     exon            complement(977274..977462)
                     /number=1
     exon            complement(977752..978348)
                     /number=2
     CDS             complement(join(978780..979119,979665..979885))
                     /codon_start=1
                     /locus_tag="AO090001000388"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000023"
                     /protein_id="BAE56911.1"
                     /transl_table=1
                     /translation="MNKQSLLNALVGILNSTSILRTGVQEPSTSDSTSLHATPTNVTL
                     SATGVSNCTQACALGGLVCVVALPHEANFCGSTNQHGRSTLMAPFPRSAEGGVVANGR
                     ITVLKPGSKKSEAEHEPQSDRRVGSGQPKSRAPLPVIPYYPDPIRRGNGTAWALQARD
                     TSLGGQPKATASFSPNSQSRRSSSYL"
     exon            complement(978780..979119)
                     /number=1
     exon            complement(979665..979885)
                     /number=2
     CDS             join(982115..982605,982744..983932)
                     /codon_start=1
                     /locus_tag="AO090001000390"
                     /note="amino acid transporters"
                     /old_locus_tag="AO070285000021"
                     /protein_id="BAE56912.1"
                     /transl_table=1
                     /translation="MGLNEEKTTKLEPSTSGEGGSIHVGESMGTLHRRLGNRQIQLIA
                     AGGSIGTALFISIGGGLAKGGPGSLFIAYTLYSCILGLVNNSIAEMNTYMPVSGGFIR
                     LAGYWVDDALGFLAGWNFFFYEAFLIPFEITALSMVMSFWNETVTEPGPTAGICAAVI
                     VCYATLNILAVKFYGEAEFWLSGGKLILIFILFAFTFVTMVGGNPQHDAYGFRYWNNP
                     GPFAEFHTTGDLGRFEGFLAALWSASFCVVGPEYISMVSAEAQRPSIYIKSAFKTVYY
                     RFCIFFVVGSLAVGIVVAYNDPALVNIYFGDGDSSTAAASPYVIAMENLGVSVLPHIV
                     NALIFTSIFSAGNTYTYCATRSLYSLAVEGRAPRILRYCNKSGVPVYCFCVVMLFPFL
                     SFLQVGSGSAQAITWFVNLVTGGGLINYFIMSVTFINYYWACKAQGVDRKKMPYYGWF
                     QPYGAYLAVTVHTLVIIFYGYSSFTPWSVSNFFSNYTMQLVAPCLFIFWKVVKRTRYV
                     RPHEVDLVWERPGIDAYENSITTPPVGFWTEMIGLVGIGRKKNSQDPERDN"
     exon            982115..982605
                     /number=1
     exon            982744..983932
                     /number=2
     CDS             join(984135..984198,985308..985759)
                     /codon_start=1
                     /locus_tag="AO090001000391"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000020"
                     /protein_id="BAE56913.1"
                     /transl_table=1
                     /translation="MPIRCTTSPMDSVSRSLDQPAKIQSPPTLLLLENTGNALRRYTH
                     DDVTYPPVDPSFKSPFLGWELNEVVRFLREYATGTVVDESVFLVADQRTAEDESLLLV
                     QSLRDGESVEFVRVAAEFVNTQAVAMAVATTDVQELRSLIDEGGVFRGGSGRGGNLLP
                     RKGGKAPRKQL"
     exon            984135..984198
                     /number=1
     exon            985308..985759
                     /number=2
     CDS             join(987606..988120,988168..988324,988344..988890,
                     988982..989499)
                     /codon_start=1
                     /locus_tag="AO090001000392"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000019"
                     /protein_id="BAE56914.1"
                     /transl_table=1
                     /translation="MSNITTEPTKSRRQNKGLACEECRSRKLKCDMSQPQCSTCRNMG
                     VPCITNTARRPRGPRKGHVNVLRSRIGGSYLCEKLPDISANLIVRSTASLERQLYENS
                     EAQPSRRENSTSTRQALEVDQVVKVDLNEIERVSMVHSQGSPDDFFPDTQSIGLPKWP
                     SVIPSLELDSECANPIKQYTHIDVNFMSDRRQHKATGTGLPGDDTAVSASSPSSSAVT
                     PRARRSIKRKDELTCGHRDDLFFDRAYPFAPIVHQQRYYARATHESDAREPLTSLQYA
                     IRTLAASMGTQFQGVLPLLYTHTCCLLDVWEQKMPNEALPIEVVQARLLLVLYEILKS
                     NPSKGWISAGRCFHLVHLVKLDQIDNPNSWQTSNLSWIEVEERRRTFWTAYTLDRYAN
                     LVNGLPLAMNDQMAKTAFRHQQAVTTEYLAPAIAKKGDQQLSPYAKSIVMLTILARCL
                     SHRNQCNVERILDPTSQECIVRHRALDTILSHEIQTSLSSAAAGFEPCDPTFLFTNML
                     AQTAVLVLFTALDSVPEVAEMYQDMYGSYETKASMATERVLSQAQKLSQVGSFKASLV
                     SHEYSSISDKRN"
     exon            987606..988120
                     /number=1
     exon            988168..988324
                     /number=2
     exon            988344..988890
                     /number=3
     exon            988982..989499
                     /number=4
     CDS             join(990265..990350,990408..990723)
                     /codon_start=1
                     /locus_tag="AO090001000393"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000018"
                     /protein_id="BAE56915.1"
                     /transl_table=1
                     /translation="MTQKTIFQGDTKAQSHVSVGSSIYSEKQGASCTVHGSSQTPHLD
                     RQLQQPQTKEILQALTVALNDIADERQCTKCAVETASGLLTGYVREVKAAKKNGQYSK
                     EEKKALKKEIKDLAKGVKRDVKALWLEGNSN"
     exon            990265..990350
                     /number=1
     exon            990408..990723
                     /number=2
     CDS             complement(join(991137..991195,991230..991841,
                     991903..992454,992523..992615,992661..992761,
                     992951..993004,993061..993860))
                     /codon_start=1
                     /locus_tag="AO090001000394"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000017"
                     /protein_id="BAE56916.1"
                     /transl_table=1
                     /translation="MIVNANDSTLHLPRILCLHGGGTNARIFRMQCRVLERMLHPHFR
                     LVFAEAPLPARPGPDVTSVYKDYGPFKAWLRVRPEDLAQNAHDIVRKIEESLAAARLA
                     DDCRGATGDWVGLLGFSQGAHLAVGILATQQELRRRGEDDKVWPAYRFAVLLAGRGPL
                     RWLRPDLPMPRGFVDAGQCTTGGEPLVAVDLLQDNRLRTPTVHVHGQTDPGLELHRRL
                     LYQNCDTCMTRLVEWGGNHRVPIKVRDAASVVEQILSVAQQTGVLDGSLARLHTLYAI
                     QGKYEVPSTYKSGLTLFGLFYHLNIRRKGCPKFGRPQRMIFRKYGALWEPGAKMLCFI
                     KLQWYYVCQDFNIKITADLQTRIMIVPTPDIATTPEIAIVGGGIVGLVLAAGLTRRGV
                     QVKLYEQARNFREIGAGIGFTKNTVGCMEKINPAVVTALRSGGAVNVSLDQQDPKSYL
                     RWIDGYGQQREGDPMYQKPLLKLDAGVKGWETVRRDQFLEDLVKVIPEGVVHLRKRLD
                     TIEDNEDVDKVYLNFTDGTRAEADAVIACDGIKSRARQLLLGLDNPASYPQYTHKVAY
                     RALIPMDKVVAAIGEYKTFRQHMHVGPNAHLIHYPVNTNTIGATVVVSDPNDWPQDKP
                     TTARASRKDVFEALAGWCTPVRNLVELFPEELDQWALFDLFEYPVPKYNKGRVCLMGD
                     AAHASSPHHGAGASFGIEDALCMSTLMSELIMDLREHRTSKATALRTAFETYDKILDA
                     FATFSNNRSGLTRLSA"
     exon            complement(991137..991195)
                     /number=1
     exon            complement(991230..991841)
                     /number=2
     exon            complement(991903..992454)
                     /number=3
     exon            complement(992523..992615)
                     /number=4
     exon            complement(992661..992761)
                     /number=5
     exon            complement(992951..993004)
                     /number=6
     exon            complement(993061..993860)
                     /number=7
     CDS             994737..996038
                     /codon_start=1
                     /locus_tag="AO090001000395"
                     /note="monocarboxylate transporter"
                     /old_locus_tag="AO070285000016"
                     /protein_id="BAE56917.1"
                     /transl_table=1
                     /translation="MSDTTARSEKSVDAKPPQPQEPPSRPAGPPSPPPNGGTMAWLNV
                     LGSFMLYFNTWGILNTFGAYQTYYESGALFTASSSNISWVGSIAAFMLLFVGLFVGPI
                     YDRGFLRTLLIVGGFMVVFGHMMLSLCKTFWQVLLAQGFVVGIGTGCLFVPCVAIIPQ
                     YFSTKMGMAMGIAASGSALGGVIYPVVLYRLINEIGFPWAVRVIGFIALGTLLIPLSV
                     MKLRVKPPKVRAMLDPTAFTDAGYMAFILTSLVAYMGLFVILFYLSYYSAAERITDQS
                     LAFYLVTIFNAASVFGRTIPNKMADKLGPFNLLVPASLLSGMLMLVMMAVHSKGAIIV
                     MALLSGFMSGALIGLPPMCLAMLTKDKSRLGTRVGMGYAIIALGVLISGPSSGAILRT
                     GGDSLNWHSLWTFGGVPTCAAGLLYAVIRVAKYGPKLAIKA"
     exon            994737..996038
                     /number=1
     CDS             complement(join(996251..996259,996338..996370,
                     996376..996687))
                     /codon_start=1
                     /locus_tag="AO090001000396"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000015"
                     /protein_id="BAE56918.1"
                     /transl_table=1
                     /translation="MSEKYDWLVQIPVNASDMKAWANARDAHLLHLKPYVADGTIVFA
                     GPTLAAHPKEPEDKMEITSSVMMFRARTEEEVRAIVSKNAFVEAGVWDMDRAVVAPFK
                     CGDSALKFYLSSECV"
     exon            complement(996251..996259)
                     /number=1
     exon            complement(996338..996370)
                     /number=2
     exon            complement(996376..996687)
                     /number=3
     CDS             997401..997850
                     /codon_start=1
                     /locus_tag="AO090001000397"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000014"
                     /protein_id="BAE56919.1"
                     /transl_table=1
                     /translation="MGSNSAVLPTTIPTVDISPFLDENASPEAKEQVVDAMRDACTTF
                     GFFYLVGHGIPEEDRQAVLNCAKRYFYLPKEDKMETWIGKAMGRSFRGYEPPALQVHQ
                     EGLLPDTKEVSRHPRDILRAVLIVKGLHYRPRDTCRRPRSWYISHGS"
     exon            997401..997850
                     /number=1
     CDS             join(997915..998080,998139..998506)
                     /codon_start=1
                     /locus_tag="AO090001000398"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000013"
                     /protein_id="BAE56920.1"
                     /transl_table=1
                     /translation="MLEMVKVILKVLARGLPEHWGCSPNVFDELTINPSAPLRLLHYA
                     PQPVKHDNQFGVGDHTDFGNVSVLLQEEDTEGLEVFYPPTETWVPVPVKEHSYVINMG
                     DMMQKWTAGYYRSARHRVVNHNVRSRYSAPFFLNGNLDLKCRALDGSGVETVIGEHIR
                     RRLMETIGGEAGRKLGL"
     exon            997915..998080
                     /number=1
     exon            998139..998506
                     /number=2
     CDS             complement(join(998848..998865,999000..999431))
                     /codon_start=1
                     /locus_tag="AO090001000399"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000012"
                     /protein_id="BAE56921.1"
                     /transl_table=1
                     /translation="MTAREAWNKTWDVNVTGAHIMTTTFLPLLLKSRDPRLLFITSGL
                     SSLQASSDSKNPKNVFPPAGLPKPLPFVGYRSSKAGLNMVMVEWAKALENDGVKVWSV
                     APGLLATGLGGDTELLKRLGAQDPSIGGDTIRRVVEGERDGESYRSL"
     exon            complement(998848..998865)
                     /number=1
     exon            complement(999000..999431)
                     /number=2
     CDS             join(1000125..1000536,1000610..1000641)
                     /codon_start=1
                     /locus_tag="AO090001000400"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000011"
                     /protein_id="BAE56922.1"
                     /transl_table=1
                     /translation="MSEVLVITCPSGKQCSLLIPLLYNKGKFHLRLAAHSEASAQKLK
                     AQYPDADVVTTDLQSLSDCRKLLHGATAINAVLPSLHSHEKEIGFNLIDATVAESRRE
                     GNVIKHFVFSSVLGTQHRNLLQHDLKSYVEERLFLMMGTDELKSS"
     exon            1000125..1000536
                     /number=1
     exon            1000610..1000641
                     /number=2
     CDS             join(1000815..1001113,1001224..1001266)
                     /codon_start=1
                     /locus_tag="AO090001000401"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000010"
                     /protein_id="BAE56923.1"
                     /transl_table=1
                     /translation="MPISETEIIQIIEKRIGKKIELKTPSFETGVNKLIRALYGGEEK
                     GDGELGLGLASEGDLRGDLVRDTVEHLILFYNRRGLKGSPNVLRWLLGREPTSVVQAL
                     ELPCLLQDSCM"
     exon            1000815..1001113
                     /number=1
     exon            1001224..1001266
                     /number=2
     CDS             join(1001844..1002491,1002548..1009270)
                     /codon_start=1
                     /locus_tag="AO090001000402"
                     /note="polyketide synthase modules and related proteins"
                     /old_locus_tag="AO080567000102"
                     /protein_id="BAE56924.1"
                     /transl_table=1
                     /translation="MVNSGSNIKSESLTLVFGPQDPNLDNTFLQSLRTTLLETPELQW
                     ILETLTQLPQEWQKISDAHSELAAFQGQRYLQLLNEWVRRGTLPSNLFPLPNILVTPL
                     VVTTQLTQYTKFITQLNPGITSNDSLQGALKLDTETAGLCTGLISSAAVAISGTLAEL
                     QKHGAAAIRIATAIGALVDAGDSEREDGDKWESLAVGWTAHGTESKLESIVDGSPEAY
                     VSVISEARLATLTVLKADTPELLEKLKAAGVIFTKTALRGPFHCGKRKDQAASLLQLF
                     DSDPSFQFPHASQLAFSTRSADSGKFRIEDKLHHEAARAMLTDKADWHKLFTALHEST
                     STRPSLTICFGSQRFVPQWFLRKLGPKLAYAADLDANPGQLPPALGALLGPIEDDAIA
                     VVGMACHFPGGSDLNEFWDTICAAESQCTEVPSDRINFDYAAWRENDEKRKWFGNFVR
                     DYDAFDHKFFQKSPRETVSSDPQHRMMLQVAYQAVQQSGYFSKAAIDQHVGCYVGIGV
                     VDYENNVACHAPTAYTATGNLKSFAAGKISHFFGWSGPGVTIDTACSSSALAVHHACN
                     AILNGECNAALAGGVNVMTSPEWYQNLDGASFLSPTGQCKPFDEAADGYCRGEGAGAV
                     FLKKLSAAMEDGDQVLGVIRGSSVNQNANCSAITAPSVQSLTGVFNTVLRKARLDPKQ
                     ISVVEAHGTGTQVGDRAEYDSVRRVLGGPGRAEPLSLGSVKGLIGHLECASGVAALIK
                     VLLMIQNGAIPPQSSFRTISSKLDASPLDNIEISTCLRPWATGSRAALINNYGASGSN
                     ASLVITQADHAEVQSEAPRVVEAFAGKRPFWFSGIDDQSLRSYAAKMVRFLQTRKPND
                     NRFTIDNLSYQLARQSNRSLGQSLIFSCASVAELEAKLASFADGWSELKSTQRQQSSR
                     PVILCFGGQKSNFVGLDREAYDHFKVLRTHLDQCHEICLSLGLGGIIPAIFERTPRSS
                     IVELQTMQFALQYSCAKSWIDSGVQVAALVGHSFGELTAMCVCGTLSVRDTLKMIVGR
                     ARLLEEKWGLDRGSMMAVDGELESIQKLLRETNAAHTTEPPVNIACFNGPRQFTLAGT
                     SKAMAVVKQTLSSNPFFSSIKAKQLDTTHAFHSVLVDPLVPELEKLGEDLIFRSPVIP
                     HERATQEAIRDPPAFNVFASHMRDPVYFDQAVQRLAQKYPSSIWLEAGSGSGVTALAS
                     RAAGSCGMVFQSINITGSGAVQNVADATFNLWKEGLNVSFWGHVGQTVKSLLLLPPYQ
                     FAKTRHWLERRKPEVKEAAPVAPWPKSPKGLWTFMGFQDSGNTHARFQIHSTSDEFKK
                     YVGAHLVAQTAPICPSMFQHVMAREALVSLLEGSDIIPELENMENDAPLCLDESRFVW
                     LDAHRTDSESTSWEFRITSVDKDNAGSNATQHVSGRLLFRSLGDSTSVFTTFERLVNR
                     RRPLDLLDGQEAEDVIQGSRNIYKVFAPVVQYNDDSYKGLQKLAASGNESAGRIVKQD
                     AEQTILSVGLADTFCQVAGIYLNCMAECEDGKMYLSNRVERWIRSPNVPLDSRPNQWE
                     VHAIHNRPSPKAYVSDLFVFDSATGKLVWVIIGLHFVEVSIAGMSRLLGRYTGVQSTQ
                     QVAALAPEPLPVLPGIASPAAVPVAKPPANKPKTKTSTSSPTKKAPGRDVLNGVRELF
                     CNLLGLEPEDIRPGSDLVELGIDSLLAMEVAREVEKAFSIKFELEELMQMTDVRSLVN
                     CIQASMGASDSSTTDGDLSDGFDEASAAGIQTPPSEPAEDVKIPSIGSAPITGHLSAD
                     SIIEAFTETKLLTDRFIEQNGLSGYSNYVQPKLTELVVAHTLDAFDQLGCSLRSVQEG
                     QIIKRLPYLPKHDKVIAVLTGLLEKARLIDLDGSTMIRTAAPLPTKSAPQLLQELLHE
                     YPEHAYDHKLTSLTGSRLADCLGGKTEAIQLLFGSAEGRELAAGMYGKSPINVAWLRQ
                     LQHFWQRFLAHLPQQQQEPINILEMGAGTGGTTAALLPLLASSGVPVRYTATDISPSL
                     VAGLRKRFKDYPWMRFEVIDIEEKPPTKLLETQHVVLATNCVHATHSLAVTTKNIHRI
                     LRPDGFLVMLEMTEAVPWVDSVFGLVEGWWLFNDGRTHALAQPDFWKRTLHANGYGHV
                     NWSDGQLPENSIQRIIIALASSESQNLVSICPPAPSITTADFAARQAVVDSLVQKHTH
                     DFAVPTSLPISQTNNDSFRCVLVTGATGSLGSHLVAHFAAQPDVRKVICLNRVSGSDA
                     TTRQLEALQSRGLQFNQNILLKIEAIETNSSAPMLGLSGNEYQHLVNCVTDVAHNAWA
                     MSMTRPARGFEAQFKALRNLIDLCRDAACHRRAGMEKIGFQFVSSVSVVGCHPFLTNE
                     AWVPEQRVNVASALPMGYADAKLICEKMLDETLHRYPDHFRTMAVRVGQISGSKVNGY
                     WNPVEHLVHLIKSSQSLGVLPDLDGVCPSIDLIS"
     exon            1001844..1002491
                     /number=1
     exon            1002548..1009270
                     /number=2
     CDS             join(1010372..1010665,1010737..1011297)
                     /codon_start=1
                     /locus_tag="AO090001000403"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000008"
                     /protein_id="BAE56925.1"
                     /transl_table=1
                     /translation="MFRSLLTLTKLASPQYIFPTVDPKIDGEECRHDCADCTVKWPSK
                     VKIDTTLPMYGYIKQFHTHVLVATGKTDWMGKVEQEKGSLMEAFKSEGGKSKHGRIMV
                     SASNLTPPEGEDGTIDSGKTTVLLLPSFTFVDRVAYGDVRHVVDTFIDNPKQESRLSS
                     RPCPHDYVVLLCSHQRRDARCGITAPLIKKELERHLRGHGLYRDLDDERPGGVGIYFV
                     SHVGGHKFAANVLIYRKKEQQMIWLGRVKPEHCEGVVKYTILQGKVVHPDSQLRGGFD
                     RMKGLTSW"
     exon            1010372..1010665
                     /number=1
     exon            1010737..1011297
                     /number=2
     CDS             complement(join(1011667..1011836,1011892..1011975,
                     1012030..1012266,1012343..1012957,1013016..1013175))
                     /codon_start=1
                     /locus_tag="AO090001000404"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000007"
                     /protein_id="BAE56926.1"
                     /transl_table=1
                     /translation="MESPRESATIVNDPNREEGNVQSETTPLLQKRASDVTGKIISTN
                     VTLFVAGLNDAALGVLVPYILPTYGVTLFQLSQIYLINCAGCLTASFSNIHVCSRIGT
                     GGTLVLGAVIQTLGFALMYWNPPFALFTAAFFLTGMGGAYQDAQANTFTTTVDNAHRW
                     LGILHAVYGVGTIISPIVANVIASRTPVWHDFYFVMLGLGLLNLCLLRWTFREGLFKP
                     NKRNASGTAASELKATLSNKAVWILSGFFFLYVGAEVTVGGWMVQFIVSVRNGDPKEV
                     GYIASGFWTGFTLGRVALADITHYFGERRMVFVYLTLAVTMQLLFWLVPNIVVIAIAV
                     FLLGFVIGPFYPIGLYVLTQVVPEDLRIGALGLTASLGQAGAAAFPFMTGAIASRAGV
                     EVMQPIMLGLLIGIGLFWALLPRQRAISL"
     exon            complement(1011667..1011836)
                     /number=1
     exon            complement(1011892..1011975)
                     /number=2
     exon            complement(1012030..1012266)
                     /number=3
     exon            complement(1012343..1012957)
                     /number=4
     exon            complement(1013016..1013175)
                     /number=5
     CDS             complement(join(1014838..1016076,1016158..1016349))
                     /codon_start=1
                     /locus_tag="AO090001000406"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000005"
                     /protein_id="BAE56927.1"
                     /transl_table=1
                     /translation="MLSVATSIFGLLATVPLAAAGSSPNVLYKDVVVVGGGASGAYAA
                     VRIRDDFGKSIALIEKQDILGGMVDSYTDPKTGKPYNFGVMTFLDAGNATGFFDRFGI
                     EVGSPSLLSVNTDYIDFKTGNPVNFTLPPMADQMAAMAKFLKIVEPWEHLMQPGYGNF
                     PEPDAIPEDLLIPYGDFITKYGLEAAVPLMYESTGLGLGDMTKETTMFVLQGFGASMA
                     RAMVGKQNQLAPASGRNQDLYDAVAEDLAGDVLYSSTVIESHRSNSSVILTVKNNKTG
                     ETTQIHARRLLLAIEPTAANMAPFDLDRNEKNVLSRFTYTNEYTGIVNNAAFAFNQSY
                     FNLPRTAAPDNYLALPEASFTARIDYIGGGDLFRVTIVGNSTLDTAGAKRLVQNDFNT
                     LLRSGRLAKTSNGEPLSWVDFATHGPMHARVSVADVKAGFFQKLNALQGGRSTWWTGG
                     AFSVNFQTTLWEFDELLFPELLKGLN"
     exon            complement(1014838..1016076)
                     /number=1
     exon            complement(1016158..1016349)
                     /number=2
     CDS             complement(join(1019356..1019509,1019666..1020331,
                     1020478..1021939,1022017..1022218,1022274..1022588))
                     /codon_start=1
                     /locus_tag="AO090001000407"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000004"
                     /protein_id="BAE56928.1"
                     /transl_table=1
                     /translation="MGASSLSPTSRPRVWNIVRQRFKDSLHDETDLEICMETFSLDIL
                     LSQLKSVAKAHRNENFLLARLSRFRPSLVYLNDFMTVLVLSFALDGKAGALLWGGICL
                     LLSLLAPLEEIFSEVQTMLEELIAALPGIHPFEDNIILDEKLETAMVGLYTELALFCA
                     RAISFIRVRRQHLSPIRQSWPQLSREFQQGLKRVQMLSQQVERETQRAATTAALKWNN
                     EIITLFQSLSTGHKHAGPELPCFHIPLTLNDRFYIREGLLDQISGTLNPKAGRSGPRA
                     LALYGIGGAGKTQTALQYAYRAREQYDAVLWISADSTVKMAQDYMAVARRLGVLPETQ
                     ETQDAFGAMAKMKSWLADTTCSWLLIFDNADNLEVLEYGWPNGVVGSILITTRDFNAS
                     LHPASQGLHVNVFDNKMGAEALQRLLGPSYDYPSNTPLIAELNEQLGGLPLALNQISN
                     YIRQQKMGLKDFLILYQNNQEKLHKRRPAAFDYQHTIGTVWEFALEKLTGNAAVLQRL
                     LAFLDPEAIDEATLCNAASTLSKQASLTDSSLMFLADPIDFEDAKAELLRAALIDRDP
                     RTKSISVHRLIQQVTLSGLSPVDKTRYFDLCCQLLCQAFPSSWTDQEHVWVYHAWKAC
                     EKCLRHVMFLAERFAQVEGGLKCLDTFIELLLRCSWYLYEAEYYEESLNLLQVCLQAL
                     ERKGDTNSSRYAQAHNVTGLVQVDLRENNKALQSLKIALKIREKILPPTDWGIGVSIS
                     NVGFAYTEQGDLTQAMNYLQRSLEFRKAINCRMVDNSYANIASCLLRMGKPNEAEAMY
                     TSVPDVRDLTDEQLLRENLPRYSSGMQLLSMIRQAQGRLDEALDFASKVLQFRRQKFG
                     SRFKTCDSLCHVAKLMLLTKKSMAALAEGHADAAECLRDAIRAKEIALGRLGSDYDST
                     LADDDEAAYTQLVAWLLW"
     exon            complement(1019356..1019509)
                     /number=1
     exon            complement(1019666..1020331)
                     /number=2
     exon            complement(1020478..1021939)
                     /number=3
     exon            complement(1022017..1022218)
                     /number=4
     exon            complement(1022274..1022588)
                     /number=5
     CDS             1025718..1027415
                     /codon_start=1
                     /locus_tag="AO090001000408"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000003"
                     /protein_id="BAE56929.1"
                     /transl_table=1
                     /translation="MELCQVLERLEGAHTQIERVGEICGASSISYGVLHYGDVIYMKS
                     VGLRDQAQRLPADSQTIYPLASVSKGFLAAAVGVLVDEGKLNWHVPIRTYLPQFDPVH
                     DRDLGQYANMIDLLSHATGIAQHELLHIGPFGSIISESSKLVHLLNALPTSNSHGSRF
                     RRWWLYNNHVSALASQVLESVSDGVCYPDYLEQRILRPLHMLRTFISTNKFDSDSNIA
                     LPYARLSDGSFAKLAFPEWLQETTHILASQGVTSCVQDLLIWAKAILERELWEQLQDK
                     EKLDRPFPPNNPLRQVTTIRHGHNPHPLDDALGHPSHYCLGWLGLTLPSSNLGMISFN
                     KETRRSCDHLDYVLGKDSPPLRVILHNGKAPGYNSAIYTFPETTSAIIVLSNGATDGD
                     PADWGAQILTQELFDLRPRMDIVSLAEKEAALSRRWFDDCILRPLREDLQRCERGSRA
                     GNSHLHDLKRYEGRYRNVYLLTTVNIRFDEPSLGLTVSFNHRTDKEYTLRFHNEHGFS
                     FLPPDRDSWLRDCMLEVFDYRTGILKFTHTDDGHISGLWWKWSAWEEASFFTKQPST"
     exon            1025718..1027415
                     /number=1
     CDS             complement(join(1030101..1031078,1031130..1031296,
                     1032273..1032384))
                     /codon_start=1
                     /locus_tag="AO090001000410"
                     /note="predicted protein"
                     /old_locus_tag="AO070285000001"
                     /protein_id="BAE56930.1"
                     /transl_table=1
                     /translation="MVPSSKSKCARYFATLMEAHWKYFGLSSFCQPTSNLVIHILRFR
                     RRRLLHNRYSKRYLNGELTDNDAWEILTTLGQLEFPAMFQIGLEYALFRTYAIPTISR
                     VLLRKSDFASPKTWYKRYSDTVALMVEALANPPASRRGHEAIARVKYLHHAYRESGSI
                     MEDDMLYTLGLLTIEPAKWIDRYEWDQTSQMEKCAMGTYWKSFGDAMEVSYDSLPSGK
                     KGFKDGLQFFEEIEKWCRDYEIQAMPHHPPGISDLQDQLIRNVALNGVPKILHNLARN
                     MILVLMDDQLRLSQPAPWVYALTHTVLVVRKYILRYLVLPRPLLFRQLRVNPDPEERS
                     PHRVRIWEAYPYYVAPTLWNRWGPYAWITWAQGRPLPGDDGDRFMPCGFNTRDIGPSY
                     MKGRGRNYARQENVKLRRGRRGQCPF"
     exon            complement(1030101..1031078)
                     /number=1
     exon            complement(1031130..1031296)
                     /number=2
     exon            complement(1032273..1032384)
                     /number=3
     CDS             complement(join(1036289..1036363,1036535..1036585,
                     1036682..1036737,1036869..1037453,1037518..1037929,
                     1037983..1038009))
                     /codon_start=1
                     /locus_tag="AO090001000411"
                     /note="predicted protein"
                     /old_locus_tag="AO070234000030"
                     /protein_id="BAE56931.1"
                     /transl_table=1
                     /translation="MPLIRKRRADPPPSNSEADSSGSEEDQSQGPTPQRRRTSNQNQH
                     QTQASASDTDDDATHHPSSTDVMVKKMVRLALASEYARQPIRRTEISAKVLGDQGVRQ
                     FKVVFESAQKVLREKFGMQMVELPGRERVTIHDRRGAFFLLYLKAAQKVEKSSSTNKS
                     WIVGSTLPAAYRRPEILPPTKAPWESTYTGLYSFIIAVIMLNGGSLPEQKLDRYLART
                     NADTYTPIDRTDRLLQRLCKEGYLVRTREMDGGEELVEYMVGPRGKMEVGTAGVAGLV
                     REVYGVGNTEEQREDFEARLARSLGIKLPEPREEEEEQNGDVEGEETQRRQSQRRGRT
                     EEEEESEAIVQILDMTFSNEYLYEGDPGNEHLEYQSKASATERTEHHSTIPTQATSIY
                     PTSPESNCL"
     exon            complement(1036289..1036363)
                     /number=1
     exon            complement(1036535..1036585)
                     /number=2
     exon            complement(1036682..1036737)
                     /number=3
     exon            complement(1036869..1037453)
                     /number=4
     exon            complement(1037518..1037929)
                     /number=5
     exon            complement(1037983..1038009)
                     /number=6
     CDS             complement(join(1038594..1039094,1039149..1039223))
                     /codon_start=1
                     /locus_tag="AO090001000412"
                     /note="predicted protein"
                     /old_locus_tag="AO070234000029"
                     /protein_id="BAE56932.1"
                     /transl_table=1
                     /translation="MPHAEPKKMGENAVNGEKVHSHFLDHLTSYPLVSDSISVFKSNK
                     YGAKSIEYADQSYDRIAKPFLPYFSKPYGYIAPYLARADSLGDQGLSQIDSRFPLIKE
                     DTEKLRNTIYDNATYPVRVVGEVKSHVFDTYGSEYKKCGGDGVVASGKALITTSLVLS
                     QESLGFLSSLLQAKKEQVKDVVNDKTDKANN"
     exon            complement(1038594..1039094)
                     /number=1
     exon            complement(1039149..1039223)
                     /number=2
     CDS             complement(join(1041977..1041984,1042039..1042375,
                     1042590..1042643))
                     /codon_start=1
                     /locus_tag="AO090001000413"
                     /note="60S ribosomal protein L27"
                     /old_locus_tag="AO070234000028"
                     /protein_id="BAE56933.1"
                     /transl_table=1
                     /translation="MKVGRVAIITRGRYAGKKVVIVQPNDTGSKAHPFAYAVVAGIER
                     YPLKVTRRMGKKTVEKRSRIKPFIKVVNYNHLMPTRYTLELEGLKGSVTNDTFKEVSQ
                     REDAKKTVKKALEDRYTSGKNRWFFTPLRF"
     exon            complement(1041977..1041984)
                     /number=1
     exon            complement(1042039..1042375)
                     /number=2
     exon            complement(1042590..1042643)
                     /number=3
     CDS             join(1043516..1043586,1043681..1049757,1049765..1049781)
                     /codon_start=1
                     /locus_tag="AO090001000414"
                     /note="myosin class II heavy chain"
                     /old_locus_tag="AO070234000027"
                     /protein_id="BAE56934.1"
                     /transl_table=1
                     /translation="MPAAHTRDGSRDRELVVRHQSIPMWDSSDPERAPPPLPMNPGST
                     SPATKGNVSPGIQAMAATFTEKMRENAPSPYISNPMPPKSSPEKSLIKGQFHKRMQSF
                     QNSPDPRSEFLNYLESKSPERPQRASTFDSTTKLPEKSLMKSEIEEPESEPEPPNLLI
                     SPRYLSKPILGESTPPSATMLALQNMQLPCEPDSQPKSVESDPFVGPSRPPNYSFESL
                     STQIHSLTDIASNLQREMAQLSRRSKDNATDLVSLKAATNARDEDIRKSLRELSSNLN
                     SRFLDADAATRFDFSTLLGSDSGVNHRESDSSPNSKKSYGRMSSPNPFAAAMERELAA
                     SPTPISDGSASIALLEKVLREMATKEGQEKITELVDAIKARPVSDTPGEPLDSRITKM
                     LEEILSIVKDEWESKALVRTRAPSVTGTAAFKTGRSKSMDPEHLYAPDLDMVHGDNGR
                     LSTRSMSHSDEQTTEEMLSIMRRVKNSVIEGGGMTNEVKALVRELRGEVLGMGRNLAR
                     KLEEIEIAREAAEDKPAGPGKEEISAIVNDSLCELREQLEAIMSENKQHSSALSEFRS
                     AMDGNQIYSIVQRAFNDLNLSHLRDEPRGATMEKDDILDAVRDAWETYKPEIELENFG
                     LERDEILECLSEGLKAYQPRHEDAVTYDQVLAAVQAGMQQFEQPPTITKDEIVHTIRE
                     CLETSQTATRSVHDEKLDAIREDILQAVTESVASQSALTRQSLDSGLGREEIMSAVAE
                     GIQAHFSSARQLEQPHVTKEDVASAVNDAFYAQQSTLSTNVQPTVSRDEILAAIAEGL
                     EAQNSITREIELNKDDLMEAISAGLHEANAENHNVGDQILERVLEHHDGMREELKQQS
                     LAKENDTIQILDAIKDGIAVVRQEVEGYAATAAEASGSHEIMDTVKEGFRLLQADMER
                     TIAESVVASVPRNPDTPELLDAMEKEFEHLRSTISTLLRTEQSTSTDKEEILDAIRDV
                     SEAQKAPKSQDIATIIKQEFEQLRESMNMSLVRAEPQAPKSDKEEIIAALRENLDSFR
                     AEKSERSDKDEIIAALREHLESFRGERTDKDEIIAAFRENLETARGVQSEKSDKDEII
                     AALREHLESFRGENRETTDKDEIIAALRESFDTFRGEKSETSDKDEIIAALREHLESF
                     RGDRIDKDEIIAALRENLETFRDEGSRSRDLGENDFSTGDLIDVFNDGVGNIRDDLGK
                     LLERPVEFDYNELLDTLKEGLSSLKADVEMLRKSQLDAEDVTTTRGGELMLASQANQH
                     IPHNQPDISSDMEALKSLISQLQTKVEAIESAPRAAEPATDALKKEHLDEVLAGLHEL
                     QGSVTGIVARENPADETTAKKEDTDAIETLLRSTKAQLDEMKFPAADELARAEQLGSL
                     ESIVKETKEALFELSTRLEAEGPTKSEIGTLETLMKDMWLALDELKGKSPEDASDTEK
                     LVKADLQTVEAMIFEVKTQIDELKLPDPETLPTKTEVQDLSALVTEFKEKVEAENELT
                     AQGFEARKVEHAGLAEKIEEAKAVVEGLGDELKSKLDGSSEGLSELKQLLEGLAVSAE
                     SFTTVENVKELTELINREFERARGEQDAHKLEKEERDAASLVKQDETRAAIIVELGAK
                     IDEKLGEVMAKYDDMQTAMDTKFSESVERDNAHLEAATDTKSLAEDIKLVIGTMGDSV
                     NEACERISEDTKSFLEKVDVSYNKMEEMHNEVKTQQEQARSDIERAAAATDRVESKLH
                     EFHPQVLESIQEILNIVGQHYDHSQKSAEAIKTDLSALPSTIPQMLPALPPPEPEKYD
                     DSKVQEKLDNLLHHAKNEKVQEALNILVERVTNDQVHEKLDQLLSQTTSTNSQMYDKL
                     DELLNHAAENNGPIHDKLDTLIDHATNTDQSVTQMMKLDEMHKDIMETSRKMTEMFAA
                     QSAMVAEDNERKRREAEEAAVALERRNAQKEQVESEIVDLKDEKESLLKMIQTLKAEK
                     EDLVKQTTKLGKELSSLEMALELRHEEMQVMEDRADSLEKRILEGVLDHARSVLLSRP
                     NNGLNMKKSRGSRARGPSAAGTSSTVREARNILTLVWR"
     exon            1043516..1043586
                     /number=1
     exon            1043681..1049757
                     /number=2
     exon            1049765..1049781
                     /number=3
     CDS             join(1051301..1051780,1051935..1052636)
                     /codon_start=1
                     /locus_tag="AO090001000415"
                     /note="uncharacterized conserved protein, contains TBC
                     domain"
                     /old_locus_tag="AO070234000026"
                     /protein_id="BAE56935.1"
                     /transl_table=1
                     /translation="MLDPFPPPPAWLRDRVEPWALYLNVPALSDHIHEVILAFAGYQF
                     IHSFLSPWLSPILFPRHYPQLNKRTKLNWDVHVVSLVQSVLINVFALYIMFVDKERKN
                     MDTGERIYGYTGMSGLLQALAEGYFVYDIIVSTVHIRMFGVGMLFHAISALWVFSFGF
                     RPFVNFYSPTFILYELSSPFLNIHWFLDKLNLTGSKLQWYNGMLLLSVFFSCRLVWGT
                     WQSILVYKDMWSALTQTWSLSPLSPSAAGGSPVALDSAINTAVFGHRAKLAEQCVDEV
                     CKRANEEVFKYAGFTAGGVPTWLVGTYVAANVVLNSLNYYWFSKMVETVLKRFRGPKE
                     GGSKKGEGEKKEEAVEEVVEKVVLEAAASLEEEEGSPFLGEGVARDVDVDVGGDVRRR
                     R"
     exon            1051301..1051780
                     /number=1
     exon            1051935..1052636
                     /number=2
     CDS             complement(join(1052976..1053497,1053548..1054486))
                     /codon_start=1
                     /locus_tag="AO090001000416"
                     /note="SWI/SNF transcription activation complex subunit"
                     /old_locus_tag="AO070234000025"
                     /protein_id="BAE56936.1"
                     /transl_table=1
                     /translation="MSTAPNLAYTAGPAMPVPMPQHPVPAQYIPAQRNMPHPNDAALR
                     RSRKPTDKNIPDGIEDVVIGEGVQQYKNLRDLEKRLDAAIVRKRLDIQDSISKTVKKY
                     RTMRIWITNTVENQPWQGATGQNGSATNPGSGRYKVRIEGRLLDDDTDPTAPEDSDNE
                     GNETQANGDAMDHDGKDAKKNAPKRSKQRFSHFFKTITVDFDKSSTANPEEVKTVNWT
                     KPQLPANTVTLPPTADFDSLQFSRASQENLNVTVSLVRDETPERYKLSKDLAEVLDVE
                     EETRSGIVLGIWDYIRAMGLQEDEEKRLVRCDHRLRSIFGRDQMFFPQIPESIGHHTS
                     PLDPIKLPYTIRVDEEFHKDPTPTVYDIQVAVEDPLRAKMLALTQNPQYTAGLRQIST
                     LDDQVSLIVQALTHSRAKHSFYTALSKDPATFLRRWVNSQRRDLETILGEATRGGGED
                     ATGPEFRRGGADGAWDSPVALEAVRYMLAKPEAMLR"
     exon            complement(1052976..1053497)
                     /number=1
     exon            complement(1053548..1054486)
                     /number=2
     CDS             complement(join(1054954..1055960,1056019..1056286))
                     /codon_start=1
                     /locus_tag="AO090001000417"
                     /note="26S proteasome regulatory complex, subunit
                     RPN6/PSMD11"
                     /old_locus_tag="AO070234000024"
                     /protein_id="BAE56937.1"
                     /transl_table=1
                     /translation="MAPSSTTAQRIEEARALAKKDASKAETIYKDILSKGPGSTEASS
                     RDYESALVGLGELYRDEKKPNEIAELIKTSRDSFSSFAKAKTAKLVRQLLDLFSEIPN
                     TLDIQTAVIKSCIDWAIVERRSFLRQNLQTRLVAIYMQKQAYYDALNLINSLLRELKR
                     LDDKLMLVEVQLLESRVYHALGNQAKGRAALTASRTSAASVYTPPNLQAGLDMQSGML
                     HAEDKDFTTAFSYFIEALEGYSSLDESDKATAALQYMLLCKIMLNLGDDVTTLLGSKQ
                     AQKYASPRLEAMKAVARAHANRSLEEYEKALSDYRFELGRDVFIRNHLRRLYDAMLEQ
                     NLIKVIEPFSRVELDHIAKMVGLDTPQVERKLSQMILDKVIIGVLDQGSGCLIVFDET
                     ERDQAYDAALETIEKLSNVVEELYTNQASQLE"
     exon            complement(1054954..1055960)
                     /number=1
     exon            complement(1056019..1056286)
                     /number=2
     CDS             join(1056618..1056620,1056676..1057658,1057711..1058071)
                     /codon_start=1
                     /locus_tag="AO090001000418"
                     /note="Sof1-like rRNA processing protein (contains WD40
                     repeats)"
                     /old_locus_tag="AO070234000023"
                     /protein_id="BAE56938.1"
                     /transl_table=1
                     /translation="MKIKAISRSTASQQAPGSAVVRQPRNLDPAQHPFERAREYTRAL
                     NATKLERLFAAPFLAQIGDGHVDGVYSMAKDPGSLERFASGSGDGVVKVWDLTTQGEV
                     WNTDAHENIVKDVCWTPDRKLLSCAADKTVKLFDPYNSSSDAPPLATYLGQGAFTSLS
                     HHRHLPSFAASSSSQIQIYDLSRPSSTASQTLNWPTSIDTITSIAFNQTETSILASTG
                     IDRSIIMYDLRTSSPLHKLVLRLASNAITWNPMEAFNFAVANEDHNAYIFDMRKMDRA
                     LNVLKDHVAAVMDVEFSPTGEELVTASYDRTIRVWNRAEGHSRDIYHTKRMQRVFSVK
                     FTPDNKYILSGSDDGNIRLWRANASDRSGIKSARQRAKLEYDQALIQRYSHMPQIRRI
                     KRQRHVPKPIKKAGEIKREELNAIKRRQENIRKHTRKDKLKPRESERQKMILTSEQ"
     exon            1056618..1056620
                     /number=1
     exon            1056676..1057658
                     /number=2
     exon            1057711..1058071
                     /number=3
     CDS             complement(join(1058199..1058816,1058959..1059486))
                     /codon_start=1
                     /locus_tag="AO090001000419"
                     /note="hydroxysteroid 17-beta dehydrogenase 11"
                     /old_locus_tag="AO070234000022"
                     /protein_id="BAE56939.1"
                     /transl_table=1
                     /translation="MPPNPSPSQPKRILTTASSPRTTTTPTQAPKWYSALTLDLVLSV
                     LRRTILHPWPAWILVLSLRAQVTPTTDLAFVLATGYAVLVTVVAMAGVVNARVAYGLP
                     RTVELGEEVVVITGGASGLGLLIAEIYAMRGVGVAVLDLKDEREVEVCEGVVYYTCDV
                     GRREMLEGVLKRIEEELGTPTVLINCAAARINGQPLLSLSAEAFQKTIQTNLFAVFHT
                     CQTFLPRMLAAPNGGTIVNVSSVLGQLCPAGLADYSTSKAGLSALHRTLEAELRASGD
                     DEKVKMILVEPGQVATPLFASVKTPNKFFAPVLEPVHVAQEIVSAIEEGRGGVIRLPA
                     YATMVNWYAVLPAGLQRIARFLSGVDHAVAQTSSQKSYDEPKAAKTE"
     exon            complement(1058199..1058816)
                     /number=1
     exon            complement(1058959..1059486)
                     /number=2
     CDS             complement(join(1060347..1060612,1060634..1061522))
                     /codon_start=1
                     /locus_tag="AO090001000420"
                     /note="predicted protein"
                     /old_locus_tag="AO070234000021"
                     /protein_id="BAE56940.1"
                     /transl_table=1
                     /translation="MPCVILPFNITTTQKFEEMPHTLPYNRSRQRSCVACAGGKRRCD
                     RQTPQCSRCLARGLECIYIRGLRQQQRPQSPRSLPIEPSSSPSLTDILAPFPPDDFTL
                     FDNAELIASWLTPSPSLLAVPTLLPAGDFPETSVIDRWSTKQLLQSIKSYPRMFARSR
                     RTSFIHHRLYDVYLPEAIQDAFTVSASYYTKTAATEDTILRIVEAKTATLIRQNHQEN
                     TLEELLAAVQALLIFHIIQLFDGDVRQRSIAERNMDTLRAWTMQLQVRAGELGPTPTW
                     QEWILAESIRRTIIISILIEVGHCTIVRALSVLPFTSGAALWNLTTDASWLAQSHRLG
                     SDTVLYGDFARAFENGRVLGKLDEFEKTLLAPCMGERYREMLTLEDQWCG"
     exon            complement(1060347..1060612)
                     /number=1
     exon            complement(1060634..1061522)
                     /number=2
     CDS             join(1061749..1061944,1061998..1062323,1062391..1062510)
                     /codon_start=1
                     /locus_tag="AO090001000421"
                     /note="predicted protein"
                     /old_locus_tag="AO070234000020"
                     /protein_id="BAE56941.1"
                     /transl_table=1
                     /translation="MAITELIFPQIKTDPDSLREIEQDWPIISKRLTHPNPGLLNAYR
                     GFLLTENGVDVRNAHREFLLFEWDKAEDFQAFIKSDQFGNFAASIKHLVNGPPTLQLF
                     ETNISPREAASASVVEIIRLSISNPENAETSTQAWARISRFLSGKKASVTYGTSSNLE
                     NEVVGGIIGWHSPETRSQVIQEAEYIEAFNSLQSLGDVNQITVDVAAMELPSL"
     exon            1061749..1061944
                     /number=1
     exon            1061998..1062323
                     /number=2
     exon            1062391..1062510
                     /number=3
     CDS             join(1063181..1063674,1063759..1065463)
                     /codon_start=1
                     /locus_tag="AO090001000422"
                     /note="predicted protein"
                     /old_locus_tag="AO070234000019"
                     /protein_id="BAE56942.1"
                     /transl_table=1
                     /translation="MEPGPSQSQKGKGPWQPDQGPSKSQMLEETFDASEQPEQGPPQP
                     QTPRGFWQPDQEPSQSRMPKETLFSHEQLEQEPPQPEVPTGALDIIHQMSAWLRAERW
                     NMSLSERNQSMPPALRATQNIDRLCTRCAAFDWKTIWKQMHRGKLNWPTKQHRPLSTM
                     YNHLRWQEYHLSVDETSCAEWQSRTQPAPRRWSLEQLDAATSVSHHMESEKGVLLIEV
                     QGCEPAKLLVSFAQRTEEPLLPTVRSDGRTSGFARHWMQICDESHLFCKRTGSILPTR
                     VIQLQIIHEELKARLLVTNGEEARYAALSHRWSCSTSLTVTTHNLERLKKGIDFAELS
                     HTFREALEIAAGIGLQYIWIDALCILQDDDHDWARESAKMGDVYRHAAITINAFASAD
                     GMGQCTTAYPPTNLVDYACRIGGEVYVHEEDGGFADVYELEGVTQTRGWVFQEEQLSP
                     RRLYCGQHHLVWKCAEMWARNDRPCGFSGEVFDKPFMSTYPCSNWKFAYRQWRRMVQS
                     YTRHNLTYAAKDKLPAISGLAAVFEQGFPGHHVGDYLGGIWRGDIYRGLLWYRDGNAI
                     DRDRRIEGPSWSWASWDGPINFVFEDDDASWPARMTWQPQRKYPCKVRKASTILTDPE
                     NKYGRLSSGRMVVKGKVLMNAGRLGEQSENTRPTDPEIHLDHDETFPEDSVLLPITQR
                     SGLLLRMDPRTANDAMRVFRRIGLCIRPERHEDFNWMRGARWETQELALE"
     exon            1063181..1063674
                     /number=1
     exon            1063759..1065463
                     /number=2
     CDS             join(1065533..1065543,1065655..1067190,1067301..1067310)
                     /codon_start=1
                     /locus_tag="AO090001000423"
                     /note="predicted protein"
                     /old_locus_tag="AO070234000018"
                     /protein_id="BAE56943.1"
                     /transl_table=1
                     /translation="MSFPETISIEVQAQLQTQVLLFRSTVHRHYLDKMPPPQLSPAIQ
                     TISNVRLHSHSPDPTTYDLTFSNEQTLSSIAPHTDTKTSPNTSPPPLALPALTHPHIH
                     LDKAYIHNSTTIHPQTGSFQEALTLTTQAKSTFTEADLHRRSEWLLSESLLNGVTALR
                     AFIEIDATVHHKCLTTAIHLKHSWRNHCHIQLVAFAQDPLFSGPNAQANRDLMHSAFT
                     EHGAHIDVLGTTPYVESDLESAKKNIQWAITTAWQLDKHLDFHLDYHLDPTKGALVWY
                     VLQCLRDVGWVKARTRKRVMLGHCTRFTLFGSDEWERLKLEIGDGEHALRVSFVGLPS
                     SDLYMAAPPCALPPSSSCDSGSGSGCDVKEGGVGDRVRGTIRVPELIRRYGLDVVLGV
                     NNVGNAFTPWGSVDPVALACLGVGVYQAGTVKDAELLYECVSTRARAAIGLEEESENR
                     VCVRAGGRADLLLFFDVDESGCGIVRPRRSVAEVVWDPPSRMARAVVSGGRLVRGRGG
                     LWDEDVFGRQ"
     exon            1065533..1065543
                     /number=1
     exon            1065655..1067190
                     /number=2
     exon            1067301..1067310
                     /number=3
     CDS             complement(1067533..1069320)
                     /codon_start=1
                     /locus_tag="AO090001000424"
                     /note="predicted protein"
                     /old_locus_tag="AO070234000017"
                     /protein_id="BAE56944.1"
                     /transl_table=1
                     /translation="MSQQHGVLPMPASIETAPPAHGTSSGLHTSAPTVERVSPSLSSS
                     LKPSRPPSAISSKVQIPKLSPATTELVARVTGHRKGEKQRNETKFVTWNPPSLSQGWN
                     HPRLEPSSTMKASSTIIELPTAPFVYSSHMTTPAVSQQAPVTTPSTTSPSTHTYTSTL
                     PQGGHDKPTSLVNIAPKPAGPPSLEAPAPPQDSLPPPLPSQPQPVAPAAKDSPPSAKR
                     KRAAVDSRQRRSTTNGTKRKKRRRGNDSDGEDIIRAGDSSSDESDVAPTATQTKSGRQ
                     VNRPSLYVPPSASPTVAKDSSNSLEASDTTQRQAAAVRKRKRVYRKPKDGIVNCIHCQ
                     RGHSPQSNAIVFCDECNGPWHQLCHDPPIDSQVVTVKERQWVCRECKPVPITILQPTV
                     VRSNPSLTGPSLGPPVHAPLLMPKMEVGGEGSSADERRGFLSGLSHATLVELLVTLSD
                     QHPAIPMFPKNLKTLQSKFSFKPNNAAIPTPTSTSSNTPTFTNSITHALTNGVDAAQQ
                     KSGVTPDFLPTPSSAPQTQHDLSEESDYEFSEHRLYPRAGNGFRLSTNADDMDIMFED
                     VSCRTFSYALHGPARVRAQANEVAPIWGS"
     exon            complement(1067533..1069320)
                     /number=1
     CDS             complement(join(1069718..1069929,1069987..1070280,
                     1070335..1070839,1070898..1071021,1071092..1071123,
                     1071199..1071375))
                     /codon_start=1
                     /locus_tag="AO090001000425"
                     /note="predicted L-carnitine
                     dehydratase/alpha-methylacyl-CoA racemase"
                     /old_locus_tag="AO070234000016"
                     /protein_id="BAE56945.1"
                     /transl_table=1
                     /translation="MSVTLKLHQAFRARRPALRWSSSVLRTTAQWRTYSSTPADDTLP
                     LKGVRVLDMTRVLAGPYCTQILGDLGADVIKIEHPVRGDDTRAWGPPYAKYQDESRQG
                     PGESAYYLGVNRNKKSLGLSFQHKSGVEILHRLAKECDVLVENYLPGSLKKYNMDYET
                     LREINPKLIYASITGYGQTGPYSNRAGYDVMVEAEMGLMHITGARGGDPVKVGVAVTD
                     LTTGLYTSNAIMAALLARVRTGMGQHIDACLSDCQVATLANIASSALISGEKDTGRWG
                     TAHPSIVPYRSYQTLDGDILFGGGNDRLFGVLCDRLGHPEWKTDPRFVTNSDRVKNRG
                     EIDGLIEEKVKQKTTQEWLEILEGSGMPYAAVNDIQGTLNHSHVQARGMVTEVDHPAC
                     GPIKLVNTPIKYSHATPGVRTPPPTLGQHTDEILEEILEYGKDDIARLKQDGVVS"
     exon            complement(1069718..1069929)
                     /number=1
     exon            complement(1069987..1070280)
                     /number=2
     exon            complement(1070335..1070839)
                     /number=3
     exon            complement(1070898..1071021)
                     /number=4
     exon            complement(1071092..1071123)
                     /number=5
     exon            complement(1071199..1071375)
                     /number=6
     CDS             join(1071908..1071938,1071991..1072113,1072243..1072790)
                     /codon_start=1
                     /locus_tag="AO090001000426"
                     /note="riboflavin synthase alpha chain"
                     /old_locus_tag="AO070234000015"
                     /protein_id="BAE56946.1"
                     /transl_table=1
                     /translation="MFTGLVETIGTVSSLEPLDTSASGGGGTSLTITNCEEILTDAHL
                     GDSIAVNGTCLTVTAFDKTWFKVGVAPETLRRTNLGSLSTNSRVNLERAVLSETRMGG
                     HFVQGHVDTIATILSVTPDSNALVLRLQPRDRGVLRYIVEKGYVTLDGASLTVTKVVD
                     GEEGYFEIMLIAYTQEKIVTASKKVGEDVNVEIDIVGKYVEKSVQSYFAGVGGGDFAI
                     LEKMVSRIVDEKLKK"
     exon            1071908..1071938
                     /number=1
     exon            1071991..1072113
                     /number=2
     exon            1072243..1072790
                     /number=3
     CDS             complement(join(1073220..1074368,1074430..1074636))
                     /codon_start=1
                     /locus_tag="AO090001000427"
                     /note="RNA-binding protein required for 60S ribosomal
                     subunit biogenesis"
                     /old_locus_tag="AO070234000014"
                     /protein_id="BAE56947.1"
                     /transl_table=1
                     /translation="MAKARTKKRTHVRAQNASAAAVKGSASSMSKTPKSMVIRIGGSQ
                     VGSSVSQLVKDVRLMMEPDTAVRLKERKSNRLRDYTVMAGPLGVTHLMLFSKSATGNT
                     NMRLALTPRGPTLHFKVENYSLCRDVEKALKRPRGGGQDHKTPPLLVMNNFNSPNATE
                     DGKVPKRLETLTTTIFQSLFPPINPQATPLSSIRRVMLLNRELKSDGQEDDSYVLNLR
                     HYAITTRKTGVSKRIRRLDPKEIRNREKRGVAVPNLGKLEDAADYLLDPSAAGYTSAS
                     ETELDTDNEVEIAESTTKRVLNKRELQRMKAGEKEKAEKKLRAAPEVEKRAVKLVELG
                     PRLKLRLIKVEEGLCDGKVMWHDYIHKSEEDMKKLDKNWEKRKKEKEERKRQQKENIE
                     KKKAEKAKARAEGKEIEDDDDEEMDVDDDEDDWLSDDFGEEEEGAEQQGGEGDDESME
                     E"
     exon            complement(1073220..1074368)
                     /number=1
     exon            complement(1074430..1074636)
                     /number=2
     CDS             join(1074890..1075178,1075237..1075457,1075517..1076124,
                     1076182..1076482)
                     /codon_start=1
                     /locus_tag="AO090001000428"
                     /note="ATP-dependent RNA helicase"
                     /old_locus_tag="AO070234000013"
                     /protein_id="BAE56948.1"
                     /transl_table=1
                     /translation="MPAIKKRKIAREAPQQEDHSDSEAHSSASEDAAPNTTEQEQEPS
                     EAPKQAPKSFKELGLIEQLCEACDSMGYKAPTAIQAEAIPLALQGRDLIGLAETGSGK
                     TAAFALPILQALMDKPSSFFGLVLAPTRELAYQISQAFEGLGSTISVRSTVLVGGMDM
                     VSQSIALGKKPHIIVATPGRLLDHLENTKGFSLRNLKYLVMDEADRLLDMDFGPILDK
                     ILKVLPRERRTYLFSATMSSKVESLQRASLQNPLRVAVSSSKFQTVSTLQQSYIFIPH
                     KHKDLYLVYLLNEFVGQSCIIFCRTVHETQRLSFFLRLLGFGAIPLHGQLSQSARLGA
                     LGKFRSRSRDILVATDVAARGLDIPSVDVVLNFDLPGDSKTFIHRIGRTARAGKSGVA
                     ISFATQYDVEAWLRIEGALGKKLPEYPAEKDEVMVLAERVSEAQRSAILEMKNYDEKK
                     GSRGKKFAKGKRSREDMDQEEG"
     exon            1074890..1075178
                     /number=1
     exon            1075237..1075457
                     /number=2
     exon            1075517..1076124
                     /number=3
     exon            1076182..1076482
                     /number=4
     CDS             complement(join(1076931..1077809,1077861..1078367,
                     1078511..1078655,1078771..1078784,1078849..1078941))
                     /codon_start=1
                     /locus_tag="AO090001000429"
                     /note="phosphoglucomutase/phosphomannomutase"
                     /old_locus_tag="AO070234000012"
                     /protein_id="BAE56949.1"
                     /transl_table=1
                     /translation="MASPAIKKAITEAAAQYVKPEGKVFQYGTAGFRMKADVLNTVVF
                     AVGLLAGLRSKKLSGQWIGVMITASHNPAEDNGVKLVDPMAEWETYATKLANAPLDKI
                     ADVYEELVKEIDISMENPARVVFARDTRASGSRLAGVLNAALTATEVNFSDLKFMTTP
                     QLHYVVRCKNTLGTQYEYGEPTEQGYYEKLAKAFKGVMRGLKVKGSLTVDCANGVGGP
                     KLRELLKYLPGPEEGGIDIKVINDDVINPDSLNFDCGADYVKTKQRAPPSSKAAALDR
                     CASLDGDADRLVYYFVDESNVFRLLDGDRIATLAAAFIGDLTKNAGIAQHLKIGIIQT
                     AYANGASTEYIEKVLKLPSVCTNTGVKHLHHAALRYDVGVYFEANGHGTITFSENALK
                     IIKSTEPQSPAQQRALECLQGLTDLINQAVGDAISDMLLVEAILAHKGWTPKEWLCTY
                     TDLPSRLVRVEVADRSIFKAYDAERKLESPAGLQLKIESLQSRYNKGRSFARASGTED
                     AVRVYAEAASRSEADDLATRVANAVRDAGAAKEILQS"
     exon            complement(1076931..1077809)
                     /number=1
     exon            complement(1077861..1078367)
                     /number=2
     exon            complement(1078511..1078655)
                     /number=3
     exon            complement(1078771..1078784)
                     /number=4
     exon            complement(1078849..1078941)
                     /number=5
     CDS             join(1079558..1079674,1081708..1081817,1081877..1082208,
                     1082272..1082743,1082796..1082802)
                     /codon_start=1
                     /locus_tag="AO090001000430"
                     /note="protein arginine N-methyltransferase PRMT1 and
                     related enzymes"
                     /old_locus_tag="AO070234000011"
                     /protein_id="BAE56950.1"
                     /transl_table=1
                     /translation="MPKAMGINERMPRRKVQQFQAHGQHDPNHTDGRQEGPCFKDDVR
                     TRSYRDSIYQNRHIFKDKVVLDVGCGTGILSMFAAKAGAKHVIGVDMSSIIEKAKQIV
                     ACNGLSDKITLLQGKMEEVVLPYPKVDIIISEWMGYFLLYESMLDTVLYARDRYLVPG
                     GKIFPDKATMYLAAIEDGEYKDDKIGFWDNVYGFDYSPMKEIALTEPLVDTVEMKALV
                     TDPCPIITLDLYTVTPADLAFKVPFSLTAKRSDFIHAVIAWFDIEFGACHKPITFSTG
                     PHAKYTHWKQTVFYLRDVLTVEEEEVVSGVLENKPNDKNKRDLDITISYKFETTDNLR
                     YSEGSCFYRMC"
     exon            1079558..1079674
                     /number=1
     exon            1081708..1081817
                     /number=2
     exon            1081877..1082208
                     /number=3
     exon            1082272..1082743
                     /number=4
     exon            1082796..1082802
                     /number=5
     CDS             join(1083567..1083686,1083744..1083792,1083857..1084174,
                     1084230..1084323,1084394..1084736)
                     /codon_start=1
                     /locus_tag="AO090001000431"
                     /note="peroxisomal multifunctional beta-oxidation protein
                     and related enzymes"
                     /old_locus_tag="AO070234000010"
                     /protein_id="BAE56951.1"
                     /transl_table=1
                     /translation="MSAPGVGFEYPPQEVSWLKRDALLFANSIGAKADELHFLYELHP
                     NFAVFPTYSLILPFKHTDQETIDFYARTQATPIPGVPKFDSRRAVDGQRKITILKPLP
                     PTSAGKKFQLRNTVIGVYDKGKAGSVVETEQSIVDENGEVYTKTVSSGFMVGQGNWGG
                     PKGPSAVNYPPPQGKKPDAVHVVQTTAETALLYRLNGDYNPLHATPEPGQKMGFGGVI
                     IHGLFSWNTAAHGILRELGGSDPKNLREFQARFASPVLPGDKLTTEIWRTGNIEDGFE
                     EVRFVTTNNRGKVVLSNGRCLLKVTGSKSKL"
     exon            1083567..1083686
                     /number=1
     exon            1083744..1083792
                     /number=2
     exon            1083857..1084174
                     /number=3
     exon            1084230..1084323
                     /number=4
     exon            1084394..1084736
                     /number=5
     tRNA            complement(1085557..1085648)
                     /locus_tag="AO090001t00004"
                     /note="tRNAscan-SE"
                     /product="tRNA-Pro"
     tRNA            complement(1085725..1085814)
                     /locus_tag="AO090001t00005"
                     /note="tRNAscan-SE"
                     /product="tRNA-Pro"
     tRNA            complement(1086581..1086670)
                     /locus_tag="AO090001t00006"
                     /note="tRNAscan-SE"
                     /product="tRNA-Pro"
     CDS             join(1088290..1088305,1088594..1089004,1089066..1089137,
                     1089211..1089297,1089327..1089343)
                     /codon_start=1
                     /locus_tag="AO090001000433"
                     /note="predicted gamma-butyrobetaine,2-oxoglutarate
                     dioxygenase"
                     /old_locus_tag="AO070234000008"
                     /protein_id="BAE56952.1"
                     /transl_table=1
                     /translation="MASKNYNTYFTDPARLQLFHLLSHTDGDGGASLLVDGFSAAEVL
                     REENPENYQLLAATPQPFHSSGNENTCIQPAEQMPIFRIHPQFNYLYQIRWNNYDRAA
                     KKDWSLEQQNRWYNAARHFNDIVTREKMQIWTQLEPGTALIFDNWRMLHGRSEFTGKR
                     RMCGGYINSDDFVSRYRLLRFGREKILNNIGNFSRRGIGI"
     exon            1088290..1088305
                     /number=1
     exon            1088594..1089004
                     /number=2
     exon            1089066..1089137
                     /number=3
     exon            1089211..1089297
                     /number=4
     exon            1089327..1089343
                     /number=5
     CDS             join(1089758..1090158,1090232..1090647,1090709..1091367)
                     /codon_start=1
                     /locus_tag="AO090001000434"
                     /note="26S proteasome regulatory complex, ATPase RPT5"
                     /old_locus_tag="AO070234000007"
                     /protein_id="BAE56953.1"
                     /transl_table=1
                     /translation="MSTLEDLDDLDREEREKKPQDGDGNGRKPSGDGDADMKDADKKD
                     DEEDLLDDDILQSSTADIVKRRRMLENEMRIMKSEYQRLTHEQSTMREKVKDNQEKIE
                     NNRYGVLGYAGSPIPFFRSWLGRITHGGEGVGQLPYLVGNVVELLDLDVEAEAAEEGA
                     NIDLDATRVGKSAVIKTSTRQTIYLPLIGLVDHEKLKPGDLIGVNKDSYLVLDTLPAE
                     YDNRVKAMEVDEKPTEKYTDIGGLDKQIEEIVEAIVWPMKEAERFKKLGIKAPKGALM
                     YGPPGTGKTLLARACAAETNATFLKLAGPQLVQMFIGDGAKLVRDCFALAKEKAPSII
                     FIDELDAVGTKRFDSEKSGDREVQRTMLELLNQLDGFASDDRIKVLAATNRVDVLDPA
                     LLRSGRLDRKIEFPLPNEEARANILQIHSRKMAVDDSVNWAELARSTDEFGGAQLKAV
                     CVEAGMIALRKGMSKVGHENYVDAIAEVQAKKKDTNMGIYV"
     exon            1089758..1090158
                     /number=1
     exon            1090232..1090647
                     /number=2
     exon            1090709..1091367
                     /number=3
     tRNA            complement(1092539..1092619)
                     /locus_tag="AO090001t00007"
                     /note="tRNAscan-SE"
                     /product="tRNA-Leu"
     CDS             1093385..1093843
                     /codon_start=1
                     /locus_tag="AO090001000435"
                     /note="predicted protein"
                     /old_locus_tag="AO070234000006"
                     /protein_id="BAE56954.1"
                     /transl_table=1
                     /translation="MLNVHSVNWIEIEGYYTRGIKDGIIVQAKIAPLGKQHSNAFVIS
                     RLTDDPASRLAFRVTLKDGKGVQKVLYFKSPQNSLEAIFKANSLVDWLDGATLDTLKT
                     RCRRHIYINLKNIAVAEDLKLFLGGAYILDDGFTVQENTIYCKAHKSRQQ"
     exon            1093385..1093843
                     /number=1
     CDS             complement(join(1094490..1094791,1095331..1095379,
                     1095514..1095557,1095651..1095684))
                     /codon_start=1
                     /locus_tag="AO090001000436"
                     /note="predicted protein"
                     /old_locus_tag="AO070234000005"
                     /protein_id="BAE56955.1"
                     /transl_table=1
                     /translation="MNLDYKYSSTNRVIGGQGIRLELPYPRRKSTVKPVSCYSRIKPV
                     VVDYLDCREALGLYPESWVNKSRNSVPGIFCADATNWGFISYVFGDANIFSSTTQLAQ
                     QQGLDMFDSTNLGVIIKAIKSRGLLSRAENAPFPGYLTAI"
     exon            complement(1094490..1094791)
                     /number=1
     exon            complement(1095331..1095379)
                     /number=2
     exon            complement(1095514..1095557)
                     /number=3
     exon            complement(1095651..1095684)
                     /number=4
     CDS             complement(1096280..1098142)
                     /codon_start=1
                     /locus_tag="AO090001000437"
                     /note="predicted protein"
                     /old_locus_tag="AO070234000004"
                     /protein_id="BAE56956.1"
                     /transl_table=1
                     /translation="MKRGSRLKLLRRTLRERKLLANLVLELRVPQMDLLFTQGKQSTQ
                     WEEYRDLVASVVMVCPNLERLLGLSIPYNHQFDRLTHALSTRRKLKEHTWLLGEAIDV
                     SEGSPRSTSCPGSLGPSQMFEFLDYHTSWTNLETLMLYGISENNALEPSIFLRMFSLL
                     PSLRNLCIANFDAEAFGDSTLLCLPPLESLRLENLPGVTDTGLSQYTSRTESHSLKSL
                     AVVEQNIESLLVISKILTSLPQLERFKIVQNDKCPTLNSDGIIFQPLFASSTLKYLHW
                     DVACPNPNTALTRLDYAPFVKPPKHINTPNSHLAQSILSDGFPQLEALRAPSDIEPPG
                     VLQAVCQPIPRGQALLQPDRYSLPRSSHGSVSTRPMALPAGNNLTSARIRAQTFIDMA
                     AKDTETGMRVLVTDHSDGYVPDNALEDMSDDDLEMDMDESVEWDSPERPRHDKLPENR
                     DGPVTVCDFRMPAYMGRVGSRRRGQDVSIPRFILRPDIQGQEADGGLVGWKHILASNQ
                     SLTYAAGVGVHCFGNKGNTSPLPEEPPSPASTTVSRFGFGGITRSSTFGSSPNTPITP
                     STPMSLSSPTALPWDKDTCTGSWNYSHKNGRDWWFHMERERPGHIKLIDVKQLF"
     exon            complement(1096280..1098142)
                     /number=1
     tRNA            complement(1101088..1101177)
                     /locus_tag="AO090001t00008"
                     /note="tRNAscan-SE"
                     /product="tRNA-Pro"
     tRNA            1101580..1101671
                     /locus_tag="AO090001t00009"
                     /note="tRNAscan-SE"
                     /product="tRNA-Pro"
     tRNA            complement(1102599..1102690)
                     /locus_tag="AO090001t00010"
                     /note="tRNAscan-SE"
                     /product="tRNA-Pro"
     tRNA            complement(1103646..1103735)
                     /locus_tag="AO090001t00011"
                     /note="tRNAscan-SE"
                     /product="tRNA-Pro"
     CDS             complement(join(1104182..1104245,1104356..1104658,
                     1104905..1105035))
                     /codon_start=1
                     /locus_tag="AO090001000438"
                     /note="predicted protein"
                     /old_locus_tag="AO070234000003"
                     /protein_id="BAE56957.1"
                     /transl_table=1
                     /translation="MVNKATEQMNTAPSPRWRKRKQDLPAQLLPCLPVFVHLCYLHDT
                     TLTLAIKTLAALKKPHAGAGDRSFTIGDKTRAQLLQGRKYNGSRTKMQEYFVMTIHPS
                     IELFLRIKEPLQEAFVKAEIKPPGQRHPHVWAQEALATDIGSRGRRHYRHYEAKTVYY
                     CTRID"
     exon            complement(1104182..1104245)
                     /number=1
     exon            complement(1104356..1104658)
                     /number=2
     exon            complement(1104905..1105035)
                     /number=3
     CDS             complement(join(1106493..1107915,1107984..1109254))
                     /codon_start=1
                     /locus_tag="AO090001000439"
                     /note="ribosomal protein S6 kinase and related proteins"
                     /old_locus_tag="AO070234000002"
                     /protein_id="BAE56958.1"
                     /transl_table=1
                     /translation="MANRSVSNGLQDDDNQDQIGSNSPSPSGMATPQPEFSDKRQPSI
                     MHNFFQVGASHGPLYPPKSQFFPSETAASAHLVQSSAYVTGTQDDQSTGHHSSSSGSF
                     VMMERDEASGMKSSNVEAKEITPESLPHTNLPTPPYCSASSLLQKESETAELGSSAPE
                     KGMGSIFNALKNILSPPASVSPEPAARRHTSHPVSSVSDDPVLATHFSNPSLPHTSDP
                     MCLSEVPLLEHEKPHISLSSENLAKLTGNVSDLARLKNTPPLTPRAMSNEGSQTDKPP
                     ATSSPESTEPTHQADEMDKSTDEIAGKLEEAFPSPAETPQPSGPPVAPIKGNLYVKIS
                     EGRGLKPGFDPYVVCVFEWNEWISKSAQDEEEESIERRQKEQEQSDRDAGRPMAIPMK
                     SRQSSNNSSLDGPDLRGRAPVTDPHWNHEATFDVFGDQSEIDVSVYDRKNQEAFLGHV
                     RLCVNLKEDNSRLEGWFPLSARGAGDSAVSGEIYMEMRFEHTEKKQVGPDDFQVLKLI
                     GKGTFGQVYQVKKKDTRRIYAMKVLSKKVIIQKKEVAHTLGERNILVRTAMAASPFIV
                     GLKFSFQTPTDLYLVTDYMSGGELFWHLQKEGRFQEARAKFYIAELILALQHLHEHDI
                     VYRDLKPENILLDANGHIALCDFGLSKANLAQNDTTNTFCGTTEYLAPEVLLDEQGYT
                     KMVDFWSLGVLVFEMCCGWSPFYAEDTQQMYKNIAFGKVRFPRDALSTEGRNFVKGLL
                     NRNPKHRLGAKADAKELKEHPFFHDVDWDALSKKQVIPPFKPKLKSDTDTSNFDPEFT
                     NANATLNDRAAAVANSYMPASTPLSPGLQANFKGFTFVNESSIDHHLKHEPTDHMDED
                     PDTWQRPHRPGGFDDHRMTGVPKAHEGGEPGIFNVDDNFDM"
     exon            complement(1106493..1107915)
                     /number=1
     exon            complement(1107984..1109254)
                     /number=2
     CDS             join(1114246..1114294,1114388..1115441,1115504..1116095)
                     /codon_start=1
                     /locus_tag="AO090001000441"
                     /note="predicted protein"
                     /old_locus_tag="AO070324000175"
                     /protein_id="BAE56959.1"
                     /transl_table=1
                     /translation="MARKLRAAAQAAQQSLRNAPPPLPDASDEEMAEAPQSRGSSPAI
                     EDPGDASDKDPDVVPEPDPPQEDEPAAVTHPPSRGDTPTRGRVSAIPRKRRIGRPPKN
                     RPPDWDLPDDGTAAPPIHVSTPVKRRRGRPAASGGRWARNRGPSHVTQVPIDKEGNMM
                     DVIDDEVALPDDPEGETKVDKNGVLKGDREYRVRTFTILNRGEKHYMLSTEPARCIGF
                     RDSYLFFQKHKLLYKIIIDDDAKRDLIEREIIPHSYKGRAIGVVTARSVFREFGAKII
                     VGGRKVVDDYNVKAARERGDVEGELAVPEDKLPPPGEPYNKNQYVAWHGASSVYHTQA
                     PSVPLPTGKAVDSKKRKVTVTGDNWMLEHAREASHYNSILSNVRRENLGGVYDIHTNA
                     MQYPKIMQPSHARWERLPPPDPRVATKLTKEMSTLSLTNGAEEEEPTTESDAQDDKTT
                     EETTNDSIFSTIPYAFSRRFAIHDVHYETPPYSNMGIPGPDGDVHDLGSNGIISTANL
                     SYPEFVSPEILAELPADCKEALVEAAAREWEWKSKWHSEVGDGARTTPLKSYAWFP"
     exon            1114246..1114294
                     /number=1
     exon            1114388..1115441
                     /number=2
     exon            1115504..1116095
                     /number=3
     CDS             complement(join(1116876..1116958,1117026..1117234,
                     1117309..1117513,1117591..1117765))
                     /codon_start=1
                     /locus_tag="AO090001000442"
                     /note="protein involved in glucose derepression and
                     pre-vacuolar endosome protein sorting"
                     /old_locus_tag="AO070324000174"
                     /protein_id="BAE56960.1"
                     /transl_table=1
                     /translation="MWSWFGGSAAQKRKDAPKDAILKLREQLDMLQKREKHLENLMEE
                     QDAVARKNVTTNKNAAKSALRRKKVHEKNLEQTTAQIIQLEQQIYSIEAANINQETLN
                     AMKQAGAAMTQIHGNLTIDKVDETMDQLREQHQLSEEIAQAITNTQIGDQADETELDA
                     ELEGLEQEAMDERMLHTGTVPVADQLNRLPAAANGEPKGKSKVQEEEDEEAELEKLRA
                     EMAMG"
     exon            complement(1116876..1116958)
                     /number=1
     exon            complement(1117026..1117234)
                     /number=2
     exon            complement(1117309..1117513)
                     /number=3
     exon            complement(1117591..1117765)
                     /number=4
     CDS             complement(join(1119050..1119782,1119844..1120117,
                     1120173..1120549,1120613..1120983,1121672..1121707))
                     /codon_start=1
                     /locus_tag="AO090001000443"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070324000173"
                     /protein_id="BAE56961.1"
                     /transl_table=1
                     /translation="MHESTWIGRSLAGFREFDLLSRTFSGRMPSSKHHPSDCEKWPQH
                     AQEEASPADTNSLAESTSTEDTEELQQIVTQASRQSVPSLARKTTTIGTNATSDPRYE
                     VDFEDENDRMNPKNWSLRYKGMGIAFLSWNTLVIVLYSTSYTSGVADIAAEFGTSSTI
                     VTLGLTLYLIGLAVGSMFMAPLSEVYGRKPVSVGCLFVFMVLIIPCARAESVATLIVV
                     RFIGAFFGSVMISTAPGMVSDLVNDEERALAMSIWSIGPVNGPVLGPIIGGFVTQYLG
                     WLWMDWIALMLSGVALVFSLIMKETYGPIILQKKAARMRKETGDPYWSRYDQKASLGE
                     ILKVNLGRPFVMAVTEPICIFWNIYIAIVYGILYLCFTAYPIVFRDIRGWSLGLSGLA
                     FLGIGIGCLITIACEPFIRRMINNHAIDPETGKVPPEAMVSIVCISAILIPAGELWFA
                     WTCAPASIHWIVPILAGVPFGAGNTGVFIYASNYLSYSYGVYAASAMAGNSVIRSILG
                     GVLPLVGTYLYAGIGPNWSGTLLGLLEVAIIPIPIVFYKYGYKIRRKSALIVRMQEDK
                     KRLEGKRLRLQQRLEARANAEATEKEKMEV"
     exon            complement(1119050..1119782)
                     /number=1
     exon            complement(1119844..1120117)
                     /number=2
     exon            complement(1120173..1120549)
                     /number=3
     exon            complement(1120613..1120983)
                     /number=4
     exon            complement(1121672..1121707)
                     /number=5
     CDS             join(1123481..1124076,1124266..1124344,1124540..1125025)
                     /codon_start=1
                     /locus_tag="AO090001000444"
                     /note="predicted protein"
                     /old_locus_tag="AO070324000172"
                     /protein_id="BAE56962.1"
                     /transl_table=1
                     /translation="MVVDVVLKCTLEEPTAVPDDSQRSVGFSSPESVCVDATTIHQLL
                     SVSAAEFVARLSPVEVSYLKTLASDILSQIPCHKSYMPIQDLINLNIPLDRLSLLLSA
                     LALCCIYPKQIDSNASAYFLSSRYLLNYRYVKPSLDLCIACYMQHLYLLKTGPDNQDT
                     AALIMAIRTAHELKINETVSPDRCTLPAKLYLFLYFHDHQRPSPGSTIRKTLRPQQHI
                     PPRGTPRRKFTRARITLRVHRLPLTEDWIPSMSICVRSSQMILLLYFQTYNPSMAPNA
                     AQNLHNPSASLLAMEGRLPLTWRQVKRIMTSAFILIYAYWHGEVTFEEVCRGTAMALV
                     LHECQRVRWGRELDGAMAVLRDIAGICGMTILPNLSSLLPDVDLGVLRVIAG"
     exon            1123481..1124076
                     /number=1
     exon            1124266..1124344
                     /number=2
     exon            1124540..1125025
                     /number=3
     CDS             complement(join(1125241..1126757,1126816..1127799,
                     1127848..1128288,1128352..1128594,1128651..1128777))
                     /codon_start=1
                     /locus_tag="AO090001000445"
                     /note="cytochrome P450"
                     /old_locus_tag="AO070324000171"
                     /protein_id="BAE56963.1"
                     /transl_table=1
                     /translation="MSTPKAEPVPIPGPRGVPLMGNILDIESEIPLRSLEMMADTYGP
                     IYRLTTFGFSRCMISSHELAAEVFDEERFTKKIMAGLSELRHGIHDGLFTAHMGEENW
                     EIAHRVLMPAFGPLNIQNMFDEMHDIATQLVMKWARQGPKQKIMVTDDFTRLTLDTIA
                     LCAMGTRFNSFYSEEMHPFVDAMVGMLKTAGDRSRRPGLVNNLPTTENNKYWEDIDYL
                     RNLCKELVDTRKKNPTDKKDLLNALINGRDPKTGKGMSYDSIIDNMITFLIAGHETTS
                     GSLSFAFYNMLKNPQAYQKAQEEVDRVIGRRRITVEDLQKLPYITAVMRETLRLTPTA
                     PAIAVGPHPTKNHEDPVTLGNGKYVLGKDEPCALLLGKIQRDPKVYGPDAEEFKPERM
                     LDEHFNKLPKHAWKPFGNGMRACIGRPFAWQEALLVIAMLLQNFNFQMDDPSYNIQLK
                     QTLTIKPNHFYMRAALREGLDAVHLGSALSASSSEHADHAAGHGKAGAAKKGADLKPM
                     HVYYGSNTGTCEAFARRLADDATSYGYSAEVESLDSAKDSIPKNGPVVFITASYEGQP
                     PDNAAHFFEWLSALKGDKPLDGVNYAVFGCGHHDWQTTFYRIPKEVNRLVGENGANRL
                     CEIGLADTANADIVTDFDTWGETSFWPAVAAKFGSNTQGSQKSSTFRVEVSSGHRATT
                     LGLQLQEGLVVENTLLTQAGVPAKRTIRFKLPTDTQYKCGDYLAILPVNPSTVVRKVM
                     SRFDLPWDAVLRIEKASPSSSKHISIPMDTQVSAYDLFATYVELSQPASKRDLAVLAD
                     AAAVDPETQAELQAIASDPARFAEISQKRISVLDLLLQYPSINLAIGDFVAMLPPMRV
                     RQYSISSSPLVDPTECSITFSVLKAPSLAALTKEDEYLGVASTYLSELRSGERVQLSV
                     RPSHTGFKPPTELSTPMIMACAGSGLAPFRGFVMDRAEKIRGRRSSGSMPEQPAKAIL
                     YAGCRTQGKDDIHADELAEWEKIGAVEVRRAYSRPSDGSKGTHVQDLMMEDKKELIDL
                     FESGARIYVCGTPGVGNAVRDSIKSMFLERREEIRRIAKEKGEPVSDDDEETAFEKFL
                     DDMKTKERYTTDIFA"
     exon            complement(1125241..1126757)
                     /number=1
     exon            complement(1126816..1127799)
                     /number=2
     exon            complement(1127848..1128288)
                     /number=3
     exon            complement(1128352..1128594)
                     /number=4
     exon            complement(1128651..1128777)
                     /number=5
     CDS             join(1130715..1130940,1131025..1131667,1131729..1132236)
                     /codon_start=1
                     /locus_tag="AO090001000446"
                     /note="predicted protein"
                     /old_locus_tag="AO070324000170"
                     /protein_id="BAE56964.1"
                     /transl_table=1
                     /translation="MLFIILAACIAVLLYLYHVNRAIMAVPEEARRLCPHRWTVDEIK
                     AAFEKVQDSPTDVAKSLPPKQSRRYIVVGGSGLVGNWIVSHLIMRGEDPSAIRILDLQ
                     TPRPEVLDQGVTFIKTNITDEQAVLSAFSQPWASSVADLPLTVFHNAAVIRPAERLRA
                     FLPLCRNVNVGGTVNVLNAAKKSGATCMIATSSGSVCLRRFSFWVAPWTKTPEYLVQV
                     VNDSSEVPKQHDHFFGNYAVAKAEAENIVRSADDPKSNFRTGCIRPVNGIYGVSDSAG
                     SVTGNYLRTGGAPTWTYDVIHSWVNAENVSIAHLLYEQRLLEHTNSPSTLPNIGGQAF
                     AVTDPNPPVIFDDIYLCLTTLAKTPAAFPHVPVMPFILMSYPIEWYAFLQQQYLPWLP
                     KITGELAKLQPGLFAIANAHVIGDDSRARLSPEKGGLGYNPPINTLEGLCRELKAWNK
                     KADMKSSS"
     exon            1130715..1130940
                     /number=1
     exon            1131025..1131667
                     /number=2
     exon            1131729..1132236
                     /number=3
     CDS             complement(join(1132539..1132670,1132732..1133028,
                     1133116..1133478,1133539..1133599,1133659..1134274,
                     1134287..1134372,1134425..1134678,1134731..1134884,
                     1134939..1135081))
                     /codon_start=1
                     /locus_tag="AO090001000447"
                     /note="choline dehydrogenase and related flavoproteins"
                     /old_locus_tag="AO070324000169"
                     /protein_id="BAE56965.1"
                     /transl_table=1
                     /translation="MTIPDEVDIIICGGGSSGCVPAGRLANLDHNLQVLLIEAGEDNL
                     NNPWVYRPGIYPRNMKLDSKTASFYYSRPSEWLDGRRAIVPCANILGGGSSINFMMYT
                     RASASDYDDFQAKGWTTKELIPLMKKHETYQRACNNRDLHGFDGPIKVSFGNYTYPIM
                     QDFLRAAESQGIPVTDDLQDLKTGHGAEHWLKWINRDTGKLIILVRLYTFNDSRRSDA
                     AHAYVHSTRAKYTNLHLKCNTKVDKIIIEDGRAVGVATVPTKPLDGRNPPRKIFRARK
                     QIIVSSGTLSSPLILQRSGIGEPEKLRKAGIKPLVNLPGVGRNFQDHYLTFSVYRAKP
                     DVESFDDFVRGDPEVQKKVFEEWNLKGTGPLATNGIDAGVKIRPTPEELEEMKRWPTP
                     EFTSGWESYFKNKPDKPVMHYSIISGWFGDHMLMPPGKFFTMFHFLEYPFSRGFTHIR
                     SADPYDAPDFDAGFMNDKRDMAPMVWGYIKSRETARRMSAYAGEVTSMHPHFAFDSAA
                     RAFDLDLATTKAYAGPNHITAGIQHGTHQPSTLHPPTYHQYTKLTMENRIMQKGYRAY
                     REMGYVTHKLPCPKPPHLIYSPANKKTTNTVQRHVETTWHSLGTCSMAPREGNSIVKH
                     GGVVDERLNVHGVKGLKVCDLSICPDNVGCNTFSTALLIGEKCAVLTAEDLGYSGAAL
                     EMRVPTYHAPGEVVNLARL"
     exon            complement(1132539..1132670)
                     /number=1
     exon            complement(1132732..1133028)
                     /number=2
     exon            complement(1133116..1133478)
                     /number=3
     exon            complement(1133539..1133599)
                     /number=4
     exon            complement(1133659..1134274)
                     /number=5
     exon            complement(1134287..1134372)
                     /number=6
     exon            complement(1134425..1134678)
                     /number=7
     exon            complement(1134731..1134884)
                     /number=8
     exon            complement(1134939..1135081)
                     /number=9
     CDS             complement(1136463..1137317)
                     /codon_start=1
                     /locus_tag="AO090001000448"
                     /note="predicted protein"
                     /old_locus_tag="AO070324000168"
                     /protein_id="BAE56966.1"
                     /transl_table=1
                     /translation="MKVGINLNLIYTCSHYTSAKSYSVQFEFQRQFIQIAYLPYSASP
                     TCPSSMSPMTLSLVGLVPTSELSPSLLIINSSLDIDAEPSAHARANAQKLIASELPAD
                     YLSTIHPSIPAFPEPQFSPLMQQEVERKAAGLPLTGGVDLSRYEAPEPPTRSSEAGPN
                     ATPNLDEWRQALQKAYTASSHLSMRRDNLTLLEENGKNAWLIGNSQLEDVLRELEKEL
                     AETKEAAETVNKQRKIAQESSKGELAGLEETWKRGVGAILDVELASENVRMQILEQRR
                     QLAQQHAR"
     exon            complement(1136463..1137317)
                     /number=1
     CDS             complement(join(1138211..1140287,1140390..1140589))
                     /codon_start=1
                     /locus_tag="AO090001000449"
                     /note="ceramidases"
                     /old_locus_tag="AO070324000167"
                     /protein_id="BAE56967.1"
                     /transl_table=1
                     /translation="MANARLGVVVSGTFIAALFLLLLFSVVSDSNQPPVVDSRYKWAD
                     RNTEFASDDSVFLLGAGRADITGPVVEIGFGGYASLDQIGTGLRQRIYSRAFIVANPN
                     RPKDTFIYLIIDSLTGDTAVRHGVLEGLASLGSEFADYGEHNVAFTGTHSHSGPGAWM
                     NYLLPQIPNKGFDKQSYQAIVDGVLLSIKRAHQSIAPGRLSFGSIDLENANINRSPYS
                     YDHNPEEEKARYSDSVDKTMTLLRFDRATDNKTTAVLTFFPVHGTSMYNNNTLVTGDN
                     KGVAAWLFERSVTADQKFADDFVAGFSQSNVGDTSPNVLGAWCEDGSGQKCRYEDSTC
                     GGTMENCRGRGPFFREKDNGAKSCFEIGKLQYEAARKLYTQLDSNPTRILKSSDVNAF
                     HIYQDLSDYTFISPFNASILKTCSAALGFSFAAGTTDGPGMFDFTQNSSGPAEKNPLW
                     YAARAFIHQPSKEQKACQAPKEVLLDVGAVTQPYAWTPNIVDIQVLRVGQLFIIISTS
                     EATTMSGRRWKEAIAKSAKDVLSVANPLVVLGAPSNSYAHYVATEEEYHVQRYEGAST
                     LYGPNTLAAYINLTLTYLPYLGDSSSLPALDSKVKPPINTDKSLSFIPGVLYDGSPIG
                     KTFGDVISSVDNATYGPGDTVNATFVGANPRNNLRQESTFAAVERQKPGTDTWEVVRT
                     DRDWNLVYTWKRTNTVLGHSEVTIQWQIEDDYYNVGNPSSLKDGTYRLHYYGDFKTVK
                     GDIGGFEGISGSFKVSTT"
     exon            complement(1138211..1140287)
                     /number=1
     exon            complement(1140390..1140589)
                     /number=2
     CDS             1145012..1146607
                     /codon_start=1
                     /locus_tag="AO090001000450"
                     /note="predicted protein"
                     /old_locus_tag="AO070324000166"
                     /protein_id="BAE56968.1"
                     /transl_table=1
                     /translation="MPEGTPSSVIDTSTVVSHLVQDISTTSSGSSYMSTTASTFSTAI
                     RTESSSSTVLHRTTAGEDEDDGSESYSAFDPTTTLTSSHMASSSSAPATHTTNTLTHG
                     HSTPSVSTSKTPDTTHSTSSLADTHSAVAVVRASSVPVASSEIAEPTVTTTTVTSTIF
                     KHHSVTVISSGTQLSHSSRLFGASSSTWKTTKFTSNLLPKVSATSISPSTSFSWRATP
                     TSTSVQSSTITQTSSHLFRGSTATTDIRSTASSSPTVGVIRTLPGAASSGASTGAHQS
                     STATAPQPDHTSAHFTSGTVSNTHTSNTWTPHTTATAFHTDSISHTQTATSAFITQPP
                     STGTHTTKTPTTPDITGTVVSGTGIVIIIPGISTSRNITIPLSPDDNIPVTGTISMST
                     SSPPVTTPIGASSQSASATQNTTPAISPHATGLVTTIHPTSTETKVVTIEMPTTEQTQ
                     RPTPNASVSVPSEGSSQLTAQATGSKKAPGPAPAPTSDIADNGVVNPVSPMFLTVTET
                     KTVTEKTTETKTVMMTVTATVDR"
     exon            1145012..1146607
                     /number=1
     CDS             complement(join(1147632..1147967,1148025..1149572,
                     1149631..1149690))
                     /codon_start=1
                     /locus_tag="AO090001000451"
                     /note="predicted protein"
                     /old_locus_tag="AO070324000165"
                     /protein_id="BAE56969.1"
                     /transl_table=1
                     /translation="MDQRTRLRKACDACSIRKVKCDTSGPPCRSCASLDIPCTYERPS
                     RRRGPPNRHAEALKRQKLTASPVGSPTPSDQASPESTGLLNSQPFPPPAVFSLEMICP
                     LSTIRLLIDDYFTYIHPLIPVPHEPTFRAALDRREDVTNRTFLALAASMIGTLVTSFP
                     RRPRFHLKTAAEKAAYPHSMALVKRCRDVAVQARGAGYLERSLTVYDAAIGYFLSICS
                     GYMYNMRTCRSYLSECLTILHVYDLCGHSTRIRTMSPPSPDSYSSRLSQDLPGQPGDG
                     QLDIIEQELGRRLFYAVLVGYRTLQQMGSTDFTFHIPPETPTERYPPLPLEIDDEFIF
                     STHVESQPADRVSRLVGFNLNVRIYNSYSQVSAWEVAFGSGQPFDWERQRAAVWESLQ
                     KAKSAVADVPREYSLQGSVPGQGPGPSPTEDLNSYERRHIQYEIQKANIYASQLGTRS
                     YLVEKYWALYAAWKAYQKRAEQATHTSPSPVKVEEDQSNTLEADADAQSDHIGATMAE
                     ERRIVIRDMLVLIRSINEVNMEPNGLSFTAKVRQVASTLLNLPNPNKEPADSTTLTAG
                     PHPLTVAEAESYLHAFIDILMRLEGMAVPSPSMASASPQTTGRSMSYVSDIDRDEEEL
                     RKWASVKEYQARFAAAGGWLSEL"
     exon            complement(1147632..1147967)
                     /number=1
     exon            complement(1148025..1149572)
                     /number=2
     exon            complement(1149631..1149690)
                     /number=3
     CDS             complement(join(1150770..1150944,1151002..1151579,
                     1152429..1152587))
                     /codon_start=1
                     /locus_tag="AO090001000452"
                     /note="predicted protein"
                     /old_locus_tag="AO070324000164"
                     /protein_id="BAE56970.1"
                     /transl_table=1
                     /translation="MAAFPDVEPALDQLARAQNVMPIIFTNGTSNMVSKSILQSGPLS
                     HHRETFRDLGVYYFASHRFLWPLFKTRLIPIVLLSAFIYVLLFLFTYLPQVAFLSIFQ
                     GRGAWVNGAVLVLGEGAAIVAALFEAFFVDETLVDIFDAVLVNEGHGELVTTSRVLYP
                     QGDDVVKRLGKPIHSAVYAPFSLRQIVEFVVLLPLNFIPVAGTPMFLLLTGYRAGPFH
                     HWRYFQLLDLSKQQRKEKIRRRQLQYTTFGTVALILQLVPPLSMFFLMSTAVGSALWA
                     VDLENKRDLIGRARPDEVDEYHDGDTI"
     exon            complement(1150770..1150944)
                     /number=1
     exon            complement(1151002..1151579)
                     /number=2
     exon            complement(1152429..1152587)
                     /number=3
     CDS             complement(join(1155477..1155628,1155701..1157513,
                     1158580..1158603))
                     /codon_start=1
                     /locus_tag="AO090001000453"
                     /note="mitochondrial translation initiation factor 2
                     (IF-2; GTPase)"
                     /old_locus_tag="AO070324000163"
                     /protein_id="BAE56971.1"
                     /transl_table=1
                     /translation="MHRRAALEASKRRDGRRPRQSEAEEDDEEEDDRRRRREERKRLK
                     KEKARQKELESASIPLYLPEFISVSNLADVIGVRPAQFVQQMEDMGFEGVTYSHVLDA
                     ETAGLVAAEYNFEPIFETAEDEDLAAAPEPEDKSILPSRPPVVTIMGHVDHGKTTILD
                     WLRNSSVAASEHGGITQHIGAFSVAMPSGKTITFLDTPGHAAFLDMRRRGADVTDIVV
                     LVIAADDSVKPQTIEAIKHATEARVPIIVAISKIDKENINLEKVKQDLSIHGVHVEDY
                     GGDVQAIGVSGKTGQGMLELEEAIVTLSEVLDHRAEVDGKAEGWVIEGTTKSYGRVAT
                     VLIRRGTLRPGDIIVAGTTWARVRTLRNEAGVAISEATPGMPVEVDGWREQPSAGTEL
                     LEAVDEQQAKDVVDYRLEKTETQKLGQDTVAINEARREVLERRRQEESEGIETAGSVQ
                     ETSGPKPVHFVIKADVGGSAEAVLNSVTAIGNNEVFANVLRSEVGPISEFDIEHAASA
                     NGHIVSFNMPIDPAMSRMAEVRGVKIMDHNVIYKLIDDVKAILSEQLPPSVSHRVTGE
                     AEIGQVFEITLKGREKTAIAGCKVRNGIISKARKVRVIRGQETIFDGSINSLKNVKKD
                     VTEMRKDTECGIGFEGWTSFAVGDHVQCYEEIYEKRYL"
     exon            complement(1155477..1155628)
                     /number=1
     exon            complement(1155701..1157513)
                     /number=2
     exon            complement(1158580..1158603)
                     /number=3
     CDS             join(1158937..1159042,1159300..1159436,1159522..1160150,
                     1160217..1160247)
                     /codon_start=1
                     /locus_tag="AO090001000454"
                     /note="mitochondrial carnitine-acylcarnitine carrier
                     protein"
                     /old_locus_tag="AO070324000162"
                     /protein_id="BAE56972.1"
                     /transl_table=1
                     /translation="MEERALEDFEKSDGALRTIKDLGAGAAGGIAQVLLDIVKVRLQT
                     TTQYANALDCASKILKNEGPAAFYKGTLTPLIGIGACVSVQFGAFHEARRRLEELNKK
                     KYADSSLSYGQYYMAGGFAGIANSVLSGPIEHIRIRMQTQPHGADRLYNGPIDCIRKL
                     SAQGGVLRGLYRGQNVTYLREIQAYGMWFLTFEYLMNQDAKRNNVKREDISSLKVATY
                     GGLAGEALWLSSYPFDVVKSKMQCDGFGAQQQFKSMTDCFKKTYAVEGLAGFWKGIGP
                     TLLRAMPVSAGTFVVVELAMKAMG"
     exon            1158937..1159042
                     /number=1
     exon            1159300..1159436
                     /number=2
     exon            1159522..1160150
                     /number=3
     exon            1160217..1160247
                     /number=4
     CDS             join(1160942..1160972,1161048..1161260,1161340..1162370)
                     /codon_start=1
                     /locus_tag="AO090001000455"
                     /note="mitochondrial/chloroplast ribosomal protein S2"
                     /old_locus_tag="AO070324000161"
                     /protein_id="BAE56973.1"
                     /transl_table=1
                     /translation="MIARQLCMRQSRQLHAFNRQARTLNSLNRFYSTEPPVDTTLQTR
                     IKERSAEIESRYQNDAVPERISRRRAEQLAWKARGERKFKFQDLGSSVTDAYKPEDII
                     RNPPKPSDVTLELLLASQTHLGHSTSRWNPQNSRYIFGIRDGIHVISLDVTAAYLRRA
                     AKVVEEVAARGGLILFVGTRKGQKRYVVRAAELAKGYHIFERWIPGSLTNGQQILGHC
                     ETKVVNAMDEEIPKYREALADRSVLKPDLVVCLNPLENVVLLHECGLNNVPTIGVIDT
                     DADPTRVTYPIPSNDDSMRAIGVIAGVLGRAGEAGQQRRLENAKNGVLTYPPITPEHL
                     LSPERLAELAQIEAGNVAANAEAAEIANKLDEAVQSIETEQASTPQETSQSTESQPEP
                     QTQVPETEKPAEPQPEQPQTQAQAPETPVKDQ"
     exon            1160942..1160972
                     /number=1
     exon            1161048..1161260
                     /number=2
     exon            1161340..1162370
                     /number=3
     CDS             complement(join(1163548..1163851,1163920..1164248))
                     /codon_start=1
                     /locus_tag="AO090001000456"
                     /note="predicted protein"
                     /old_locus_tag="AO070324000160"
                     /protein_id="BAE56974.1"
                     /transl_table=1
                     /translation="MSGYDQYNQQGGHYGQGQQGYGQQGYGQQGYGQQGYGQQGYGQQ
                     GYNQQSYGQSSGYDQGYNSHSGSSGSGAANDYYGGGGQSEHHQQSYGGQQHYGQQQGY
                     GQQGGYEGSGEQAPGGAQEGERGLMGALAGGAAGGFAGHKADHGFLGTIGGAIMGSIA
                     EDAMKKYKGKKEHEQQQQEYGGYGGSQYGAPHSQQGGSGMMDQLGGFFKK"
     exon            complement(1163548..1163851)
                     /number=1
     exon            complement(1163920..1164248)
                     /number=2
     CDS             join(1169276..1169290,1169394..1169477,1169585..1171069)
                     /codon_start=1
                     /locus_tag="AO090001000458"
                     /note="predicted protein"
                     /old_locus_tag="AO070324000158"
                     /protein_id="BAE56975.1"
                     /transl_table=1
                     /translation="MDDIEDRLRSHAQAFDGLLSLIPAKYYYGEDGSDQWKRKKQTKE
                     EAREAKRAKLDPDAAKTAKDVMEENARKRKRQEEGHNETASSEDEDLGSEMPKEGLKR
                     ADAAKKQKQSEDSAKSEEAEARKKLKEEKKAQKKEQQKEKRKAKEASKKEKLKEQQDK
                     EATTPTADAAQKPESKPASDKNKKQEKPPVKDDDNDDDVDEEETEGLALEFNPEQTEQ
                     SSSSTPNSPGFDASALQSGASSISSIVPPSAPNDASKNPSDQKPLKSTPEELKQRLQK
                     RLDELRAARHADGLNGKPARNRQELIEARRQKAEQRKAHKKELRQKAREEEQRLKDEA
                     LARRFSPGGSGSLLASPRSPAESVGSSAANYSFGRVVFADGQAADPSLNSVRDQPKRH
                     GPHDPASALKAVEAKKARLESMDDEKRAEIEEKDMWLNAKKRAHGERVRDDTSLLKKA
                     LKRKESAKKKSEREWKERIETVRKGKEMKQQKREDNLRKRREEKGNKGNKGKKPAAGK
                     KKARPGFEGSFKGKSGGKK"
     exon            1169276..1169290
                     /number=1
     exon            1169394..1169477
                     /number=2
     exon            1169585..1171069
                     /number=3
     CDS             complement(join(1171718..1171848,1171912..1172177,
                     1172346..1172629))
                     /codon_start=1
                     /locus_tag="AO090001000459"
                     /note="NADH:ubiquinone oxidoreductase, NDUFS8/23 kDa
                     subunit"
                     /old_locus_tag="AO070324000157"
                     /protein_id="BAE56976.1"
                     /transl_table=1
                     /translation="MASSKSVARLVTYRRPAPSLLTSSFRPLGSTANFSSSVCRAATP
                     AGPPPSGFRLAPPKKWDETTESSLDKASKYFLMSEIFRGMYVVLEQFFRPPYTIFYPF
                     EKGPISPRFRGEHALRRYPTGEERCIACKLCEAICPAQAITIEAEEREDGSRRTTRYD
                     IDMTKCIYCGYCQESCPVDAIVETANAEYATETREELLYNKEKLLANGDKWEPEIAAA
                     ARADAPYR"
     exon            complement(1171718..1171848)
                     /number=1
     exon            complement(1171912..1172177)
                     /number=2
     exon            complement(1172346..1172629)
                     /number=3
     CDS             join(1174850..1175119,1175214..1175460,1175534..1176027,
                     1176086..1176136)
                     /codon_start=1
                     /locus_tag="AO090001000462"
                     /note="golgi protein"
                     /old_locus_tag="AO070324000154"
                     /protein_id="BAE56977.1"
                     /transl_table=1
                     /translation="MASAGGLTRRRGGGRVAGADENDDSRVSSPISRNGSSLDNRIPE
                     TSFTSTENGHKIAFDPRDLSETEERSKQPKLTLMEEVLLLGLKDKQGYLSFWNENISY
                     ALRGCIVIELALRGRISMQKDSSRRRFPLADRVIEVVDDTLTGEVLLDEALKMMKSSE
                     KMSVNSWIDLMSGETWNLMKIGYQLKQVRERLAKGLVDKGILRTEKRNFLLFDMATHP
                     VADGGAKDDLHRRVRNVCSNRTVILPPNQWLPEDSEFRYLRTITMVCAAYAANVLENA
                     LVTMSHEARERAFAQVDELLAEYSQWPFARRAGGSQAIGANLAGAINEEVTKAKDREL
                     QLEIVAACLSVFTRLDSLL"
     exon            1174850..1175119
                     /number=1
     exon            1175214..1175460
                     /number=2
     exon            1175534..1176027
                     /number=3
     exon            1176086..1176136
                     /number=4
     CDS             complement(1177366..1178493)
                     /codon_start=1
                     /locus_tag="AO090001000463"
                     /note="predicted protein"
                     /old_locus_tag="AO070324000153"
                     /protein_id="BAE56978.1"
                     /transl_table=1
                     /translation="MDEQTFVPGTMRALYHRPASTAITDLTALDAPRVDSGIIFDTDF
                     PVPKPAANQYLIKVQTAAFSHDGLRLARTLHPSKSIPQIPLHNYCGIVISTPTQDHNK
                     PDGPKFKISDTVFGLISNTRDGAAADYTVATEDEIALKPKNISAAEASTIPGPALTAW
                     QALFTYGGLDPSDTRHKLRILVTNARDNEVAAQALQLLRAKSLFPHHRPWICATCSCP
                     EHDDFLRDQIKVDEVIDAALPLPQDFDLAKIFRKNKWEPVDIILDCAGEQMFNLAHSS
                     DVVKNNGIVLTAVDDTAVQPKTADREAQNQKQGLFSRFVALKPDGKALTRIAELVEEG
                     SIRGRVQCLVDLAHGVDVLASEAAGAGGGRRGGMMVFRVNI"
     exon            complement(1177366..1178493)
                     /number=1
     CDS             complement(1178922..1180154)
                     /codon_start=1
                     /locus_tag="AO090001000464"
                     /note="predicted protein"
                     /old_locus_tag="AO070324000152"
                     /protein_id="BAE56979.1"
                     /transl_table=1
                     /translation="MDSLNAQTKHPPVIQNLRRLGDRLWRRDSMLYFLTSFLWKQPSL
                     QAVDVRQHTVWLFDNTAYLRASPNAKGLIESWHAEVVACVFRRDSRKDMSKIVAMIAD
                     LIGLDGEIGTERETRHQITRRLQPFLYHVMPAHLMMLEIPQPNSTTIIQQLGPTNSNG
                     ISSQVVNMGSRHITDGSVVRSYLRGSRDNVAMRTYFAGPNGWLVISDIDDTIKYTKTS
                     ESTGILRTTFVEEPRPIAGMPELYSHMHRELAPAWFYVSASPYNLYPFLRTFIHTHFN
                     PGTLILRDSSWLDISELVKSFTVNTMEYKVKQIEKIRRQFPQREVICIGDSTQKDPEA
                     YAEIYKRHPHWIRAIWIRKVTDVPHLEDQNSPERFKAAFQGVPDQIWKVFEQPEAVFD
                     FLVNLNVDTTTHFSHETH"
     exon            complement(1178922..1180154)
                     /number=1
     CDS             complement(join(1181211..1181962,1182024..1182160,
                     1182269..1182504))
                     /codon_start=1
                     /locus_tag="AO090001000465"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070324000151"
                     /protein_id="BAE56980.1"
                     /transl_table=1
                     /translation="MVRHKKDNYSRGGKKFSSTPRPRPVPRGDGESSDRLPFKAACWD
                     LGHCDPKRCSGKRLMHLGLMRELGIGQKYPGVVVSPNAKKIISPADRDILEQYGAAVV
                     ECSWVRLKEVPFSRIGGKCERLLPYLVAANTVNYGRPWRLNCVEALAACFCICGHEDW
                     AREVLKHFSYGEAFLDINSQLLKRYAACATEEDVKRTEEEWLAKIEKEYEDSRVEGAD
                     DMWTVGNTNRRADDSDSEDDKDSEEGEEGDQDKEKKDEEEEPEEEKDPFAISDDSEEE