LOCUS       AP007152               51359 bp    DNA     linear   PLN 16-DEC-2016
DEFINITION  Aspergillus oryzae RIB40 DNA, SC308.
ACCESSION   AP007152
VERSION     AP007152.1
DBLINK      BioProject:PRJNA20809
            BioSample:SAMD00067075
KEYWORDS    .
SOURCE      Aspergillus oryzae RIB40
  ORGANISM  Aspergillus oryzae RIB40
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Eurotiomycetes; Eurotiomycetidae; Eurotiales; Aspergillaceae;
            Aspergillus.
REFERENCE   1  (bases 1 to 51359)
  AUTHORS   Sawano,T., Tanaka,T., Machida,M. and Yamada,O.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-JUN-2004) to the DDBJ/EMBL/GenBank databases.
            Contact:Toshihiko Sawano
            National Institute of Technology and Evaluation, Genome Analysis
            Center, Department Of Biotechnology; 2-49-10 Nishihara,
            Shibuya-ku, Tokyo 151-0066, Japan
REFERENCE   2
  AUTHORS   Machida,M., Asai,K., Sano,M., Tanaka,T., Kumagai,T., Terai,G.,
            Kusumoto,K., Arima,T., Akita,O., Kashiwagi,Y., Abe,K., Gomi,K.,
            Horiuchi,H., Kitamoto,K., Kobayashi,T., Takeuchi,M., Denning,D.W.,
            Galagan,J.E., Nierman,W.C., Yu,J., Archer,D.B., Bennett,J.W.,
            Bhatnagar,D., Cleveland,T.E., Fedorova,N.D., Gotoh,O.,
            Horikawa,H., Hosoyama,A., Ichinomiya,M., Igarashi,R., Iwashita,K.,
            Juvvadi,P.R., Kato,M., Kato,Y., Kin,T., Kokubun,A., Maeda,H.,
            Maeyama,N., Maruyama,J., Nagasaki,H., Nakajima,T., Oda,K.,
            Okada,K., Paulsen,I., Sakamoto,K., Sawano,T., Takahashi,M.,
            Takase,K., Terabayashi,Y., Wortman,J., Yamada,O., Yamagata,Y.,
            Anazawa,H., Hata,Y., Koide,Y., Komori,T., Koyama,Y., Minetoki,T.,
            Suharnan,S., Tanaka,A., Isono,K., Kuhara,S., Ogasawara,N. and
            Kikuchi,H.
  TITLE     Genome sequencing and analysis of Aspergillus oryzae
  JOURNAL   Nature 438, 1157-1161 (2005)
COMMENT     URL:http://www.bio.nite.go.jp/dogan/Top
FEATURES             Location/Qualifiers
     source          1..51359
                     /db_xref="taxon:510516"
                     /mol_type="genomic DNA"
                     /note="SC308"
                     /note="phrap>=30:4-51305"
                     /organism="Aspergillus oryzae RIB40"
                     /strain="RIB 40"
     CDS             complement(join(3754..3971,4032..4672,4729..4864,
                     4966..5080,5307..5327))
                     /codon_start=1
                     /locus_tag="AO090308000002"
                     /note="alcohol dehydrogenase, class III"
                     /old_locus_tag="AO070204000002"
                     /protein_id="BAE56552.1"
                     /transl_table=1
                     /translation="MSSTVGKAAIAWAAGEPFSVEDVEVAPPKAHEVRIKIIHTGVCH
                     TDAYTLSGKDPEGAFPVILGHEGSGIVESVGEGVTTVKPGDQVIALYTPECGECKFCK
                     SRKTNLCQKIRTTQGKGVMPDGTSRFRARGKDILHYMGTSTFSQYTVVADISVVAVTT
                     KAPTDRACLLGCGITTGYGAATVTANVEQGSNIAVFGAGCIGLSVIEGAVKNKAGKII
                     VVDVNDGKEQWARKFGATHFINPTKVKNGKTIQEELIELTDGGCDYTFDCTGNVGVMR
                     AALESCHKGWGESIIIGVAAAGQEISTRPFQLVTGRVWRGCAFGGIKGRSQLPGLVDD
                     YVAGYLKVDDYITHRESLGTINTAFQHMKSGDCIRCVLDMKV"
     exon            complement(3754..3971)
                     /number=1
     exon            complement(4032..4672)
                     /number=2
     exon            complement(4729..4864)
                     /number=3
     exon            complement(4966..5080)
                     /number=4
     exon            complement(5307..5327)
                     /number=5
     CDS             6154..7407
                     /codon_start=1
                     /locus_tag="AO090308000003"
                     /note="NADH-dehydrogenase (ubiquinone)"
                     /old_locus_tag="AO070204000003"
                     /protein_id="BAE56553.1"
                     /transl_table=1
                     /translation="MSSKEKVVIIGGGWGGYRLGYGIDHRKYDITLIAPDNTSAVTPL
                     LASAACGLFDPRLAHEPIRRKDFHAKYIKAFVVDIDFSRQVLVCQPAFEELKEDRFEV
                     SYDRVILTPGCRSNTFGIPGVAENAIFVKTVANANTVRTRLNDILEMASLPGISEARQ
                     RQLLHIVIVGGGPTGIEVAAELTDLFEGDLGILFPHLKGLTSVSVIDVAPQILAPFDQ
                     RLSEYACSALKTNKVKVKLNCHIVNVTKDTIETRESGITGYGMLIWATGNRSIPLVDQ
                     LQLRKTEHGLVRILTDDHLNVFSPDGNVIPNVFAMGDAADIEGGTLPTTAEVAIQKAD
                     YLIRLFNSGLKDTRPFKYQQRSLVTYTGAWDGVVQGQREYTGYGAWLSWRSGNFFWTR
                     SWRRRVLMCYAWFMDWLDGREIIRN"
     exon            6154..7407
                     /number=1
     CDS             complement(join(7837..8298,8306..8523,8571..8831,
                     8902..8991,9011..9347,9408..9662))
                     /codon_start=1
                     /locus_tag="AO090308000004"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070204000004"
                     /protein_id="BAE56554.1"
                     /transl_table=1
                     /translation="MGAGRGSPTVAGGQAIAYGPTGYKGIIKEPRIFGLACFASIGGF
                     LFGYDQGVISGVLVMNSFVSHCLVHLISYHIKRLQSCVNTCLVSIMTLGAMCGAFANG
                     PISDSLSRRWSILCANIVFLIGSVIQCAAENVAMLFVGRFVFGCAVGMLAMVVPLYLS
                     ELATPNNRGALVALQQLSITLGIMSSFWINYGTQYIGVRLLGESSFALQCLPSAILAI
                     GTFFLPYSPRREEEAKQVLVRLRRLTATDYRLTLEFLEVKAARVFDEESRLAKYGDNS
                     SRFQIAWNQYKELFTVPHLRRRTTIACLLQILQQFTGINAVIYYAPQFFEAIGLRGNS
                     VNLLATGVVGIVFFICTIPAVMYLDQWGRRKTLILGSIGMSIAELIVATLYAVHPAAG
                     WAACVFVWVYIGTFAFSIACVNWVMPSEMFPPATRGKAVGVAIAANYLSNFIVALITP
                     WMLQSITFGTFYFFLVFSITLGVWTYFCVPETNGVPIEEMDTLFGGNEGEADLQRIAS
                     IRARLGFETSEDRKMVLEETKHDSVEHCERVD"
     exon            complement(7837..8298)
                     /number=1
     exon            complement(8306..8523)
                     /number=2
     exon            complement(8571..8831)
                     /number=3
     exon            complement(8902..8991)
                     /number=4
     exon            complement(9011..9347)
                     /number=5
     exon            complement(9408..9662)
                     /number=6
     CDS             16160..16573
                     /codon_start=1
                     /locus_tag="AO090308000007"
                     /note="predicted protein"
                     /old_locus_tag="AO070204000007"
                     /protein_id="BAE56555.1"
                     /transl_table=1
                     /translation="MSYFLQRLRLAEIPRGIVDHTPMAVTSAGGASYYTHVTAIDFEL
                     DQMIHDIPSFFHLDTYKCSSDSTTSGIFIQAYLPSSVIHTQRCKLYLTYSRILHPDRT
                     TTWPTRPHETCLKSARQLIRAEAQLERAQHPFVQM"
     exon            16160..16573
                     /number=1
     CDS             complement(join(17275..17277,17343..17382,17424..17842))
                     /codon_start=1
                     /locus_tag="AO090308000008"
                     /note="predicted protein"
                     /old_locus_tag="AO070204000008"
                     /protein_id="BAE56556.1"
                     /transl_table=1
                     /translation="MSDDAPYEEEINKLVAEHGAVPPPYVTFPDIHPFEISWRIGSGE
                     SYLMMYSAWSAKEGMGEAQWIEYFRKFPPPPIWLTWAIDCIWSVAEKVEENIGENSDD
                     DHDEFNLDPLEFDYWCYFRRTAALGFGTESDCKRAWEENRERRKKKWEAWR"
     exon            complement(17275..17277)
                     /number=1
     exon            complement(17343..17382)
                     /number=2
     exon            complement(17424..17842)
                     /number=3
     CDS             join(19798..19864,20511..21680,22138..22148)
                     /codon_start=1
                     /locus_tag="AO090308000009"
                     /note="predicted protein"
                     /old_locus_tag="AO070204000009"
                     /protein_id="BAE56557.1"
                     /transl_table=1
                     /translation="MEENLLKQLGCADSMYSSCLCFDAFNRLARAGLHDSIVGCLVGS
                     ALGDAVGLYTEFLSGDMSAAAYPARKFVLSPQSQATPFRRDSHRGPHRPGEWTDDTDH
                     AMLLLLSFLHTDLKTLDPTDFAARLHVWVQFGFLPLDTLPLGLGRAVGAIVRTKTYLD
                     DPEAAARRHWTNCKYNVAPNGSLMRTHPLGLVCLDRNLDETFDLGAAFSVVTHVDPRC
                     VASCAIGTALVRGLVLREIHTEADIDSMIGAAIHWYAKYRVRALQEHPERRDEPDLDV
                     SELRRHAKVESLDDLELDDSGKIGYVYKTLGAGVHLLRLAMRDTATGMLTSRALAFEP
                     LITDLIMRGGDADTNACFAGALLGAYLGYANLPLNWRNGLRHGEWLLGKAEGLSQMLG
                     VADGEYVGSADRETARDGGRASC"
     exon            19798..19864
                     /number=1
     exon            20511..21680
                     /number=2
     exon            22138..22148
                     /number=3
     CDS             complement(join(22693..23068,23124..23224))
                     /codon_start=1
                     /locus_tag="AO090308000010"
                     /note="predicted protein"
                     /old_locus_tag="AO070204000010"
                     /protein_id="BAE56558.1"
                     /transl_table=1
                     /translation="MDSSNFAPPCRQLTPPFHQIPASCSTVDVRVIDTNTYLYLKPGA
                     FYEPAIPSDGPRVPSYCFLLSHGDRHLVFDLGVRIDWQNYAPQIVRLLTATTEITSCD
                     RDVASVLDSDTSGLTIAVLTLRPSCGLTTISTTPATRPVPMALSWTVTPWVARFVK"
     exon            complement(22693..23068)
                     /number=1
     exon            complement(23124..23224)
                     /number=2
     CDS             complement(join(24138..24155,24279..24634,24699..24732))
                     /codon_start=1
                     /locus_tag="AO090308000011"
                     /note="predicted protein"
                     /old_locus_tag="AO070204000011"
                     /protein_id="BAE56559.1"
                     /transl_table=1
                     /translation="MQFKPLRWYTINNLLTHPATLQALSSELITANLTLPYPKWNEVC
                     DLPYLDACIQEAVRLHPPFALVLGRVVPAGGVTVLNHYLPEGTLVGGNPYVVNRHAET
                     FGPDVEEWRPERWLEGEGRKRLEQSVPTFPSWC"
     exon            complement(24138..24155)
                     /number=1
     exon            complement(24279..24634)
                     /number=2
     exon            complement(24699..24732)
                     /number=3
     CDS             join(29797..30144,30213..30347)
                     /codon_start=1
                     /locus_tag="AO090308000016"
                     /note="defense-related protein containing SCP domain"
                     /old_locus_tag="AO070204000016"
                     /protein_id="BAE56560.1"
                     /transl_table=1
                     /translation="MDSNGLFPFITTVSAKLHYVELYSPLTMDTQDRSSVTPSASNMK
                     PIEWDEGLATAAQQLADSCKFEHNRAGQNLYEGSDPADLVKQAIDAWHNEHKDYNYDS
                     NTCGPNAICGHYTQVVWADSSKVGMAVSSRKCESGMYIVVANYDPVGNYAGEKPYKQQ
                     "
     exon            29797..30144
                     /number=1
     exon            30213..30347
                     /number=2
     CDS             complement(join(35617..35747,35850..35998,36066..36365,
                     36438..36510,36662..36755))
                     /codon_start=1
                     /locus_tag="AO090308000017"
                     /note="predicted protein"
                     /old_locus_tag="AO070182000006"
                     /protein_id="BAE56561.1"
                     /transl_table=1
                     /translation="MESPEYELLYLKENPKAIFFTDFDGTITLKDYNFGFGMEMRRKL
                     EMEVMKGHMAFRDAFHAMLQSVQMPLADCLRIVQDNIQLDPHFLDFYYWAKGCNIPIV
                     VLSSGMTPFITMLLESVLGSNPENIFVVANDVEPHSFGDKTSGSGWRIKYRDDSAFGH
                     DKSLEIKPYFGLPSGNCPLLFYAGDGVSDLSAASQTHVLFAKEGLVDHCKERGIPFIP
                     FDNWSSILDTMQGIYEGLSRAGITGYSNVV"
     exon            complement(35617..35747)
                     /number=1
     exon            complement(35850..35998)
                     /number=2
     exon            complement(36066..36365)
                     /number=3
     exon            complement(36438..36510)
                     /number=4
     exon            complement(36662..36755)
                     /number=5
     CDS             join(38401..38716,38817..39160,39231..39947)
                     /codon_start=1
                     /locus_tag="AO090308000018"
                     /note="alanine-glyoxylate aminotransferase AGT2"
                     /old_locus_tag="AO070182000005"
                     /protein_id="BAE56562.1"
                     /transl_table=1
                     /translation="MGSAAEPAYLYKNVTHDPTVPSVKSAEGIYIFLENGQKILDATS
                     GAAVSAIGHGVGRVKKAIMSQLDQVEYCHPGFFPNTPAMDLADLLVESTGGKLSRACI
                     LGSGSEAVEAAMKLAYQYFEEQSPNTRRTRFISRHGSWHGCTLGALALGDFKPRKTRF
                     NSILTSNISHVSACDPYHGLMENEDPETYVARLKDELDNEFQRLGPETVCAVFLEPMV
                     GTALGCVTALPGYLQAVRDVCDRYGALLVFDEIMCGMGRTGITHAWQEDGVAPDIELV
                     GKGLAAGYGTISGLLVNDRVLDGLRHGGGYFVHGQTYQSHPLGCAAAVEVQRIIKEEN
                     LVENCRKMGQYLGQQLKLHLGDHPYVGDIRGRGLFWAVEFMADPPTKTPFSPAFTISK
                     RMQSRGMERGYDICLFAATGAVDGCNGDHVLLAPPYIVHKEDVDEIVSRLVRTIDSVF
                     EDVAALVM"
     exon            38401..38716
                     /number=1
     exon            38817..39160
                     /number=2
     exon            39231..39947
                     /number=3
     CDS             join(40544..40689,40741..40777,40936..42114)
                     /codon_start=1
                     /locus_tag="AO090308000019"
                     /note="predicted protein"
                     /old_locus_tag="AO070182000004"
                     /protein_id="BAE56563.1"
                     /transl_table=1
                     /translation="MSTQQDLASQAPLLSDSAYVSYGSYQADGRDRDNVSEAGDSYSR
                     QQPESFIVVGANDGAYGLGRYYDADYTTVSVVFLSPFLGYATAAMANSWIHERFGQRG
                     IALLGTGMHVISYFATTQHPPFPLLITIFILAGLGNGIVDASWNAWIGAMHNSSQLMG
                     ILHAFYGLGAALAPLTATYVITQRGCIWYHFYYIMGIAATIEFVTSVAAFWSARGSLV
                     EASELGVPGDNVQQDDRDSSRRNTTLKNPTLESLGLVSTWIISLFLLVYVGIEVTVGG
                     WVFTFLVDLRNTPPSVAGVVTFMYWGGLTVGRVCLGFITPYFKRQRLVIVVYLLACVV
                     CHIGFWLATDLHLSMIAVTLLGFFLGPLYPEAVIAQAALLPKHLHVAAVGFACALGSA
                     GGCIFPFITGAIAKAHGIKVLHPVVLAMLMLCLILWFALPGQRRGTKEAASPAWSSSP
                     TLS"
     exon            40544..40689
                     /number=1
     exon            40741..40777
                     /number=2
     exon            40936..42114
                     /number=3
     CDS             42896..43876
                     /codon_start=1
                     /locus_tag="AO090308000020"
                     /note="branched-chain amino acid
                     aminotransferase/4-amino-4-deoxychorismate lyase"
                     /old_locus_tag="AO070182000003"
                     /protein_id="BAE56564.1"
                     /transl_table=1
                     /translation="MTSMNKVFSGYYERKARLDNSDNRFAKGIAYVQGSFVPLADARV
                     PLLDEGFMHSDLTYDVPSVWDGRFFRLDDHLSRLEDSCEKMRLKIPLSRDEVKQTLRE
                     MVAKSGIEDAFVELIVTRGLKGVRGNKPEDLFDNHLYLIVMPYVWVMEPAIQHTGGTA
                     IIARTVRRTPPGAFDPTIKNLQWGDLTRGLFEAADRGADYPFLSDGDTNLTEGSGFNI
                     VLVKDGIIYTPDRGVLEGITRKSVFDIAQVKNIEVRVQVVPLEHAYHADEIFMCTTAG
                     GIMPITKLDGKPIRNGEVGPLTTKIWDEYWAMHYDPKYSSAIDYRGHEGN"
     exon            42896..43876
                     /number=1
     CDS             complement(44391..46478)
                     /codon_start=1
                     /locus_tag="AO090308000021"
                     /note="predicted protein"
                     /old_locus_tag="AO070182000002"
                     /protein_id="BAE56565.1"
                     /transl_table=1
                     /translation="MGLKWASVLLLIGLSKAEKSIVHGSLISAVAQGASLGIEGSGAP
                     VDTGGENTGLYQSPPYNSARIDRSSWIATCDSELVGHECINAIDGDNSTYWHSGDDTN
                     GIASLPHNITINLGTVQNVSGIAVWPRAVEDGWIGTHDVSLSTDGVTWGDPVAHGAWW
                     PDSTVKLAVFEPKAVQYVRLIARSSSNGDNATSIADLQIWSANSIPTAPQGKRLSEVG
                     AWGPTIDFPLVPASAAIEPSSGKVLVWSSYRKNQYGGTSGGLTQTATWDPNTGVVSRR
                     EVSDTEHDMFCSGISMDVNGRVIVTGGNDDTMTSIYDSFSDSWIAGAPMNVERGYQAS
                     TILSDGNMFVLGGSWNGPQLQNKNSEVYNVTADTWTQLPNAGSQPMLTHDNLGPYHAD
                     NHGWIFGWKNLSIFHAGPSQAMHWYFAQGEGNVTNAGNRSTDYDQMSGNAVMFDATGG
                     RILTFGGSPNYEDSDATKNATLITIGDPNTPPVTVKAGGDMGYARTFHTSVVLPDGSV
                     FITGGQAHGLPFNEDTAQLTPERYIPEEDRFVEHFPNNIVRVYHSWSLLLPDATVING
                     GGGLCANCTANHYDAQIYTPPYLFDADGNRAPRPHIETVAPASLRYGGQITITADSPI
                     SNASLIRYGTTTHTVNTDQRRIELVLEDAGTNMYTADIPNDPGVALPGYYMLFVMNAN
                     GVPSVSKNVQITL"
     exon            complement(44391..46478)
                     /number=1
     CDS             join(48231..48292,48347..48581,48649..48953,49009..49101,
                     49163..49273,49327..49406,49464..49763,49833..50074)
                     /codon_start=1
                     /locus_tag="AO090308000022"
                     /note="predicted iron-dependent peroxidase"
                     /old_locus_tag="AO070182000001"
                     /protein_id="BAE56566.1"
                     /transl_table=1
                     /translation="MASEENLTTGVNKDNVQGNIWPGLPKEFELFYFFKISKTDSFRR
                     HLHYLIPHITTANSALKSRDQIAKHKAAVSDGLTHPATIPLAGVNIGFSANGLKKLVK
                     NESDRLKAGPFLGGMLADLQGGTAGGEGRDNPDDWEKRFKDNDIDGIILVTGDSERTA
                     YAKLYEVKSHFIGFFWFNSSIEDRFTIPGYKRPGQESNKEHFGYREHISQPQLVGLDP
                     SPTGDKEPPPVPPGYIITNTDQDPSPQPDWATEGSFLVFRKLQQLVPEFNKWLNETAP
                     KHDLTADQLSARLMGRWKSGAPLCHTLWKDDPALAENNNFDYLPTNTQEHCPFAAHIR
                     KARPRGDLADKFSSAIIRRGIPYGPEVTKEEQDKQTTKEDRGMLFVCYQSNISNGFRR
                     IQEQWCNKNTFPSGKKRITGDPGPGADPICGQPNGPDPFVMGLCDGKNKNIHVDLHCC
                     VIPRGGEYFFSPSIAALKNISNGST"
     exon            48231..48292
                     /number=1
     exon            48347..48581
                     /number=2
     exon            48649..48953
                     /number=3
     exon            49009..49101
                     /number=4
     exon            49163..49273
                     /number=5
     exon            49327..49406
                     /number=6
     exon            49464..49763
                     /number=7
     exon            49833..50074
                     /number=8
BASE COUNT        14637 a        11130 c        11119 g        14473 t
ORIGIN      
        1 aattttttag tctttttaat aattaaataa aatttttttt aataaattaa ttttatttta
       61 ttaaaaatat agtataatat aatataaatt taaataatta atttctatat ttttaaatta
      121 aatataattt attttttatt tttattttaa aaaatagttt ttatttattt taatatataa
      181 tataaattat atatattatt taatatattt taaaaaatct ttataaatta ataataaata
      241 gtatattaaa taaagaaata tatttaatta taattaatat tttaactatt atattattta
      301 tataatatta atactatact attaaattta taattaatta taaataattt attttctcta
      361 tactctctat ttttaataat agtttttaaa taatataaat attataaaat aaaaaaataa
      421 ctaaaatatt aataattctt ttatagcaag atataataat attaataaaa aaatataaaa
      481 aaataactag atttaaaata taaaaaaaga aaatatttat aatatataaa agaaatatta
      541 tagaataaaa aagaataaaa tataaaaata ataaaaagaa attttttaat attttattaa
      601 tattaatatt attattatag ataactatta tttacttaat aataatttat atagagttaa
      661 tatttctata taatatattt aacgcgtttt taaaatatta attatttaat ataaataata
      721 tattaattat tatctaaaga tagttaatct aaaaaaaaaa agtataatta ttataaaaat
      781 aataataatt atataaaata actatatagt atattctatt ctagatatat agatattcta
      841 gtagttaaat agtattttta atatctatat ttattatctt tctaataata tataatagcc
      901 ctgttaaaag gattgattat tatatacaaa gaatcttaga gatcctcggc cataaattag
      961 tactataatt attagtagaa aattaagaat cagtcttcta tctctagtat ctactaccta
     1021 gtgctttgcc cacgtatcct tacctagtta acaggtcctc taccctgact agtagatatt
     1081 cctctgacac taagttcagc gaagcgtcca acagtgtgag ggatttgcac agtataacac
     1141 tgatctctag cttttcttta tgtgttccaa tgagaaacat ggccactaga gtgatgccta
     1201 atctggtagt cctagttata gtaagttaaa acggagatac taggcaggcc cgcatccact
     1261 tgagttcagg tgggccgcca tctctattag tttatgaggg tccttatgtt cgatcttctg
     1321 ctcaagagcg tgttggactc tgatactggt ctactattgc cagctactgt gaaaatacta
     1381 gcgccctaca tagaccctaa ctgaggtaat ctcacgtgat tatatccact gcgcgcggtt
     1441 attaaagggc tagattccct aggtgtgtcg ctggtttgat cgcatgggtt gtgtcgtcgg
     1501 ctcgattcca ttaggcgtat cgctagttga tcccattagg tgtattgctg gtttgatccc
     1561 atgggttgtg ttgttgattc gatcccatga ggcgtgtcgc tggctcgaac cgccggcttc
     1621 tcaatcacct ctctaggcac cctgcaccca gcagtacaag tctcctttgt agtaatgatg
     1681 tatatattag aattcccgat tgcaattgct atccaaaaaa attaatgtct acgaagaaca
     1741 aagcctcggc atctacgaca acgagaacaa atccaacccg tacaacctgg ccgcacacat
     1801 ctagcggtaa ctcgggttcg acctgtgata tataatgcta ggcttttttc ttatctccgt
     1861 tactaagggt aagcgtattt aataaatcca cggccgtgat ttcgtgttct cgctcttcct
     1921 acttctattt gagatcgtct ccgcgtacgg gacggtgggg ctgttattga aatatccaaa
     1981 gagagagacg agtctaagtg cgcagttcaa tttagtgttg aagctgatta ttattactat
     2041 gcaggtgcgt ggtagatacc gtggtttgcc atatacgctg gattatgcta tcctgctgcc
     2101 gtgtgatgta caccaggatt agtagggcga gtagtagtgg aagcgctggt taaagtggaa
     2161 gagcttgaat attagcagtt tcttttcgca tggcgatgct ggtgaggatg ttgagcggct
     2221 ttcggtttca aaaccatcat attaattaga aaatgagggc ttttgagatt gacgctggaa
     2281 gtaatcacta ttctggccat ttgagacccc tgttttcttt tccctgtaat tccgaacttt
     2341 tggtagttga ttgaagagcc ctatgtgggt tatgtacgcc attatcttga ttcatctcga
     2401 tggtgactgt agattttgcc catgataatt gatctgatat gtcggctaaa ggtgctcata
     2461 gcaagaccac cgggctatac tctgtgtata acattctcca aatttaaccc gtactataag
     2521 acctgaaaaa caagaggaat attaagaggc ttcgcaaggt actctacaca ggaccttata
     2581 atgaatctca ggtagtacat cctgtatcgt cttcagtagg atagaactat tgaccgacgt
     2641 gctgctgcga agccttgttc gcccacctct acaacactgg atgcttgctc tttatatgat
     2701 cttgaatatg tcttgatccg acgcatatgt cctctctgac agatgaagga ctatcgaaac
     2761 tcgcgtctcc gtcccctaac ttcaagcaca tttgtccctg tttgatcatc ctgaggcggt
     2821 cgaagaagaa cggcatgtta aagatcacgt ctaaagaatt gtgattggta ggcttttgtt
     2881 tttttctttt tttttcggag gctatcaaca ctgctagtga gcccgggtag gtcaagatat
     2941 cccgttttca cggtatccga ttatttcttt ttcgtattta gcgaaagaag aactgacgat
     3001 ttatctcatt tgccgtccaa cgacgaaagt tcgaatgtct gacatgattt tcaaccctag
     3061 catctccacc cggttctttc agagcttgcc gacattgttc taggagccat tgctagagag
     3121 tcgtaaagcc cataaccata cagagtgcgc tcatatggtc acaggagagg tgtgttgagg
     3181 acttcgggct tgcaccaggg aatatccaca cttgctttcg ccgacagtgt tcaacgacag
     3241 cgacatcttt tagagtattg ggtttgcaat ttgaatctat ccatcaaagt tacaaaactg
     3301 tcctaacctg gctcgagttt cctcgcaaag aatgggatca gtccagtatt ggtgctcctc
     3361 accttgagcc acagaataag tgggcgtgcc atgtggaaaa gccaagatga atgatcaagg
     3421 gtggaatctg gagacacaat cagcaaatct cgcagagctg ctctgggtat cgggggtttg
     3481 gagatacgaa gagaactgcg aaaatggaag aagactgaga gaggggagag ggcatgttat
     3541 aagcacccga ccagggaggt cgaagaggga cgcctggatg ggactgcaag gaggagccat
     3601 cttcagcgcc aagctcgcag gtcctcatgt tcaccatgtt actaaattga caacaccgta
     3661 ctcccgtcat tggggaaagt tatatttctt atatttactc ctgaagctaa attttgcaca
     3721 ctgtacgcat ggatatacct tatcgcgcca actttacact ttcatatcca acacacaccg
     3781 aatacagtca ccactcttca tatgctggaa agcagtattg atggtcccca gtgactcccg
     3841 atgagtgatg taatcatcca ccttgaggta gccggcgacg tagtcatcga caagaccagg
     3901 gagctgagat cgacccttga taccaccgaa tgcgcaaccc ctccacaccc ggccggtcac
     3961 tagttggaat gctagataac tagtcagcaa tgtgatcata tatagacagt cagcacattg
     4021 agtaaactta cgccgagtgg agatttcctg gccagccgca gcaacaccga taataatact
     4081 ctcaccccag cccttatggc aggattcaag agcagcacgc atcacaccca catttccagt
     4141 acagtcgaag gtataatcac atcctccatc agtgagctcg atcagttcct cctgaatagt
     4201 cttcccgttc ttgaccttgg tggggtttat aaaatgcgtc gcgccaaatt tgcgcgccca
     4261 ctgctcctta ccatcattga catcaaccac aataatctta cccgctttgt tcttcaccgc
     4321 gccctcaatc accgacaaac caatacaccc agcgccaaac acggcgatat tagatccctg
     4381 ctctacattg gcggtgacgg tggcagcacc atatccagta gtaatgccac agcccaacag
     4441 acaggcacga tctgtcggtg ctttcgttgt aacagccacg accgagatat cggccacaac
     4501 ggtatactga gagaaggtcg acgttcccat gtagtgcagg atatctttgc cgcgtgctct
     4561 gaagcgagac gttccgtcgg gcatcactcc tttaccctgc gtggtacgga tcttttggca
     4621 caggttggtc ttcctagact tgcagaactt gcactcgcca cattctgggg tactggttat
     4681 tcataagcga gggttcgtaa cgtaagtgag atcagagaaa tcactaacta gagcgcgatc
     4741 acttgatcgc cgggcttgac ggtggttacg ccctcaccaa cggactcgac gataccggag
     4801 ccctcgtggc ccaggataac agggaaggct ccctcggggt ctttaccaga cagagtgtag
     4861 gcatctgtat tgtggccaca gccatgttag ccgatatgag tcaaatagga atgtgaagca
     4921 agaatacaga tttgggtcat atgtatccaa cgtggtagga cgcacccgtg tgacaaacac
     4981 ccgtgtggat aatcttaatc cgaacttcat gggccttcgg aggggcaact tcaacatcct
     5041 caacagagaa tggttcgccg gcagcccaag cgatagcagc ctgatattat cagccacaat
     5101 gatcaagaag atatgctgca aacgtcttta ccttgcaagt tatggtctat catatcaagt
     5161 tagcacaata ttcgcggagc gcatatcata atataacatt gattttggtt gacaaggagg
     5221 taaagagtgc tactcatcgt gcagcgcaga aggctgagag ctttaagggc gttttgggaa
     5281 tgaagacatg ggagtagaga actcacttta ccaacggtac tcgacataat gaaaactttt
     5341 tgcctttgga atgattgttt tttttttttt ttttttcaag ggcaattgat ttgaaggtgg
     5401 gattaaatga gtgaagcagc tctaggttcg aaatggtcga acttatatag aattggtccc
     5461 tggcgtccac atttgtgacg caagtatcat gagaaaaaaa atgacgtcga gcaagtgaaa
     5521 gtggagcatt ggagtcatca atgatagagg ggtttaaagg atttaatcgg ggtggagaat
     5581 gtggggagcg gcagacagag actcagcttg tcattttaaa gttaaacatg gggctggacc
     5641 cgttctcatg gaggctagaa tttccataac cctaacagtc ctgagtcggg gacccaaata
     5701 ggcatgggta agatggttga gagagaatga atccacatca tcttcccctg atatagggca
     5761 caacttgagg atcatcgatg cacgctagtg tgggcggagg attgccgatt tgggttcgag
     5821 tattgagcca atcagaagca cgctcggccg cccgctgcca agcattcatg acagctttaa
     5881 gttaaacttc acgattctag gttccggagg tacatccata ccaacactca actcgcgcgt
     5941 ccatccctta cctgaaccta ccagcttggg agagaactct aggccagtac catgtctacg
     6001 aaggagtcat gatgtcagga atattctgca tagatcgaca aggtatttct aatgcatacc
     6061 cggtgtgaac tataaaggtc gttcaggaga aggtgacttt cattctgcaa tctctttctg
     6121 caccactccc caacatcaga ccacaaatca acaatgtcta gcaaggaaaa ggtagttatc
     6181 attggcggtg gatggggtgg ttatcgactt ggatacggca tcgaccaccg aaaatacgat
     6241 atcaccctca ttgcgccgga caacacgtct gccgtgactc ccctcctcgc cagtgcggcc
     6301 tgtgggctgt ttgacccccg tctggcccat gagcccatcc ggcggaagga ctttcatgcc
     6361 aaatacatca aggccttcgt ggtcgacatc gacttcagcc ggcaggtgct cgtctgtcaa
     6421 cccgcatttg aagagctgaa agaggatcgt ttcgaagtat cttatgaccg tgtgatcctc
     6481 acgccaggct gtcgaagcaa caccttcggt atccctgggg tggcggagaa cgccatcttt
     6541 gtcaagactg tggccaatgc aaatactgtg cggactcgtt tgaatgacat cctggagatg
     6601 gcttcattgc cggggatatc ggaggcgcgc cagaggcagc tgctccatat cgttattgtt
     6661 ggcggcggtc cgactggcat cgaggtggcc gctgaattaa ccgatctttt cgaaggcgat
     6721 ttgggaatct tattcccaca cctcaagggc ctgacatccg tttcggtgat cgatgtcgca
     6781 ccccagattc tggccccatt tgaccaaagg ttatcagaat acgcttgcag cgcattgaaa
     6841 accaacaagg tcaaggtcaa gctgaactgc cacattgtca acgtgacaaa ggacaccatt
     6901 gagaccaggg aatctgggat cactggctac gggatgctca tttgggccac cggaaacaga
     6961 tcaatcccgc tggtcgacca attgcaactc cgcaagaccg aacatggcct tgtccgaatc
     7021 ctgacagatg atcatcttaa cgtcttctca ccagatggca acgtgatacc gaatgtgttt
     7081 gcaatgggcg atgcggcaga cattgagggc ggaacactac cgacaacggc cgaagttgca
     7141 atccagaaag cggattatct cattcggctt ttcaactctg gtctcaagga tactcgacca
     7201 tttaaatatc agcagcggtc actggtaaca tacacgggtg cctgggacgg tgtggtgcaa
     7261 gggcagcgcg agtacactgg ctacggtgca tggctaagtt ggagatctgg caacttcttc
     7321 tggacgcggt catggaggcg aagggtcctg atgtgctatg cttggtttat ggattggctg
     7381 gatgggagag agattattcg caattagttg tggtgccgaa aagaatgcag agttatattg
     7441 tgtaatacat atcggtcact tgttttggtg ggatctttgg acttttgtct atttcacgtc
     7501 gattcgtaga gccttatgcg tattttgtac tttaataaaa tacttccttg gtagtttgtt
     7561 tatactgttg gttgaggcgt aacgaaaata gtcagtgtag tacaagattc atgttcgtta
     7621 tgaaactcga aaaatggttt aagatatcta ccgtgaaacc aacatgggga gactatgaat
     7681 gcttcgtatc ctcgacctga gctttcccat gagaaggcct ttcgctggtg cgtcatgaat
     7741 agtctcctga cactatatag tcagtgttat gcagcttgga attgctgacc acggtattaa
     7801 tcctgacctg tatgtccaac tgcgcggtcc gcctgcctag tctacgcgtt cgcaatgttc
     7861 tacactgtcg tgtttggttt cctccagcac catctttctg tcttccgaag tttcgaatcc
     7921 tagcctcgcc ctaatactcg caatccgctg tagatccgct tcaccctcat tgccaccaaa
     7981 caatgtatcc atttcctcaa tgggaacacc attcgtctcg ggaacacaga agtaagtcca
     8041 tactccgagc gtgatagaaa acaccaagaa gaagtagaac gtgccgaaag tgatagattg
     8101 gagcatccac ggtgtgatca gcgccacgat gaaatttgag agatagttgg cggcaatcgc
     8161 cactccaaca gctttaccgc gcgtcgccgg ggggaacatt tccgatggca tcacccagtt
     8221 cacacaggca atgctgaacg caaatgttcc gatatagacc cagacaaaga cacaagcggc
     8281 ccagccggca gctgggtgct cggacaaccg catacaaggt cgccacgatc agctcggcga
     8341 tcgacatccc gatagatccc aggatcaggg tcttccgccg gccccactgg tccaagtaca
     8401 taactgctgg gatggtgcag atgaagaata caatacccac gactccagtc gcgagcagat
     8461 tcaccgagtt acctcttaag ccgatggcct cgaaaaattg tggggcataa tatataaccg
     8521 cgtctgatag tgttagtgga taggccgctg tatggctaaa agaaacttac ttatgcccgt
     8581 gaattgttgg agaatctgga gtagacatgc tattgttgtg cgccttcgta ggtgaggcac
     8641 tgtgaagagc tctttatatt gattccatgc aatctggaac cgcgagctgt tgtcgccata
     8701 ctttgccagc ctactctcct catcgaacac tcgcgcagcc tttacctcga gaaattcaag
     8761 cgtgagtctg tagtcagtag cagtaagccg tcttaggcgg actaagacct gctttgcttc
     8821 ctcttctcgg cctaccagaa cgtcagttag atgagccagt atctattcgt caattccgca
     8881 tccctttatt catcaaccaa cgggggctgt agggaaggaa gaaggtaccg atcgcaagga
     8941 tagctgaagg taagcattgc aaggcgaaag aggattctcc aagcagcctg actttatccc
     9001 gcacaggtac caccgatgta ctgtgttcca taattgatcc aaaagctgct cataatacct
     9061 agcgtgatcg agagctgttg caaggccacc aatgcgcctc tgttatttgg ggtcgcaagc
     9121 tcggaaagat agagaggcac aaccatcgcc aacatcccaa ctgcgcagcc aaatacgaag
     9181 cgaccaacga acaacatcgc cacgttttct gctgcacatt ggatgacgga gccgatcagg
     9241 aagacgatgt tggcacataa gatcgaccat cggcgtgaca ggctatcgct gatgggacca
     9301 ttcgcaaaag ccccacacat tgcacctaag gtcatgattg aaacgagcta tccttgtagg
     9361 gttgcgttct cggtcagggt tggtaaatgc tctgcctggg tcgggacaca ggtgttaaca
     9421 caggattgga gacgttttat atgatatgat atcaaatgca caagacaatg actcacaaag
     9481 ctgttcatga caagcacacc agatatcacg ccttggtcat acccaaacag aaacccgcct
     9541 attgaggcga agcatgctag cccgaatatg cgaggttctt tgattatccc tttgtacccc
     9601 gtgggaccgt atgcaattgc ctgaccaccg gcgacagtgg gactgccacg accagccccc
     9661 atcgctagtt atgtatgcat cactatgatg tgtggcgaaa acgacggcgt tgctccgtcc
     9721 ttccactcgg aaaggaacac agtccgtgat gaggataggc aggagaacaa ggatagaaaa
     9781 tgggccagct ataacaacag ttaaacagga ggcatgggag gaattgccct ggctcttatg
     9841 atttctttat tacatatatt atggaccaga agatattgct gaaggctaga tcaatgacta
     9901 aataccccag attcctcccc ggcctcttac cccggaccac ctaccccaca ttatctgaag
     9961 tttttatcgt ccactgcgca caacatacca gagtggcaat atattgcatt agactatcta
    10021 agaagctact gattcctatt acaccccacc tttcgtattc tggttgtgtc ggtggaatca
    10081 ccgacgaagc cccacaggcc ccgctgcggt acctagtccc gagcctaatc gcatacgtta
    10141 aagacatgct acgtcggtaa aaacgccgaa aaatggacag atagagtttt cttgctctgg
    10201 gccttctccg atttcactcc ccaacatgcc ctgcagctgg tcttaacggc cctcggcgca
    10261 tgtgccccgc ggcgtcaacc acgtagtctc atctcacaac aatggccctg tgtgaacaca
    10321 agtgcttccg agaccggatc gcacggccaa ggcaatcgcg acgggcgaaa caccgctcct
    10381 gtgataagtg caaactctgt aaccgttgtt ggggcaaact gctgtgcttg cagtgtcaac
    10441 gcggaggaga ctcatgtcaa gacaactaac cacataggag gcttgtgaaa gcgatgtgga
    10501 gacgtattct ttactgaaag tttgacacaa gtactttcgc aacagcgaca tcgagagcgc
    10561 cattcaatct agtatcaaag ctactcatta ttgctttgtg catgtgtggg agaaattcga
    10621 atttactcga tgcggtggat catgctagtc tgctgtggtg caatgtgaga atgaatagag
    10681 cggtagaaat agtagtcaaa gaggaagagc gtagatatta gcatttatta ttaaggtcaa
    10741 cactgctatt tctctcaatg acatggccaa cattctccag atcattaact tcgctcgact
    10801 tgctgcttga catttccttt gatagagcgc tgatatccac ttctggtacc gctactacaa
    10861 ccctatatac atggacaaga tgctatggac aaggcgtttt gcaaaagaag ctctctggat
    10921 ctgctttcgg ccaagtatgt gcattcaatg caatgcgccg ccggggaata ctctgatcct
    10981 cactttaacc gggcctatcc tgagtccagc catcgccccc cgcgtaggtt aatcttattt
    11041 atacgttgga gtacatgctc aacccgtaca accctttcgc aatgctcgag aatatccagg
    11101 ttagcgctac ttctgccaag acaaagtttc ttcgattagg ggagacgttg agatgatttt
    11161 atgtaaaacg ggttctctat tgtatcccac ctcccaaagc aatgtcacaa tcatacaaac
    11221 tttgtttcta taacggacaa atgaccaagc actcagtgct gctccatact gcaaaagtcg
    11281 aagtctttga cccagagatt tctttgatcc acaagctgga gaatacgcgc acgctgatca
    11341 aaagtcagtt tcttaggcct gtttgagcgg gaatgcgtag tattattagt acgcgcaggt
    11401 tgaaggggaa ttgtggattt cattgtggaa agcgagagcc gtgagtacag attcttgatc
    11461 tttttcgcac cccggccgat agaatggagc ccacaaagga gtgcacgtag ctgaggatct
    11521 cgctcctttg cgcagggagc gatattagcg agttgtttag agctgaatag cttaaaaagc
    11581 acgaccgtcc acaatctgaa tctaagtagt tagatcaggc agtcaagacg actgggtata
    11641 tggggtcaca tacgtagcct acttcggcag ggtccatgga tgaagaagcc ttgctaggag
    11701 cggtgggtct aagaagctta ctccacacaa gtacgggtca cgggtcaagc tggcctttac
    11761 tgcgtctggt atagtgtgta catgggtcat gtgatcatct gtttagctgc atcaaactct
    11821 gtccttttat ggaatacttg tactccagac attgaatacc gcatgtgctt ttcaatcagg
    11881 gaaatggcca aatatactta gaactgttct atatatagct tgtttataaa cttttttaat
    11941 taacttaaac gactcgcgtc taatatctct aatagtactt tatttcttct actttcaact
    12001 tcttatattt atctacttcg ttgtatttag taaagttgtc tctctttatt aatcaatata
    12061 aatagagtaa cttagttatc tctagtataa tattatacat tagtactgcg cgggtattaa
    12121 tcttcttact aaactattat aactagaacc acttatttat tatataagtg gccatattcc
    12181 tatataaaac agtaattata agagtaagac taatagcgtt gttagctatc tgatatatta
    12241 tattatgtag accgttgata tcctatgtat taatatctta gaaaacaaaa ctagcttcca
    12301 ggcccgtgaa gatttacatc ttttggacac ggtgattagg ttttttaaaa aacataatcc
    12361 aaattgtgaa actgccgtgc cttgctacgt cagttggcta tactaccaag ttgctcttcg
    12421 ggctattaac aatgcagcta cttcacaaag cagcggtcta gaaaacccgg ctggagcctt
    12481 ggctacaacc aataataata atggctaacg taatccacgg gcgagcggcc atcccgggca
    12541 agcagccacc acaccagaat tctacgcacc tcctagaaat aaagctattt aaaataccaa
    12601 aaaatatata tttctataaa aaatttaaat agtctaataa ttaaaacact aaataatttt
    12661 atattctagt atattatagc tagaacacct taataaaata tatatacgct ggctttctac
    12721 tagagtgcct atatctacta aaacaatagt tatagactct ataatagaat ttctgcctta
    12781 tataagtttc taagcttctt aaactaaagc gcctaatttt atagatagct atctagtaaa
    12841 gcgctttttc tttttaaata tttttttata cgcggcgcgt agttctctag ctttctactt
    12901 tataatagta gctttattta aagcttattt ataatcttta aaaagctgct ttattataat
    12961 cttagtagac aaattaaagc tctttatata agctctaagc agcttcttca atatagttcc
    13021 ctatttttat agttacttta gattataaaa tgttttaaat attaaattag tagatctact
    13081 actagatcta ctatctagag atattacttc tagctaaata ttcagctaaa ataatacacg
    13141 cttagaatta aaaaaaataa aactagtagc taaaaaaccg ctatagatat tactaataat
    13201 atatatctaa gctctcgcct aagaaaagac ttcaagaaaa ttaagtttat caatatagtt
    13261 aaagcctaat cttattttat tcttaactag ctatctatac acgcgtttta aaaggctaaa
    13321 gcaatctata ttaaataact aaagtagata agataaatat atagatatat agagtagtat
    13381 aatattattt taactatata tattattaaa ctgagatatt aaataactac cataactatt
    13441 aaatattaaa agctaatatt aactaactat atagtcagta gtaaaagata taaataacta
    13501 ctacagccaa cgtaaaccta tcttattaat agttcagcta tttacactcg tttctatata
    13561 ttagtctaat agtagaccta tctcatacca gcccttaata tagactttat ctttaaaaat
    13621 aaaataaaat agaagagacc ccctagagct aatatactta ataaaaataa tctattccca
    13681 gttctttagc tatagaaaaa aagatctatt aattaactta gcttaagtaa ctactttaat
    13741 aatagatatc aagtctatta caaagccagt tttattaaaa ttataaatat cgtccagtta
    13801 aatactatac tatattataa taatttatac acgcttaaac catttatata aaagcttaga
    13861 atccttatat ttagcgtact aataattata gtaacaaaaa aattaaattt ttaatttctt
    13921 acagtattta ataaaagtat atacccagtt tttattaata gtagtagaaa tattactaaa
    13981 accacacttt aaaaataaaa tattaattat ttcttatata taagtaaatt aagaagatac
    14041 tctacgctaa tctagtaata gaatctagta taccagtaaa ttcttcttat tttaaattaa
    14101 tttatagcta ttagcacgcg tttcggctta aaaagtatag ctatttagac atctctaaaa
    14161 aatagtatat agaatattat agatacatac tactttagct atagtatgaa tttcttattt
    14221 tttaataact aaaattacta gtagaattct atcttcttat ttaatagaat cttttagctt
    14281 tctagctact tttagtagta tagttaatag ttaaaatata tagattcttc aagcgtggtt
    14341 aaaattaatt aacatagcca ctcacccggg atggccgctc gcccgtggat tatgttactt
    14401 aacctttcta tatcttaata ataataacgt attagatata ggtacagtaa cactggcatc
    14461 aggttcgaat gggtccctga accctgtgtt gtactcgtga gggatacagc ttagcttcct
    14521 gcctaagctt tggcaggatc cttatctagc tatgttggac gaccatttag ccgagcgttc
    14581 acccaacgtt taggcgggat gtacaactgg cgtttgataa gtccaaggga gtgattaatc
    14641 aattagggaa acgtgaacat ggcgacataa ctagaaggac aaaccataga tgctatacca
    14701 ggctccaata aaggtcgaac agtcgaatcc ttcgatcagt tcggctctgt agtaatatta
    14761 tattaacact attatatttc actttgacat agattcgctt ccgatgaata tgatacttct
    14821 tttgaccggc caaatgccat actatgatac gcacgcaaac agaacctcac ctgggaaacc
    14881 aaaaggtcac ggtcatttaa ttacatggcg taaaacctga cctgagcttc ttcatcacct
    14941 aatttatgga tcgtcatcgt ctgcatttct agtgaactga tttgctgaag tgctagtctg
    15001 tactcgagcc gagacctgcg ggacctaaat acacgcaaac ccaccagcag ctgtacaact
    15061 gaagctcaca ccgtcctgga atctgccatg gccaagtagg aaggcaatac cgttgtccgg
    15121 tccactatat ttgggaataa ccccatatcg ctgatttgac tagtggtaca tgtgcgtggt
    15181 atatcaagca ggtatgactc acggaaataa gaaggatcga atggcggcta tcctgattga
    15241 taaatacttt tccgtactat tgaatcttag agatagagta tgtcatgtat gaatgtgtgg
    15301 ctgtggagat aagacaagtg actgatagca acccggaaaa cccaatagat ccactctaac
    15361 catccccttt tctctcccct cgggggttaa gacactactc caggctgcgt ctctctaggt
    15421 ccttactagg ctcgggcacc cgagaggccc ggggagattc ggggggataa gcagaacact
    15481 ggcagtgtcg gttcttacat acacgctcgt ctcagggccg gagtaagctg cacgccctcc
    15541 tttcccacga gtatgacacc gtcgacacct tgcgtccata atcaaggtct acaagaaaac
    15601 ccaaacagct aaacgaattg gtagaatgca acagggacaa tctttttcgc caagagagta
    15661 actcagtata gttgaaccga gcatggctac tgttgttctt gttacgggtg ctagtaaggg
    15721 ccagtaatag atccctatgg tacataagtt atactcaagc actaatgttg aatgaaggta
    15781 ttggaaggga agggtgtctc actgcactat cgatccctca tctcgatagg gcttctatta
    15841 agccgcgagc tggacctcca ccgcatagac cattagtcca atgcggtctc tgcacacact
    15901 atcgaagccg agatgggtcg tcgggtgtgg tggtacttga tagtgaccga ctggtatgtc
    15961 tttggtaaac tcgttctcaa agcaactagg gaatactaat agtttgagcc aggctgttgg
    16021 ccgtgaggta tggcggtcca ggcgagggca tgtaccaggc caacccgcgt caaatgatag
    16081 tgaagaagcc gcgcaacatc acgtagactt actcgatgcc ggacttcacc tagactcacc
    16141 catctcccaa ccgactgaga tgtcttactt cctccaacgg cttcgtcttg cagagattcc
    16201 gcgcggcatc gtcgaccaca cccctatggc tgtgacgagc gcaggcgggg cgagttacta
    16261 cactcatgtc acagccatag atttcgagct cgaccagatg atccacgaca tcccatcctt
    16321 cttccacctc gatacctaca agtgcagctc cgactcaaca acaagtggca tctttattca
    16381 agcctactta cccagctcgg tgatccacac ccagcgctgt aaattgtacc tcacgtattc
    16441 acgtatctta catccggacc gaacaacaac ctggcctaca cgtcctcacg agacatgtct
    16501 caaatccgcg cgacaactca tccgcgctga agcacagctc gagcgcgccc agcacccctt
    16561 cgtgcagatg tgattgcgct catccaccat tctgtatggc gtcttcatgg cgagaattgt
    16621 gctcctggcc gatgcgtgcg tcaacggaac tggctcattg caagatgaaa tccgttatgg
    16681 ggaggtcgcc gaggccctac gcatactgga ggatgcaaga agtcactcgc tagctgcagc
    16741 gaacctgctc cagtcgctaa tgcaggtctt ggagaagcat cgcgcttagt agcagatctc
    16801 acgggtatcc gcaccgctgc aactgggggg agcctctact actcgtactc ctgccaccag
    16861 tacaaccccg gttatgagtg ttgcgaccgc gcagatgtac cagaggcccg atacactgtc
    16921 actctcgggg actcctaacc ccgtggacgc gaacagaagc ggcccgctgg gtgctgttcc
    16981 ggaccaaacg cctgtcacga caggtcagtc gtcatatggc aatcagctgg ctcagagtct
    17041 cgaggagcta gtagatattg atggtttcca gtgggatgat cttttttctg gtatggatgg
    17101 ctctacattt ttctaatccc agatcggcag ctctgtcatg ctatgagata acggtgactg
    17161 ttccaaacat agagtataat ttgatttgcc tataatctaa agcatctaaa attatatcat
    17221 tgattggtct tcgcattgcg ctgatagggt gctcggtttc ttagtaaata gtttctactg
    17281 aagcaaacta tatatttaat tccgactggc attaatatat tctgagagta accatctctc
    17341 acacgccatg cttcccattt cttttttctt ctttccctgt ttctattttg cttttcgttt
    17401 tctttcatat ttctggaacc cactcttccc aagcacgttt acaatccgac tccgttccga
    17461 agccaagcgc cgctgtgcgt ctgaaatagc accagtagtc aaattccaac ggatccaaat
    17521 tgaactcgtc gtggtcgtcg tcgctattct ctccaatatt ctcctcgacc ttctccgcga
    17581 cactccaaat acaatcaatc gcccacgtga gccaaatcgg cggaggtggg aacttgcgga
    17641 aatattcaat ccattgggct tcgcccattc cttctttagc gctccaggca gaatacatca
    17701 ttaaataaga ttcgccggag ccgatacgcc aggaaatctc aaatgggtgt atgtctggga
    17761 acgtgacgta tgggggagga accgctccat gttcggcgac tagtttgttg atttcttcct
    17821 cgtacggtgc gtcatcgctc attctaatgt cttgttagct ctcgcggaag cgcattgcga
    17881 tgcgctgagc tggtacatga atctgcagag tcttgagcag ctcttcatag tttaagccga
    17941 atctttctgg cgcggtaatc gcctggtacg acctatgtcg acacgtacgt ggaagtgcca
    18001 ggtgtgaatt aattaaacgt cccaagcctg gttctggatc ctgggaacct aatgactaat
    18061 cgcatcagcg ctttcctact ggctcacgcg agacacaccg tgtagggtat aaggcgttga
    18121 tgagtgccgc ggctactaga agatcaacga gatcgacggg agagtcaaag cagcattcaa
    18181 gtacagcgaa ccaattatgc aagcgagcat tctggtgtcg ggtgcgatta tatacagata
    18241 attgactaac tgctatcttg ttcgctcacc ctgactgtct cgcacatttc cattgtaata
    18301 ctgatgtgtt gctgcccgac tgtacataca ggactagcaa attactacat gctacttctt
    18361 gatatattgg ccagtacctg gcaatgatct ttatatatta catttgcgtt cgtatcaggc
    18421 gaaatagaag agactattca tgtgcctagg ggtactttat acgggcgact ttcctgtggt
    18481 cctaactaat aggtgccgcg actggctttc ttcatttaaa gcgcttcttt gcatgtggca
    18541 tattagtaaa ggagttctcc agcgctgtca tcagttcttt agctcgaaga atggccaagg
    18601 aacggatgaa gtggatgaaa tggcgtggga ttagttctat tctgggtggc atacagcttt
    18661 ggcatctcag aacgaaatga cgctctaggg gcgcctggcc taggtttgaa cttgaatatg
    18721 gcgatctgta tttcgactcg gcatggtaca tcaagatata atggcttgat ccgcatatgg
    18781 agatgagcgt tatagcatgg gtggacaagc acttggcttt cggcatgtgt cgagttacgt
    18841 cgaccgttga ctcactgatt ccaccttcga tttttatctc cagtctttag agatttgctc
    18901 agagtgcaac cctgactgta ggttttcagg ctggcaccgc cgccagacgg cgcctgcctc
    18961 tgggttcggt cccataaaat aacatcccag agggcgaacg acgtgctgca acacgatgtc
    19021 ggcgccttga tcatacaaca ctcctatatt gtcttccatc cacgcaaagc ttggataata
    19081 gggcagagaa gcgtactggg taacgtagtc ccgatcatga ttctgcaggt tacacatgat
    19141 cttaaagcca aaatgcttcg atcccatata tagcaacact tgtgcataca ggtttgccat
    19201 gcgtatggga gggttttggt tcgcagccga gttcacttct atactgccgc cctggtcatc
    19261 accatccttc cggcatttga tggagagaat cttggtgctg gcgatggtgc tgttcccgcc
    19321 ggtcgagagc atacagtagc ccagcttcct ggctggcggc tgggacgtca acatgtttcg
    19381 ccacgacgcg cattctcgga gataagggtt gttctcccgg gcctttgcat tggcgttagg
    19441 atcttgtccg tcgtggtcga tgaagtcgtt gttggccatg ctcagctggt acacaggcat
    19501 ggacttgaaa ttactcatgc cgttgtaact gatgtcctcg aaaagatagt cgtagcaacc
    19561 ttcgtcgggt gctagaccct ggatagggaa cgggcagcca atgtcgtaaa cgggggtaaa
    19621 gaaaggcggg aagtgtttct ccagcagtgg gttgacgacg gtatttgtgt ccgatgcgtc
    19681 ccggtcgtct tcgggcagca gaaaaagcgc ccgctgcagg cgtggagact ttgtaatcag
    19741 gctgttccat gccctacaga ctcgtattgc cgagacgagg agggtttgca tgtcaagatg
    19801 gaggagaatc tgctcaagca gctcggatgt gctgattcga tgtattcctc ttgtctctgc
    19861 tttggtgcgt tcctttctgt caagccgcag gcaaccctct cttgacccgt ccgattccac
    19921 ggggcacggt gtgtttggca tgtcgtcgta agacagtttt ttatgaggtc agttaggcga
    19981 cgtgagtggc attcgcagtt tcgctgggga cgagctggac attaaactaa tgaattgcct
    20041 gccaggcaac caacgaacta tctatgccca ttgccaagca tactaaatat ggcgacctac
    20101 cactttattc ctacatctat aactaacgcc atacaagatt caatcaatcg taattatctc
    20161 tttccagctg cgaacataaa gaacgtggta ccatggaaag cttcacacag attgccataa
    20221 tgtggccagc catatcccac gtggacctcg cccactgcgt gcacagtgca ttcaggagga
    20281 attcccctac cagaagcagc tttttcgtat tatggaccgt gaatcggatt atggtaacag
    20341 tggcgttttg ccaacctcgt atacggcgag tctgccttgc ggcttggcga cgcttattca
    20401 tttgttggct cctcaacagg ctcccactta ggctgcattt aacagttcta taggtgccca
    20461 ccacgcgcaa caggttcatt cccacatgga caaaatacaa ttatcacaag atgcctttaa
    20521 tcgcctggcc agggcaggcc tccatgacag catagtcggc tgtctcgtgg ggtccgccct
    20581 gggcgacgcg gtcggtctct acaccgagtt cctctccggc gacatgtcgg ccgccgcata
    20641 tcccgcgcgc aagtttgtgc tctccccaca gtcgcaggcg actccatttc gccgagactc
    20701 gcaccgagga ccacatcgac ccggcgagtg gaccgacgat acggaccacg ccatgctact
    20761 gctgctctcc ttcctgcaca cggacctcaa aactctcgac ccaacggact ttgcagccag
    20821 actgcatgtc tgggtgcagt ttggctttct gccgctcgat accctgccgc tggggctggg
    20881 acgcgcggtg ggtgccatcg tgcggacaaa gacctatctc gacgacccgg aggcggcagc
    20941 ccggcggcac tggactaact gtaagtacaa cgtggcgccc aatggcagcc tcatgagaac
    21001 gcatccgctg gggctggtat gtctcgacag gaacttggac gagacgtttg acctgggagc
    21061 cgccttttcg gtcgtgacgc acgtcgaccc gcgctgtgtg gcctcgtgcg ccattggcac
    21121 ggcgctcgtg cgcggactgg tgctgcgaga gattcacaca gaggcagaca tcgattccat
    21181 gatcggcgcg gccattcact ggtatgcgaa gtaccgggtt cgggcgttgc aagagcaccc
    21241 ggaacggcga gacgagccag acttggacgt ttcggagctg cgccgacacg ccaaggtaga
    21301 gagcctcgac gatttagagc tagacgacag tggtaagatt ggctacgtat acaagactct
    21361 gggcgcaggc gtgcacctcc tccgtctcgc catgcgtgat actgcaaccg gcatgctcac
    21421 atcccgggca ctggcgtttg agccgctcat cacagaccta atcatgcgag gcggcgacgc
    21481 tgacaccaat gcctgctttg cgggcgctct gctgggcgct tatttgggct acgctaatct
    21541 gccgcttaac tggcgcaatg ggctgcgaca cggcgagtgg ttgctgggta aggctgaggg
    21601 cctgagccag atgttgggcg tcgcagatgg cgagtatgtc gggtcggcag accgggagac
    21661 ggcgcgggac ggcgggcgag gtgggatgcc ttctgaggct gataatggag aggaaggtaa
    21721 tggtgctgca ggcatggatg gcggagcaag agcaagaggc caagcggaga gccagcaaac
    21781 tggaggacaa gggttggttc aagtggagga agtagccatg agcatacaca ccattgtgga
    21841 catgtagtca cagagtttcg tttgtttaca atggaagaag tcaaataatt ggccgacgcc
    21901 taccaagatt ccaatcgcgt ggaggattca gctttcaagt gactgtactc ttcatccgta
    21961 gaggaaggtt cagcaggcta atggacttca taattacctc aaaagctata tttaaatata
    22021 tctatgagca gaatacaagt ccccaatctc gatctaacta cacccaggga tgaattcctc
    22081 tacgctcctc tgcgaaccct cccaagatag ccccatatcc ttgactaact gtcctagctt
    22141 cgtgttaaac ccactgatca tgccctattt ccttgcagaa tgaccaaatc gtggtgtccc
    22201 gcagcccttg caccaaccag tcattcagta actgtggaaa caacggcagg tgttcttcta
    22261 gcgagttatc atgagcaaga agaactacca cgttacctgc agcatccaat tcttggattt
    22321 tagccactgt atcgatagct tcagcataat cagggaagaa ctgcccacgg gccaggtggt
    22381 agaagggctc attggggctc ttccaagatg ccaactgcat cagcagatct cctggacatc
    22441 cgccgcagcc cactggatct cccctgggta gtggccgggg aagaggaaga tactgcgacg
    22501 gccgcaacac gccagggtga tggcaggcgt cagcgcccat gaagacaaac gagggcggat
    22561 aggctgtcgt gcgggcgagg gcacacatat gtcccgcagt atggcctgga gcgtctagaa
    22621 ggtagaagga gccatcacca aaatagtcaa aagcggccaa gcggccgatc cggaggccag
    22681 tgttgtcaaa gtttatttca cgaatctcgc gacccacggc gtcactgtcc aggacagtgc
    22741 catcgggacg ggacgggtcg ccggtgtggt cgaaatggtt gtgagaccac acgatggcct
    22801 caatgtcaga actgcgattg tcaacccact ggtgtcgctg tcgagcactg atgcgacgtc
    22861 cctgtcgcat gaggtaatct ccgtggtggc tgtgaggagc cgcacgatct ggggcgcata
    22921 attctgccag tcgattcgca cacccaagtc aaaaacaagg tggcgatcgc catgcgagag
    22981 gaggaagcag taggagggca cgcgcggtcc gtcactaggg atggctggct cgtagaaggc
    23041 cccgggcttc aggtaaaggt atgtattact atagatcaag ggagttaggt ggatgtgtcg
    23101 ggagaaacat ggacctgact tacgtatcta tcacccggac gtccacagtc gaacaggatg
    23161 ccgggatctg atggaagggt ggagttaact gacgacaagg cggtgcaaag ttcgacgagt
    23221 ccattgtggg acacggggtt atactgcgga accggtggtg gtagcacttc taaggaagag
    23281 ctttgataat ggcaattcgt acttatattg agagggggga aggtttatca atagtgtagg
    23341 gagggccttg acagaatgtg tggatatggg cgatagtacg ctatatatac acctgtcgaa
    23401 gcaacgcttg ccacatcgag gaaacagaac cagctgaata cttcgtgaac taaggcactt
    23461 ttggtgggcc ttgaaaacca gcttaggtag caatttcagc tgatttgaaa aggatagggg
    23521 gtagggccca cacatatcat gcatacgccg tgaccctatt gtcaaacgag aaaataccaa
    23581 caatagcagg aacatagaca accagagtcg aatgtttaag tctagtttga ttaacggaac
    23641 atcccaattt tagactgttg gccccttgat gaaaagtagt ctactgagta gcagggttga
    23701 gcactccaat tgtcttctaa ttttccaaaa gatgccccga tatgacccca gtcggattag
    23761 agagcattct taacacctgg cagggcaggg tatctctcga ggtgtgtttg tgaaggcctg
    23821 gattttactt tggggagttt ctcttccatg cttatctgga agtaggtagt aacatctatc
    23881 gcctacatgt acttgtaagc atcagctggc ccttaggtag cctgttcgcc tgctctactt
    23941 tggatccgcc ttgtcccggt ctgatccctc cttccgtctc gtaatattgc aataaaaccc
    24001 gcgctgcttg aagaaaaagc cgttctccac cgaaaacctc tccggatcaa tgatcttcat
    24061 ctatagtatc ctattagcaa ccacctaatt caacaccggg tcaatatcct caataaagcg
    24121 agaactcacg tcgtatttta acaccaagaa gggaactaat cttttcagtt caagtatccc
    24181 aatatacttg ccaagacaga cacgccgtcc ggcatcaaac tgccccagtt agctactcag
    24241 ccatgagtcg aattagttag caaagggttg acacttaccg taggaacgct ctgctcgagc
    24301 ctcttgcgcc cttccccctc aagccatctc tctggcctcc actcctcgac atcgggcccg
    24361 aatgtttccg cgtgtcgatt taccacgtag gggttcccac caactaaagt tccttcaggc
    24421 agatagtgat tcaggactgt gacgccgcca gcagggacaa cacgcccgag gacaagtgcg
    24481 aagggggggt gcagacggac agcttcttga atacaagcat cgagataagg gaggtcgcag
    24541 acttcgttcc atttcgggta ggggagggtg agattcgctg ttatgagttc actggataga
    24601 gcttggagag tggcggggtg ggtaagaaga ttgtctattg aatttagaaa tgttggtgtg
    24661 cggcattgag aggtgtgatt gcgataactt ggactcactt attgtatacc agcggagtgg
    24721 cttaaactgc atagttaagc taatttcgtg ttctagactg cgccttgccc tctgcctagc
    24781 cttgctttac cgcgcgggca atgtctacac atccgtctcc acagaaccgc cacccgctat
    24841 tggtgtccac agcagtctgt aaggctttta ccttttgata atgtgccgct acctcctgct
    24901 ctgtaaacct ggatctattc accatgcata tacaaaagag ttgaataagg attggtatcc
    24961 tggtggtaag ggagctcatt agtaaccgta gctgcaggat ttgtgatcta ggttcaaaga
    25021 aagggtcaat agcgtggata gcgtgacggc tacttacaga actgctatag agccaccaag
    25081 acagaccaat gacatatcat acgtttggct acgcgcactg cgacaccggt agcgtccacc
    25141 gcttttgttg tagcatagag cgccatgcct ttcgtttttg aatccaagag tcttcaatag
    25201 taatgtgatg ctggtcgcca cggcagccag ggttagggta agcagggcga caaactgaac
    25261 cagccatact gtaggtgggc gtgggttggt gggtgaatgg gaatgcctca gcgatgggaa
    25321 cactgtaagt atatgtgcac cagccttgga aagcgaatcg attaagttag ccttccggtc
    25381 attcattcac atgtggacca ccaattatgg ttgtagatat gaatcgcatg gtgatagacc
    25441 cacacagagc tcgttgacaa tggcgaaggg cacgaggccg gggacagatt tggagaccag
    25501 aatggccgtt gtgctaccaa gcaagatgaa ggacaaaagc cagcgcagca tcccccagta
    25561 gctaatcaaa gtgtagtagt cagatattga gtatatatga ccagatacac ctcccgcttc
    25621 agactctccg gtacggttaa ctcgattgtc tccggagctg catttgcaga cattccccgg
    25681 tgtgtactgt ccatgaggga atggtgttct tcattgcctt ccttgatgtt catattgagt
    25741 gacattatag gggacaggga ggttggtttg ttggtgctgt tctgtcggta ctctgatcaa
    25801 agaggcgcag cagggcgttg ggaggcggca ctagtagctg tcacaagtaa tgccttccgt
    25861 actccggaat cgataccatc caactaatca tactcccatt aggtgtagag cctcttcatc
    25921 agctttgaac tccatcaggt gggggatgcc attttacaat aacggtgtgt ttgttcgtct
    25981 gacgttctat tgtatcaccg ctagaatgtg acaggcgaga cggattgcgc tacctcaaag
    26041 aggatacgag acaaccatct atacaaaccc tctcaaatga agatcagcat cagtggttcc
    26101 gccatcgggg ctagtgccgt ggcagaagtt gggtttaaca aggcagtctc cgcttcccca
    26161 aaaaacttca tcgacaatag ccatgggtgt tctttcgctc aacaaaccac agcactcacg
    26221 ggtttacttg acgaagaaag aaatgagtat ccccatagcc cctgtgatta aatgcaacac
    26281 agtcgacact tttcaattta acaccgatgg gggcaatccg aaacaaaggg gtgattctgt
    26341 ttacgaaggt tagagcccct tcgtattcgt atatgcggag accgaaccag ccctaaccag
    26401 tccggataca aggggggttg ccctgtaatt cgcgcctcat tcgacgtagc ccaagggtac
    26461 cctgaaagct ttgcttattc caaagaatat cttgtctcct tcgagaaact tgatcttcac
    26521 cagggctagc cattcttggt ggcaatacga gctgtggtcg tcgtaattgg ctagtaccaa
    26581 gtgctggtgt ccgatcagtg gggctggaaa agtaacgttg aacacgtatc ttaactcaat
    26641 cgaccagcca tccaccacga gatttgcaga cgcgtactga gatcagcgtc cagccagaca
    26701 gaacttatgg cgatcattca ctcccattgc tacgttggat gggccataaa tagagccgat
    26761 gaagggtttg acaaaacagt ctgctccaca ttgtgcggtg caccttcaat agaatataaa
    26821 taagatccct tctatcgaac ccgaactcca tttgttcttt cgcccttctt ttccatccac
    26881 agaattgcgt cggattcaga cggaaagatg aagtactctc tattcctcgc catagcaaca
    26941 tcggtggttg cagtgatggc tcgttgcgac ggctcctcac agcctgggtg ggagcaacat
    27001 ggcttctgcg acaacggcca accatgccat gagcgttgca gagatgcggg tttcacatgt
    27061 ggtggctgcg gtggtgtatt ttggaaccag tgctggtgtt gcaacaactc ttgttagtga
    27121 catcgctgtc cggcgaggca cgttgttgct gtcttggaat gaaacgtaag tctctctttt
    27181 ggaaatattc gtcgtctcca tcatgagact aattacctcg ccaacaggat caagtgagca
    27241 aaaataggcg aagtgaacgt cagaatccat cttcacagct cggatccgtc tgtggtgtag
    27301 ctcttcacaa gcctagcggc cccagcaacc gctataaagc actggaaaga atagtgacga
    27361 attaagagct tataattctg tcctctcctg tactgaagac ttctgctcta gaaatgagac
    27421 ctacttaata tgtactgctt accaaactca actgtcaagg tcctacgtta atgtactcat
    27481 ctgagacaaa tgtatagttt ggtgcaagcc tgtccaagaa tgccttcatg atgaacgtag
    27541 ctgctctggc actaacgaat ctgaagaaca ttataatcgc aataccccca aaagatagtc
    27601 acgggacacg ttttactata cctaaaagag gtggagacgg gtctaaagtg ccacaagcca
    27661 agctgactat ttggtctccc atttgtggaa tattccttac caagccacca tgcgtgtcgg
    27721 acttggctac gaatgtaggg aatgatcatg cgaagaattt gcttcggtac tggatcaccc
    27781 gaagtttata ctagtttatt gacttgctag tcgaacatct gggggtgctg catcctttag
    27841 tccggctgcc aaactggcca tacaactgtc agctcaaagg gcgtgattca gggctttctc
    27901 tgtccaacac aattagagtt aaatatagaa tatattatta attccagtat tttaaattta
    27961 catagatcta ttagatagct atattctatc aaagttaata taatctgctt agagtattta
    28021 ttactaaatt ctcgtgtggc aaaagctttt agatatagag aaatagtatt aaaattaaac
    28081 tagagcatag tccacgcaag gttcagaata aataaaagag aaatctctat agatttgata
    28141 ccactaatat caataatcta aactctatcg actccacgct tataggctta taacagcttc
    28201 ttatatatct taggctatag agatttaaat aatagttccc ttaaataaga taagaggcga
    28261 ctaatcagat tgttattgtt ttatcatttt cagctcttag atctactaat atagtcgaaa
    28321 taatagtaaa gctaagagca tgattagaag aataagataa ttattagaga accagagggt
    28381 aaccttacac caatgccacc agatctctgt cacttcttct ctgtaggcag tctctggaca
    28441 ttaccccaat tatcatcggg gaatatcaat gtcacatcgt ctggcaggtt tcttgaatcg
    28501 tattataaca ccttatgacg tccagtctgc ataagttgcg caaatgcgaa tgaaagacag
    28561 tacattcaag tataaataac attttgtctt ggtgttcaaa ttggccaacg tcaagggaat
    28621 actaattagc tgaaatcgtc ttagttctgt aagcatgtgc aatcatgtgt taggcaatag
    28681 aataatataa aaaaatcata tatggcgggt ccactgttgt agtatcaatt gattggcgtc
    28741 ttgcatagtc ttcttacttc cagttgatga gtggaaccat caaccgttaa atctgacact
    28801 aggcttctag ataagtattg cttctacaac agaattgagg gtcgtaacac ttaacgagga
    28861 aggtagtcaa attgatcttc agtggatatg accccctgac tggttgttgt aagggaaccc
    28921 cgggtcaaat atcctgacag ggcatcttca agctttgatg atcttcattc tagtaccgat
    28981 gatcttcatt tcagctccga tggccttaat cgctaaattg attggaagac tacggagacc
    29041 gataaacgct aagcaaccaa agtaccggtt gggtagagtt tacttgggtt gtgattttag
    29101 caattaaaaa gagtgactaa attacgcttg aatagaggtg cctactcaaa agattctgtt
    29161 gacctgagaa taccttacaa aatattcgcc catgatgtac ggacgaatgg gaagattttt
    29221 cgttccacag attctttgat ggatctgcaa tgtaattaaa tgtagcctcg tgtttccact
    29281 tttggatcaa tatacggaat aattttgaag ctcaggcttc cgggcacaac tagtgccatg
    29341 actatcagac tccacataaa cccttaccaa cctttgatta gttcagttag ttgatcgaca
    29401 ttctaaaatg aaagagtaaa taataaatca tacaaaagcc cccacagcta ttaaacttaa
    29461 aaggtatata attcaacaca aaaaggggtc aagcccgtac aaaacatcca acaaactcct
    29521 catcgcaaga tattctccga catcttcagg gtttattcga cttcaaggca ccttggtaac
    29581 gcattggtta aagccttatg cccatagccc cttctgccta cattcaatga gcttatcctt
    29641 tatgaactga acaacctgat cgccaaaatg aagtccccag tcagctttgt tgcgattatg
    29701 ctattttgta tctctggagc tcgagcttca ttcaccgatg cagacaaggt atgtttgaca
    29761 tgcaaatcag aaccaaactg tggatatatt cctaacatgg atagcaacgg gctgtttccc
    29821 ttcataacaa ccgtaagtgc gaaattacat tatgttgaat tatattctcc attaactatg
    29881 gatactcaag accgatcttc cgtgacgcca agcgctagta acatgaagcc catcgagtgg
    29941 gatgaaggtc tcgccacagc tgcccagcaa ttagccgata gctgcaaatt cgagcataat
    30001 cgtgccgggc aaaacttata tgagggcagt gatccagcgg atcttgtgaa acaggcaata
    30061 gatgcgtggc ataatgaaca taaagactat aattacgata gcaatacatg cgggcccaat
    30121 gcgatctgtg gacattacac tcaagtaagt gatatacacc ataagattca ctgtatggca
    30181 ttggaagtag cttatgaatc ttttacaact aggttgtttg ggcggattct tccaaagtcg
    30241 gtatggctgt atcctcgagg aagtgtgaaa gtggcatgta tattgtagtt gccaactatg
    30301 atcctgttgg caactatgct ggggaaaagc cttacaagca gcagtgatga accttcacag
    30361 tgtggtgatg gatggaatca aggcaaggat gatctatgtc ataatgcacg gtgagaaata
    30421 ggggcattct tggacaagcc caggtcatcg tgggaggggc ggcttttgta tctactacat
    30481 ttccgttttt gaagcacaat cggggatcca ataccctctg gttaaagcgg ggagggagct
    30541 tctgacaaac gatgaaccct aacacatcaa acttgatgag ataatctact aggttggatt
    30601 agaaataaat ctatcttata tgcattctat taattaatag aaacaaagta ttaaagattt
    30661 tttaatagag ataagattat tactaaagta taaatattac tataaatttt ataattaata
    30721 atagtatagt atttaaaaaa gaaatttact tactatttaa aatatctaaa atattgtttt
    30781 tttctaaatt atatctttat ttttaagctt tactttaatt atattaaaca taaaaaaaag
    30841 tttattataa atattatagt aaaattaaaa aaagacttag ttaaaaaaag aagatattta
    30901 atttaatact atttttttaa ttaaatttca ttatatttaa atattttaaa ttagggtcaa
    30961 cataagttgt atttaaaaaa ctataaatat tttttaatac tataaatttt taaatctttc
    31021 gtattttaat taattaaaat ataaatagat tttataaata aaaaaaaata ttttttttaa
    31081 tatatttata atctagatat tattagatat gttctattta ctttaaaaaa atagatcttt
    31141 ttttaaatta ctttaattta atcttcttat taaatagcac tatttttagt tttttaaaaa
    31201 tatttattta aactacgcta aattatatat ataatataaa aaatttagaa aattaaaaga
    31261 tttaataaat actataatta aaaatagttt tgaatattta atattaaaat attataatta
    31321 attagaattt aaattatagt tttattaaga tattttattc gtatagaaac tatggatata
    31381 tttaaattta aaaagacttt ataataattt taattataat taataaaata gagagatcta
    31441 gtaatctaag attattaata attaaaaact ttttaaaaat ctctataaaa tcttttttta
    31501 gttattctag attattatat gaaaatagta ttaagtaatt tatataaata gaattataga
    31561 tttaataaat aattattaaa taatctttat tatataataa aattaaaaat atttaataat
    31621 ttaaaaaaat aaatatataa ttaaaataaa tcttagacta gtatttaaaa aaatagtttt
    31681 tacaaaatta tatatttaat atacttagct aaataaatca taaaattaat tatttaatta
    31741 taaagaacta gattcctata ataatattat ttaaaacatt ttaattaata tattatttat
    31801 ttaataaatt aattaatttt aaagttagct tttcttaaat ataatctaat tttaaaatat
    31861 actattataa ataaaaattt aaaatggtaa tattttagat agttaatagt attaaaatac
    31921 attatttata aaatctttag ctttctattt tttttattta taatctagtt aaaactattc
    31981 taaatataat atttaatttt taatttttaa taaattatat tttcaatatt agattataat
    32041 ttatatttaa ttataaacta ttaattaata aactttttat atgaattatt tatattacta
    32101 ttaattaaat taaaaaaaat ataagatcta attttctaaa aaaaataaat taatataaaa
    32161 gacactagag aatataatag ttataactta ataaaataaa tataatagat atttagatac
    32221 taataaaatt agagagatta ttaaaatata tttaattaaa attaaaatta ataaaatcta
    32281 aattaataaa taaaatctat aattaaaata ttaagaaatt aataaatata aaattaaaaa
    32341 tatttaaagt aataaaaata gaaaaattta tattttaatt aataaaacct tttctatttt
    32401 tattactagt atataatatt atagtttaat ttaatttata ataaattaaa ttccaataat
    32461 taattaaaat attctttagt ataaatattt aaagaatatt ttaaaaattc tataaatatt
    32521 tgtaaaatat ctataggact ttaaaaatta tttagatcta tattttaaga gtttctattt
    32581 ataacttttt aaatttttac tatcataata tacttaaatc caatatataa atagttataa
    32641 aatacaatat tattttaaat ctaaaatgaa agtatattat taaaaagtaa atattttatt
    32701 tctagctttt tgtatttatt ataaaatttt taataattta taatagtaaa tatatatttt
    32761 tttaatataa attatcttaa aatttattat ttatagctat acttataatt aaagtctaga
    32821 ctactaaaat tattatatta tatgtaacaa ttatatagta aagtcttaga tatatattaa
    32881 ttttataatt ttttatatta tagaaaataa attaaaaata ttagttttat taagataaaa
    32941 cgtttattct ttttaaatta aaaaatatta gtaagctata ttaatattag ataatagtct
    33001 atatttacaa aagtaagcaa gagttatact agtataaata atttaaaact atctatatat
    33061 ctatattttt agatatcttc actaaaaata tagtattaaa gctatatcta ctatttataa
    33121 tttatagata tagtattaga tcttatatct gttggagcgg atatgccgca gtctacttaa
    33181 gatacttcca atacttaact agtaatagaa ctattacaag gtaaataaag agtatatatt
    33241 agatctagat tattataaaa ctgtaaaata ttttaattaa ataattagtc tttctatatt
    33301 aacgctcatc tattaaagta ttttctttaa aaagccatct atattaatat tttattaaga
    33361 atatatcgct actactagag atatattata gatccttgtc taatacatct tattaaagat
    33421 ggatatataa gatagaataa taatagaata ataatagtta attcttagat aaaagatatc
    33481 taataaatta tttatctagt atttatttta aaaaaaaact ataaatatta atattagtta
    33541 ttataataaa attatatata ttatagtaat aatataacta aatatattaa taatataata
    33601 aatttataat attaataaga tatagtatat tgttaatata aaaaattata gtaataatat
    33661 aataaataag aatatataaa aatatttatt ttatatattt aatttaattc tttagattta
    33721 atttatatta ttattataaa attatcttta atagtataac tagtcttaac ttatttataa
    33781 ttttttaatt attagatata tatatttaat agctctagtt ctttaaactt aagtctagta
    33841 ttaatagtaa tcttatattg actatatccc tgtaatgacg gcagtctagc attaatagta
    33901 gtcttatatc gactgtatcc ctgtgataat agaaattaat aaataatact agattagtaa
    33961 cccttggaac gtggtccgct aactggtctt agatttgact ataaagcccc ggacataaca
    34021 agatactctt tataaatata actaatatat tgctataatt actaaagtat aagagaagac
    34081 ggtgtttctt aaagtatata ttaattggtt tattaatagt aatactctat tctattttta
    34141 ttaaaattaa tctaattaaa agatatagaa ctattatcta atcttttttt tattatattg
    34201 ttctatcata ttattaaaat attagaggcc ttagacctta agtatatata agatcttatt
    34261 aaaatattta gttctatatt aaatcctggt atatatagta tatatagtaa ataatattat
    34321 ctcttttgga tattatataa tattatagct aagtatatta agatcaaatt ctatataagc
    34381 ggtaggccag gaagaatacc ttagtcaata gcttagccgc agtctatcaa catatttgcc
    34441 ggcataatct taaacaatcg tgggcttaat atattgcacc ctgacgcgat ggcaagagac
    34501 ttggggacca cgaatactat agatacccca agccacatag tatcacttga cgagtttaac
    34561 ggggacagaa taggccttgg agatgggctg gtcgagccta cagtatttgg ggatgttgac
    34621 atggggatgg atctctcggg agctcaacta tgggactggt tcaacaagaa ccaggccata
    34681 atgagactgc ttgaggatac atagaagacc gtcgtggtgg tatgagatgc gtttggaaat
    34741 gttgtggcga tgtagaacct gtactaccag tcggactgta tagtagtggt agttgcgtag
    34801 ggctctgtat catttgtcca tagttattga ccctgactga attccaatcc actgcgtcct
    34861 ggggagtaaa tgatattaac actaatgctc tatacccata catttatgtc tcctaacaaa
    34921 acataaaagt gccttagctc gatagctacc tggtatttca cttgaaagta gaacaggaaa
    34981 gcgacatgta aagatgtgag tgtctcttct ctataaaccc taggccatac acatgctcat
    35041 gttgacattc caatattcct ttcttatttc tatcgaactg ccggtttcga atagaggcta
    35101 aggccttcca aaggacctta ccctgtgatt taaaagaaaa gatgttgtgt gggcggagag
    35161 ggggagaagc ttaacagcct caagtctcta cagacaatac acaaatgaga aaggagagga
    35221 aatggattgg caggcttgag ggatctaagc aatattctaa ctgtactttc gtgtcctata
    35281 gacgaaggtc tccagtatac ccagatatca aacttgaacg accgtatcta gatattatct
    35341 gttcacaaat attactcaac ggagatcagt ctcttaaaat atcacatatt ctggatatca
    35401 cacgaggggg gaccaggcaa gcgttggaca acccctaata ctaaccacga ttatactact
    35461 ataatgatgt tgcccgtggg agtctcaact cggaagaaaa aaatataatc agaagttcaa
    35521 ttcatatcct gcagatacat gagactttga tcggagaata aagtggcata agcgccttgt
    35581 gttccagtgt atcaggtcac agagcctcct agattattat acaacgttgg aataacccgt
    35641 gattcctgcc ctagacagac cttcataaat accttgcatt gtgtcaagga tagagctcca
    35701 gttgtcgaag gggataaacg gaattcccct ttccttgcaa tgatctacta ggtctacctc
    35761 atgcgttagg ctcgcttatt atcaattgca agtagccaac catgcgggtg gatatgagat
    35821 tgtgaaagta attcaccagg agaactcacc caaaccctcc tttgcaaaaa gaacgtgagt
    35881 ttgcgatgcg gcagataaat ccgagacacc atctccagcg taaaaaagta gaggacaatt
    35941 tccgctgggt agcccaaagt acggcttgat ctcgagtgat ttatcatgac caaaggcact
    36001 atatagttca tcatttcggt ttagtgaaga ctcactcaac agctcagcaa atgtgttgcc
    36061 cttacctgtc gtcacggtat ttaatccgcc atccactccc actcgtcttg tcgccgaagc
    36121 tgtgtggctc aacgtcattg gcaacaacaa atatattttc tggattgctg cccagaacgg
    36181 actccagcaa catggttatg aaaggagtca tcccagaaga gagcacaact atagggatat
    36241 tacacccttt tgcccaataa tagaaatcca ggaagtgggg atcaagctga atattatcct
    36301 gtacaattcg cagacaatcc gctaacggca tctgtacact ctggagcatg gcgtggaatg
    36361 catctctatt ggtggagttg gtcaagtggc tgtgtgaaat gacagaaatg gcatacggat
    36421 ggatagcgaa ttcttacctg aaagccatat gtcctttcat gacttccatc tccaatttcc
    36481 gtcgcatttc catcccaaac ccaaagttat ctaccttcac atcaggtaag ctacggagat
    36541 tggatattgg ggtcgacata gtaccagata gtcattgcct agattgctgt cagcgacggg
    36601 cgtgtctgag tatcatgacg gagggaaaga ccaaaaaaag ccttagggaa gagtgtcata
    36661 cagtctttca gagtaatagt tccatcaaaa tctgtaaaaa agatagcttt agggttctct
    36721 ttgaggtaca gcagctcata ttcaggggac tccattatgc cgcctgtgat cacgattgag
    36781 gatctttcaa gaaccgccga acgtattaaa atggcaacta aacagataat ggaaagcagc
    36841 aagggtatcg aaacgtatgc accggtatta ttaacattta agttatctaa cgacaactgg
    36901 atgccgctct cctaggtaag cctggtggtg ggcagctatg agatttaaga tttttcccgt
    36961 tgcgtatatg atcattacat acatgacagg gagatctgta tgaggtaaaa tattacgaat
    37021 gtttcctatt ccgaagtacc tactgcgaaa gattggccta gccttgaact gcgatcttat
    37081 gacatttaca cctgtagctc catctctagt tgctactatc tctcgtgtaa cgaggagcct
    37141 tatctagctt gcaggtatac taggatacgg acaagataaa gatctagctt ctcagagtgc
    37201 caaaattcgg aagttgccat ttgcagcgat ccttctggtg tcactagcct tgagagcaga
    37261 tccagggaat gtaaccacat ttccggcgta tccagagctc aatgtcgggt acttgaatgt
    37321 catatcccac aataactgtg ctcagatggg tcggctattc tgcacaatct ctggttcact
    37381 ctgcatatga caacctaatc ctgtgggtct tgtactgaca gccgatatct atctcctacc
    37441 cgaaagggac tgcttccaca ccctaagcga cctatacatt aaccagtcgt atacgagatc
    37501 tgatcatttt aatcgatgac cagcatgtgt ccgtgaatta agcatttgtc atatagcgaa
    37561 ggttgaactt aaatcctgtc tacattttcc agttaagatg gcttgctgtc tgcactcgac
    37621 gcaaacggag catgccacac cacaccacat acccggaacc ctgggaatgc aacattccgc
    37681 tattcgctat gattttaatt ccaactagca aaataactga gcttcatgtc acatatgcaa
    37741 tttagcacta cgtgttaggt gtcctttgcg caagccactt ctgtctacat cgttgtcgat
    37801 gccgtgttac taccctagat tagcacttat tcgaggaagg ctatattcta tgagtcacta
    37861 ctgttagctt gaacctgcaa ggtaacatga tatcggatat gttgatgcaa cctatgctat
    37921 atgtggatat tgaattgcgc tagagtatgc taagaactgc agacacgcct tcagccttcc
    37981 acacggaacg caatgtggtg aaccatagtc tgtcagggtt gaggaaggaa ttctaactcc
    38041 gaagaagcta cagatgtaga gtcggaatag gtagcatttc gcgaagaaat ggttcacaat
    38101 tgtcgcataa ggcctagact tgccacaccc tctacgataa acgtattaat gcgaaggcta
    38161 caactcaatc tagccatact gactggctac cgtagttact tttaccatgt agactgaaat
    38221 tgatcggaag cttcggtaaa agaacaaaaa aagcatctga tgttgatata cctatgtatt
    38281 gctcaagacc caactattta ttcaagcgtg tggaaggccc aactgtttca cgatttcgtg
    38341 attaagagat tctcatcatt taaactcccc gcaagataca atctatacta tcacagtaca
    38401 atgggatccg cggcggagcc agcatacctg tacaagaatg tcacccatga cccaacggtc
    38461 ccttccgtaa agtcagccga gggcatttat attttcctcg aaaatggaca gaaaatacta
    38521 gacgccacga gcggagcggc tgtttctgca atcggccacg gcgtaggtcg tgtcaagaag
    38581 gctataatgt cccaacttga ccaagtggag tactgccacc ctggattttt cccaaataca
    38641 ccagcaatgg accttgcaga tcttttggtc gagtccacag gaggaaagtt gtctcgggcg
    38701 tgcattcttg gatctggtaa ccaatcaact cccctcttct gtttttctat gcatcatccc
    38761 tcgcgtcaag ggaccattca gtacgaactc gtgaactaaa tttgtgaact acataggttc
    38821 cgaagccgtc gaagcggcca tgaaactggc ttatcagtac ttcgaggagc agtcgccgaa
    38881 cacacggcga accaggttca tttccaggca cggttcgtgg catgggtgca ctttaggagc
    38941 attggcatta ggagatttta agccgaggaa gactcgattt aattccattt tgacctctaa
    39001 tatctcccat gtctcagcgt gcgatccata ccacggcctc atggaaaatg aggatccgga
    39061 gacatatgta gctcgactca aggacgagct ggacaacgag ttccaacgac ttgggcctga
    39121 aacggtctgt gcggttttcc tggaaccgat ggtcgggacg gtaggtgatc atggaccccc
    39181 agcatggttt agttggttag gatgagagat tgatatgtct gaacatttag gccctgggct
    39241 gtgttactgc actaccagga tatttgcaag ccgtgcggga tgtatgcgac cgctatggtg
    39301 ccctcctagt cttcgacgag attatgtgcg gcatgggccg gaccggaatc acacatgcct
    39361 ggcaggagga tggcgtcgct ccagatattg agctcgtagg aaagggtctc gccgccggat
    39421 atggaaccat ttctgggtta cttgtcaacg accgtgtctt ggatggattg agacacggtg
    39481 gtgggtattt tgtccacggt cagacctacc agtcccaccc cctgggctgc gcagcagcag
    39541 tcgaggtcca gcgtattatc aaagaggaaa acctcgttga gaactgtcgc aagatgggtc
    39601 agtatctggg ccaacaacta aagctacacc tgggcgatca tccatacgtc ggagatatca
    39661 gagggcgtgg tctcttttgg gcagttgaat tcatggctga tccacccacc aagactcctt
    39721 tttctccggc attcaccatc agcaagcgca tgcagtccag gggaatggaa aggggatacg
    39781 atatctgcct atttgccgcc actggtgcgg ttgatggttg taatggtgac cacgtgttgc
    39841 ttgcaccacc gtacattgtc cataaagaag atgtggacga gatcgtgagt cgtcttgttc
    39901 gaactattga cagtgtattt gaagatgtag ctgcgctagt tatgtgaagt attactgttt
    39961 gtggaatatt ttgttgtcta gcctttcttt ttcgtttgcc tacgttgatt taccttgttc
    40021 ttagttgaat tatccaagag ggagcaaaac gaaaaaaaaa aaaaaaaaaa gggcaaagac
    40081 aaacgacgga ctgggaacga ccaaaagtat aatcctgcga gtattatgct gataattacc
    40141 tcatgactac tgtattagtg gcacaatcta tatccaagtg aaaagaaacc tccatgtggc
    40201 attccctaga tacagatgta acgtaaacgt ttactacact cattattctg atgtattgca
    40261 acccttccag cagtgagggc tttgataact atgtgcctgt acgcttagta agactagatg
    40321 cgtaggattt gcctctgcct ccgtcggctg tgtccgtttt ttctcttatt tccattcctt
    40381 tccctccctc tctttctttt ctgcttgctg ccggcctgct tgttacacct cctaccgtct
    40441 gacgttaata tctacaccaa acactttggt gtaattaaag cctaaatcct tgtcttattc
    40501 acatacaaca tcgcatcccg gaaggcaaga taccgcatga atgatgagca cacagcagga
    40561 cttggcgtca caggcccctt tattatcaga ctcggcctat gtgtcttatg gttcttacca
    40621 ggcagatgga cgagaccggg ataatgtcag tgaagcaggc gactcctact cacggcagca
    40681 gccagaaagg tggaatgaac cttcagtgaa cctgtggcgt gtcctggcaa cattctacag
    40741 cttcattgtg gtcggcgcaa acgatggcgc atacggggta agtggctcac agaagtccat
    40801 tctcagggag cttgtactaa taggcttgct atcggtaggc catgattcac tatgtaggtt
    40861 catccgtcgg atatatgcgc ggcactttct gaatattggc tgctaaccac ttctcttccc
    40921 ttcatctctt aatagctggg tcgatattac gacgcagact ataccacggt ttctgtagtg
    40981 ttcctttcgc catttcttgg ctacgctacc gctgccatgg ctaatagctg gatacacgag
    41041 cgcttcggac agcgcggaat tgccttgctg ggcacgggga tgcatgttat ctcctacttt
    41101 gccacgaccc agcatcctcc cttcccgctt cttattacga tattcatcct agctggcctg
    41161 ggaaatggca ttgtggatgc atcgtggaat gcttggattg gtgcaatgca taatagcagc
    41221 cagctaatgg ggatcctcca cgcgttttat ggtctggggg cggctttggc accgcttacg
    41281 gccacttatg tgatcaccca gagaggctgc atttggtacc acttctacta tataatgggt
    41341 attgcagcaa ccatcgagtt tgtgacttcg gtcgctgcat tctggtcagc aagaggctcg
    41401 ctggttgaag ccagcgaact gggtgttcct ggggacaacg tgcaacaaga tgaccgagac
    41461 tcgtcaagac gcaacaccac attaaagaac ccaacgcttg aatcattagg tttggtctcg
    41521 acatggatca tcagtctatt cctgttggtc tatgtgggca ttgaggtcac cgttggagga
    41581 tgggtcttca cgttcctcgt ggatctccgg aatacaccac cgtctgtggc aggcgtggtc
    41641 acattcatgt attggggagg actgaccgtt ggccgtgtgt gtcttgggtt catcacaccc
    41701 tacttcaagc ggcaacgtct tgttattgtt gtgtacttat tggcctgtgt ggtgtgccat
    41761 attggtttct ggctcgccac ggacctccac ctatccatga tcgcagtaac attactgggc
    41821 ttcttcctgg ggccccttta cccagaggcg gttattgccc aggccgcact gttgccaaag
    41881 catctccatg ttgcagccgt cggtttcgcc tgtgctctgg ggagcgcggg tggatgcatt
    41941 ttccctttca tcacgggcgc aatcgcaaaa gcccatggta tcaaggttct tcaccctgtt
    42001 gtccttgcga tgcttatgtt gtgtttgata ttgtggtttg ctcttccagg gcagcgccga
    42061 ggaaccaaag aagccgcatc acctgcctgg agcagttcac ctacactgtc ctagtggcct
    42121 tatactcatc tctgctgttt gtaacgatct ctatacaggc actgatttcc gcgtgttatg
    42181 atgcgattgg tgtactgaac tctggctgta atgtcttgac cgtgttcgca ccaacatttg
    42241 cagcaggtcc tattcaatat acacttcctc ccctgcgata gaccttatct caatatataa
    42301 ttatcctaga cgtagcatga gtgcaacagc cttgtctcct ccacgagaga gctgggggtt
    42361 ggactcaaaa gcaactacac ggtccggaaa gtcataaatt ggctcgtgaa cgtcattaaa
    42421 ccagacacat agaaatgtag atatttgcac agggcgacac aagtcacggc aaccatactg
    42481 gaaccggaca tagcatccag gctcagacaa tacgtcacaa caggatctga aatgacagcc
    42541 ggagcaggtg tgccgatcat acacaggtgg tgacgacttg attctcaatc catcatagaa
    42601 cagactagac ccgggaagaa tagccaacca agagcggtgc caatttacgt agtcacggag
    42661 acggatcatc catagttcac tgctacttta cgagcctgga gtcattgagt catgcggaag
    42721 tgggcgtacc agcaggtgaa accagacaca aagttctgcc atagccccaa agcaactccg
    42781 attgttctct tccaatgttc gcggtatcgg tcgactagag actgtagata caacgtgctc
    42841 gtaaccagac gcttctttta gtaacgtcct cagtcgaaca tacaggcatc tcaccatgac
    42901 atctatgaac aaagtatttt ccggttacta cgagcgcaag gctcgtctag ataacagtga
    42961 caaccgcttt gcgaaaggaa ttgcctacgt ccagggatct ttcgtcccac tcgccgacgc
    43021 acgagtccca ctcctcgacg agggtttcat gcatagcgac ctcacgtacg atgtgccatc
    43081 ggtctgggat gggcgctttt tccgccttga tgatcatctc agtcgattgg aagatagttg
    43141 tgaaaagatg cgactgaaga tcccactgtc cagggacgaa gtcaagcaaa ccctaaggga
    43201 gatggttgct aagagtggaa tcgaagatgc ctttgtggag ctgatcgtca ctcgtggcct
    43261 gaaaggggtc cgtggcaata agccagagga tcttttcgac aatcatctct atctgatcgt
    43321 catgccgtat gtctgggtga tggagcccgc catccaacat accggaggta ctgcgatcat
    43381 tgcccgtaca gtacggcgca ctccccccgg tgctttcgat cctaccatca agaatctcca
    43441 gtggggggac ttgacacggg gtctatttga agcggctgac cgtggcgcgg attacccatt
    43501 tctctcagat ggagatacca atctcacaga aggatccggt ttcaatatag tgttggttaa
    43561 agatggtatt atctacacgc ccgaccgtgg tgttctggaa ggcattacac gtaagagtgt
    43621 ttttgatatt gcccaggtca agaacatcga ggtccgcgtt caggtggtgc cactcgaaca
    43681 tgcctatcac gccgatgaga tattcatgtg tactactgct ggtggcatta tgcctatcac
    43741 gaaactcgat gggaaaccga tccggaatgg agaagtcggt ccccttacta caaagatatg
    43801 ggatgagtac tgggcgatgc actatgaccc gaaatatagc tctgctatcg attacagggg
    43861 ccatgagggt aactgatgct gtctcattct gctcgtcctt cccctttctc cggatccagg
    43921 tttttaagtg cgatggccag agacgaatcc gccggagtgc gtgaagcatg ctttccagct
    43981 atgagggtct tgtttatcct atcttgatct tatactgtgt attgttaagc caccttcaaa
    44041 ttgaggtccg gaattgcagg ctatatatga tacatacatt gaagagaagg cttaccgctg
    44101 caaataaaaa tgaataacct ttctcaaaca ttcatgtgca aatctgggtt ggaacattct
    44161 acatatttgt tgtagagcca gcagttacta acagtctttc acattgcgct acacgttcta
    44221 tagcattctc cacagcaggc cttgtcagtc tgaaaaccga aattaagtga caagtgtttc
    44281 tcaatccaac catcaaaaaa gtcttgcccc ggtcgtgaat cctctgcgta gtctgaatct
    44341 gcggtttctg atccggttca gtctggacca tctcgttgtc tcgcggcttc tcacagagta
    44401 atttggacgt ttttcgatac gctaggcact ccgtttgcgt tcatgacgaa cagcatgtag
    44461 tatccaggaa gagcaacgcc aggatcattg gggatgtctg ctgtgtacat gttggtcccg
    44521 gcatcttcga gcactagttc gatgcgacgc tggtcggtgt tcactgtgtg tgttgtggtg
    44581 ccgtagcgga tcagggaggc gttactgata ggggaatcag cagtgatagt aatttgaccg
    44641 ccataccgaa ggctggctgg ggccaccgtc tcgatgtgag gccgtggggc acggtttcca
    44701 tccgcgtcaa acaaatatgg cggagtatag atctgggcat catagtggtt ggcggtgcag
    44761 ttggcacaca atccaccgcc accattaatc accgtcgcgt cagggagaag aagggaccag
    44821 ctgtggtaaa ctcggacgat attgttcgga aagtgttcga cgaatctgtc ctcctcaggg
    44881 atgtatcgct ctggcgtcaa ttgagccgtg tcctcgttaa agggcaggcc atgtgcctgg
    44941 ccaccggtga taaaaacact tccatcgggc aagacaaccg aagtatggaa cgtccgcgcg
    45001 tatcccatgt caccacctgc tttcacagtc accggcgggg tgttagggtc ccctatcgtt
    45061 atgagagttg cattctttgt agcatccgaa tcctcatagt ttggggaacc tccaaaagtg
    45121 aggattctcc caccggtggc gtcaaacatg accgcattgc cggacatctg atcgtagtcc
    45181 gtgcttcgat tgcctgcatt cgtcacattc ccttcgccct gggcgaagta ccagtgcatg
    45241 gcctggctcg gcccggcatg gaagatcgag aggttcttcc aaccgaaaat ccagccatgg
    45301 ttgtctgcat gatagggacc caggttgtca tgggttaaca tgggctgtga gccggcgttc
    45361 ggcaactgag tccaggtgtc tgccgtgaca ttatacacct cactgttctt gttctgaagc
    45421 tgcggcccgt tccacgaacc gcccagaaca aacatatttc cgtcggacag gatggtggaa
    45481 gcctggtagc cacgttcgac gttcatcggt gctccagcga tccagctgtc gctgaaagag
    45541 tcgtagatac tcgtcatggt gtcatcattt cctccagtga caatcacgcg cccattgaca
    45601 tccatggaga taccagaaca gaacatatca tgctcggtat cggagacttc gcgccgtgag
    45661 acaacgcccg tattcggatc ccacgtggca gtttgcgtta agccaccact ggtaccccca
    45721 tactggttct ttcgatatga agaccagacg agcaccttcc cggaactggg ctcgatggcc
    45781 gcagaggctg ggacgagagg gaagtcgatc gttggccccc aggcgccaac ttcactgagg
    45841 cgttttccct gtggcgctgt gggaatgctg ttcgccgacc agatttgtag gtctgcaata
    45901 ctagttgcat tgtctccatt ggacgaggaa cgcgcaatga gcctcacata ctgcaccgct
    45961 ttaggctcaa acacagccag cttcacggtc gaatcaggcc accatgcccc atgtgcgact
    46021 ggatctcccc aggttacccc atcagtgcta agggaaacat catgtgtccc aatccaacca
    46081 tcttccacgg ctcttggcca cacggcaatc ccgctcacat tctgtactgt cccgagattg
    46141 atagtgatgt tgtgaggaag ggacgcaata ccgttggtgt cgtcaccgct gtgccagtac
    46201 gtgctattgt cgccgtcgat cgcattgata cattcatgtc cgaccagctc gctgtcgcat
    46261 gttgctatcc agctgctacg gtcgatccgc gcgctgttgt aaggtggaga ctgatacaag
    46321 cctgtattct ctcctccggt atcgacgggg gcaccactac cttcaatacc cagagacgcc
    46381 ccttgtgcta cggcagatat gagggacccg tgcacgatgc ttttctctgc tttggataaa
    46441 ccgatgagca acaataccga tgcccacttg agacccattc ttggcttctg cttcatcgcc
    46501 cctttgcaga cgttcatagt aagaataaag atgttatccc aacccgtaac gtccctgggt
    46561 ggaagctgaa ttgatatata tagttcatca tggtcattgg aaactcgagc aaccaattca
    46621 gagtatctgt attcaatcaa gcaatagaat gcctggtgtt caggaatgaa gggatttccc
    46681 gtgtcccaca cagtgtgaca catgccgcat atcccaacat ccactaaaag acagtgacac
    46741 tcgccataag gaatgtacgg tctagtccct gtcaccgccc tagtcttacg agcggctggc
    46801 gatcaggatg gcatgttaag aggaatcaag tcaaagccgc caataagtaa ttctctccct
    46861 accgatcgat gttctcacac gctgtcctca agatacatcc cttctcagca ggtcgggtta
    46921 gggacacgta tacagttgtg ttcgagaaaa cctttatctt agagacggca gcaagtgata
    46981 acatcctagg acccttgtat gggctagcga ggtctagagg gatctgcatt acaagcgtag
    47041 cagtggaatg acgagagaaa tgctgaattg cgggatattg acatatggac taaattgtcg
    47101 gaaatagaat gttgtgctat acaaccacca aaccttttca attctggcat gcctcctctg
    47161 aactacccat gcaattccgt gtctggggta gagctatgtg tcaccaaaaa ctaatattaa
    47221 aattcctgag ccctcagata ggtagtcacc cccattcaat cctcattcct gttgtgcttt
    47281 gtaggctcgt cgagtctttc gctccacggc attcaaaaag agataaacta tgtccaagta
    47341 agggcgttga ccatcattgt ttgttgtcct agcctcgtcg cgttacgatt taccaggagc
    47401 tgtacccaac tgtacctgat tagtagagaa ggatgcgaac tacctgtctc ctcgggacat
    47461 taggaagagt ggctgttcac acatagcgtc ttgcagtcgc ttcctgcaag atgagctgac
    47521 atgagctgtc tccatcattc cacaaacgtt gtacagggct ctattagcag ttcggagtga
    47581 tgacctcatt tcccaaaaca tatgagttta atcggtgggc ataggtggat tggttattaa
    47641 tccgatatat tgcgtcaatt aatgttctgc aagcggcata tccgtttctc tgtccccgac
    47701 gccagtccgt gtaggtaaag ttgaaaccct cgttacaaca caagcctttg atcaaagcta
    47761 gccagaagcc agaaagaaaa agggtgttac ttcacttggt catacagatc cggtccttct
    47821 agaccatcgc gtcaaccgct tcttgactcc gggctcaata tttggtcggt tacccgagac
    47881 caccaaccaa atcaaagaaa gatgagtttg tcacataagg atgcaacatt agtcaatttg
    47941 gtattttacc ttacaacctc ttaaggtttc ccatccagtt ccgatcggag tcatacacgc
    48001 aatggcgtgc catcaaacca tggtgttgca taccccagta ttgctggctg ttcagtccgg
    48061 cattgcgcgg aactggtgtt gaagattttc attcagtgtt ccgataatgg cgtctcttcg
    48121 aaaggtcaat ttaagctata aagccagctc tatctggctc catgtgtgcc aattattctc
    48181 tcgtgcggct attgtattac ctgctggact actacattct cattatcaat atggcatctg
    48241 aggaaaatct gacgactgga gttaataagg acaacgtgca gggcaacata tggtgggtgc
    48301 tctagggagc ggtctgtctt cgggaaacaa tattaacctt gcctaggccg ggtttgccca
    48361 aggagtttga gttgttctac tttttcaaga tttccaagac ggacagcttc cggcgccatc
    48421 tgcactacct gattcctcat ataactacgg caaatagcgc cctcaaatct cgagaccaaa
    48481 ttgcgaaaca caaggctgca gtgtctgacg ggcttacgca ccccgcaacg attccactgg
    48541 ctggggtaaa tattggcttc agcgcgaatg gcctgaagaa ggtaagccag tggttatacc
    48601 cccgggtccc atcctggtgt gagagatatc gctaacctca gcctctagct ggtgaagaac
    48661 gagagtgacc gcttgaaggc tggtcccttt cttggcggca tgcttgccga tctgcaaggt
    48721 gggactgctg ggggtgaagg ccgggataat ccagatgact gggagaaacg cttcaaggat
    48781 aacgacatcg atggcataat tctggtcacg ggcgattccg agaggaccgc ttatgcgaag
    48841 ctctatgagg tgaagtctca ctttatcggc tttttctggt tcaattccag catcgaagac
    48901 cgcttcacga tccctggata taagcgtccg ggccaggaga gcaataagga acagtaagga
    48961 gctccactcc cagtgcaatg catagcgatc agacttaacc gatagtagct ttgggtaccg
    49021 tgaacatatc tcccagcccc agcttgtcgg gctggacccg tcccccacag gggataaaga
    49081 acctcctcca gtaccaccgg ggtagggacc gctttctcca caaaccgtat cagagtgtga
    49141 ggggatactt acacaccacc aggtatatta tcaccaacac cgaccaagac ccttcgcctc
    49201 agccggattg ggcgacggaa ggtagcttcc tggtattccg caagctgcaa cagttagtgc
    49261 cggagtttaa caagtaagtc tccaatactt gccctatctt cttatcacaa actcattggt
    49321 gcctagatgg ttgaatgaaa cggccccaaa gcacgacctg accgccgatc agctctctgc
    49381 acgcttgatg ggccggtgga aaagtggtat gtatttggaa aactcctccc tcctattccg
    49441 tgacaagttc tgaaggaaag taggagctcc cttgtgccac acgctctgga aagacgatcc
    49501 cgctctggca gaaaataaca attttgacta cctaccaacc aatacccaag agcattgccc
    49561 ttttgctgcg catatacgca aggctagacc acgtggcgat ctggcagaca aattcagcag
    49621 tgcaatcatc cggcggggca taccgtatgg cccggaggtt acaaaagaag agcaagacaa
    49681 gcaaacaacg aaggaagatc gtggaatgtt gtttgtctgc tatcaaagca atatttcaaa
    49741 tggattccgc aggatccaag agcgtaagct atccacattg atccaactcc taaacgttat
    49801 aatagaacac gtcctctgac aactacatcc agagtggtgc aacaagaaca ccttcccctc
    49861 aggcaaaaag cgtatcaccg gtgatccagg acccggagcc gatccaatct gtggtcagcc
    49921 aaatgggcca gacccgtttg tgatgggatt gtgtgatggc aagaataaga acatccatgt
    49981 ggatttgcat tgctgcgtga ttcctagagg gggggagtac ttcttctccc cttccattgc
    50041 cgcactgaag aatatttcga acggctcaac ttaagagttc cctgtcatgg aatgctccat
    50101 agctcttgtc actctaatcc agaaggggtg aaaacttaaa tattggtgtt ctaatagtag
    50161 ggcttcccgc ctatagtaaa ttaattaggg tcttctattt agtaatattt agattcttat
    50221 actttagtta aagactataa ctatttttac tagataaaat tatataaaat ttacaggatg
    50281 aggcatgagg acagagagag tgggcatgtt acgcccgggt atccatccaa gaactctaag
    50341 attagttagc tatcttagag acaacttact taataattag aatctactag taatcagtaa
    50401 taatagataa tctaagatag tctaataaat taataatata ataataataa tattacttta
    50461 aatagtctag tccacaaggg ggtgagcatt catagaagga tggaatgaag tggagctgac
    50521 agcagctgtg gattggtaga gcgggttagg gttttttcta aactaagtat tatagattaa
    50581 agcactttaa gtataatact aactaaacta taagactaat aatgtttaaa tttatataga
    50641 ttaaagagta ctatagaaat ttatatttaa acaattttta gatataaatc ctataattta
    50701 tagtagtaga gattaattta gatagactat agtattttat taaaagtttg cttagagtac
    50761 aatttaatta aataagactt tctattaatt atctataact ttaattatct aataatacta
    50821 gtaagaccag tagttttagt agaatctatt taaattatat tttattctag attaaatata
    50881 tctaatctaa gaaattaatt aaatttagta ataatttact agttagtcta gtaaactcta
    50941 aattattatt tctattctat aatatattaa taatagtatt ctttatttta gattctatat
    51001 ctaaagataa ttaattaatt ataatctata ttaaattaaa aataataata ttctatatta
    51061 agctatatat tttatattac ttttttctaa ttctattagt attctatttt attttctatt
    51121 atttattttc tatatagaat ctatattata ttagctatag aatatctaat tttttagaag
    51181 ctaaatagat tatctataat tatttataaa aaatattagt atagtatata gtttaataag
    51241 attatatatt atattaaaag tattatctat agtaagaaat atattaagat aatctagatc
    51301 taataaatta tttagtagta gaagaatatt actctgtata tagagaatat taagattct
//