LOCUS       AP007151             4429080 bp    DNA     linear   PLN 16-DEC-2016
DEFINITION  Aspergillus oryzae RIB40 DNA, SC005.
ACCESSION   AP007151
VERSION     AP007151.1
DBLINK      BioProject:PRJNA20809
            BioSample:SAMD00067075
KEYWORDS    .
SOURCE      Aspergillus oryzae RIB40
  ORGANISM  Aspergillus oryzae RIB40
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Eurotiomycetes; Eurotiomycetidae; Eurotiales; Aspergillaceae;
            Aspergillus.
REFERENCE   1  (bases 1 to 4429080)
  AUTHORS   Sawano,T., Tanaka,T., Machida,M. and Yamada,O.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-JUN-2004) to the DDBJ/EMBL/GenBank databases.
            Contact:Toshihiko Sawano
            National Institute of Technology and Evaluation, Genome Analysis
            Center, Department Of Biotechnology; 2-49-10 Nishihara,
            Shibuya-ku, Tokyo 151-0066, Japan
REFERENCE   2
  AUTHORS   Machida,M., Asai,K., Sano,M., Tanaka,T., Kumagai,T., Terai,G.,
            Kusumoto,K., Arima,T., Akita,O., Kashiwagi,Y., Abe,K., Gomi,K.,
            Horiuchi,H., Kitamoto,K., Kobayashi,T., Takeuchi,M., Denning,D.W.,
            Galagan,J.E., Nierman,W.C., Yu,J., Archer,D.B., Bennett,J.W.,
            Bhatnagar,D., Cleveland,T.E., Fedorova,N.D., Gotoh,O.,
            Horikawa,H., Hosoyama,A., Ichinomiya,M., Igarashi,R., Iwashita,K.,
            Juvvadi,P.R., Kato,M., Kato,Y., Kin,T., Kokubun,A., Maeda,H.,
            Maeyama,N., Maruyama,J., Nagasaki,H., Nakajima,T., Oda,K.,
            Okada,K., Paulsen,I., Sakamoto,K., Sawano,T., Takahashi,M.,
            Takase,K., Terabayashi,Y., Wortman,J., Yamada,O., Yamagata,Y.,
            Anazawa,H., Hata,Y., Koide,Y., Komori,T., Koyama,Y., Minetoki,T.,
            Suharnan,S., Tanaka,A., Isono,K., Kuhara,S., Ogasawara,N. and
            Kikuchi,H.
  TITLE     Genome sequencing and analysis of Aspergillus oryzae
  JOURNAL   Nature 438, 1157-1161 (2005)
COMMENT     URL:http://www.bio.nite.go.jp/dogan/Top
FEATURES             Location/Qualifiers
     source          1..4429080
                     /db_xref="taxon:510516"
                     /mol_type="genomic DNA"
                     /note="SC005"
                     /note="phrap>=30:535-4428238"
                     /organism="Aspergillus oryzae RIB40"
                     /strain="RIB 40"
     CDS             complement(join(5905..6325,6375..6841))
                     /codon_start=1
                     /locus_tag="AO090005000001"
                     /note="predicted protein"
                     /old_locus_tag="AO070259000001"
                     /protein_id="BAE55128.1"
                     /transl_table=1
                     /translation="MLISSVAKDGYGKDIWTLPFDSITRILKFTWLLQLLYIPALAAT
                     KMAFLCLYLRIFPSTGIRRVTWVLVTINVLYLLTYGFGTAFNCLPVSYIWTKWHGETE
                     GSCLNFNAFGIANATTNIALDLAVIGLPLHKIAGLSVSLSKKIMLLAMFALGFFVTIV
                     SILRFRVVITYATTTNATCISLYPHQPNSLHLTFYPADDTVATSYWSIIECFSGIVCI
                     NLPSARRFYRKVTHFCFGTSQTGQEEGYQNVTLGCSSASKKRKLPIELSILKTTETTV
                     RHDQMDVEMESLVVVSRSR"
     exon            complement(5905..6325)
                     /number=1
     exon            complement(6375..6841)
                     /number=2
     CDS             join(7979..8338,8407..8663,8710..9099,9151..9598,
                     9648..9791)
                     /codon_start=1
                     /locus_tag="AO090005000002"
                     /note="cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies"
                     /old_locus_tag="AO070259000002"
                     /protein_id="BAE55129.1"
                     /transl_table=1
                     /translation="MDLLRLRDRSLLGQGALVAFVTYWAVWIIYTRWFHPLAKFPGPF
                     WASVTRAWTLLHVLHGDAEKRQMKLHAKYGLVPPGDILEPYLSSIGSVVRIAPNELVT
                     SEPEAIQTLYGARSFTAKATLGYVRTQYYPQQRLIGVARFPDHFSSEGGKQHGERRRI
                     VSHVYTMTSILQSEKYIEKCIAVWLEKLGQMADRKESFDLWIWTRMYAYDVIGELYFS
                     KMFGFLQAGHDHLGYIDATEDLVPIQFLAANMPTYVRGLFMLTGILFPKVRRALRALG
                     DLTDATNAMLKDRLAAIQSDSEDKPQRHDILGKLLEISQKRGKELDFVLDDIKMESFG
                     AFFAGSETTALTLSGILYHILRNRSVYEKLTAEIDTAVQCNQLSTPHISYNDAIKLPY
                     LTACIREGIRMHPITGVSFPRHAPSSGCTIGGYYIPPNARIGVNPGVMHFNKTVFGED
                     ADQFRPDRWIDGDVSKMDRYIMQFGMGARTCLGKNISMCEIYKAIPELLKFYTFELAG
                     DEDMQTTSYWLYKPVAIDVNVRRR"
     exon            7979..8338
                     /number=1
     exon            8407..8663
                     /number=2
     exon            8710..9099
                     /number=3
     exon            9151..9598
                     /number=4
     exon            9648..9791
                     /number=5
     CDS             join(10773..10803,10869..10991,11048..11073,11142..11552,
                     11598..12290)
                     /codon_start=1
                     /locus_tag="AO090005000003"
                     /note="hexokinase"
                     /old_locus_tag="AO070259000003"
                     /protein_id="BAE55130.1"
                     /transl_table=1
                     /translation="MAIAAAVSSNDVLKGVPENVLRELQKMKSMFTINRETLRTVTDK
                     FVTELENGLSSHENEIPMNITWATGRPTGQEQGTFITIDLGGTNLRVCKVELTKQLGG
                     YKITQRKFKLPVQHRQRSVDDLWALVADKLKESLESQHITKGREALPLAITFSYPLTQ
                     HNIRRGSCSVGRRAPIFLALRDMPSLPSWSTSLHREDNLPVEIVALVNHTTGTLVATA
                     YQYAQVKVSSIFITGCNPAYIEDCGLVTKIASYDLPAGKEMAIHKGYGAFNNSHSVLP
                     RNVFDEAIESTSRPGQQTYEKMVAALYFGELVRLIILHLHHTTGLFTGCDLSRLDRIH
                     SMESTFLSAMEGGPLGSLGEMQALFRERFNIEPKTKELKICRLVAEIACTRAARLYAC
                     GITAICKKKGIEPYHVAVDASTLFGERAAAALREI"
     exon            10773..10803
                     /number=1
     exon            10869..10991
                     /number=2
     exon            11048..11073
                     /number=3
     exon            11142..11552
                     /number=4
     exon            11598..12290
                     /number=5
     CDS             complement(join(13020..13257,13322..13406,13458..13548,
                     13594..13705,13783..14252))
                     /codon_start=1
                     /locus_tag="AO090005000004"
                     /note="predicted protein"
                     /old_locus_tag="AO070259000004"
                     /protein_id="BAE55131.1"
                     /transl_table=1
                     /translation="MSRQLCITSVDGHTGFLIAELILTDNKFKKAIGTVTGLTLHPDA
                     PFCKELSKLGAKIVPHRPGRLRDMVSSLQEVGADTMCLIPPAHTEKFDITAELIEETK
                     KANVPNVCFLSSAGCDLAERDKQPRLREFIDLEARFMASKGDPSTSTGHSPVIIRAGF
                     YAENLLLYSRQAQEEGILPLPTGKDHKFAPIALGDVAQVAAHVLTGKGKHGFSDRHRG
                     QLMVLTGPLLTTGDELASAASQALGENLKFEDISEAEAKKVLHAQSESDESEVQYLLE
                     YYSLVREGKTNYISTTAFHDVTGGHPQEPPDFFKTYAQEFHAKRGHKKRKLSADK"
     exon            complement(13020..13257)
                     /number=1
     exon            complement(13322..13406)
                     /number=2
     exon            complement(13458..13548)
                     /number=3
     exon            complement(13594..13705)
                     /number=4
     exon            complement(13783..14252)
                     /number=5
     CDS             complement(join(15191..15876,15951..16294,16351..16520))
                     /codon_start=1
                     /locus_tag="AO090005000005"
                     /note="serine/threonine protein kinase"
                     /old_locus_tag="AO070259000005"
                     /protein_id="BAE55132.1"
                     /transl_table=1
                     /translation="MPREATDIEEGTQVYRPEGFHPVYIGDVFKDRYKVLNKIGYGVY
                     STVWLVRDLEPAQSGLENQFRALKVLSADSYEGTNSPIFEREILTHLRDGDRDQIGYD
                     YVCHLLDDFEHRGPNGTHVCLVFELMGETLRSFGAWFAESRLPNSVMRRFTIQLLLVL
                     DFAHEHNVIHTDIKPDNIFVKFRDHSLIESGYLTDVAIPQQDRFEEQYSVVPSTPLRQ
                     YYFNDADSRRVDEFDIALGDWGVSSWANRHLSETIQPVALRSPEVLIQAPWDASTDFW
                     NLGAVVLEIFQAVRMFSGSVPPDGHYELKEHLAEIVDLFGPFPNELLAKWDQNLVRDV
                     FGDDGRIKDAPPMNRPGLASEAFMPGLDQELRDMFASFLHAMMKINPADRVSAEDLLR
                     HPWLDAL"
     exon            complement(15191..15876)
                     /number=1
     exon            complement(15951..16294)
                     /number=2
     exon            complement(16351..16520)
                     /number=3
     CDS             complement(16647..17249)
                     /codon_start=1
                     /locus_tag="AO090005000006"
                     /note="predicted protein"
                     /old_locus_tag="AO070259000006"
                     /protein_id="BAE55133.1"
                     /transl_table=1
                     /translation="MMMFFLPFLECPVEEKRTTGSIQRPFQWTDVVDGALLPVSLSLV
                     ESHTDPELPLEKEPTFHFSGERFISNDLLVKPPDSQTMSLFRHYRQDLDELRIVSSRT
                     VTVAEDPLLANAWLLPLWNVDLKGDVRGKRCLLVLQLKGPTAADQLAHAVFGGMIEVW
                     GIRSETVEVKEIILDASASLVIYLFSDGLPYHVYGHDTGS"
     exon            complement(16647..17249)
                     /number=1
     CDS             complement(join(17473..17929,18004..18122))
                     /codon_start=1
                     /locus_tag="AO090005000007"
                     /note="predicted protein"
                     /old_locus_tag="AO070259000007"
                     /protein_id="BAE55134.1"
                     /transl_table=1
                     /translation="MEEIGTRYIWWDWMCVPQGLKHQLDPELFKAKGEEIGKQLHIYK
                     NAAKSIVWLHSTSWEDDSALKELLLLEMSRPGFRDPTLVQDYTGKAGRWLEAAQADER
                     WLKSGWTLQEGVLLGSTCLLNRDGMTLSDSKFYNSSETIIRDLSIPVSVLAHNLATAF
                     FIQSEGHDSDTTRPRAGQFGHLPPKAPESVI"
     exon            complement(17473..17929)
                     /number=1
     exon            complement(18004..18122)
                     /number=2
     CDS             complement(join(21186..21269,21795..21954,22846..23036))
                     /codon_start=1
                     /locus_tag="AO090005000008"
                     /note="predicted protein"
                     /old_locus_tag="AO070259000008"
                     /protein_id="BAE55135.1"
                     /transl_table=1
                     /translation="MSPLATLRRSRPRCRVNMCQRRRKRKRNKRQRRRSRRKPRRRMK
                     RRRMKRRRLKAMSLSLKRSTRRRARRRTRRRARRRTRRRRKTTKKRRRRKPIMMMRMQ
                     VFSRKSSPTSTLSAKLNEKVVVSKLGLGAGITYATVCAMGPE"
     exon            complement(21186..21269)
                     /number=1
     exon            complement(21795..21954)
                     /number=2
     exon            complement(22846..23036)
                     /number=3
     CDS             join(30841..30876,31381..31997,32245..32347)
                     /codon_start=1
                     /locus_tag="AO090005000009"
                     /note="predicted protein"
                     /old_locus_tag="AO070259000009"
                     /protein_id="BAE55136.1"
                     /transl_table=1
                     /translation="MAASCLRLICPLLILDLKAEDQPLERAQGALLLSYQASPDDPQI
                     GSLLLANAIQNALILGKPTKPSISVERSTIKRLWWSVLLRDRWISLALRRRSQLTPKD
                     FDPENNPLEEADFGKEIQESKVYDVHTKRILFTALKQQCRLAIIITDMVSLIFSSCDG
                     SSMGLPSKDFPACMSRCMKTRNRLRQWETETRYALSTAPPEVHHSVMSFIKMTYVYYQ
                     YPACAISFLTKSTDSPVGEQTGIRWMANSGGGD"
     exon            30841..30876
                     /number=1
     exon            31381..31997
                     /number=2
     exon            32245..32347
                     /number=3
     CDS             join(35863..36754,36816..36834,36955..36968,37028..37208,
                     37293..37336,37396..37439,37468..37640,37674..38567,
                     38634..39291,39313..39720)
                     /codon_start=1
                     /locus_tag="AO090005000011"
                     /note="uncharacterized protein conserved in bacteria"
                     /old_locus_tag="AO070259000011"
                     /protein_id="BAE55137.1"
                     /transl_table=1
                     /translation="MKTKSDAYIDQEDDYSSVDVEKGYSMPEISDLAMLELQMVARES
                     ITFVGGPAAILLQIAHPLVGAGVADHSTFKTRAISRAEYTQMYIYCMIFGTTSEKAAM
                     RAYVDKAHSRVGGQHNRQSYNAKDPELQVWVAATIYATMVNMYELIYGPLNSTRAERV
                     YQAFSIMGTSLQVSPEMWPKNLTEFQLYWDDMVNKRLCVTPDARAVLHDIFHPAKGLP
                     LWARPLAVIAMPFVKRLTIEQLPPRVRDQFFLKSTKSSRLISGLFITGMSGVYPFMPL
                     FVRQFTKTYMMGQMRRRIKKRVLYIPPINLKEEPFIIQRSCNCPRESLQEYTELEYDI
                     YFVEFRNGLHAIREYTVVPADYINHYIIDQSIRYGLFQVRLYIFTGHTRNPKILVSNG
                     SNCRVERERHTATTALINGMMFCTSVVSVSPVKIGRIALTRPGIAEMTVPISFRKSVV
                     RMPVRSSGKRLFSSLGTASSSELTASLPTTEIKLWTMAGTSLSTDPTLFRRSGVIRSL
                     RTFSPGTIMSWWNNSMVSLRRGGTVSTSPPTSPRNSCVNSVDMTFSIGPRSSVPKMGT
                     KLCSSGGIAARTEPTSVTNCLVTSPVRAFSSARIMSTFKIGSIPLMISGSPAIRFSTA
                     SLPMMGMISPTTGMTALTREVKSLMNSGVMMAASRFSIAEMRSLLKIGTRSCTNGGIR
                     LAILLISLMNSGVTISVTICTSDLMISPCSNGSTSCMIDGTAASTDSMAEMKSGVRIL
                     GMSSSMGGSRGRRALTIRSSSEGISGSSVLIIPGTLERSDWTADINSGVRTCCRTSSS
                     VGRRGNSVFTNPGTALRTDSMTCRSSGVRTFVTRLTKSGRSGSRLLISPGTASRIDPS
                     ALMSSGVRILVIRFTRSGTSGSTLFISPGTASRTDSSALMSSGVRIFLINSSTFGRRG
                     NRLFSSPGTASRSDSRVCRSSGVRTFWIKFTKSGTRGNRLLISPGTASRTDSSALISS
                     GSSIFGTSGNRLFSSPGTASSSDSRVCRSSGVRTFFIRLTKSGTSGNTLFIRSGTALS
                     TDSSAFMSSGVRTFSSNSSIFGTSGRTVSKRPGTAWINDLMSFTNSVVRTSLSRLTRG
                     SRRGRSSWMMGGRALINDPI"
     exon            35863..36754
                     /number=1
     exon            36816..36834
                     /number=2
     exon            36955..36968
                     /number=3
     exon            37028..37208
                     /number=4
     exon            37293..37336
                     /number=5
     exon            37396..37439
                     /number=6
     exon            37468..37640
                     /number=7
     exon            37674..38567
                     /number=8
     exon            38634..39291
                     /number=9
     exon            39313..39720
                     /number=10
     CDS             complement(join(41915..42334,42390..42996,43068..43333))
                     /codon_start=1
                     /locus_tag="AO090005000012"
                     /note="predicted protein"
                     /old_locus_tag="AO070259000012"
                     /protein_id="BAE55138.1"
                     /transl_table=1
                     /translation="MAIGESERPFESSSVWRESMDSDSPGKEKQRDGEGAGPRGSTAL
                     GARSKDLRYNKPKGFWPRIFKHFKRYWLCYGLLGFIFLAIFLPVFFLVIIPAIAQRLV
                     NDASIPIHSAAIMQPTPDGLTFSLSASLSVPLGLSVRIDAFNLSLFNRDVKPMKPYVT
                     VPLEGLRLKGKSDITITNQTTKIQDQDQFTTFLSNAVYSERFKLSAYGKATAHLGKIK
                     VPLKLDKDIELNGKWCCCALADPLALTSGISGLNMLKGFSIDNAGVVLPPEADGSNLL
                     GQATLPNYSVVTFALGNVTLDLKIDDIILGNGTINNVLLKPGNNSVPLRAVVDIPNAI
                     KNIAPILAAETNALSQGNVMISASGQSTIYEGEHIPYFEKVLNNLTISANVPILKVLF
                     GTISTLVSSNPDVMQNVTDALRDTDLSSSPNMRVVSDN"
     exon            complement(41915..42334)
                     /number=1
     exon            complement(42390..42996)
                     /number=2
     exon            complement(43068..43333)
                     /number=3
     CDS             44233..45150
                     /codon_start=1
                     /locus_tag="AO090005000013"
                     /note="uncharacterized protein conserved in bacteria"
                     /old_locus_tag="AO070259000013"
                     /protein_id="BAE55139.1"
                     /transl_table=1
                     /translation="MAKTEVPRATTPDSEESKRDDTPEPWQSSISEKPTLNMVPDDEL
                     LDSLQSTENVQKIVREGVLLATGAAAILLQVAMPGVAKGVDNHSSFAYRLLHRLRTTL
                     TFVYCMAFGTKDEKRAIISMVNRAHAEVKGPDYSADDPHLQMWVAATLYASGIFMYEE
                     VYGTMEPRNADMIYREYSVLARSLRVPQEIWPKDRKAFWRYWDKTVANLEVTDHARNI
                     AQDLLYNKELFLPLRMGLPFVRLMTAQMLPQRLRVEYGMSDGRLRRSIYKSVILGAKI
                     AYPIIPRFIRTVPMKYYMRDMRRRLRRMA"
     exon            44233..45150
                     /number=1
     CDS             join(46600..46972,46996..47013,47078..47204,47260..47470,
                     47545..48164,48218..48406,48528..49269,49385..49432,
                     49477..49554,49732..49785,49959..50011,50075..50236,
                     50254..50933,50997..51103,51162..51440,51494..51695,
                     51760..52580)
                     /codon_start=1
                     /locus_tag="AO090005000015"
                     /note="oxoprolinase"
                     /old_locus_tag="AO070259000015"
                     /protein_id="BAE55140.1"
                     /transl_table=1
                     /translation="MYQTKGPRPAEKRIRRAAAACYRCHARKVRCDASILGYPCTNCV
                     LDGRTDCTLRPNATTRFKNLKQSQRRNTVQGLVKPNEEEHTTLNSSGEPCETTPQSAM
                     LPRASGFPELLESPRQTETIYEYTGPTVDLNALSLLPMSDVHILVTGGCLDMPPKSAM
                     DVFLMKYFLLVHPTPTTHRKSPSLYFKPCFFRAAQYVPYSIMWPRDLKLTMDMMLQFV
                     PVEVIQQCGFNDACEARRTFYHRAKMLYDTNFESDPLARAQGALLLTFHTTAEDPQAT
                     MTWNMCAIHNATATGLGLHPSLQDPNRCAKKRLWWSIFVRDRFLWLGRHRRPQFTSAN
                     FSLNIDYLQEEEMTNEIIMSPFYEPNVKRLLLKVFQAQCRLAVILTDVITISFSASDG
                     DAPRLSLQELDIYLTRIKQLRAGLAQWEETVYSPLHHTGIAEPGTVGIIINLTALHYQ
                     TARMVLGNYETLLVESHLDMIQDRSASILLPVAKELKDAVFQLTQKLGYFSSRNLTEH
                     IPLSVLAYCGTPMVLAATDVKLSMSYSDMIDRKRTLDKCSEVIDQSRRVYDVTELFSQ
                     GTNQILHLAYAITKNLLLESNVPETGASLLEDSKCLEGSELEMKGRDKLLSPAFKRLR
                     IRGWAEAFLKYPRAYLLISTCIDSSLATGRLPRNELLPPIIRDTAYVILGLPKLPWTI
                     RLATGATSVPTEESVQKDQRRLRGRPESVSLNDTWYLSLLQNVDADPSLFDACALDGG
                     SRNGNVETTIKYLTDDNHATGSPLGCSVYNRKYSSGSSHGEKHKLRAYCIERKELGRE
                     NCLFTQSCLARYIGRIKHRRADETIVSGGAPETHQLGGTTSISATSIITRANYSLDSL
                     VDCARSNETMEPLNNIQACRFLSMGYDGSETSIMIPDAKEAFVKAHHQQFGFTPVDRV
                     VYVDTIRVRAIGCSVFHEIPSSPQVKYPLNSKSATTTATPSSRVSTYFSSVGWVDTPV
                     YHLDALSEGIQIQGPAMVIDKTQTIVMSPDSKATIAQDLLILDVDSPSPKSTSPEGID
                     PVQLSIFRHRFMGVAEQMGRVLQNVSTSANIKERLDFTCAIFTPEGDLVANAPHVPAM
                     IGSMAFAVRSQIAEWQGRLQDGDVLLSNTPAYGGVHLPDLTVITPVFGSAGKDIVFWA
                     ASRGHHADVGGILPGSMPPMSKLLSEEGAIFNSHLLVRAGHFDEEELRRVLCVEPARF
                     PGSSGSRRFQDNVTDLKAQVAANHCGARLMRRLIEEYSFPVVQVYMGAIQDSAELAVR
                     NLLKRLEHERSGEDISAVDYMDDGTPNQLKVTINPTDGSAIFDFTGTGPEVYGNWNAP
                     IAICNSAVIFALRCMVNSDIPLNHGCIKPVQIIIPDGSLLRPSAEAAVCAGNVLTSQR
                     IVDVIFKSFKVCAASQGCMNNLTFGNDGENGFGYYETIAGGSGAGPSWAGTGGVHTNM
                     TNTRITDPESLERRYPVALRRFSLRRGSGGAGMYPGGDGVIRDIELRLPMSVSILSER
                     RSFAPYGMAGGEDGQRGKNTWITKAGRCINVGGKGSIRVQPGDRFVIETPGGGGYGPP
                     GELVWSERDESIVMPTFIPVANGSVAANRTLAEQV"
     exon            46600..46972
                     /number=1
     exon            46996..47013
                     /number=2
     exon            47078..47204
                     /number=3
     exon            47260..47470
                     /number=4
     exon            47545..48164
                     /number=5
     exon            48218..48406
                     /number=6
     exon            48528..49269
                     /number=7
     exon            49385..49432
                     /number=8
     exon            49477..49554
                     /number=9
     exon            49732..49785
                     /number=10
     exon            49959..50011
                     /number=11
     exon            50075..50236
                     /number=12
     exon            50254..50933
                     /number=13
     exon            50997..51103
                     /number=14
     exon            51162..51440
                     /number=15
     exon            51494..51695
                     /number=16
     exon            51760..52580
                     /number=17
     CDS             complement(52899..54194)
                     /codon_start=1
                     /locus_tag="AO090005000016"
                     /note="predicted protein"
                     /old_locus_tag="AO070259000016"
                     /protein_id="BAE55141.1"
                     /transl_table=1
                     /translation="MAPSHSFMLFLSVICTHLCSLVVAVPWVVTDYYEQAVVTEAYYY
                     GSEVITTIQEVSPTATSLPEAVSTITSIGTGYYGGDATVIQKLYPTGVGESLDDYDRY
                     PYYRDNSHYTIFKVYLTYSAPTGCATQWTQTTAVPVSPPVVVQNLLPRTATETSISVD
                     SSQPFQPTTYTYDVVYVDPTQVPSSSLDSLSYYNRPTSLYTGAQCYYTSTEGSYSRSS
                     YGGYYGYDDDYNWFLDDYYMGISPLALTLILTIGWIGLFLILGFIEAFVRFRRLMTGW
                     QTRRGLPVCWSLTVIPISLLLLCFFRKGYRARSQADAEILKKRWDAMGFWTKLRLFFV
                     WGLRFKYPPMLGPAPARVKTSKQPGKNPGPRLLTPSPSQSVAPDSRQGSTAGRSAGDL
                     EMAEASPEALQHPSQAAVPPSTASGALPPHQDDHIGRAH"
     exon            complement(52899..54194)
                     /number=1
     CDS             complement(join(56259..57563,57617..57703))
                     /codon_start=1
                     /locus_tag="AO090005000018"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070259000018"
                     /protein_id="BAE55142.1"
                     /transl_table=1
                     /translation="MSTEERIMDSTQQDEICSLSAQDREDTPMKWSWLRKHLILIQCS
                     FLAVCPGFTSSILIPGTNAVALELGIPQQKATYFIAVHVLFLGLAPFFWIACMKAYGR
                     RPILITSTLLSCFAALGGGFAKKYGGLMTARVFQSFGISAGFVLPGVIVVDIFSEEQR
                     GRKNGIWAQMVSIGAPLGGVIGGPVVRYAGWQWTLWLTAIMNAVQSIAFILTCPETSY
                     RHRTSGNAELRLQQVLEPFLILQAPHIVFVAFAYGVTFAIVSVGLATIVPIALEKIYG
                     FGAVAQGLFFLGPLVGALIGEQLAGPGSDWVMKRERGNATVGDVGGTAQRLERRLIVG
                     LPGFLIAVAGILIFGLTLQYRTHWMGPCMGFAVANFGLQMVTTPSKTYCVDCLPSQSG
                     SVLQLINTVRQIIAFTVPFWSPNLVEHLGYGLGYGIEAIILAAFSVGCVLVLCWGGLW
                     RNKRSIKGLEDTS"
     exon            complement(56259..57563)
                     /number=1
     exon            complement(57617..57703)
                     /number=2
     CDS             join(58859..58958,59053..59123,59202..59438,59538..60284,
                     60381..60851)
                     /codon_start=1
                     /locus_tag="AO090005000019"
                     /note="uridine permease/thiamine transporter/allantoin
                     transport"
                     /old_locus_tag="AO070259000019"
                     /protein_id="BAE55143.1"
                     /transl_table=1
                     /translation="MSLLKRSINILQVPTEPGLTTAELMLTNEDLRPVEPERRQWRWL
                     NFVAFWIADSLNVNTWMITSSMIVDGLSWWQAWLCVWIGYTISGIFVIAMGRIATIYH
                     IPFAVANRASFGIWGSFWPILNRAAMAVIWYGVQMMTNSGLGQCVTLMIQAIWPSYVN
                     IPNNIPASSGVTTMEFTSFFLFWLGSLPALWFPIYKIRHLFTAKAYFSPACAIAFFVW
                     AIVRAHGLGPIIHQPNTAQGSTLAWAFVKSIMNCIANFAALIINNPDFSRYAAKPNDA
                     VWPQLITIPVGFAVTSFIGIMVTSSSSVIFGQAVWNPLTLLGMFLEDASSAERFGVFV
                     IAAGFALAQLGTNIAANSVSAGTNLSALLPRFCTIRRGAYVCAAIGLAMCPWNLVASS
                     NKFTVYLSSYSVFLSSIAGVMISDYYLVRRGYLELQALYSAERNGPYYGTWGVSWRGY
                     TAYICGILINIVGFAGAVGAKVPVAAEYIYNINYLSGFLVAAAIYWALAKAFPIPCTS
                     ETWNEVPYLGEAMHADGKVIAEATEVEDAKAKV"
     exon            58859..58958
                     /number=1
     exon            59053..59123
                     /number=2
     exon            59202..59438
                     /number=3
     exon            59538..60284
                     /number=4
     exon            60381..60851
                     /number=5
     CDS             complement(join(61107..61236,61288..61487,61573..61726,
                     61790..61908))
                     /codon_start=1
                     /locus_tag="AO090005000020"
                     /note="predicted protein"
                     /old_locus_tag="AO070259000020"
                     /protein_id="BAE55144.1"
                     /transl_table=1
                     /translation="MEESGTKKSNTYPCVEPIKVLNSSGGMTICDNLKDYSMPCTMSA
                     CEEEHTMIHTGVCICKGVGFTVKGPPEDVFCCYCSDCAIGAGGPCQITASYASSNVTI
                     HDPDVLLTCYTITEGTISGRAKEKHFCKRCGCTVFTIPYSLDRQYIVIRPVLIENGLE
                     IYKPGLECFAKRRPSYFAGCQSAKEYDIMPTDAGSSDTKG"
     exon            complement(61107..61236)
                     /number=1
     exon            complement(61288..61487)
                     /number=2
     exon            complement(61573..61726)
                     /number=3
     exon            complement(61790..61908)
                     /number=4
     CDS             join(62480..62567,62619..62942,63016..63052,63110..63533,
                     63539..64285)
                     /codon_start=1
                     /locus_tag="AO090005000021"
                     /note="amino acid transporters"
                     /old_locus_tag="AO070259000021"
                     /protein_id="BAE55145.1"
                     /transl_table=1
                     /translation="MEADLDLKMKEDPQLAETNVQDGQIDSGEGSIGTALFVTIGNGL
                     AAGGPASLLIAYVLYCGVLACINNCLSEMIVLHPVSGGFIRLAGKWVDDALGFMVGWN
                     FFLYESLMIPFEITAINLILSYWRDDIPVAAVCAASTFVTYSAKHTPLAINALAVAAY
                     GEAEFWLSSGKVLLIFLLFFFTFVTMVGGNPAHDAYGFRYWSDPGPFAEHRTAGSLGR
                     FEGFLAAVWSAAFCIVGPEYIAMAAAEAKRPRIFVKAAFKTIYWRFGLFFALGALCVG
                     IVLPWNDRLCKPFLLSSEKGGGASPYVIAMSNLKVRILPDLVNALLITSVFSAGNTLT
                     YCATRSLYGMALDGRAPKVLSKTKNGVPIYAFLIVICFPFLSFLQLSDNSSQVLTWLV
                     NLVTAGALIDYLVICITYIQFHRACKAQGIDRKTFPYYGYFQPYCSYIGAVCMVLVLL
                     FYGYTAFAPWSVEVFFQNYTMQLIAPILYFGWKLAHRTRILKPRDIDLVWDRPIVDSY
                     EATFTSPAPGFWTEMIQMFGFKRQQAEQVDA"
     exon            62480..62567
                     /number=1
     exon            62619..62942
                     /number=2
     exon            63016..63052
                     /number=3
     exon            63110..63533
                     /number=4
     exon            63539..64285
                     /number=5
     CDS             64896..66395
                     /codon_start=1
                     /locus_tag="AO090005000022"
                     /note="FAD-binding protein DIMINUTO"
                     /old_locus_tag="AO070259000022"
                     /protein_id="BAE55146.1"
                     /transl_table=1
                     /translation="MGLARHKTAVSRIANSIRGFYERKEPFRINHGSTNSTRPIRRDR
                     EVDIGDLRNVLHVDPTTRRALVEPNVPMDRLVEAIMKYGLVPPVVMEFPGITAGGGFA
                     GTAGESSSFKYGFFDKTIHSVEMVLADGSVVKASESENADLFHGAAGAVGSLGVTTLI
                     ELQLIEAKKFVKATYHPQRSIRDSVHSVHEHTLNDRNDYVDGIVYGPEHGVVVAGEMT
                     DELPSAAQVQTFSHAWDPWYYLHVQEKTRATQGPVSDYIPLAEYLFRYDRAGFWVGRS
                     AFQYFHFPFNRLTRWWLDDFLHTRMLYKALHASGESSRYMIQDLALPYSTAESFIDYT
                     SEKLGIWPLWLCPLKQSPAPTFHPHETTVKSEGFTPGQMLNIGVWGFGPKDPDTFVAA
                     NRDLERRLRELGGMKWFYAHTYYSQEEFWKIYDRDWYDGLRRKYNAETLPSVYDKVRI
                     DVEADRKERSESWSRKLRDIWPLGGLWGIRKAIQSKDYFIHRNSEWKWK"
     exon            64896..66395
                     /number=1
     CDS             66885..67772
                     /codon_start=1
                     /locus_tag="AO090005000023"
                     /note="dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /old_locus_tag="AO070259000023"
                     /protein_id="BAE55147.1"
                     /transl_table=1
                     /translation="MALEKDVVVVTGCGGMGIAIARRVGSGSLIILADYSQTMLERAV
                     HALREEGHSVEGVQTDVADISAVKKLALHAAGLGSIRVVVHTAGVAMNQAPPSRIYHV
                     NLLGTANLIEAFYPLATAGTSLVAISSAAGHRIQGSLSPGFERHLATAPLQTLLQHPD
                     FPAGAFDSVAESTDQRSRTSAYAVSKRANILRVQASAPLWASKGARINSVSPGVVLSN
                     MMKEELQGPAASMLRESIDRTPAGRMGTTADIANAVAFLCSSDAVFVTGSDLLVDGGL
                     TGLNLWGNGGLDSSPKSNI"
     exon            66885..67772
                     /number=1
     CDS             complement(join(68146..68474,68530..68639,68690..68768,
                     68827..68891,68954..69546,69614..69694))
                     /codon_start=1
                     /locus_tag="AO090005000024"
                     /note="2-polyprenyl-6-methoxyphenol hydroxylase and
                     related FAD-dependent oxidoreductases"
                     /old_locus_tag="AO070259000024"
                     /protein_id="BAE55148.1"
                     /transl_table=1
                     /translation="MKVIIVGGGIGGLATAIGLRRAGHRVKIFERSSFLHEIGAAINI
                     CPNAARVLSHWGFNVELARVVTARQSIVAAGSSLKPLAEVDCSKCDEVYGAPWLLAHR
                     VDLHSELQRLATAQEGPGIPADIVLNSKVVGYDASEGYVTLADGSVHGADLIVAADGV
                     HTSAIHHVNGRATRPVATGSAVFRFLLSTEELPDDPSLEPHFGDGLMRIMAAEGVRRL
                     VWYPCANNTVQNFVGIHPDQHTNGHEQESWDRSANVDDVLAQYHDFHPSILSIIRKAT
                     NIKRWPLLYREPVPTWSRDRLVLIGDAAHPMLPHQGQGGAQAIEDAGALSVIFTQLPT
                     EPTADEIRDRLAVFERVRIKRASAIQVTSNVGQDEAWKIREHAQKYMPEGVDVPTSPS
                     EFMEHNFRYDVLQDSRQHLEAFLVKS"
     exon            complement(68146..68474)
                     /number=1
     exon            complement(68530..68639)
                     /number=2
     exon            complement(68690..68768)
                     /number=3
     exon            complement(68827..68891)
                     /number=4
     exon            complement(68954..69546)
                     /number=5
     exon            complement(69614..69694)
                     /number=6
     CDS             complement(69956..70603)
                     /codon_start=1
                     /locus_tag="AO090005000025"
                     /note="predicted protein"
                     /old_locus_tag="AO070259000025"
                     /protein_id="BAE55149.1"
                     /transl_table=1
                     /translation="MSTTFHLFPLLPPEIRHYIWHLSLTHARVIRISCDRGILPTSRR
                     YARCFRADYPNPPQLQVNTEARHVALRLYAPYFRTKHKPHSCIYLSPDQDVVHLHEAV
                     LAYLSSVEKAALQRLMIDVHDYGSFGSYWMDSLCGMEQLKEIVLVVLPGALSPYGVYD
                     QLPVEDSEIVWLLKAAFVEGARTSPGWAMPRVKVISHEGAAMGDIVVTADDLEIN"
     exon            complement(69956..70603)
                     /number=1
     CDS             71936..72991
                     /codon_start=1
                     /locus_tag="AO090005000026"
                     /note="Fe2+/Zn2+ regulated transporter"
                     /old_locus_tag="AO070259000026"
                     /protein_id="BAE55150.1"
                     /transl_table=1
                     /translation="MSFDPNNVDLDTADPAEIICYLNASENDYDGRLGARISAIFVIL
                     IVSTAVTFFPVLAKRAPRLHIPLYVYLFARYFGAGVIVATAFIHLLDPAYDEIGPASC
                     VGMTGHWADYSWCPAIVLASLVGIFLLDFGAERYVEVKYGICREDPEPIMTSATDNSL
                     RTTAVANQAPVEKEAQLESQSVNDSLSERSFKQQIAAFLILEFGVIFHSVIIGLNLGV
                     TGEEFSTLYPVLVFHQSFEGLGIGARMSAIPFRKGSWLPWILCTLYGLTTPISIAIGL
                     GVRTTYNSGSYTANVVSGVLDAISAGILIYTGLVELLARDFLFDPHRTQDNKRLTFMV
                     ISMLWGVGIMALLGKWA"
     exon            71936..72991
                     /number=1
     CDS             join(77611..77686,77739..77824,77873..78087,78141..78405)
                     /codon_start=1
                     /locus_tag="AO090005000029"
                     /note="predicted protein"
                     /old_locus_tag="AO070259000029"
                     /protein_id="BAE55151.1"
                     /transl_table=1
                     /translation="MHLRNIVIALAATAVASPVDLQDRQLTGGDELRDGPCKPITFIF
                     ARASTEPGLLGISTGPAVCNRLKLARSGDVACQGVGPRYTADLPSNALPEGTSQAAIA
                     EAQGLFEQAVSKCPDTQIVAGGYSQGTAVMNGAIKRLSADVQDKIKGVVLFGYTRNAQ
                     ERGQIANFPKDKVKVYCAVGDLVCLGTLIVAPPHFSYLSDTGDASDFLLSQLG"
     exon            77611..77686
                     /number=1
     exon            77739..77824
                     /number=2
     exon            77873..78087
                     /number=3
     exon            78141..78405
                     /number=4
     CDS             complement(79610..80923)
                     /codon_start=1
                     /locus_tag="AO090005000031"
                     /note="predicted protein"
                     /old_locus_tag="AO070259000031"
                     /protein_id="BAE55152.1"
                     /transl_table=1
                     /translation="MVSNIFTWFLYVANQVSDLSIQPIQPQARLRPGNQQVVAPPPST
                     TEAFDTGPPIIQTPTTEPSITPSPTSPPPAEATDEFWDDIITGVYGIPPLLKVHDRAG
                     NIKWSWGRDDVTQELPPYIRHCLYSDANDATEVKWIKNGTAIAAIYSDLVLMINHTPD
                     NPETDKLITFAVCRQNEFLWNAHTLEPLPGDRVAVGTTGSNAWDGILVYNSSVDNPLV
                     DEPLILQNITGLRAIHGMIWDEQEQMLWAAGTDAAADGSDPIPAYGTIQGYPYNATTG
                     ELEDTDEFMYRLPEAWDQETEWGPGYPWWCGPHDLVPIPNDRKFLMSQDRGLHAFDLN
                     TREFFLDSKGVIDTYMRGFEVTTNDRKGFNRAGEYLELPESDLKGFSMAPDGSFVYVQ
                     SLWRLLRGNHTNLVVDGVRQQINLGDEIYRSRWFADIPGWPKPAA"
     exon            complement(79610..80923)
                     /number=1
     CDS             complement(join(82653..83075,83132..83518))
                     /codon_start=1
                     /locus_tag="AO090005000032"
                     /note="predicted protein"
                     /old_locus_tag="AO070259000032"
                     /protein_id="BAE55153.1"
                     /transl_table=1
                     /translation="MVTIAVGIEERPASAPKDGVWVSDFKIANNPSFSEGITAVSSLV
                     FAYSGTPGFFNIVSEMRDPRHYTRALLICQAGVTAVYTTIGCVVYYYCGSYVASPALG
                     SAGPTMKKISYGFALPGLLVTTTLVTHIPAKYIFIRILRGSRHLTANTLTHWVTWLGC
                     TFGITLIAYIIASAIPVFNSLVSLIGALLGTLMSFQPMGCMWLYDNWSKGKQERSLRW
                     MLMVCWSVFVVVIGTFLTVAGTYGCIVSVIDTYNASGGSAAWSCADNSNST"
     exon            complement(82653..83075)
                     /number=1
     exon            complement(83132..83518)
                     /number=2
     CDS             complement(join(83778..84080,84133..84267))
                     /codon_start=1
                     /locus_tag="AO090005000033"
                     /note="predicted protein"
                     /old_locus_tag="AO070259000033"
                     /protein_id="BAE55154.1"
                     /transl_table=1
                     /translation="MSKTKEDPNELAPVPSQTGEVRDMPTYVTDDVFGEVTENGPNYR
                     NVGWIGTVALMMKSQIGLGVLSIPTAFDTLGIVPGIICLIAIAVITTWSDYMIGVFKL
                     RHRSVYSIDDVGALIFGRVGREFLGAAFCLCITSRPRIVEATR"
     exon            complement(83778..84080)
                     /number=1
     exon            complement(84133..84267)
                     /number=2
     CDS             join(86133..86764,86814..87624)
                     /codon_start=1
                     /locus_tag="AO090005000034"
                     /note="proline oxidase"
                     /old_locus_tag="AO070259000034"
                     /protein_id="BAE55155.1"
                     /transl_table=1
                     /translation="MVLIHSSKAAPLATLGTFTSRCGVGTPLNNVSKCRLRVRSVSTS
                     VLAETKGAPNVTLPPLSALPTSMLLRSLLVAAITSKPYLLKPSLSILSRLSKSGNSLL
                     LSVDRNIILHTILKWTFYKQFCAGENGRETQATVQMFKDLGFRGTLLTYAKETVFDHS
                     TKSQQGLGVTTDQGKGQDGNGKRYCEHIEAWREGTVKTVDLLGEDDYLAMKLTGAGPA
                     ATEAFAAGELPPVQMIEALEEICQKCKDKGARILIDAESQHFQKGIARVTIDLMRKYN
                     RDGYALVYNTYQAYLKSTPTTLATHLAAAGEEGFTLGLKLVRGAYMATDDRSLIHDTK
                     QNTDDAYNSIAQGALRQELGEFGATNGRAFPSVNLFLASHNKESVMAAHHLHQQRLAA
                     KLPTVPVGFAQLHGMSDDVSFSLLQLKGPDGSPQVYKCSTWGGMGECLAYLLRRAIEN
                     RDAVSRTQDEYRALKGEVGRRLKSLVTFST"
     exon            86133..86764
                     /number=1
     exon            86814..87624
                     /number=2
     CDS             join(88023..88056,88110..88975)
                     /codon_start=1
                     /locus_tag="AO090005000035"
                     /note="pyrroline-5-carboxylate reductase"
                     /old_locus_tag="AO070259000035"
                     /protein_id="BAE55156.1"
                     /transl_table=1
                     /translation="MASSTLCILGCGNLGGAILKSLIDGPKDKHGSAPFTRFIACVRS
                     QESEQRLTTQFSHQSQSLTVTRDNIKAVQESDVVVLGVDPAVVEKVLSTPSLTEALSN
                     KLLISVAAGWTRQKLETTLYGSPTTTSNAEGRAWVVRTLPNIAASVSQGLTAIEISEP
                     EVPEHYQKITDAVFDNLGKTVHIPPTLMDATTAVAGSTPAFFAVIVDAMIDAAVAVGV
                     PRDLARTMTVQAMTGTAALLQSGMHPAVLRDQGTSPEGCTIGGLMVMEEAGVRGHVGR
                     ALREAVTIARLMDGTRHLNDTRQ"
     exon            88023..88056
                     /number=1
     exon            88110..88975
                     /number=2
     CDS             complement(join(89085..89784,89842..90008))
                     /codon_start=1
                     /locus_tag="AO090005000036"
                     /note="predicted protein"
                     /old_locus_tag="AO070259000036"
                     /protein_id="BAE55157.1"
                     /transl_table=1
                     /translation="MQEGRTVSQPPQMSYTASQTLQGDWGSSVAGRLAGDLTAAAVSA
                     SLIAPTVTIIDRALVERAASDRPLLQSLRSYTVAALKRPGAFVFSRPFGLVWTLYGAT
                     YAVANGTETISKEICPARVDPITFATTFIVNVPLGVWKDIRFAQLFGTQIQSSAKEAL
                     RVSSRIVSKAATATFLLRDGVTIFGSFTLASWCSSVIPDSLASQPSTKTIITQIAVPV
                     LSQVVATPLHLLGLDLYNRQSGVTWSDRIATIRKHLPSATVIRCVRIIPAFGFGCLTN
                     IGLREFFHEQCD"
     exon            complement(89085..89784)
                     /number=1
     exon            complement(89842..90008)
                     /number=2
     CDS             join(90446..90484,90547..91019,91070..92192)
                     /codon_start=1
                     /locus_tag="AO090005000037"
                     /note="delta-1-pyrroline-5-carboxylate dehydrogenase"
                     /old_locus_tag="AO070259000037"
                     /protein_id="BAE55158.1"
                     /transl_table=1
                     /translation="MPFALPAARNEPNPLYTRGSQERAKVEEALKELRSQLPVQSEVF
                     YNGVAQKVSQSIDQPMPSEHATTFTNYPLASKEQVAAAIESALKAKKSWEETPFVDRA
                     AIFMKAAELATGKYRYELIAATMLGQGKNVWQGEIDAAAELADFFRQNCNFAAELMGK
                     QPPRNTNGMWSRMEYRPLEGFVYAVSPFNFTALGGSLVSAPALMGNVVVWKPSPSSIY
                     ASTLVYKILLEAGLPPDVVQFVPGDAEEVTSVALSHRDFAGLNFIGSSDVFRNIYGKI
                     GEGIANKTYREFPRVVGETSGKNFHLIHNTADIPSAVNHTIRGAFEYQGQRCSATSRV
                     YLPESRAEEFLTALKAGVKNITIGSPDKDFEAFMGPVIHRQSFNKIKSIIDASNKDPS
                     LTLLAGGTYDDSVGFYVHPTVYQAHTLDHRLFDEEIFGPVLAIYVYPDAEWSSILKKA
                     DEQGGGFALTGAVFAKDRRVIREAEDALRYSAGNFYINCKTTAALIGEQSFGGARASG
                     TNDKAGSSDMLRRFTSPRMIKEEFFPVEGYTYPSNH"
     exon            90446..90484
                     /number=1
     exon            90547..91019
                     /number=2
     exon            91070..92192
                     /number=3
     CDS             join(92867..93073,93127..94212)
                     /codon_start=1
                     /locus_tag="AO090005000038"
                     /note="FAD-dependent oxidoreductase"
                     /old_locus_tag="AO070259000038"
                     /protein_id="BAE55159.1"
                     /transl_table=1
                     /translation="MVSKSTPIAIVGGGAFGLSTALHLVRDGYNNISVFEQDDQIPPR
                     PSAANDLNKIVRAEYEDPFYTDLTMQAIALWKTPLFAPHFHQTGFLHCVSGKAPERAV
                     DTLKRFQAAADDHPELRKHVVPLANDEEIRQRFWQYDGQFPGWNGYLNTFDGYAHSGN
                     ALKAVYQATQKAGVRFFLGEQHGAVAEVTYKNGRSTGLRTKNGQFHPAELVIVAAGAA
                     AAKLVPAIGSQVVAKSWSVAHVHLTEEETSALRGIPITYARDLGFFFEPDPVTQLLKL
                     CPMGGGYVNTDPATGVSHAPSVADSAFVPPDDEAKIRQLLAHTLPTLANRPLVRKSLC
                     WFADTSDSDFIIDYVPHTSNSVVLLSGDSGHGFKMFPLFGSWVKALLEAKDQQQPVPR
                     WRWKEPQQSGDGKWGDAVSWRIGSTREFKDIQPGKPKL"
     exon            92867..93073
                     /number=1
     exon            93127..94212
                     /number=2
     CDS             complement(94710..95708)
                     /codon_start=1
                     /locus_tag="AO090005000039"
                     /note="predicted protein"
                     /old_locus_tag="AO070259000039"
                     /protein_id="BAE55160.1"
                     /transl_table=1
                     /translation="MQIKVCQIMEEINSSKLSTGTVSLAFADGPRCLWAGWAPESEFP
                     LENQERSRQRRRVGHRASQMLRLAAGRVLDQRRVPTIGALASTLPSGLTAAFFVNCLH
                     IPDRLQCIVLATRPVLFCFLKMRIQTADSSLESLNSSANVRKLLQVCIDSAQQILNIL
                     IVLQRQNLLGTDLADSGIDTADRLLDSFLPFDLEATYTAAVVLVTAPAADASLLDDWT
                     PWFHTSVTVLDEMISRGNLIAGFRKSELQQLAGMLSHLADDGVIHGTDLARKGQLDRI
                     ISRLPSPSTPDRVFGISEIPNLHPGLTTAEIMAVAESIDTGDVDWIAHAVTENHIW"
     exon            complement(94710..95708)
                     /number=1
     CDS             join(99314..99629,99737..99906,100096..101886,
                     101942..102293,102711..103838,103959..104323)
                     /codon_start=1
                     /locus_tag="AO090005000041"
                     /note="WD40 repeat"
                     /old_locus_tag="AO070259000041"
                     /protein_id="BAE55161.1"
                     /transl_table=1
                     /translation="MRTSLHGGSAFGNAGKHLKVPPPRSSRHAVSASTHPKEPIATPS
                     PRVQPGPEEGFEPETKSDTASVPPEGSEPVSLWDEAYVLLKKEKPDLMSDYESLLSRV
                     AAEARRQKLQQIAKLSFEKMQEGKLHATFFGKKIALQEAIGTLGNGINWAQTYAKDAL
                     KDEQVKGLYKLVIDYQVQSVMRFDRNPAKNYFRSVTDYDAWSDQLNTIKEEEKTIKMR
                     FQVALSGLGVQKLNDLELEAGKSRETLEVVANYTRKIEKHLSDAEYRRCLNTLKATDP
                     QLDKQRIEKLKGGLLRDSYNWVIENQEFRRWMDASSGELLWIKGDPGKGKTMLLCGII
                     DELSQVAAPGTNIAFFFCQASVETLDNYPAVLRGLISMLVKQQPSLMSHLSEASFDGH
                     NAWLALQNTLTNILKDPTLQSTYLLIDGLDECVRDRQNLLDLLVEHSSAHENIKWIVS
                     SRNWPGIEEDLHLAKKIKLHLELNEAVLSKAIQSFIEYRVQKLENRSNGSKGKTDIWI
                     SVKDHLVENANGTFLWVALVCEHLAKMFYWEVREKLRDFPPHLEKIYERMMSQIIDSD
                     KSEICKAILGVTTTVLRPITLDEMMVYVDIPGDDARALEDLVGLCGSFLSVQESTIFL
                     IHQSAKDFIMGTASSEIFPHGKDMVHYDLFSRSLHLLRKNLRRDIYNLREPGYPIQQI
                     PIRNPDPLRTARYACVYWVDHIVSCGNIEDIKKAIAEKGLVDSFLQQSYLHWLEAMSI
                     LKSIPSGISSMQKLEKFIQKWMNAEPKSLVHRVRDAIRFVQYTKVAIESSPLQVYYSS
                     LIYSPMQSITRECYDDRQSIRDWIRKEPVVESCWSLCLQTLEGHTDVICSLAWSRDGS
                     RLASGAYSSARIWDLDTSECSRLYSICCLAWSPDGSRLAAGSLYPIVNVWDTQTRDCV
                     LRKGHASRITSVAWSSDGSRLASGSTDETIRIWDVRTMDCVFILEGQFSVILCLAWSP
                     DGSRLASASMDDNIKIWDTTSQFKSITRGHDEILESITWSHDGVQLVSLAEDRTVRVR
                     NTTTGGQLSIFQGRPNIRHWHTDYIHKLVWSPDGNQLASGSGDGTVRVWNPITGDQLS
                     IFRDHINDIRDIAWSPDGRQLASASADSTIRVWNPTTGNQLSISGDHIKRITYIAWSP
                     DGSQLASVALNGTAQVWNPTTGDQLSISGDGIKRATDIAWSPDGSQLASVALNGTAQV
                     WKPTTSDHLSISGYGIKRITDIAWSPDGSQLASVALNGTVWVWNLTTENPASGQCISK
                     FPVPTGDLLRFDSIDPNYLHTTLGTFDMRDLKRASRGSNDSNHVPKPHGYGLSEDLSW
                     ITYDGTKVLWLPPDHRPQNLSAVALSNLAVAIGCASGALEILEFSTLNPLSDL"
     exon            99314..99629
                     /number=1
     exon            99737..99906
                     /number=2
     exon            100096..101886
                     /number=3
     exon            101942..102293
                     /number=4
     exon            102711..103838
                     /number=5
     exon            103959..104323
                     /number=6
     CDS             105817..106608
                     /codon_start=1
                     /locus_tag="AO090005000042"
                     /note="predicted protein"
                     /old_locus_tag="AO070259000042"
                     /protein_id="BAE55162.1"
                     /transl_table=1
                     /translation="MKASFISRLLSLTAFAISSNLSYGLPLSERDVRLFEERYINSLD
                     YSLGNDTVKLVGYKNIKIPAEELDDLNDHYNNHPEVWKNLPNYFYDQGSGTLRAYFPV
                     DGALVEHDGQYHEANSLGELELTKVNGDSSVLGRRQTESITGVEGNIIKDGIIYLEKA
                     AKPHAQYGKVLVYDFGDKIVLDHDHGSHTKRDGKKSCMKNHGGPNCSDKFNIHNNKCK
                     KRHDICMDYNGWFSNCKKNGSTWRNFPGSDCDKALGRGKCGNEVM"
     exon            105817..106608
                     /number=1
     CDS             complement(107037..107975)
                     /codon_start=1
                     /locus_tag="AO090005000043"
                     /note="predicted protein"
                     /old_locus_tag="AO070259000043"
                     /protein_id="BAE55163.1"
                     /transl_table=1
                     /translation="MAEQPQPTVKTRFLVISDTHGRDSIPSSNEPADVAIHCGDLTMG
                     STLQEFQGAIKLLKQINAPLKLVIAGNHDFTLDPPAFQNKIREARRLQNIDPLLVEKE
                     YGYCGQVRELFDHVDAKEKSGIRLLEEGTHYLNLQNGASLTVYASPYTPSFGEWGFQY
                     SPHEGHEFAIGNVDLVMTHGPPRGVLDNTISGQRTGCEHLFGRVARSRPRMHCFGHIH
                     GSWGAKLVAWRKTISEKPSHLTDIDSGQSTVIEKLSNIKASGPRAYYLTSHCADDANP
                     LQHGRHTLFVNAAIEGSDGFPSHPAWLVDLDLQRAL"
     exon            complement(107037..107975)
                     /number=1
     CDS             complement(join(108618..110000,110057..110302))
                     /codon_start=1
                     /locus_tag="AO090005000044"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070259000044"
                     /protein_id="BAE55164.1"
                     /transl_table=1
                     /translation="MGAAGGGFSRDAVKQIPAEAKRLYIWLSVIWASYCGGLHGFNTS
                     NISGAMSLDPFVRDFHWTDLSDAEVSNNSGWAVSSMLLGQVVGILVSGALGERRGRKP
                     VIMAAAIFYTIGALLMCGNVGSFAELLVGRILSGIGSGFGMTAGAVYISEVAPQELRG
                     MMTTFYNVNIMGGVAGSYWINYASQGVISSQSSWQWRTTFVLQAIPSVILFIGYPFFP
                     ESPRYLMMRGRVEAAHNSLSRLRGGLEESNDYFAREWMELQSKVDSTAEASTQSALKA
                     TLSLLKACISHAPTRRLLTFVTLIQTFFIMSGGNSITYYAPTILKSIGLNSKQVLLFT
                     AVYGLIKVVSVFLYAFFFTDRFGRRPLLLIGSAINTVCLLYLAVYLGVADLSTSVAPS
                     PAAWVSIVAICLFAVGYAIGWAPAFSLTASEICPTHLRGTIVMITFTYQNLLNFGITR
                     GFPNMIISMKSYGPFALFTAFTGCATVWVFFAFPECKGRSMESASALFSLPWYKVGFQ
                     KVPTLDETSEIDDEEKGMSVHDEDVHAKEKDMRP"
     exon            complement(108618..110000)
                     /number=1
     exon            complement(110057..110302)
                     /number=2
     CDS             complement(join(111067..112912,112988..113509,
                     114997..115049))
                     /codon_start=1
                     /locus_tag="AO090005000045"
                     /note="aconitase/homoaconitase (aconitase superfamily)"
                     /old_locus_tag="AO070259000045"
                     /protein_id="BAE55165.1"
                     /transl_table=1
                     /translation="MVNTQMGVPVLDYHHAVVITQSRCVIDVSYTDVGFVLTFVGPQL
                     FGVNYGEQLSNLDTVRQSSRRPLTLTEKLLYSHLIPSDDKVWSLQEIDRGKTILELRP
                     DRVACHDATATMALLQFISAGLPRVAVPTTVHGDHLIVSEKGAEPDMKRALTEHAEVY
                     EFLSSASRKYGIGFWKPGSGIIHTVIFENHAVPGGLIIGTDSHTPNAGGLAMMGIGVG
                     GSDAVDAMSGMPWELVTPQIVGVRLTGQLSGWASTKDIICKLAGILTVSGGKGRVIEF
                     FGPGTETLGATAMATICNMSAEIGSTSCIFPYTTAMGRYLTATRRAHVAQAAQGVQQA
                     LLQADEGSDKYYDQVIEIDLSTLEPHVNGPYTPDLAHPISELGKAVSQSEWPINLSHA
                     MVGSCTNSSYEDLDKTRQLVAQARDAGLPRFKTPFLVAPGSEQIRATAEEDGILKELQ
                     EAGAVVLSSSCGPCVGSWDRKDVDVRGKEKNSVVSSFNRNFVGRHDSNPATHSFVTSP
                     ELVTAFAYAGRLDFNPLTDSIPVESVEGGKSFLFKAPVSRELPAHFATGEDTFQEPPS
                     DGSSLSVIIDPQSDRLQLLTPFAPWQSGCATNMELLMKVKGKCTTDHISPAGPWYKYR
                     GHLENISNNMLTTARNAFLPGNDPQMLGHTRNPITSGVEVVPQVARDLQGRGIRWCII
                     GDFNYGEGSSREHAALEPRYLGGVAVIARSFARIHETNLKKQGMLPLTFDDPLDYDRI
                     LEGDRITLTGVEDGELAPGRQVTMRVTPRQGASWTAQLNHSYHAGQLHWLRAGSALNH
                     IKNTALAK"
     exon            complement(111067..112912)
                     /number=1
     exon            complement(112988..113509)
                     /number=2
     exon            complement(114997..115049)
                     /number=3
     CDS             complement(116475..117050)
                     /codon_start=1
                     /locus_tag="AO090005000046"
                     /note="predicted protein"
                     /old_locus_tag="AO070259000046"
                     /protein_id="BAE55166.1"
                     /transl_table=1
                     /translation="MTSADETTIPRRPAISTNGAGQERAHAPSPVLESAEHPLVEATT
                     SSKRSYSMAEGPEMEQPIFVELGMLSLHSDSRQKHYLGSSSGLLFTRLIGIDSERSST
                     ASPELVSTSSRSGHRRRLAPGRSQSREAYQALYDRLREVIPQNAAVIFGIWGANREQG
                     ITIIGGSQCVVRGLFPGDPRGSPISSSSLNM"
     exon            complement(116475..117050)
                     /number=1
     CDS             complement(join(117098..117147,117200..117458))
                     /codon_start=1
                     /locus_tag="AO090005000047"
                     /note="predicted protein"
                     /old_locus_tag="AO070259000047"
                     /protein_id="BAE55167.1"
                     /transl_table=1
                     /translation="MAPTEAEAAQPAPSKKVRLACRRCRAKRVKASNPQPISKDENYL
                     TTPANVLPTSVMEVFQPVGTALGQVSRVLMSMAGIMDYPSHETSSHGVMPGSTGLNKN
                     "
     exon            complement(117098..117147)
                     /number=1
     exon            complement(117200..117458)
                     /number=2
     CDS             complement(join(118008..118076,118137..118874,
                     120074..120160))
                     /codon_start=1
                     /locus_tag="AO090005000048"
                     /note="mitochondrial tricarboxylate/dicarboxylate carrier
                     proteins"
                     /old_locus_tag="AO070259000048"
                     /protein_id="BAE55168.1"
                     /transl_table=1
                     /translation="MSSNPAWRVTSPSHSGGSMLGPFSKAKWSYPTEYLKTRQQLLNP
                     NDPKQSPVQLLTATVRQHGIRHLYTGSMAFCVSNASKSGIRFFAFDSAKKWMPTDSSS
                     KVTSTGNMCAGLIAGVAESVLVVTPGETLKTKIIDDRAGAKVYKSASHAVRTILSTEG
                     VSGLYRGTLPVTLKQSSNAMVRFTSYNFFLHHLTALTSTGAANGAPVWSTVVAGAMAG
                     VVTVYATMPFDTIKTRLQALDGSQRYRGSFHCLRSIVTTEGTLALWNGTTPRLARLSI
                     SGAISFAIYERVVQWTGSLHG"
     exon            complement(118008..118076)
                     /number=1
     exon            complement(118137..118874)
                     /number=2
     exon            complement(120074..120160)
                     /number=3
     CDS             join(121005..121171,121225..121702,121762..122274)
                     /codon_start=1
                     /locus_tag="AO090005000049"
                     /note="predicted protein"
                     /old_locus_tag="AO070259000049"
                     /protein_id="BAE55169.1"
                     /transl_table=1
                     /translation="MDVYLNPLPPLLNNSIAKWAYISLAALANLPGQFNRTAFEAPWA
                     TSEISDEGFSTALSYLNTTDFVAYDSRFFDIIGPNATVEHVQKLAYQVHEAPCYIKDT
                     NQLFFVEWGPPGGDDGIHSWQYLLDVETNTLRNITTNPPTYNVHGCVYYNHSIHVVTD
                     GYSDLQTGELAKIDPHSHEKTTLLNNYLVQPFAGFNDLEIDQVGNFWLTDSKSGWGRQ
                     IVEFAPPTNPSVYFVERSTFRTKVVYTTTGNTNGIAISPDGKTLFIPETGVSKYFPKR
                     TDPYGMRQLWAFDVSKSRSVLSNQRFLSNPISYFYDGVRVSRHGLIFCGAGDGVDVLD
                     PDTGYTLGTIRVGGGENGAVSVAFGEHELSVVGKGGVWHVKGIQERLAREW"
     exon            121005..121171
                     /number=1
     exon            121225..121702
                     /number=2
     exon            121762..122274
                     /number=3
     CDS             complement(join(123338..123394,123446..124804))
                     /codon_start=1
                     /locus_tag="AO090005000050"
                     /note="predicted protein"
                     /old_locus_tag="AO070259000050"
                     /protein_id="BAE55170.1"
                     /transl_table=1
                     /translation="MSCPSGILDANPGNGAGVGKMDTPKPNGWSPDSKVLPDALDDGE
                     QQIIEAGEAKYHRLGWKRLTIMLIIEAIGLGALSIPSAFASLGMVAGVICCVGIGLIA
                     IYTSWIIGKVKLAFPGVRHYGDAGGLLMGRVGNELFTFMLILQLVFLTGSNCLTGTIA
                     WRHITDSNNVCSVVFSVVSAIILLLLSIPSSFADMAWLGYIDFVSIVAAIGITIISTG
                     IQGTQSGLSKVDWSALPQGDPSFSDAFIAISNIVFAYTFASCLFSFMDEMHTPKDFTK
                     SIWTLGILQIVIYTVTGATIYAFVGQEVESPALLSAGSLVSKVAFGIALPVIFISGAI
                     GTIVAGRLIHGRIYENSVTRYVNTTKGWITWLTLITILTILAWVIAEAVPFFDDLLSI
                     TSALFTSGFSFYLPPVMWFFLLRKGEWYSRENLLLSLVNLFVFIFGLVVLVGGLYSSI
                     QDIRNNYRTGNVHSPFTCGAV"
     exon            complement(123338..123394)
                     /number=1
     exon            complement(123446..124804)
                     /number=2
     CDS             126991..128241
                     /codon_start=1
                     /locus_tag="AO090005000051"
                     /note="2-polyprenyl-6-methoxyphenol hydroxylase and
                     related FAD-dependent oxidoreductases"
                     /old_locus_tag="AO070259000051"
                     /protein_id="BAE55171.1"
                     /transl_table=1
                     /translation="MTGLKVLICGAGITGNALAFWLSKMGHQVTVIERHSSLRATGLQ
                     VDLREPGITVLRRMGLEQQFRARSVREQGMEIVDHAGKRKAYFAANRSGLGMQSFTTD
                     YEIMRGDLCRLLYDATKDRATFVFGTTIESFTQREGHVDVQFSDGSHDWFDLLVGADG
                     QGSRTRKLILGSEPDPFHPLGVHIGYFTVPREIQPGEEYNAAIYIAPGRRFIFTRRHS
                     PHAIQVYLACKTDSDRLVKARGNTEEEKDELAEIFRGAGWQTDRILKELQSADDFYCE
                     RLGVVRMDSWSAGRVALVGDAAYCPSATTGMGTTSGLVGAYILAGEISKHYQADHESK
                     DRLLLALKAYDDTYRPFISQVQKGIEKGSTFWDYTPSSWWGITILHILLWVASFLRLD
                     ILSQWFIREDTTWALPDYKKMEQS"
     exon            126991..128241
                     /number=1
     CDS             complement(128738..129283)
                     /codon_start=1
                     /locus_tag="AO090005000052"
                     /note="predicted protein"
                     /old_locus_tag="AO070259000052"
                     /protein_id="BAE55172.1"
                     /transl_table=1
                     /translation="MDSDCDENLLDEAPQMLEVCQTAHDLVVRLFPPTDPDTCHTIYL
                     HDLNQNNVILDPISHDIIAVIDWEMICVLPNWASFFYPKMFLDVDPITEEEPPIPVDY
                     NGENDYTIIRRDRWDARILGRAFDTYIETVCKEKSDTTCKNRFEEKRTLEAAIEGLTD
                     NWEGARAKLEDLQALAGTGSG"
     exon            complement(128738..129283)
                     /number=1
     CDS             complement(join(129644..129709,131320..132575,
                     132670..133355,134714..134778))
                     /codon_start=1
                     /locus_tag="AO090005000053"
                     /note="transferrin receptor and related proteins
                     containing the protease-associated (PA) domain"
                     /old_locus_tag="AO070259000053"
                     /protein_id="BAE55173.1"
                     /transl_table=1
                     /translation="MGLFLTALGALSSVNVLYSRGRMPLKHLATLLCALSPTVALSQD
                     AVQDILLSVPQAEKIREWSHYYTNGSHLSGQGLEQGQWTKDLWEGFGIQANLTTHEAN
                     LTYPGDHRVALLDLNLKDPLVQEARRIEDTAPGAGPGQKPFIPSFFAWAGVGNVTAQY
                     VFANFGLREDYDDLLNANVTVRGRIAVVKTVFGSSLLRKLHMGVHRQEQMQVAAEYGL
                     AGLIVYTDPQLDGEFTEANGYEAFPDGPARPPIQSGSTFAIPAMPIAFADAIPILRAL
                     NGYGPSATEFGERWQGGGLNYKDVHYNVGPSPNNIVLNLCNKPIFPDGQVHHVIGTIP
                     GSTFPDEVIMLGTHRDSWSPGAGDGSSGSSALNEVARSFGTALAQGWTPSRTIILASF
                     EGVEFSLPGTQDWWEQNQWLNTSAFAYLNVVSAGAGSKFHVQGSPLLGRAMRYGTGLV
                     LDPNTNANNQTMLDVWDGEVSIGTGGDASVLLGTELLSSVDFGFSAGEGDPPFPYHSL
                     YDTDEWMDCYGDPNREYHLTTTKIWSLAVFALANDVLIPVTTNEYAVLLQGSLESVDM
                     PGLHISSMENAINDLHQATLAFDTYADNLISQILAQPDEPKLLSKAREVNQKYIKIER
                     IFADPHPQSSSDRHLIIPRVPYYFQSSAFPALQESIAAGNLSAAEFQKWWHGALHQIT
                     PSVMNGLF"
     exon            complement(129644..129709)
                     /number=1
     exon            complement(131320..132575)
                     /number=2
     exon            complement(132670..133355)
                     /number=3
     exon            complement(134714..134778)
                     /number=4
     CDS             complement(join(137767..138793,138861..139228))
                     /codon_start=1
                     /locus_tag="AO090005000054"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070259000054"
                     /protein_id="BAE55174.1"
                     /transl_table=1
                     /translation="MDSITELADEVKVSGANLDANAQHKLTLERQGHGCSSLSPPPSS
                     ASATYHHSNSRSSWGSEGFSQDKCGEYPDAREEGTLPRADYGPYEVSFDGDQDPMCPR
                     SMSSVRKWVIVLIVCTGTLCVTCTSSIYTTTYTQMDPEFHTSTLISTVGLSSFVLGIG
                     TGPLLTGPLSEHYGRRPIYLVAWSMFLIWTIPSAVAKNVQTIIVSRYFNGFTGGTFLS
                     VAGGTAGDVFSRNQIQAPMALVSSVPFIGPSLGPVLGGFINSHLDWRWTYYIMIIWSA
                     VLLVCMIFFAPETYHPIILRAKAKALRQETGNDRYRAPMENNTKTWKQIIIVSLLRPF
                     QLLFLEPMCLCLDIYSAILLGILYLFFGTFPMVFRTTYDMNLWQGGLTFVGIIVGMMI
                     AAATTPLWSNIRERLLNNNKKEPGRSEPEYRLPPAIVGGILIPVGLFWFGWTTYSRIH
                     WIVPIIGSAVFGGG"
     exon            complement(137767..138793)
                     /number=1
     exon            complement(138861..139228)
                     /number=2
     CDS             join(140184..140341,140398..140464,140522..140934,
                     140991..141018,141079..141356,141416..141481,
                     141525..141936)
                     /codon_start=1
                     /locus_tag="AO090005000055"
                     /note="1-aminocyclopropane-1-carboxylate synthase, and
                     related proteins"
                     /old_locus_tag="AO070259000055"
                     /protein_id="BAE55175.1"
                     /transl_table=1
                     /translation="MSSICRKGHIDAAIYEHHLSRRAAENFKYRDVWGPREKSMANPW
                     SPETPMGRSIILRLAENSLLHDEMGQFIKEQINVLPLSHLTYSTGPRGSCRLRRAAAA
                     FLNEEFHSLQTIAQDNIFVTPGLASAIDALIWAICNDGDGILVPQPYYNGFDFDTLNR
                     SNGRVIGVKYEGIEGFSELDDLFRPDVNKRALEVALREAKKNGITIRALLISNPHNPL
                     GRCYPPKTLLEFASFCGKNQLHVISDEIYAKSVFLNAALSSPTPFVSILALDIHKVIE
                     LNLTHVLYGASKDFCANGLRLGLVCTNNEGLIGALSSISMFSWSPHVLQDVWAAMLED
                     RQQTIISQRPSSGNVVLATTRCKYTSTCNRPHGLIASTNAGLFIWVDLRHLLIPESSR
                     DQTGYRELRVTSPDASVYKQREQRFADICAQNGLMIAPGSIYAAEEFGWFRLTFTVGK
                     NALEEGLKRLDKSLKAAETDLRI"
     exon            140184..140341
                     /number=1
     exon            140398..140464
                     /number=2
     exon            140522..140934
                     /number=3
     exon            140991..141018
                     /number=4
     exon            141079..141356
                     /number=5
     exon            141416..141481
                     /number=6
     exon            141525..141936
                     /number=7
     CDS             complement(142084..142704)
                     /codon_start=1
                     /locus_tag="AO090005000056"
                     /note="predicted protein"
                     /old_locus_tag="AO070259000056"
                     /protein_id="BAE55176.1"
                     /transl_table=1
                     /translation="MEQHSEMGPPPTPTTVDPPSYAESVAETLDLFFFPDWHYRGGCD
                     DSMLKTLDDLLNKDLSFMHPGTDFYAFYSFLLKMGEQRLEVWSPEGLFQPIAVIELRG
                     TYIRELRACEGRALVYLMHPKNEPYVKECYFIVQETISPLPQRSGVAGKLVSLFDKSK
                     QVQRKYWVKATLHGERYVFREVASGEEPMPEECVGVRSICYQKFWA"
     exon            complement(142084..142704)
                     /number=1
     CDS             complement(147724..148839)
                     /codon_start=1
                     /locus_tag="AO090005000057"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000153"
                     /protein_id="BAE55177.1"
                     /transl_table=1
                     /translation="MQQRRRALWLGIPALILLIITYFLYLSGQNGPALLPTNSDPTQE
                     PNSLEPEDVLEENTTYHPAGTQVVRNATRTLVIAKLQEEDTVWVDRLPQDDPYLTSAV
                     YVVDSNNTSAPFTVPLNKGHEVMVYLTYIIDHYHSLSDISIFMHAHQITWHNNDFLDF
                     DSAKMVRRLRSQYILDNGYMNLRCHLEPGCPDHIHPYIGKDSDDILNVPEAAVIGMAW
                     GQLFPGSPVPSVLSQPCCGQFAVSADQIRKIPPERYLEFREWLLATELDDRLSGRVWE
                     YIWHWLFTGQAEFCPVETTCYCEGYGICFDPNEYRLYFQIRGEARKLEGEVRELESEA
                     TEADITTSERITELNSKVGELHGKMDEIKARTKGIGQ"
     exon            complement(147724..148839)
                     /number=1
     CDS             complement(151979..152383)
                     /codon_start=1
                     /locus_tag="AO090005000059"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000151"
                     /protein_id="BAE55178.1"
                     /transl_table=1
                     /translation="MHLQATLAVGLSLLGLTLADTLKNTIEWKASDFAITCGSEDCNY
                     NFNIVSTATGPSKFKTSCSGVPAEEDYTPCQGKGTEAKLQAVPGAATMFSLHIQHTWM
                     EGEARYTAHGDANITDTQKSFTVPVTRVSGVV"
     exon            complement(151979..152383)
                     /number=1
     CDS             complement(join(153750..154229,154289..154618,
                     154674..155074,155136..155218,155272..155361,
                     155505..155575,155634..155756))
                     /codon_start=1
                     /locus_tag="AO090005000060"
                     /note="amino acid transporters"
                     /old_locus_tag="AO070309000150"
                     /protein_id="BAE55179.1"
                     /transl_table=1
                     /translation="MSMHELKQMAPPVLSEMEGQPIYRDKDDLYLTRMGKRPVLKRNF
                     GLMSMVGFSCTLLVTWEGYIIGGPAGSVYGYLFVWAGIAATFVVISELVSMAPTSGGQ
                     YHWCSMLAPPSAMKLASYMTGWLTVIGWQATFASALYLNGNMVQALIILTRSDYVPHP
                     WRKALYAWGLSVLSAIINIVGGKFLPRFEGTVLIFHVLGFFAVLVPLTYMADHKSSAE
                     EVFTYFINEGNWPSKALSVFVGLTGPVFAFAGGDAAVHIVEEMTNATTAVPLSLMLTV
                     LINGSMGFGMMIALYFCLGDIQTALKSPTGVPFFAIFLQATGSVSGTAIAGALVMSLG
                     SCNTIGTLTAASRQFWSFSRDRGIPGWRMWSKVTERTSIPTYAVLLTAVVGCLLNLIT
                     IGSDVAFNSLVSMSISGLYLSYMTAGGLLLYRRCTGGIGHATAGEQTMINTAGARLVW
                     GPFRVPGILGITINVFSLAYMTIATFFGFWPTTKDVNTQTMNYSIVGTMGVIILSLVY
                     YFVRAKKVYTGPLIEIS"
     exon            complement(153750..154229)
                     /number=1
     exon            complement(154289..154618)
                     /number=2
     exon            complement(154674..155074)
                     /number=3
     exon            complement(155136..155218)
                     /number=4
     exon            complement(155272..155361)
                     /number=5
     exon            complement(155505..155575)
                     /number=6
     exon            complement(155634..155756)
                     /number=7
     CDS             complement(join(156568..157021,157078..157430))
                     /codon_start=1
                     /locus_tag="AO090005000061"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000149"
                     /protein_id="BAE55180.1"
                     /transl_table=1
                     /translation="MLFISSMCFSKLSVIYFIRDVTPLFNPDRLITAGLELLTILWAG
                     IGILTAVFQCGLPRPWDYLHGQCIQHERWWTYMCVMNIVTDSGVMAHRIFIVVRLQMR
                     LKRKLILTVIFGLRTCVIAASACQAFYANQVVESPDPTFDTSLFTISTQVAQCLGLIT
                     CCSPQMKPFIESLRSFGFYVDGRPRHGSSGVRHDELLARPRKQEDLFHQQHELGTISP
                     FNSSYQTAVTASPSKRDWDAGSQSSQAHIIHEIRTWTVTESVKNTSPVVL"
     exon            complement(156568..157021)
                     /number=1
     exon            complement(157078..157430)
                     /number=2
     CDS             158878..160386
                     /codon_start=1
                     /locus_tag="AO090005000062"
                     /note="2-polyprenyl-6-methoxyphenol hydroxylase and
                     related FAD-dependent oxidoreductases"
                     /old_locus_tag="AO070309000148"
                     /protein_id="BAE55181.1"
                     /transl_table=1
                     /translation="MTYTTHDVVIVGAGPVGLFLACELRLAGLSVLVVEKRTNSDGMA
                     ETRAFVMHGRSLEIFASRGLLDSFIEAGQKTDWWHYGVLDTRLDYSVFGRETDQNYLL
                     LVPQYKTEMILFQRAVDLGAVIIKGVQVDSIDESGPYVVARGFYSNNKPFTASGKYLV
                     GADGVRSTIRKIANIEFTGNPPVNTVMSGEATLGTAMPNPYIVHNEHGLVIAADLRVP
                     SGRTRLNVFASDRGTVPESVEVTLEEMNQSLQKITGVDYKLSNPCMLKRFSNEQRLAT
                     TYRQNRIFIVGDACHKHLPAGGQGLNVGLQEALNLGWKLAAVISKSAPASLLDTYEEE
                     RWPIAKAVVQNTTSQSLLFFASSGPEWAVREAIDKLLRVPEANKRLAREISGFSVAYP
                     KSLDMILPDGWRALPENIQGKRALNVKMRLPDGMVTELRDYTQDGRWIQLHLPGKHII
                     ELRPPPAFGNWTTVVEVVDMPDEEEKTSLYMCGVREMLIRPDGYLAFGRMDD"
     exon            158878..160386
                     /number=1
     CDS             join(161538..161694,161754..162375,162424..162660,
                     162708..163475,163823..164237,164290..164428,
                     164488..164705)
                     /codon_start=1
                     /locus_tag="AO090005000063"
                     /note="UDP-glucuronosyl and UDP-glucosyl transferase"
                     /old_locus_tag="AO070309000147"
                     /protein_id="BAE55182.1"
                     /transl_table=1
                     /translation="MAAATASPHRPREHGLTAGDWPDEHLSPRRRSVGGGHAHLREQG
                     LDTGVRVMDDGRLDIKFREHKPWLLNLIKHLERQPKPLPGERRPSVMSMEGQDKFPLR
                     LNIVIHVVGSRGDVQPFVALGKELQKHGHRVRLATHLAFREYINETGLEFFSIGGDPA
                     ELMAFMVNNPGLMPDMRTIRSGAIPKRRREMKAIFSGCWRSCFETGDGTGMHHIKEDP
                     WSDAPDCNTQPFVADVIIANPPSFAHLSCAEKLGIPVNMMFTMPWSATQSFPHPLANI
                     RARNTKPSVANFASYAIVEVMLWEGLGDLINRFRKRELGLDPLDAIRAPSIAHRLQIP
                     YTYLWSPSLLPKPQDWGDNIDVCGFQFLESDTNYKPPDDLDAFLKAGDPPVYIGFGSI
                     VVDNPAKLTEIVFEAIRLTGKRALVSKGWGNIGEGRAEVPKDVMLLGKVPHDWLFQHV
                     SCVVHHGGAGTTAAGLVLGRPTVIVPFFGDQPFWGSIVARAGAGPQPVPYKQLTAEKL
                     AEAINKALEPSTLEKAEEIGKGMRTERGVQNAVCSFHQHLDLRSLRCAICPTRPAVWW
                     HKHLHIKLSAFAAAVLVEAGIVDPHHFEFRQDRPEGDNRSSISESDIDSESDSDYASA
                     EEEQSDSSSTNTVVDDSDEAANELDLERTLTRKRAKEQKTGAQEILAETGYHTSKFAK
                     QVLNFAIMLPTDLTLSLAKGFHNAPKLYHDTTVQRIPRVRNVKSGFRAAGTEFTEGFY
                     YGITGLLTQPARGFQKSGGRGLVKGVGKGVGGVFFKPAAGIWGLAGFPLDGLHKSLRN
                     SLTKNKTKYILRSRLEQGIQEMCAASMEERAIVMKKWRELEKNHPQNQNGHAH"
     exon            161538..161694
                     /number=1
     exon            161754..162375
                     /number=2
     exon            162424..162660
                     /number=3
     exon            162708..163475
                     /number=4
     exon            163823..164237
                     /number=5
     exon            164290..164428
                     /number=6
     exon            164488..164705
                     /number=7
     CDS             complement(join(164817..165494,165549..165839))
                     /codon_start=1
                     /locus_tag="AO090005000064"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000146"
                     /protein_id="BAE55183.1"
                     /transl_table=1
                     /translation="MTPSLSKLVALSLFLGTALGEPWKAIDADFPDPSVIKTGDGYYA
                     FATTANGVNTQIAHSADFKTWNVLDGQDALPGPFPSWVNGSHPKVWAPDVIQRNDGKF
                     VIYYSAATSGTGSKHCIGAATSSSVTGPYSPEQDVLACDKSKGGAIDAAGFKDDDGTY
                     YVVYKVDGNSLNEEGSGYHPTPIMLQKLKSDAVTPDGEAKQLIDRDDADGPLVEAPSL
                     VKSGGQYYLSFSSNWYNSLNYDVSYAVASAVTGPYTKASAPDAPLLVSGDSSNVGALG
                     GPGGSDFREDGSAIVFHAFNNGKNMAKGRGMWAANVKIDGGKISIQ"
     exon            complement(164817..165494)
                     /number=1
     exon            complement(165549..165839)
                     /number=2
     CDS             complement(join(168094..168691,168747..168864,
                     168933..169221))
                     /codon_start=1
                     /locus_tag="AO090005000065"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000145"
                     /protein_id="BAE55184.1"
                     /transl_table=1
                     /translation="MRIFSSIFAVANVLSLSTGRVIPRQDGNSYVGYLLSTFTDANPQ
                     VFWYFSEGSDPLAFKALNGGSPVLESTVGTRAVRDIFLASNAARSEYFMIATDLDINA
                     DGFSWDEATRRGSRGLTIWKSSNLVDWSEPTLTTIEEDTAGMAWAPSAVWNDDEQQYY
                     LFWASRLYDSTDSDHTGTAGLDRIRYSTTRDFVTFSSPADYVALDDIPLIDQEFLELG
                     TPGAYARFIKDENINQVYQETTTGGLFGEWTRIPGYIGDNPLSEGPASFPDIENSGVY
                     HLLLDNYEEYVPFQTSDIDAGSWEKSSSSSYPTGLKHGSVLRLTQTEYDAITSKFGSN
                     "
     exon            complement(168094..168691)
                     /number=1
     exon            complement(168747..168864)
                     /number=2
     exon            complement(168933..169221)
                     /number=3
     tRNA            170375..170487
                     /locus_tag="AO090005t00001"
                     /note="tRNAscan-SE"
                     /product="tRNA-Gln"
     CDS             complement(join(171042..171838,171907..172108,
                     172165..172203,172260..172886))
                     /codon_start=1
                     /locus_tag="AO090005000067"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000143"
                     /protein_id="BAE55185.1"
                     /transl_table=1
                     /translation="MRSVSLFLWGLAPLLASAQLTGRVGPLKSAVEKAANKTCNVLDY
                     GAVADLSTDIGQPLLDAFEDCNGGGLVYVPEGEYALSTWVLFDKGESWALQLDGVIYR
                     NGTDGGNMITFEHTSDFEMFSSNGKGAIQALGYEFRNAGESTNTRIMRLQKVSSFSVH
                     DIILVDSPAFHMSLDTVSDGEVYNVVVRGGSSGGLDGIDVWGENVWIHDVEVTNKDEC
                     VTVKNPSYNLFIENVYCNWSGGCAIGSITSGTNITDIIYRNVYTRSFNQMFMIKSNGG
                     DGYVRNLALENFIGHGNAYSLDIDSAWSNIDTADGDGVEFSNITVSNWKGTEEDGVQR
                     GPIKILCPDENPCYDITIKDFDMWTETGDSQTYFCQSAYGDGHCLQDGDELKEYTTTL
                     TATSAPSGYAAPTMKEDLSEAMALNTSIAIPTIPASFYPGVMPYSSIAGGSAAAVTPS
                     SSVASPSVSATPSSSFVAWSSSVRVSSPSRPASSPSSTRVSPSSSWITTTGTPPTTAS
                     TDALPTIPAQKQPSPDTEVIGKCGFAPPPNQGGHHHVHHHTAPQHH"
     exon            complement(171042..171838)
                     /number=1
     exon            complement(171907..172108)
                     /number=2
     exon            complement(172165..172203)
                     /number=3
     exon            complement(172260..172886)
                     /number=4
     CDS             complement(join(181557..181935,181999..182270,
                     182313..182566,182618..182769,182817..183008,
                     183070..183202,183259..183457))
                     /codon_start=1
                     /locus_tag="AO090005000070"
                     /note="cytochrome P450 CYP2 subfamily"
                     /old_locus_tag="AO080508000080"
                     /protein_id="BAE55186.1"
                     /transl_table=1
                     /translation="MPLPTLGSVLLGLAFLYFVKLVLLRKKTLAPLPPGPKPKPIIGN
                     LRDLPRPGQQEWTHWLKFKELYGPISSVSMFGQTIVILNDHQAAFDLMEKRSAIYSSR
                     PRLVFAAEIVGWEDVITLQGYTNRFRSYRKAMHRVLGTKELMSRFNPLQDVEVRRFLL
                     RILQKPDELIQHIKTEVGAVILKIAYGYNIEPHGRDPLIDLVNDSMENFSAVVKPGTW
                     LVDVIPLLKYLPTWFPGAGFKRTGYEWRKTLLATIEKPYQLVKQHMRQGSYPPSYLAR
                     LLEQIDGEPTAEEELVSKWTAGALYAGGADTVTPTASSLSSFFLAMALYPEVQRKAQK
                     EIDRVVGPNKLPTFEDRDTLPYIDAMVKETLRWHPVGPMGVAHLVTEDDIYEGYLIPK
                     GALILPNIWGFTHDPKIYRDPETFRPERFLGDNPELDPHTLAFGFGRRICPGRLLADA
                     TIFLTIAQSLTVFNFSKPEGEGDLKAEFLPGVISHPAPYRLEITPRSAAHEALIRSVE
                     VEHPWEESHAKELEKVEC"
     exon            complement(181557..181935)
                     /number=1
     exon            complement(181999..182270)
                     /number=2
     exon            complement(182313..182566)
                     /number=3
     exon            complement(182618..182769)
                     /number=4
     exon            complement(182817..183008)
                     /number=5
     exon            complement(183070..183202)
                     /number=6
     exon            complement(183259..183457)
                     /number=7
     tRNA            complement(184998..185086)
                     /locus_tag="AO090005t00002"
                     /note="tRNAscan-SE"
                     /product="tRNA-Asp"
     CDS             complement(join(185597..185756,185807..185970,
                     186027..186111,186175..186200,186261..187126,
                     187201..187413,187445..187495,187534..187561))
                     /codon_start=1
                     /locus_tag="AO090005000071"
                     /note="cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies"
                     /old_locus_tag="AO080508000081"
                     /protein_id="BAE55187.1"
                     /transl_table=1
                     /translation="MVHPSVLVEALVMFRPIAQFLLFPPFCMFQFLFQPWIIALAGAG
                     YLISLAVYRLWLSPLAKFPGPKLAALTLWYELYYDIYCEGQYTFQIIRMHEKYGPIVR
                     ISPWELHISDPDYYEVLYSRDSPRNKYEYYTRQFGLTKTAMATVDHYHHRLLRSNMNP
                     YFAMTRIRKLEPLIQGLVDKLCDRLREFKGTGTPVALQYPFTCFATDVVTDYTMGAGF
                     HYLDEPDFVPRWSRTLSGVAKSGVYIKPFPWLIKVFNALPESWLSWLNPEMDLTFHFQ
                     RRCREVIASIMEEQNANGYDKVKSQFSHPTFFHDVLNSNLPPEEKSPERLWQEVQVVV
                     GAGAETTGKALTWTMFYLLHSPDKLQKLREELNQLDPDRTATLLDFEKMPYLTSVILE
                     GLRLSYGLSTRLQRVAPDRALQFREWSIPAGTPVGMSSTLMHHDERIFPDSHKFIPER
                     WLDLEQRKHLEKYMVAFTKGSRQCIGMNLARSEILLALPKVLRELDFELYETTLEDVT
                     LAHDMFLPFPKMDSKGVRVLIK"
     exon            complement(185597..185756)
                     /number=1
     exon            complement(185807..185970)
                     /number=2
     exon            complement(186027..186111)
                     /number=3
     exon            complement(186175..186200)
                     /number=4
     exon            complement(186261..187126)
                     /number=5
     exon            complement(187201..187413)
                     /number=6
     exon            complement(187445..187495)
                     /number=7
     exon            complement(187534..187561)
                     /number=8
     CDS             join(190816..190894,190946..190992,191053..191148,
                     191211..192578)
                     /codon_start=1
                     /locus_tag="AO090005000072"
                     /note="Zn2+ transporter ZNT1 and related Cd2+/Zn2+
                     transporters (cation diffusion facilitator superfamily)"
                     /old_locus_tag="AO070309000136"
                     /protein_id="BAE55188.1"
                     /transl_table=1
                     /translation="MGLSKTNRIIILLAIDSAFFLLELTVGYAVHSLALVADSFHMLN
                     DVLSLCVGLWAVKVANQETNSTTSKMYTYGWQRAETLGALVNGVFLVALCMSIFLEAI
                     QRLVEPQEVQNPKLVCIVGCFGLLSNILGLLLFHDHSHGHGHGHSHGEAHGVEDVDVA
                     EQGYISHGGSDPARGIAVRSTLHNCVINDRILIYSMQDECTLSSPNTRRRRTLDSQHR
                     GSPRYSNNVEDIQVHPATMRQEIIGRSRYVDEEQSSESDSDQTNLAETSERSALLSHK
                     DRAGKYTDEANASLQPNATVDDDIHKFHNHAQPKSKDSKHGHGHGHGHGHGHDLNMRG
                     VFLHVMGDALGNVGVIASALVIWLTDYEWRFYVDPGISLVITVIILASAIPLCKAASR
                     ILLQAVPPGMSIDHIKEDIERLPGIISSHDLHVWQLSDTKHVASIHIQVDTEIKGEGS
                     ERYMRLARQVRRCLHAYGIHSTTIQPEFAPGSDVEDNQPASSYSSNGPSSLREEDSRA
                     CLLECGDGCTRGGECCPKTST"
     exon            190816..190894
                     /number=1
     exon            190946..190992
                     /number=2
     exon            191053..191148
                     /number=3
     exon            191211..192578
                     /number=4
     CDS             join(193208..193558,193628..195247)
                     /codon_start=1
                     /locus_tag="AO090005000073"
                     /note="cell division control protein/predicted DNA repair
                     exonuclease"
                     /old_locus_tag="AO070309000135"
                     /protein_id="BAE55189.1"
                     /transl_table=1
                     /translation="MSYSYPNSTNADAYRPVRRDYHTDSSNDHSRLVDTLPPWLRQWV
                     AELHAHWIAPSFSITENSRGSYALTARLWRIFRHIFTITNALAVLWFFTLWWGERAVF
                     QDSLERCAWENWERWPRDATPHHVAFIADPQLVDPHTYPGRPWPLSTLTVKFTDQYLR
                     RSFSSIQRNLGPDSVLFLGDLFDGGREWATSHSSSPEKRYQKYKDSFWKNEYHRFVKI
                     FSNQWNEGDSHSGNTRGRRMIASLPGNHDLGFGTGVQLPVRDRFQTYFGQSNRVDVIG
                     NHTFVSVDTVSLSAMDQPDPDTGSSGSGDGHPPNEHIWKEAEDFLNSMNVHRGKAEME
                     ELRLMRNQSEGHVFDHKVVDLSQPTLHQRLKPEVVGFPAILLTHVPLYRKPATPCGPL
                     REHYPPSDGEPEEDDRNALSISAGYQYQNVLTQTISKDLVTKAGPNLVHIYSGDDHDY
                     CEVTHRQFSGSPREITVKSLSWAMGVRRPGFLLTSLWNPVDPATGKPTHSLSTGATLQ
                     NHLCLLPDQLSIFIRYGLLFGLTLAVLLARAAILVLYFPAVDSSAPILPLSEFRPTLH
                     VHTAKAPSSSTSSSTFSSPGGLASRAVNAPPRYPKVYDDTYPGAGHDDVDNAKWKPRV
                     PASRGIWGEYMNSVKYVATIVFAWYFFLIWRW"
     exon            193208..193558
                     /number=1
     exon            193628..195247
                     /number=2
     CDS             join(196943..197040,197110..197438,197497..197958,
                     198014..198717)
                     /codon_start=1
                     /locus_tag="AO090005000074"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070309000134"
                     /protein_id="BAE55190.1"
                     /transl_table=1
                     /translation="MGFMLKKPDDATGSAAPAIVIGLFVAFGGVLFGYDTGTISGILA
                     MPYWRKLFSTGYINPSDNYPDVTSSQSSMIVSLLSAGTFFGALGAAPIADYFGRRLAM
                     IINTFVFCFGVILQTAATAIPLFVAGRFFAGLGVGLLSATIPLYQSETAPKWIRGTIV
                     GAYQLAITIGLLLAAIVNNSTKGRDDTGSYRIPVAVQFAWAIILVVGMIVLPETPRFL
                     IKKGKHEAAAKALSRLRRIDVNDPAIVEELAEIQANHEYELSVGNASYLSILRGSIGK
                     RLATGCAVQGLQQLAGVNFIFYYGTTFFEHSGIKDGFIITLITNIVNVVSTFPGLYMV
                     EKWGRRPLLLFGAVGMCVSQLIVAIVGTATTSDVANKVLIAFVCVYIFFFACSWGCTA
                     WVVTGELFPLKARAKCLSITTATNWLLNWAIAYATPYMVNSGPGNANLQSKVFFIWGG
                     FCFIAGIFVYTCIYETKGLTLEQVDELYAKIPVAWRSHEFVPSVSYADVRDVAAGKVS
                     GNLADLEADAQMKRDMEHVEKA"
     exon            196943..197040
                     /number=1
     exon            197110..197438
                     /number=2
     exon            197497..197958
                     /number=3
     exon            198014..198717
                     /number=4
     CDS             199441..201369
                     /codon_start=1
                     /locus_tag="AO090005000075"
                     /note="triglyceride lipase-cholesterol esterase"
                     /old_locus_tag="AO070309000133"
                     /protein_id="BAE55191.1"
                     /transl_table=1
                     /translation="MLIRSASAHDPDSVYKVPLLSCEPTDSPAPFEKMSVSATTTSIN
                     PDISPIEDKNVQPGVELEELNKTCDENQKQTSDSTGTDSLYEKRHTIEQSGSHTQPKN
                     YAFSFQDHPLFPPLPSYGPPSFVFTIKCLVLQCVSFLLSLLFLGAVVVGALVCRTRLA
                     VSHVKIRLRGQDPNEQRAFYEEERARELERQKNLQQWKRRQEKKEVDEEAPDECSPLE
                     GGKDPIICDVAYYARRVGLDVETFRVQTEDGFIITLWHVYNPQEYMPLPADARAPRGP
                     GVFTGKKDPGLSSRSNRKYPILLMHGLLQCAGAYCTNDEDSLAFYLCKSGYDVWLGNN
                     RCGLTPEHTTLSTSDPRMWTWNIRHMGVLDLSALVSRVLYETGFEKLGLVCHSQGTTQ
                     TFVALAKDQRPELGERISVFCALAPAAYAGPLVERSYFRFMRIISPNIFRIVFGIHAF
                     IPFMMTVHQYLHPKIYGTLGYYVFSYLFGWSDTRWDRGLRDRMFQFAPVYVSAETMRW
                     WLGRECFATQKCILATREVGLLEAEEDHRFEKGIDGGAPRSDTAWYGPQVPPMALWVA
                     GADNLVDGRKLLQRFRNGREPHVHVVHEKVIEEYEHLDVLWAMDVIEQVGKEVRQVLW
                     ATMPDDARAVCQVPKGVQ"
     exon            199441..201369
                     /number=1
     CDS             join(202106..202127,202278..202828)
                     /codon_start=1
                     /locus_tag="AO090005000076"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000132"
                     /protein_id="BAE55192.1"
                     /transl_table=1
                     /translation="MSSHRDYYLEHFTNPRADLVDELIARVHDYHIIRVIGPPASGKT
                     TLMKLMVNKLLEMNGPTKSIHVLTGWDKQEVCGAPGWARYLGQKTGVHGEEWLSNPAY
                     LLLDEAQQTYWDSGLWASFFKSAGPGWSVFIVLFMSYGSPGEGLEGFESELYSSVPMH
                     FGPDQEIFLRLEKSISDLYLAQKPVGLLLD"
     exon            202106..202127
                     /number=1
     exon            202278..202828
                     /number=2
     CDS             join(202935..202981,203094..203399,203550..203607)
                     /codon_start=1
                     /locus_tag="AO090005000077"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000131"
                     /protein_id="BAE55193.1"
                     /transl_table=1
                     /translation="MLGYLPALRMCCTMCRGVSIDWPTTSKILSSQPRKFFDLLSGYP
                     FSKGLPTLNSLRDPVTVQVFKMAIAHDGIYKASLRTGSKEFKYALRDIWRNGWLHAVE
                     SKWDIRYIFASQIHRCPITHQICRLPSSRADACP"
     exon            202935..202981
                     /number=1
     exon            203094..203399
                     /number=2
     exon            203550..203607
                     /number=3
     CDS             complement(join(204428..204576,204641..205145,
                     205202..205322,205378..205445,205496..205600))
                     /codon_start=1
                     /locus_tag="AO090005000078"
                     /note="thermophilic glucose-6-phosphate isomerase and
                     related metalloenzymes"
                     /old_locus_tag="AO070309000130"
                     /protein_id="BAE55194.1"
                     /transl_table=1
                     /translation="MAGVDMRLEAGAYRELHWHVASEWSLVLNGSCRIQAVNENGETF
                     VDDVTEGDVWFFPPGVPHSIQALDAGVEFLLVFDDGDFSEDNTFLASQVFSHNPRSVL
                     AKNFDLPISAFNDIPEDQLYIFPGTKAPKDIEEQNVTTAAGIVPLSQSYSYHFSEQPA
                     HEVAGGSVKIVDPVTFPIATNFAAAIVTVKPGGMREIHWHPTSDEWTFFIKGKARATL
                     FTAPTTATTFDYRAGDVGYFPQSNSHYIENTGDEDLMFLEVLQTDKFTDIALGQWIGS
                     TPKQIVADTLKLPESALSKLKTEKQYVVAGSNVTSVAKR"
     exon            complement(204428..204576)
                     /number=1
     exon            complement(204641..205145)
                     /number=2
     exon            complement(205202..205322)
                     /number=3
     exon            complement(205378..205445)
                     /number=4
     exon            complement(205496..205600)
                     /number=5
     CDS             complement(join(207654..207927,208353..208393))
                     /codon_start=1
                     /locus_tag="AO090005000079"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000129"
                     /protein_id="BAE55195.1"
                     /transl_table=1
                     /translation="MFVVFSLFYPCCQRVGIHDRFVAGDFDLLDSQWSSQVDRLDSGE
                     ILSAPGPPCITLNCKAAKPGRAGYVVASAFRFKFEGDKEYPGQAGKQAWFSLTLEPVI
                     MK"
     exon            complement(207654..207927)
                     /number=1
     exon            complement(208353..208393)
                     /number=2
     CDS             complement(join(208512..208649,208829..209025,
                     209073..209245,209299..209303))
                     /codon_start=1
                     /locus_tag="AO090005000080"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000128"
                     /protein_id="BAE55196.1"
                     /transl_table=1
                     /translation="MDPDGRTDGWLNKGENSFESIGQVKRSEHYDRASEFFTAYIVMV
                     QTTLTNTDHRWADVNGDRMADFLWIDKFNGDTKVTSSMWHLKSTIAGYVKVWINQGPV
                     PTLDSKWRCGPQDGPRYMGADRGAYTWSNECPNEALDDDDSTEDPKLPQYPAPAQPAS
                     INNNGANDAM"
     exon            complement(208512..208649)
                     /number=1
     exon            complement(208829..209025)
                     /number=2
     exon            complement(209073..209245)
                     /number=3
     exon            complement(209299..209303)
                     /number=4
     CDS             complement(join(209901..210144,210419..210708))
                     /codon_start=1
                     /locus_tag="AO090005000081"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000127"
                     /protein_id="BAE55197.1"
                     /transl_table=1
                     /translation="MGRQTPVYRAAQTCILGLVLLSFASASSYLPRESPTGIISNDGF
                     SFLNETSQLTPRDEKPFTLRIMPLGASITYGYQSTDGNGYRRWLHQQLRHAGCAGTND
                     ANQYHDTTVDVYKTGERMDALLTRLFDAIPGTTIILRETNKWRLEALRPCLQEHWSRR
                     HPGEGYSTDIVALLRLR"
     exon            complement(209901..210144)
                     /number=1
     exon            complement(210419..210708)
                     /number=2
     CDS             complement(join(211789..211923,211992..212642))
                     /codon_start=1
                     /locus_tag="AO090005000082"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000126"
                     /protein_id="BAE55198.1"
                     /transl_table=1
                     /translation="MDKKSAISNNSLPGSSTPSISRSSINHCSFNGLNAADSIHRSEL
                     DSVNVFRKTFPESSRVTSISPANTTIRRSKVSHTVIANSYVRRCKLANCELIDVCSAK
                     SLDANDSKFDNVRSIRGHTSVRNSTVTGQSTLNRSKVNGSSVTDESCLRRSHLEDVRI
                     ARSRVKRSELRNCDVSDCVIIKTNFTDMILRYGVWKNGKLVGRVGDNEVVMVTQDGQN
                     IGHVPSERLVTQDAKVWADDDPDSDSSDKESLGSDDLPPPYKP"
     exon            complement(211789..211923)
                     /number=1
     exon            complement(211992..212642)
                     /number=2
     CDS             219004..220647
                     /codon_start=1
                     /locus_tag="AO090005000083"
                     /note="hexokinase"
                     /old_locus_tag="AO070309000125"
                     /protein_id="BAE55199.1"
                     /transl_table=1
                     /translation="MSASLTKVLHRMQELFSNVVAALEAMLLFPSLFRDSSGKRKSFH
                     RASWRRRTLDDLADEIDHVFTAPLSLQNMAMMSEKIREQLRICLQSSPVSMLPSYNHA
                     LPSGTEKGTFLALDVGGSTFRVALIELRGNGDMEILRVNSSPIDEQVKLLEGTLFFDW
                     MAEKIDSMLSEVGAQYGRELAPLSMGLSWSFPVEQTSINSGLVIQMGKGFLCSNGTVG
                     QELGDLIVQSCRKRSLNLQMGAIVNDSSATLLSRAYVDPKTRMSLILGTGTNMAIHFP
                     VHAIGLTKFGTRPVGWFDYAKHVIINSELSMFGGKVLPMSRWDDVINRTHLRPDYQPL
                     EYMITGRYLGEILRLIIVEAVETAQLFGGELPRSMRDAYSFDTSIVAAIEADTSSSFS
                     SSAALLQKEHTFHRAPTVDDLKFLRRVCEIVSNRSAGYLATAIHSMWSLRNEAEFPEV
                     TASATSSIKETQEVTVVESEHSQSLTIACDGSVINKYPGFRDRCQGYINQLLQETNAS
                     KGTLEATPSPSVRLDPAPESGILGAAVAVAVAVAEKTSA"
     exon            219004..220647
                     /number=1
     CDS             complement(221639..222109)
                     /codon_start=1
                     /locus_tag="AO090005000084"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000124"
                     /protein_id="BAE55200.1"
                     /transl_table=1
                     /translation="MSYNTPDLSSVLATLSALSNQSQPQAQAHPQHQQPYTTNKNTQN
                     VSEDDTDTYEPSETINPLTPSPNIPHPKPQAHPQHPKPPTFHLPDTSTITTWPPALKS
                     IMRTLSTNEDLQRKIRFLIQRQHDHERQWWAGREALVRKQKARVEKKKELDAVL"
     exon            complement(221639..222109)
                     /number=1
     CDS             join(222487..222784,222915..223393)
                     /codon_start=1
                     /locus_tag="AO090005000085"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000123"
                     /protein_id="BAE55201.1"
                     /transl_table=1
                     /translation="MSRSAADATRFTATGPYAHSKPGAAPYKLPGFMANAQSQGSGNG
                     GRQETPKEKVERLRAQARAARMAQSTSRVDTMIDFGRRFANKAHKTMVYTLIAASGIC
                     GALTVYSMVSLTLYNRRQRALWIEKELQTLQDAKTAFASGTATPAQLELLKNEKIGEI
                     YEQKKQEEKAQRPWNKFKRYLFEGLSSEDAASKVEGAAENNKPGVLEALNAKAAEEAK
                     AAAAVPAAVQQPGQLDALAENAETAAKQTSKSWKSWLTGR"
     exon            222487..222784
                     /number=1
     exon            222915..223393
                     /number=2
     CDS             complement(join(224021..225016,225143..225198,
                     225263..225305))
                     /codon_start=1
                     /locus_tag="AO090005000086"
                     /note="3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP)
                     synthase"
                     /old_locus_tag="AO070309000122"
                     /protein_id="BAE55202.1"
                     /transl_table=1
                     /translation="MPLVNTTEVNEDTRVLGYDPLLSPQYLQSEIPAPAEATATVRSG
                     RNQAVEIIEQRDDRLLVMVGPCSIHDPATALEYATRLKELAGKLSSDLCIIMRAYLEK
                     PRTTVGWKGLINDPDIDESYNINKGLRISRKLYADLTSMGMPIASEMLDTISPQYLAD
                     LISLGAIGARTTESQLHRELASGLSFPIGYKNGTDGNLVVAIDAIGAAAHPHRFLGVT
                     KQGLAAITKTSGNEHGFVILRGGSKGTNYDRESIRQAREALRSKKQREVLMVDCSHGN
                     SNKNHRNQPLVAKEVADQMREGQDAIVGVMIESNIHEGNQKVPAEGPKGLKKGVSITD
                     ACIDWETTVTVLEDLADAVRARRAAKASSA"
     exon            complement(224021..225016)
                     /number=1
     exon            complement(225143..225198)
                     /number=2
     exon            complement(225263..225305)
                     /number=3
     CDS             227373..227957
                     /codon_start=1
                     /locus_tag="AO090005000089"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000119"
                     /protein_id="BAE55203.1"
                     /transl_table=1
                     /translation="MDIDYDRDMLPSIGDRTHYPWPTSARGNEDIQPSPIPHSLLNQY
                     LTISERHAATSAYGYLPPTTSDHGSTLSTCHPTSHDATPCYSDAQRLPSPVSDGEDAM
                     RSIKDTTSDVDMTYNPSRPASFSPSTWLGTERSSPNMQETMPPMDSARGMLQDPKSKS
                     ASNKKKITISMGYRADCEKCRCKVPGHYSHIIRA"
     exon            227373..227957
                     /number=1
     CDS             228730..229971
                     /codon_start=1
                     /locus_tag="AO090005000090"
                     /note="3-oxoacyl CoA thiolase"
                     /old_locus_tag="AO070309000118"
                     /protein_id="BAE55204.1"
                     /transl_table=1
                     /translation="MASPIPRGLRQVLQKSPNDIVILSSLRTPVTRAKKGGFKDAYPE
                     ELLANVLKATLEANPKLDPALIEEVAIGSVLQELGGAKAGRMAQIHAGFPHTVPFHTI
                     NRQCSSGLAAITAIGNGIRAGALNIGVGGGMESMTRNYGFRAIPTVLWPELKESPSKD
                     SRDCIMPMGITSENVASRYGISREDQDVFAAESHKKATAAQNAGLFDSEIVPVKTLSF
                     DPENPDAPPKEITATKDDGVRPNISVEKMASLKPAFSPTGASTAGNSSQVSDGAAAAL
                     LMRRSTATELGLTSSIKGRWVGTAVAGCAPDEMGVGPAVAIPKLLQQLDMSVSDVNIW
                     EINEAFASQALYSIRKLGIDEAKVNPKGGAIAIGHPLGATGARQLATLLPEMERTGQE
                     VGVVSMCIGTGMGMAGMFVRE"
     exon            228730..229971
                     /number=1
     CDS             join(230149..230714,230824..231262,231326..231597,
                     231742..231769)
                     /codon_start=1
                     /locus_tag="AO090005000091"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000117"
                     /protein_id="BAE55205.1"
                     /transl_table=1
                     /translation="MRCQARTTTHVTGCLDEPPNGNHETFLKVAEVRNSCHTTAMRPS
                     LRLLNLEVSSLQGSRTLYVCSVCRQEARPRPLVARQFLRNASNATPITERVRRKIWGT
                     DNPPGLKDPYGGEGVLERKFKKDQPARQEEEPENLAQTSEQTQVENEAELASAEAYEP
                     ATTWEGLQRVGHLGRWSDLPPSEADAYESFMLKKKVTKKGQLSLAAHQAAVEVSLMHS
                     LNKPLSKVCDVVEHDKSVFKMLWKCKIQPGEWKQAVVYPSKEAEKALVYIFEQIGGQP
                     ESAVAEETAEEVEEAVDESKWEDLVAEVNDSNVPFFGYADVRDKGFLSLSLSDPATKF
                     AFLKRFSQLSGHYLPDPVVHSVATVGQVVEYVQSVLNPKPKKLADYLANSQGLQNLPN
                     VKVFTKKQKPMDRDEELGRKKVIEAELRSRGLIDQKCKRYQH"
     exon            230149..230714
                     /number=1
     exon            230824..231262
                     /number=2
     exon            231326..231597
                     /number=3
     exon            231742..231769
                     /number=4
     CDS             complement(join(231840..232743,232808..232827))
                     /codon_start=1
                     /locus_tag="AO090005000092"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070309000116"
                     /protein_id="BAE55206.1"
                     /transl_table=1
                     /translation="MGNDGGSIPTRRELVREAARAPSTAQVKEAQRELQEHYWKTCPL
                     SHKPLMRPIVADCVGNMYNKDAILKFLLPGEEIEGISSKADCEEILCGRVKGLRDVVE
                     LKFEIDTEQSQHPSTKLDKQEGWICPVTAKQLGPNVKAVYLVPCGHVFSEEAVRQLKG
                     DKCLQCNESYTEENVIPILPTKSEDKQQLMARAQKLAEQGLTHSLKKAPGSKKRKKQA
                     NGDSAETEGASRSNTSTPKPSASNGIKHAATAMLTARVLEEENEKKKRRKMMGLNENL
                     DSLFTKDSKDGKMNNADFMTRGFTLPAGSRK"
     exon            complement(231840..232743)
                     /number=1
     exon            complement(232808..232827)
                     /number=2
     CDS             join(233068..233179,233354..234301,234353..235005)
                     /codon_start=1
                     /locus_tag="AO090005000093"
                     /note="protein kinase C substrate, 80 KD protein, heavy
                     chain"
                     /old_locus_tag="AO070309000115"
                     /protein_id="BAE55207.1"
                     /transl_table=1
                     /translation="MILPQGLLFFVSLAACSTAVVAASNDGSARPRGVGPEFAKFYKD
                     TDTFTCISHPAIKIPFSAVNDDYCDCPDGSDEPGTSACAHLSRNSPLTVADRPGSNDL
                     DLTLSLPGFYCKNKGHKPSYVPFQRVNDGICDYDLCCDGSDEWARVGGTKCEDKCKEI
                     GKEWRKKEEKRQKSMTTALKKKKELLTDAGRQQKEVEENINRLEIQIQGQEIKLKDLE
                     ADLEEIEKQERSKVVTGKKAGKVNVLAQVAKGRVEELRTALAEVRKERDETRSRIKEL
                     EEILSKFKVEYNPNFNDEGVKRAVRSWEEYAARGTSEGLENAARDRDLDEIVKPDDDK
                     SGVNWEQWENEEDGCEANLVYQLAAYLPPSLVNFIEDKALAIRGFLEQNGILPTKDEG
                     SASESKAVTEARDAVDAVRKSIEDLKNQVKDHKEDLDTDYGVGSIFRALKGVCIQKDA
                     GEYTYEHCFLDQTKQIPKKGGSTARMGNFVRIGSVTIDQLNESGEIVPEERISLEYAK
                     GQTCWNGPARSTSVVLQCGEENEILKIAEDEKCVYSMLVNTPAVCPGGEEDVHAASGR
                     KDEL"
     exon            233068..233179
                     /number=1
     exon            233354..234301
                     /number=2
     exon            234353..235005
                     /number=3
     CDS             join(236302..236644,236758..236765)
                     /codon_start=1
                     /locus_tag="AO090005000094"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000114"
                     /protein_id="BAE55208.1"
                     /transl_table=1
                     /translation="MKISYASIMVLLSMTALAIPNPEAYSQDRSAHALNMLEARKGCS
                     GQRKNEDKCSGQRLGPMNSFHSWSDINCPLMTSSRLTLYIHSKNMDGKCCAKTKDGSG
                     ALDASRGQGREDYR"
     exon            236302..236644
                     /number=1
     exon            236758..236765
                     /number=2
     CDS             join(237562..237782,238188..238539)
                     /codon_start=1
                     /locus_tag="AO090005000095"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000113"
                     /protein_id="BAE55209.1"
                     /transl_table=1
                     /translation="MLSSKWTSTPREFPTSGFELLDASSKIEEETLPTYSPEKYYPVQ
                     QGEVFNDRYQVLAKLGYGVTSTVWFARDLVAPSNAWNDGTKVEKDIQLKNLLLPTPSS
                     SALADFEEREIKVPAARKILKDRTVYTTSRFPAGDGLPLLGDFGEARFGDEENIGDIM
                     PDYYRAPEVILKSNWDYKVDIWNVAMIVSA"
     exon            237562..237782
                     /number=1
     exon            238188..238539
                     /number=2
     CDS             complement(239645..240418)
                     /codon_start=1
                     /locus_tag="AO090005000096"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000112"
                     /protein_id="BAE55210.1"
                     /transl_table=1
                     /translation="MPNSNPVIVILHGAWHTPAHYAEFTSALKSKGHEVHIPRLPSMS
                     DTRPPNADLHTDTDFIRSYVKSLVEAGQGVVVFMHSYGGQVGTNALVGLGAETRKQQG
                     QTGGVVLLIYMSGFAVTENTSMMSVVKQFGHEDLIPLAFDIAEDYSTVSRDPKNLIIG
                     PGRSDEETDAYVAAMLRWNGKTMYQDVERCAWREIPVAYIYATEDMNVPFDYQKWFVE
                     TMREDGREVETFEVQTGHCPTFTKFEEVATIVDGVVSKL"
     exon            complement(239645..240418)
                     /number=1
     CDS             join(243090..243171,243240..243343,243409..243880,
                     243949..244166)
                     /codon_start=1
                     /locus_tag="AO090005000097"
                     /note="dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /old_locus_tag="AO070309000111"
                     /protein_id="BAE55211.1"
                     /transl_table=1
                     /translation="MATSTSISAANLFDVSGIVAVVTGGGSGLGLFMTKALATNGAKK
                     VYILGRRKPILDQVASELDRDIVIPIQCDVTDQSSLKAAVARIEADTGYINLLIANSG
                     IAGPSGSVPPGSSIAELQETLYNIPMQDFTNTFHVNCTAVFYTTIAFLGLLDAGNKNG
                     SYSNGRSQVIATSSIGSFNRRISAGFAYSTSKAATTMMMKVLATYLVPYRIRANVLCP
                     GLFPTDLTTDLYQGKNPTEEGAFPLDQIPAERAGTPEDIMGPLLYLASRAGAYCNGNC
                     VLTDGGRLSVTPATY"
     exon            243090..243171
                     /number=1
     exon            243240..243343
                     /number=2
     exon            243409..243880
                     /number=3
     exon            243949..244166
                     /number=4
     CDS             join(249665..249849,250502..251192,251283..251536,
                     252119..252161)
                     /codon_start=1
                     /locus_tag="AO090005000098"
                     /note="DNA polymerase sigma"
                     /old_locus_tag="AO070309000110"
                     /protein_id="BAE55212.1"
                     /transl_table=1
                     /translation="MPPPFQFRGNDRRSQNHHPKPEFTFRYSRPPTSERPLLRSRRET
                     TPDLLVAPENGDDKPALKLHNEILSFYYWVKPVEYEQIVRADLIERLQTAFQSRYYGV
                     QLRAFGSFASGLYLPTADIDLVLLSSNFMRHGIKTFGERKGQIYAFSAFLRNLDIAVP
                     GSIETIAHARVPILKFVDKMTGLRVDLSFDNDSGLVANNTFQQWKSEYPAMPVIVSVI
                     KQFLLLRGLNEVPCGGLGGFSITCLVTSLLQHLPHGSMSQNLGSILMDFFEFYGHEFD
                     YETVGIRMEPPGYFNKDARLSIEDPNNADNDVSGGTREIALIFKSFRDAYRLLKERMV
                     YTAMAGDQNNSILESIIAANYDEYTEQRWQLRQIFQTHPRFARHDDEKSLQTSFLA"
     exon            249665..249849
                     /number=1
     exon            250502..251192
                     /number=2
     exon            251283..251536
                     /number=3
     exon            252119..252161
                     /number=4
     CDS             complement(252840..254258)
                     /codon_start=1
                     /locus_tag="AO090005000099"
                     /note="predicted oxidoreductase"
                     /old_locus_tag="AO070309000109"
                     /protein_id="BAE55213.1"
                     /transl_table=1
                     /translation="MGRPSLPLSANLPPLVMGTATFNSQYNPDPYALPTTELVHRALT
                     SGVRAFDTSPYYGPAEELLGRALATDFVQSNFPRHTYRLLTKVGRVASSSFDYSPEWV
                     RYSVKRSLRRLHTDYLDVVYCHDVEFVSPQEVLEAVRELRRIRDTEGTIHYVGISGYP
                     VDVLSDLAEMVLQETGEPLDVVMSYANFTLQNTRLLTEALPRLVAAGVDVIPNASPLG
                     MGLLRRSGVPIGSMGDFHPAPDGLRSAIHRAAEWADTQGEKIEVIAIRFALESWLREG
                     AKAGALGPPLARSADADPGFLSVVNMGTGERLGVSVMGVSNLDELNETLRVWHSIIEG
                     LEYKDDEEIAEIGNSQSNPAAVPSAPQAPTILTPSEGIITDRAWSKSRRHRILSLAQE
                     IQAILGSEWVDFVWPSPGTDFVNTLSAEHLALKTELAGLTAAGQEKAASATTDSQTMI
                     TPPLDAVDTKIPVDATPSDVAL"
     exon            complement(252840..254258)
                     /number=1
     CDS             complement(join(255478..255879,255971..255973))
                     /codon_start=1
                     /locus_tag="AO090005000100"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070309000108"
                     /protein_id="BAE55214.1"
                     /transl_table=1
                     /translation="MAHRLVSQVVVTGARVFGRAFAEAYKQASATGKYKAVKGNGGSS
                     FSSSGLTLDEACKILNVKPPQGGETNLEHVMERFKKLFDLNDPQKGGSFYLQSKILRA
                     RERIEMELRQAERKAAQEKELREGWKPKVYKD"
     exon            complement(255478..255879)
                     /number=1
     exon            complement(255971..255973)
                     /number=2
     CDS             join(257085..258275,258343..258615,258769..258984)
                     /codon_start=1
                     /locus_tag="AO090005000101"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000107"
                     /protein_id="BAE55215.1"
                     /transl_table=1
                     /translation="MADDIPWIDSMAPSTSAQDHADSQPPTVAAFSPTTISGSSLASR
                     QRSSIIVHRKSPLLVATPPPITRALAYSHPFILPLNKLVGLLTWTTDDAWQSFLLVSI
                     FWTIVLYGDAIILWAGPPLVVVGLILGMYWRRYSPLSTRSISGEKPGHQRAPSESSLR
                     HHDSLDEIVETMRAFTTRCNMLLEPFLELTDFLSTQRTATSATTRPALTTLFFRILFV
                     TPIWIALTLPPLHLITTRRVILIIGTIILTYHSRPARVSRVILWRSLTVRRICSLITG
                     LSFSLNVDKTPSTRTQSHGHAASVATRRRGESSGVRFTFILYENQRRWLGIGWTYSLF
                     PSERAAWTDEHLNNVPSKDEFELPEVQSGNAKWRWVEGSEWRIDGADDASAKDGGGWI
                     YYDNKWNDGRRGQDGWDRYTRRRKWCRDAELVEVSSTADLTSAEATSGLTQALEKERE
                     KRRGSGTLDASTVDADSESLAGSTSKARRRRWFGNSKTKLSSSYSSGSGSLGREGSIH
                     GSAAHSDKSARDKEIAHSQDRLDRWGSRAAGGIERAEREMGLGDEVNMGLS"
     exon            257085..258275
                     /number=1
     exon            258343..258615
                     /number=2
     exon            258769..258984
                     /number=3
     CDS             complement(join(259325..259820,259880..260083,
                     260135..260895))
                     /codon_start=1
                     /locus_tag="AO090005000102"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000106"
                     /protein_id="BAE55216.1"
                     /transl_table=1
                     /translation="MWAEPLKPSAEIFQQVLPPKRRRVSPSPSLSASSPAAPVEQLSP
                     NSTVFSGYTTVPSTPSEYGAIEICTPQDEDNDSHGNDDLALDVTHSENCAVLVPKQCG
                     SLSHLSNLEMHYLQYHMEQGSKLLANLESDENPLRSLIIPYALSSPLLMKALCAVSAM
                     HLANRSCGNLSAQNAAANYYVRTMSGLRSALSKAPVEGFPTDSILAVALLCKYEIVRG
                     SVKQWAVHLSALEKLVVSRGGFSTFDQDTAEFLWGLFMYAHNVARVTNRKQITNYIPG
                     EEALSLRKLDIYIGYTEDIIRLCPRIADLPLLSHDPVALGLEIHTIDSSLRNWTHTST
                     PYIIPKGATDASLVRLRMVAECFRDAAYIYLHSTLERMSRGIVARNLPSLWSSFISRT
                     KQVALRRCLDRIQSFPLDENCEYSALTFPLFIAGCESESPAARELVILSLSKLESNFG
                     IGNTKRAKELLHILWNGEKMHWLDVLEQLKWDLILA"
     exon            complement(259325..259820)
                     /number=1
     exon            complement(259880..260083)
                     /number=2
     exon            complement(260135..260895)
                     /number=3
     CDS             join(262102..262443,262501..263080,263135..264043,
                     264110..264342)
                     /codon_start=1
                     /locus_tag="AO090005000103"
                     /note="copper amine oxidase"
                     /old_locus_tag="AO070309000105"
                     /protein_id="BAE55217.1"
                     /transl_table=1
                     /translation="MSFTSQETTSTTSGKLHPFDPVRPEEIRLAVRILEASFPGVPLR
                     YNRIDIHEPIKQDVIPYIEAERLGKPLPPRPARLLYSYFSRVDTGVCIKALMNADTKS
                     LIYAKEFPEGVQPPMDVDEIAGIEEHCMQHPAVLAEIEKLKLPPGMTVCNDPWMYGTD
                     DPNEKRRLFQCFMYIVEVDHPENNHYSLPCKFSPVFDARTKELVRMDYLPGGADHQTV
                     ETQPWVPVKAVQYAPELLDEPLRTDLKPYIVQQPQGASFSVDGNSVYWQKWRFRVGFN
                     NREGLVLHNITYDKRNVFYRLNVSEMTVPYGDPRAPYHRKQAFDVGDVGFGLNANQLS
                     LGCDCLGHIKYFDGYRSDSKGNPVLLKNIICMHEQDNGLQYKHTNYRSNAATVKRNRQ
                     LVLQMICTVANYEYIFAYIFDQAGNVELEVRATGILSTVPFDNLNGETVPWGTNVGPG
                     VMAPYHQHMFSLRIDPAIDGFNNTVYYEDSVPLPEDENNPYLVGYTTEQTVIRKSSSA
                     NTDVNRHRVFKIRNDNVINPITYKPVSYKLMAAPSQMLLLPKHAVGHQRAEFASKPIW
                     VTKYQDNELFAAGEFTNQSKKADGVETWVQRNDDTENEDVVLWHTFGLTHNPRIEDFP
                     VMPMERISVMLRPDGFFTKNPALDVPPSSQAFNKSTLHPEPAPAAACCSGVGGSKAKL
                     YKRVD"
     exon            262102..262443
                     /number=1
     exon            262501..263080
                     /number=2
     exon            263135..264043
                     /number=3
     exon            264110..264342
                     /number=4
     CDS             complement(join(264885..265094,265158..265909,
                     265984..266470,266566..266676))
                     /codon_start=1
                     /locus_tag="AO090005000104"
                     /note="cyclopropane fatty acid synthase and related
                     methyltransferases"
                     /old_locus_tag="AO070309000104"
                     /protein_id="BAE55218.1"
                     /transl_table=1
                     /translation="MAETKIHPQSPEEFEFIETPPASCTTPAEPCGVRTTSYPAIKNA
                     PVPADSPGSDSFSNILLFSLLLLIPWYLARQVGGGFYTTIFFAIFTTIPILMAFWSVA
                     SSISPRKTEKAKYAGRPVEHYLHFHSEHDRAAYRGKSKIPMEVFYEKYFNGEVDFKGD
                     ALECLEFRHDWANFRFTMGLFKHFLFGFIPEMLMHTRSQDEEQVRDHYDRGDDFYAWF
                     LGPRMIYTSGVISDPDREETLEELQDNKLAVVCEKIGLKPGDTVLDLGCGWGTLAKYA
                     SVHYGAQVTGITLGRNQTAWGNNGLRKAGIEDSQSRIMCLDYRDAPRVDGGYKKITCL
                     EMAEHVGVRHFTTFLSQVYDMLDDDGVFFLQIAGLRKSWQYEDLIWGLFMNKYIFPGA
                     DASTPLGFVVDRLEAAGFEIKAVDTIGVHYSATLWRWYRNWMGNREKVEAKYGKRWFR
                     IWEYFLASSTITSRQGGATCWQLTLVKNINSTHRIEGINTQYGLKGARQAAIDSVGHG
                     AVPSAHVTPKA"
     exon            complement(264885..265094)
                     /number=1
     exon            complement(265158..265909)
                     /number=2
     exon            complement(265984..266470)
                     /number=3
     exon            complement(266566..266676)
                     /number=4
     CDS             complement(267786..268391)
                     /codon_start=1
                     /locus_tag="AO090005000105"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000103"
                     /protein_id="BAE55219.1"
                     /transl_table=1
                     /translation="MMDDMILKQVESISFEDPSDSDQNEPCVDEAPPRRYETRRTRAM
                     SSREKHTSNIPTVRARDAAAALSGTERTLRPRPVSIPKPKPRVASSLFSSRKPRTPTN
                     PSSMHHAAAVVNSKTIVGYTKGRDVSCKLHGKPPSTTKGQTIPQGIFSADTYVRPSGT
                     PPLETDTVPLAHDADHLTANSEEVLPVYEEDEESLNFQLTL"
     exon            complement(267786..268391)
                     /number=1
     CDS             complement(join(268459..268505,268620..268865,
                     268913..269165))
                     /codon_start=1
                     /locus_tag="AO090005000106"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000102"
                     /protein_id="BAE55220.1"
                     /transl_table=1
                     /translation="MLALRDQENLVHAHQTVAASKPLNQGVKQLQPKTPGARAPKTPF
                     KVPLNDENDPLAFGKKTVKGAGKQNGAAKPSVKDAFVTPMDAIAETRQRAPLGMKTTN
                     AKARGLQTPAPPAGTVKPEKTGKRASTQRVKKFAPLVEQSKAEVQDKPAEDDVPEIEY
                     MPPKPKAEELGVGLRNGLWTY"
     exon            complement(268459..268505)
                     /number=1
     exon            complement(268620..268865)
                     /number=2
     exon            complement(268913..269165)
                     /number=3
     CDS             complement(join(270724..271200,271263..271439))
                     /codon_start=1
                     /locus_tag="AO090005000107"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000100"
                     /protein_id="BAE55221.1"
                     /transl_table=1
                     /translation="MGPQAKRRKTSKVEEITFDHSARHEFLTGFRKRKQQRIKHAQEI
                     AEQKAREMKREERKRIREEREAEFKNALVEHQKQLKRLRQEEDGASSGSDSGSDDEDN
                     EEWEGFEEPPAVDYEAEYIDEDKYTTVTVEEMDASKEGLLRSQEHSSDEEQEDEKKKA
                     TSEADSKPKPVEKTKKASDKPKKKKKKFRYESKAERQLTRKKERLSNSRKAKARKER"
     exon            complement(270724..271200)
                     /number=1
     exon            complement(271263..271439)
                     /number=2
     CDS             join(271757..271851,271924..272222,272285..272389,
                     272442..272678,272742..272881)
                     /codon_start=1
                     /locus_tag="AO090005000108"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000099"
                     /protein_id="BAE55222.1"
                     /transl_table=1
                     /translation="MHLSSFSLLALGAATANAFRDTSPFFLASTSEILSTSSQLKTAP
                     SLLDDLSSKLSSCPSDYYVIASQPGVHSTDFATRKSAPRLGAKMTGKDKTIRSTATVN
                     EVVGVLEAKQIQSIIEKECGAQTTVIDGSSGSYPSDFGADPRVLFINFPVLPLGKERA
                     QQLSDNDGLLSDIIERIPSSKKYTILYVTSPREFGESDSVIYQSETDPYQDPVHMDLK
                     RDFAAHSRRSEPASNKSLFQEYQYLTPGLFMGLMATFVFIMILYVGFSALASLEVPYA
                     AFEKDTSASVQKKQQ"
     exon            271757..271851
                     /number=1
     exon            271924..272222
                     /number=2
     exon            272285..272389
                     /number=3
     exon            272442..272678
                     /number=4
     exon            272742..272881
                     /number=5
     CDS             273707..274720
                     /codon_start=1
                     /locus_tag="AO090005000109"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000098"
                     /protein_id="BAE55223.1"
                     /transl_table=1
                     /translation="MNLRAAGLRKARRQRSFTWLLLLIAVLMLAQISLAQDTTGNDPA
                     STTDVTTKETTTATTKDDTTTTSKTTETSATDKSATTTTSESKSTDSSTTSTATNDYP
                     VVTVPPLADAPYMQTSDTPEGTVFIAVGAVLGFVGLALLAWRGMVAWSVNRSVRKAAI
                     MQSSEAKGLLRHRRKRSAHRSHGGPAPAVSLEKIGGGHRTNHRSSKGPRSNSGLFFSP
                     TAGIHSGGNRGSSYLPAGYYAAGSAAAGSGSHQSMQFSASDLPGMGPQAQGYTRTKSG
                     PSPPGTPTHAPGGVYEPQFNTSRYSHMASNSSVNLASPTQGRTPSAYLEDLFENHPPN
                     NRH"
     exon            273707..274720
                     /number=1
     CDS             complement(join(275429..275502,275563..275876,
                     275939..276621,276686..276735,276801..276885))
                     /codon_start=1
                     /locus_tag="AO090005000110"
                     /note="predicted small molecule transporter"
                     /old_locus_tag="AO070309000097"
                     /protein_id="BAE55224.1"
                     /transl_table=1
                     /translation="MGPDQHAQLDRFSLFLPFPYRVAVILVAGFWGWGVNLQYLLKKN
                     IDVPALIRYPARHSSSQRPHHVSTYHLATLLTVPLLLSLLIFWAATHGSTEKVESLDF
                     IPQSYLIIFFIILLLPFNRLARSGRHRLFVTLKRISIGGLAEAQDGKFGDILLADALT
                     SYAKVLADLVVTFCMFFTSGVSSTSKPDRKCGHDWVIPLVVAIPSIIRFRQCLIEYVR
                     VRRAGFKLENQGGQHLANALKYATALPVIYLTSKLRNYNPLESYGYSEMSLSRVLYLC
                     TFVNSAYSFYWDVTKDWDLTLLTSARRDAHHPYGLRRHRHFADRQYYLAILVDLAIRF
                     SWLSRFMPGFVWLCETEVGIWLLMFLEVARRWMWIFLRVETESVRNSRGPAPNDILLG
                     EFNGKLDAD"
     exon            complement(275429..275502)
                     /number=1
     exon            complement(275563..275876)
                     /number=2
     exon            complement(275939..276621)
                     /number=3
     exon            complement(276686..276735)
                     /number=4
     exon            complement(276801..276885)
                     /number=5
     CDS             277437..278558
                     /codon_start=1
                     /locus_tag="AO090005000111"
                     /note="predicted E3 ubiquitin ligase, integral
                     peroxisomal membrane protein"
                     /old_locus_tag="AO070309000096"
                     /protein_id="BAE55225.1"
                     /transl_table=1
                     /translation="MADEDFSLSPATSAPAPSPSAHFYPFATSPDIIRSHEKDLFLTS
                     NLVQQAQNIIRSLRGARFAHTYSETIKNLTEILYFSLTTLIGNRTLGEEYCDLVQLED
                     DTLQLPSFIRRAGYIVSSIIVPWILQRILPAFRQRLRAKLERSIARQQLKAQQAREGT
                     KPSRKETSKAPSFFTKLRIQKYILEHLDSITSLSPIYAVSIATFYFTGAYYHLSKRFW
                     GLRYVFTKKLEENEQRVGYEVLGVLLVLQIAVQSVLHVKKVGLSLQQEDLETEATHSR
                     GPDDTLIHSIENPPTLPLLPASDARYDLSEDSTAIPWIPSGQQSRCTLCLEPFKDPSV
                     TTCGHVFCWTCVRDWVREKPECPLCRQDVLLSKILPLRG"
     exon            277437..278558
                     /number=1
     CDS             join(287187..287475,287555..287972,288041..289103)
                     /codon_start=1
                     /locus_tag="AO090005000114"
                     /note="amino acid transporters"
                     /old_locus_tag="AO070309000093"
                     /protein_id="BAE55226.1"
                     /transl_table=1
                     /translation="MEKDEIEAKAEPRGAAFESPPPLYGDSEPTQAGLGRRIWDSFKR
                     DPNAHVTGGHGSSGADGKSFDIENAAQKTASSPLQRSLKGRHLQMIAIGGSIGTGLFV
                     GSGKVLATGGPASVLIAYALIGCMLYCTVHALGEMAVLFPVAGSFAHYSTRFIDPAWG
                     FAMGWNYALQWLVVLPLEIVAASITVDYWQSDISNAAWVAIFWVLIVSINLFGVRGYG
                     EAEFVFSLIKVVAVIGFIILGIVLNCGGGPQGGYIGGKYWSDPGAFHNGFKGLCSVFV
                     NAAFAFAGTELVGLAAAETANPRKSLPTAVKQVFWRICLFYIVSLTLVGLLVPWNDER
                     LLDGSSSADAKASPFVIAIKNAGISVLDSIMNVVIMIAVLSVGNSSVYGSSRTLAALA
                     EQGQAPKFLSYIDRKGRPLWAILIASALGLLSFLAASDKQEVAFEWMMAISGLSSIFT
                     WGSVCLAHIRFRRGWKAQGHSLNELAFQSQPGVIGSWIGFLFNCLVLVAQFWVGFAPI
                     GYATKTAGELVEAWFSVYLAAPVVLLFYIPYKLWFKTPFIRAKDMDLQTGRRDLDLQY
                     LIEQERAEQAEWPAWKKVYKFFC"
     exon            287187..287475
                     /number=1
     exon            287555..287972
                     /number=2
     exon            288041..289103
                     /number=3
     CDS             join(290153..290383,290444..291587,291642..291737,
                     291792..291977,292035..293041)
                     /codon_start=1
                     /locus_tag="AO090005000115"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000092"
                     /protein_id="BAE55227.1"
                     /transl_table=1
                     /translation="MSGFAASFWTPDYATGLGVLYGKLQQGVVENKQIITIASMRADA
                     EDQYGARLGDIAPTVDRLTGAGFAKDDGASVRKAYEGVRTEMVEAAKNHQKIASNIRE
                     LVVSPFRRWCDQHEARIQNSHDDLQARIKEHTKQADLVKKLRSHYFNKCRVVEDLEEE
                     NKLAFQAPEASPPVKAPPKIVLPEEAEDEEPMEIGDHVYTPEGLKQLLVHMLDNIKMG
                     DVKVPIIGTYQNTSTGADIVEYTQKHMNATSVSYAERIGQDLVDNGLLRLVGNMGSTF
                     ANSSKMRYQWRPKVFQITGIPEKKTPLLRVTSMANSEDGSESPISTVSEMLAGWNPLN
                     NAHPNETPAEKLRREAREADERYKAAVRKLDQIRCKLEEEIVENLRFMEQCELDRLKA
                     IKAVVLDFSGAISNVIPNLQSTVDHMMLYQETIQPLGDLRYLLENYRTGGFVPRVQAY
                     ENYYGSVEDQNFGVDLEARARADRKRVPVLVTTLLTYLDNRYPDLEGDEARRAIWLYD
                     VPLAATHHLRNVLNNSKVDYQEVLEKYEVPIVASVLKLYLLELPDSLVSSQVYEIVKT
                     IYSTTAHETTEEGRIKVLQSTLGQLRLNNIATLDAVMTHFTRLIDLTSADEAYISALA
                     QALSPCILRPRIESSLTMNERHSYRLIRDLFAHKDAIFGELKRQSSALGVTGSISRPR
                     AISTDESNRRAAMEARARAIMDRTRANSPAPPRKHRRDRSSGPSEAGRFPVNVSSPTE
                     RRTVTRNSLDVPSSNSSPTAQEQLSNVNINAATEAAATEATPNGTSSDSSASATANET
                     PSSGTSTPPPIAAPTAPEDSPTPTPTPAADGEKRTSIARASITRKPGLGNRSSFPVVP
                     SGESGTDSKRNSLADSEPKGVTLEDKPMDDD"
     exon            290153..290383
                     /number=1
     exon            290444..291587
                     /number=2
     exon            291642..291737
                     /number=3
     exon            291792..291977
                     /number=4
     exon            292035..293041
                     /number=5
     CDS             complement(join(293739..295645,295733..295784))
                     /codon_start=1
                     /locus_tag="AO090005000116"
                     /note="pre-initiation complex, subunit CDC6, AAA+
                     superfamily ATPase"
                     /old_locus_tag="AO070309000091"
                     /protein_id="BAE55228.1"
                     /transl_table=1
                     /translation="MTASVLGKRQRNTLEVGVPVLPVRSASRRRTQPPRILQAENAPS
                     APTTRQLRSKTRGDSAFQKENDDKSKDVINTNGGVKDEEPEHGVPSPTKAHSRIRTSK
                     SQNGGLSTRNYADPQPVPTDENTTSVEFKTPSKSRFRDALDSPPITPRHRVQVGGISL
                     TPRTPRQTSTPQATQTTQTIYTQARQLFARGANSGRLIGREAEREKLASFIQDGLESQ
                     QGGCLYVSGPPGTGKSALVKEACDELDLGSVKVTHVNCASMRSARDVYSKLIEDLCDD
                     QQIFKKSEAERLKAMFTSNKKQDEMFLVSLDEIDHLLTADAGILQSLFEWSLQGKSKL
                     MLIGIANALDLTDRALPQLKAKNLKPRLLPFLPYNAGQIANVVTERLRSLLSPGQCDD
                     PKFIPFVQPAAITLCSKKVASQTGDLRKAFELIKRAIDLIEQETLQKLEKQNENPESP
                     SKTILVENNNLSSPRPKQNLTSAYTTLTAPRASIAHVARITSATFGQGTVQRLQGINL
                     QQKAAICALIALDRKRREGEFPGTPSKTKHSAPTIKQIFDTYCTLCRKDNILHPLTAT
                     EFRDVLSNLETLGLVGEYQGKGRGGTVAGGSNIRRSPSKSMSGPMTPSRAMDEQGLVC
                     FVSQKEIETQLSGPGEGILRRLLMGQGL"
     exon            complement(293739..295645)
                     /number=1
     exon            complement(295733..295784)
                     /number=2
     CDS             join(296517..297012,297075..298165)
                     /codon_start=1
                     /locus_tag="AO090005000117"
                     /note="predicted ubiquitin regulatory protein, contains
                     UAS and UBX domains"
                     /old_locus_tag="AO070309000090"
                     /protein_id="BAE55229.1"
                     /transl_table=1
                     /translation="MNDDVVAQFTEITGSSPELAIQYLHLADYNIEQAMQLYFENGGA
                     PLTDEPIPSTSDAPGARPTAGDSGAVHVGSDDEVTVDEARSTPRHQGPQSSTYEDDEA
                     MARRLQEEMYGGGGGGGAAVEDDGVRAPMARTTETLVGPDADFDDGDMHTSILGQLRA
                     RQQRNNRPGIFNQRDTSSIWTGEDEASRRQRLSEATGGASDASNKSNMLAEMYRPPFE
                     IMSRLPWDQARQEGRENERWLLVNIQDPSIFDCQLLNRDLWKDAGIRDTVKEHFLFLQ
                     YSKDDPRAAPYLQYYFQASDVSDNYPHIAIVDPRTGEQMKVWSGPPVVKAADFLMQLH
                     EFLDRYSLNHNVRNPVAKRKPEKKEKSIDAMTEEEMMELAMRNSLGGDPSQPQKLEDP
                     DDLTRSVEDVKGKGRAADTEDINMDEADQGGKGEVETSPFASIPDDKPHTEPPSDPAT
                     TTRIQFRHPSGRVIRRFALKDPVRRIYEWLKADPPLPDKAGVEFELNSLGHNLLDSLD
                     TSVEDAGLKNGTVMIGYVEE"
     exon            296517..297012
                     /number=1
     exon            297075..298165
                     /number=2
     CDS             complement(join(300796..300952,301004..301173,
                     301239..301850,301925..302416,303578..303628))
                     /codon_start=1
                     /locus_tag="AO090005000118"
                     /note="cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies"
                     /old_locus_tag="AO070309000089"
                     /protein_id="BAE55230.1"
                     /transl_table=1
                     /translation="MFPCCLVPTISTSQPVEVSIAAIASWSYNVFFHPLSNYPGPRLA
                     AATRLWYAWHCAKGSLPFAIHKLHLRYGDVVRVAPDELSYIHPDGWNEIYGHRPGQSE
                     IPKDPSFYSSALSSPEGIFRAPRDRHGYIRRQMSHGFSEKSMREQEDTIRHYADLMIS
                     YLSTQANGPKENVVDFTRWYNYFTFDVMGQLVFGESFNCLQSSGFHPWVSIIFDSIRY
                     NVFVRCTQFWPWLSPVIRRFIPKSFQRRKIEQQALSREKANYRKTIHDGRNDLVANLL
                     KPDSGVTDLEYQSTVQTLIVAGSETTASLLCGVTFHLLNNPEKLEKAVKEVRSEFDSA
                     DKISFVSVNKLHYLLACLNEALRVYPPVADGFPRRTGSNVEVINGQPVPPNTAIRMTH
                     WATYRSPRNFVRPNEYLPERWLGNAPGFEKDHKNALQPFHVGPRNCIGRNLAYMEMRL
                     LLALVLWNFDLELYPASKLWDKQRVYNLWEKPELKVKVLPRKI"
     exon            complement(300796..300952)
                     /number=1
     exon            complement(301004..301173)
                     /number=2
     exon            complement(301239..301850)
                     /number=3
     exon            complement(301925..302416)
                     /number=4
     exon            complement(303578..303628)
                     /number=5
     CDS             complement(join(304920..305260,305624..305660))
                     /codon_start=1
                     /locus_tag="AO090005000119"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000088"
                     /protein_id="BAE55231.1"
                     /transl_table=1
                     /translation="MIDIRFHDSTAICNTIVNYAINKTSEPVIGFLLRNDDNCVTKVT
                     AYVGRYEPTGVDILYGIELTYKDGKRSIRVGTRGESSKSLSLGHGEKISHMVIRATDR
                     VDGLEVKTNRDQHSTVGGRWRTS"
     exon            complement(304920..305260)
                     /number=1
     exon            complement(305624..305660)
                     /number=2
     CDS             join(307959..308010,308074..308104,308174..308490,
                     308547..310171)
                     /codon_start=1
                     /locus_tag="AO090005000120"
                     /note="serine/threonine protein kinase"
                     /old_locus_tag="AO070309000087"
                     /protein_id="BAE55232.1"
                     /transl_table=1
                     /translation="MEGLVDPESIYMKQNCIGGGSFGRVYKGVDKRTGASVAIKIIDV
                     ENAEDEVEDIIQEIAILSELNSPYVTRYHGSFLKGSSLWIVMEFCSGGSCSDLMRPGT
                     IPEDYIMIILRELLRGLDYLHSDKKLHRDIKAANILLTSSGQVKLADFGVSGQLSATM
                     TKKNTFVGTPFWMAPEVIKQSGYDYKADIWSLGITAIELANGEPPYSDIHPMKVLFLI
                     PKNPPPTLQGNYSKAFKNFVELCLRRDPRERPSARELLEHPFIKRAKKTNYLTELIER
                     YERWHAVYGNKNADEEDEPAYEPPPKPTNAEDEDDLWDFGTVRPAGRGPGLKPMKEAD
                     MNTRGHESSEWETKDRPPREPVENNSYTPQRPTQTKHIPTAASKPSSPTKVPLPPSPL
                     KQGPAEVKPRTPTHLQRPNSQQLRESPGSEYDKALQQSLAQDISFLHIDPTPESPSPS
                     VKNRNSVPVPQESRKANLPRPSGVPSHQERISAQPLRRPSDQSPRPAVESRPHHQVFQ
                     QHPRPPPTPRHASPQPQRLPQTPMQPPGLGSSFGPLHRGIDPNLQPSVGIPPSNEITA
                     LNSVILPALKAAVRRRSRRLELLSRNPSAENGHTRMETYELQSNREYVQQMMESLVND
                     LGGIFTRIERWDSEAPVGMGADVSSFLEGFLEEVLVRIEPADEESPTPSN"
     exon            307959..308010
                     /number=1
     exon            308074..308104
                     /number=2
     exon            308174..308490
                     /number=3
     exon            308547..310171
                     /number=4
     CDS             complement(join(311149..311914,311975..313346,
                     313435..313551,313643..313670,313760..313981))
                     /codon_start=1
                     /locus_tag="AO090005000121"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000086"
                     /protein_id="BAE55233.1"
                     /transl_table=1
                     /translation="MPNAAAPAVSAQQTPPITRPFGDQDRDQSADESWSAVDSDNDLV
                     TQNGNASRSLKRKRPLTVSYVPPPSGLEHELCKQRKVKCDRAQPSCGWCSRNGQSCEY
                     KERKKPGLRAGYGKELEQRLDRLEEVIQTQARLIETHILQSQPRSNHEFPHPGPHSYS
                     SPSEPSAAHGPSPRNAAYFHEPSSVPAHPRPSDASITSPSDISVRNVMHSHLTSGLNP
                     PIPIPQVSDTTHASDYTGNESSLKVPVNLFSNQEQSFADPELDLPPYDLLYALVDLYF
                     DHINSWCPILHRRTTLDTFFGPSPLEEADRMVLYAIVATTLRFSSDSRLNEQNRKRYH
                     DSSKQKVLLYGLENSSVRALQALVILALDLVGSSNGPPGWKLLALITRSVVQLGLAVE
                     SKSSLIAPVYPSIYTLRAVTLPDSESWIEDEGRRRLFWMVYFLDRYSTLATAFDFTLD
                     DKDIDRKLPCKDEFFMKNQPVETRWFHHSGDRADYLKRAENVGSFGLYVEILGIMSRI
                     HTFLKRPVDIGALSDVEEWQATYRKLDGELAAWEFGLPAEYAYENSSRLFNGSKSNKG
                     LPCDWVQLHATYQTAVIRLHSSAAYPTTRSPIFTPSYSASQRCLFAVENILSVTRFVV
                     DNNMLDKLGPPFAFTLWVSARLLLVHGSTIAHTVSPDIIFFVDTLAQMGTYWKVAERY
                     STILQRVLDEYGEYQQSGVEDSERVTPSSVKILADMRRCAFDLDFLISRQPRSSPAGS
                     QPTVPTPAAHPRNLAPNELEYLDVFGFFNVPRVPAARAPDITDLDINETVNNPMSING
                     LTGSVVDGAAPNANEFNITNYLIPTPETDWLFRSEG"
     exon            complement(311149..311914)
                     /number=1
     exon            complement(311975..313346)
                     /number=2
     exon            complement(313435..313551)
                     /number=3
     exon            complement(313643..313670)
                     /number=4
     exon            complement(313760..313981)
                     /number=5
     CDS             join(314602..314688,314764..314986,315058..316028)
                     /codon_start=1
                     /locus_tag="AO090005000122"
                     /note="L-alanine-DL-glutamate epimerase and related
                     enzymes of enolase superfamily"
                     /old_locus_tag="AO070309000085"
                     /protein_id="BAE55234.1"
                     /transl_table=1
                     /translation="MGSISEFPRIKEIRTFIIDGVGSGGDYHNVKGGHWLIDSDISTP
                     MTKWAQYRGSRTSWGINVLGSFCVEIEATDGTKGFATGFGGPPACWLVHQHFERFLIG
                     ADPRDVNDLFEKMYRASMFYGRKGLPVAVISVIDLALWDLQGKIRNEPVYKLIGGATR
                     TRLNFYCTGPQPASAKAMGFIGAKVALPHGPDEGTEGLLKNVAYLRKQRESVGPNFPL
                     RVDCYMSLNVPYTIQLVKKCEAEGIDIDWWEECLSPDDFDGHALLKKAHPTVKFTTGE
                     HEYSRYGFRKLVEGRNLDIIQPDVMWVGGLTELLKVSALAAAYDIPVVPHASGPYSYH
                     YVVSQPNTPFQEYLANSADGHTVEPVFGNLFLNEPIPTKGYLDVSILDKPGFGLELNP
                     AAPLIPASALLTPAPQKSLPPPTDNENGANGAAH"
     exon            314602..314688
                     /number=1
     exon            314764..314986
                     /number=2
     exon            315058..316028
                     /number=3
     CDS             join(316575..316643,316717..316982,317118..317535,
                     319084..319086)
                     /codon_start=1
                     /locus_tag="AO090005000123"
                     /note="dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /old_locus_tag="AO070309000084"
                     /protein_id="BAE55235.1"
                     /transl_table=1
                     /translation="MPLPQLLVGKVAAITGGLTGIGRAIALEYLRHGAKVAINHLGGP
                     KEEPLLEALQKDVSEITGANANSFITVPGDVTQPDTGRDFVAKTVAAFGRLDIFVSNA
                     GVCKFAEFLEVDPPLLGHTINTNLSGAFYATQAAGRQMALEQSPPGGSIIGISSISAL
                     VGGGQQTHYTPTKAGVLSLMQSCAVALGKYNIRCNALLPGTIRTQLNDEDMSDPVKRE
                     YMEGRIPLGRLGQPPDLAGPAVFLACEELSSYV"
     exon            316575..316643
                     /number=1
     exon            316717..316982
                     /number=2
     exon            317118..317535
                     /number=3
     exon            319084..319086
                     /number=4
     CDS             join(319775..319899,319972..320020,320078..320234,
                     320288..321057)
                     /codon_start=1
                     /locus_tag="AO090005000125"
                     /note="alcohol dehydrogenase, class V"
                     /old_locus_tag="AO070309000082"
                     /protein_id="BAE55236.1"
                     /transl_table=1
                     /translation="MATSEIPQKQKAVVYDQPGTVSTKVVELDVPEPGAGEVLINLSH
                     SGVCHSDYSVMTNSWSWLPHPTQPGQVGGHEGVGKIVKLGSGTESSGLKVGDRVGIKW
                     LSSACTNCQPCQAGAEGLCVNQKVSGYYTPGTFQQYVLGPAHYVTPIPDGLESDAAAP
                     MLCAGLTVYAALKRSNARPGQWVVISGAGGGLGHIAVQLASKGMGLRVIGVDHGSKEE
                     LVKESGAEHFIDLTKFPMDDNGKAISDHVKSLAGGLGAHAVIVCTSSNAAYAQSVQFL
                     RFNGTMVCVGLPENNPQPIASALPVTLIGKHCYITGSAVGNRREAIEVLDFAARGIVK
                     THFRTEKMDKLTDVFEEMREGKLQGRVVLDLS"
     exon            319775..319899
                     /number=1
     exon            319972..320020
                     /number=2
     exon            320078..320234
                     /number=3
     exon            320288..321057
                     /number=4
     tRNA            complement(322825..322896)
                     /locus_tag="AO090005t00003"
                     /note="tRNAscan-SE"
                     /product="tRNA-Arg"
     CDS             complement(323584..325017)
                     /codon_start=1
                     /locus_tag="AO090005000126"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000081"
                     /protein_id="BAE55237.1"
                     /transl_table=1
                     /translation="MSAPTRQFRGLSIDDKMPQRPTQPEGTPHPDDDSALMETGSDES
                     EVGGELPEFSTLQGKSGITYDLTKLDPESEARALVGLTSRFDVIGCRRTKTGFDFQFS
                     ERPQVHIGSGGYTCTCSTFMGLPGIACPHVFVSSSTIYRNRQSLLTSEKWLVDQLHGC
                     LIPQIPDYDVPLSSDGHPPVFTRIERLLDDKLETVAEQLSWQYVRSEVEGGMSRPQKV
                     RDLMSAFDTAVLPEDFRLDLIDDDGQSRTPEQCVVQGDFEATMFRLAVHDDMVYFSLC
                     KAMPPGACAAIYFDKVQEKSRKLLADFDRYCQTGQRPEGSNADVNSVIGELQHNVNRI
                     QANIATRAPHGFEGAAKALVTLLEDICNRNKDALDGNHWGGVTFGGEDEDQRNLYHQL
                     IGKTEETGECFILDALEQLAGSDLHQFKERLRAILQKNEVNRAPKAYILKLNALVRRA
                     ESNSAGSGQKRPATASSGGHGQSKRTR"
     exon            complement(323584..325017)
                     /number=1
     CDS             complement(join(326749..330081,330136..330515,
                     330604..330631))
                     /codon_start=1
                     /locus_tag="AO090005000127"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000080"
                     /protein_id="BAE55238.1"
                     /transl_table=1
                     /translation="MCCWSKSATVSSTSRTTAHSYIILDMYGSHPQSSSSGQQNSGPP
                     VPEWRVPSTAQQRPSRKPTPGPTPPPPPPPPPHPPLSASSYNPSTYGSISGPAPGSGA
                     SASPAPGSAGMDTSAWGVKYNRQQYPIYAPPPLPPRPPSTPAHSSSAQSPIVSPLDNK
                     PLQVNPTYGPPTSAAEYQPQWTTNAPHVSQAPVVSPLSPPPPPPVPPGYQSSIPQQGS
                     QPSQQLSPPPYSVLPSGESHSSQNSSAQQHASLSSSNASSPQPTLSGQVPLTAANPVP
                     CGAGLPVTAPPVPPKTSHNALPTNTAVLGSGGPSDWEHLTPTPGDVDDVEAFGVKHGN
                     GTHSSATSEPTPRYPAPIPTATSGSQTVISTPPADVSPISQPVHTQDTTAAQPFLSSS
                     SATQGIQDPPRPIRTDTSGSTYSTASTTGTSESIDGVIEAWNRPVTTDLQPSITQAGQ
                     SISSRTDSPTPMQKLSPLEIPKVKQDSSVPRKEVQSGPNTPPSSNTPNETSAKVDALS
                     PQLKPLDPYEDLDPWSKSSLERYVAMLRKEAVADSDMERFKIFTAFMSKETKLREILY
                     NIEHEPKNEEAPSQKPTPASEESSQKSGKASPPVESGLIPVESEEGNESADASEDLED
                     GKYSPGGRPIIPRVETPSTLGLQRPASQPPGKGHSLGHQNQSQPLRATSVPPSMLDKQ
                     ELSPLTTNPPQPIYTPFRYTEGPQRGSDHLVIDRPAYQAYSALRQASAESGRVMSNAP
                     HSGFQEDSHSTAPLAGNDDETFIGLIREKSVAYRKASRRKSSPPPPLPMSLRKGRPSG
                     PVDDLRSMVSSPLAKQSESSWHITTRKNLEKYSTDFDYIKEAVKSWETANKSRREKVD
                     KQRMHRQEESEKRIDALFNGREIGYADINVLEEEFRQTEARAQLDEERQELDDYIAKV
                     FNPLDERLQKEISALQTQYDSALGQLDHENNKIKNSVTDKYNLSHTMKTVNGIYQKLE
                     ARYQKRLEIALDREHRRKKTERRPLVFMGDSVALKQLDREFDEMEKRNILEAAKDRDE
                     RANRLMDSFDDAIMHGLGENQSLLDDVSAKLSKIDAATIRSSNLPDSEIEHILRSVYN
                     LVDSLRQDSESILHNFGIADSALNDADYGVSVAEARYSNADDDVFGRLEDDKKKEDAK
                     IQADLKSKLDSVRAAPADITATINNLLKSLGKAPITKPNRPSESAPVGHPIDVLFPGP
                     RPTASAGPKKTDEDQEHQERLRKALENAKKRNAARNTPQPPN"
     exon            complement(326749..330081)
                     /number=1
     exon            complement(330136..330515)
                     /number=2
     exon            complement(330604..330631)
                     /number=3
     CDS             complement(join(331094..331965,332022..332655))
                     /codon_start=1
                     /locus_tag="AO090005000128"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000079"
                     /protein_id="BAE55239.1"
                     /transl_table=1
                     /translation="MVSSFCWGCLTRLRPTPRAVLPPTVAAPRAAAFHTSTVRYALPT
                     KKKNSLDGPPKYRQAKSARMKKKKPVERARPPPVGERKALRKRIVLSNPNALEVEGMQ
                     DFTSETMVDARLRGSILGLPVPMLTQLRAVEAFKPKQGWSIFRRPGTVVRRETLELGR
                     LIDSISNEGQDKGRSVKKIVTGVRGSGKTVHLLQAMAMAFTKQWVVFTVPEPQDLVIA
                     HTGYAPLSDETPNLYVQNEATATLLSRTVVANEQVLKTLHVSREHAALKSSVKAGMTL
                     EELAKLGIQDPAIAWTVFQALWAELTATSAASGFDKNFKPRPPMLVTVDGLAHWMKNS
                     EYRSVEFEPIHAHDLVFVRHFLGLLKPGTGKPALPNGGLLLYSTSASNNPTIYSFEVA
                     LKQIAARQAGLNASAPEFPQADPYSGADKRVIDAFDSSKPTVAKEGMLELQTLGGLTR
                     DEARGFMEYFARSGLLREKINDEWVGEKWSLAGGGVIGELEKLGRRLRVTD"
     exon            complement(331094..331965)
                     /number=1
     exon            complement(332022..332655)
                     /number=2
     CDS             join(333025..333086,333165..333765)
                     /codon_start=1
                     /locus_tag="AO090005000129"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000078"
                     /protein_id="BAE55240.1"
                     /transl_table=1
                     /translation="MSETATTTAASAASKSKPERLPITVSKPTPYTFDLGHLLANDPN
                     PLEISRSEPVNVSLKATARDGVQSLLNQLLTTCPITSSQQGVLLTLPAPTTVLPRHKP
                     LPTPKPPTKWELFARKKGIGRFSGKAGAGLAEKERRKKLVYDEEKGEWVPRWGYKGKN
                     KSDEDWLVEVNEKDWKKEEEAAAKGSSIRGMSRAERKERIRRNERKMRNNERKSRKSG
                     GG"
     exon            333025..333086
                     /number=1
     exon            333165..333765
                     /number=2
     CDS             complement(join(334818..334858,335059..335449))
                     /codon_start=1
                     /locus_tag="AO090005000130"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000077"
                     /protein_id="BAE55241.1"
                     /transl_table=1
                     /translation="MFKAWLRELPDELFPKETQAMIAEKCEGATTAPQMLKDELSKLP
                     PYHYYLLFAITCHLNLLHSYVDQNKMSYPNLCICFQPCMKIDAFCFNFLVCDWKNCWQ
                     GCWTEKEYLEIEKGMDEKERLAHTKQDTDMRTPQSKTTVQF"
     exon            complement(334818..334858)
                     /number=1
     exon            complement(335059..335449)
                     /number=2
     CDS             complement(join(335707..336362,336418..336946))
                     /codon_start=1
                     /locus_tag="AO090005000131"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000076"
                     /protein_id="BAE55242.1"
                     /transl_table=1
                     /translation="MPSRQSCIPNLDLSPSTLQISAKTTSPHTPGASSDGPSPLTPRS
                     PKSSSSSTFFKGTTIRSVTQESNSKANSPILPVSPGLTAESPTQGVTAIPQYPPSPRD
                     SPKHSRDPSRSFFANLKAPKVSHRAQRSDSSGNSGDKPRSRGSSRDRRTQISSKLYES
                     TPDLPGAIERAAQQENNSPSSDDRHTQQAEIKRVGTESESGHTLKKSKPRFANLLSRS
                     RSIRLDDSSVNRIAHRRPSTSLMRLEESAKREAQTPPKAAEVKPTGNPHVRSHTIDRL
                     TDVNSGSIRKDRYGGSMVPSASLSQVSGASAALFNNIKQSSSGAADRIGKAGKGFFGK
                     ITRSGSTNERELINDDNYVCSVINLPLIEQARRTRIAKRLEDCKDKTEFWMPALPYRC
                     IE"
     exon            complement(335707..336362)
                     /number=1
     exon            complement(336418..336946)
                     /number=2
     CDS             join(340685..340768,340826..341563,341613..341737,
                     341791..341833)
                     /codon_start=1
                     /locus_tag="AO090005000132"
                     /note="protein geranylgeranyltransferase type II, beta
                     subunit"
                     /old_locus_tag="AO070309000075"
                     /protein_id="BAE55243.1"
                     /transl_table=1
                     /translation="MSPVSGAGQSDQYLCVQKHVEYIKNLDSRRDELEYWLTEHLRLN
                     GVYWGLTALHLLGCPQALPREDTINFVLSCQRENGGFGAAPGHDAHMLYTVSAVQILV
                     MLDAVGELEKRGLGGKQKVGSFIAGLQDEKTGSFMGDEWGELDTRFLYGAFNALSLLG
                     LLDTVDVPKAVAYIQECENLDGGYGIHPGAESHSGQVFTCVGALAIAGRLDLINKDRL
                     GGWLSERQVDNGGFNGRPEKLEDACYSWWVGASLAMIDKLHWINGDKLAAFILRCQDP
                     ENGGFGDRPGNMVDVFHTHFALAGLSLLGYDGVEEVDPVYCMPKAITTKCLSK"
     exon            340685..340768
                     /number=1
     exon            340826..341563
                     /number=2
     exon            341613..341737
                     /number=3
     exon            341791..341833
                     /number=4
     CDS             342595..344403
                     /codon_start=1
                     /locus_tag="AO090005000133"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000074"
                     /protein_id="BAE55244.1"
                     /transl_table=1
                     /translation="MQLHFCATYAPKKPKFSDVSHLLTHVSSKAHLSHYFKLQVRSHQ
                     EPQAVILLDEYDRWYKANNLAKLLSDRLASKDARRKRIQGKAAPHDKRCPVKEDHGYK
                     SPPVPVRSPHDNALPDYLDPRLVTSGVNMEHDTSDRGTPVSADCVAAVASPKLGMHAN
                     AESSHLLHPTSGAQIPTEAAAYQWKQERVFSPDDEGASVLECTPSWSKTLGHTAQMAS
                     QLLNRHLSYDTFVDDAESEVDKERVDEIARLKGVLWPGMDIFDSATEQMRRKRNQKKD
                     ESALRMMEKTSMGVEPTELIFSPTGILRKQRVISGNVEECSPLKGETPIPRRRSTRSK
                     RALSQTDANLQRGRDRKRKKKAVKRVPITAGQDFDHGDSNFTRPTSTEVPTYGGNQVV
                     HGESADDFALTFNGHEPRARHGLKIFCDTPNENIPDQHCGDGLQHGLVAPSDALFLQQ
                     EAMATRTPNSVLSSNYISEFAERLCRFTTDKENIEPLLDAHGRIDPLVGWHSPVIKRH
                     LASDTGYPPQFLFGDSQRIELNMFDGHDSHVGYSYNPLAASFPKLSAEENPIYTMDTS
                     NGLSFQGATRVTSPEATISDIEEDDFERLYLDGSSS"
     exon            342595..344403
                     /number=1
     CDS             join(345368..346124,346189..347288,347341..348819)
                     /codon_start=1
                     /locus_tag="AO090005000134"
                     /note="mismatch repair MSH3"
                     /old_locus_tag="AO070309000073"
                     /protein_id="BAE55245.1"
                     /transl_table=1
                     /translation="MPLSSQPSSSNLKRKQPTISSFFTKKPQLSQESISNDVLEKEER
                     DEEREEVAKQEEGLRENGGTRSNNVDDDEDDVVAPASKRARTNGSHSQNTIETPKEKH
                     VERPLPSDSIQKTELSKFASSPATEGETKERTKERERLHQKFVRRLGGPDCLIGIGRN
                     TAPEAVPEEVGEGDEDDEPSPPPAAKGKATAKKGARKLTPMEKQVIDIKRKHMDTVLV
                     VEVGYKFRFFGEDARTAAKELNIVCIPGKFRFDEHPSEAHLDRFASASIPVHRLHVHV
                     KRLVSAGHKVGVVRQMETAALKAAGDNRNAPFGRKLTNLYTKGTYIDDMEGLEGSTAS
                     MSATGTSMATGYMLCITETNTKGWGNDEKVLVGIVAVQPATGDIVYDEFEDGFMRSEI
                     ETRLLHLAPCEVLIVGDLSKATEKLVQHLSGNKTNAFGDEIRVERAPKAKTAAAESHS
                     HVSSFYAERMKKVNATNDVQASSLLQKVLNLSEQATICLSSMIKHMSEYGLEHVFQLT
                     KYFQHFSSRSHMLLNANTLNSLEIYHNQTDHSTKGSLFWTLDRTQTRFGQRMLRKWVG
                     RPLLNKLGLEERVDAVEELKNLERVALVEQMKCLLGRIKTDLEKSLIRVYYGKCTRPE
                     LLTLLQTLQMIAQEFAGVQSPADTGFSSPLISKAVASLPTILEDVVRFLDKINMHAAK
                     NDDKYEFFRESEETDEITEHKLGIGAVEHDLEEHRSTAGEILGKRKVDYVTVAGIEYL
                     IAVENKSPSIKKVPASWVKISGTKAVSRFHTPEVIRLLRQRDQHKEALAAGCDKAYAT
                     FLAEISASYQSFRDSVQSLATLDCLISLATIANQPGYVKPEYTNHTCIQVDQGRHPMV
                     EQLLLDSYVPNDIDLDSDKTRALLVTGPNMGGKSSYVRQVALIAIMGQIGSYVPARSA
                     KLGMLDAVFTRMGAFDNMLAGESTFMVELSETADILKQATPRSLVILDELGRGTSTHD
                     GVAIAQAVLDYMIRSIRSLTLFITHYQHLSSMVHSFPDHELRNVHMRFTESGPTEEEI
                     TFLYEVREGVAHRSYGLNVARLANLPAPLIELAKQKSAELEQKIHRRRLAGLVRTVGD
                     ILADSAKADESLIERLISSAEQL"
     exon            345368..346124
                     /number=1
     exon            346189..347288
                     /number=2
     exon            347341..348819
                     /number=3
     CDS             join(349626..349642,349848..350380,350439..350576,
                     350643..350878)
                     /codon_start=1
                     /locus_tag="AO090005000135"
                     /note="ATP phosphoribosyltransferase"
                     /old_locus_tag="AO070309000072"
                     /protein_id="BAE55246.1"
                     /transl_table=1
                     /translation="MDLVNQVHELQLTRISLKTEGRLQQATLDLLAGVDIQFRRETRL
                     DIALVKNLPIALIFLPAADIPTFVGEGRVDLGITGRDQVAEHDAQLANGETSGVEEIM
                     DLGFGGCKLQVQVPEKGDITEAKQLVGRNVVTSFTALTEAFFAKLEGVDDTSKLSTKI
                     KYVGGSVEAACALGVADGIVDLVESGETMKAAGLKAIDTVVESTSVLVKSRNAQNPLV
                     ELITSRIRGVITAQKYVLCQYNIPRSELSTASSITPGKRAPTVTALEEDGWVAVSSMV
                     EKKKIATVMDELTKVGATDILVLNIANSRTG"
     exon            349626..349642
                     /number=1
     exon            349848..350380
                     /number=2
     exon            350439..350576
                     /number=3
     exon            350643..350878
                     /number=4
     CDS             complement(join(351404..354005,355983..356095))
                     /codon_start=1
                     /locus_tag="AO090005000136"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000071"
                     /protein_id="BAE55247.1"
                     /transl_table=1
                     /translation="MASDARTGPASRTAGPHESDMGNKLDPRVDSDVDNRAHLPPSSL
                     ILPSNMAVPAAPPASHDPVNAAGEPSQALSRPLIAGNTSSDSDEPVVNGVDVAREDEA
                     AGMVGVSISRAQSRMKARSTPAEEKTRAMEHNGGYFDPIPDTDDSSGLYTSEITDEPE
                     QLPQTSKPETSQPSASSQSVAHQSGTAFSKDGANSRTSFTRSILKNGLPLRPRAWSGD
                     AMKKFLPDLGYLTKRTSLPFRSSQNRSRSQTLKPSSSKMALDQEGESHAKPRRRSWND
                     SDSNNGLVDEPISDLKPLDGATAAKHSFTRRPSATVSGAPLMLRRSSSDQSLYLRASS
                     TASSLDQRPQYEHIHSQVNSRFKAIKDSLQDSSSRLLSMPSLHLQDLRSDWGYKPFLG
                     DVTNRKGNNYADELPPTSDAPREQAPPPRSPRANSNTWHPVLNEAMSELTGDVVIMGG
                     YRGSVLRSAKPPQRQLWVPMKVGLNLRKVDLEVGLNPEDEERMEETIIPSGVLSHVGP
                     VDICRRLMKHLRKSENAVKGDLRVWDYGYDWRLSPHLLSKKLIKFLEGLPCNAPGVPR
                     EKRGAWVVAHSLGGLITRHAVNQRPELFAGVLYAGVPQHCVNILGPLRNGDDVLLSSR
                     VLTAQVNFTFRTSFALLPEDGHCFIDKRTKEEYRVDFFNVQAWDEYRLSPVINPALPP
                     MTNRAFGLGGNFGKRFSAVLGSKDSLPSEDTPDDEQQDPNQPGRSNPNPITDPAEKLA
                     PSIEGVVGPTSNLRGSSNVKSTTTVTIPRATAITYLERTLAEVRRFKQELAFNPSHQS
                     SNSYPPFAVLYGKSVPTVYGARISTREQIKHQDAYDDLAFAAGDGVCLASAAMLPPGY
                     RIIRHGLVKSDRGHVGLLGDLEGVGQCLRALVRGRREGVGINNSPLST"
     exon            complement(351404..354005)
                     /number=1
     exon            complement(355983..356095)
                     /number=2
     CDS             join(357527..358351,358431..358655)
                     /codon_start=1
                     /locus_tag="AO090005000137"
                     /note="putative NADP-dependent oxidoreductases"
                     /old_locus_tag="AO070309000070"
                     /protein_id="BAE55248.1"
                     /transl_table=1
                     /translation="MPITNRQAIYANTPSPAIDPSLSNGTFKISTTTISDNVPDDKVL
                     VRVHYLSLDPAMRQWLTAKRSYIAPVERGSVMRGQSIAQVIGVGSNLKTQYKAGDWVI
                     AYSGWQEYALLGQKEAQKVVIPPGCRPTDAMSVLGMTGLTAYFGMTEVGQPKPGDTVV
                     VSGAAGATGMVAGQIAKIKGAKRVVGLAGSAEKCAFLRNELGFDAAINYKDKDWKKQL
                     KDATPEYIDVFFDNTGGEILDACLARAARDARFAICGAISQYNSAKPQGPASFMTVIG
                     FIVFDYAKKYPIALKDLSEWLTQGKIKRKEHIVPGGLEAAPQGLVDLYGGVNTGKMMV
                     EVAPVSEAIGAKAKL"
     exon            357527..358351
                     /number=1
     exon            358431..358655
                     /number=2
     CDS             join(359369..359432,359493..360319)
                     /codon_start=1
                     /locus_tag="AO090005000138"
                     /note="dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /old_locus_tag="AO070309000069"
                     /protein_id="BAE55249.1"
                     /transl_table=1
                     /translation="MEAKASNENFKLENLFNVKGKVALITGGGSGIGLMATQALAVNG
                     AKVYITGRTGEKLDRVAELYNKNIQGEIIPITSDITDKSSVDKLVQEISSREKYLSIL
                     INNAGISSSTQTTEKEDPKELRKELFESSALDPKEWDDVYRTNVTQLFMTTTAFLPLL
                     QKGSEQEKGWSSTVINISSISGIVKVSQHHFAYNASKAAAIHLTKMLAHEVASSGLRI
                     RVNNIAPGVFPSEMTAGESDEKQKSEIPKEKYEGKVPAARPGKDEDMANAVLFSTTNQ
                     YLNGQTIVVDGGYVLAAGTV"
     exon            359369..359432
                     /number=1
     exon            359493..360319
                     /number=2
     CDS             complement(join(360489..360620,360639..361670))
                     /codon_start=1
                     /locus_tag="AO090005000139"
                     /note="checkpoint kinase and related serine/threonine
                     protein kinases"
                     /old_locus_tag="AO070309000068"
                     /protein_id="BAE55250.1"
                     /transl_table=1
                     /translation="MSQLQNSYGTCTTHRHQLKLKFPEHKSSLKLLSALTFPNVLARC
                     WLPRESTDDEERQTLLTPSSTAPSTLTERYGLSTIILHYGVHSSVRVCTRKSPSAGAS
                     RQLHVVKILRRSSDALVRATQRFEQSLSSAVSHPNLLQTIDVLQNEHGETCLVMDYCA
                     GGNLNALIATAEDSIDALQADCFFKQIMRAVTYLHDNAIAHRGLKTENILLTAHGAVK
                     VADFGSAEWLLDEVADGEHAENRIRLQLSSLYSPRKLRGSIPYLPPEEFSNYATVDPR
                     AGDVWAAGLVYMAMRCGRLLWRMPCADEDGGYSAYLRGRQTYDGYPPIEALEEVRFSS
                     GFQGLGESLFTRCRNVIYAMLHPDPVRRIKASEVLRSEWVYYVQVCDAGEIGW"
     exon            complement(360489..360620)
                     /number=1
     exon            complement(360639..361670)
                     /number=2
     CDS             join(363785..363887,364086..367081)
                     /codon_start=1
                     /locus_tag="AO090005000141"
                     /note="Na+/K+ ATPase, alpha subunit"
                     /old_locus_tag="AO070309000066"
                     /protein_id="BAE55251.1"
                     /transl_table=1
                     /translation="MADSPSSSDPPEKDLETGEQRLGRPERRTTIKFDERQEKEKHPD
                     QDYFESLDFHILSTDRLSQQLNVDCRYGLSSSAAAQRLQRDGKNVIAHHRENYLKKVL
                     GYVFGGFCSVLWIGVIIFFICWKPLSNPPSVPSLAMAILVIIVIVLQASFSAFQDWST
                     KHVMNSILNLLPSEALVLRDGKQTRVPSTDLVVGDIVYIGIGNKVPADMRLFQSSGDV
                     RFDRAVLTGESDEIDGAIDATDNNFLETRNIAFMGTSVTNGNAVGMVVLTGSRSVMGR
                     IAKMTAGVKEKPTLIQKEITRFVTIIIGLTITLVLIILFTWVGWLRVDHYSFMNVVAM
                     LNNVMGCVVAFIPEGMPVGVALTLMMVAKRMKKANILPKGLATVETLGCVNVICSDKT
                     GTLTQNKMSVRSLGLLDMSLDVKQLPNIQRNDMSESLKSLLRGSLLCNDAFFDPATVA
                     LPVNERGVTGNATDAAVLRFAESIMPDGRNQLSTFERIHQVPFNSKNKWMLTIHRDPT
                     DTDGYLVFVKGAPDVLLPKCTSYLSGIDSTVKILDETAKGLFSNFQAELSRRAERVIV
                     ICQRRFTPRASIGSNDFNDEVLAECVQGLTVTGIFGIIDPPRLETAETVSACRRAGVR
                     FFMVTGDFGLTAAAIARDIGIFSGTAEPDTVDDLKPFTDGEIGEKQSLHSRHSLLVDG
                     KHISTLNDWQWDTICKYEEIVFARTTPEQKYRIVEELKSRDNVVAVTGDGVNDAPALR
                     AADIGIAVVSGSDVAIEAADLVLLDRFDSIAQAIRLGRLVFQNLQKLIAYLLPAGSWS
                     EIWPVLMNVFFGVPLPLSSFLMIIICVFTDLFCSLSLIMEKEEYDLLSVPPRNHKKDH
                     LINLKIYGQSYLFVGVMEAFCAHSMFFLYMYKKAGIPFHALIFAFERYSDGFYGYTQD
                     ELTNFNNVGQGVYFVSLVMLQWGNILSVRNKRMSILQADPVRKQRRNPWLPLSMAISL
                     VIAIFVTEVPGFHRLFNTAPVPIEFWFIPLALALGILLMDELRKLLVRQFPKSIIAKI
                     AW"
     exon            363785..363887
                     /number=1
     exon            364086..367081
                     /number=2
     CDS             complement(join(367890..368492,368546..369000,
                     369066..370269))
                     /codon_start=1
                     /locus_tag="AO090005000142"
                     /note="uncharacterized conserved protein, contains TBC
                     domain"
                     /old_locus_tag="AO070309000065"
                     /protein_id="BAE55252.1"
                     /transl_table=1
                     /translation="MTTVCTTPNSPPELSGSKSSKSSSFRSSSQLDGPDGIFTDISNF
                     EDIGLEDDADLAYNNAVASPYGRPGLPRSSTARMQSKTPMITTRELTTTSQQTKGLHK
                     PPAQVNGMLSLQTRSVSRSKSGNKRDPGSTKSPSKTPNSQRARSTSPLRPASHLGSSP
                     STHSLSLSPANARPTLNRKQSWQPNRKTLKELEEEYHDSDEELPEDASLWNVPISPRP
                     LEDRSASRSTSPNGRSPGPRPLPLSHSVKDVSLPGVRSPSGSRPARPAVRSSSAGPER
                     GQISPRNPRVYSYNSMMSDLSEEAKIITEALEHHADQRERKRGENLQSGLSSLRSSEE
                     SKRGSRGTIELPPLQKSNIMIDPLPISKEKEKVLTRTRPSWLPPKDQKEEKKHLKEYK
                     RMMAQSREADKRRAAKAASAKCEKDNTRETLQRIWDDYVYPNWENAIGETRTRELWWR
                     GIPARSRGTTWQRAIGNELSLSEETYKKALQRAKDVRSRADGDAGESNKRMREWFEAI
                     EADASKAFPDLKLFQVGGPLRESLIDVLEAYSMYRSDVGYITGLHTIAALLVLQFPSP
                     SSAFLAMANALNRSLPVAFLTLDRGAIGRTYTLTTATLRYKFPRLATHLTETLQLSDE
                     EIWEPMFRSLLTNGLDLERISRVWDCWVFEGDRIMIRAAVAVLGCLQAQLFGFTKPDD
                     ESRATVREILGWGPRSAGAKPKERHSAPVTLAGGFGGQFSSAGVGDYWILTTAGDEDG
                     FMSEVREAGKVRH"
     exon            complement(367890..368492)
                     /number=1
     exon            complement(368546..369000)
                     /number=2
     exon            complement(369066..370269)
                     /number=3
     CDS             complement(join(371852..373789,373848..374066))
                     /codon_start=1
                     /locus_tag="AO090005000143"
                     /note="telomerase catalytic subunit/reverse transcriptase
                     TERT"
                     /old_locus_tag="AO070309000064"
                     /protein_id="BAE55253.1"
                     /transl_table=1
                     /translation="MKPKLSLTDYATPASSVSAFCRAVLRSLIPPQFYGIGQHKLNNQ
                     HVVFKHVDRFVRMRRFESLSIHEICKGIKITCIPWLEPPAVHDQNSPKNKVSLSDLQK
                     RTEILHEIIYYIFDSILIPLVRANFYVTESQTHRNRLFYFQHDVWRHLTEQPLADLKL
                     STFEELKSDKAERMLGRRSLPYGTLRLLPKSTGIRPILNLRRRMLVNNKWAGSKGRFF
                     GQSVNSTITPIYGILNYEKMRKQDDLGSCLFSVGDIHLRLKAFKERLLLHYHEAGSLP
                     VFYFVKLDIQSCFDTIPQDKLVRLIEDLVSEEAYHFTRHVEMRPPDEFGSMWPMREAR
                     QSKAFRKFVARAAPAARPQHLTEAINNGGTTNRRNTVFVDTTGQKEYDTEDLLDLLHE
                     HVRNNLVKLGRKYFRQRNGIPQGSVLSSILCNLFYAEMEREVLAFLQSDETLLLRLVD
                     DFLLVTSNPDLAKRFLEVMIKGQPAYGVSVNPAKSLVNFAAAVDGTHIPRLVDTSLFP
                     YCGSLIDTRTLEIHKDHDRILEGGDSAAETLANSLTVESARVPGRTLHRKLLTSFKLL
                     MHPMYLDTNHNSLTVVLSTLYANYLTTAMKMYQYMRSLRGRAHPSSEVIIRIVRDTTQ
                     LAHRLVQGKRCWGQRDATMESSSPSVCTVQHSQVQYLAAAAFRFVLSRKQTRYTLALR
                     WLELVLKGSRPRSDAKAKRLAQVVQKGNLMYGSWRF"
     exon            complement(371852..373789)
                     /number=1
     exon            complement(373848..374066)
                     /number=2
     CDS             join(376830..376994,377052..377095,377138..379571)
                     /codon_start=1
                     /locus_tag="AO090005000144"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000063"
                     /protein_id="BAE55254.1"
                     /transl_table=1
                     /translation="MASPFTSPRSAPGTRPLNRNLYQCGTCSQSFSRVDHLSRHVRSR
                     KLPFAILGCRISAAKGLGGCEIYLPKDLLNRHSSLHNTDGDGPVSKKRRRNGCNTTMI
                     ARASQACTACAEDHLRCDEEKPCKRCQRRNIQCKVPPKQIDELSTSPTIPEMQNAGGD
                     PSSLSNPTSKPDITNDQLYQMSASPPAEIPAADIWSQVPSHHAPTDPEIDVSASLTKA
                     YPDLITPDSVDMLTAGLSMDSLSGVRTPRGLITFGLETDLDLSMVDLSFLESYNFRIP
                     FQIDEHETPPSFSGSALGDCAAGTSYSTPNDRSMQRLRWHFVPEPQDHGYAEHNNLLL
                     PTHADQNSTPRNFIDMDSYCNAESLDLASRDKILSIFLSQMKHPISQATLSFPSVELL
                     DILIRYCLTSPRSNAKSWIHLATFTPKQTRPELLLAMAAMGAVLTPDPSLQKLGFAMQ
                     EVVRHQLPVVFESDNTMINNLELLQAYMLCLETGLWSGNNRKMEICESSRLPLITILR
                     RRGLFHHSAYPPVLISPEDASDNLDSKWRSWVRQESFKRLVYNLLRHDAQLSMVLFTN
                     PLLSYGEISLSIPCSRDLWTPSSAQKWKELYCGRFAMGTTRIPTLLECIANLDLLECS
                     KAVADTTLSCLSILCAMWGMVWEYRQFSILLAAQSRYWDNGILMVSRYQELVKMLKYF
                     HMGYKNESKLHLNLILMHMHMSLEDVQILATLEDPKKTSGFPPSINSWSQSKECRQAL
                     WHAGQVIRELKALPSQCLRDFMAVALYHASLTLWAYGMAISHATEDNAVSRPDSMGMN
                     MENIVWLDGDDTEGVHRYIALERGIPALHGAQPHIASASLAEPGAILELVLQIMHRNH
                     YGEREPPLVENLVHLIEKLRDVSK"
     exon            376830..376994
                     /number=1
     exon            377052..377095
                     /number=2
     exon            377138..379571
                     /number=3
     CDS             complement(join(379693..379758,379983..380090,
                     380151..380642))
                     /codon_start=1
                     /locus_tag="AO090005000145"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000062"
                     /protein_id="BAE55255.1"
                     /transl_table=1
                     /translation="MSPKVALITGASRGVGAAVARALAADGDTSIVLNYGSNPEPAQS
                     LIQELNSLRDNNTRSTEKPRFQALKANMADRADIRRLVSQTVQEMGRLDIVVSNVGWT
                     RMTDFANLEEADNEADWDRCFNMNVKSHFFLFQECRKYLEKTQGAFIATASVAGVKPS
                     GSSLPYAVTKAALIHLAKSLAAIAAPNIRVNTVSPGVLLTFLANSKSITGMNVVIDAG
                     FSL"
     exon            complement(379693..379758)
                     /number=1
     exon            complement(379983..380090)
                     /number=2
     exon            complement(380151..380642)
                     /number=3
     CDS             join(381961..382278,382334..382380,382443..383142,
                     383207..383488)
                     /codon_start=1
                     /locus_tag="AO090005000146"
                     /note="histidinol dehydrogenase"
                     /old_locus_tag="AO070309000061"
                     /protein_id="BAE55256.1"
                     /transl_table=1
                     /translation="MPARHLKSRSDNVAVSTTPQIDVSSVVKGVIDDVRQNGDAAVRK
                     YSEKFDKWSPASFKLSQADIDAAIAACPQQTIDDIKEVQKNVRAFAQAQRESLKDFEY
                     EIQPGVVLGQKNLPINSVGAYIPGGRYPLLASAHMTILTAKVAGVPHVVGCTPPIAGK
                     VPHATIAAMHLAGADEIYLLGGVQAIAAMAVGTGTMKKVDFIAGPGNAFVAEGKRQLF
                     GEVGIDLFAGPTEILIVTDDTADPFTVATDILSQAEHGPDSPAVVITTSERVGRKAIE
                     IINELLKHLSTGDVASVSWERFGEVIVVDTIDEAWKLADEYASEHVQIFTKRPRDALD
                     NMTAYGALFLGEKTCVSYGDKVIGTNHVLPTKKAARYTGGLWVGKYLRTVTYQEVESS
                     KASGELGRLCGRAARAENFEGHARSGDLRAQKYLDDQYDWIKLYHDENPKAYRGNL"
     exon            381961..382278
                     /number=1
     exon            382334..382380
                     /number=2
     exon            382443..383142
                     /number=3
     exon            383207..383488
                     /number=4
     CDS             join(383945..384076,384144..384269,384332..384406,
                     384459..385302,385366..386303)
                     /codon_start=1
                     /locus_tag="AO090005000147"
                     /note="2-polyprenyl-6-methoxyphenol hydroxylase and
                     related FAD-dependent oxidoreductases"
                     /old_locus_tag="AO070309000060"
                     /protein_id="BAE55257.1"
                     /transl_table=1
                     /translation="MTQLNGTSVTPNSRSESCPLKVLVVGAGIGGLTAAIALRKQGHD
                     IFEQSRLATETGAALHLAPNANGILRRLGICAEEFGANTFERLTEYTASGKVERSMEL
                     SEGHKLWQHKWLLAHRIDLYNKLKSVATNAEDGRPAIPLRTSSRVVSVDAEAAHITLE
                     NGAHYEGDVILGADGVHSITRRAVPGGDIKPFCSGKSAFRFLVSKQAALDDPVTAPLV
                     KHPGELCMWYGTDRRIVMYPTSNNSVLNFVVIHPEAESADQAADGWDQSGNLDKMLQI
                     FSSFDPTILKLLAKADPESVKVWKLLDMESIPTWHFGRLALLGDAAHPFLPHQGQGAG
                     IAIEDAASLAVILPQGTPVEEIPERLQLYHEIRYERASQVQEYSRILGEDRTDGKELD
                     MYGFVNFNCGHDEWDNSTQKLREWTWKRIPNPYWRMPIAFGPMPGPRQTHLGVPRDGT
                     KSTFTTASIKFKTSRTVLQNLFPPGRRGWRFTSPGTVAYASFAKTTLNKMEWLGGSGY
                     SHIGLYIHGVEYVKKDGSSVKGTYLPILFESLTDPIVSGREELGMPKLYTSIDVYRRA
                     TSYRIRTGWQGALWGNFLLEDLVEVDPSSESGGLSGEADAGMLAYKYIPKSGRANKNV
                     PAEEHAVWDPFSEATPKPSPKRVYTTKKASFQIDALDWEQLPTLHHIISRLAEVPVYE
                     VVGAKLVEGEGVPDVSGARPIE"
     exon            383945..384076
                     /number=1
     exon            384144..384269
                     /number=2
     exon            384332..384406
                     /number=3
     exon            384459..385302
                     /number=4
     exon            385366..386303
                     /number=5
     CDS             complement(join(387140..387395,387462..387970))
                     /codon_start=1
                     /locus_tag="AO090005000148"
                     /note="dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /old_locus_tag="AO070309000059"
                     /protein_id="BAE55258.1"
                     /transl_table=1
                     /translation="MDGKSLADKVAIVSGSSSGIGAAIIRELSSRGANTVVNYPFAHL
                     KNEADSLVASLPSLSIAVEADMSLATSPQKLVDAAVSKWGRIDIVVNCVALAVNKPFE
                     SQTLEDWDLLVNTNGRSTFLLTQASLPHLTKGRGRIVNIVSISGRGPPPNQTIYAGTK
                     GMVDSFTKCWAKELPPKYGCTVNAVSPGPTKTEGFSAAGEEQMKILQPIIDQTPVGPR
                     MAEPEEIAFAVAFLCEERARWINGAHIVASGGLFID"
     exon            complement(387140..387395)
                     /number=1
     exon            complement(387462..387970)
                     /number=2
     CDS             complement(join(388473..389296,389352..389475,
                     389533..389936,391448..391682))
                     /codon_start=1
                     /locus_tag="AO090005000149"
                     /note="FAD/FMN-containing dehydrogenases"
                     /old_locus_tag="AO070309000058"
                     /protein_id="BAE55259.1"
                     /transl_table=1
                     /translation="MVGAIQCRLLFIPTPYSTSAAGAHTPPIAMDGRRISGCRMPSLR
                     RVSQSATQSDTWPPKVMPIKDPIKPAIKQSPDCHADGNTYEDARVGRVFNHRRPQRYP
                     LAVVKASSQDDIVAAVKLAIENNCRVAIRSGGHSWAAWSVRDNSILIDLGNYKHLEVD
                     AKRRIAWATPSMTGKDINGVLTKEHGLMFPGGHCPDVGIGGFLLQGGMGWNCRNWGWA
                     CERVRALDVVTANGDLVHCNSQQNSDLYWAARGAGPGFPGVVTRFHLDLVPYPKNGFR
                     SSGFVYPIKHYHEAFRWVISITPDFDNDTEIAAVAQYPEGQDEICLFILFVTMKSSVE
                     EAEKALAPAQETRPSGVIVEWFCQEDSLENQYINQAKANPERHRYCADNAYIHDDADV
                     PAVLEEAFTTLPHKKSFALWFGMNPCSRRKLPDMALSMQSDHYFALYTVWEDEKDDPR
                     CQTWVQDIMRKVERHSVGAYLGDSDFQVRKTRFWEDDNAQRLMEIRRKWDPTGRICGY
                     LDKGDVSGTQGLTNAHEWKL"
     exon            complement(388473..389296)
                     /number=1
     exon            complement(389352..389475)
                     /number=2
     exon            complement(389533..389936)
                     /number=3
     exon            complement(391448..391682)
                     /number=4
     CDS             complement(join(392689..393355,393404..393423,
                     393471..393536,393748..393804))
                     /codon_start=1
                     /locus_tag="AO090005000150"
                     /note="sentrin-specific cysteine protease (Ulp1 family)"
                     /old_locus_tag="AO070309000057"
                     /protein_id="BAE55260.1"
                     /transl_table=1
                     /translation="MLDGGLGKLHKRMKRFGDTTLHLTVTREDMQSLKNDWLTDNIIS
                     FWEEYLEREFLVNYKSSNIVLLRPSMSFMILQTPNPHTLREALPDFTRTTHVFLPIND
                     CRNVTEAEGGTHWSLLLISIVDGIAFHYDSLPPGNVREAGTVTMKFGALLNRPIRFIH
                     LQDSPVQENGSDCGVFVCLSMRHLLLKRLLTANASEKVSMSLGGMKVDARGGRKEMTK
                     IIDGFRKEGERRRSYVAEQVHRRDYANLSLNRASLSPLGKKSASPGPPRIE"
     exon            complement(392689..393355)
                     /number=1
     exon            complement(393404..393423)
                     /number=2
     exon            complement(393471..393536)
                     /number=3
     exon            complement(393748..393804)
                     /number=4
     CDS             complement(394962..396068)
                     /codon_start=1
                     /locus_tag="AO090005000151"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000056"
                     /protein_id="BAE55261.1"
                     /transl_table=1
                     /translation="MKKRDKRLMDYARFKSIKERGDKPDKKTTEQGEQFVALNEALKD
                     ELPKLYSLTAKLMEACLKSFVHIQTSWFKTLQDKLCPLVDSFPDDIQKVIGDWNANFS
                     FSEAQVLSLGICNGSLLADAVNLVNFNTPPTGANISSPRCPSTVNSASTRVGSTMDES
                     PKASHDFGSGSHAFQSPSLDSQSQISLGRKRADSTFSGRAPPDSIELPRSQMLQQITG
                     SSSASVLQPSSNRESCPSLPRLSLDSPFLVDVIGPSESSDKPTEEQPSSPGRYSGFFS
                     SAMPMSDNPQDNPPQENEAPKEPAVLFLAASIYEFNIDRARREAGYPYLTYVVGEIFD
                     VIAEKGELWLAKNQDDPTHQVGWIWNKHFAKLST"
     exon            complement(394962..396068)
                     /number=1
     CDS             complement(396154..400770)
                     /codon_start=1
                     /locus_tag="AO090005000152"
                     /note="invasion-inducing protein TIAM1/CDC24 and related
                     RhoGEF GTPases"
                     /old_locus_tag="AO070309000055"
                     /protein_id="BAE55262.1"
                     /transl_table=1
                     /translation="MSGSDVEHVSCFLNGNSRELRRQSSPTTNDYFYDAPTEDSFETS
                     LTASCSAAPPFASTTYSAQQGLTDSPILPATAGLSSNDRSSPDPDDYYRPHPHTLVAI
                     GNTAAGSGESLMVEVDNAEVTEDHPTQFQRVCSVPAHPSKSVESSGPFRSLSDSSYGN
                     IGFGSTIRVPPARASTARSRQVSFKDLVNKFNNNQDQVLPLPSTSTSRTVSPASPTDG
                     SIQSKAASRLQQTHHSSIKKAPIPRWNTIGTFDPDIASERSLPRLRTSDIKDNGPSSS
                     NLSQRPPFGQLLALDTGFDNLGYGTPSLPRRRGSEGTIPSPNPAFLDHPESALGLTPL
                     TPTAWYLGRTPFLEAVHTTSSTPNHRRTRSDFAGDRPGGVAVCLSDTHMAVQPPLQPQ
                     PGTSLESPHSKSRIPISSRRLNSASASGDSSPSSPTRTELAFGNRSAQQIALPPKGVS
                     RLPKPSPKQASNPARELTYEGEATFATPPHARREVAPGRARQYIPEKGTLLEAYIAAP
                     PPKKSPPLRSSRPRQPVSQTAQTAPRSKVVETVSNFQRQINCDREPRNSRLRERRLPE
                     LGNVDFATRRQRIQQAFNRTVEENERKEEKAAELRRQVKAQEDTQQPVQPTTPKQQFT
                     GLADVITSAQPEDNVAVIEELGECGHETKDMTPETEASKAHQQLHVDTDVSLTENSRN
                     TTDYHPMTMDSPTLGHSGIILNSQGYESTPCDLQPDSAVTTGSNETHTTAFDPEPQDE
                     LSKQNLHASHRTLLSQIMRIRDSSPSSSSCDEQDYGFSDNDEKESIPIVLRDALAIED
                     SIDSSENQEHRDLYIKQGATDTDPMNRWSMSSWSSSLHHGNSSGGQCEGSDDDLSNIQ
                     HCVEDSEEATTKSCSASSSIPSVIGHPLSHALSQTASEVTEPSKEVISHTLPYGSSNT
                     PSLIRLGGWDSKRVSQLYIEELASGRNHPLPMPAIRASPEPPHSRIEQRDEGRNDSLT
                     DDPVLITETDRIQPSERMRHPASLFLRDDWEHASPSIMDWMQIAVDEGSAHQDPTIDN
                     SRRNNGVPTSQLVTPNAHPKGADEGLGLAINVHPPQEFDNDDVPPPPIPRHDPPAPPS
                     DTQESTVHPPPQIPVVHPNIFSNAIFAPLGPVQSTDSSEDSSLRRLEPTPSSQTVDSS
                     ATSLVPSTSEHPRPRTASPTPEQRQLKKRRHVIKELVDTEYTFGRDMKVVDDIYKGTS
                     SSCLDLSTEDVKVLFANSDQVVQFSMAFQDTLKEAAKSVYIMPKSQRWTSRRNARNPI
                     TKTDQESSTETSTSDLEKDNATFIGQAFIAHIANMEKVYADYLKNHDAANKKLQTLQK
                     NPKVAIWLKECRDWASDLTTAWDLDSLLVKPVQRILKYPLLLSELLESTPQDHPDRAA
                     LINALEEVTNISVRINELKKRADVVGQVVGRKRKESDVRAGLSKAFGRRTEKLKQQVG
                     ISDLVEDKEYDALSQRFGDNFFQLQVVMRDAEGYTREVQGSIDCLGEITSAIEEFIKV
                     APTAYHEIEGKCDELRAVVQGVLTEALPNHVSTIHCGSIGIQHD"
     exon            complement(396154..400770)
                     /number=1
     CDS             join(409833..410776,410963..410987)
                     /codon_start=1
                     /locus_tag="AO090005000154"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000053"
                     /protein_id="BAE55263.1"
                     /transl_table=1
                     /translation="MARLCIPGFPFRRDDRPITRWRTPAFLSFPRTVHYRANPPVSPR
                     SFLPVSSKPGVHSFSTSSTSSTGNRSFSQMSQGSHLPVRSVRAPSTPSTTAPAPTGVV
                     DALKALTSRLAERRAARQARHRPWAQPSSTSRKPSPGHPSTAHRKPAPTKSAIRKPTK
                     PVTPAPNMANRAQRAIAQIDLALAKLASASRKAKPVKRVRFGETTVIPVSRWINRSEH
                     SFIFPSWFGHLQGWRVVALSEPNDDGETEKYISTWGSDQFDMLQTHTHSRIPCGREGC
                     AWEAMRRIKRQRPGWTSQMLIKGFNDYREKMRQRGKFYLCWCNVLL"
     exon            409833..410776
                     /number=1
     exon            410963..410987
                     /number=2
     CDS             complement(join(415733..416038,416090..417363,
                     418113..418128))
                     /codon_start=1
                     /locus_tag="AO090005000156"
                     /note="cyclin"
                     /old_locus_tag="AO070309000051"
                     /protein_id="BAE55264.1"
                     /transl_table=1
                     /translation="MTTLKVLLNHPRSDHIDSSYTMLGGAITPSESVYRPSSHQTSHP
                     SSHLDTGSSRSTSTNTTPTSSTAPPSTSAAASARLHSHSSHDVPAYINRSSHTPSQPS
                     TRESSATPGSTYTQPPSMSSTHVPYADSSTYPAFHRSQHVSTNQAAAAPITGSHRESH
                     SSPASPRLKPTHQSLRSLGGSEANSPSRIKVRDLSHIQSFASEEFLAQSQRDQVPGQW
                     SQERQYEISSMPVTDIIEMVAGLLTKITTTNDTHHEQIHRHIPPPDGTASLSPQATSV
                     LAFHGKNVPSISILSYLTRIHKYCPTTYEVFLSLLVYFDRMTELVNKGQLERLQRRWG
                     HIQPDSASRPGSQESAVKPAHGSPMVTPPSSAGMRAQDPTSPSSISPSLHPQEEDDYF
                     SQFFVVDSFNIHRLVIAGVTCASKFFSDVFYTNSRYAKVGGLPLVELNHLELQFLLLN
                     DFRLSIPVEELEAYGTMLVEFYAREIVAQQQQQQQIASQTGVPRAFGSSTGTDPQSDA
                     MYMRSYEKRRPDQPEIRQTPTPP"
     exon            complement(415733..416038)
                     /number=1
     exon            complement(416090..417363)
                     /number=2
     exon            complement(418113..418128)
                     /number=3
     CDS             complement(join(418979..419303,419359..419634,
                     419772..419817,419882..419918))
                     /codon_start=1
                     /locus_tag="AO090005000157"
                     /note="20S proteasome, regulatory subunit beta type
                     PSMB6/PSMB9/PRE3"
                     /old_locus_tag="AO070309000050"
                     /protein_id="BAE55265.1"
                     /transl_table=1
                     /translation="MVGHGASGMLGEDGIHVDMNHLKSGEVNMAINFKDGVILGADSR
                     TTTGAYIANRVTDKLTQVHDTIWCCRSGSAADTQAVADIVSYHLNMYSITNNEAPSTQ
                     VAASLFQELCYENKDMLSAGIIIAGYDPRHGGQVYSIPLGGSLHKQPYSIGGSGSTYI
                     YGYCDANWKENMTEEEGINFVRGALREAIKWDGSSGGVIRLVVLTAKGAQRHLYLPDT
                     DYTGPGFTN"
     exon            complement(418979..419303)
                     /number=1
     exon            complement(419359..419634)
                     /number=2
     exon            complement(419772..419817)
                     /number=3
     exon            complement(419882..419918)
                     /number=4
     CDS             join(420438..420577,420662..421174,421229..421354,
                     421414..421570)
                     /codon_start=1
                     /locus_tag="AO090005000158"
                     /note="predicted alpha/beta hydrolase BEM46"
                     /old_locus_tag="AO070309000049"
                     /protein_id="BAE55266.1"
                     /transl_table=1
                     /translation="MSESPPPPPSWSITNMANSAAQYLRLPVLASSGLAVVASGLLYF
                     KQNELIYPRNVPTDARTFVPKPRQFGVNNYEELQIPTPDGESLHALFLRPSKKGLAGD
                     ITVLMFHGNAGNIGHRIPIARVLLDILGCNVLMLEYRGYGLSTGVPDEAGLKIDAQTG
                     LDYIRQRAETSNNKVIVYGQSLGGAVAINLVAENQDKGDIGGLILENTFLSIRKLIPT
                     VFPPARYLARFCHQYWTSEEVLPKITKVPILFLSGLKDEIVPPSNMTQLFAICQSERK
                     VWRTLPNGAHNDSVAEPGYFEHIHSFIKEEVIDQD"
     exon            420438..420577
                     /number=1
     exon            420662..421174
                     /number=2
     exon            421229..421354
                     /number=3
     exon            421414..421570
                     /number=4
     CDS             complement(join(422498..423341,423409..423587))
                     /codon_start=1
                     /locus_tag="AO090005000159"
                     /note="mitochondrial F1-ATPase assembly protein"
                     /old_locus_tag="AO070309000048"
                     /protein_id="BAE55267.1"
                     /transl_table=1
                     /translation="MAFLRPSTFQSLIRNTRTPFLRVQQRRWAQVHDVRFLATHHDPK
                     LVLDRYRYKLDQKAQQEGHGSVESLKDAYKEKIDDFRRKASTIVTPEPSKPTPSPSTS
                     ATHPPPPPPSPQANAASEASGKSSTGIKPLSSFIDVEKVLDLPPKEIEAIWRLRHASN
                     PHSVCAVIPVETYQRIASAARQNPQFVLPLPRTQPEAEQPEQQGDKAAGAGAEIHFLQ
                     WAFHPAAPTVTSGPLATSHTSTVIFTQLAAYQLHGSYAQPHTTITHHLDLADEKGLVL
                     MHGQIMPNSGITSTDATWLVSCVQRFYDFGGQASGRKGELLRSFTKGDTNVFKLEALL
                     EEAEKL"
     exon            complement(422498..423341)
                     /number=1
     exon            complement(423409..423587)
                     /number=2
     CDS             complement(join(424858..424914,425005..425363,
                     425426..425493,425553..425692,425742..426017))
                     /codon_start=1
                     /locus_tag="AO090005000160"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000047"
                     /protein_id="BAE55268.1"
                     /transl_table=1
                     /translation="MQTPEKLVNLQKVALSKSLVKATVNQIPGTRCKPNSRLPFYGDP
                     GEDFDPSLLYPHLQHTEVPHDSLCGWFYCPRPRDRRLFRRDIPMFPCTAFYRYVSPPN
                     ILTDVLILVMPLPFVWKLHTRMTQKLALTGVFLLGGLGTVASILRMTIFFQENALTDP
                     TWASVNLGIWTVLEAGIIIISACLPSIWPLIVRILPRKLVSKHSSKTRGHRYTASNVK
                     AKIGDGFSRLGENVTGETDKWPLDVNPLHESPLVSIHGQGLVKGDSISLQSLNGTRQE
                     PRYSWLRYSYPSSWMVEAELEVL"
     exon            complement(424858..424914)
                     /number=1
     exon            complement(425005..425363)
                     /number=2
     exon            complement(425426..425493)
                     /number=3
     exon            complement(425553..425692)
                     /number=4
     exon            complement(425742..426017)
                     /number=5
     CDS             join(426657..426839,427336..427468,427651..427774,
                     427842..428293,428397..428710)
                     /codon_start=1
                     /locus_tag="AO090005000161"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000046"
                     /protein_id="BAE55269.1"
                     /transl_table=1
                     /translation="MVVAWEIGTAINVHPSLKDPAPRLRHFSRGKFRSRTHAPLSGPW
                     SAHIVPSKEISSLLPGNNPVLLTAIRMGVQLGVFQMIRDHQGEGATTEQIASQSGASL
                     IVVDQILRLLTAAGYVSEAGVQTYKPSPLTMAMADGTLEAMTRACFDIGNYCSTYAPE
                     YFRQNNNQFPTSAEDTPFQLAKKTPLSYFEWLGENPSLAKDFQQWMTLKQQATPNWVD
                     WFDVRGNLLHGFRNRPDDVLLVDVGGGEGHYLHAFNDKYPDAPGRRILQDLPQVISTI
                     NKTPKDTELMAHDFFTVQPVKGARAYYMHWILHDWRDEQAHSILSHIVDAMEPGYSKL
                     IINDQIIPDRDCDFATACISIMMMLQVGAFERTEKQWRALLTSVGLKDVSFYQPPGNG
                     EGIIVATKA"
     exon            426657..426839
                     /number=1
     exon            427336..427468
                     /number=2
     exon            427651..427774
                     /number=3
     exon            427842..428293
                     /number=4
     exon            428397..428710
                     /number=5
     CDS             join(429811..430022,430088..430216,430270..430603)
                     /codon_start=1
                     /locus_tag="AO090005000162"
                     /note="mitochondrial sulfhydryl oxidase involved in the
                     biogenesis of cytosolic Fe/S proteins"
                     /old_locus_tag="AO070309000045"
                     /protein_id="BAE55270.1"
                     /transl_table=1
                     /translation="MANRHITRRILLGAAVSIFLLFVFFVRPQGPPSPAIRAPGHLEK
                     ASHSTLTKDDMVKGEVVMPKLGNETAKAELGRATWKYFHTMLARYPEDPTEEQQETLR
                     SFIYLFARLYPCGECASHFQGHLKKYPPQVSSRNAASGWGCFIHNEVNTMLKKPIFDC
                     NKIGDFYDCGCAKDEDTEDENEELKSRSHVDSKESDDIATSQRFEVSKEPWVFPLASP
                     HISLSR"
     exon            429811..430022
                     /number=1
     exon            430088..430216
                     /number=2
     exon            430270..430603
                     /number=3
     CDS             432884..434257
                     /codon_start=1
                     /locus_tag="AO090005000164"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000043"
                     /protein_id="BAE55271.1"
                     /transl_table=1
                     /translation="MTEAQKYEGALYKPKQTKNQRNQKGKNDHQQNSKPTANGHRAPY
                     VEDAPESDKSKENVSALPTAPTPPVTSGTPQRNDPKQVNVFDFLVAENASKVSLAQPK
                     EQMQMVDHAPSVFEASKALTNYETGGEDEDKKYDLPYEENGYSYGSGPIPPSAYPSKA
                     ANASMEFMTPAPKKKKDRSRKTEAGAVTSEKKRKRHNEDQEIEDADTPMMEAPSSVVN
                     HPGTPMLNHSGLTGGLSRMLRSPSLEAENDHADHPRRRYQDPSSPIKRTRRDDKDGSD
                     AGLGISMKNRAGRFVSSMFGGPAESKRGSSDDGDARPKKSNRGASDSQKSKRKSSAQD
                     GRPSQRLKQIEYANGSRTESPRGDDGRQVVIYGQPNIPSDLQRQMAAHFLSLVTKGPE
                     SQRGFSVNKVLKRFHRDFTDEFDDDRGREQGRSRADHEQRGEDEKDLWRTLRIKRNDR
                     GEIVLFM"
     exon            432884..434257
                     /number=1
     CDS             join(435096..435876,436747..438518)
                     /codon_start=1
                     /locus_tag="AO090005000165"
                     /note="transcription factor NF-X1, contains NFX-type
                     Zn2+-binding and R3H domains"
                     /old_locus_tag="AO070309000042"
                     /protein_id="BAE55272.1"
                     /transl_table=1
                     /translation="MSDAPAPVAEGSASRPRPSRRGGRGRGNRNHRRPQTQATERSHD
                     AQAAQPPTQQSSQLQPTQNSPSDLPADAPRSRRGPRRGRGGGRGDGAPSEGSSRRQRQ
                     RGGDRGTTSTGRRFEGRLTKPEQAPEGEQVDTAVDANDLGLRADAPAFVPGTQSEPVA
                     NEPTPSTTSAPTKKKPKAKNAPPPPPKVTTKSVAPDIATRIHEDIAHNLYECPICTAE
                     LGRRSRVWNCGLCWTVFHLSCVKKWSKNEGAAAQDSARRQGEGTLEHPQCFRVCKAGL
                     HCGRHACAERCCPGEQKAVERQALRRKLKSHLRPSDEDVEAEHICTRVCGRMLKCGRH
                     TCPELCHKGPCNTCREAIFEEISCNCGRSVLYPPLPCGTQPPPCSAPCERPKSCGHPQ
                     TPHNCHTDEEECPKCPYLTEKMCLCGKQILKNVPCWLADARCGRICGETLKCGSHTCQ
                     KNCHRPGDCEDTLKPCQQPCGKTKTMCGHPCTEPCHAPYPCPEKTPCSSMITVTCGCG
                     RLRQERRCNAAKAVASKGQLQQPQRLPAVTPLTCDDECARLERNRSLASALGVDINPS
                     TTVAQNATASLPYSSETLDMYIQLSSSAPLSTLQSYESTLHSLAANPTQRSVRFQPAK
                     SSLRAFVHSLATDWGFASESFDPEPHRHVFVLKPTVWNPPLLGMGNGTAIGIGGMSVS
                     ECVKLRERQRQKEREAQRLAAAEAKAQREAVKAQANATNEGGWAQVAASRRSNASTRS
                     TTPNPGTTSRSGSMFAALAGDDGSTWGAPKKEKLVLRSGVGAGKQLRTPQPAAEVVDS
                     WEEEEEKQEQEERAREQEQGQEQDDGQGDVQQGTSELETAQTGEAIATSSVV"
     exon            435096..435876
                     /number=1
     exon            436747..438518
                     /number=2
     CDS             join(442328..442599,442669..443282,443339..444276)
                     /codon_start=1
                     /locus_tag="AO090005000166"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070309000041"
                     /protein_id="BAE55273.1"
                     /transl_table=1
                     /translation="MGVLEKFTGGTPAAETGDTEAHRPKNAAEASGNQILAIETDSSR
                     LSLEARNEKEAQEHPDQVTRDALLGQQKAEAAALVWSKKAVRFTYGWIWVCFFMMALQ
                     SALSSTVMLAAYADFQQAPQVATSNILYSIIGGVLKLPIARMLNIWGRAEGLLVFIGV
                     YTLGLIILAACNGPDSFAAGNVLFWVGYNSVYLILDVFIADTSGLKNRAFAFAFVSTP
                     FICTAFTAPLAGQSFVRHSGWRWGYGVFAIVVPVTLCPLAVVFKYYERKAIKMGVFKR
                     EPSGRSLVQSIVHYFHEFDVIGALLLMAAWILLLLPFSLATYGRAQYKSAAFIAEIVV
                     GFCLLFVFAAWEKWFTRSHFVSYELLKKRTVLGACGMAALAFFSFYCWDQYFMNFCIV
                     VYNLSESMGGYMAQIYNVGSTFWGVGFGLWVKFTKHFKYACLFFALPLMILGAGLMIH
                     FRGEGGGDIGYVIMCQIFIAFGGGSIVLGNEMAVMASADREGVPMMLAILGLFNSLGG
                     AIGYAVAAAIYNNTWLDALESRLPSDMLSQANEIYLGGYTLQQTYAMESPTRDAINYA
                     WGRTQMYGSIAATCLLALGIPCIAIWKNYNVDKKQNKGTMI"
     exon            442328..442599
                     /number=1
     exon            442669..443282
                     /number=2
     exon            443339..444276
                     /number=3
     CDS             join(445008..446119,446168..446842,446889..447468)
                     /codon_start=1
                     /locus_tag="AO090005000167"
                     /note="putative alpha-1,2-mannosidase"
                     /old_locus_tag="AO070309000040"
                     /protein_id="BAE55274.1"
                     /transl_table=1
                     /translation="MRREYIAVLCAQLTTFALGSHQARTPVADQDVLRFVDPLIGSNN
                     GGNVFAGASLPYGMAKAVADVDGQNTSGFSTDGSNVTGFSALHDAGTGGNPSLGNFPL
                     FPQYCPEDVLDNCNFPNAARAVHYLNDSVVARPGYFALALENGIHAEMTTTEHAALFR
                     FNFPPATAVNGSELSPLILVDLTDLWKSRQNASISIDGQTGRIKGNGTFLPSFGAGSY
                     VSYFCADFAGAPIRDNGVWVNNRGGTEPKELYVTRGFNNFYLEAGGFARFERPTNGSV
                     SVRVGISYISTDRACENARREIPHPLEDFEDIRRRAESAWREKLSPISIQSGDVSEDL
                     QTSFWSGVYRTMLDPQDLTSENPLWESDEPYFDSFYCIWDSFRAQHPFLTIVDPEAQS
                     RMVRSLLDTYKHEGWLPDCRMSLCKGWTQGGSNADVVLTDAYVKNLTGIDWDLAYEAM
                     VNDAENEPLEWSYEGRGGLQSWKRLNYIPYLDFDYLGFGTNSRSISRTLEYSYNDYCL
                     STVAKALQKDDYTKYRSRAGNWQNLYKADQTSLINGTDTGFVGFFQPKHLNGTWGYQD
                     PIACSALASWCSLTSNPSETFESSVWEYQFYVPHDMATLIDLLGGPDIFVSRLDFFHT
                     SGLADMGNEPVFLTVYQYHYAGRPALSARRAHSYIPSLFNNSNSGLPGNDDSGAMGAF
                     SVFSMMGLFPNPGQDVYLIIPPFFEAVHVTHPTTNKTATIRNINFDNTYQNIYIKSAT
                     LNGSPYSRSWIRHDFFTQGMTLELTLGDTESDWGRREDDLPPSISQPL"
     exon            445008..446119
                     /number=1
     exon            446168..446842
                     /number=2
     exon            446889..447468
                     /number=3
     CDS             join(453053..453324,455276..455855,455912..456072,
                     456124..456257,456319..456767)
                     /codon_start=1
                     /locus_tag="AO090005000169"
                     /note="gamma-glutamyltransferase"
                     /old_locus_tag="AO070309000038"
                     /protein_id="BAE55275.1"
                     /transl_table=1
                     /translation="MSRVLAEFSVEYSGPAFICSILIMLCSYAYPCVSKDDQPFDPLG
                     QILEIRRLLAGCAFFFHQLGKMEHPGELAGWLRYKDAEDLEEELPKDGVPGEVRGLEY
                     LHKKYGSLPWSTIMQPAIQTARQGFPVGRDLVRYMNSAVGDGEDFLSKDPTWAIDFAP
                     NGTRLGLGDTITRKRYADTLETIANNGPDAFYTGPIAETMIQALQAANGTMTLEDLRN
                     YTIAIRDTSQIDYRGYRVIGTSAPSSGTVALNILKVLDTYDSFMVPDNVNLSTHRLDE
                     AIRFGYGLRTELGDPYFLEGLDEYQKDMLEQSTIDEIRGKISDLHTQNVSAYDPKGLE
                     SLDTPGTSHIAAVDHTGLTISTITTINLLFGSKVMVPETGIIMNNEMDDFSTPGSSNA
                     FGYVPSEANFIRPGKRPLSSITPTIVTHQNGSVFFVAGSAGGSRIITATVQNIIHAVD
                     EGLSAAEALARPRLHDQLIPNQVRFEYTYNNETVAFMKSLGHNVTWVAPGDSTAQAIR
                     VLPNGTFDAAGEPRQLDSGGFAV"
     exon            453053..453324
                     /number=1
     exon            455276..455855
                     /number=2
     exon            455912..456072
                     /number=3
     exon            456124..456257
                     /number=4
     exon            456319..456767
                     /number=5
     CDS             457682..459445
                     /codon_start=1
                     /locus_tag="AO090005000170"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000037"
                     /protein_id="BAE55276.1"
                     /transl_table=1
                     /translation="MNSIIKRVVSLFSSQEPQSDIPPPSAERKKTPDQSLVMNDPKPV
                     SVVVSPPAFDLDSYESFDEDYFRRTVDEILSDQASFENSFDAYSGTKMMDGTCERKAS
                     MARDSGLGSSGHKASPYFPSKVAKKRPVAHRVIQKMESTEDEDDSEECQSGNKVVRRE
                     DPADSVVKIKLEQLEKRRLGDVGIYAPDNEVGSAARASSVIDVDACDDENFEEVSEER
                     FVFASVSEEEHNRLVRFLVDHPFMREGAYPVKRSVRRRFISDVRREASYSGMDEGALG
                     VLTKWIKKTYLEVCMVADADKEGSEFGDEIDDENVLEHRSRSKSKKDRKRKRTSIDQA
                     REKTKTKKTKTKKSDISMVPSKQDVREVINIDSDDSAIAISKSPSTDIQVLEKAPVPQ
                     SDLQRTPTSHHIHPENAKHGRVVIEHATPKAPTTPSNHRGNERSISSKESSLPMPRYH
                     NSTSKNDVNSNKRIQPASQEDIARKESSKKRTVSSADLPSSHSKDELQKIAENREKRK
                     KKKKKKKRCDDKNKRRLDRQEKRRSEKSETIPESNRLSRKGDQQATHIAGPISQEHPA
                     KSISLPRKAVSMDDPFWDMDF"
     exon            457682..459445
                     /number=1
     CDS             join(460057..460071,461238..461302,461662..464257)
                     /codon_start=1
                     /locus_tag="AO090005000171"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000036"
                     /protein_id="BAE55277.1"
                     /transl_table=1
                     /translation="MATADIVFATGCRMPLDRFFPGVTQTPRAHLSHVMFLPIRLNDR
                     DRDRDRERKVSSSSAVSSKTKSKPRSSHGRPNRSSTKEHDRDAPTGRSSTPTTSNSQQ
                     QRRSSMPGVDSASRPVTASFLESRTSLPYPTFSKAHSRESVVQPDLPTPDPTDLTEEN
                     KDGGKRHSQHRTDNHHAPPSPPLTSVDQNSRKGSTVGDKEDKEKPKDGKAKIRIRAES
                     TRSSSSLRSKRDDESKTSKTMRADTPSSRTKRSSHDKDIPARTASRNSTKSKIVEEAA
                     LPKRSSSSRAAPVVSPPRSPATVRDIGSESANGSDATIAAQQQSSSRKPKSPEKPPSR
                     NQTRSSMSQRPGSRTSADFAFEYGRSPTSNSAYGAPPPPPPPPEVPVTIPRVDYLLQN
                     GGLDHRVPKALLLAAGTPDQSPYQPFQPQLAASKIFDPFSRILEDYHKVMAKNGSLAV
                     ATGYRSVARRLLDRLEAVFARDISSESCNCLMCVHEGLEPEEHPSGVSWGEVLELVSG
                     RQDLPNWPPFMLSLSVNDAELSGDEHIPMQKMDIDIPEEYREHFMRQSRKTKVTVDKW
                     LSEQVSQATNAPDEVDDETLTFAILTHLGPEQRPLFRALLGIPASSPTPQPDGKRPPR
                     PSALISSSLAIQRLYRLPSPPRDPETAIYMLNHPELHHVLATLAAISDDEWDILISGR
                     FDGFLRSGAEDSFAGSTPQRWSSSRSNTPFTTGGISRGPTPSPMDPNSRPASQPYGRV
                     ASPANFGGPIALDEEMEIAALAEIERDIYLGMEALEDAFEALHCKAEVVRRALRERGA
                     GLSVANQQRRGSYVEARLGTPASGLGTWEDSTEDDGLDDDRSLAPDDSASNISSNRRR
                     RPKRRTERRTPAPVEEEDEEQDTYDSRRDRGSKRR"
     exon            460057..460071
                     /number=1
     exon            461238..461302
                     /number=2
     exon            461662..464257
                     /number=3
     CDS             join(470858..470866,470939..471056,471158..471408,
                     471462..472205)
                     /codon_start=1
                     /locus_tag="AO090005000173"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000034"
                     /protein_id="BAE55278.1"
                     /transl_table=1
                     /translation="MTRPNARVLLRSRSWPSYLSSRLWFCYYLSLIGWSSGAPTTHEN
                     KIEASSAACFLQGFWLQIGDPGSGLFVLAIAVHTFILVALGHKLSHRVFVCGVVGVWL
                     FVAILVIIPLAAHGRFVFIPSGAWCWISEEYEPIRLWTHYIWIFLAEFGTVCLYAIMW
                     FQLRRRIKQSAILGNSQTESLKRLRRVIGYMIIYPVAYIVLSLPLAAGRMATAQGQTP
                     SIAFFCVAGAVITSSGLVDVLLYTLTRRNLILESEPSRDRSYNRFASSVNRKTDHLTT
                     ITAAEGKHTRTDISVLRTHRHREDDDEFGHTVREGSTDNIVQPSGMELAPLGKVYQHT
                     TIEITHEPAYPEAESSDRSSKGSIGDGKGPAQSARMWGR"
     exon            470858..470866
                     /number=1
     exon            470939..471056
                     /number=2
     exon            471158..471408
                     /number=3
     exon            471462..472205
                     /number=4
     CDS             join(474316..474333,476019..476546,476599..477474)
                     /codon_start=1
                     /locus_tag="AO090005000174"
                     /note="cytochrome P450"
                     /old_locus_tag="AO070309000033"
                     /protein_id="BAE55279.1"
                     /transl_table=1
                     /translation="MSIKVIVLYTAFTSPLRRVPGPLYTVLTRLPLKLASLTGNRIYF
                     VHELHRKYGPIVRIAPDEVDISSLAEFREIHRAGSPFLKSKWYEKFVPSKRSGVFTMR
                     DPKEHAARRKLFARPFSKSELRRTWEPAVREKVQLAVSQIQRELKAVGKSDLLKWWTF
                     LATDVSGQLMFGESFNMLQLGKKNQYINVLESTMMGSGIGAELPLVAWLGRHIPLSSF
                     QNMFRATDYLFQYGQRAVTNSRTTSNASRNIFAGMVYESEKGDGIITDEEVVLEAGNL
                     IVAGSDTTAITLTYLIWAVLSQPKLQRELEEEVNSLSADFDDSALEELPLLNAVIMEA
                     LRLYGAAPGALPRETPEGGAKFCGYFIPQGMTVTTQAYSIHRDGDIYPDPERFDVSRW
                     LKTETSASELAKKAFSPFGAGGRICLGIHLAWMELRLATAQFFRECAGVRLAPSATWE
                     NMRPVNYFLISPRGHQCEVECNY"
     exon            474316..474333
                     /number=1
     exon            476019..476546
                     /number=2
     exon            476599..477474
                     /number=3
     CDS             join(482517..482839,483095..483209)
                     /codon_start=1
                     /locus_tag="AO090005000176"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000031"
                     /protein_id="BAE55280.1"
                     /transl_table=1
                     /translation="MNLTLLTTLLTTLATTNALTPNTANSTTGQKILDKALTAAGTPY
                     AWGGGSCKGPTHDQPPYQYGDIGYDCSGLVCWAVCQVTGRDLFSEGLRVTSDMYCAEE
                     KELKYKDSGDRMWNAPNDRVNKVQENSIAKFGEKPCPYVVRFA"
     exon            482517..482839
                     /number=1
     exon            483095..483209
                     /number=2
     CDS             join(485678..485956,486011..486673,486731..486940)
                     /codon_start=1
                     /locus_tag="AO090005000179"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000028"
                     /protein_id="BAE55281.1"
                     /transl_table=1
                     /translation="MQDPTTPSKPPSSRQPSSLACVSCRRRHLKCDALLPACTRCQST
                     NLECRYVRSRRGLRTKPTNQSPQRFHEQMLTADDFATWLNATTLATDLEADPVLLQGL
                     ETPPVWDIPCLQDDTTTATWHEPEPVTTITPEIAYDPMVQLYYQNFHRSHPFLIPRKV
                     LHSPLRHRIPTYITGIMRYIGAHYYPEARFKEEFRPAAYTVLSDVTPRDGFKVQGLLL
                     LAVIEHAHGQEENAYLKIQMAIDLALELGMNRTSFALVNSEGSSVLAESWRRTFWELY
                     VVDGLLAAMRDQSSYRLFSHKADVRLPCAEELYNSASEITPTTRTLDDLKQSWSLDQC
                     SSSFTYRIEAAQNLGLVMEVNRSLDIDLEARVETVDATLVSSLMQIPSS"
     exon            485678..485956
                     /number=1
     exon            486011..486673
                     /number=2
     exon            486731..486940
                     /number=3
     CDS             join(486995..487008,487064..487469)
                     /codon_start=1
                     /locus_tag="AO090005000180"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000027"
                     /protein_id="BAE55282.1"
                     /transl_table=1
                     /translation="MITYLALIYLHHPRSSMRFASFHARTWCTRLRICNNNPPPTELD
                     LHSQKFLRAADMLSNLVTLPSTIKSRTPFFTCALAMCVIVHTAACLIMSTPDKVESLK
                     ARIQLSIGGLNMLGKSWPLAKMVRQQMVNMYQEVGLR"
     exon            486995..487008
                     /number=1
     exon            487064..487469
                     /number=2
     CDS             complement(join(488397..488576,488651..488732,
                     488793..488940,489004..489074,489239..489426))
                     /codon_start=1
                     /locus_tag="AO090005000182"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000025"
                     /protein_id="BAE55283.1"
                     /transl_table=1
                     /translation="MANSTIHFQASLFPHYTDFLAHVTGQIRDSQCNLFLVYKGIQNT
                     WIQDAWDYIEDNHEGRAVSSAWRENGLITPEDFRELHTYAGTTLDFNQGPYRGSKKDP
                     DLFTLPTTCLFPCLAMESGWSEDLTEMENDVDMFDNYHVSGVVKVYKLDENGMPVHEG
                     PDQVIFPKPADSQNQVIGVARGDIVGRTRFQDRNPFDTLEYPLDILREIATIALDRMG
                     LVPA"
     exon            complement(488397..488576)
                     /number=1
     exon            complement(488651..488732)
                     /number=2
     exon            complement(488793..488940)
                     /number=3
     exon            complement(489004..489074)
                     /number=4
     exon            complement(489239..489426)
                     /number=5
     CDS             complement(join(491060..494175,494234..494435))
                     /codon_start=1
                     /locus_tag="AO090005000183"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000024"
                     /protein_id="BAE55284.1"
                     /transl_table=1
                     /translation="MRPRPPIAVTPLTMPRKEFQRDLIQASVPGRFPHLKGVRAGEEH
                     GSVLFTYTVPFSTQTIDFQTSVLNTDDYPGHHTYFTFAASDNIPDDVSKAIERLQPVF
                     AGLAIEPFLKCISDSIDDALLGVDSALDLLHENRSESEIFSGDDMDFDADSVDSDAQF
                     TPPTDQAEVMKQIRSDMSAVKKAGYRVAFLGQLTGCLIISISCRIAKLGISKVAMQAW
                     NVRPSQYLVLLLRYPFGYRNLDQVISKSIPKTPLIQMYVGLCDSSKPSLAAATQAFVS
                     TETEIPGNTQKVGPDLQSFFIGDSLHTLLNTHLIDLVRHRLQHGFTWTGAELYLRNNQ
                     GRIQDSEEVAREVYFVPEAWNDATPRFLRADHISEEKSPLSLPLIAIQFILRRFVKCT
                     EFCLNCYCKVDAGFEALMPYVCSNSLCLYQYMRLGMGPRLEWEIISQPYVVDMLVSFA
                     YARALAGYLEDFPLGLGMNVPTYYATENDQMIYHGLLNKATMELDVHEMPDLRVGDWI
                     AIVPCGAHIRHGRPQWHCRVQDADSPSSIQLTPPIRREIPNEHGINMEGSDEVQFVRY
                     KECFDDLPDSAKCDAIVMLLETLPDINSMRSFILSHPNGNSKRMLASWCDKISPAALY
                     ALRWIVASNRSCIRYEDDPEHKLPYMNGYAQFRLAQGAPDKEQRFVSAVKSLSSSHNA
                     EYPTLFAWHGSPISNWHSILREGLHFKRVLNGRSYGHGVYMSPQFGHSMTYASSQNLA
                     RTWPNSILNIDKALSLNEVVNAPEQFVHNGNYYVVDKLDWIQPRYLIIRHKSASPMTA
                     DAGLVPSITYTQHPDYQALGPNHQALTLPISAVSSHWSQRYAETTTRSTCEGQLSHNV
                     ALVSDDDRDSVTTIADDDWLLDAGAIASTGTHDEVANEAFHDLSKTDFRPGSLKESAL
                     QLLGPPKYATTLATKSLQRHLQATLKVQEREPLHALGWYIDPALVNNVYQWIVQLHSF
                     EPSLPLAKDLKAVGLTAIVMELRFPPQFPMSPPFVRIIRPRFLPFSQGGGGHVTAGGA
                     MCMELLTSSGWSPVSSIESVLLQVRMALTSTDPVPARLEQRRMQDYSVGEAVAAYTRV
                     CQLHGWAVPDDLREVSW"
     exon            complement(491060..494175)
                     /number=1
     exon            complement(494234..494435)
                     /number=2
     CDS             496801..497451
                     /codon_start=1
                     /locus_tag="AO090005000184"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000023"
                     /protein_id="BAE55285.1"
                     /transl_table=1
                     /translation="MTLHRPHILASAESRKAALEATLATLESQQRFFGQTSEHHYPLF
                     GLAFYTIDASILLSIIVASYPPHGHEPRQYVYHVLQQAIERLSYVQPYNPIARSGLGI
                     VQRCYEKLKEACHSPPNTSATPSSSVVSPRFELQSLRQELSHRNSVPANDVQSPPSPS
                     SGPEYLDLLAPAPSMIPDSFSEAYWLDQLNLIQPSSAIGQDPDMFWDSLLFDRNIL"
     exon            496801..497451
                     /number=1
     CDS             join(500352..500361,500796..501010,501061..501206,
                     501257..501992)
                     /codon_start=1
                     /locus_tag="AO090005000186"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000021"
                     /protein_id="BAE55286.1"
                     /transl_table=1
                     /translation="MKRTVVTTPVSVPTASSSFTGNGGTTCTVTEYAAISSAVASCSN
                     ILLSDIYAPPSSTIDLQGLQTGAAVIFAGKTTFGDTADSDFDPIVVSGTSVTITGVEG
                     HVIDGNGAAYWDGQGSNGGSDKPDHFFVVKDMYNSRIENLYIQNWPVHCFEIESTEHL
                     TVSGLTLNNSAGDAANSKSDGDPAAHNSDGFDIKESSYFTLENTWVHNQDDCVAVTSG
                     TDIVVDGMYCYGGHGLSIGSIGGKSDNTVNGVTFSNSQVISSQNGCRIKTNSGETGEV
                     YNIRYENITLSDISDYGIDVQQDYLNGGPTGEPTNGVTIANVTFVDVTGTMSDGKDYY
                     ILCGDDSCSNFVFDGVSITGGSGDSCNYPSTGCP"
     exon            500352..500361
                     /number=1
     exon            500796..501010
                     /number=2
     exon            501061..501206
                     /number=3
     exon            501257..501992
                     /number=4
     CDS             complement(502268..503008)
                     /codon_start=1
                     /locus_tag="AO090005000187"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070309000020"
                     /protein_id="BAE55287.1"
                     /transl_table=1
                     /translation="MTSTTTTKKQPKTPKMTTQNKNQYHELPIKPHGILWQEDFITPT
                     HEAQLISIFQNQLEWPTRNGRISLHYGYSFDYKTFGIDPDIPYKEFPDWLQPLIPTTE
                     GRPPEQVCLQYYPPGSGIPPHVDAHMAYDQLYALSIGAPIMMQFRRGEERVDVDLVPR
                     CMMQMTGESRLFWTHGIKKRKNDILADGTVRPRGDRWSITYRWVREGECECGDVEVCD
                     VAQRRMGVEKEKRSLKELAAKEDGGVSG"
     exon            complement(502268..503008)
                     /number=1
     CDS             complement(join(503359..504358,504412..504809,
                     504863..505174))
                     /codon_start=1
                     /locus_tag="AO090005000188"
                     /note="synaptic vesicle transporter SV2 (major
                     facilitator superfamily)"
                     /old_locus_tag="AO070309000019"
                     /protein_id="BAE55288.1"
                     /transl_table=1
                     /translation="MADEIPHHVNDGRNSERNMEAQSAFASTLVVDVEKSLHSKGADP
                     SKCSTSSNGISVSTPTNQAGSNAVYAAKAQLLNQALVDMKMGRYQWVLFIITSVGWFL
                     DSFWIMSFVVIAPSASNEAQFFFPGDKSSYLFVSLAVGLTVGATAWPWMSDILGRRWI
                     FTSTIVLMGMGGLVGAGMPSFTGLCVVGFVVGFAVAGNQLVDAIILIESLPASHQFLV
                     TVQGAFWGLGQLVSAAVGWAFIAGYTCGTGLDAISTSQALSTHSSRAEGSTQSSQSST
                     SCHYVSNKGWRYLWWTFGCITLFLYLCRFVFPFRETPKYLLSKRRDAEAAQLVNNIAT
                     YSKRGTWLSETSFARVDSTIDATESRRTPRLRSLIFALQPTGLPILCLLWALTGLTFP
                     LHKTSLTAYLASTHNIAPITATTVTTPYLYTHYLYTSLCAIPGPIIAGMLIQTKPFGR
                     KRTGSAIALLTGLFMLLATLARSRNALLAFECVLSFLQFADLAVLTTYTVEIFAAPVR
                     GFGVGVMGFFWGVFGLVAMIANTFAGDVVAGGAAVWFCGAVWVVMSGAWLTLNETRGF
                     AAA"
     exon            complement(503359..504358)
                     /number=1
     exon            complement(504412..504809)
                     /number=2
     exon            complement(504863..505174)
                     /number=3
     CDS             complement(506689..507228)
                     /codon_start=1
                     /locus_tag="AO090005000189"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000018"
                     /protein_id="BAE55289.1"
                     /transl_table=1
                     /translation="MTIILYSSGSSVTAYALDPSGVFTRRQTFTYKLDGPGTDPDRQD
                     APHPHGVVLDPTGQFILVPDLGADLVRIFRINPSSGLLEPQTPLAVSPGSGPRHGTFW
                     TPKGARPGRAIDTRFYLASELNSHLTGYKVHYPKNGTIAFEKFFETTTYGGPELPSGA
                     TAAEIAISVGPFLATQYIL"
     exon            complement(506689..507228)
                     /number=1
     CDS             complement(join(512529..512598,512796..513154))
                     /codon_start=1
                     /locus_tag="AO090005000192"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000015"
                     /protein_id="BAE55290.1"
                     /transl_table=1
                     /translation="MKLASLPLTTYGFQLLMFGRRKEGLTPDQYRDHYENVHIPLMKN
                     LTGDTFPLTHVRHYVKRDGPPDFPPAVLMGNQTDFDYDAVAVLTYRDKAHFDANWAFF
                     EDEETSTLIKEDEEKFSAAQSKSLIFAGAGWGLVCFDQRR"
     exon            complement(512529..512598)
                     /number=1
     exon            complement(512796..513154)
                     /number=2
     CDS             join(516392..517166,517223..517716)
                     /codon_start=1
                     /locus_tag="AO090005000194"
                     /note="predicted dehydrogenase"
                     /old_locus_tag="AO070309000013"
                     /protein_id="BAE55291.1"
                     /transl_table=1
                     /translation="MTVSNYIVSLAEAQTRLPPPVASSRLLEQIDQQVEQLPILVVLD
                     DDPTGTQTCHGINVLTVWDDATLVEEFHTCDRGFFILTNSRALPTAEARKLISDICTA
                     VKKAAVQAQKTFEIVLRGDSTLRGHFPDEPQIAEEVIRKVDGWILAPFFRQGGRFTID
                     DVHYVADAEGNLVPAAQTIFAKDATFGYTSSNLIDYVVEKSNGSIPRHRVQSISLHDI
                     REGGVSAVAERLLKFAQGSIIIVNAIVDTDLEIFVLGLLQAKSAGRNYIYRTGAAFVS
                     TRLAIRPKPPLSAGDLGLNTEASSPGGLIIAGSYVSKTTDQLQSLTSGRGPALKVITL
                     DVESLLNNTESSYSTVLSASDEAGKYISDGQDVLIMTSRRLVSSHDELSGLQIGSIVS
                     NALVLFLRLLIPRPRYIIAKASCLLCKTMM"
     exon            516392..517166
                     /number=1
     exon            517223..517716
                     /number=2
     CDS             517922..518977
                     /codon_start=1
                     /locus_tag="AO090005000195"
                     /note="voltage-gated shaker-like K+ channel, subunit
                     beta/KCNAB"
                     /old_locus_tag="AO070309000012"
                     /protein_id="BAE55292.1"
                     /transl_table=1
                     /translation="MVTSWQSRSIEKRPKMQYQRLGNSGLKVSKIILGCMTFGNPSWE
                     GSPWVLPEAEALPLLKKAYDCGINTWDTANTYSNGMSEIIIGKALERYNIPRSKVVIM
                     TKLYYPVLEPESNARPNPAINDGVLVNQMGLSRKHIFEAVDASLARLKSSYIDVLQLH
                     RIDDTHPEEVMRALHDLVQMGKIHYLGASSMYCWQLVRLHYAAKMNNWTVFTSMQGLY
                     NLLYREEERETNKFCQAEGIGLIPWSPLARGLLARPWNVKTDRSVKDAKTAKWFSGEQ
                     DQKIITRVDQLARSKGCSMSALAIAWLLEKGACPIVGLNSIERIESASEALAVRLSDV
                     DIRFLEEQYRPLSVQAI"
     exon            517922..518977
                     /number=1
     CDS             complement(519650..520414)
                     /codon_start=1
                     /locus_tag="AO090005000196"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000011"
                     /protein_id="BAE55293.1"
                     /transl_table=1
                     /translation="MDKNLPEEVKAYLEEIVQRLTDYLKDQLVGVYLFGSAGYGAYES
                     GTSDIDVQAIVRGPLDTVDKQAVISRLNQNALPCPATKLEFVVYAQSAVYPASRHPRF
                     ELNLNTGAHQPDHISLDPANESSHWFLLDIAVGRELGRALYGPATTDAFGAIPRRWVL
                     EAIATSLEWHQAKELRSSNSVLNACRGWRYIVTGEFSSKLVGAKWAMQQQGSPDVVSR
                     AISARKTGDELPVVQIMTLYHIVIMANRAELAKDLI"
     exon            complement(519650..520414)
                     /number=1
     CDS             join(520734..521251,521311..521635)
                     /codon_start=1
                     /locus_tag="AO090005000197"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000010"
                     /protein_id="BAE55294.1"
                     /transl_table=1
                     /translation="MILFPRYYLFEIGDQAWCPEWMRAYIQSYLTRVWNLHIPPFSNA
                     PPAGVAADLILGHIKDPDSFTFVDLCAGAGGPIGTLEHVLNEKLRAEGKSAARFVLTD
                     LHPRVEEWSAISRRRENISFVSEPMDAAKCERVAPTNRKECRIFNLCFHHFDDLLAST
                     ILRKATESADSFIIFEFAQRNFTSLLNIPVMLLFPFWYTLCRYRHSPLHLFFTYVIPL
                     LSLLISFDGLVSTMRCRTPEEIRALLDGLDLDLSDWEFRSGHRMLFEPFVHIYYYIGV
                     RKER"
     exon            520734..521251
                     /number=1
     exon            521311..521635
                     /number=2
     CDS             complement(join(521716..522135,522202..522283,
                     522343..522658,522717..522841,522941..523128,
                     523210..523320))
                     /codon_start=1
                     /locus_tag="AO090005000198"
                     /note="2-polyprenyl-6-methoxyphenol hydroxylase and
                     related FAD-dependent oxidoreductases"
                     /old_locus_tag="AO070309000009"
                     /protein_id="BAE55295.1"
                     /transl_table=1
                     /translation="MKVIIVGAGIGGLTCAIACRREKLDVIVLERSSVLLPVGAGIQI
                     PPNGLRVLQELDLKQEVLEKGAIVESMDLRRYKDGGLITSMECGQTVAREYGGPWVAL
                     LMGAKVCFGATVDDLDVENTQVILEGGETVAGDIIVGADGLWSKVRDAIFDRPVPLIE
                     TGDMAYRAVFPRKQLENLHNPEIDSLCSKTSVTAWLGPEKHAVFYPVRGGEEYNLVLL
                     QPDNLPTGIRTNEGDLEEMKSAFRDWDATLQKLISCISSVVRWKLCRLPELDTWSKGS
                     VTLLGDACHPTLPYQAQGAAMAAEDGAVLGMLMGSVVERIDTQTDSLDATLGGLISES
                     LYVYEDLRKAPTTANVNGALRNRGAFHMRDGIVQWMRDFVLGYSGMTRETDWIGLMSR
                     RQSHTLSADPMQECKKRIGRA"
     exon            complement(521716..522135)
                     /number=1
     exon            complement(522202..522283)
                     /number=2
     exon            complement(522343..522658)
                     /number=3
     exon            complement(522717..522841)
                     /number=4
     exon            complement(522941..523128)
                     /number=5
     exon            complement(523210..523320)
                     /number=6
     CDS             complement(526469..527638)
                     /codon_start=1
                     /locus_tag="AO090005000200"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000007"
                     /protein_id="BAE55296.1"
                     /transl_table=1
                     /translation="MRSMFEKRDVGFLRALCIASFWLADASRILCSDAIRRAADIRLH
                     RSFDYLIGARDPESCSPSSANPIAAVDRVRLWYLLFVCDQHLSILHNRDSLLRSDKDI
                     AVSWETYLHRAETTESDIRILSQVSLLLIMGQVRDVLGSDNQTPLPPTLTHHITNYSR
                     QLDKWFAKFSALFITNAYIGDFPRKGLELHYQFGKLYLGHQVFKGLHGNPIPMHFVSA
                     ANMAHDAAVGIYEMILNDNQLTNSLVGMPHYFHIMIAFAGHLLLEICHNHHEQLSINV
                     QEEFNLIGAVLDLFRSQNCIPQHPIRRMAPGLSRKLSTCAASLGIGSLFDGHQSSQNA
                     YIATTGAQGLANPSQNFDGQPVQFPVDSTAPQMDDFLFGDIGEFTFPDLTSSFLP"
     exon            complement(526469..527638)
                     /number=1
     CDS             complement(527687..528241)
                     /codon_start=1
                     /locus_tag="AO090005000201"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000006"
                     /protein_id="BAE55297.1"
                     /transl_table=1
                     /translation="MSSELPCKCDPESGANPDTLTRNVELVQSDLRNLHDTVDIICQH
                     LDLSRPKTLVVDRGKDRENIPVSGEPDREESEGCEVSPPDSPSAVHAPIDTFLDIAKF
                     GSPKSVESPPGRRASRATHGDDLITKGIVSLAVAEQLLHRYFSRLDHYLYGICSEHHD
                     LHQLRTTSPILLAAICTVSALHDP"
     exon            complement(527687..528241)
                     /number=1
     CDS             join(528894..529352,529411..529950)
                     /codon_start=1
                     /locus_tag="AO090005000202"
                     /note="predicted protein"
                     /old_locus_tag="AO070309000005"
                     /protein_id="BAE55298.1"
                     /transl_table=1
                     /translation="MTSSIAGKTRPLPPGIFCPVISLYKSTPRQEIDYEASYKYFSYL
                     IRGGVDGLVLGGTTAEAVLLSPSERQELIKTARRAAVDLGFENFPLVAGISGQSTNES
                     IRLAQEAREAGADFGLLLPPSYGAKAVTKDVIIDFYKDVASENILPIVIYSFPVVCNG
                     VDMNSDVMSTLAQHPNIVGVKLTCGNAGKVTRLTQEYSHEQFSVYAGSSDWLIPCLSG
                     GGSGCVTGIGNVFPKSVARLYALWREGKVQDAMKLQGLVAQAEKACKEGIAPTKFAAA
                     HFAGPLSGITEAEAFWPRKPYKPSPKGIQDWVVDVMQHMVEIENSLPEVSGPGRAK"
     exon            528894..529352
                     /number=1
     exon            529411..529950
                     /number=2
     CDS             complement(join(530125..530137,530264..531358,
                     531463..531749))
                     /codon_start=1
                     /locus_tag="AO090005000203"
                     /note="predicted neuraminidase (sialidase)"
                     /old_locus_tag="AO070309000004"
                     /protein_id="BAE55299.1"
                     /transl_table=1
                     /translation="MLAFYGSSNSRCLFHVMNKPIELRDTNPTFSWTEDLGKVETLCS
                     ADSRTIHRAFIIYRTSGRNDFTLNLNPSSGGHVILSLYTEAFWLDVVKRRFSLVRETN
                     RPYFYREAYLPGATAQNHASNLLLLPNGDVLCAWFGGSMEGKPDISIYLSRLRSGEQS
                     WSEAIRMTHDNTRSEQNPVLFRTPTGDLWLLYTSQHAGNQDSAIVKRRVSKDDGITWG
                     KEEVLFPDSGIFIRQPAIVLDDGAWVIPVFKCRVEPGERWLGNNDISCIRVSRDEGQT
                     WTESVIPESTGCVHMEIQRLKDCSYLGLFRSRWADHIYLATSPDGLSWSPPQPTILPN
                     PNAGICFDVLPSGRVVVVYNHSSKLDATGRRQGLYDDIADGVDERRDQSSTQDGRESF
                     WGAPRAPLCVAWSDDSGKTWERRVLEDGDGYCMTNNSEKKLNRELSYPSMVLDEGKIH
                     IAYTFWRQRIKQNT"
     exon            complement(530125..530137)
                     /number=1
     exon            complement(530264..531358)
                     /number=2
     exon            complement(531463..531749)
                     /number=3
     CDS             join(531924..532142,532180..532629,532675..532908,
                     532967..533323,533395..533745)
                     /codon_start=1
                     /locus_tag="AO090005000204"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070309000003"
                     /protein_id="BAE55300.1"
                     /transl_table=1
                     /translation="MAGGTSIWASKEARTDPKEIFNLRLLYLLISVAWGGWFYGFDTG
                     NIGGILTLPSFENAFGLNNLPAAEIDNRKTLMRLQGTIAAMLAAGGSAGALCAAPTSD
                     FLGRKWSVFLWGFIFVVGAAMQMVADYDVLLAGRFIGGMGVGASSMLTPQFLAENSPK
                     SVRGSMTATYNLMILAGIMLAFWINYGVSLWSFPGVEHDNTQWRTSMGIQLIPGALMC
                     LMIPFEGIKNLCRLRKLPIEHPYVQTEYQEIEAQVRYEQECHQGHSYWVVLQDILLIK
                     SNFQRFFLAIMLFLFHKFTGTDSLNYYAPEIFELIGVKGSSNSLLTTGVYGVVKFVVT
                     IFYVTYLVDRVGRRLPLLVGASLQATAMLYLALYLRFAGTNTDTVGGTPAGGIVGIVW
                     IYIYAFGWSFGHSVACYVVAAEIFPTRIRSVCMSICFFVNWIVDYGITRATPNMITEM
                     GWGVFLLYALLTYAGVVFIFFCLPELKGRSIESIDDLFQRPLWSMWRHAYPTEEEKTR
                     QGIPQLMKGGNEDNADGDKDRPVHIESV"
     exon            531924..532142
                     /number=1
     exon            532180..532629
                     /number=2
     exon            532675..532908
                     /number=3
     exon            532967..533323
                     /number=4
     exon            533395..533745
                     /number=5
     CDS             join(545240..545365,545470..545588,545649..546336)
                     /codon_start=1
                     /locus_tag="AO090005000207"
                     /note="aldo/keto reductase family proteins"
                     /old_locus_tag="AO070289000077"
                     /protein_id="BAE55301.1"
                     /transl_table=1
                     /translation="MTTFTLTTGAKIPAVGFGTWKAAPGEAAAAVKTAFEVGYRHFNM
                     SVPVSNPTRNTDGNEPEIGGVFKSTKVPRSEYFVTTKLWSSDHRRVESALDKSLQDLG
                     LSYVDLYLMHWPVTLDPSDSVEYGKENRKVHAAGWDFNDTWREIEKLLETGKVRAIGV
                     ANFSTVNLEKLLKTAKVVPAVNQTEIQPLLPQNKLNAYCREKGIHQTAFGPLGGSGST
                     LHSHPVIVDIATKRGCDTGNVMLSWGIQKGWSVIPKSTNPKRIQANLRGNVELTSEEM
                     GKMDALALPKGKRFNRPDWGTVIFHDDAEVDLEE"
     exon            545240..545365
                     /number=1
     exon            545470..545588
                     /number=2
     exon            545649..546336
                     /number=3
     CDS             complement(550709..551617)
                     /codon_start=1
                     /locus_tag="AO090005000209"
                     /note="predicted protein"
                     /old_locus_tag="AO070289000075"
                     /protein_id="BAE55302.1"
                     /transl_table=1
                     /translation="MSFTGSKFQLIIRQQPTRARVAGVKEKDRKPVDPQPIVQFQVIE
                     RGNYLAQHYLQSPYYFMCCSLFDPLNDVPVPVPPSTALTGTLVSSLHRLKDEDNSEGG
                     FFVFSDLSVKLEGSFRLKFTLFEMGEGSASHLASIISDRFTVARPKDFLGMTEATSLS
                     RLFADQGVKLKLRKKSRAGIKRSLQQVEEYPRPAPRRSPDYSSIQIPGNPSTGYSGAV
                     AGVYQDYSYYTGPVKRQCMSLDYTNRGTYNDGRTYPIEAHPQSPAQPTNQPRAYTTPI
                     LQGHVGVRNYAMSDGIPPFSQVPESL"
     exon            complement(550709..551617)
                     /number=1
     CDS             complement(join(552279..552361,552583..552679,
                     553153..553281))
                     /codon_start=1
                     /locus_tag="AO090005000210"
                     /note="predicted protein"
                     /old_locus_tag="AO070289000074"
                     /protein_id="BAE55303.1"
                     /transl_table=1
                     /translation="MGSMADGQRQNVALTGAREGLIIVRHAEIGKYSSVAAQSWVKLR
                     IERATPTLATPVEYTPLEERVDEGHVEHDLNHLARMLPHKDDTLIRLRRKLRKYEDGL
                     "
     exon            complement(552279..552361)
                     /number=1
     exon            complement(552583..552679)
                     /number=2
     exon            complement(553153..553281)
                     /number=3
     CDS             complement(join(553928..553972,554077..554400))
                     /codon_start=1
                     /locus_tag="AO090005000211"
                     /note="predicted protein"
                     /old_locus_tag="AO070289000073"
                     /protein_id="BAE55304.1"
                     /transl_table=1
                     /translation="MSPELGRLGISDAEFNLLRSSIEDSMKGQGNPSLGGHIIKPLEH
                     AKCLGSNSLECEDKDMILLWTFLTYQEALVPGGFLFLEDVVEDAVEEPGAMARPGEAL
                     ASDDNSLAARCSGGFAPPRQ"
     exon            complement(553928..553972)
                     /number=1
     exon            complement(554077..554400)
                     /number=2
     CDS             join(557694..558127,558178..558430)
                     /codon_start=1
                     /locus_tag="AO090005000213"
                     /note="predicted protein"
                     /old_locus_tag="AO070289000071"
                     /protein_id="BAE55305.1"
                     /transl_table=1
                     /translation="MPFGQLSISNRGIPQHDPPYSDATPVFDDVTVLTIQYRTSFKSI
                     SHLIPDVIEVENEPLVTATLLNYGAGPAGPFLEFIHTVEAKYLGKSYDFCLSLILDNE
                     MAVLAGREPCGFPKRLGQLSLTTRSSNRATGYVERPVGQKLVEPFLNLRVIPSPVTGA
                     PASLKELVPSNFETRPVEVWEGVGKLTFPENCLQAEAINKIEIVRYESATLGYGSACI
                     LHPSEEVFQL"
     exon            557694..558127
                     /number=1
     exon            558178..558430
                     /number=2
     CDS             complement(join(559357..559687,559754..560235))
                     /codon_start=1
                     /locus_tag="AO090005000214"
                     /note="predicted protein"
                     /old_locus_tag="AO070289000070"
                     /protein_id="BAE55306.1"
                     /transl_table=1
                     /translation="MHEYLSLTCIRGATRGIGRATAIHLAKRGASILGTCSSETSMHN
                     IESLSSEITEYYRGTGCDAPKIVGVAANVLSLETPGIVAEAVEKHFNSKIHILVNNAA
                     YDELREMGKLDDEYVRKVLMGNTHTLVMLVEALYTRSMIQPDSRIINMSSVSGRKIPF
                     PAMYLVGATKATMEALTRSWADIFGKDPKTLGTTVNALLIGATATEALFREATPELKN
                     MGLSAVQSGSAVCGGMGLPEDIANIAGLLASEKARWITGSVVCANGGSVHVM"
     exon            complement(559357..559687)
                     /number=1
     exon            complement(559754..560235)
                     /number=2
     CDS             complement(561690..563183)
                     /codon_start=1
                     /locus_tag="AO090005000215"
                     /note="predicted protein"
                     /old_locus_tag="AO070289000069"
                     /protein_id="BAE55307.1"
                     /transl_table=1
                     /translation="MRLVNVCDGSKLRLTRYAAQITEGHFLKLGSDTTLPTIHESGNH
                     LPSCRLDERSTHESTLSLDQPNQGSIPSSGDNPLPSPRDSLQIDCWTFEGRAFPLQTP
                     RISYPFLELAPALWHIYTDNVAPLLPLLQRPSTRNLLLLGTQSKQSMTQNKKALILSI
                     LFVAVVSMSPAKCGMVLKESRDSVVRYLKSEVKQALSDARFLTTTSLTCMQGLVLFLI
                     GLYAENEQHDFWSMTALVLHRAKGMNVHRDGAHFGLTPLRAEMRRRLWWMICLLGVYS
                     CEDHARETRINEEMYDVRLPLNVNDDDLFPGMQALPPERKGGTELTFCLLRFETISIL
                     HSASSTPGSSFNDIKEVSNDDRLCKVQKIRQYLDETYLKHCDQNIPIFWVGAAVTRLI
                     MAKACLSAYHQILDLDNGTPQPPLIGEKLIQLAVEMLQLDYQLRDHPVIFQWGWHLRS
                     CTQWHGMAVALSAQYLYPASSVSAGHASQLAMLERQDSLEYVQCCCS"
     exon            complement(561690..563183)
                     /number=1
     CDS             564164..564883
                     /codon_start=1
                     /locus_tag="AO090005000216"
                     /note="dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /old_locus_tag="AO070289000068"
                     /protein_id="BAE55308.1"
                     /transl_table=1
                     /translation="MIVALVTGANSGIGEAVARQLARQPDHHVIVTARNLEAGEKVAA
                     AIVEEGNSASAVRLDLSSDESISTVAEHVKEAYGKLDILVNNAGTFLDHRSDLSVREN
                     LTMTFDTNVIGTAVLTDALLDLLRQSSAPRVVFVSSVLGSLTLSNDENWPLRHIVSKA
                     YKSSKAALNMLVLHYSRALQDVSGLVNTVCPGLVKTKLNGYAEDGVTPDVGGRRIVEL
                     ALLGPDGPTATFSNRDGPIPW"
     exon            564164..564883
                     /number=1
     CDS             complement(565225..566829)
                     /codon_start=1
                     /locus_tag="AO090005000217"
                     /note="alpha-D-galactosidase (melibiase)"
                     /old_locus_tag="AO070289000067"
                     /protein_id="BAE55309.1"
                     /transl_table=1
                     /translation="MRLITRWIPLANALASTMPVQVVASIENPSLLPTPPMGFNNWAR
                     FMCDLNETLFVETTDAMASNGLLEAGYNRINLDDCWMNYDRAENGSLEWNVTKFPRGL
                     PWLGQYVKSKGFNFGIYEDSGNLTCGGYPGSEGYEEIDAEIFAAWGIDYLKLDGCNVY
                     PKEGRTLQEEYKYLYGNWHEILSKMQQPLIFSESAPAYFSMTDNLTDWHTVMDWVPEY
                     GELARHSVDILVYSGEGSAWDSIMTNYKFNTLVARYQRPGYYNDPDFLIADHPGLSLD
                     EKRSQFALWASFSAPLIISAHIPDLSSEDLEYLTNQALIAVDQDPLAQQATLASRDGS
                     LDVLTRNLADGSRLVTILNHGSESIETDISLDILGLSTDCTYKAQDLWGGSTQTIKDA
                     IRIKLNTHATAVYKIDTDEKCSQVIPTGLIFNTASGKCLTGTSSSVGSESCNGSKSQI
                     WQIDASGVIRTLSEQSKCLTADGKAISLQECSENNGQKWSYAITGNLKNADTGYCLTN
                     GGGVSACGFETNSQVFGLPAGVHVAL"
     exon            complement(565225..566829)
                     /number=1
     CDS             complement(569536..571011)
                     /codon_start=1
                     /locus_tag="AO090005000218"
                     /note="predicted protein"
                     /old_locus_tag="AO070289000066"
                     /protein_id="BAE55310.1"
                     /transl_table=1
                     /translation="MHPSVRYKIGILLLSALLIFYSLNLYWKADLNFAAAIEPATLRE
                     RQTLLWQQLSSLLEDHAPECPPPERDDSSGAIPYNAVESVSRPDLITNSDRIQEPLQG
                     AHDRFVDAIKTSNIDRAYSPGTSGIVSSAGKSYIPLFVTSLRMLRRTGSTLPVELFVK
                     DESEYETKICEEILPQYNARCVILSDIEAGQGYSTEEIAHYQLKIFAVLFSSFENVIW
                     MDSDGFALYKPESLLQNEPFMSTGLVTWPDFWASTASPLYYNISRQPVPSMTERASSE
                     TGVFLISKQTHFLTLLLAAYYNYYGPSHYFMLLSQGAPGEGDKETFIQAAAAMGEPFY
                     TVSEKVSAVGHPKPNGGISGSAMVQADPIEDYRLTTQGHWRVKDPSAAKAPRVFFIHA
                     HYPKFNPAEHLFGNHWETAPTLKPDGSDGRAWLVAEKTLERFGFDAEKSYWEEIKWVS
                     CNLEHVFESWKGKSGICDRVSEYWRNVFESSDEETPVFTQK"
     exon            complement(569536..571011)
                     /number=1
     CDS             join(573238..573472,573534..573877,573942..574553,
                     574623..574757,574842..575042)
                     /codon_start=1
                     /locus_tag="AO090005000219"
                     /note="cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies"
                     /old_locus_tag="AO070289000065"
                     /protein_id="BAE55311.1"
                     /transl_table=1
                     /translation="MIGTVLDTVLGNPQGAVGGLFVGSFVIFWVVPFLYNLFFSPLRN
                     VPGPFWARFTILWEFSQLMKGRSHEEYIKLHKKYGPVVRVSPKRYSVIDPQDVKKIYG
                     FGADFPKSEFYDSLGDPKNIFTVRDNEDHKDRRRKVASLYTMSSMVAYEDAVDRMTTL
                     CIKKMTDLAASRKLISIPKFMQFYAFDVIGEITFDQNFGMMENMGDTQGIIKEIHAMN
                     NTIGIMGLLPELQSTWRAAQKVLFSGTAMGKLTEYIWSQYWKHRNTNSGAKQKSQYDT
                     FLRKVLELEAAHKVGRMNVLDSCGSNIGAGSDTTGITLSAALWYIYRNPDKLAKLRHE
                     IDTMTAEGRISDPVTYKQAQEMPYLNAVIKETLRVHPGVGTILARVVPKGGITLTGGY
                     YVPEGTHIGTNAWPLHYSETVYGPDADQYRPERWLEDKPQPDYRDSMMFAFGSGSRTC
                     IGRNISLLEITKVLPQIVRKFDLKFEEKKDPWDAWCAWFVYPKYKCWIEPRKPVENVA
                     "
     exon            573238..573472
                     /number=1
     exon            573534..573877
                     /number=2
     exon            573942..574553
                     /number=3
     exon            574623..574757
                     /number=4
     exon            574842..575042
                     /number=5
     CDS             complement(join(575544..576707,576775..577203))
                     /codon_start=1
                     /locus_tag="AO090005000220"
                     /note="cytochrome P450 CYP4/CYP19/CYP26 subfamilies"
                     /old_locus_tag="AO070289000064"
                     /protein_id="BAE55312.1"
                     /transl_table=1
                     /translation="MSDARTTLMETWFTPALVAAIVAARLLFSLYSAWRHAQRARSLN
                     CQEAPLYPSRDPFGVATLLETLRADRDKFLPKLSQKRVDLISSQQNRYVSTFRVRQAG
                     RENFFTVDPKNIQAMLATQFNDFFLGDMRRNAGAPVIRSGIFVSDGADWSHSRSLIRP
                     QFTRTQINNLELEERHVQNALRAMPTQSNGWTSEVDIQTILFRLTLDSATEFLFGKSC
                     NSQLTALEKDAGEMSDSFLNSFDRCAWYLAARLRFERLYWIVNNKEFRECTRVVHELV
                     DGYVHAALQRAQQAEKPADPERGSHYVFVDALTATTQDPNQLRDECLNVLIAGCDTTA
                     SLLSWNILLLARHPDIFQRLRKEIIERFGTYSEPRDINFSSLKSCQYLQHFINETLRL
                     HPVVPFNRRCANKDTTLPRGGGKDGNSPVYLQKGQPVLYSSYVLQRRKDIWGEDAEEF
                     NPDRWYGRKAIWEHIPFSGGPRTCIGQQFAITNTSFVLVRLLQRFDSIEDVYPEREIR
                     YGVTLTNCPADRVTVRMHQAEL"
     exon            complement(575544..576707)
                     /number=1
     exon            complement(576775..577203)
                     /number=2
     CDS             join(578810..578969,579023..579305,579359..580577)
                     /codon_start=1
                     /locus_tag="AO090005000221"
                     /note="predicted protein"
                     /old_locus_tag="AO070289000063"
                     /protein_id="BAE55313.1"
                     /transl_table=1
                     /translation="MADTSSSTTIQQSSAKEAALQKVSSGTPRSRDGIADWKWKGSLA
                     AVMLTTVINGYDVSNVANIQPRLYEAFGDIALLPWIGLSFSLAVFAFLSFSRKIIYCF
                     DMQWIYIVSVVVFMAGAAVAGAAHNLATVIVGRTIMGVGGSVIYQSNLTFVAVFATPA
                     ETPLLFGLLGALWAVGLVIGFPIGSALASNPNTTWRWAFYMNLPWAGLVLVIAFICMP
                     SKYLGPDIPVWSRIARMDPIGITMNIAVPALFSIALEFSGPVWDWGSGASIAVWVVFG
                     VLLIGWIVQQYWCMGTTPDQRAIPLHLFRRLDLVPLWIASGCAGASYAGTLYYTPLFF
                     AFARGHSALQQTVRLLPFVILFIAVVLLVGALLPLFGRYNLIYIIAGLATVAGAGAMA
                     ATLSPDVPESQVMGLEALIGVGLGCSYQHGVGISNVINKDPRDKVDSVVMFNLAQMGG
                     ITVILSIAGSIFQNVGFHLLKEVIGGNGYSEDDLRQALAGVSSTVWGSDDPDVLARGV
                     QAVSEALAREYYLIVAGGALCFVCGLVMKWEKLDYGRGRGKKPEA"
     exon            578810..578969
                     /number=1
     exon            579023..579305
                     /number=2
     exon            579359..580577
                     /number=3
     CDS             join(581380..581487,581537..582355)
                     /codon_start=1
                     /locus_tag="AO090005000222"
                     /note="predicted protein"
                     /old_locus_tag="AO070289000062"
                     /protein_id="BAE55314.1"
                     /transl_table=1
                     /translation="MAFLYQMLGSKIWPPRDTKPDLTGRTLLITGAECLPNSGLGYES
                     VIKFVRASAKRIIIGVRSIEKGEEAKRAILAQIPQSNVTIDVYHLDMLDYTTIEAFAS
                     RVNQEVERLDYVVLNAGISPHAYKKSAYGFESGIQVNLVSTTLLSLLLLPKLLASKTD
                     TFTPVLELVGSGTHQRMPQLLPETDNTEKDISEVYNSETSFRTFGFIQQYSLTKLFLM
                     YVQWQLVKLVDDKVSGSPRVYVIVVGPGPTQSGLGRDFQEQSSLGVRVAVHTMNLLTK
                     TAEQGARTYLSGLMLGEKGHGQFWQWDSVNRC"
     exon            581380..581487
                     /number=1
     exon            581537..582355
                     /number=2
     CDS             complement(join(582810..582857,583513..584004))
                     /codon_start=1
                     /locus_tag="AO090005000223"
                     /note="predicted protein"
                     /old_locus_tag="AO070289000061"
                     /protein_id="BAE55315.1"
                     /transl_table=1
                     /translation="MATNTKPAIVICHGSYHSPTPYEPFMEKLQSQGFETYCPHRPTC
                     DLSKLNVGDVDHPDFDLGPPAEGYPTDTDDVNVVVKLLDKLVNEGGKLVLLVAHSSGG
                     WVATQAAIPELQANSRRSEGKTGGLIGIFYMGAFVVPVGESIHSFFQPKDGITFVPPF
                     MRFHTCWRYAQELVDMINW"
     exon            complement(582810..582857)
                     /number=1
     exon            complement(583513..584004)
                     /number=2
     CDS             complement(join(584681..584722,584960..585220))
                     /codon_start=1
                     /locus_tag="AO090005000224"
                     /note="predicted protein"
                     /old_locus_tag="AO070289000060"
                     /protein_id="BAE55316.1"
                     /transl_table=1
                     /translation="MIRGYVPVRVLPRPFTNLNLFEHLSGARINANINPREQRFNIFK
                     NLALCCCQAPTPLSQYRNVRGYWPVDRCLVQSTPGGGRTKECSQVKSREPWELEIK"
     exon            complement(584681..584722)
                     /number=1
     exon            complement(584960..585220)
                     /number=2
     CDS             complement(join(586863..586921,587302..587531,
                     588498..588917,588977..589210,589262..590007))
                     /codon_start=1
                     /locus_tag="AO090005000226"
                     /note="predicted protein"
                     /old_locus_tag="AO070289000058"
                     /protein_id="BAE55317.1"
                     /transl_table=1
                     /translation="MTAQVDSPPLASSVSSVSSVGRQTIKKTRLQQVVVIVQLVGVTL
                     TASLINGLVTIALPTITKDLELPSSLAFWPSSVSSLATASTLLLAGSIADTIGPRWVE
                     LVGSFSSGALMIGQGLAQNGEGLVVMRALQGVGLAFHLASSVSIITQLLPQGRGRNFA
                     FSCIGLSQPLGFSLGLVVGGVLVDTIGWRAGWYIAGGITLFFAVIAVWTIPKNKTVQD
                     ESLLHNVRTKIDWLGAFLASAFMALLCYLLAIVSADPSRIKSVDSIVILCLAAIALPL
                     FIISSHHRVKRNKVALIPNSLWRNTSFSSVCATVALSNAVLNSMELFASLFFQEVQYL
                     SALQASIRILPSLIVGALLNLIIGLFVHKIRAVWIVTITSLLCAGSPLLMAVIQPSWP
                     YWGNAFFAQILQPVSFDALFTVGLIVITDVFPDDTQALAGAVFNTSAQFGSALGLAVL
                     QVISTVVTDQSGAAKESFTMPGAWRYLTMGGENEGEHVTAAIAAAPVSKICFWERSTG
                     TKIITAFNVAWANGKESATYGDTHGATKTVLELRYDFNTQNIGRGVRRYNDGAG"
     exon            complement(586863..586921)
                     /number=1
     exon            complement(587302..587531)
                     /number=2
     exon            complement(588498..588917)
                     /number=3
     exon            complement(588977..589210)
                     /number=4
     exon            complement(589262..590007)
                     /number=5
     CDS             complement(join(591703..591992,592053..593477,
                     593541..593622))
                     /codon_start=1
                     /locus_tag="AO090005000227"
                     /note="Na+/Pi symporter"
                     /old_locus_tag="AO070289000057"
                     /protein_id="BAE55318.1"
                     /transl_table=1
                     /translation="MAVLDEYTYVFAIGTIFALLDAYNNGANDVANSWATSVSSRSIS
                     YRQAMIFGTIFEFLGAVCVGARTADTIKNGIIPVSAFRDDAGVQLMAFACALAAASSW
                     VMWCTKHSTHVSSTYSLVSAVAGVGVATAGASKVQWGWNHGKGLGAIFAGLGMAPVIS
                     GAFGAIIYMLIKVIVHMRKNPVPWAVYTSPFWFLVAATICTLSIVYKGSPSLGLSKKP
                     GWYIAAVTLGCGGGVALLSAIFFVPFVHARVIKKDQDVKWWMFIMGPLLLNRASPNVG
                     EQAKVPDYAVVQDDHDDMASVPSTAGSTTGEPGKDQTQTKEKALVMAETQATYQELVA
                     QGEARFHARLMKKRGPLGWAMRTLRDNPMGAGEIYEWRNMLRLAKRVPAMITVGLLYG
                     MNYDIHAAQSGVHGTPEGERMARVYAHAPKYPNEVEHTYSFVQILTACTASFAHGAND
                     IGNSVGPWAVMYSAWKTGDAQQSKAPVPVWQLAVLALTISAGLITYGYNIMKVMGNKI
                     TYHSPSRGCCMELGAALTVLVFSQYSLPVSTSMCITGATVGVGLCNGTWRAVNWQRVL
                     LLMIGWVMTIPIAGTLGGCLMGLFLNAPHFSS"
     exon            complement(591703..591992)
                     /number=1
     exon            complement(592053..593477)
                     /number=2
     exon            complement(593541..593622)
                     /number=3
     CDS             join(598343..598634,598696..598811,598869..598935,
                     599003..599142,599194..599458,599504..599794,
                     599844..599957,600020..600243)
                     /codon_start=1
                     /locus_tag="AO090005000228"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070289000056"
                     /protein_id="BAE55319.1"
                     /transl_table=1
                     /translation="MSNPSAFDPEKPSSSALENVAESSLEAVDEKRPHEEALPTYDVE
                     MENRILRKMDLRIIPMLAVLYLLAFLDRGNVGNAKIEGLLEDLNLTGPQYNWCLTVFF
                     FTYAAFELPSNLLLKKMRPSRWLPLLMVAWGIVMTLMGVVHNYAGLLSTRIFLGVAEA
                     GLYPGVAYYITLWYPRHRAQFRQALFFSAASIAGAFSGLLAYGIAKMDGVGGYAGWRW
                     IFILEGLLTIVVAFIAPFAIHDSPETAGFLTEEERKFVIHMLRTQNTGGTAEATEFRM
                     KYVIDALLDWQIYVSIIVYWGITCPLYGISLFLPSIIKDLGYTSSTAQLLTVPIYITA
                     AVVAVIAAWLSDRQKQRSPFILFFMGLIAAGFIIVLASTGRGVPGVVYFGVFVSVVGI
                     YPAFPGNITWLSANLAGDYKRASGMAIQIGLGNMAGAMASNFYRSQDAPKYILGHALE
                     LGFCVAGMIAAVILRLSYQMINRKRDRIDLSGYDEAEMEKMGDRSPIFRYML"
     exon            598343..598634
                     /number=1
     exon            598696..598811
                     /number=2
     exon            598869..598935
                     /number=3
     exon            599003..599142
                     /number=4
     exon            599194..599458
                     /number=5
     exon            599504..599794
                     /number=6
     exon            599844..599957
                     /number=7
     exon            600020..600243
                     /number=8
     CDS             complement(join(603773..603826,603894..604295))
                     /codon_start=1
                     /locus_tag="AO090005000230"
                     /note="predicted protein"
                     /old_locus_tag="AO070289000054"
                     /protein_id="BAE55320.1"
                     /transl_table=1
                     /translation="MTISKKLKKDLGGFWGPGTRDVLFLLRGLFAGGILVFAFGLKRW
                     RVNYGLTSTREPSTKLAVPYRAKDSPTARSEYSHPDAVIVLTCLSWYYGGLSNEDLFS
                     AFSHLLKTDQVDMEYQLWVKDAYQLPTKFQQLAGQERIRFCIAINVHHR"
     exon            complement(603773..603826)
                     /number=1
     exon            complement(603894..604295)
                     /number=2
     CDS             complement(join(606063..606244,606299..606440,
                     606506..606577,606631..606636))
                     /codon_start=1
                     /locus_tag="AO090005000231"
                     /note="predicted protein"
                     /old_locus_tag="AO070289000053"
                     /protein_id="BAE55321.1"
                     /transl_table=1
                     /translation="MKFISVIALLAPTVLAAGWIELIQEKCPDIPNRCLDIAKEAHDP
                     VFDIVAATKATQTLPGCNPAYLECIKNMDDTYEPGATQGNPVTCVLQIAPDHFKYFLD
                     NDSAEIPIPSNQNCPLRELHRVAHVELGSLA"
     exon            complement(606063..606244)
                     /number=1
     exon            complement(606299..606440)
                     /number=2
     exon            complement(606506..606577)
                     /number=3
     exon            complement(606631..606636)
                     /number=4
     CDS             complement(join(609484..609615,609693..611453))
                     /codon_start=1
                     /locus_tag="AO090005000232"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070289000052"
                     /protein_id="BAE55322.1"
                     /transl_table=1
                     /translation="MTNMAMSEQRIFRGIPYVTGAASATLLAADLELSFWGGVDPRTG
                     EIIDRFHPLSGRFMKDTILAIPGGRGSCGGSVIMMELILNGLGPKALIFERREEIITL
                     GVMVAEELFDKTAAVVTLNPEDFCEALGWDGKTVHIRGELVSDAPLKADSANGAAKPT
                     IDLNNFGVKLTDADRAMLDGASGEAAKISLKIIIRMADMMGAKELMDVSQAHVDGAWY
                     GPGSNAFGQRLRDWDGKFQVPTTINALNVDQKRWRLLGIDAEFGSACDELAKAFVDMG
                     GKISFTCAPYLLETAPRLGDPIAWGESNAVIYANSVLGARTLKNPNMLEAFIALTGRA
                     PKAGVYVDENRFASTWLRVTPSEGADDSFWPILGYALGAIATTHIPVITGLEHLKPSN
                     DDFKAFSAAFATSSSAPMFHMVNLTPEAPTLEAACANGMVPKAIDVDSKDLYAIWDEF
                     NHGSEPREIDLVSFGNPHFSCREMKEVARLCQGRTKNDNVSVIVTCGRAQYSLASQAG
                     YVGELEKFGVQFLQDTCWCSIEEPIIPKNTRTIMTNSGKYIHYGPGLTGRQFAFGSLE
                     MCVDAACTGKTTGDPPSWLQEIPGLPVIKMLRLLLMLPNYLHPDWSILTCVQVSVKQI
                     NIKFLF"
     exon            complement(609484..609615)
                     /number=1
     exon            complement(609693..611453)
                     /number=2
     CDS             complement(611953..612363)
                     /codon_start=1
                     /locus_tag="AO090005000233"
                     /note="predicted protein"
                     /old_locus_tag="AO070289000051"
                     /protein_id="BAE55323.1"
                     /transl_table=1
                     /translation="MPLVTATTAVLPDERDDGLGLMPISVPYQSTRPTSEAKSLFLRT
                     GSSSPAAISERIYRPCLERVVFLLTSDCDLLRTDLSLPSYQDVHVPHLASKITMDLDK
                     LVQHLAANATCLGPVPGIRKAAVDSSIRESIITV"
     exon            complement(611953..612363)
                     /number=1
     CDS             join(613628..613678,613802..613996,614012..614197,
                     614253..614339,614372..614458,614523..614783)
                     /codon_start=1
                     /locus_tag="AO090005000234"
                     /note="zinc-binding oxidoreductase"
                     /old_locus_tag="AO070289000050"
                     /protein_id="BAE55324.1"
                     /transl_table=1
                     /translation="MSFCFGFQGIAQKFLLTGLYPFPLKDGHVPLSDGAGVVAAVGSR
                     VHRFRVGDRVATLFHQDHLAGPLDAKSRTSALGSSLDGGVFTEHGLVNVQENLSLLEA
                     SSLPSAALTAWNALYGLEGMVSRQGDTVLTEGTGGVSIFAMQFAKSAGAKVTATTSTA
                     QKAERPKELGADYRGEPAKNSTPNEERVSAVVEVGGPASLRQALTALKFDGSISMVGS
                     VGGFVDPGSNTEEPTFFDTAIHSCTVRGIAVGSRLRFEDTNRAIEVNDLHPVLDRQTF
                     KLEEARDAYQYI"
     exon            613628..613678
                     /number=1
     exon            613802..613996
                     /number=2
     exon            614012..614197
                     /number=3
     exon            614253..614339
                     /number=4
     exon            614372..614458
                     /number=5
     exon            614523..614783
                     /number=6
     CDS             complement(join(617300..617744,617807..617943))
                     /codon_start=1
                     /locus_tag="AO090005000235"
                     /note="predicted protein"
                     /old_locus_tag="AO070289000049"
                     /protein_id="BAE55325.1"
                     /transl_table=1
                     /translation="MNPLGLPADEWTSTVLRRAKDAATNTNRILGNMIGDDMISNSQA
                     MVCIALVPALQIHLLDATSEKQMVQRMGRHNLEFCMMVIEELKSVYFGAEILSRMFTK
                     AKNWILYRTFAPATAPREHMPQSSRDSTIGSIPEPPNDARQDDVEIFDAFVTMLSPFA
                     PLSAGGPFDNDEYVLSIVLDPLVSRLPMTISAR"
     exon            complement(617300..617744)
                     /number=1
     exon            complement(617807..617943)
                     /number=2
     CDS             complement(join(620356..620968,621038..621228))
                     /codon_start=1
                     /locus_tag="AO090005000236"
                     /note="enoyl-CoA hydratase/isomerase"
                     /old_locus_tag="AO070289000048"
                     /protein_id="BAE55326.1"
                     /transl_table=1
                     /translation="MAEEDLVRLDINGIFAVITLNNPKKSNALTQSLYYRLASLLREA
                     EDNSDVYVTVLIGEGAFFSAGADLKGKPPSMEDMLSRPHWLPKLVNNNIDVARAFYSH
                     SKILVTALNGPVIGLSAALISHSDFIYAVFDAWLMTPFTSLGLVAEGGSSVAFVQRMG
                     QGKANEALLLGRKIPVSELAQVGFVNKVFESKGNFREQVMGYLQQTFGEHLVKSSLLG
                     TKALMRRRLVREQDEQAPLEMFGGLDRFFQGIPQAKMGEALSKSKTYRL"
     exon            complement(620356..620968)
                     /number=1
     exon            complement(621038..621228)
                     /number=2
     CDS             join(621555..621626,621683..622471)
                     /codon_start=1
                     /locus_tag="AO090005000237"
                     /note="predicted protein"
                     /old_locus_tag="AO070289000047"
                     /protein_id="BAE55327.1"
                     /transl_table=1
                     /translation="MGHLMWCLGLVLGLSLKNLPFMWHFRFFGALAMGYLTRRRSGYA
                     LQQRHIFLLAVVRSRSSATEGDFNIHKSNSTYITDLDVSRAHLSGLLFAPILLQIKSS
                     VHCNLIVSAISCTFHREIKPFQRYEIWTRVASWDDKWIYMVTHFVDTSKSCPSCYVMQ
                     AHTSTNRKMRVPAPHKKEHHEVVFASAVTRMVFKSGRLTVPPKRALEICGLLSAPAAE
                     SPMATSCPGPGAGVTESATGFNEWTVEEMAVYKETNLPIVRLERGWDAVRELFREDQS
                     VLAEYRDFMW"
     exon            621555..621626
                     /number=1
     exon            621683..622471
                     /number=2
     CDS             join(625401..625476,626062..626777)
                     /codon_start=1
                     /locus_tag="AO090005000238"
                     /note="predicted protein"
                     /old_locus_tag="AO070289000046"
                     /protein_id="BAE55328.1"
                     /transl_table=1
                     /translation="MVVSCVHAFNSQFSQTQQVVRSASRAPTTQFQCDQGATPESGFS
                     ISPSGLLEFQGSSEFLACDTGQNGGRNIHVTPSKDLGQCVIVELKADSCAPSASTAPS
                     ASPSSSKSCPTTLSSGNFEFPHLIIPVDSKSPNTAFGTSFNGKVTSAISSIFNFDIPQ
                     ADSGKMCNLVFLFPQKADLQTSSFSFSGDGKINFSKLSKAATTSTTFKNAPSVSQNLG
                     DITISPGHSFVVSTFSCPAGEAIAFEMKNAGTTDLELFEDFNPSP"
     exon            625401..625476
                     /number=1
     exon            626062..626777
                     /number=2
     CDS             join(628591..628655,628711..628999)
                     /codon_start=1
                     /locus_tag="AO090005000239"
                     /note="predicted protein"
                     /old_locus_tag="AO070289000045"
                     /protein_id="BAE55329.1"
                     /transl_table=1
                     /translation="MQFTTIINVALLVAGSLGYANNCKGSSNSPSITDCQEAIRRIDE
                     SSSYGDGAEFSVGNCYMVYATNGAGEHKVDGKTIRNTAQSILDSCGHHKGSYGTNNDC
                     DSCHVTVNYRAPKKF"
     exon            628591..628655
                     /number=1
     exon            628711..628999
                     /number=2
     CDS             complement(join(630816..631988,632024..632725))
                     /codon_start=1
                     /locus_tag="AO090005000240"
                     /note="alkyl sulfatase and related hydrolases"
                     /old_locus_tag="AO070289000044"
                     /protein_id="BAE55330.1"
                     /transl_table=1
                     /translation="MSQPTINPEDSHPPSLHIIEQWKEVKQSLPFDDQQDFDDSRQGW
                     RGHLHPNQVTNDQGVVWDNDVYDFLKEDAPFSANPSLWRQSQLTRKNGLYHVAGPIYQ
                     VRGLDLSNTTIIEGDEGIIVIDPLTSLETGAAALALYQKHRGSNRDVKAIIYTHSHVD
                     HFGGVKGFVSEKDVEEKDVKIIAPEGFLEHAVSENVYTGTSMSRRAAYMYGAALERGP
                     RGQIGAGLGQTTSTGTHRRKVNHRWDPNGVPMAPDTEAPSEMLIWFPDLNALCAAEDA
                     THTFHNILTLRGAVVRDPHSWAKYLTETIDRYGNKVEVVFAQPHWPTWGNDNILKFLT
                     YQRDLYAYVHDQTLCLLNKGYNGPEIAEMLTLPPALDQSWYCRGYYGSLSHNVKAIYQ
                     RYVGWFDGNPAHLWEHTPVAKAKRYVKLIGEDEIIEQGVKGYLKGDYRWAAELLSHAV
                     FNNPDNKDACNKLADVYEQLGYGAENGTWRNFYISGATELRSGNFGTPTKTASADVAG
                     QLSPDMVLDTLAIQIKGPEAWDKKLLMDLVVSDQDNKTYHSWLSNGALVYSTADQSDA
                     AQVTLSGTAKQLTALAVYGPDPEALVNTGVVIDGDTTALDMLASLLDPGDPNFNIVTP
                     "
     exon            complement(630816..631988)
                     /number=1
     exon            complement(632024..632725)
                     /number=2
     CDS             join(633877..633893,633979..634083,634186..634378)
                     /codon_start=1
                     /locus_tag="AO090005000241"
                     /note="predicted protein"
                     /old_locus_tag="AO070289000043"
                     /protein_id="BAE55331.1"
                     /transl_table=1
                     /translation="MDQLNSKQEINDAIAKHGSFVLMFTAVWSDVGNITKRNYERIGA
                     KHPTVYMAWVSTDDHPELAEEWGFTAIPSTVAYKNGTKVDYFVGPQYLDEQVEEFIKK
                     TL"
     exon            633877..633893
                     /number=1
     exon            633979..634083
                     /number=2
     exon            634186..634378
                     /number=3
     CDS             complement(join(634823..634917,635114..635245,
                     635909..635958,635977..636026))
                     /codon_start=1
                     /locus_tag="AO090005000242"
                     /note="predicted protein"
                     /old_locus_tag="AO070289000042"
                     /protein_id="BAE55332.1"
                     /transl_table=1
                     /translation="MLALDVPSVDLVLRAFKLVEERFDGPAASDLNNWNIHIKADKLI
                     STEEIKISNKSGVQCNLCGMSKNGVKKIRLLEDYTRVISVGISSSCTSVAARQMLSDG
                     WTTSTV"
     exon            complement(634823..634917)
                     /number=1
     exon            complement(635114..635245)
                     /number=2
     exon            complement(635909..635958)
                     /number=3
     exon            complement(635977..636026)
                     /number=4
     CDS             join(638838..638990,639043..639079,639132..639988)
                     /codon_start=1
                     /locus_tag="AO090005000243"
                     /note="predicted protein"
                     /old_locus_tag="AO070289000041"
                     /protein_id="BAE55333.1"
                     /transl_table=1
                     /translation="MTDPESHGPSGIVLASVFGGIALTTVGVRLWARCVIQRRGGWDD
                     LCAGLAVVPVLGLAIAFVLSSEVYGANLHTWDNTLPKLIAQRQVALAMEMLYVLGSGL
                     VRISVLLFYRRMGFRSISRGFMLTTWISIFSVVGYSVAFLAVIFGSCRPLHAYWDQIN
                     PVWAASHTWKCYNEAVHIIVATGVALVQDAVVTTLPAILCWNLRISFREKIALGSIFV
                     AGYLTPVIAGIRLYFIVRLYYVSYDASWTSWYCWMLAMMELLIAITCSSLPAARVFFN
                     QYKPHVDFVGTARGIKSVFSRSTSRKSISAERSRRVSSSTVKLTEQTYSKNSNTFTDD
                     GPEIELDRMQKMPV"
     exon            638838..638990
                     /number=1
     exon            639043..639079
                     /number=2
     exon            639132..639988
                     /number=3
     CDS             join(641238..642130,644205..644331)
                     /codon_start=1
                     /locus_tag="AO090005000244"
                     /note="predicted protein"
                     /old_locus_tag="AO070289000040"
                     /protein_id="BAE55334.1"
                     /transl_table=1
                     /translation="MPDHGIAYPRLPSEFNEVTNPIPNLRPHQARKIVIYYQTMTVSL
                     KDLAVAYLIESWLQMETLTHLIVGCFHLGRNGYLHLNNHTPDHESFTELWQDKQTLQQ
                     RGLKVLAMLGGACPGSFIVLDEDESFQECYKTLYDMLVKYKFDGIDLDIEEPISQNGI
                     NRLVDRLRADFGPNFIITLAPVATALQGKAHLSGFDYLRFEGERGDKINFYNTQFYNG
                     WGSLETTKDYDAIMAMGFPPSRVLPTLLTHRNNGTAGFIEFDKLRPVLIELRLRYPYL
                     GGVAGWEYFNSDPGGQEMPYQWLAIVSFIETSVYLLGPDHRRLLSFARTQQSRGHPRD
                     SLLGQ"
     exon            641238..642130
                     /number=1
     exon            644205..644331
                     /number=2
     CDS             complement(join(645862..646243,646311..646663))
                     /codon_start=1
                     /locus_tag="AO090005000245"
                     /note="predicted protein"
                     /old_locus_tag="AO070289000039"
                     /protein_id="BAE55335.1"
                     /transl_table=1
                     /translation="MESLDQAVSEGDLILLYVLGQRAFMFLVESCPDSQISNPKISSI
                     TVREVKVGYLDEPGRCVVSGPDVYYNEEEDDDTSEDDDSSSEVSYGLTWGRLSMYVAR
                     FPADSKIEYRVNPHGRDVLKDYWRGKCPFCQTLGWYCPGCSWDFPDLRGGCSVDQSCP
                     VCLGYDFAMDDKIRSREVGEYETRLSRGECSFGCYGEPEELKQEILKMVRERYEFIDA
                     RRQEMGLSGYDVDDIVESWFADGDDE"
     exon            complement(645862..646243)
                     /number=1
     exon            complement(646311..646663)
                     /number=2
     CDS             complement(join(648753..649365,649435..649531,
                     649613..649703,649754..650209,650267..650294,
                     650370..650623))
                     /codon_start=1
                     /locus_tag="AO090005000246"
                     /note="amino acid transporters"
                     /old_locus_tag="AO070289000038"
                     /protein_id="BAE55336.1"
                     /transl_table=1
                     /translation="MATHGSADHDGLDMSQIDWLPRMLTVPSLGTSPGTSEPRRSDTH
                     LQPSLSSISFRQPESVTVVVDPRDGAGSDQVILDEQDRTVNRRLRGIHVFMITISGVL
                     GVGLYLRSGSILRIGGPAAVLISFSAMGLLAWLVMQCIGEFLAIWPVAGALVEFVGTF
                     VDEDLGTTVGIAYWWVPLTRRSMAVSQNFQLTVVACRISYCLNFAAMIVAAAGEVEFW
                     NTSKAIQGTVILFIVPLFLVLLNSFGVQVYGFTEVIGGSVKILGAIVVTVSMIVINVG
                     DLPTVFSLQVLTRFQTIATHLYFSTMIEQRETGISFSIAAFSFVGVDIAAATALEARP
                     DRKRISAEDPLNEELKQPWPFISIRFSATWTSFIAWIAYFVAGFVMTLNLPWDSDQLP
                     EAGWLGHPGPKSDRPTDSGFVISAKQSGIKGLADLFNVILLFTALTCANTNLYVGSRT
                     LFGLTRKIYGRKWRWLAFFGKTNSYQVPVRAMFLSCCFLWVPFLYLSPNNSKGTTIAS
                     VSET"
     exon            complement(648753..649365)
                     /number=1
     exon            complement(649435..649531)
                     /number=2
     exon            complement(649613..649703)
                     /number=3
     exon            complement(649754..650209)
                     /number=4
     exon            complement(650267..650294)
                     /number=5
     exon            complement(650370..650623)
                     /number=6
     CDS             join(651974..652145,652199..652283,652345..652532,
                     652583..652887,652938..653387,653448..653648)
                     /codon_start=1
                     /locus_tag="AO090005000248"
                     /note="predicted protein"
                     /old_locus_tag="AO070289000036"
                     /protein_id="BAE55337.1"
                     /transl_table=1
                     /translation="MVALTEHVQTSLPRPIDPFSLVPYIDDLWHVAKSRTCFQDDESK
                     VQVDWTDSDSEHRVTRRTFSSLAELQAHQKVASTESNGLRFISINQGNSWRPLNVTQE
                     MFEEIGKLTSSSHMLHNLSLSFHDRFMATETAFSSAPTFVWNEQSIEVAYIFKYASQK
                     TNNDKPDSWTIRQTGVYQRFDTATKHSTWIFLNPTRDCLFQQRLMDMLMSPSQCSQLT
                     SHPLLIHNLLFATFFPKWREYLGSHEATVLTVSNTTVTERIQDPLRVNHQMLTSIRSV
                     ESRCLPLQALFRSFDKTLQTLRKANNALKDCGGVQHLPWHKMDQLLDNYESYADAYLQ
                     AASFLQSRAATTAQLIADTFSFKNSHTAQEQSDYMLDLTSSTVDDSSTVRVITVVTLI
                     YLPSTFMALLNTQTLLGMNSFFEMDPQTHHLVVSPQFWIFVVCAVPLTAVTVLYWWVR
                     SKRHSKHAKGKVELLA"
     exon            651974..652145
                     /number=1
     exon            652199..652283
                     /number=2
     exon            652345..652532
                     /number=3
     exon            652583..652887
                     /number=4
     exon            652938..653387
                     /number=5
     exon            653448..653648
                     /number=6
     CDS             join(658209..658351,658441..658648)
                     /codon_start=1
                     /locus_tag="AO090005000249"
                     /note="predicted protein"
                     /old_locus_tag="AO070289000035"
                     /protein_id="BAE55338.1"
                     /transl_table=1
                     /translation="MIDDAVSATGVPIFAATLFCFVDQGVGLCVCYHHNAVDATGFTE
                     VVRLCSIRVLATSNEEAMRSLFKICARISESQSHSKINSRHIAELYRLVNCMEDYRSL
                     FAGWDLGLGPVWVA"
     exon            658209..658351
                     /number=1
     exon            658441..658648
                     /number=2
     CDS             complement(join(659026..659947,660642..660679))
                     /codon_start=1
                     /locus_tag="AO090005000250"
                     /note="thiamine pyrophosphokinase"
                     /old_locus_tag="AO070289000034"
                     /protein_id="BAE55339.1"
                     /transl_table=1
                     /translation="MNSGSHGLVLVEIFASNDEPTSQSEVLTKCYTFRVNGCSAILGY
                     ILHEIVEKIEWSDSWSIDHHQRTVTLAVPATATADMRSRVLEDTLQATRKLGLISMLQ
                     SWRDETFPVYGPEGQLLLEIERCATALFGIVTYGVQLLCYVRDEQGLRLWIGRRSERK
                     QTYPGMLDTTAAGGLVTGKLPIEALICEAHEEASLPEEMVRDKVKPISHLTYFHVRGS
                     KAGGEIGLLQPEVEYTYELELDPGMTPKPRDTEVESFSLYTIDEVLCALKEGQFKPNS
                     AIVIVEFLILHGIIRAENESGYAEILSHLHRELQFPVRILPST"
     exon            complement(659026..659947)
                     /number=1
     exon            complement(660642..660679)
                     /number=2
     CDS             join(664292..664359,664412..664480,664554..665404,
                     665460..665613,665663..665738,665821..665939,
                     665986..666043,666096..666504,666560..666583,
                     666696..666850)
                     /codon_start=1
                     /locus_tag="AO090005000251"
                     /note="predicted protein"
                     /old_locus_tag="AO070289000033"
                     /protein_id="BAE55340.1"
                     /transl_table=1
                     /translation="MRRRHSKWVMVILHSMLITQVCRPFCLSTRYPVGAGIMILSQAM
                     GEEKIENYHGVPMLTHGRNVSYDIPDPGLPEVSQWLTANPNRINLGRIGLQYKGSLVS
                     ASQITEPRQELDLWKGVITSTFKIDGQLVNVVTQGDLHSDSVVFEIESSLIASGDLGV
                     ELDFPYPPIHSTKYKYEVFVGVYDFPENHTTSIEGYRDSMAHIRHELQETNYYLNLRW
                     GPGQPLRLSRQHNATHRYTLKSRSSSSMAFTANFSPEMQTADLPAVVQQRSSSAWNQY
                     WTQGGFIDLTSSSNPKADELQRRIILSQYHVRVNSAAKGQSPQESGLMNNGWYGKFHM
                     EMVIWHNAHWATWGRQEQFDSIFPELYDTLLPSSFARARSMGWDGARWPKMTDVETGV
                     SSPGGINGLLMWQQASPTHETLERWDRILTATADYMASYAWKNTSSGYYDLGPPAYGV
                     TENTPPSESLNLAYEIAYWRYGLDVAREWKRKLNQPVPEKWTVVAEGLARPPQIDGLY
                     TVYEGLNSSWWNDSSLSGDPRSLIMLQGILPNTPAVDPDIASKTAKKVWEIWTDDKIR
                     GWGRPVLAINAARVGDPDRAIYHLTAYGYWNFDDAGFAERGGDGLFTYEREVIIALTT
                     IVAYMAAGWEGSQGDAPGFPQDGSWVVRHEGLIRAP"
     exon            664292..664359
                     /number=1
     exon            664412..664480
                     /number=2
     exon            664554..665404
                     /number=3
     exon            665460..665613
                     /number=4
     exon            665663..665738
                     /number=5
     exon            665821..665939
                     /number=6
     exon            665986..666043
                     /number=7
     exon            666096..666504
                     /number=8
     exon            666560..666583
                     /number=9
     exon            666696..666850
                     /number=10
     CDS             join(667229..667735,668148..668165)
                     /codon_start=1
                     /locus_tag="AO090005000252"
                     /note="predicted protein"
                     /old_locus_tag="AO070289000032"
                     /protein_id="BAE55341.1"
                     /transl_table=1
                     /translation="MFAKLAFVLLAIEASAQSITSTATSTATSTLPTLQSDWYFIRAV
                     ETPYYHSYLQTIPSATPGPAHLASNTNAGQFNIVSGQLVYNTGTEQLYMNVEDPTNKT
                     QRTLQTWFNETENAYGTFAFQGDAVTWTVEDIDRQNTAAWLVCGEDKLYINTGAYGYQ
                     TPDGCYDQTGSLNV"
     exon            667229..667735
                     /number=1
     exon            668148..668165
                     /number=2
     CDS             complement(668270..669085)
                     /codon_start=1
                     /locus_tag="AO090005000253"
                     /note="predicted protein"
                     /old_locus_tag="AO070289000031"
                     /protein_id="BAE55342.1"
                     /transl_table=1
                     /translation="MKFHLWAVALASALCVQANEWHAYYRLDSKAYQTKFDEMVSQGF
                     RLNSVSGYEYNKEPNFAVIFEKRPSPAWKSHHGMTSDQYHQKFEDYLKQGYRVVQVNG
                     YTVGGKDRYTAIWEKDSSLPWISRHGMNKEWMQKYFDKYLEEGYRMTHVSGYEVDNES
                     RYAAVWEKRNDSTAWVSVGELNSTEYQATFDKHVKDGYRLVDVDGYQVGDEVLYAAIW
                     DKSASGAWVARHGVESSKFQAEFNKYRDEGYVLRTFSAYNDGTADRYAAIWVK"
     exon            complement(668270..669085)
                     /number=1
     CDS             671852..674428
                     /codon_start=1
                     /locus_tag="AO090005000254"
                     /note="predicted protein"
                     /old_locus_tag="AO070289000030"
                     /protein_id="BAE55343.1"
                     /transl_table=1
                     /translation="MAIKTRHIPVLPRPRWLDAAGMGKGIDHDRQHLSIVLAAGQTIK
                     ARQTNTAITGELTLRLLNDDNQTEASKKVGSDWAELSASVVSVPFIDTLYTDTSNAAV
                     EPVVEYEYPDGSKQLPVYRKGQSQSEFFNHWDNQGSEFALLDSSYTQVLVPVIDKEAL
                     RHPQEVDNIDGLIGYYESVFSFYNALAGLSFEPERPSDLNSTNRYFMKADKHGAGGAY
                     YGQNWTAASTNAIKEWWLLPSASNWGNLHEIGHGYQMSFRNDRYFWNGEVSNNVYAAL
                     YQSAYLGDRKYQEGWLYNYGKQAQVEQGIISDITSHKSLNDWDLRAKLYFLVLMVEKA
                     GVDSFADFNQQYRLVSNQPNFDSTNHLLLDMLSDSFSRIGHIDVTPFVELCSGYISPG
                     QREINQFGQGRAVYPLNQLVDGDTLTQLQEQLKLQSPLTLVTVSQLLASGIKGDVSLE
                     LKIDDFSQIYGKTITVLDGSRYVRQLTVETENISLGALPIGVYTFRLPLGRNSKYQVD
                     QRYLVVKPGSAQVHVNFVPQTGSQVTNQEIKLLGLGDNLFSTILVDQANHVVQVAVTN
                     KDPHSYFGNETYAEVVIKDNTGKEQFRATMPGVGATLRDDKIAFKPGYTLEVYHAEPS
                     HRIQLRPDFDGVIDHNQKRNIFEITSSGLKNQSLNNDPLAALLARIAAAATALRSHPT
                     RLHAECPSKVDIWLAIDQFTGSQREALLKEYSDCIPSDNNAPSEGLGNSFTAAFKGIG
                     DWQFLTTELDLVGRKLTVALRDGIAHHYFNDTYAALQVLDADGNELLNLDVKGSTSQT
                     ARNWTLPLSGYGGEVLNIRHEEAPTRLFINNNMRDLRLSGRETRQNYRVTSTGLELLT
                     RT"
     exon            671852..674428
                     /number=1
     CDS             join(677761..677767,677909..677955,678109..678145,
                     678330..678628)
                     /codon_start=1
                     /locus_tag="AO090005000256"
                     /note="predicted protein"
                     /old_locus_tag="AO070289000028"
                     /protein_id="BAE55344.1"
                     /transl_table=1
                     /translation="MHGIFQIQHYPLQDYLLLTDLLRCCLRRQGLTNPSSSTMQFTYT
                     AIALALATTISAQSSYLIMSCNTSPIPCQNVGIPCNNENTPWACPVSGDKVELFSNSC
                     RNINGYPEVRGSGFTLSDAQQTAGCKA"
     exon            677761..677767
                     /number=1
     exon            677909..677955
                     /number=2
     exon            678109..678145
                     /number=3
     exon            678330..678628
                     /number=4
     CDS             join(679624..679727,679778..680808,680867..680924,
                     680972..681198,681204..681279,681328..681521,
                     681578..682442,682490..682675,682736..682886,
                     682949..683068)
                     /codon_start=1
                     /locus_tag="AO090005000258"
                     /note="helicase-like transcription factor HLTF/DNA
                     helicase RAD5, DEAD-box superfamily"
                     /old_locus_tag="AO070289000026"
                     /protein_id="BAE55345.1"
                     /transl_table=1
                     /translation="MSLRRLLNPTDDDAGDEWPDDMRRVRPRLGGPVDWALNPTEDHP
                     DQMVYPTDMSFNHSFADQDMMFVNQLVPIPGLDAISFDQTSFLQPVPDDVGLSGTSMT
                     STPGLEFIDGPVGNVDVSMVDVASSVQEEQVCYGMVGHNPLHKHQILTFTQLVHEKVK
                     LVGISQDLETKILALKETNQHFQTLTIQPSSDGPLFLRFPDGTDLGYLSKKMEQALQG
                     LIGRPLFEIDALTNLNSLIDSLRRAGKPSDAAARVSINVYGRESDRDKVGRELSNKDL
                     FLQHPDGCRVGVKYDNPHILHLDGMDETDTDEEDEEDVIEVDVAETTPEQEEGLRETL
                     DEVFNSLTRGDHLRQLGGSETLNRTLYQSVTNYLAPSALGWKLICDIPDEYRLWQPKP
                     MARGQLYFHVITGNEQHEQPDESGGGILADEMGMGKSLTTLVLMAKTLQEARQWVEHA
                     KALPGASLAETPTRATLVIVPSRGPSPLNHIGRLTSKVLINTWEREIDDHLNAGIKMM
                     RYHGRSRKDLISNIDRYDIVITTYNTLAKEHDAKILGKGQSPLHDFAWYRVVLDEAHM
                     IRRRSTTFHRAVVELRAKSRWCLSGTPIQNSLGDLGSLLAFIQLKPFHDPRNFSHWIA
                     NPFGVRATKRKAIERLTHLLEAVCLRRTIERVDLPGQRSEIRLVQFTPEERAKYELTR
                     KDMKRFIHQQAGEYNQQAETFGMFQVFLQLRSFCNHGTYQPRFSWAKRNLLEDELDPV
                     CSMTRDSLNRCSGCRQPLPVIPHDRRPKYVESCKHVLCDDCSWGSSTHPDPEERRHCP
                     LCESLRGARYRGHIPGASNQRNRDDADFLNADGYSSKMRALISDVQRDIRTTKSIIFS
                     CWTRTLDLIAKHLKASRIEFERIDGKTSTSQRQKILDRFDGTRTVPVLIMTTGTGAFG
                     LNLQSVNRVFIVEPQWNPSVESQAIARAIRLGQEQQVLVTRYRVENSIEEAMCSQQTH
                     KLKISQMDFKKDLEASPTGDEGASDQPSDIQ"
     exon            679624..679727
                     /number=1
     exon            679778..680808
                     /number=2
     exon            680867..680924
                     /number=3
     exon            680972..681198
                     /number=4
     exon            681204..681279
                     /number=5
     exon            681328..681521
                     /number=6
     exon            681578..682442
                     /number=7
     exon            682490..682675
                     /number=8
     exon            682736..682886
                     /number=9
     exon            682949..683068
                     /number=10
     CDS             complement(join(683419..683669,683717..683978,
                     684027..684640,684703..685213,685263..685288,
                     685359..685386))
                     /codon_start=1
                     /locus_tag="AO090005000259"
                     /note="splicing factor U2AF, large subunit (RRM
                     superfamily)"
                     /old_locus_tag="AO070289000025"
                     /protein_id="BAE55346.1"
                     /transl_table=1
                     /translation="MNGDTYTSRDSGRSRDYYPYQRDERRERGDRGDRGDRRRSRSPH
                     HSSRSSRREYEVDTYSSSRDYRVREREDRYSSRRDDREWDRDRGGDRGDRRRRDYDDR
                     SSRRDRERGDLFEERPRRDGRDRDRERDRGDRRERRRSASPPPRKREATPDLTEVESV
                     LHRKRRLTQWDIKPPGYENVTAEQAKLSGMFPLPGAPRQQPMDPSRLQAFMSQPGAGT
                     AESASLKPSNSRQAKRLFVSNLPASATGENLLSFFNLQLNGLNVIHSVDPCISAQVSD
                     DRSFALLEFKTPNDATVALAFDGITMDESEAAGNGAANGAPQGLEVRRPKDYIVPSGN
                     EQEYQEGVLLNEVPDSPNKICVSNIPHYIPEEPVTMLLKSFGELKSFVLVKDGSTEES
                     RGIAFCEYADPNATSIAVEGLNGMELGDRHLKVVRASIGITQAAGLDMGVNAMSMFAK
                     TTSQDLETSRVLQLLNMVTPEELMDNDDYDEICDDVREECAKYGQVVELKIPRPSGGS
                     RQSPGVGKIFVKFDSVESTTNALKALAGRKFSDRTVVTTYFSEASLYLPFCNLSF"
     exon            complement(683419..683669)
                     /number=1
     exon            complement(683717..683978)
                     /number=2
     exon            complement(684027..684640)
                     /number=3
     exon            complement(684703..685213)
                     /number=4
     exon            complement(685263..685288)
                     /number=5
     exon            complement(685359..685386)
                     /number=6
     CDS             join(685726..685820,685877..686688,686751..687148)
                     /codon_start=1
                     /locus_tag="AO090005000260"
                     /note="8-oxoguanine DNA glycosylase"
                     /old_locus_tag="AO070289000024"
                     /protein_id="BAE55347.1"
                     /transl_table=1
                     /translation="MTVGAFSEWRRLPVSLSELCINTTLRCGQSFRWHNVPDSDEWRC
                     VLYGRLLSLKQDPTDLYYRTYLPAKLSNPIPLPTPPSSHPPSRADSNKPLDQPQSDKD
                     DILPILTHYFNLDSNLTSLYSYWSSNDPNFKKKAPQFTGIRILRQDAWEALVSFICSS
                     NNNIARISQMVEKLCTNYGPFIASVDGRAYHDFPPPEALTGDDVESRLRSLGFGYRAK
                     YIYQTAVIVSTQREKGWLDSLRNPESPALGVEPAPGGEMRPEGREGYREAHEKLLELQ
                     GVGPKVSDCVCLMGLGWGESVPVDTHVWQIAQRDYKFGKGAHKSLTKATYDAVGNHFR
                     KLWGKEAGWAQSVLFTANLKTFSDRLIASKKEEVEVKVKDEADEDCKVEVTTKVTTST
                     AVGVKRSASVHKVKTELSDEKDVKAIVETQTTRRMSKRLRNR"
     exon            685726..685820
                     /number=1
     exon            685877..686688
                     /number=2
     exon            686751..687148
                     /number=3
     CDS             complement(join(690743..691717,691987..692141,
                     692203..692298,692376..692451))
                     /codon_start=1
                     /locus_tag="AO090005000262"
                     /note="predicted protein"
                     /old_locus_tag="AO070289000022"
                     /protein_id="BAE55348.1"
                     /transl_table=1
                     /translation="MTNQTLHGLCPEPFYQESFFPSTGGFTRGRYCAQLPLADGNVSC
                     CIPCPLSDWMYGEDITTKAQAASWLSVGVLPLCIFLLVSYAVLPAKWTHRHYLSICFT
                     MGICFMEVCWEVILGNKFMWGAFICGWGIPGIGITVMLILTGVSFRFGDMCHINIQYG
                     TKDYWAPVTAFAGASLVLQLATMAYCIHVYVKSIFDTADSSTNSSHLPSYTSSVRTVT
                     ARQAYRRIRRVLKLQWRGVALVLIIIGNVIFFAVVFIKVNNKTNLTPENLQRAQPWLL
                     CLVSTKGDVKKCQNLAHAIGPNEDTILALLILLSLVGFWNFILFARPGMFLGWAEFFK
                     IKFGQNHEFVSADARAKTPDTRTYEMLESSGLKSPEPIVRAPSAARTMSPEGEHYGRE
                     ARYVRPSMSFSSPRPPSASQGRDWDPQSTFAQSSHQHTLSK"
     exon            complement(690743..691717)
                     /number=1
     exon            complement(691987..692141)
                     /number=2
     exon            complement(692203..692298)
                     /number=3
     exon            complement(692376..692451)
                     /number=4
     CDS             join(697339..697585,697661..697686,697746..697817,
                     697890..697949)
                     /codon_start=1
                     /locus_tag="AO090005000264"
                     /note="predicted protein"
                     /old_locus_tag="AO070289000020"
                     /protein_id="BAE55349.1"
                     /transl_table=1
                     /translation="MERDSNSLVNEVLRHSLALCRPEKLLIVMIPAIRENRKDWVTRQ
                     RFKKLQSTAQDVISPRACIATLRKSQTTDEGTYNDTDNIVKISRHPRKSIPFIEQVTR
                     TRPKIRGTRKNKKSDTVREKAGNEVAKSSIKL"
     exon            697339..697585
                     /number=1
     exon            697661..697686
                     /number=2
     exon            697746..697817
                     /number=3
     exon            697890..697949
                     /number=4
     CDS             join(698211..698298,698351..698464,698523..698555,
                     698734..698954)
                     /codon_start=1
                     /locus_tag="AO090005000265"
                     /note="40S ribosomal protein S13"
                     /old_locus_tag="AO070289000019"
                     /protein_id="BAE55350.1"
                     /transl_table=1
                     /translation="MGRLHSKGKGIASSALPYSRSAPSWLKTTPEQVVDQICKLAKKG
                     ATPSQIGVVLRDSHGIAQVKHVTGNKILRILKSSGLAPELPEDLYHLIKKAVAVRKHL
                     ERNRKDKDSKFRLILIESRIHRLSRYYKSVGVLPPTWRYESATASTLVA"
     exon            698211..698298
                     /number=1
     exon            698351..698464
                     /number=2
     exon            698523..698555
                     /number=3
     exon            698734..698954
                     /number=4
     CDS             complement(join(699329..699838,699896..701309,
                     701365..701870))
                     /codon_start=1
                     /locus_tag="AO090005000266"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070289000018"
                     /protein_id="BAE55351.1"
                     /transl_table=1
                     /translation="MSLLDYWDTLRPSVKRRKTTADDTDDATGLSDAVTGRKDGLEIP
                     ETPLVNPDVEDTASTSYLGQEPEGGELPFPGSQTELESSLPAIDTDSHAIEEYEASQS
                     IPDHEEEPGLRERLQDGKWRKGKSSIYVDAFNLALETVLDEEAHLFDDAEMEVFKQWK
                     ELSYESQYLYVRLFLRKTSAWHRINRLGYYSDISDLTSAVNDLQRTRTLPINSPPATS
                     PHPNTPKLGTKFHFADKTDQITTLEEASSLLLLDELKTLAKDAKVQGKSKKDLLTALH
                     RASQQQTGLDWTTTSTNKASANRDTHFTQKILDYTGDCIRLATAPRELFERVHLVFYR
                     STEWTEKSLTTIILAKISRRNFPEYVVCRSSSISPSRAFLLEFESALRTQFDIDHILE
                     FSGTPTVELLTQVRDHAYKVYPRWKKLCQQEQQKEDSVYECGEGAYLRRFSPAWVYTR
                     IIHKGLYPLGRFKEYKEEHRLLCELLGQRLFHAARRGSWYQRKALLEEHYMWNLMSWE
                     GRSEDAQRKHWRRIALQTCEEGLQDPDCHLIYHYDLQKRIMKLERALKVVKREQHDFS
                     HVMLARPEERTVEGIRIEREDTLAQEDMSRRGRATVWVDERDGGECRVESMCLSWYRD
                     QGWKGYHSEGGIVRTLFGYLFYDILFTYVPNVFQTPFQTCPLDLHTDSFYATRASEIN
                     HRLVEITNGESERILRAVHAREAPRQPCAIGIDWTFELDDLVDIVRCFRGEALAAICK
                     VLAQEYQQRGGGIPDLFLWRVESREVMFVEVKSENDRLSDTQRLWIHVLGGAGVRVEL
                     CNAVAREVRYV"
     exon            complement(699329..699838)
                     /number=1
     exon            complement(699896..701309)
                     /number=2
     exon            complement(701365..701870)
                     /number=3
     CDS             complement(join(706608..707053,707100..707446,
                     707545..707647,707734..707773))
                     /codon_start=1
                     /locus_tag="AO090005000269"
                     /note="predicted protein"
                     /old_locus_tag="AO070289000015"
                     /protein_id="BAE55352.1"
                     /transl_table=1
                     /translation="MSTEYDHENGRYDDEPRFSRDERSASPRDEPRTDRARSRSPNGR
                     ADDRAPIEPRKPLEDEEGAVNTGSNLFVTGIHPRLTESDISRLFEKYGDVESCSIMVD
                     PHTKESRGFGFVKMVTAEQADAAKEGLQGEVIEGRTLSIEKARRSRPRTPTPGKYFGP
                     PKRAFADFRGGGRGGRSDRYDDRRAPYGGSWRRNDDYRYGRYDSYSDRRDYGGRGEGR
                     GDYRDYRRDYRDDYGSYRGIDRYASGGREDRYSRDERRDDRREERRGYYDRDANPPSY
                     SHGGAPPPPREAYSGGGGGGGGRSYEPREDRYGSR"
     exon            complement(706608..707053)
                     /number=1
     exon            complement(707100..707446)
                     /number=2
     exon            complement(707545..707647)
                     /number=3
     exon            complement(707734..707773)
                     /number=4
     CDS             complement(join(708624..709710,709763..712230))
                     /codon_start=1
                     /locus_tag="AO090005000270"
                     /note="PHD finger protein BR140/LIN-49"
                     /old_locus_tag="AO070289000014"
                     /protein_id="BAE55353.1"
                     /transl_table=1
                     /translation="MAPLTSNKYRSSPGRPPKTQSKAVLKGTQNSNATPGDGPPLKKR
                     KYVPGGPGGGGRYIELDVRETKPPKPAKPARPPKPAKPSPVARNSTPRTRHAREAEAQ
                     PMQLPPPPPPVPTTPPSARLTRDKSQNRGGRFGSSTAAALALQQGDGYKPREERGWEE
                     FHPDLDIETKFVVFPAEEVDKPAPSAHVAHILSPNGLNLSNDKDPLAELIRAHANGTS
                     PTPIKRRPGRPPRRPEAILNALGITPQPKVVPPPGPNPRERLTLPKPSFRLRDPFVFY
                     DHPGVGQQNYVDRTMASVGYQESDLFLRHDRRLIRVTEAPQEDDLDAVNPVGTEEEPN
                     TSVGRVEYDMDEQDEKWLEDYNAKRREDQLEPIKPAVFEITMTKIEKEWHALEKRIPK
                     PNPKPPQTQRPRSSSAAAVNGETTGPGEDQDSKCAICDDGDCENSNAIVFCDGCDLAV
                     HQECYGVPFIPEGQWLCRKCQLVGRGAVNCIFCPNTEGAFKQTTTSKWSHLLCAIWIP
                     EVSIGNPSLMEPITDIEKVPRSRWKLHCYICRQRMGASIQCSNKNCFVAFHVTCARRA
                     QLYLKMKSGHGSPAVMDTHLLKAFCDKHVPPEWRREHGTDAATAEAIEFYRNTMQGRR
                     WGDSQAAALALEPSQPLGYEHGDDEALRTHTPRITLTVGGNKRKRPTVPKTIWKLPSG
                     APVIPHVVLNAVAASLQRFGVRQRKQYAEDACKYWTLKREARRGAALLKRLQLQLETF
                     SSMEMTRRDYVAMGAAGGKRLQRRIEFGERLYHDLDRLRTMCDEVKKREREKLKDAET
                     LRSIVDTVYFPIFPLLWPIFEKAQGLDGKGIFRQGLVSIRTKLEERRYTSVSAFSADL
                     ARVFTSEIGVQPAGDTAELQMQISGRAPELSLEQREKRKLAKRIIKFIQPALEEAIKK
                     ESELNRKPFEQELKELDLMLENSVMSRRGSQAESLAAGDEGQGKREVPLENAEKVNGD
                     VEVTAKSEPSDGAEVTAIPQQSIDSAMPDADQAQAPDGASVSQSQEAPGAMVATPAVE
                     HESDKQENPSANATSTTLDAPPVPNGVSDKSEENDLGPADQPTEPQKEPLTPPPSFKG
                     DQQLPLAQGGIQWYMQPFDPVGTTIHEERWTGRDVMRGMSEELSELDEDELKDLVDDE
                     LEGEMGTAIEGSTDTRPDAAPEQAVKVYRTRRRWRGFK"
     exon            complement(708624..709710)
                     /number=1
     exon            complement(709763..712230)
                     /number=2
     CDS             join(712671..712693,712814..713028,713144..713221,
                     713280..713371)
                     /codon_start=1
                     /locus_tag="AO090005000271"
                     /note="predicted protein"
                     /old_locus_tag="AO070289000013"
                     /protein_id="BAE55354.1"
                     /transl_table=1
                     /translation="MSGPGDDRWRGGRTYDQNRQSGQRHSLHRTMSAHSGSRSGQNQN
                     NWGESRDQLSTGPAQEQHVPVRGFNAAEAKAALKRILIEPKPFFYKPGGKDTNRSGPW
                     GSKPNTMANGKDFFLELRKQITNLRQGDNVAGG"
     exon            712671..712693
                     /number=1
     exon            712814..713028
                     /number=2
     exon            713144..713221
                     /number=3
     exon            713280..713371
                     /number=4
     CDS             complement(join(713822..715091,715150..715215,
                     715642..715682))
                     /codon_start=1
                     /locus_tag="AO090005000272"
                     /note="predicted metalloprotease with chaperone activity
                     (RNAse H/HSP70 fold)"
                     /old_locus_tag="AO070289000012"
                     /protein_id="BAE55355.1"
                     /transl_table=1
                     /translation="MRNVPVGKEGSVSITARRSLLPQNRGLLTFAIETSCDDTSVAIV
                     EKNEATNAAKIHFLENVTADSNEYRGVHPIASLESHQENLAKLVDKALRHLPVALGNA
                     EGHRSITLADGSQPRYKPDFVSATRGPGMRANLFVGLDTGKALSVAWQVPFMGVHHMQ
                     AHLLTPRLVSSLRQDQETSNHTSPSPPVTPEFPFLSILVSGGHSNLVKSSTLTDHKIM
                     ASTADIAIGESLDKSAREILPSSLLQSAKNTMYGKMLEEFAFPNGSADYADYRPPMNR
                     GEELIKRETPWGWSLTTPFANTRNLQFSFSSIASAVKRIITQKENSGQKFSHEERVDM
                     ARESMRVCFEHLASRTIIALETLRQQKPEDEVKTVVVSGGVAANRFLMTVLRSFLDVR
                     GFGHVDIVAPPPYLCTDNAAMIGWAGLEMFEAGWRTDLSARALRKWSLDPQADDGGVL
                     GPSGWQKA"
     exon            complement(713822..715091)
                     /number=1
     exon            complement(715150..715215)
                     /number=2
     exon            complement(715642..715682)
                     /number=3
     CDS             join(722464..722643,722745..723938,724001..724163,
                     724225..724775)
                     /codon_start=1
                     /locus_tag="AO090005000274"
                     /note="mitochondrial aspartate/glutamate carrier protein
                     Aralar/Citrin (contains EF-hand Ca2+-binding domains)"
                     /old_locus_tag="AO070289000010"
                     /protein_id="BAE55356.1"
                     /transl_table=1
                     /translation="MTVKDAVKESLVGSSTDQSQPSSQAKTNFLRHARKDEGTGDLYM
                     TEDDFINAIAPKHEDYHKIKREHYGILFKVADRKQTGKLSLSDWATFENLLSKPDAEY
                     EIAFRLFDTDGTGAVKWETFKNLYNVNKDKDSIPFDWNSDWASLYTGRTKSRHDMTYP
                     QFAQMLRGLQGERIRQAFHIFDKDGDGYIEPEDFQRIILETSKHKLSDYVLEHLPSLC
                     NISTGTKISYATVRAFQNIMREMDMIDVIVREATQKSDDGKITRADFLNEAARITRFS
                     LFTPMEADILFHFAGLDAPSGRLAQKDFAKVIDASWRMPLAIAGQAAAATAHKAADKT
                     KSVLYNVLESVHHFALGSLAGAFGAFMVYPIDLVKTRMQNQRSTRVGERLYNNSLDCA
                     RKVIRNEGFTGLYSGVVPQLIGVAPEKAIKLTVNDLVRGHFTNKENGKIWYPYEILAG
                     GTAGGCQVIFTNPLEIVKIRLQVQGEIAKNVEGAPRRSALWIVKNLGLVGLYKGASAC
                     LLRDVPFSAIYFPTYAHLKSDFFGESPTHKLGVVQLLTAGAIAGMPAAYLTTPCDVIK
                     TRLQVEARKGEVGYTGLRHCARTILKEEGFKAFFKGGPARIIRSSPQFGFTLASYELL
                     QKWLPMPGHEEVTPSGQIEPGVGLQGAKAPLPYLRSRNALKLILDLDENIGRIKIPQA
                     DKWPKFMQTPSTN"
     exon            722464..722643
                     /number=1
     exon            722745..723938
                     /number=2
     exon            724001..724163
                     /number=3
     exon            724225..724775
                     /number=4
     CDS             complement(join(725539..725735,725792..726233))
                     /codon_start=1
                     /locus_tag="AO090005000275"
                     /note="predicted protein"
                     /old_locus_tag="AO070289000009"
                     /protein_id="BAE55357.1"
                     /transl_table=1
                     /translation="MSFTRLSTRLLSNTRAAPRLIGNIPIRTPQQIRLESTRVPRLAQ
                     ASVWNSMIPKFIRNRGSKETTAESAKSKEWNPASFYIIIFILIGSQAIRMIALKNDYR
                     AYTRTTDAKITLLREVIERVKNGEKVDVERLLGTGDHGKEREWEEILREIEEEDSLWH
                     QKSKDQEPDQQAQSDKRQVENSQKKDPAMPAEGAGNEEPPANSPSRRKINFF"
     exon            complement(725539..725735)
                     /number=1
     exon            complement(725792..726233)
                     /number=2
     CDS             join(726535..731218,731268..732841)
                     /codon_start=1
                     /locus_tag="AO090005000276"
                     /note="regulator of spindle pole body duplication"
                     /old_locus_tag="AO070289000008"
                     /protein_id="BAE55358.1"
                     /transl_table=1
                     /translation="MAVTTLLSDSSVESVKQAVRSTSTCSNATVISLQTLFRGLSKTA
                     PESDKTTVKRGTRTTKTTATSTRPKSSRGTKISAQEAAINTVMEMDAARLSFQEKLVL
                     ATDVFNTTLKTLSDASKQCAKRDDARVRTACASPSTSHGVKSPRKLKTSQEDELDAGL
                     VAVAECASTALSSLRSLKGDQVDQQDALPNMQLEQGACVLAGRYLSLGLNDMASKELR
                     GLKRRLQQHLDNQATVRPKTTSRRKNEAQEEENTKERMSDFLTFANFDHAGPVLSVLV
                     PFQSNALRLIASEKKLATVQKVASSLQLAELSSPANVIVAATESGALTKDKAALQLQL
                     LSNTVLSLAGVHQPSTSSTTRDRLKPFTSLSLQLLSLEIRCMSWKLSGHTCDEGKEMW
                     DPLTRYLANYSHHSKSIEKAEFASIYKTIVRLQTAVANTQKRTTASLRDNVSVARIAT
                     ILGQLAQEAGCFDEALKLFTEAVNPLSSGQCLSLATVRCKIASLHLQASKSSKPSLDK
                     VTNVVSDATSSLSMPLKGSLSDLDELLVEAAKLKKLTMSAYGDLATKAGEKNGIDISQ
                     IYEYLPAFLRFLRRYVGRPSSSDNESKEDDLFLTRVRACRNIVLSAVDSALAVGKFSV
                     MSQRPPWEDVLSALTDCQRLLTAIDIADKEADPSVLEQIGAAFVRLSNLFWSRYLKEK
                     ERGKGYRELVPLVKHSANLLSSCSAEQRNTGFAALKYERLAYLYMEGNRGAEAEQAFS
                     QAIQEHIDTGVLDGLISSPNFPYRTSQDPKSSGFMLGRVLTAYLKLQLKLRGKSKSNG
                     FFDDESQSLLVRGHIMEWQMGILTELHSHASSDEAFRSHFTCLVSKLLGLYDPEVYPI
                     RRLRVVLGGLRSSLERPNCLESTVLQDLLEEALEAIELGDYAEDGALATLATHLHNSV
                     RLSVGLLQGDLQPESLNLMISSWTSLMRNCNDGVTLIQYVGDDEHYLLQLKAVVDYTE
                     IHGLWKLQLSTLELVLRVTELQEHGDFSEAIIVIARLVQQNCRLGYCKKAGDLLTRAE
                     QYLGPNVSCLATLSHKLAGVAYLLETGETDKAAANLSTARILYEKNQKKQDLSSCSVL
                     AKIAWERLVADAAFMSSQLSFAQGVIKDALFFAKLSVRLNCRIWAKVEKISQRKQEKS
                     LPVPVISVGDSSELDNIVETMAKLDVSQANHTTTSVYTQGAPFWPHIGSHHTSLLNLA
                     SLSAHHGLFQDAIYYGEQALKINKTLNAPVRLINSQAQLGSHWILGGHISEGQELLTA
                     AEKLSKQLESSVELASLQMGLASLYRAQGHYRDELQALLEADRIMADFGSLDVSDVAS
                     VSSGVLELEDKMESLRIRPSSRRTKQPAATTRRTRATTSARKPTKVDATPSKAADTVP
                     ESKSLLQIRSDILRQQAACCRSLRDFERASCLLNNARQYAVSRDSQISVHLGESEHFL
                     AEAIRHFASHAVYCVLPESTISLPSLQSPSKTTSTSKAATKSTARKPRAPARGTRSRA
                     QTASEDFAVMLSKAGDCLNNVFATATTVGSTLDSHSASRLMSRISMLSHVTAAESISA
                     WSQPPANVNELGRIGAFAREHTAIDLDKQLAEYNDPLLWPTPSPMMAESEDLCSSRFV
                     EEYIDILPDNWNVLSLSLSADRSEFIVSRLHQGRSPFLLRLPLKRGNSEEEDEQFTFD
                     DGREEMQELIKLANESSHAAKAQTDRQMKKDWWKNREALDRRMETLLQNIENVWFGGF
                     RGIFSPVPHDTTSLTRFASSFQSILDKHLPSRQKGGRAEGPRLTLHPNVLELFIGVAD
                     LDDQEDPEETLMDLLYFVVDILQFQGERNAYDEIDFDMMVVETLDAVRAYHDATSNRR
                     GKPTPNHTVLVLDKSLHLFPWESLPCLQGFPVCRVPSLECLRDRVLQFQNKRNSDLAR
                     GVGIDRNSGTYILNPTGDLRTTQSTFEKDLSELQGWTGIMQREPSEEEFKRGLETTNL
                     FLYFGHGSGAQYIRGRTVKRLEQCAVAFLMGCSSGTLTEAGEYEPYGTPMNYLHAGSP
                     ALVATLWDVTDKDIDRFAQSTFEKWGLFDAGSDGATLDEAVSQSRPACVLKYLNGAAP
                     VIYGVPSVFLE"
     exon            726535..731218
                     /number=1
     exon            731268..732841
                     /number=2
     CDS             join(733270..733534,733597..733817,733870..734061,
                     734111..734296)
                     /codon_start=1
                     /locus_tag="AO090005000277"
                     /note="esterase D"
                     /old_locus_tag="AO070289000007"
                     /protein_id="BAE55359.1"
                     /transl_table=1
                     /translation="MSVTTQATIASFGGKLLKLSHAATSTRCEMSFNLYLPPQAIQNP
                     SQKVPVLIYLSGLTCTANNCSEKGFFQHGASKKGIAVLYPDTSPRGLNIQGEDDSWDF
                     GTGAGFYVDATKDPYKGGYNMYTYVTEELPKTVFAAFPQLDESRVSITGHSMGGHGAL
                     TLFLRNPGKYKSVSAFAPISNPINCPWGQKAFGGYFGEDQQEKWKEHDATELVKKWKG
                     PLDVLIDVGTGDNFYKQGQLLPENLEKAAKEAGVEGLKVRYQPDYDHSYYTMATFADD
                     HVEHAAKYLFA"
     exon            733270..733534
                     /number=1
     exon            733597..733817
                     /number=2
     exon            733870..734061
                     /number=3
     exon            734111..734296
                     /number=4
     CDS             complement(join(734849..735102,735409..735589))
                     /codon_start=1
                     /locus_tag="AO090005000278"
                     /note="predicted protein"
                     /old_locus_tag="AO070289000006"
                     /protein_id="BAE55360.1"
                     /transl_table=1
                     /translation="MPTATPERIGQTHGPTFNPSGHCPRFSSFQNSPIGHRLTLPDPL
                     PIRPVINQPGLSFRRLSYKRIKMVLITRGISLTNFLVASSALAFQVFVLYPWHKQLDE
                     SFEDLKKEHLKVLQVLDRVEHGKTGGSGGSIREQIELKRQGL"
     exon            complement(734849..735102)
                     /number=1
     exon            complement(735409..735589)
                     /number=2
     CDS             complement(join(736085..736305,736356..736596,
                     736643..736738,736785..737145,737196..737337,
                     737383..737452,737504..737682,737729..737888,
                     737937..738330,739291..739448))
                     /codon_start=1
                     /locus_tag="AO090005000279"
                     /note="phosphodiesterase/alkaline phosphatase D"
                     /old_locus_tag="AO070289000005"
                     /protein_id="BAE55361.1"
                     /transl_table=1
                     /translation="MPTSVFTVPFCPLYLFIFSLSITITLLFFTRLGRTVARRPLVFL
                     SSQRVVVLFYNANLNYRSPSTRHTGMGINIDSVHRRSLAKRDEAPFHPSQLNFTHGVA
                     SGDPYADSVILWTRVAPSLEADRSNVTVSGTVGLYNHDTESYIKASAHPICVDYRVYE
                     DKEGRRVVDKGRAYTTSDIDYTLKVEASGLKPFTTYWYQFQICNSNVTSPLGRTKTAP
                     GADDATEEINLAVYSCSNYPNGYFNAYGNAVRKDSVDYVLHLGDYIYESKKGVVGQDE
                     RAVRPEREIFSLYDYRTRLGHYRTDLDLAASHQNFAWIPVWDDHEIADNGYRDGFSRL
                     NNTEESFRNDSPQISVDQRKMNAVRAYFEWMPLRQVDMDDGLRIWRSFKMGNLFDLIM
                     LDTRNYDRSITDLCMYVPLSEDEANLSDWNTDYIEEIHNDAGRTLMGGRQESWFEKQL
                     TASNQRGAKWRIIGSQLRFARLGRETNGEVTYNMDSWEGYRANQNRTLKHLYDNNIGN
                     NIMIAGDTHVNWVSDIAWIGEKPYDGNTGVGAIGVEFAGTAVSSSGFGGTINSAEQTA
                     ASYARNEDLQWNEGYYRGYFELRMRQDEVEAKYFGCPTVATRNSWEIPLANFTVKHDD
                     NHLSRPIAGGQVEAGFVHQGEVKHSNLTLNTDTGEWQVIGFDQMFVKYQ"
     exon            complement(736085..736305)
                     /number=1
     exon            complement(736356..736596)
                     /number=2
     exon            complement(736643..736738)
                     /number=3
     exon            complement(736785..737145)
                     /number=4
     exon            complement(737196..737337)
                     /number=5
     exon            complement(737383..737452)
                     /number=6
     exon            complement(737504..737682)
                     /number=7
     exon            complement(737729..737888)
                     /number=8
     exon            complement(737937..738330)
                     /number=9
     exon            complement(739291..739448)
                     /number=10
     CDS             complement(join(739940..740193,740249..740614,
                     740667..740720,740780..741136,741184..741306,
                     741361..741521,741578..741716,742857..742890))
                     /codon_start=1
                     /locus_tag="AO090005000280"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070289000004"
                     /protein_id="BAE55362.1"
                     /transl_table=1
                     /translation="MATTATTASTDKPEKPSDGELSPEAPRSPINERKLMAKIDWHVV
                     PCLCLMYLLAFLDRVNISNAAILGLQEDLNIETGTKYNTALTIFFVPYIIFEIPSNIL
                     MKKLKPHLWLSLCMFGFGLVMVCQGLVQNWGGLMTTRWFLGMFETGLFPGCFYLMGMW
                     YKRSEAQKRFSFFFSSTTLAGAFGGLLASGLGKMDGLRGYRGWRWVFIIEGVLTCVVA
                     IICYFLVTDFPEDAKWLTEEEREFVREKLAADTGKAAPDADLTLRDVLSVFKDYKIFI
                     GGWMYFGQVVTAYGYAYFAPTIIKTYGYGAIKTQLYSIPPWAAAFGFSMLVAFLSDKF
                     RHRFAFAFIPMLIAMAGYGILLNIHGEAQRHVQYAALFLVTMGCYSAMPVLVCWFSMN
                     LGGHRRRSVGTAWQIGFGNIGGIISTYSFLSKDAPLYRNGYIISLSFLCFSAAMAALY
                     FVAVWFDNRRRDRAMANGTVDAQNNGAEEQEEQLGDMALTYRYNY"
     exon            complement(739940..740193)
                     /number=1
     exon            complement(740249..740614)
                     /number=2
     exon            complement(740667..740720)
                     /number=3
     exon            complement(740780..741136)
                     /number=4
     exon            complement(741184..741306)
                     /number=5
     exon            complement(741361..741521)
                     /number=6
     exon            complement(741578..741716)
                     /number=7
     exon            complement(742857..742890)
                     /number=8
     CDS             join(744099..744321,744408..744539,744592..744731)
                     /codon_start=1
                     /locus_tag="AO090005000281"
                     /note="predicted protein"
                     /old_locus_tag="AO070289000003"
                     /protein_id="BAE55363.1"
                     /transl_table=1
                     /translation="MRHSVSDPDVDEKLLSDEEATWPREQKKNESLFKKCAKYFLFVA
                     VAVFSCLVGVVLGRQQHNLDKVCTRQLTQYSPVIPEVGIEYHQEQFNGSFLKENIYRQ
                     EASPEVDAAWEALGVNYRSLRVPAEEAQKSGLAPDQVKINEKYGGGYPANVEGLHHLH
                     CLVC"
     exon            744099..744321
                     /number=1
     exon            744408..744539
                     /number=2
     exon            744592..744731
                     /number=3
     CDS             complement(join(745605..746202,746275..746542,
                     746594..746696))
                     /codon_start=1
                     /locus_tag="AO090005000282"
                     /note="predicted protein"
                     /old_locus_tag="AO070289000002"
                     /protein_id="BAE55364.1"
                     /transl_table=1
                     /translation="MFEHLDHANFVSYDSSIDVACKDEEKWLSFPAALNIERSARLFR
                     QANIDPNKLSPILVLGGQEWKLLDPKCKTPECPAETRPSRGRCDTYTNYQLSNYDVDR
                     LMRSSYPEEPEVHYNISTAYSWVTFESARSLKAKADLANENCLGGLAVEMVYTGGPAT
                     LANPNDLDPINTSMESAPPTNPLQDFDPNAQLTVTDTPSTTSTQSASLSTDTSTTDTD
                     TNVNTEGLSCHPAIGSVHVPIAQQDCDSNSTSTASHSPDTPVNAEEHTPSPTLAAPHD
                     ASTSDEPNAMGPKPTLTLAYRIGTPTDTAEKANDEGTTPGEPANAP"
     exon            complement(745605..746202)
                     /number=1
     exon            complement(746275..746542)
                     /number=2
     exon            complement(746594..746696)
                     /number=3
     CDS             752709..753731
                     /codon_start=1
                     /locus_tag="AO090005000284"
                     /note="NAD-dependent histone deacetylases and class I
                     sirtuins (SIR2 family)"
                     /old_locus_tag="AO070339000001"
                     /protein_id="BAE55365.1"
                     /transl_table=1
                     /translation="MTDHPDQPFTGQEYALDDIVKLIKTGKATRIVVLAGAGISTAAG
                     VPDFRSPATGLYDKLAPLKLPFPEAIFHINYFRHTPEPFYAIARARNPKNLQPTISHA
                     FLALLAKKNLLDFVFTQNIDGLELDAGVPAEKVLSCHGNWKSQRCHKCKTPYPDGPMA
                     EAIETGQVPYCQVPDCGGAVKPDVVFFGEPLPAAFEVEEKRVFGADLMIVMGTSLKVA
                     PCARLPRQVKEGTPRLLVNMVQVGDFGTRPSDVCILGSCDDGVRQLADSLGWREELES
                     LWTHAVAGKQVEVNTDDVKTLDECIEELAERMRIAGKISDGHKRMLEKHLEEKFANVL
                     PKPPIS"
     exon            752709..753731
                     /number=1
     CDS             756326..757108
                     /codon_start=1
                     /locus_tag="AO090005000286"
                     /note="C-4 sterol methyl oxidase"
                     /old_locus_tag="AO070339000003"
                     /protein_id="BAE55366.1"
                     /transl_table=1
                     /translation="MDLHSQLQAAWDHVRTTYKPGTIELTGVIVTQIVGFIIPATLYM
                     LIDVLFPKFSQRHKIQNIRRQPTRQQILHCVQVTMLNHVWVVALYALLVYLTGLDYAF
                     TNQDPVVPPWKTFIVDFTFGLLAREISFYYVHRALHHPSIYAYIHKMHHKYTAPVAFA
                     AEYAHPVEHILANILPLTLPLYLKGAHFLSIVFFFVFELWEAAADHSGYDFLKLPPAE
                     LHDLHHEKFRVNYGTIGLMDWIHGTDVVGWDRPKARKVKIAE"
     exon            756326..757108
                     /number=1
     CDS             complement(join(758007..758565,758624..758976))
                     /codon_start=1
                     /locus_tag="AO090005000287"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000004"
                     /protein_id="BAE55367.1"
                     /transl_table=1
                     /translation="MWLCFALAVADIFLIFFLCPESNFRRPEWDLISTNGLDTTEAEK
                     ADGDNEIFFENVPPEAGYTVRQPSLADMIVPIRADRDLNFFRAMVAPLHGLTRPAVIW
                     VVLLYGCALSPQIIFIFTMSSLLEAPPYLFSSVAVGLMEVAALIGFLLACYGGGMLSD
                     LINDHIVRRRGYGQVRAEDRLLSLIPGMAIGPAGCVLLAFFCQNHLHWAAIAVGFGMV
                     SFGSVYTPNIAITYLAHRHQRDAAQCLVLVNVVKNLVAFLFLYEAVEWVQSQGYLQVY
                     LVMFALGVATIAGALPLYLFDGKQYVE"
     exon            complement(758007..758565)
                     /number=1
     exon            complement(758624..758976)
                     /number=2
     CDS             complement(join(760335..760447,760503..760872,
                     760929..761065,761149..761428))
                     /codon_start=1
                     /locus_tag="AO090005000288"
                     /note="2-keto-4-pentenoate
                     hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase
                     (catechol pathway)"
                     /old_locus_tag="AO080508000298"
                     /protein_id="BAE55368.1"
                     /transl_table=1
                     /translation="MHLPWKRLIRFRALDGRILRGEPILPAENKIDLGLITEADQLQA
                     RVIQGQDIYDITGETIVTDEVVIVKQILSPLAPGDVPILRCVGLNYAKHIKEAGRKPP
                     PFPFIFFKPNTCVHDHGKPVVIPRIAQNDQADYEGELCLIIGKDAKDVSPEHALEYVA
                     AYTAGNDISSRKLQRDPAYAGVVPQWGFSKGFDTFAPLGPVLVAASEIPDPSQLHLKT
                     IVDGEVRQDETVGDLLFDCKYLISYLSQGTTLQKGSVIMTGTPGGLGVGAGFKPPKWL
                     VPGTQMDVQISQIGTLRNNVVYV"
     exon            complement(760335..760447)
                     /number=1
     exon            complement(760503..760872)
                     /number=2
     exon            complement(760929..761065)
                     /number=3
     exon            complement(761149..761428)
                     /number=4
     CDS             join(761664..761846,761916..762039,762103..762503,
                     762559..762642,762712..763392)
                     /codon_start=1
                     /locus_tag="AO090005000289"
                     /note="lignostilbene-alpha,beta-dioxygenase and related
                     enzymes"
                     /old_locus_tag="AO080508000299"
                     /protein_id="BAE55369.1"
                     /transl_table=1
                     /translation="MSDIRVCFPDRPQFSGFMKPCRVEGDVSQLEVYGEIPKEIDGVF
                     YRVMPDPQLPPFIDNDPWFNGDGNVSAFRIKDGRASFRQRYVRTEKFVREREAQRALI
                     GKYRNKFTDAVEFKVRSTANTNVVYFNGQLLALKEDSPPYAMDPVTLETKGLYDFEGQ
                     LPSLTFTAHPKFDPVTGEMVCFGYEARGDGTPDVCYYSVSPTGKFTEVVWLVAPVVAM
                     IHDFAVTDNWVSEPVPRSVCDIQRMKQGGEHWQWSPETPLYLGSCPSNVMQWFQYKNS
                     FPGHTANAYEDEQGHLVIDLGLSEKNVFFWWPDAQGSAPEPSSIVSQLVRFTIDPQSE
                     KRALSKPEILQHGNSEFYRIDDRFATCPYRHCYFDLMDPQLGTDLERIGPKLGGGFPL
                     YNAVAHFDNVTGETEVYFPGDVHLVQEPVFLPRKDSTTEGDGYILVLVNNYETMASEL
                     HLLDTRDFTRAQARILLPVRLRQGLHGSWVDGGDLNPRTA"
     exon            761664..761846
                     /number=1
     exon            761916..762039
                     /number=2
     exon            762103..762503
                     /number=3
     exon            762559..762642
                     /number=4
     exon            762712..763392
                     /number=5
     CDS             complement(join(764198..764776,764838..765104,
                     765173..765523,765589..765807))
                     /codon_start=1
                     /locus_tag="AO090005000290"
                     /note="NAD-dependent aldehyde dehydrogenases"
                     /old_locus_tag="AO070339000007"
                     /protein_id="BAE55370.1"
                     /transl_table=1
                     /translation="MSTIPLIIDGEDVLLPHDRHGTVANAYAEGPTLYQGATKELALQ
                     AAQSSAQAFAAWSKTTPIERRTLLFKLAEVLRSRAEEIKRVCDQEISCGPLWAEIITD
                     GAIGMIEEYGALTTSIATGSLPFIQNGYGLVLKEPLGVVLGIAPWNAPIILGLRAVVA
                     PIAAGNVAILKASRSLTTTDRRGIIDLLTGLASPPGVLNFLLHRPEDAPEIFDVLINH
                     PDIKKCNFTGSTHVGRIIASQAALALKPVLLELGGKNFTVVLDDADLDLAAQEITKGA
                     FLNNGQICMSTDKVLVTTAVAPALEAKILAILRSINTTSVLISPSAKAKVESLVSDAR
                     DKGAQIHTSPTTVNHDVSNRNYPPTVVTGLTPEMKLFEIETFGPVVGIVVVETEEQMT
                     AIIQAANYGLSSSIISRNHHRALKLAGAIQAGAVHINSMTVHDEPTLPHGGYGDSGWG
                     RFGARWGLEEFVQTKVVTLHQ"
     exon            complement(764198..764776)
                     /number=1
     exon            complement(764838..765104)
                     /number=2
     exon            complement(765173..765523)
                     /number=3
     exon            complement(765589..765807)
                     /number=4
     CDS             complement(join(766808..767157,767210..767349,
                     767401..767556,767616..767772,767828..768386))
                     /codon_start=1
                     /locus_tag="AO090005000291"
                     /note="2-polyprenyl-6-methoxyphenol hydroxylase and
                     related FAD-dependent oxidoreductases"
                     /old_locus_tag="AO080508000301"
                     /protein_id="BAE55371.1"
                     /transl_table=1
                     /translation="MPTYPSNCLQFAKTLDGTLPTLPNPTSGPPALNILVVGAGLGGL
                     VTAIALTQAGHKVTIYEQTAVLGEVGAGIQIPSNSARILFKLGLESYLKPYVTTPESI
                     SFRRWQNGKVIGKTRLIPDFIDNFHAPYYVIHRADFHSALCQKAEDMGIEIRLGARVV
                     DYDSVLGSITLHDGTRHTGDLVVAVDGIKSVARNIILDGKRMPFQKPGFAAYRAVVDV
                     NRMRNDPEVSWILERPALNIWIGDSRHVMTYTIGAGRAFNMVLSHPDTSDPATWDAQT
                     ALQAMKTEFQGWDSVLTKIIGMVEKTIKWPLMSGSLLTRWTRGKLVILGDAAHAMLPY
                     MSQGAAMAVEDGVALARSLSYMQSQEQLTEALTIFEKVRILRAGQMQEASLLNGQLWH
                     FADGPLQEARDAAMAPEVEGLSFSHSPNQWSDPATQMWCYGYEAEREIDQAWAEREGS
                     RKK"
     exon            complement(766808..767157)
                     /number=1
     exon            complement(767210..767349)
                     /number=2
     exon            complement(767401..767556)
                     /number=3
     exon            complement(767616..767772)
                     /number=4
     exon            complement(767828..768386)
                     /number=5
     CDS             join(768840..769095,769152..769577,769674..769951)
                     /codon_start=1
                     /locus_tag="AO090005000292"
                     /note="gentisate 1,2-dioxygenase"
                     /old_locus_tag="AO080508000302"
                     /protein_id="BAE55372.1"
                     /transl_table=1
                     /translation="MVPSMDNTLAQSTDSAAQLLRDLEDSKTMPLWTQMTRLNPPEPN
                     PTAVPFVWKYDNIRPNLLRAGHLVTEKQAERRVLMLVNPARDAPYTTDTLYAGLQLVM
                     PNETAPAHRHTAFAMRYIIEGNGGFTAVHGRRIRMQKGDVILTPVWNYHDHGKDGSGP
                     MIWLDGLDLPNFRHFPVHFVEHFSKPRYPAEDVDTSASPIVFPWNQMKERLDETEGNW
                     ATQRYLKADERLDAATSSPRRQDTLSAVYHVITGEGHSEVGGQTLEWKAGDTFCVPSW
                     YPYQHFADAGETVYLYRFDDKPMITALGFYRSVADDTETLISD"
     exon            768840..769095
                     /number=1
     exon            769152..769577
                     /number=2
     exon            769674..769951
                     /number=3
     CDS             join(770906..771317,771377..771612)
                     /codon_start=1
                     /locus_tag="AO090005000293"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000011"
                     /protein_id="BAE55373.1"
                     /transl_table=1
                     /translation="MDKIAYDGGFVSATRPPSPVSGRTPTAVHAGLATDPLLPSSEET
                     LQLIRRYFYDTGLLFPYIHPPTFFETYHQFKNNAKKVRRTWLGLLNIMLAMAKVTAVS
                     THAPAETRITESTRYYRQALNLCRGEILRGTTLEVVQYLLLMGQYLQGTQKSVQAWTV
                     HGLAVKAALQLGLHSKDASQAFPPLEREIRKRAWFACVVLDRYTTLYKLSIVVPD"
     exon            770906..771317
                     /number=1
     exon            771377..771612
                     /number=2
     CDS             join(771918..772593,772646..772714,772786..772835)
                     /codon_start=1
                     /locus_tag="AO090005000294"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000012"
                     /protein_id="BAE55374.1"
                     /transl_table=1
                     /translation="MGRVLSIENQLLSWVMALPNNLRQLSLQDLREEVGQSDSQPRLF
                     PLKFRVILTLRYLHIQILLHRPILVKFLDASHASGLEPGEERVLNEIGYSSMKKCVES
                     AMGIIDMIHELVCATGWQRDLLGAWWYSLYYSKLPSLAFLWICEYLITLSPGIAFNAA
                     LVIIGATWVQRTRQSVRDFPSHQLANIELYPGRAVATLRQLDMGNRMVDRCRYYLEQL
                     ISILHLEPENSTDTAPIDLGLAAMGSSTTDGSGIGTLVGCAIIDHT"
     exon            771918..772593
                     /number=1
     exon            772646..772714
                     /number=2
     exon            772786..772835
                     /number=3
     CDS             join(774309..774391,774450..774706,774764..775606,
                     775677..775850,775905..775957)
                     /codon_start=1
                     /locus_tag="AO090005000295"
                     /note="vesicular amine transporter"
                     /old_locus_tag="AO070339000013"
                     /protein_id="BAE55375.1"
                     /transl_table=1
                     /translation="MASEKQLPWGYRWRSSRTFIISTIIIAFASPETFLYGFVVPILS
                     FMLESRLKMDPSKTQRMTTAVLTVHGFVSLIFAPVIAHFADKTPNRKAPLLIALAGCV
                     AGTLLVASTFSIEALFVGRILQAVAGSATWIIGFATLTDNVDLDHMGKAMGTAMAFVT
                     AGQLSGPIVAGALLEWVGYWPTWSAPLLVLCLDIIARRLMIERRELPLDDRPRSPKLA
                     APHDPEESERAPLLPSTPTNESPDYNAVPTEAEQVGPSRSFYRIMIGDIGVVASVANT
                     LIFATLISAFDATLPLHLRDTFHWNTLSVGMIFLSLQVPSMCLGPLVGWLRDRAGARW
                     PVTIGWALSAPLLWLLGVPGEKMFPWASPETNGEAIFITGLVTIGIVFTLIRGAGTMQ
                     LVAATKAMEAKDPKIFGEFGGSSRVSSLAEVAFSLGSMLGPLISGTLSEMVGYFYMNL
                     VMGAICLPVALSCFLFFTV"
     exon            774309..774391
                     /number=1
     exon            774450..774706
                     /number=2
     exon            774764..775606
                     /number=3
     exon            775677..775850
                     /number=4
     exon            775905..775957
                     /number=5
     CDS             778192..778959
                     /codon_start=1
                     /locus_tag="AO090005000297"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000015"
                     /protein_id="BAE55376.1"
                     /transl_table=1
                     /translation="MSTNLSIPPPPAVYLLIGSLPLLVISESVSRSHTGTALFKMLSS
                     VAFLSGPLFLTSGEWTSTRSLITAGLLFSLAGDFFLIPSRSEFHNANSNPQQEKKISI
                     SFQLGVIAFAAAHIAYILAFFQDNETISWGTFATTFLVTMAVAKWLGVIYPPPHSSAR
                     SNVLDLDLPADMKPLVLVYATIISVMFATAASTTPVDVSSRWQYQRVFGAAMFVASDV
                     YVAKDAFKKSPGSRGWVQSTFGYGLYFWGQMVIAGLV"
     exon            778192..778959
                     /number=1
     CDS             join(780635..780829,780893..781378,781433..782283,
                     782422..782425)
                     /codon_start=1
                     /locus_tag="AO090005000298"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000016"
                     /protein_id="BAE55377.1"
                     /transl_table=1
                     /translation="MIRTISLVGAWLIASGATLVQADSSFEPANFNVTAALKGYGVDT
                     SSIPALTNLSKRSTESACLAACASLESVFGSEKVLDQENTSYTTFTDAFWSEQQAEVR
                     PSCIFKPSVNTDVAIVVLLSQLTRCPFAAKSGGHAAFRGASSSPGGITIWFTDMNEVS
                     LNEDHSIASIGPGNLWGRVYKALEPYGLAAIGGRESSLGVGGFVTGGGISFHSNLYGW
                     ALDNVESFEVVTASGRIVTANATNFPDLYWALRGGGNNLGLVTKFNLYTIPSSTMRGT
                     TRVFEEARLPEVVSAFGSVSRGATADGNAQQYVAFARMQGVSVASAELSYALNITDPP
                     IFKPYRDIPALADTTESRSLVQYCEYINDQNPSGHREMYWTIATQLDESFALWAAEYY
                     FKIVPQAANITGGNPVIIYQALTEPMLANVTKFGGNALGLDTSQGPLILFNMAFWWDN
                     AADDNAVYTFIHNYYKVITDEAKKRGIAHQYIYMNYGSQFQDVIAGYGADNKARLQKV
                     AAT"
     exon            780635..780829
                     /number=1
     exon            780893..781378
                     /number=2
     exon            781433..782283
                     /number=3
     exon            782422..782425
                     /number=4
     CDS             784712..785197
                     /codon_start=1
                     /locus_tag="AO090005000299"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000017"
                     /protein_id="BAE55378.1"
                     /transl_table=1
                     /translation="MTVCFLNAFTPETTFDPLLATRMKRLRDSRLERLLHNILDRSSL
                     LHPLLKTVSESAQVRRLHELFHIYQIAADLCIGMWSNEMDFEFGSFDSLGPFHEDIPH
                     MERHAFAEPEPEEKSDPADKDRTVLFMMQPTVTRYCRFDGHEDQSLIHRALVVYSKDA
                     A"
     exon            784712..785197
                     /number=1
     CDS             complement(join(785429..786073,786147..786539))
                     /codon_start=1
                     /locus_tag="AO090005000300"
                     /note="ketopantoate hydroxymethyltransferase"
                     /old_locus_tag="AO070339000018"
                     /protein_id="BAE55379.1"
                     /transl_table=1
                     /translation="MFTKSSFSRLASLRHSWRPRYSVPPRFPLFNSILVRYSSYSPMG
                     KTQSDSRKKVTIQTLQSLYTKSEPITALTAHDFPSGHIADAAGMDVVIVGDSLSMVAL
                     GMEDTNEVTIEDMLLHCRSVSRAVKYAFTITDLPMGSYELSPEQALQSAIRMVKEGGM
                     QAVKLEGGEQMAPTIRRITQTGIPVLAHIGLTPQRQHSIGGFKVQGKSVAGAVKVLRD
                     ALAVQEAGAFMVLLEAVPGEVAALITERLRVPTIGIGAGVGCSGQALVQVDLIGNFPP
                     GRFVPKFVKTYADVWGEAVRGIEEFKRDVKSRAFPSGEYTYPISEQEMAEFRSLMGEV
                     GQQGVGMASRA"
     exon            complement(785429..786073)
                     /number=1
     exon            complement(786147..786539)
                     /number=2
     CDS             complement(join(787216..788184,788251..788285,
                     788334..788436))
                     /codon_start=1
                     /locus_tag="AO090005000301"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000019"
                     /protein_id="BAE55380.1"
                     /transl_table=1
                     /translation="MKEAIVRKDTSVEIVDSPIPKPGPGHVLIKVIVADHFPLAWPAQ
                     AFDWKIPIHFGREMNTGDDISGIVEAVGEDVVGFHKGDRVAAFHEMMTSHGAFAEYAI
                     APYYTTFHIPDSTSFEEAATVPLAAYTSACALFQELELPEPWSPRAKAAGKEGIKRPL
                     IIYGASTATGAFAIKLAAAANVHPIITVGSKRSDFIKPFLDENKGDVLIDYTAYATEE
                     ELIKAIQEAVKKGGAPGGRCWKAYDTVSEDKTIRLVSKAIAGPPNPAGQKPKITNIFL
                     KTEVEGSDPSVEIVFSMVGQVHYEDENDKLIGVTWGAAFSRGLREGWLTSHPYTLGNN
                     GLEGLSEGLKGLRDGKIRAQKFLTRPNETPGARD"
     exon            complement(787216..788184)
                     /number=1
     exon            complement(788251..788285)
                     /number=2
     exon            complement(788334..788436)
                     /number=3
     CDS             complement(join(789337..789504,789560..789998,
                     790065..790309))
                     /codon_start=1
                     /locus_tag="AO090005000302"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000020"
                     /protein_id="BAE55381.1"
                     /transl_table=1
                     /translation="MVVSAIPAQYFRAKRGIANGMVYAGGGLGGTVISFIMNALLGKV
                     GIAWTFRIIGFMIWGTGLPAACFIKERVPIQRTQFVEWRLFRDIRFALLFAAGAIATF
                     PLFVPPFFLPLYTESMGMNSGVGAGVVAAFNFSSAVGRLMCGFCSDRLGPLNTLFMSL
                     LLSALSMLILWPVSTSIGPLIVFVIINGMGNGGFFSTMPTVVGNVFGSARVSVAMGMI
                     VTSWAGGYLMGAPIAGYILNASGGEDSGISAYRPAIFYAGGMALGASVLAMFIRLKTD
                     AQPFKKL"
     exon            complement(789337..789504)
                     /number=1
     exon            complement(789560..789998)
                     /number=2
     exon            complement(790065..790309)
                     /number=3
     CDS             complement(join(790371..790443,790507..790865))
                     /codon_start=1
                     /locus_tag="AO090005000303"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000021"
                     /protein_id="BAE55382.1"
                     /transl_table=1
                     /translation="MATITQSVSTAIELQDRNQVGGRLTKHTGDPTPPENSDAVLQAS
                     LAADAEVPDGGYGWVIISACAVVAWWFTGTSYCWGVLQAALVKEGVSTSSTLAFIGSL
                     APACISFLGVINANVIRSGFTTKNVGGLFATAGVLFGLGLR"
     exon            complement(790371..790443)
                     /number=1
     exon            complement(790507..790865)
                     /number=2
     CDS             join(791722..792094,792137..793652,793772..793791,
                     793848..793888)
                     /codon_start=1
                     /locus_tag="AO090005000304"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000022"
                     /protein_id="BAE55383.1"
                     /transl_table=1
                     /translation="MEYAHNDAPRYCEDVLLLPPLSLDNALASDIDYRWFQEEIAAHS
                     GQPSSHASIDELQPETAAHGSSIQSQLPTEPFESYSDLNYHSQDPLSGSFLDFSTFDY
                     SGLADRITSDVISERHSHISSSWSNNTRRARRKSRRFSTTAVSIMQSWLAQHQDYPYP
                     TEQEKEQLGRETGLDVTQISNWFTNARRRRTVGTGPTPQAHHADNSLLSPLERWQNSP
                     PESEPAATSDILRALEDIPHTSDGSVTYPAHRNAVSSNSSSASFVIGAPSISSYEHSQ
                     SSGSDISFKRSSRTSQRPPTPNINARPRRRRRKPPHPNETWNKRKSKGQRPYQCTFCS
                     DTFNTKYDWQRHEKALHLPVDRWICAPQGGLVEVDGAHVCTFCQAPDVDFNHLETHGY
                     LACREKSLDQRTFTRKDHLRQHLRLTHNVDYHPSMEQWRDSLTRIKSRCGFCEARFET
                     WPERVDHVADHFKKGADMIQWKGCWGFEPGITKLVENAMPPYLVGQERQTMDPWKTTD
                     ALATGGNEVLPVINDVPNALSRYVDLRRDLIVYMREQAALGNHVTDQMVQDKAREIAY
                     GSNDPFDQTYADNPKWVTSLRQEAELMSVPESNCLFPYCDDPPLQYPGASNDVSQPRS
                     SEFGLIGWAVARKVSLKPNFKGLWN"
     exon            791722..792094
                     /number=1
     exon            792137..793652
                     /number=2
     exon            793772..793791
                     /number=3
     exon            793848..793888
                     /number=4
     CDS             complement(join(794118..795795,796268..796460,
                     796837..796867))
                     /codon_start=1
                     /locus_tag="AO090005000305"
                     /note="ATP-dependent RNA helicase pitchoune"
                     /old_locus_tag="AO070339000023"
                     /protein_id="BAE55384.1"
                     /transl_table=1
                     /translation="MKTGRTRPLRVFDILVPPWPPTVPHRIKLPRGKTNWFEFYSAIT
                     RNWNKLKGLKNCWQIWKDVQEIIRRIRKYQGESTVMQGPGNNDGAHPYATMAGKLDSK
                     LLQALKVMEFEYMTPVQHRVLTELPSWRSDCLVQAKTGTGKTLAFLLPTLHCLLQGHS
                     APPRGQVAILIITPTRELAQQIAKSCDQLTSQLARPLECHIAVGGTARASALARFMKG
                     APSILVATPGRLKDYLSEPSTAEKLSNIQTLILDEADTMLESGFLADVKRILQLIPPK
                     STGWQGMCFSATVPPKVKDVVSVVLKPGYTSISTIEKNETPTHERVPQYHVLIPSVAD
                     TFTTLASLLNLEIKNSSKIIVFGVTANMVALFAAAFSQGLTPLKVFEIHSRLSQSART
                     KTTALFKEAATGIMFASDVIGRGMDFPNVDLVIQVGLPSNGEQYVHRVGRTARAGNDG
                     RAIILLTEAESFFMKVNRHLPIQPHPQTDAINAGASSCADAVTKAMYSIGEETKQRAY
                     SSYIGFFAGSGLLKQVRLDKPGLVQLANELAIQGMGCPEPPPMDKKVVGKMGLKGVPG
                     FNYATGNDLNGDRPARPRGRPGNKTRDVLSPGAGQGDRRGSVSKNRGGRRGGGRGGRG
                     GRGGKPRAA"
     exon            complement(794118..795795)
                     /number=1
     exon            complement(796268..796460)
                     /number=2
     exon            complement(796837..796867)
                     /number=3
     tRNA            797519..797600
                     /locus_tag="AO090005t00004"
                     /note="tRNAscan-SE"
                     /product="tRNA-Arg"
     CDS             join(799678..799779,799844..800024,800253..800293)
                     /codon_start=1
                     /locus_tag="AO090005000306"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000024"
                     /protein_id="BAE55385.1"
                     /transl_table=1
                     /translation="MVALYLRLASNKTHIRFLYGVGAVILSHGIAATLVACFICEPIS
                     VIWKPEFPKGCLDMTSFNYFNGAFHVTTDILLALLPIPIVKKLQTNNRRKRTGPPPNS
                     LPASK"
     exon            799678..799779
                     /number=1
     exon            799844..800024
                     /number=2
     exon            800253..800293
                     /number=3
     CDS             join(801641..801679,801737..801747,801800..802120,
                     802143..802791)
                     /codon_start=1
                     /locus_tag="AO090005000307"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000025"
                     /protein_id="BAE55386.1"
                     /transl_table=1
                     /translation="MPNDEAEQDRLDLVHHMFSVMLNGELFLAPVENPQTILDLGTGT
                     GIWAIDVAEYIFPFKKFPCKRIQLTLCSQFPSAKVIGNDLSPIQPSWVPPNVEFVVDD
                     FEDVWMHDRNYFDYVHARTISGFEHLDHNILITRVSCVQDWGRLMKQAYDHLKPSGYF
                     ECAEFVIDAFSDDGTFKQDSPYREYINNLNKAGEITGRPMNVATSLKTWMKNAGFENV
                     TEVVYVIPYGPWPKDPKLKEIGRWQYVQAPEGVEAYGLRLYTQVLGWPESEAKLHQAL
                     VKQQLRDKSLHIYGKLCVVRQFSLTIPLQVILLLTVAQDMWSMVGSVERNERKKSGAR
                     CLESM"
     exon            801641..801679
                     /number=1
     exon            801737..801747
                     /number=2
     exon            801800..802120
                     /number=3
     exon            802143..802791
                     /number=4
     CDS             complement(join(803293..803707,803785..804015,
                     804071..804307,804365..804494,804551..804653))
                     /codon_start=1
                     /locus_tag="AO090005000308"
                     /note="intracellular membrane-bound Ca2+-independent
                     phospholipase A2"
                     /old_locus_tag="AO070339000026"
                     /protein_id="BAE55387.1"
                     /transl_table=1
                     /translation="MNEKLPTEYDLSVPPMRADGFDADTERPLRILSLDGGGVRGLSS
                     LCILREVMQRLSPEGKPRKPCEVFDMIAGTSTGGLCAIMLGRLEMTVDECIEAYNQFM
                     KKIFNVSSLRKNTRLVWKGCRFGADNIEAVIKELINERLGDSEAPLLNEHGQCKAFVL
                     AVRQDAANSKGPVHLRSYFNTQQKSLLPNVKAWEASRATSAAPTYFPPMEVSTDKGVK
                     HKLIDAALGANNPVGWLWNEVLSVFGAGRPIDCILSIGTGIPKNQVFGESVKGAITGL
                     GSAITNTELANILFRTLIDAYAPESRRLKYIRLNVGREIEDWPEDAMEKENEELAEMD
                     SLTQIDGFIERTEQYIKEQEPRIRRCASTLNRNLFRR"
     exon            complement(803293..803707)
                     /number=1
     exon            complement(803785..804015)
                     /number=2
     exon            complement(804071..804307)
                     /number=3
     exon            complement(804365..804494)
                     /number=4
     exon            complement(804551..804653)
                     /number=5
     CDS             join(807050..807149,807271..808668,808774..808823)
                     /codon_start=1
                     /locus_tag="AO090005000309"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000027"
                     /protein_id="BAE55388.1"
                     /transl_table=1
                     /translation="MPRLDAKSPTPRRAGVNLFRISSATTWPSYWTIKEASSTNPATN
                     LLFALLCLTSFDIAEPFAQQYPHLKQSLQLAVSSYGQEFIFSPPTHPNSVAVCLFLAE
                     FRPTLLATSQFVAHKAVSPEVYVNLAYRIAERLNTLPTRDASFFDELMNPQSLEFERC
                     FNDSVQELKILSLDFGLDGFLSKTLPLMRAIFGDMQPHVDAYQHVLRYRECSLTVIFH
                     IQWNMSFYVLLEGLIHAKQCWSSPESLFLVVEEVERKCQEQIKISNSLLLNATGQGRR
                     EDLSTARSLLEMKFHWVFAGICGLGLLYTSVLRTRLIEGKNDGDPDIQSNESLQIVDQ
                     VAGSVNSPPDAPGQYLSGFLKRFGEVYPQQLVRVLESFLECAEVQIDGIAFNAPLQQV
                     VYGIVFVCKNLVENNFVQVRVFGRLARNHEKQLALFPKCARCIRQMAVEPWKSTKSAF
                     ATGCVYAASSKIIYGLHNILERLRTELAKGTKSNEALDFFNIPPDLSSIGLNYDGDFG
                     PMNISGM"
     exon            807050..807149
                     /number=1
     exon            807271..808668
                     /number=2
     exon            808774..808823
                     /number=3
     CDS             complement(join(809211..809521,809559..809799))
                     /codon_start=1
                     /locus_tag="AO090005000310"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000028"
                     /protein_id="BAE55389.1"
                     /transl_table=1
                     /translation="MNMKGYMTKHRPLLKLMAFKLVVGLVLLEKVNTYPKKPPWRERT
                     LTRNQDPFPHPYINKRSQNTLHLNDLHRRNNGSPNNVLYAYSAKPYEISNSRRTLRPQ
                     VYQTVESDDDGEILMSGFQKRYQGGRWGLRAWAVYLNPLELLRDVKAAYVMIHSARAL
                     QKAHAKEREMARYETRHESGEGA"
     exon            complement(809211..809521)
                     /number=1
     exon            complement(809559..809799)
                     /number=2
     CDS             complement(join(811677..812828,812881..813085,
                     813145..813533,813611..813673))
                     /codon_start=1
                     /locus_tag="AO090005000311"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000029"
                     /protein_id="BAE55390.1"
                     /transl_table=1
                     /translation="MHFTSLLLLLGAPCVSAKCRCTPTDDCWPSASKWNGLNSTVHGH
                     LIANEPLAKSCYDGLGKNSTHCQRISKIYRDAFFREASPIGFTYPVIDTCAPINDSIA
                     GSPVCDLGSASVYSVNATEPADVAAGIKFSKENNVRLVLKNTGHDVRARSQGYGSLSI
                     WMKHIKPELQFQERYEPSNGSCQLNWTGSAIVVGAGYIWDEVYTFAAKHDHIAVGGSS
                     KTVGAVGGYLQGGGHGPASHDFGLAADQVLEFKVVLASGEVVTASACEHVDLFTALRG
                     GGGGTFGVVVSATLKVYPTRPILKHSLTITAPSTNMSALIDASVAVLSKYPILSDAGF
                     SGNGQLNRVLGTKSAYSHNFVKMLSRNSSSSKSSFQVEDAKRLINEQVVEFLRPLNGT
                     QLSVTSTFEQYDTFQNYFDSGIHESPALNNPSPVMVSRFFDKESLVNNQKNLTAMFHA
                     IFPQSVSKVQAVASLLEFCLVGGGEVLKAKPHTAIHPAWRKTYMFAENFDVPPSDSGM
                     QGVRQIRDYGTSKKLQAMKAAAPGLGTYLNEADPYDPDWKEDFYGDQYNWLKSVKQKY
                     DPDEVFWCYRCVGYEGWEEITGPTLYGPLCQTNNAL"
     exon            complement(811677..812828)
                     /number=1
     exon            complement(812881..813085)
                     /number=2
     exon            complement(813145..813533)
                     /number=3
     exon            complement(813611..813673)
                     /number=4
     CDS             join(815500..815517,815588..815626,816164..816231,
                     816288..816879)
                     /codon_start=1
                     /locus_tag="AO090005000312"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000030"
                     /protein_id="BAE55391.1"
                     /transl_table=1
                     /translation="MLLGALHMSIAHPEDPRCHCVEKGKTDADSGPYLRLAEQSQQSD
                     TPVVSLELKAPETLFLESPLALEVILRRNDTDPRSCIFYWPPNIAARFVLLRHTSHGL
                     ERVEVAERRSEAPDVLYVGDWRQYLFELQPHESSRYLELLHSYRRVLRPGERYELLWP
                     GAKTCIWDWGDIQDHLDMELRRRESCISIVGGSNISFTVEEGERTFPSPEPSPPSEPL
                     SRVYVCTLSTQVLLPFFFGC"
     exon            815500..815517
                     /number=1
     exon            815588..815626
                     /number=2
     exon            816164..816231
                     /number=3
     exon            816288..816879
                     /number=4
     CDS             join(817112..817434,817465..817488,817544..817581,
                     817653..817711,817729..818009,818056..818590)
                     /codon_start=1
                     /locus_tag="AO090005000313"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000031"
                     /protein_id="BAE55392.1"
                     /transl_table=1
                     /translation="MPYQIYDDPDIEVTPGRHADFISLQPGEQWTRTDSLELPSDIDI
                     GEVFKYEFSDRVIDWWDWGMKEDHLQTTVKLPCWVKDDVVEPRDNEGRPAIVVPASNV
                     VEFTIVALNVILRQPYTGITLIPGRSEYTEKGRCNHEFRRFELAPHFIELESNCSSLL
                     LILSIFSFLPQLRRLHQNGDSTGVSLIYLLCNVISATEQLTISFSYIFIAQSSDFFIH
                     NPPNVGDWLNLLQLAVTWGLSSTLFFFAISYYPACVRRKAFIVGIYIAFLSLSLLAAI
                     LCVLADPCGANCGSQRWDYGIFLGSHLIFVNPVVTLLALAALPAQLQELKWHGHAALS
                     LTGLASQAVIFAVLSLSWLFRVRVYYNLSDFFRTWGSFISWYQLVGWAAVDHLVFAVV
                     QGILFLIVLKRKRTVTAEGENEPLLSH"
     exon            817112..817434
                     /number=1
     exon            817465..817488
                     /number=2
     exon            817544..817581
                     /number=3
     exon            817653..817711
                     /number=4
     exon            817729..818009
                     /number=5
     exon            818056..818590
                     /number=6
     CDS             819593..820021
                     /codon_start=1
                     /locus_tag="AO090005000314"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000032"
                     /protein_id="BAE55393.1"
                     /transl_table=1
                     /translation="MFTVLEELYLTWEYQDLAPSNALDEEEHFFDRIADCCEFAPLKK
                     CTLQNIRTSETALLLFLHKVRLTSLWMKVVFITNGQFESIFHYLSTSMPNLEYSHLYQ
                     LFHELGTVYFNAPIERRFPETRDARTGEPMQGDWLETINR"
     exon            819593..820021
                     /number=1
     CDS             complement(join(820391..821144,821195..821580,
                     821642..821731))
                     /codon_start=1
                     /locus_tag="AO090005000315"
                     /note="metal-dependent
                     amidase/aminoacylase/carboxypeptidase"
                     /old_locus_tag="AO070339000033"
                     /protein_id="BAE55394.1"
                     /transl_table=1
                     /translation="MTAITKQVVQKAIDEYIAGLQPSLRELNLKIHGNPELAYKEYQA
                     HDVLCEFLESQGIPTDRHAYGLKTAFESRVGDPAGRCVNFNAEYDALPGIGHACGHNL
                     IATASVTAFLALAFAIQRFNLPGQAQLLGTPAEEEGGGKIDLIRAGAYEKADVSLMMH
                     PISDEELTTHNILGIAGQASISCYDITAVYHGHSAHAAVSPWEGINALDAVVAAYNNI
                     SMLRQQLRPDERVHGAILQAPSITNAIPELTRTRYTIRSRTMERTRQLGTRVRQCLEA
                     GALATGCKIELEEDQIYGDLVVNPPLCKGFAECMEDQGVTVLATHEDLMAGSTDQGNV
                     SQIMPALHAVVGIPVSNGAKNHTRDFTAAAAGDKAHRRTVLAGKAMAMTGWRILVDEE
                     FYQDVKGAFSVTKGVSL"
     exon            complement(820391..821144)
                     /number=1
     exon            complement(821195..821580)
                     /number=2
     exon            complement(821642..821731)
                     /number=3
     CDS             join(822252..823667,823722..823806,823864..823988)
                     /codon_start=1
                     /locus_tag="AO090005000316"
                     /note="amidases"
                     /old_locus_tag="AO070339000034"
                     /protein_id="BAE55395.1"
                     /transl_table=1
                     /translation="MTIPDWQQKAAAKQAEAAAKIPKEWRVSASILENLDNEQEVLTI
                     PQRCGILSPKELEITETVDATTLRDKLAARELTAVEVTTAFCKRAAIAQQVTSCLTET
                     MFPQALARAKELDEYLQTTGKPMGPLHGVPISLKETFNVQGVHSSLGLVSFLDRPEAS
                     HNSALVEILLAAGAVLYVKTNVPQTMMTADSENNVFGRVLNPHRRNITAGGSSGGEGA
                     LIALRGSLLGIGTDIAGSIRIPALCCGTFGFKPSVGRVPYAGQASAARPGMAGIAPVA
                     GPLCYSARDAELLLRVVMEAPVDDLDDNVLGFPWIEPAPLAAPTLTIGVLPEDPQVPL
                     HPNMQRTLKTAVERLAAAGHRIVDLSGQIQCIKEASEISFRFFRIDPDQTQVKYVSSS
                     GEPFIKSLRYTYNLKGDDPEPTLRDLFDLNVERAKVAAIMRRLYVENKLDVIIGPGNQ
                     SCAGPHDTYGIPVYTVLANLVDYPACVIPFGKANEVADAEYVRDVAYIPPYCPKEVEN
                     APCHVQLIGRRLKDERLMQHAKIVESVLASKST"
     exon            822252..823667
                     /number=1
     exon            823722..823806
                     /number=2
     exon            823864..823988
                     /number=3
     CDS             complement(824047..824667)
                     /codon_start=1
                     /locus_tag="AO090005000317"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000035"
                     /protein_id="BAE55396.1"
                     /transl_table=1
                     /translation="MLFEPSLDTLQRVNPTMDLARYFSELPPPTLQPILDASYPFFLL
                     IADVTRLARSIRPLNNTEIQTYSHLLTNLLYYDRHLNDGSLTMNLYLLTMRILLLKVD
                     PVLSTAEATEQISHLSPAGFSILDSLNVNQYLLGFSLWPVAVLGSIATTANEQYIAES
                     KISSLAHRQHGQAMRLRNRLKAIWATPKVERTTSLVHRLHMLVKGI"
     exon            complement(824047..824667)
                     /number=1
     CDS             complement(join(824835..824837,824866..825213))
                     /codon_start=1
                     /locus_tag="AO090005000318"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000036"
                     /protein_id="BAE55397.1"
                     /transl_table=1
                     /translation="MINGTPGIDIRYPTFRPDEHIDMYTHFATVVLPGMVRQNCATEY
                     NDQTYMLHLALEFPPLMAIMIGIAAVYREDETLALESYLFSLHGLRSRMAHAVDAANE
                     DAILASTILLCVME"
     exon            complement(824835..824837)
                     /number=1
     exon            complement(824866..825213)
                     /number=2
     CDS             complement(join(827046..828406,828461..828662))
                     /codon_start=1
                     /locus_tag="AO090005000320"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070339000038"
                     /protein_id="BAE55398.1"
                     /transl_table=1
                     /translation="MATSHLNDEEMIDQKLAIETTTSNTKQTPSRQALIEALQAEKPS
                     PWSPNLRKLYIFCVIAFLCSTMNGYDGSIFGSLPALESFRDQFGVEKNGAKIGYISAM
                     YTVGGICSLPFSGPACDFRGRRWGTFIGSLIVVACTFLSALSHGVPQFVAGRFFLGFG
                     VNIVRSTSSIWCAEVCPPAYRGIIMAFYNCTYAVGSLIAAGVTRGSAGYPGNKSWQIP
                     LWCQMICPAIVLLSVLFFPESPRWLYSHGQEEQALEFLAKYHGEGNPSHPLVQLQLQE
                     YREFISLSGSDKRWWDFRDFYKTKAGRWRFINALITGIWGQCSGNAVVTYYLPAMLLT
                     TGITDSNQVLNVNLGYTVVSTVASYLGASQIERMGRRPTIIWTAVACSICFACITIGS
                     GIFDSTQATPAASAGIAFIFIFGFCYNFGMTPLQALYPVEALSYETRGKGVGLTFSIA
                     HGFTLLNQFCFPIALKNIGWYTYIVFIVWDLFEATVSYFVSVETKGHTLEELSEIFES
                     PNPVKASLEKSI"
     exon            complement(827046..828406)
                     /number=1
     exon            complement(828461..828662)
                     /number=2
     CDS             complement(829343..831412)
                     /codon_start=1
                     /locus_tag="AO090005000321"
                     /note="uncharacterized protein conserved in bacteria"
                     /old_locus_tag="AO070339000039"
                     /protein_id="BAE55399.1"
                     /transl_table=1
                     /translation="MPPLRGFSDNPFSDKGDVIVATTALVQALEPYFSPGQARVRLPI
                     YSGAHFDEVAADLEGFARPIWAIAAVFAESATTTDPTLQTYAERLVSGLANGVDPGHP
                     EYWGAIDDWDQRMVEAEAISFALLLAPKTFYEPLSAHSRSHLVEWLSGLNGKVMPKNN
                     WRWFRIFANLALHRVCGVPYEDVKHFIWEDFALLDTFQLDNGWAADGPWRKDATDGEE
                     AYGRQADYYSGSFAIQFSQLLYTIFAADLDPGRVSRYIHQAREFAGQFWRYFDKDGAP
                     IPFGRSLTYRFAMGAFYAAFALAGAYDSSSPYTSPGFVKGMLLRHLRWWATHSDNVFA
                     LDGTLTIGYLYPNMFMCEDYNSPQSPYWAMKSFVMLALASNDELWQADELPHPLAAIE
                     ETKSLESGVKLLSAPFQILCDHPDGQHHFMISGGQFCVWPLKATQAKYSKFAYSSAFG
                     FSVPTGLLLTQIAPDSTLAISGDDGETWVTRWQTTTNPRIETFTINNQDVQCLRSGWK
                     PWRSGSIEIDTLVIPPCDKWPDWHVRVHRIRNTRAGSSNIEKLRLVEGAFSIEVKQPR
                     RTPTLTENWGATDGLDVAHGGRMECGTSCLVIGNGDASGIKNLFTSECSLEGKVLKPD
                     PNTNLMTPRTLIPTLEHEILSLPGRDIVIANAVFAISKGKIQFSQQELMKRWYLAPRL
                     PEEVFIF"
     exon            complement(829343..831412)
                     /number=1
     CDS             join(832282..832979,833031..833051,833140..833535,
                     833602..833924,834094..834164)
                     /codon_start=1
                     /locus_tag="AO090005000323"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000041"
                     /protein_id="BAE55400.1"
                     /transl_table=1
                     /translation="MEEWRENNTPPNDAPDQRLNSPPDRDVQDSTTSASGPETSRKRP
                     CPDPGSSVDYTSQVDLPPDNLINGILDAYFSVVHPFIPILHEPLLRSRLRDPAERLKL
                     IPLLHAMIVCSLRYVANERLAAEWSTSHPGALQKSRDFVVLSSIDNLSVESAQSLIII
                     AFVHICDGNGSKAWPIVGALTRAVVYMGLHIEPDEGQQGDPCIEPIRCLPPARVWTEM
                     EERRRVFWNVFLLDRFCSFTTGDDVKLRLPSDGTYWAKEEPVTTPFFNIWDTTLAKIG
                     KSVSFLPGHLSSLADKEKYVDNTPSRSERVSPVLQASGTHTVDLSTIGSFAYCIEATE
                     SLNRIVKFFLQRPVSLQSKQEFGAWLTRFKELDLQLIHWKMFLPRRWKDSNISKEPAF
                     VHMDPNLTLAHITHNTSMILLHQCIAYPRANLVDKLRQASISSAETCQLAASETANIV
                     QKYLQYTPFVGLVNAQFVFCAFVSARVMLGKRQLCQCPSFSTSEVAGAVQVH"
     exon            832282..832979
                     /number=1
     exon            833031..833051
                     /number=2
     exon            833140..833535
                     /number=3
     exon            833602..833924
                     /number=4
     exon            834094..834164
                     /number=5
     CDS             join(835050..835235,835294..835822,835877..836694)
                     /codon_start=1
                     /locus_tag="AO090005000324"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000042"
                     /protein_id="BAE55401.1"
                     /transl_table=1
                     /translation="MAPHVLSTSPVMDDRLAHKGVTKPPPLKDAGDDEIQAQLASLFH
                     ENNLAKVIGVAETLLENNDPPTRFPETVPQTGAEKGVYRCRDAEFWTCGFFPGSLYCL
                     LERVRKYPAASLPSLSDRSEDSQGKFTEDTRAVYNHDILISHLTDLCRKWSEPLHAMS
                     FRKDTHDIGFIIQPALQRDWELFGNKRSLDSILNAAESLAARFDARVGAIRSWDRFSN
                     ANHNINSMDDDFLVIIDSLCNLDLLFYAGNYLHSERLLSIASTHATTLLSTHLRPESG
                     LNGDKRYSTCHVVNFSPSNKGKVKQKLTAQGYSDNSTWARGQAWAIMGYAQTYSWTKK
                     QEFLDAAKGLADYFIQRMESSPVIVEQQGRGRYVPLWDFDAPITHTGANGDQGPLRDV
                     SAGMIAANGMLILYGHIAGMGELDAAKRYLNYALNITKDTVDFAYNRDEMRLRICQQD
                     GVTKMESCEATSGHRFDAILEKSTANFNGNHADRAWDHGLVYADYYFLELGNRLLDMG
                     LR"
     exon            835050..835235
                     /number=1
     exon            835294..835822
                     /number=2
     exon            835877..836694
                     /number=3
     CDS             complement(join(837048..837625,837689..838338,
                     838432..838565))
                     /codon_start=1
                     /locus_tag="AO090005000325"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000043"
                     /protein_id="BAE55402.1"
                     /transl_table=1
                     /translation="MKTNSARGIHSAGMASISPQSVECSARLGIARLDNQPETRIGGR
                     IPETLLTISNIASMISWRDLLFVTSIAAIVQLGVGETITTTTALAPSKWVHPGAMISQ
                     SQLDFVKSKVNNGEQPWADAYDALMEDESVSNPQAPSPHVIVECGPYSDPDIGCKAER
                     DDSLAAYANALAWAINGTKAYAEQAIRIMDAYSSTIQGHNNSNAPLQSGWVGSVWART
                     GEIIRYTDAGWSDDGITQFEDMLRNVYMPLTLNGTTGTANWELVMTEAAIMMAVFLED
                     ADSYNTAMDWHLKRVPATVYMTSDGEYPAAARGHSSDPDAIISWWFNQTTFQENGQSQ
                     ETCRDLEHTGYSFASMAHVAETSRIQGTDLYKEDLGTRLRYALEFHSQFENGVAAPAW
                     LCGGELKLALRAVTEVGFNALSFRMGIDMPQTENLTVKQRPAENNGLFVAYETLTHAQ
                     NNA"
     exon            complement(837048..837625)
                     /number=1
     exon            complement(837689..838338)
                     /number=2
     exon            complement(838432..838565)
                     /number=3
     CDS             838741..840207
                     /codon_start=1
                     /locus_tag="AO090005000326"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000044"
                     /protein_id="BAE55403.1"
                     /transl_table=1
                     /translation="MIASRALRHSSFIALVACLLQLSSAKDLYLDCNSASSDGDGSKS
                     NPFSSIKEANAAVLSAGDTLSIKSDTTCSGTLSPQGSGTQEKPIILTSYGDGPLPIIN
                     GSGAAEAVSLTNQDYWEISNIAVINPAAKIAWRRGILATSSDGTVHRGLYIHDITVYN
                     VAGETNKATQSSAFIASGGILVNGTEHNSRYDDVQIFNNTVYDCGGGGIKVRVGQMDN
                     RGEGVHVFSNNISYVGGDGIVVSYGVSPLIESNLCGFLGHGKYPWTGGNFAGIWVLGC
                     RDAVMRFNAVHDSLMSEVDSEAFDCDWGNEGTCTVEYNYSHDNAGGIFLNCDGCGTPG
                     GARQIVRYNIFQNDCRMYSNGDNVELDFYNNVVYCPDKKFEIAVPPKTNMSNNIWVGT
                     QDSTLPTGDLIEWHGNLFQTVPQPGDTAGIDGDALFIDPGTGKDTIDSVDGYKLRSGS
                     PALLKGVVVSDNGGRDFWNNKVSFEQRPNIGSYNGKGL"
     exon            838741..840207
                     /number=1
     CDS             complement(840592..840996)
                     /codon_start=1
                     /locus_tag="AO090005000327"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000045"
                     /protein_id="BAE55404.1"
                     /transl_table=1
                     /translation="MAASQNAILTRDQLAGLPQSFFNAVDRKDLDAVVSHFSQDAIFT
                     IKTAQVTFTGPDEIRHSFADFFNNTKHMLHDIKSIVVDEINGKVATQQRYTGELLDGT
                     KNEMHTCNFFDVGPNGKFTRVVVFMTGASPLK"
     exon            complement(840592..840996)
                     /number=1
     CDS             join(844171..845124,845218..845277)
                     /codon_start=1
                     /locus_tag="AO090005000330"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000048"
                     /protein_id="BAE55405.1"
                     /transl_table=1
                     /translation="MGDAQKASRPGPNVLSQVLFPTHPHKLSDEQVWAIVCRWHGIRS
                     PFALYSDPTIHNIYLNDWVPWWHTQCPLLLGNNPLPQLSDQTIHSTPNQKRRLYHRFY
                     QALTSHWLSIECLALAKATVYPSRTSRNQWHKIISAQWYSRGHLNLREKLDILHVTVF
                     VWEFLARKAFETIPLIPRLQEFRTRKVFLRPPSVIQAVILQNWPDPDSMCDLMEYFEH
                     LTPEYTIQQAIAGDEHEGDEEPGNLVDENAGAWDMGLQDLEKCTHDYLRQVKTIPRAT
                     WRWYWPASLGGNFGKRPRLGHPGDGRLSISVLDRLFLCPETDNISHGRGSAPPDICII
                     FTR"
     exon            844171..845124
                     /number=1
     exon            845218..845277
                     /number=2
     CDS             complement(join(845576..845628,845634..846063))
                     /codon_start=1
                     /locus_tag="AO090005000331"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000049"
                     /protein_id="BAE55406.1"
                     /transl_table=1
                     /translation="MTDNKWYWNHDAPFYAHWTYQRSPDGVTGKWFRFLVTAASREDA
                     KTFFRGVEKYAKLKDANIVSVKAINLAWWTYDISGGDGWNIMRLVQNIDQMKASAYGD
                     IDELHNSRGKILISILNDADGGSRSWPILPTQDVSLSDYQHDRPPRLGCPALSFCRIF
                     "
     exon            complement(845576..845628)
                     /number=1
     exon            complement(845634..846063)
                     /number=2
     CDS             complement(join(847733..847835,847892..847965,
                     848022..848954,849024..849098,849157..849249))
                     /codon_start=1
                     /locus_tag="AO090005000332"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000050"
                     /protein_id="BAE55407.1"
                     /transl_table=1
                     /translation="MPNWILGNKFDTIYPHKGSIKTLWETRWKFACQKGVYPFHDGSF
                     EDFEPIFQKLISENINDASTDEYTSTFFPIASDLESQASQALDSGKPDDAIDLFRRAA
                     VVYRISRFPYVDITQPNSIKRAAFERQKQVYLKAASRWDPPIKEVIIPHSSRGRNDGQ
                     EIPIYTRIPRTARPDNPVPVVFIMTGLDGYRPDNSQRTHKIIGRGWAVVIAEIPGTAD
                     SPADPADPSSPDRLWDSVFAYMATQPMLDMSQVVLWGLSAGGFYAIRAAHTHASRLRG
                     AIAHGAGCHYFLDKEWLSRVDDHEYPFSCVETFVLRRFKGHALIICRIMPGWTKKYGY
                     DDTEVFVQEARKKFSLVETGIVDRPSCRLLLLNGVADGITPIEDSLLLFNHGSPKEGR
                     FFEGLPHMGYPDSLPVAYRWLEDLLPCEPKQKN"
     exon            complement(847733..847835)
                     /number=1
     exon            complement(847892..847965)
                     /number=2
     exon            complement(848022..848954)
                     /number=3
     exon            complement(849024..849098)
                     /number=4
     exon            complement(849157..849249)
                     /number=5
     CDS             complement(join(851604..851675,851963..852745,
                     852915..852967,853146..853176,853215..853474,
                     853560..853641))
                     /codon_start=1
                     /locus_tag="AO090005000333"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000051"
                     /protein_id="BAE55408.1"
                     /transl_table=1
                     /translation="MSGFRHAFSMTRKEVRDAVPPGTISLSIYSQESAGRTHLKNNGE
                     LVLSPQPSEDPMDPLNWPSWRKFTVLLLMSLYAAIGNFTSGSISSAFPLYATPMAFNP
                     PVSIGKLGHLVAFFFIFENSCFVSLLPAFSWGLASLQPTQGFYTVFICIGPVLGGIAG
                     GYIAGNLGLAWIHWINVILSGILLVACFFLVPETLYVREVPQATDPALDNGGKDEDAA
                     SSVKIEDITRNRTTSGSYTELTFLRSLKLYTYHGNLFQNFISPWLTLRLPGVWLVMLW
                     YAGLVGGVVTISTVGPTLAAQPPYLWGNNAGLILVGGIIGALIGAVATALTADRIVTT
                     KKTLQGEENMESEARLPIALPGLVLATTGLWTFGFCAQASNPHMWIGMQFGLGMLSFG
                     LMQAPSIGFNYLPGYQIEQTFTRTGDISVYRAWC"
     exon            complement(851604..851675)
                     /number=1
     exon            complement(851963..852745)
                     /number=2
     exon            complement(852915..852967)
                     /number=3
     exon            complement(853146..853176)
                     /number=4
     exon            complement(853215..853474)
                     /number=5
     exon            complement(853560..853641)
                     /number=6
     CDS             join(854793..855044,855362..855463,855533..855556,
                     856166..856397,856453..857021,857461..857607)
                     /codon_start=1
                     /locus_tag="AO090005000334"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000052"
                     /protein_id="BAE55409.1"
                     /transl_table=1
                     /translation="MCRPRDVESVGSNLERHLSAFEPWTAKVLRVLQKLLMNQSARME
                     DKLPMWVYVPARCSLTPFPTIIADIRNSFYVHPLYEAILDFKCGQALTGPRIVSTQGG
                     CIRCRPCLAIYKHPLEHDGADSAEIIEQFSASTRQTELSQTLCAGEMAVSMASTIRGQ
                     YPPSGLSILIAGGGIGGLTFAIEAYRKGHDVRLIEKRANFDGYGDLLLIECNALHSIK
                     HWPGFYERLQTISYKTQRNIKKYDGTWVGTWPLGDGKDISMAFNRSELHNALWEYVQE
                     LGIRVDFSTTVEDYFETDEAGGVVLADGKKLTADIVVAADGVGSKAWSLVLGKKDVPI
                     SSGFACYRATFPSGPALENPIIAKEFEGYVDRACIHVGPGAHIAVGKTTRQICYMLTH
                     RKGVILTPPTQIRACIMRPENGIPPPGEIPQHRLGCGSEESGYFQQDNG"
     exon            854793..855044
                     /number=1
     exon            855362..855463
                     /number=2
     exon            855533..855556
                     /number=3
     exon            856166..856397
                     /number=4
     exon            856453..857021
                     /number=5
     exon            857461..857607
                     /number=6
     CDS             complement(join(858321..859138,859297..859359,
                     859417..860038))
                     /codon_start=1
                     /locus_tag="AO090005000336"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000054"
                     /protein_id="BAE55410.1"
                     /transl_table=1
                     /translation="MRLQYINLKMNPVAPTSRSSAAYPRKRAVTACQVCRSRRTKCDQ
                     KKPRCSFCEKTGAECVFDPTALSTFDPASLAILDRLEALEQKTDSFQQQQQPVPALVP
                     FPTLNPNNDSSTAYTIAKEPQHPESLLPENLDTVLKWPILQDVNYQMTQSPDIPNPSS
                     DNASPAQPSPDGDELNPKITNAYLDNFFAHVHLKNPVLDEPYIRRLVLCANRAITGPL
                     LAPSISAEDLRIGRMPVSNSWAKPPRQAHQLKKASTGHRGSLNESSGWELGLPDFGTR
                     ISLEPPQRFPTLPLTDDEEILRAWYFYLSEIWLWRLETEIRKDMTTRLSELSNNSLSD
                     LADISEIYKQHLVACLHSLPSTVSISDPPCQTPETDVLRFILQGRSIYVNELITWPYI
                     AYAVNDVHLGHTAHGWVSKGLQIHLERLEVNQAGFYHCHHGTWLMIPTSARSACILLA
                     VARSSMRDLLPGGWKEAVEATVKMLEFWQSDVEGLAALASFLRYLLSHVA"
     exon            complement(858321..859138)
                     /number=1
     exon            complement(859297..859359)
                     /number=2
     exon            complement(859417..860038)
                     /number=3
     CDS             complement(860168..862348)
                     /codon_start=1
                     /locus_tag="AO090005000337"
                     /note="beta-glucosidase-related glycosidases"
                     /old_locus_tag="AO070339000055"
                     /protein_id="BAE55411.1"
                     /transl_table=1
                     /translation="MGSHGEYTFNDAITDVKAGQSLVETTQILLSQLTKEERLSLLDG
                     DVEFWPGLRSILCDRYNRTPYVHGAIPRKHIPGIKFTDGPRGVVMGSSTAFPVPMARG
                     ATWDVELERRVGDAIGREAKAQGANYFAGVCVNLPRHPAWGRIQETYGEDPLLLGEFG
                     LALTQSVQKHVMACVKHYALNSMENARFRVDVSVEEAVLHEVYLAHFRRIVEGGVAAV
                     MSSYNSVNGEWAGQNRHLLTEILRDQWGFDGLVMSDFIFGLRDAAASVKNGLDIEAPF
                     RQQRARKLPRALESGELDWKYVDRACERILRKQIEFTVRTEDSQPSRDVVFCDEHRAL
                     AREVAARSMVLLKNDTVDGKAVLPLQAESLSRVAVVGRLANIANTGDKGSSQVFPPGV
                     VTPLDGIKAALPGTEVLFADSVAKAEQLASQVDVVICIVGYTHEDEGEYVVPALQDNP
                     ALRDTLPPATTAEERETLDIFEGNSDKGGNGGIKAGAGGDRNSLRLREEDEKLIPAVT
                     AHNPRTIVSVITAGAVIMESWKDRVPALLISWYSGSEGGHGLGDVLLGKVDASGRLPF
                     SIPTSEAYLPFFNRNAAEIYYDRWFGQHMLDKLGVKAEFPLGFGLSYTTFAVDNIIAE
                     SVDKESIQVAVNVQNTGRRPGRFIAQAYAVTNIPDFPTRVLLGFAPVDLDVGQKTKMR
                     FLASTRPLQQWKAGTFTLRTNQIQLQVASFAGDGGAVSTNVSFV"
     exon            complement(860168..862348)
                     /number=1
     CDS             complement(join(863670..864242,864301..864384,
                     864434..864518,864578..864911,864948..865011))
                     /codon_start=1
                     /locus_tag="AO090005000338"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000056"
                     /protein_id="BAE55412.1"
                     /transl_table=1
                     /translation="MKPSILSATNLQKTSSPCLGSQRPSAINTPRVLTTNDQGSFRYT
                     KAFGDDTADIADTDAVHWIASLTKFVTTIAVMQCVEKGQLDLDSDIGKVLPEWQDPQI
                     LTGFNEKDEPIFRPATKAITLRQVVFILRPYGMAYVFMHPLLTRYQQLQGERPLIQQT
                     VKESYHPFLLFEPGKRWLYSPSLDWAGVAVERVTSMKLGEYMKRHIFDVVSANDITFH
                     LDQREDLRARKAKNWQRVGQSLEEEKNPVMPNPVAEGQGGGGLYATVNEMLKIYHGVL
                     TEKLLRPETIKIMFQPQLENNVGLDKPDEYPVFVRNAIWNAVPSDVSVSFGLGGLVNI
                     AAVPERRGVNSLTWSGIPNCYWVSQSVLNEMKVLAHSWVNLVDRY"
     exon            complement(863670..864242)
                     /number=1
     exon            complement(864301..864384)
                     /number=2
     exon            complement(864434..864518)
                     /number=3
     exon            complement(864578..864911)
                     /number=4
     exon            complement(864948..865011)
                     /number=5
     CDS             complement(865865..866686)
                     /codon_start=1
                     /locus_tag="AO090005000339"
                     /note="dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /old_locus_tag="AO070339000057"
                     /protein_id="BAE55413.1"
                     /transl_table=1
                     /translation="MANFPKYPDLQGKVALIMGAGQTHVPGSEARGNGAAIAQCLAQN
                     GVQVFGCDVNLQAAELTASRIQAEGGKCDIAQADVTSEKDVRRVVDAVMSKYGRIDIL
                     INNVGATVAGDPASMPSDVWDKQIDLNLKSVYLACHVVLPIMEKQGSGCVVNNASIAG
                     LRYIGKPQVAYSAAKAAVIQFTKVTAVMYAPKGVRLNTVVPGFIHTPLVDNFKFNGQK
                     EVYDKITRQPVPLGRMGDAFDVANSTVFLASDAAKYITGQILVVDGGFTSSAASL"
     exon            complement(865865..866686)
                     /number=1
     CDS             join(867291..867679,867839..868016)
                     /codon_start=1
                     /locus_tag="AO090005000340"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000058"
                     /protein_id="BAE55414.1"
                     /transl_table=1
                     /translation="MSTPNSPTQSPVAELCHSIETSFKSTSLGPDSWYLLTIACLSGS
                     PDPELAKDLYLYVIQKEKNSTSAARQAFIRRIRETLVKCVSIVWCCKPIEARIAISQV
                     EQEEDRDYSLTREYWQCDQANDERGMRCIMIENLRKKTHWHIGGTRRIGVSKEDTQVL
                     WECIQRVACIFDLKMNKVPTVDAVEYDV"
     exon            867291..867679
                     /number=1
     exon            867839..868016
                     /number=2
     CDS             complement(join(868233..868388,868450..868799,
                     868860..869283))
                     /codon_start=1
                     /locus_tag="AO090005000341"
                     /note="dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /old_locus_tag="AO080508000347"
                     /protein_id="BAE55415.1"
                     /transl_table=1
                     /translation="MHWNELKQEILERARSRTVIITGAGGGIGAATAREFNNYGSNVV
                     LADIPALESNAKELIVSFAYPDNAVFIAVDIRDWQQMQSLFKKTMETFGSVDTVVANA
                     GVMESEHVLDMENVDGEGHLRESEEASRVIDINLKGTLNTLRLAMHHMRFSSTTKNGQ
                     PSIVLVASTSGYFGGTGVAAYIASKHGVIGLLRASQLAAKKYGISITAVAPFFTPTAI
                     TSGLSERWKAAGLEANTPEMVGKVILQSALEDNNSGSCLLVAGRFLRELELTRGDLIP
                     QWLGRDVKEFMDTAFNVIQETGGYALPKIRAKV"
     exon            complement(868233..868388)
                     /number=1
     exon            complement(868450..868799)
                     /number=2
     exon            complement(868860..869283)
                     /number=3
     CDS             join(870166..870269,870333..870415,870468..870627,
                     870689..870813,870914..871013,871403..871701,
                     871786..872016,872085..872098)
                     /codon_start=1
                     /locus_tag="AO090005000342"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070339000060"
                     /protein_id="BAE55416.1"
                     /transl_table=1
                     /translation="MPSSDVETSLDGDVKLEHAEELENVHSIDPELERRIVRKIDCRL
                     LPTTAVIYLLCYLDRSNIGNAKILNSSTNDTLLESNNISNYQYTIAMMVFLVAYSVFE
                     APSNLALKIFEPRRWLGFLVIAFGAFCTGIGFTHNFAGLAALRFLLGAAEAGAFPGMI
                     YYFTFWYKPAERASRIAVFMCSATLSGAFGGEDKLNWKDAKETLLSARLYAHYLTYLS
                     ISAGVASLSLFAPTIIAGLGYTDLQAQLFTVPPYAVAYVVTLGLAWLSDRLKCRGAIA
                     CGSQVMASVAFIIQAEAYTARYAFLVIATTGAFGGLPSLNAWVGDNIHTTTARSITTA
                     LNISFSGPGQIIGVWIYRAQDAPAYRLGHGVNADARY"
     exon            870166..870269
                     /number=1
     exon            870333..870415
                     /number=2
     exon            870468..870627
                     /number=3
     exon            870689..870813
                     /number=4
     exon            870914..871013
                     /number=5
     exon            871403..871701
                     /number=6
     exon            871786..872016
                     /number=7
     exon            872085..872098
                     /number=8
     CDS             complement(872462..873940)
                     /codon_start=1
                     /locus_tag="AO090005000343"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000061"
                     /protein_id="BAE55417.1"
                     /transl_table=1
                     /translation="MGNESGGYARNRRESDLHHARGVFEINCGNLRRAWAVYRRAMTV
                     AQLMGLHRSPMPPLKRLDPGLDAKPEFMWFRIVYMDRYLSLLLGLPQGTTDKNMGMMS
                     TLRHEPPLGRFERLLTIIASRILERNERTFVTSDYTTTQSIDAELLRVSESMPTSFWR
                     PPNFQNLTPGSPDTLLETVRLGAQVYYYGLLIQLHLPYMVQISDNTHQGYSKITCVNA
                     SREIMTRYITHRSFNPVSSCSRPVDFFTLLAAMTLLLAHLNEHSHPEAISLFAHQRLN
                     DRGLLDQALETMDIISNMKKDIIAERSAELIRRLLEIEADTAEGKTYITGSLAGDDIE
                     ENRKQGEELRLHIPHVGVIKVARGRPVSRQPSDGNTAACTHMSHGELESCVTWNDAIG
                     PSPTSKHSLSNMHDVAPGSVLSLDLAESESLSEHLRSPRYEPSILQNTGFGQDGIALQ
                     LPVGHPPTAAGVDDWAFQGVDMAFFDSLMRETSSVDNGRLGQ"
     exon            complement(872462..873940)
                     /number=1
     CDS             875204..875959
                     /codon_start=1
                     /locus_tag="AO090005000345"
                     /note="predicted hydrolase related to dienelactone
                     hydrolase"
                     /old_locus_tag="AO070339000063"
                     /protein_id="BAE55418.1"
                     /transl_table=1
                     /translation="MSFSKCCIQGFSWQGTPTGRTDKLSNNDVYITGDKADVAILFIA
                     DLFGWTFPNVRLIADHYAREVGATVFVPDFFGGEVLDFDLVAAEKFDQIDLPGFIGRN
                     GRDQRESEIFDCARALKQELGYKKVGAVGYCYGGWASFRLGAKEHASAPLVDCIAVGH
                     PSLLTKKDIDEVAVPVQMLAPEIDQAYPLELKLHTFETLQRLNVPFDYQHFPGVVHAC
                     FVRGDENKPGERAAMERGKNAVVGWLRQFLKDT"
     exon            875204..875959
                     /number=1
     CDS             complement(join(878324..878722,878903..878983))
                     /codon_start=1
                     /locus_tag="AO090005000346"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000064"
                     /protein_id="BAE55419.1"
                     /transl_table=1
                     /translation="MTRSFRFANREGLLKRFFPWQHKSHACVPSAKTILAAAVIYVPA
                     LAFAKVGLVILYHRIINKQPGYTWTLHTISAIICGYSVAIMLALIFACNPIQRNWDSS
                     ITRGSCIDRGGLYIATAVTNIVSDFALVLVPVPLVLGLQMPRIQKFGLLCMFLVGCG"
     exon            complement(878324..878722)
                     /number=1
     exon            complement(878903..878983)
                     /number=2
     CDS             join(880425..880690,880754..880954,881017..882085,
                     882159..882326)
                     /codon_start=1
                     /locus_tag="AO090005000347"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000065"
                     /protein_id="BAE55420.1"
                     /transl_table=1
                     /translation="MPSLSTLKLGAFLGLAAIAPSIEAADSSSCRCFPGDDCWPSVST
                     WDAFNQSVDGRLVATVPLATPCHTPNYDQTKCEALKEDWLLPEDHYQSSSSLMAPWFT
                     NGTCDPYHPVSQPCTLGNFVRYAVNVSTPAHVAKTLQFANEHNIRFVIRNTGHDYNGK
                     STGAGALSVWTHHLKGIEFKDWKDEHYTGKAVKLGAGVQGFEAYEAANAQGLRVVGGE
                     CPSVGIAGGYSQGGGHSFLSSMYGLGADQVLEWEVIDGTGRLLVANRQNNTDLYWALS
                     GGGGGTYGVVWSMTSKAYPDSQVSGLNLTFTTTGISDDTFYKAVELYNARLPSFVDQG
                     IMSLNFMTNVSFSLSPMTAPGMPLEKLESLIKPFLNELKALGIKYQYHAESFPAYLDQ
                     FNAQAPLVEIAVAQYGSWLLPRSVVENNSTNRELIQSYRTILSTGANFTNVGLKVSKE
                     VAGDVDNAVNPAWRNAISHMLLYTGWEFDQREKMVEAQKLMTEVLVPAFSKLAPESGA
                     YLNEADFHQPDFKTAFFGNNYDKLRAIKAKYDPNDLFYALTAVGSDEWTVSESGRMCR
                     V"
     exon            880425..880690
                     /number=1
     exon            880754..880954
                     /number=2
     exon            881017..882085
                     /number=3
     exon            882159..882326
                     /number=4
     CDS             complement(join(883153..883231,883286..883663,
                     883713..883806,883813..884005))
                     /codon_start=1
                     /locus_tag="AO090005000348"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070339000066"
                     /protein_id="BAE55421.1"
                     /transl_table=1
                     /translation="MVAPALTNMAADLGIGNVVVPQLTFTIFMLAYAIGPLLPGLLSE
                     TIGRSPVLLASNVFYLPRTLGLARNKAELIAFKFLAGVGGSAPLAVGAGVISDLWAPG
                     ERGQAVGIYSLAPLLGPVIGPLTGGWITERTTWRWMFYSTSMAASVVGVVGCVFIRET
                     YTPVLLKQRQHHVSCEETSGSNTSESLATRLRLASFRPLQFFVTEYIVMVVAIYMAAV
                     FGVFPGIGALNYISLGLGYVLGSQINACI"
     exon            complement(883153..883231)
                     /number=1
     exon            complement(883286..883663)
                     /number=2
     exon            complement(883713..883806)
                     /number=3
     exon            complement(883813..884005)
                     /number=4
     CDS             join(886126..886323,886379..886487,886536..886979,
                     887076..887449)
                     /codon_start=1
                     /locus_tag="AO090005000349"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000067"
                     /protein_id="BAE55422.1"
                     /transl_table=1
                     /translation="MYSSLLLTLLATSTKHVLGEKHHLYSGFFSGSQLYGIQFDDETS
                     TLTVVNNITTNSSDGSKWIAIDERRENVYVASGASYNSYTITSDLGLTLASNLTISDT
                     CANLNHITSLSSSPYTVFGAPYSTGCSGQAITVDQSGALKAIVGSITYRNSSGVHGLA
                     VDTDGTFIYSADDMGDAVWVHSFDKTTGAVEEVQYLAAPRGANPRHLAVHPRGNYVYV
                     VYEKANQLAVYSRDASTGKLTYTNTTYPLIPSGYTNTSSYWSDEVAFSVSSAESPKYL
                     FASTRSIISTSSPGYVTAFSLDATTGAIQEQLFLSQTTGSGGSANSVSPAIFSEDYFA
                     ITDSGSNFIEVWQVSVDGSAATVVAHLDLDNGPANVVWYS"
     exon            886126..886323
                     /number=1
     exon            886379..886487
                     /number=2
     exon            886536..886979
                     /number=3
     exon            887076..887449
                     /number=4
     CDS             complement(887867..888580)
                     /codon_start=1
                     /locus_tag="AO090005000350"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000068"
                     /protein_id="BAE55423.1"
                     /transl_table=1
                     /translation="MCNALEILGLPCWHSTQFMSTRFGDIEMWQEAVDRKFFGAGLKF
                     GRQEFDQLLHDFGAVSSDTPAIAFADDLIEAYPEAKVVLVERDVDSWYESWMNTVIKN
                     TYDPFVTVVYHIDRFFTRPIARIHITTFQGWLGISNPEDARLKSKAKYRQHYELVRRI
                     TPMDRLLEYKLSDGWEPLCEFLGKPVPDQPFPHLNEKKWVDEKLQLLLSQGMKRLAYK
                     VFLYFLAPLALAGLMCFVM"
     exon            complement(887867..888580)
                     /number=1
     CDS             889729..890433
                     /codon_start=1
                     /locus_tag="AO090005000351"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000069"
                     /protein_id="BAE55424.1"
                     /transl_table=1
                     /translation="MDPLQFDKIGHRYNDVTNLPSVWLLEDILKSQIGPIQGLDVLDL
                     ACGNGYWSRRSIDWGAKKVVGVDISKVMVDNAQLQARAEDPSEFHVVDCIAPFNMGAF
                     DLVLGIWLLNYAKDKTELLTMWQNIFHSLKPGGRFVGVIPNYEILQTTACGQEYHFGG
                     VTYKVLERITEGTRIQVILDTTDPIASICYMLEPGLHEECAAQAGFSNLRWEPLPSEL
                     DVDLGPLFFQIVTASC"
     exon            889729..890433
                     /number=1
     CDS             complement(join(891084..891842,891926..892345))
                     /codon_start=1
                     /locus_tag="AO090005000352"
                     /note="ribosomal RNA adenine dimethylase"
                     /old_locus_tag="AO070339000070"
                     /protein_id="BAE55425.1"
                     /transl_table=1
                     /translation="MGKVARTKHSRGANGPYQKPDQGPLGKATSAIFKFNTDLGQHIL
                     KNGAIADAIVDKANIQQGQTVLEVGPGPGVLTNRILAKAKKVVAVEVDPRMAAELTKN
                     VQGTPAEKKLQIVLGDFVKTDLSQLPPFQICISNTPYQISSPLIFKLLSMPNPPKMCV
                     LMVQREFALRLVARPGDSLYSRLSVNVQFFSRVQHIMKVGRNNFRPPPQVESSVVRVE
                     PKSDRPAISWDEWDGMLRICFVRKNKTLRAGFMGNKTRAMIERNWITFATMYPEKVTQ
                     ADIDFMLGNGEPEPMEDVEMDTNNDADDDVPEMDEDDILMGDMGFEKKNVPEIPKGAL
                     LTIGNNKVSRVMVTKLIQVKLQRILDRTELANARAQKCDENDFLRLLHACNKEGIHFS
                     "
     exon            complement(891084..891842)
                     /number=1
     exon            complement(891926..892345)
                     /number=2
     CDS             complement(join(893917..894615,894675..895745))
                     /codon_start=1
                     /locus_tag="AO090005000353"
                     /note="chitin synthase/hyaluronan synthase
                     (glycosyltransferases)"
                     /old_locus_tag="AO070339000071"
                     /protein_id="BAE55426.1"
                     /transl_table=1
                     /translation="MEWTAEKLAARLPVFQQRGPDVPVWRQFLNFLGCVLILPVYYFI
                     TGYSRHPLTLDILISIFVAEFNRYSNEGRRRRLYGLDAPTKTKEDPEKALMSPSLHTG
                     PECLAVVVGYREDPELFRRALDSYKRADGCRFILVGVDGDEKADMEMVRVFEEAYPED
                     SAIVHIDEPFGEIAMRTYKKITEACYETPERCQEMTIAHCCQLAREILAEHDLGLGEL
                     GGVSRLCLYQPHMHKKAIMFTSFIFSIVISDILGIEYMWSSDSDTIVFTDSVRRTVET
                     IAGDPTAGGGSSGLVVHNEDDSMTTKLGSAVYWCELYMTRSTSASSGTSDCQSGPSTA
                     FRVSALPSILYPWYTQTVFGRRMIINEDRHLTTNLLLRGWTVTYASDTLTATDTPTTF
                     SRWLLQQVRWGRATHIESFQQPRVYLLNHPVFFWAAMKKEVGPLLVFLCVLYYLVTGQ
                     RFAYFSSNDAFLRVAYTIGYNWLRNPDRGPRNAWVWIAPALVFYNIPLPSIHLWSMLT
                     VFDGGWGTSMRSNAELSKREQFWKRAYDLGFFVVWMGIVGGTAARMLSGYAGWDAAGT
                     AKAIFLGVFFPSAVSFYGLLVRG"
     exon            complement(893917..894615)
                     /number=1
     exon            complement(894675..895745)
                     /number=2
     CDS             896670..898208
                     /codon_start=1
                     /locus_tag="AO090005000354"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000072"
                     /protein_id="BAE55427.1"
                     /transl_table=1
                     /translation="MARVLFHRENRIVPLGIMIFVLFLFFYHLDLEHDDPVIRGLPDL
                     PQDLSSRQSPLREESKQQPLPSAQPSPSAVPVAPLVPSSEDQKPSTHQQEKPKPKQQQ
                     KPQPKQYGDLSPDDVVLLFKTGASVLWRRLPIHLSTSFEPSRIPADNILIYSDYPETI
                     GSWQVIDVLENSTETVLKTDNYEPYRQQPDYEARQVYAEMANVEGDGNGPAGGWKLDK
                     YKFLPLIQHAGRAKPEAKWYIYIEDDGYIFLPNLLLHLEKFSWQEPWYFGGLAWKHGD
                     YFAHGGAGFVLSRGAWEQSFGLEEDMVTKYADFTEAHGCGDHVLGHVMQDYGINFGQT
                     HGKSEYSWGFNPEPHWGGWFRRASWCYPLYSWHHTHSKDVARLYNFEQSWDFEKKGQF
                     RYRDFFKAMVEPYMRRRVEWWDNQSSRYELRSDNIADAQPPEGVSKQVWNSAWKSVDA
                     CEAACVAWEGCVQWTFYEDQCRMDENFMLGMGIPVGDLRRQTSLPRTSGWLPQRAEKW
                     VCDA"
     exon            896670..898208
                     /number=1
     tRNA            complement(898801..898873)
                     /locus_tag="AO090005t00005"
                     /note="tRNAscan-SE"
                     /product="tRNA-Arg"
     CDS             complement(join(899581..901406,901466..901832))
                     /codon_start=1
                     /locus_tag="AO090005000355"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000073"
                     /protein_id="BAE55428.1"
                     /transl_table=1
                     /translation="MLLISILSILTFLCSAPVSASRVIKSNSLDLCTDNKNFTATFFN
                     VTFTPDDRLLSIGFNGTVAISGNVVADLSLKAYGKEVITKTLDPCQMKEQRLCPMNIG
                     KLEIPAIQTTLPQSVINQVPNVAYTVPDLDASVRVYINSTDTGAPIACMEASLSNSKS
                     VYQQAVGWVIALVIGLGLASSGIASILGYSHAALHVAAKSLALFGFVQSQAILGMTSV
                     HMPPIVESWTQNFQWSMGIMHLGFIQKIANWYLRATGGTSSTLLSDLENTSVNVLKRK
                     RSLDFGAGALMKRESGEGAAPDGSKTIYGIVRVGFKASIERTDIFMTGFIFIMVFIGF
                     TMLIVGLVRLVSGLLAKSGKTDSTKMDSSTWAVTMKGILLRLILMCYPAVCVLCLWEF
                     ASHDSPAEVILAVAMLLSTTAILVMAAVRIIRKARRSVEIYKSPAFMLQNDTVFLNKW
                     GFLYAHHRSPAYYFVTLMVVYIFVKGIFVALCQPSSSVQIAALFVIEVLMLVAVCVIR
                     PWMDKKTNIMNISVTSINFLNTLLLLIFNFRERDMATSILGVILFVYNAILTLILLIV
                     IFIASIMALVSKNPDNKYQVMKDDGSSIMSRTHMTELDALGAAARGSPDQNQKQNPFV
                     HNEVPPNHANSLQASDRTSPSHMTGANHSPSSPLDPSVPLFPSSDTRSTSPYESGDHT
                     LSPSEYSPPGVSPVNRGYNVSPIRTPSPHAYRAANNASPWQRGAGYEH"
     exon            complement(899581..901406)
                     /number=1
     exon            complement(901466..901832)
                     /number=2
     CDS             905328..905900
                     /codon_start=1
                     /locus_tag="AO090005000356"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000074"
                     /protein_id="BAE55429.1"
                     /transl_table=1
                     /translation="MHERGVVEEQLRRYLIAVDKLYQGSEEKVAQRILLLRIQARMYY
                     GILLQRFPCTSSGQSSIIIHPLSPLNVQSYPAPEDWIDTALSEISILLDASKSPACRS
                     RPFTLSTQLVGGLLHAGLKTTHQHTMKTALNLLQHPNFPSRDGLWDAKATESAIRSLL
                     AQVSAEQDAGDRVLFVSTLDEPGQMVSYGR"
     exon            905328..905900
                     /number=1
     CDS             complement(906153..906914)
                     /codon_start=1
                     /locus_tag="AO090005000357"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000075"
                     /protein_id="BAE55430.1"
                     /transl_table=1
                     /translation="MSKAQYRDHEDPIPSYEESVRSSTTQNPPYNMRSDIAAPLHRHL
                     DASRVQRVHSLLEQYVDPLLAEQASSGLYRTTFIFIPSNVTSLQPREKTSYSAPRTPE
                     PVGFPTSTVVKLVQLEGEAHTMEFWRQPAVLRELESSLRARLAASGHHVEGGDEVPTS
                     TKETKSLKSNEDSKPKQKRSFWSRITGTSEAVIVDRKLGWRAEQEETAGRKLGRDQVR
                     VVVEWKEVCLRVENDLGLYDNCNAPGICLSVEVGE"
     exon            complement(906153..906914)
                     /number=1
     CDS             907855..909066
                     /codon_start=1
                     /locus_tag="AO090005000358"
                     /note="2-polyprenyl-6-methoxyphenol hydroxylase and
                     related FAD-dependent oxidoreductases"
                     /old_locus_tag="AO070339000076"
                     /protein_id="BAE55431.1"
                     /transl_table=1
                     /translation="MSRPILIIGGGLGGLCLAQALRKHNIPFKLFEKDAEINYRPQGY
                     RLRISEDGIYALQYALTPEIYTLFEQTCAAGLAIGVQVKPDGSPVDAARRIGPPPMKG
                     PKPYTVDRTIFRKVLLTGLKDDVFFGKALDHYTLHDDKVSAHFTDGSVEDGAILVGAD
                     GVRSRVRKQLIPGAKVVDTGMRALYGKTPITPEFLARFPEQYQRGMNIAIDDSVPEGQ
                     VYLLFEATWFPNADTVSEPELPSPYVYWVLGAHSSRLGVPDEKLLSLSNDEAADLAIQ
                     VTESWSPGLRAVFEMQGKGQASTLRISSAPLDLPVWEVSPRVTLLGDAIHVMPPTGAL
                     GLVTALRDSADLARKIVDAGGIENVDRSVIGNYESEMRDFAKMALGRSWQSGLKTFGL
                     RPVEECEMVDM"
     exon            907855..909066
                     /number=1
     CDS             complement(join(909290..909529,909592..909902,
                     909962..910121,910183..910284,910347..910711,
                     910770..910993,911046..911244,912466..912484))
                     /codon_start=1
                     /locus_tag="AO090005000359"
                     /note="amino acid transporters"
                     /old_locus_tag="AO070339000077"
                     /protein_id="BAE55432.1"
                     /transl_table=1
                     /translation="MAGNCLGINHYKKTKKYLLSSSLIVRSRKEDSDNDNLKSQDSLH
                     VIESHVLQERKIGTFGAISLVVNKIVGAGIFSTPATIYKLSGSVGMALMLWVIAGMIS
                     TCGALVMLEFGSGIPRSGGIKVYLERSFSPRLLQTCIYLFYCVFLQVSASNAITSSSY
                     LLLAGGVESTTWKLRGVAIAAAGFAVGLHTIAPRAGRGLQDLLSAVKLFTLLFIVCTG
                     FAALAGHRRVPDPHNFDIHTSFKGTSNSGYNIGTALLDAIFSFQGYDNVNAVLSEVKN
                     PQKTLRIALPSAMGIITVLYLLANVAYFAAVPTEEFTNSNITIAASLFRNVFGDSAAT
                     KALPALVAISAVGHLLGIAYTVPRVLQELAKDGITPFPNIMMQNRPFKTPIVALAVHL
                     GVTILFICAPPAGDAFNFIVSLSSYPTTFLLTAITVGLVKLRLTKDEGWASAFTAPWA
                     MIAFYLVGNIFLLIMPFIPPPNGKGSTNLPYWLSPVVALAILSLGIVYYLLRFILFPW
                     VFGYTLQPVAVELSDGSQVTRYRIQKIGETR"
     exon            complement(909290..909529)
                     /number=1
     exon            complement(909592..909902)
                     /number=2
     exon            complement(909962..910121)
                     /number=3
     exon            complement(910183..910284)
                     /number=4
     exon            complement(910347..910711)
                     /number=5
     exon            complement(910770..910993)
                     /number=6
     exon            complement(911046..911244)
                     /number=7
     exon            complement(912466..912484)
                     /number=8
     CDS             complement(912781..913824)
                     /codon_start=1
                     /locus_tag="AO090005000360"
                     /note="flavonol reductase/cinnamoyl-CoA reductase"
                     /old_locus_tag="AO070339000078"
                     /protein_id="BAE55433.1"
                     /transl_table=1
                     /translation="MSSDDLVIPKGSLVVVTGANGFIGSHVVDQLLQHGYNVRGTVRN
                     VAKNSWLNDYFSAKYGPGRFSLAEVPDMSHEGAFDEVVKGAAGIAHVATPVRQFHDPN
                     IAVPMVVNGTLNVLASAAAEPSMRRVVITSSSTAAASPQPNKVFTMDEKTWNETAVKA
                     AWAPPPYEGLQRRLDVYSATKTQAEQAAWKFMEDKKPDFVLNTVLPNVNMGTILSPEN
                     QGYPSSGGWVKAVWDGFPGEEGEKLKYNPPQYYVNVQDDALVHVAALIYPDVQNERLF
                     AFAHPYSWNDILDALRRLYPQQKFIDDIPNIGEDKSKVANQRAEELLKRVSGLPAWTS
                     LEQSVHDATKAWV"
     exon            complement(912781..913824)
                     /number=1
     CDS             914899..916092
                     /codon_start=1
                     /locus_tag="AO090005000361"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000079"
                     /protein_id="BAE55434.1"
                     /transl_table=1
                     /translation="MNPKYQKNRKASIRKRLCQVTWGWYSISMATGGIAVLLYNTPHQ
                     FTGLETIGKIVYVFNLVLFLSISLCLSFRFLTKSSALKESFQHSNETHFVGTCLLAFA
                     TIIIGAESYGTSACGPWLQVALRIVFWIYVAISIIEAIFHNWYLYHHSMASEQPFALV
                     RLLPSFPAMLSGTIASVIASNQPQKHALPIIIGGTTLQGFGFLMSLFIYGEYFYRLNK
                     SGLPKPSERPEMFIAVGPWSFTALALIGMANAAVEKFPVRYIISYADSSHSETVTVTT
                     GDIALVIAALAGIFLWTIAFFCLCIAIASVLALCKAFGGAGAPGMSLPYWSMVFPNTG
                     FVIATIRIGQVLQSEAVLWVASAMTILQVAIWLIASVATIWAVWTRRMLWPEDAEKEE
                     GEKEC"
     exon            914899..916092
                     /number=1
     CDS             join(916615..916984,917089..917259,917533..917627)
                     /codon_start=1
                     /locus_tag="AO090005000362"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000080"
                     /protein_id="BAE55435.1"
                     /transl_table=1
                     /translation="MSQKVIRLSGPRTSVRNLSFAYIRNFSQFSDGNSREIFSWNVAS
                     IARALRLSPSANHEWDELLAAHHVTHFMGILVRLGIQYIKHNRASLWSIEAALCGLGC
                     SVFLDKWLRAFRTPTGPKSLTDQEHLLIAWTRDIVRDGSISINAVCPDLSSERPEDLV
                     NYTIEVWCHIMQGDSPWPFINTPYRNSLSMMKDIRTPSRLALRPLHVRNTL"
     exon            916615..916984
                     /number=1
     exon            917089..917259
                     /number=2
     exon            917533..917627
                     /number=3
     CDS             920637..921170
                     /codon_start=1
                     /locus_tag="AO090005000363"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000081"
                     /protein_id="BAE55436.1"
                     /transl_table=1
                     /translation="MLRRIQSLASIILLLSLICPVYSANGFVGYGVSMYKPPCAHACR
                     SSITNPLNCSTNSNDDMGITWIIEKSPEPHCYATNDAFLQTLAYCIYSHCRTESNSTL
                     QRYWEMNVAGSEKDQPLPNQAYQQALQNIGFRPNITANASTALESASLVSEELYKLNW
                     RTLTVFEEVEATHEKFG"
     exon            920637..921170
                     /number=1
     CDS             join(921389..922708,922816..922844,922856..922875,
                     922930..922958)
                     /codon_start=1
                     /locus_tag="AO090005000364"
                     /note="ferric reductase, NADH/NADPH oxidase and related
                     proteins"
                     /old_locus_tag="AO070339000082"
                     /protein_id="BAE55437.1"
                     /transl_table=1
                     /translation="MPTRGQALFIAYLIFINVVLCAVGFNSADPSAWYTSNHLEILTY
                     VSNRAGILSFANIPLLVLYSSRNNILLWLTNWSHSTFLLLHRWIAAICVIEACLHSAI
                     YLHIYSAQGEHSSESQRAYWYWGIVATLAMVLIVPGSMLQVRRRFYEFFLAWHVIFFL
                     LAMVGCCLHIYYRYDFQWGYENWIYMALAIWGFERGMRILRFARHGIRTAQVSIVDDE
                     YIKLEIPGIAADGDVYLYFPTLTWRVWENHPFSVMTDVCQGTDTGLSTTRITTDKDRL
                     PISWTEKGESLDKMSLAEISNAPCQRGLVFYIRTQSGITKYLRGTKSKFPVLVESSYH
                     PVVLSKPNPSGMTNIIAIAGGVGVTASAPILMRHEGWHRLFWAVRSKPLADSVAASLG
                     ADRFNRLNAVVFQDNRMDISRILQEEVSRCVGTEVAVIVSGPARMADEKFMFDYTDFV
                     LSSECFYSIKAGMSG"
     exon            921389..922708
                     /number=1
     exon            922816..922844
                     /number=2
     exon            922856..922875
                     /number=3
     exon            922930..922958
                     /number=4
     CDS             complement(join(923553..923718,923814..924268))
                     /codon_start=1
                     /locus_tag="AO090005000365"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000083"
                     /protein_id="BAE55438.1"
                     /transl_table=1
                     /translation="MRQIFILIALFLAGFAASQGAAGSAQAGIPGSYPESPPQSRPQS
                     PPQSPPSSPKPGPKADTGKPQPALSLKAELEKRCREISIHEAPRDDYRGSMYAFVDTI
                     CDDDPKNYPKHYQDADHRDPHKPKELKSTVNLGRCLGWDKKNGGFIKEIDYKRGTKDG
                     ENNLSCWCQYGKGERVQDPIRKKMAIKMEFDLGEPPCTTDHIITLN"
     exon            complement(923553..923718)
                     /number=1
     exon            complement(923814..924268)
                     /number=2
     CDS             complement(925141..925935)
                     /codon_start=1
                     /locus_tag="AO090005000366"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000084"
                     /protein_id="BAE55439.1"
                     /transl_table=1
                     /translation="MALDEYTNLMQQAEALMDKWSTALHRFEESRGSRLTYRDSIGLK
                     ILRIYQCWRLVMLDRTKSEATDLKSWDKYNSTFQLIVSLAEAVINTADSDAPLSSTSS
                     VPSGTFNEDRRPSFSLDMGIICPLYDVATLCRDPSIRRQAVKVLRSASRQEGLLNSHL
                     CAIVAERVIELEETAALQGGIDDQKCLASVATHPLGPEPSSQAEASSQHITRSSEVPH
                     AARFIYAYPNFDPLYKQAFLTLAVDQAGERHTKIPLPAVTAMLDME"
     exon            complement(925141..925935)
                     /number=1
     CDS             join(931606..932273,932325..932775)
                     /codon_start=1
                     /locus_tag="AO090005000367"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000085"
                     /protein_id="BAE55440.1"
                     /transl_table=1
                     /translation="MSFLRNFFGTSATAAKDDQNTPIRALPASWYTSQAMYQLERRSI
                     FSRKWLLTTHKARVPNPGDWVQYDAAGYEFVVMKDHQGNVKACHSSDLAPVHTHIDRN
                     GFVWVNLDASATPEVAWKDDFEGVDEQPRFQHYNFDEYNFDHTWDMEGDFNWKILADN
                     YNECYHCQVAHPDIPTIADLNSYYVKTKDGHIQHYGAQRQDQIDKGFRIATTYFWPNA
                     SFNISPHFFFMQRFTPMSPTKSVMRYEVYRHKDASDEEFNLISDMYKRIMSEDKYLCI
                     HTQKNLNAGVFVNGQLHPEMEKGPLHFQKTVREVVTEHNKKEDAAGHEIWPAQRSAPQ
                     DSTVSQDTFSFPTPVDSYTEKDDLKDSLNANLATAIAV"
     exon            931606..932273
                     /number=1
     exon            932325..932775
                     /number=2
     CDS             933359..933754
                     /codon_start=1
                     /locus_tag="AO090005000368"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000086"
                     /protein_id="BAE55441.1"
                     /transl_table=1
                     /translation="MPWQAQVCTFCQKQYVHKTGLRDHLSCYTGDVRIPADGIHDVLK
                     IEKILDGGNRRHCQYRCPVCSKTINGRYNFIEHVVYSKHHDVLNGDFQKGTIRRYRHQ
                     GWPFQFEKKTVKVWQRKGKFPFLRLPFGL"
     exon            933359..933754
                     /number=1
     CDS             complement(join(936959..937113,937168..937461,
                     937513..937743,937807..938277,938331..938523,
                     938573..938825,938877..938922,938973..939350,
                     939373..940000))
                     /codon_start=1
                     /locus_tag="AO090005000371"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000089"
                     /protein_id="BAE55442.1"
                     /transl_table=1
                     /translation="MDERHRPLRRNGFEVAIICALPLEANAVLCSLDEIWHDAHNTYG
                     RAVGDDNAYDYGRSGGHSVVVVTLPGMGKVPASTAASYLRMSFSSIKLVLLVGVCGAV
                     PRTDRTEIILGDVVISQSIVELDRGRQYPNGFKRKDTILDSHGRPNEDILGLLQRWKA
                     TLHLKNLQKKTTENLKTLLQHPDSEARYPGATEDKLFERDLQYSSGTRLTACDELQCD
                     ESKLVPRTRLRERDTDGEIPTPLIHFGLIGTADTVQKSAAHRDKHAESEGVIAFEMEG
                     AGVWNKFNCLIIKGVCDYADSHKNKNWQNYAAAVAASVAKEILGQYVSHDQPSQPGTP
                     NDSSGYFTQHSMISRGRATKRFREGLAKEQLDTFKATDLRALKKELKKIQDEQEQSHS
                     LRNLRRLERFIQATEQIGTVLEDILGTSEEMCLVWGPVKALLQVAKGNVDLFDTLLEA
                     YEYIGSELPNLGVYRELFKHHVGLQRILARVFALILEFHENTLRLYSGRALRTVFRPL
                     WKDFETTLFDVIVRETGSHRIMIEDKTMALYSHPGHCTMDAQEVRDHLESTSNNMRLS
                     KQEHQKAREKMYDEVRCWIAGAAGVSGVEDVADVVGAETESDHNNICRDRGFYPGSGS
                     WILENEKVKKWLSPEPEQSSNSMLWINGRPGTGKTYLASVVIETCLEDSSSVTCYFYC
                     KEKVKSRNSAIAVLRGILLQLARQHRELIPYCYAKIKSSGSLMLSDLSTANDGVDECE
                     EQRKDLIDIFRILVRKNEIYAKGKLRVLFLSRPMNEVKNALPEAEMLALEPDHNRQDI
                     QKYCERRKREFQKFGFDNEYLKDVVQIICTRADGMFLFAKLVMNNLKEQPTREDFRIE
                     TTAAILPSEIDQACVASFYQRPLPSH"
     exon            complement(936959..937113)
                     /number=1
     exon            complement(937168..937461)
                     /number=2
     exon            complement(937513..937743)
                     /number=3
     exon            complement(937807..938277)
                     /number=4
     exon            complement(938331..938523)
                     /number=5
     exon            complement(938573..938825)
                     /number=6
     exon            complement(938877..938922)
                     /number=7
     exon            complement(938973..939350)
                     /number=8
     exon            complement(939373..940000)
                     /number=9
     CDS             join(941128..941315,941372..941534)
                     /codon_start=1
                     /locus_tag="AO090005000372"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000090"
                     /protein_id="BAE55443.1"
                     /transl_table=1
                     /translation="MKSLQTEADTAQAEVEKLTAKIQELEQDNQSKDEEIATLSTRHQ
                     MLEEQVEETEILVREVKRLSNEDDIQAGHYERRAQALQADCDQWEAKYNDMAAKHAEL
                     QKNLDSLLGEMGEV"
     exon            941128..941315
                     /number=1
     exon            941372..941534
                     /number=2
     CDS             complement(946209..946943)
                     /codon_start=1
                     /locus_tag="AO090005000374"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000092"
                     /protein_id="BAE55444.1"
                     /transl_table=1
                     /translation="MGFIIPSNSNAAGYPEGDDVMKEDLIGNGLIWILSKIINFISSG
                     DNLQLGSGPVNTGPLGISQQVLLERWYRLETELDVWYNGLPDTFRPCARLEHPLQKDG
                     DGDGDGCALSEIWYSIPVCSSAMQHYHMARILLLINKPHESTSRRSTITNRLNSYRSI
                     ESEIRFHSREIVGISMAHPEGSVRINSLQPLFVSGQCLTEPREREMVLQLLRGIEFDL
                     GWATGYRVKQLLREWGWDEQAKVGAP"
     exon            complement(946209..946943)
                     /number=1
     CDS             complement(join(950763..951001,951065..953317,
                     953378..954527))
                     /codon_start=1
                     /locus_tag="AO090005000375"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000093"
                     /protein_id="BAE55445.1"
                     /transl_table=1
                     /translation="MRNPSLFRPATAGLSTALYLGSLLQLSPASGLSFTPVAQPDLEL
                     SPLGRVALTGDFDAVSFYSYKEQSETASVNNGSQSILTPLPDGILTTLSTSDAYIRSM
                     CPFTQKDGTYAGIFVGGNFTSLGGVETQGAALFDPETKKVTALPGLSGSVSAVLCDKD
                     TNSVYVGGDFKYENTSNAVAWVGNEGWKSLVFGGFNGPVTSILKSDDHIIFGGSFDGI
                     GNSTSSKKNQQIINLQNATISSDAVSSRSGYSDPRNIICQTSGEDGEGKTWLLEDNSP
                     GFWRADMRFGYNPTKIRIYNTHFEGRGTKTFLLRRLPDNGIMNLTYTDPDTAKDVYCD
                     QDCSLSNSTDEKYREFEFVNSVGMKGFQLEVHSWYGDGAGLNGIQLVQNDIFAYAIND
                     FNEPTCADLKYPSKATQTGSWTTTELGQSQSDYLTANINDSTASDTSVVFEPDVKQSG
                     NYSVVVYTPGCTQDGTCGSRGVVNVTATLKSNSKSAEPIQMTIHQTNLNDKYDTLYTG
                     HVDSSDGSFRPSVTLTPVAGQGDVTIVASRVKFALIRASEGLDGELNGLYDFDPSAKT
                     TSSNFTESAVNRAGLQLDEDATIRSLAIHDGVMYAGGNFSSSGFKNILSLKGETNATG
                     LQQGGLNSEVSSMTVLDDILYVGGNFTDTSDRSNSDLKHVAAYSFGSKAWTALGGGVN
                     GPVHKVTSLTLNVSTEINETTIGVTGDFDQLLAFDDNTLVNVTGFAIWVPSKKNWLQN
                     LNVTQMAFAGQLSACTKVDNTTVIAGTLSSAGIAAAGAAALLHEGPLSIKPLFANANF
                     TGETYTGIYETKSNRNLTIVGGHFTTTGTDGSSVKNLALLDGKAGTVKGLGTDIDNNS
                     TFLALTAWKDKLYAGGNVSGTFEDYILNGFVVYDLENGTIARKQPPRFTGDAATVNSI
                     AARPDSDEIYFGGQFEKAGALPCPGVCFWDAADQQWNRPGILSGKVLALKWISNKKLL
                     AIGNLTVDGNSSAIATYTPKQQTWESWTSASDLPGTVTAFTPASVDVSTFWLAGVSKN
                     GSSYLANYDGSKFQYPGDLFDQGTTIRNLEVLSLTKDHSGVDVLHNDQVLLVTGQLVI
                     PDFGNASAALFNGTELTPFMLSSNADGQPGSMAQLFYENDNPYSSEVGNHHSNGIVVL
                     ISFCCALGAVFLIVIAGVIFNKIQRRRQGYMPGPQAYGTDRSSSMRRLPPEYLFSTLK
                     SLNPGTPAI"
     exon            complement(950763..951001)
                     /number=1
     exon            complement(951065..953317)
                     /number=2
     exon            complement(953378..954527)
                     /number=3
     CDS             join(955571..955572,957530..957752,957814..958337,
                     958391..958630,958685..958816,958878..959111,
                     959168..959543)
                     /codon_start=1
                     /locus_tag="AO090005000376"
                     /note="nucleosome-binding factor SPN, POB3 subunit"
                     /old_locus_tag="AO070339000094"
                     /protein_id="BAE55446.1"
                     /transl_table=1
                     /translation="MESFDNIYLDLSKQPGKCKLAESGLGWKPSGEGETFTLDSSNVG
                     AAQWSRAAKGFELKILSRSSGVIQLDGFDQEDFERLSKAFKIWYGINVESREHALRGW
                     NWGKAEFTKAELSFNVQNRPAFEVPYSEISNTNLAGKNEVAVELALNTDGADANAQPA
                     GSTKNRGRKAASGPDELVEMRFYIPGTVMKTEKGIKEENGKEENGEEEEEGEEQNAAN
                     LFYEMLMEKAEIGDVAGDTFATFLDVLHLTPRGRFDIDMYESSFRLRGKTYDYKIQYS
                     SIKKFFLLPKNDDTHTLIVLGLDPPLRQGQTRYPFLVMQLKLDEEISLELNMTDELME
                     TRYKDKLEPRYEEPIHQVVTKIFRGLSGKKVIMPSKDFVSHHGHSGVKCSIKANEGLL
                     YFLDKSLIFVPKPATYIQVENIAIITMSRVGGAVSASRTFDITVSLKAGMGEHQFSNI
                     NREEQQPLEEFFKAKNIRFKNEMSDDAGALLAAALDNDVMGSSDDEGVRADRGSADED
                     EESIDEDFQAESESDVAEEYDSAHESSGSGSDAEMNDASDGGGDDDDDDEDVDMSEEE
                     RPKKKSKVGK"
     exon            955571..955572
                     /number=1
     exon            957530..957752
                     /number=2
     exon            957814..958337
                     /number=3
     exon            958391..958630
                     /number=4
     exon            958685..958816
                     /number=5
     exon            958878..959111
                     /number=6
     exon            959168..959543
                     /number=7
     CDS             join(962622..962736,962794..963260,963322..963957)
                     /codon_start=1
                     /locus_tag="AO090005000377"
                     /note="septin family protein (P-loop GTPase)"
                     /old_locus_tag="AO070339000095"
                     /protein_id="BAE55447.1"
                     /transl_table=1
                     /translation="MKNVVRRKLTGYVGFANLPNQWHRKSVRKGFNFNVMVVGESGLG
                     KSTLVNTLFNTSLYPPKERTGPSHDIIPKTVAIQSISADIEENGVRLRLTVVDTPGFG
                     DFVNNDDSWRPIVENIEQRYDAYLEAENKVNRTNIVDNRIHACVYFIQPTGHSLKPLD
                     IEVMRRLHTKVNLIPVIAKADTLTDEEIAQFKQRILADIQHHSIQIFEGPRYELDDEE
                     TIAENQEIMSKVPFAVVGANAEVATADGRKVRGRSYPWGTIEVDNEEHCDFVKLRQML
                     IRTHMEELKEHTNNHLYENYRSDKLTQMGVAQDPSVFKEVNPAVKQEEERALHEQKLA
                     KMEAEMKMVFQQKVAEKESKLKQSEDELYARHREMKDQLERQRQELDEKKSRLESGRP
                     IEEKGKRKGFSLR"
     exon            962622..962736
                     /number=1
     exon            962794..963260
                     /number=2
     exon            963322..963957
                     /number=3
     CDS             join(964806..965351,965472..965811,965868..966418)
                     /codon_start=1
                     /locus_tag="AO090005000378"
                     /note="uncharacterized integral membrane protein"
                     /old_locus_tag="AO070339000096"
                     /protein_id="BAE55448.1"
                     /transl_table=1
                     /translation="MPSQSGCVMKRCLQRHWARCCLPQVLPSATTIKETVSLLSCVVS
                     QQLPQLSLSLSLLFQKTYLVLLLVLPTNTALVQLRRHRQNPLTTTAPRPASPKNSALH
                     RSIRSPSSFSRPFSVLSLTSRPLSALLPLRSRSLEPSFLLSLRTSPVPKKTTHTFRSH
                     GSTSSVELAFGREAEGLGPDSTRNMVPVWSNLRYPHTRCYPPSDDIRKARLGENKPAD
                     WLRHVTLLLSVFRYLLSYITFNYYSSSAQVSYRLAFLSAAATYGIVVYKGHIARGRLQ
                     GSVPNIAVKLAGDENVQYLGMAIVWLYSRQVPLALLPFSVYSIFHVATYSRAHLIPTL
                     QPPAQGAGSASPSSPGAAKPAASPLADTIGRFVKQYYDASMDLVAGLEMALLFRLALG
                     VLTFSKGSILLFFIYVAFFRARYTQSSFVQQAVRHFTARVDASVSHQSTPPAVRQGWE
                     TFKGVVRQAYESTDLGRLTSGAQGKKPQ"
     exon            964806..965351
                     /number=1
     exon            965472..965811
                     /number=2
     exon            965868..966418
                     /number=3
     CDS             join(967369..967572,967678..967975,968040..968797)
                     /codon_start=1
                     /locus_tag="AO090005000379"
                     /note="predicted mitochondrial carrier protein"
                     /old_locus_tag="AO070339000097"
                     /protein_id="BAE55449.1"
                     /transl_table=1
                     /translation="MSLTSRVLGLFSTTETTVPDSPPVASYSKPTNTGDHAFHATGQI
                     RAGSGHVQTTPLEDEEEPRPPYLRAMLAGGTGGTCGDMLMHSLDTVKTRQQGDPHFPP
                     KYTSMTSSYATIYRQEGLLRGLYGGAVPAFCGSFPGTLIFFGVYEFTKRRMIDSGINA
                     NVAYLSGGFFADLAASVVYVPSEVLKTRLQLQGRYNNPHFNSGYNYRSTRDALRTIIR
                     QEGFSALFHGYRATIYRDLPFSALQFAFYEQEQRLAKNWVGSRDIGLGLEILTAATAG
                     GMAGVITCPMDVVKTRIQTQQNPDVQSSASSSKPAAEHASIKESPRQHTSSQTPSSLR
                     KHSRPISTGGASTSVAPPGAPRLDTSSFLTGLKMIYQTEGLAGWFRGVVPRGVWTSIQ
                     SGTMLVMYQYLLKKLEVYDNLGEMNPL"
     exon            967369..967572
                     /number=1
     exon            967678..967975
                     /number=2
     exon            968040..968797
                     /number=3
     CDS             join(969449..969528,969597..969941,970043..970745)
                     /codon_start=1
                     /locus_tag="AO090005000380"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000098"
                     /protein_id="BAE55450.1"
                     /transl_table=1
                     /translation="MSAALPYLQKLRKSQLTDWAEATDLHNYEEYNKPELATLLDQHL
                     QANQSIFAKDARLTDYYRRLSQTPRKGSPVKRDPRVEISPLAKETPRSVLRSARRRQT
                     RALEEEVKEDEAKEEANEEPKEELKEEPSAEPKEEAEQLQEESDASPPPVFQTPGPSP
                     LNFQSALPASPALIADVVDRESVAWRKKASDWWTGSGVPDSTQSLRSLLSSAKAVQIL
                     TLLLEGCSIIYEILPLRFVSTISIWAIEISIKVPDVFVLVDSVFWAPFSLWLLTSILL
                     PLTVAYFFNISLNITQGSSAASHTRRSRASPDNFDPLSFNIAKAGLSYLVYARQFNFF
                     NLYSQFSIARVNAAVPGQWAGLVTGSAIGLVGTLYEAILRK"
     exon            969449..969528
                     /number=1
     exon            969597..969941
                     /number=2
     exon            970043..970745
                     /number=3
     CDS             complement(join(972688..972708,973014..974783))
                     /codon_start=1
                     /locus_tag="AO090005000381"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000099"
                     /protein_id="BAE55451.1"
                     /transl_table=1
                     /translation="MSGHLDDYPLDTARREIRLLTIVPALSSKARIKCSLQVASLDAF
                     PRYEAISYVWGDIQEKQDILLDGRTVQVPTNVRRILQRLRHRMQRRVIWIDYVCIDQE
                     NVAEKNTQVPLMSAIYANATSVLAIISLDNLSDNATDAIDWMKTADMEKGKWKEACRR
                     VNCILSQISMRYERRLAVSLRNVVSFYVNFLFAEYWTRMWTFQEYQSSQGKPPICICG
                     DVEFPAPDESAFGSVFVSVFRRFRKMSSKAEERGRRPQLRNHYKEIERLTIKFHNTLS
                     KVNYMWVSDRQEFFVQDLLRQTSGRKCQNPKDKIYALYGLLPSLREAYPPDYNKSLSQ
                     VIFETAKYILNKEHGGLSMLDIFCLREDRLENISIPSWVPDLTATSLVSTGTLGRHSS
                     RFGIAYKIRETVPGRYLEITEDHSVLCLSGRPIGKCRPVFQFASDVKSVLAQIMGVIQ
                     MHGYGCHVWNNVWEPENIPLRFVQGCCVFSNHDDAEFDRSTLGSLRTIFETLDMTHQD
                     ADTVLETFAEAGFEFLRDLVPRLYNIEVFTIHHMSSVSFGFSEQSVKKDDQVFVNVSQ
                     FNMPFVLRHGCGTDYNRGQVYHKLIILRVL"
     exon            complement(972688..972708)
                     /number=1
     exon            complement(973014..974783)
                     /number=2
     CDS             join(978053..978090,978175..978230,978277..979321,
                     979557..980391)
                     /codon_start=1
                     /locus_tag="AO090005000382"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000100"
                     /protein_id="BAE55452.1"
                     /transl_table=1
                     /translation="MTSFGKVAPLRSTMTEILSEVRDEIWKKGTGNDSRLHGDTDGYG
                     SFHSLANLTIAIDGIDKVSDYTRSLDLGTGIHTTTYSTGKGKYTTDVYCSYPAQVCIY
                     KLNSTATLSKVTIYFDQLVEESSLWNATCDSDFARLRGVTQEGPPRGMTYDTIARSSI
                     PGRCDSSTGKLAINARNSSSLTIVIGAGTDFDGTKGTAATDYTFKGEDPAEYVEKITS
                     SALSQSESKLRTEHIEDYSGLMSAFTLDLPDTQDSTGTELSTLITNYNANKTDGDPYL
                     EKLLFDYGRHLFISSSRANSLPPNLQGVWSPTKNAAWSGDYHANINLQMNLWGAEATG
                     LGELTVAVFNYMEQNWMPRGAETAELLYGGAGWVTHDEMNIFGHTGSLVVNPCTSPEQ
                     GPTTFGCTHWQQLIHQVYENAIQGAEIAGETDSTLLKDIKDQLPRLDKGLHIGTWGQI
                     KEWKLPDSYDYEKEGNEHRHLSHLVGWYPGWSLSSYFNGYNNATIQSAVNTSLISRGV
                     GLYTNAGWEKVWRSACWARLNNTEKAHYELRLTIDQNIGQSGLSLYSGGDTPSGAFQI
                     DANFGYLGAVLSMLVVDMPLDSTHSEDDVRTVVLGPAIPAAWAGGSVKGLRLRGGGSV
                     DFSWDSEGLVDKASATGVSSNVRIVNVEGTVLV"
     exon            978053..978090
                     /number=1
     exon            978175..978230
                     /number=2
     exon            978277..979321
                     /number=3
     exon            979557..980391
                     /number=4
     CDS             complement(join(980704..981487,981542..981803,
                     981857..981967,982032..982593))
                     /codon_start=1
                     /locus_tag="AO090005000383"
                     /note="predicted protein"
                     /old_locus_tag="AO080508000386"
                     /protein_id="BAE55453.1"
                     /transl_table=1
                     /translation="MRYPHFILLCTLSPLALGKLCPIQGPAFPAPKDVASSSSFTQAK
                     NQLLSTLDKAVHASNASEVTGIDPDSISFSLQVFNTKSDQPLLEYYHTAPSIRNSTVG
                     VREVDADTVFRIASVSKLWTVLMLLIEKGDASLSEPVAKYVPELRDAAKELSHNATMR
                     DDEIDHLRWDEVTIGELASHMTGVIREYASIDIAALSASTPGGFPTLPKSDIPPCGTK
                     VACTRSEFFDGILKSHPILHTSSTPIYSNPSFQILGYALEAMTNQTYKSLLQRDLIKP
                     LGLSRSSYDKPEDDTAIIPGPAMSSFYGVDAGGETAAGGLYSSTKDMSIVGRAILNST
                     LLRPSLTRRWMKPRAHTSSLEVSVGAPWEIFTLTNPRLIDLYTKQGDLGMYSSMLALS
                     PEHDVGFTILAAGESTTEAVTLITDLTINTLIPALEDAAREEANTQFAGEYSSANASI
                     KITTDDQPGLKVTEWTNESVDVRQLLVSKLGLQNASDLSVRLYPSGLKAPGRVGFRAV
                     FQDNSEGDSGIGPVTRACTTWSSVDSIIYGNVGADEFVFGVDGSGRAVSISPRALRVE
                     IPRVEA"
     exon            complement(980704..981487)
                     /number=1
     exon            complement(981542..981803)
                     /number=2
     exon            complement(981857..981967)
                     /number=3
     exon            complement(982032..982593)
                     /number=4
     CDS             complement(join(983162..983173,983285..984764,
                     984817..984875))
                     /codon_start=1
                     /locus_tag="AO090005000384"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000103"
                     /protein_id="BAE55454.1"
                     /transl_table=1
                     /translation="MTKQRRSSSKRSRSGCITCKLRHIKCDESKPTCLQCQQSDHKCE
                     GYDNASQSQLRRRIEAVQNVSRRPPLSGDHRIILRPETREERRWADFFQAKTAVAFSG
                     FFDSMLWSYLIPQISEGEPTIRHAVVAIGAIHARYQMAADQPLADPSSTTQFVLQQYN
                     KAIRHLIDRMSTIDSQNWEITLTTCCLFACLEILRGNKTEALDHIDAGLKMLYQHEQE
                     GGATGRTTELYKELRRLYSKFNLEASFMGRTLYPLETTSQDVATSELALTNLSHARSY
                     LDNLMNKGLAFIRAVDLDRKPRDSLLQQRLELEQLKLCYEFDNWLVGLNKLIQRMGPW
                     IQQVDQRASLILKIYHHTSLIWVKTVLAGDENVFDLYISDFDAVVSYAGKVIQLTVEI
                     DKRTNNQSMFCLEGEVIGPLYYAAIKCRNPAIRRKAIDLLLRYGKIEGMWNARRYAAV
                     ANLVMEVEESACSGVIESERDVDLHARVYESLQPEVMERNPCQVLLLFKPDGVDSDFQ
                     QRMEFAFL"
     exon            complement(983162..983173)
                     /number=1
     exon            complement(983285..984764)
                     /number=2
     exon            complement(984817..984875)
                     /number=3
     CDS             join(987548..988025,988076..989460)
                     /codon_start=1
                     /locus_tag="AO090005000385"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000104"
                     /protein_id="BAE55455.1"
                     /transl_table=1
                     /translation="MKFVKGEKVIWLMGTAWLIRSDLLVTAGHNVYDWEYNLGRAREI
                     KASLGYWGEDSVDNTVQFRYGTMVATSSGWLATKDNRINDVAFIKLDRAFDGTDTEMN
                     LFHFKATPVSGERRMGIVGYPGDLDRGNRPYEEFKNVKYDLSQASRNMLVYEISTTKG
                     QSGSPVLLDDYNTSIGTHVNGDFFENSASPIAGEYGNLYHAYIRAIDGHYTPVKRKDE
                     VEYVRVTIPNDPERPYEAAEESLITVGGNVNSNILKLGSPFLGPIGGPIAALAATCVL
                     FAGGVCESALDPEGSVSGSDITAYAHHAILAEAAIQATNRLSREALNKLNFEENVREE
                     YSTLASQVYGIGSKLFPVLMESALRLALEAYHISESGQQSTPSAEAESLPKLGTLQYT
                     KEGSNQDSQTEAFIDSLLQNFWPTQGEERFFDQLGSVIVNGLRTSKTIQTMAPTGLCL
                     LSSLLAPTQSRSQSTELDIYFEDLLDRALMAEATLRAIIFAKKTVRSQTVSISEDEKK
                     AVLQREGFYDLLKAGVQGIGRKVIESTPSVISKLQPLLMELLSPNKATKQLDIPIPGN
                     PTQDLETNLAFARKSVRLPEGPVVQRSTRLGAVASRYGNNHNLDGPSVAFSSLS"
     exon            987548..988025
                     /number=1
     exon            988076..989460
                     /number=2
     CDS             complement(join(990687..990904,990954..991201,
                     991261..991649))
                     /codon_start=1
                     /locus_tag="AO090005000386"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000105"
                     /protein_id="BAE55456.1"
                     /transl_table=1
                     /translation="MASTIDLGKLTGASLDLEEIGLPSYESINAASADAPLPDKDVAT
                     KAVQDAKEVPSIWFVNFPTKQAAAEKKVLADFMQSVQDYRCWASLIWWRTVYSNPNIP
                     QDGKKESVAKRSAYAAKVGVKHMKTTPWLGMNVDHDVSKDIECSTSEFHTQLLEAVLQ
                     GFVGVVPAVLQALEGILKSLAKTVEQSTTNTDSKTVVCERYEYIPEADVIRSYVRLIS
                     FTVTDSMRNVEKAKKTERRVKCTIAYNEYEAVFNRKLWDANSEQIEAEQKKAADEFRK
                     QQTVDCPP"
     exon            complement(990687..990904)
                     /number=1
     exon            complement(990954..991201)
                     /number=2
     exon            complement(991261..991649)
                     /number=3
     CDS             join(992683..992993,993049..993311,993413..993531)
                     /codon_start=1
                     /locus_tag="AO090005000387"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000106"
                     /protein_id="BAE55457.1"
                     /transl_table=1
                     /translation="MSTSYDISVQEPVHGQNDIKNAEEAIKRFREDDDPQTVFFLNFA
                     PEFDGMEDLHVTKYSWATKIEQTVQAQYGKEKERHAIQLSWDRASYRAKLVDYLLRTT
                     PWCIFGVDRVKDAEKHDLTGDYHHDKEVYKGATSDWLQASLPEVPVDRLQVIVKYIAE
                     TLALGQGRLQGVQRFAVALSVESENEALNQPGKPRRTKSKSPAPCTRQKSTTNSCISR
                     NSTRRCWTWASH"
     exon            992683..992993
                     /number=1
     exon            993049..993311
                     /number=2
     exon            993413..993531
                     /number=3
     CDS             join(994644..994858,995130..995262)
                     /codon_start=1
                     /locus_tag="AO090005000388"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000107"
                     /protein_id="BAE55458.1"
                     /transl_table=1
                     /translation="MASKVPQDTPDSGIIIRAPIFPEDELLEREPKYAFPPIPISDPF
                     FGGVPRTLMPGDIAAQAANVSKDFPSVWLIKSKDNDTNRRIECKTSEFHARLIQEVVS
                     QFVQLDPTAIAAL"
     exon            994644..994858
                     /number=1
     exon            995130..995262
                     /number=2
     CDS             join(997659..997827,998385..998608)
                     /codon_start=1
                     /locus_tag="AO090005000389"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000108"
                     /protein_id="BAE55459.1"
                     /transl_table=1
                     /translation="MLLTASKVLGITEVLDILNCILSTDKKKKGTQSTSPKSNNLVKV
                     SCRHTLHISIPLVSESLADPQCLFEVGFAFFVPAILRARDPSFFVGEVQSLTHSSQLV
                     ADTGNQVKGKFFKDTAAIEVVRVHRNRP"
     exon            997659..997827
                     /number=1
     exon            998385..998608
                     /number=2
     CDS             1002857..1004062
                     /codon_start=1
                     /locus_tag="AO090005000391"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000110"
                     /protein_id="BAE55460.1"
                     /transl_table=1
                     /translation="MATRMAQGIYLQTKTNTKDASCINFTKHETIIRTVWACFVLDCI
                     LRCGRCGSQRAEIEVPDIPLPMGEDDFEFGSQSTLTPHFLVHSGTNTSIKVMGSDGKI
                     NGPQQILSLIVKGFSIFSTLSTWICRGGRRYPSPDSIEPPWKHTSFWSRSMTTVEAWR
                     GTHSSRLVYSRSGGQMQAHILHNQVEGFALLNLLYYMSVFFLHREYTPFFPHRVSRPC
                     GPIDPPLLEEVPPHDWWHHSAQKLFEATSIIIQLMQDLETRDVQFQTPFTAFCMFSAA
                     SAVLYADTWPYMAPGLENAKEKYTWSLDWLRTASEKWKIAKCWCEILGELSGIFTRLK
                     TDGHDFPHLGREEFQDLHDNLHRLAEPESTTVNALAVLSQGAPLDFIGAACQSRLEDT
                     DAGNSGLQS"
     exon            1002857..1004062
                     /number=1
     CDS             join(1004776..1005005,1005058..1006219)
                     /codon_start=1
                     /locus_tag="AO090005000392"
                     /note="acetylornithine aminotransferase"
                     /old_locus_tag="AO070339000111"
                     /protein_id="BAE55461.1"
                     /transl_table=1
                     /translation="MTASSEASKCALEEAQRLLISAEKAFIEHNPKSKAQHKVASEVL
                     PGGNTRSILHTDPFPICMERGEGIKLVDVDGHEYLDLVGEMTAGLFGHTNPIIRDTII
                     STVSKTGLNLGATTRTESLFAKAICQRITSIEQLRFCNSGTEANLHALSIARGATGRS
                     KVIVFEGGYHGGVLTFAHGVAENNVDKEDWIIGKYNDVEGTRKLISENKGIAAAVLVE
                     GMQGAGGCIPGTAEFLHTIQNETRANGMIFILDEVMTSRLAPGGLQSVIRNPYDGAPL
                     KPDMTTLGKWIAGGMTIGAFGGRKDLLAAYDPRPSSGSSERKTQISHSGTFNNNTLAM
                     NVGLAALERVFTPEACMELNNIGGWFHRGLEERCRGTKMTVTGIGAVCNIHFTSNVGN
                     AGITSVDDLATESNGVEPILKDLFWYYAIRHGYWIARRGMLSLILGTSKGDLQGFLDV
                     VEGFVREHREFLE"
     exon            1004776..1005005
                     /number=1
     exon            1005058..1006219
                     /number=2
     CDS             complement(1009757..1010527)
                     /codon_start=1
                     /locus_tag="AO090005000394"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000113"
                     /protein_id="BAE55462.1"
                     /transl_table=1
                     /translation="MATKDPSNKEVLLQETAQHLGTQALDTVDISRVSAPVPQGTGKL
                     PSSPVCITQEPVPQNFKHDPAAIMVGLGTEVPRWRPGSVIKWTAWRMGYDSQDDANYA
                     AAQLQQAAEEWNKLNIGVTFEFVPLAKDANFVLSHGGNKGTVLASAYFPNNKDLNFVY
                     VYSFAFQPDWKPFLWRVFTHELGHVIGLRHEFAMNPGPYFEGDAVQINERNPLSVMNY
                     RREPPEIQQSDVEATKKFYSFPAGTEISSTAIVDYVPR"
     exon            complement(1009757..1010527)
                     /number=1
     CDS             complement(join(1012052..1012505,1012571..1013046))
                     /codon_start=1
                     /locus_tag="AO090005000395"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000114"
                     /protein_id="BAE55463.1"
                     /transl_table=1
                     /translation="MFPAGECRAVRLLLLPRIYHHIQCKLASLLIQPAATFNANRYCS
                     YVFGGMANTTALSDGNVYVLSVPSFRWIRVTDDNSIRIKHKCVRPQNNTMIVVGGNTP
                     VTNREYDPLPQNCDSATFANGIGIFDLHSLSWISNYNASYSDAYRIPSKVSDVIGGSE
                     TGGATVVSPKDGFNSTSMESLFKKRNNATDSGTSSTSTSSTTGQSSSGSKKSLSGGGI
                     AGVTVGCVAGVGLIADLAWFLARRHRKAKAASSTRLAWQSDASAIPPLESPQKELYGS
                     GPEVYEMGVRDQARFEMPAENMAVEMPAEGIKR"
     exon            complement(1012052..1012505)
                     /number=1
     exon            complement(1012571..1013046)
                     /number=2
     CDS             complement(join(1013154..1013758,1013808..1013891,
                     1013942..1014035))
                     /codon_start=1
                     /locus_tag="AO090005000396"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000115"
                     /protein_id="BAE55464.1"
                     /transl_table=1
                     /translation="MAGVVLFTLYLYTLTQYALAAETNCSRIFHSAVISNGKLYIDGG
                     EMHTRWPNETITTKPIDDLETIDLTKSWVNSDTDLYTYIPKPLANNTAIYLDEGAAWS
                     DGDNLFFYGGYVSGVNGPSVPPLGTWKYNIASNEWTHNGFSGAALVRLCQGGAVQSSS
                     KAYYLGGSLNPGGNPSFAGTAGADVYMDPGLITLDMDKQEWTNASTADMNEWGTIGDG
                     YTSLLESAGEEGAIVAFGGYKYSVGQTLSYLAYRQNETIHRV"
     exon            complement(1013154..1013758)
                     /number=1
     exon            complement(1013808..1013891)
                     /number=2
     exon            complement(1013942..1014035)
                     /number=3
     CDS             1016475..1018316
                     /codon_start=1
                     /locus_tag="AO090005000397"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000116"
                     /protein_id="BAE55465.1"
                     /transl_table=1
                     /translation="MIPLPQLLKRRYIFLVVSGIVLLAIVNGFYLNLLPVPSVIRGSA
                     ETEGAQRPDFDEAAPHPIDGLIRDAQAKWDQLLSKRVDSLADATKQYRDRRGRHPPPG
                     FDQWFTFAKQKKAVLIEDLFDQIYDDLSPYWGLDPQVIRRHATHSDPRIIIRNHTLSS
                     VGHTGVNWLEVWMDMISTIQEFLPDMDIPLNGMDEPRIIVPWETVSEYRAKDRDLQQQ
                     LDPRMAVDQYMTLSSEEQSAEYSPPAFQGADKPFWDIMRGACPPESPGRTSNIQKVDF
                     ANPPAEFFNYRNSFSENGYVRDFERSKDPCWRAELQALHGSFIEPTTTSTTHELIPLF
                     GGSKLTVNNEILIPPAVYWEDNPTYSGGKSNHGGPWSKKKDIVFWRGIASGGRNRVDT
                     WTGYQRHRLVSMLNGTEVALTNGSSHGINFRLPDYQYYQVTAGLDGALPEFLNKHCDL
                     GFLDLCCFPLEGSPHCSYTDPYFKLVKGMPMKEQYAFKYLPDVDGNSFSGRYRAFLLS
                     TSLPIKATVYKEWHDSRLIPWAHFVPMDSLYMDVYGILQYFMGYKGRDRHDKQAEKTA
                     MDGKSWAEKVLRQEDMQIYVYRLLLEYARLCDDQRDSLAFVGDLMNI"
     exon            1016475..1018316
                     /number=1
     CDS             complement(1018916..1019461)
                     /codon_start=1
                     /locus_tag="AO090005000398"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000117"
                     /protein_id="BAE55466.1"
                     /transl_table=1
                     /translation="MSFRTTPVFLTTTKGWEQARIHPALAWMEKCTIAWDTRESWSTP
                     WSDWVTDDYTYIKPNGERFTGGETAWEASKADYSAFKLSHHEPKWVCVAEKVDGWEFV
                     GEATLFIDLPKEGIKKAVDLEGRRWDLGVECMFRFNFVKDWTAKHDGIRIRSMQIYSD
                     SGPVVGEMLRRGIMKTEDLVR"
     exon            complement(1018916..1019461)
                     /number=1
     CDS             complement(join(1021022..1021111,1021153..1021425))
                     /codon_start=1
                     /locus_tag="AO090005000399"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000118"
                     /protein_id="BAE55467.1"
                     /transl_table=1
                     /translation="MPYLQYSTGIYDPVLVEGWVVVDVDVAPGSETLLEVDEELEAEE
                     DCTELEAIDVGKGLEAELRTGFKSTRFAVLLYKEFLPHPGLDSEPGSISWSEENRLPS
                     NRSIAQSVQCAKGVSDSD"
     exon            complement(1021022..1021111)
                     /number=1
     exon            complement(1021153..1021425)
                     /number=2
     CDS             complement(1021968..1023119)
                     /codon_start=1
                     /locus_tag="AO090005000400"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000119"
                     /protein_id="BAE55468.1"
                     /transl_table=1
                     /translation="MGIENETTNARCTALEGEMRRRLWWSLILFDNRISEISGHKTTM
                     LTPTWDCRVPLNANDFDIRPEMKILPQSHDEPTEALFTVVRSKMGDFMRQSAFHLDFT
                     NPSLKVIIKDTPHGADPEGDRMTAFERMIENRYLRLCNPENPLHFMTIWTTRGQLAKN
                     RLLEHYSKYASVQQTDEQRDIAISHALIIIECDTKLMTSPLTIGYRWLTDFHFPFPAY
                     IYILKDLRKRPTVEHADRIWRTMSDNCEARFKDMQKVNPFFEFFAKIVLEAWEAREAV
                     FRPINKPLQPPLIVLNVKRVAQTTGGIQRSDLKQPIVGSNVNTDHLPMTMPMDFGAHD
                     LLYSTEGHDFPGPDLGGYLDIPGQATMDVEVNQSDWTTIDWYPMHSQNW"
     exon            complement(1021968..1023119)
                     /number=1
     CDS             join(1027865..1028514,1028593..1028599)
                     /codon_start=1
                     /locus_tag="AO090005000401"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000120"
                     /protein_id="BAE55469.1"
                     /transl_table=1
                     /translation="MHSLFSKEKCFLTSTDWQSVMKQQFDSTFPAVIFAQVEELFAYY
                     TTIPCFIHQFFDLRQADPTHEKTQLKASKLLNDALDMQNKLSTWYDKFSQTAPLPTEV
                     LSSMGDTLYPIVYSFTDVDTATIFAAYYSYMVIIHAILGACHYPGEHAAMVVYYRDQI
                     CMSVEFNAQGMLGPSRLGFPLLVVNEFADPPMKLWVQGWLQRLSKTYKVMLPQNYERK
                     "
     exon            1027865..1028514
                     /number=1
     exon            1028593..1028599
                     /number=2
     CDS             complement(join(1028673..1028688,1028784..1029113,
                     1029177..1029243,1029362..1029559,1029716..1029911))
                     /codon_start=1
                     /locus_tag="AO090005000402"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000121"
                     /protein_id="BAE55470.1"
                     /transl_table=1
                     /translation="MDPDTMNMKALVWSANVDWFLSAVDANPEWVSCREVSTAPHIYI
                     LFLGSAEAEKGGRCGYKRVSGDMSTLVFSPEKRHIAIAEVVIFSLIQIIQCTTRFVQE
                     WKYWHHDKQKSVPRCIFYSWYGLIGLVAQQAILQGIGLSPLLFEVSLVMLRSGQTGRT
                     GPGNSRYPKTIRFLLHFFRFPVFFGIVLIVVGESAAVYACKVVGSVLLVLIFAFGCGL
                     FSWLAVAYRSVLPRAGHRCVLLVLAALPFFVVRIAYMLLAQYGPRSGRAD"
     exon            complement(1028673..1028688)
                     /number=1
     exon            complement(1028784..1029113)
                     /number=2
     exon            complement(1029177..1029243)
                     /number=3
     exon            complement(1029362..1029559)
                     /number=4
     exon            complement(1029716..1029911)
                     /number=5
     CDS             1031818..1032255
                     /codon_start=1
                     /locus_tag="AO090005000403"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000122"
                     /protein_id="BAE55471.1"
                     /transl_table=1
                     /translation="MQSMSRDSWVKYLWIDSLCIVQDDSEDWREQCPRMAEIYHNAYI
                     TLASSAAPYPRAGLYFTSDDEWDLGREVLSTSGRHAFRTFARTPMTDMKSTGDCEPLF
                     KRAWAYQERMLSPRILYFTRREYCGNLTNRLHVNAFNCEEKGA"
     exon            1031818..1032255
                     /number=1
     CDS             join(1033924..1034863,1034894..1034907)
                     /codon_start=1
                     /locus_tag="AO090005000404"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000123"
                     /protein_id="BAE55472.1"
                     /transl_table=1
                     /translation="MATPAGVPLELLYHITDYLHPKDLISLLFAFPEFANRLTYRRLS
                     ATDRHQRTVLHLLADPEVGPDEPELRDMIITHLIQFRAIPVNIRDIYGYTPLWIAADR
                     GNEEMVKLLLETKDLEPDIPSLSGVLPLGQAASRENEAIVKQLLAHGGVNPIREHSPN
                     GKQVVLAPLATAAMAGRAAMVKLMLGHVPREQLEPTAAMAFKYAANFKHKDVMEVIIN
                     SVGNVNFQIEKGQSVLLYTYSRFYRGIAKQLLTKDGVDAGCKDNIGRTLLRIAVDRED
                     TEMVKLLLARRDVEVVFKGSNGWTNLALCASNVYHPNSGES"
     exon            1033924..1034863
                     /number=1
     exon            1034894..1034907
                     /number=2
     CDS             join(1035951..1036146,1036263..1036630)
                     /codon_start=1
                     /locus_tag="AO090005000405"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070339000124"
                     /protein_id="BAE55473.1"
                     /transl_table=1
                     /translation="MFRPASRALLRAPAVARGPASRRLISTAPAESKPRSWKNTAVRL
                     GLAAGAIYYYNTSNVFAENPSFSLNNQLKKNSAEEPLPTLDSIKPRIREERESAAPKP
                     NAEQAPAQELPFGEGAVKSPQELEEEAGQEAAFNPETGEINWDCPCLGGMAHGPCGEE
                     FKAAFSCFVYSEEEPKGMDCIEKFKCV"
     exon            1035951..1036146
                     /number=1
     exon            1036263..1036630
                     /number=2
     CDS             complement(join(1036749..1036947,1038052..1038151,
                     1038203..1038344,1038398..1038724,1038785..1039063,
                     1039120..1039277,1039328..1039619,1039691..1041841))
                     /codon_start=1
                     /locus_tag="AO090005000406"
                     /note="nonsense-mediated mRNA decay 2 protein"
                     /old_locus_tag="AO070339000125"
                     /protein_id="BAE55474.1"
                     /transl_table=1
                     /translation="MSRTTGPNLTAQPHETDIFPVSRSLDSALKKNTAFIKRLRTGIS
                     ASAQQTFLADIRTLSLHKYLSEIISACYEGLCKLKSPGEIATGVEIASALHQRFGPAE
                     FTRQIGWLLGRGLSTPDKGQLKALSQEVREREEKERLSRHRVLLRVATELWLVGVLRT
                     LDDIERPEDLGAKGKDGVVGIGGKASENPVKAKVPSAVRDSDKEAEPFPLEVLKDLLG
                     HDRDHTNLPLAVLFVKSFSWDILGAKTVEEGRKTVEADGATTPAEATNGEEGAGDVTT
                     AENDPPLIPEKTQARFKSILNRYLEDVKAHVVRDQRALAAQSRRNAEAYVKSGEIFED
                     RQANFEKQSKSLEKLVANTQVLCEALGVEMPALAEQESADPASSGGIGLVKTSEYLRG
                     HGDGAGIWEDEEERRFYENLVDLKGKVPAVLLEDGKKKKTDSDEAGKKKDGEDLEKSE
                     SAQGQPSEEKAAADADDQSMAIASKTVGAQVDALLAKLPDLQTKDHVDQLALDFCFLN
                     SKASRNRLIKAVSDVPKGRIDLLPLYSRLVATLGQYLPDIPQGLITYLDEEFRSLQRR
                     KSKEFLGQVRMSNVRYLAELTKFGVVPEHIIFHCFKVSLDDFSRMNIEIIGYLLENCG
                     RYLLRNPETSPRMASFLETLGRKKTVQHLGQQERMIIENAVYYVDPPPRPAIQQKERT
                     PMESYIRRLIYLDMNKRNYTRILKSIRKLHWEEQEVVDIIERVFSKPVKVKYGNIHLL
                     AILVSALYRYHQEFVIGIVDNVLEQITLGLEQNDFKFNQKRVAEVKYLGELYNYKMID
                     SPVIFDTLYRIVTFGHEGGTPIPGKLNPLDLPDDFFRVRLVCTLLDTCGHCFDRGSAK
                     KKLDFFLTFFQYYMTTKDPLPMDIDFLVQDTFSMTRPQWKLVTDLEEATRIFGEAVAQ
                     NYKTQDAERPAEPDDEEAESSSSDEGFEDDVMPEVDEDGESSDEAEASGPNAEQNGDS
                     DSEDEQIFVTRQEEERDPEAEAEFDREFEKMMAESMDSRKFERKGVFDIPLPMKRAPR
                     DAAGESAPETSQPQPQPQPQPQPSTMAFSLMTKKGNKQQTRTIDLPSDSSFAVAMRSQ
                     QQADREEQQRIKNLVLNYEMSNEAETAEALEKRSPRDSRVDKSGGNRTAFRSRKLQLS
                     DVNCSSLSGSSPFCESSDFTWAVVSFARARFSSGCEAASISVARGAAFWASPSGAGAG
                     APSSSSSSSAP"
     exon            complement(1036749..1036947)
                     /number=1
     exon            complement(1038052..1038151)
                     /number=2
     exon            complement(1038203..1038344)
                     /number=3
     exon            complement(1038398..1038724)
                     /number=4
     exon            complement(1038785..1039063)
                     /number=5
     exon            complement(1039120..1039277)
                     /number=6
     exon            complement(1039328..1039619)
                     /number=7
     exon            complement(1039691..1041841)
                     /number=8
     CDS             join(1044984..1045175,1045308..1045533,1045648..1045703)
                     /codon_start=1
                     /locus_tag="AO090005000407"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000126"
                     /protein_id="BAE55475.1"
                     /transl_table=1
                     /translation="MNKTHINTSTSSPDDQTAGWSKLWDTDSSNLWDRGMPSPALIDF
                     IEERVNPLTEDGRRKKALVPGCGKGYDVVMLALHGFEVYGLEVSETGASVAREYARSE
                     LHNPQDYNFGSHFKENPEVGKGEVTILQGDFFKRDWEVPLCASSEYASSVGWENG"
     exon            1044984..1045175
                     /number=1
     exon            1045308..1045533
                     /number=2
     exon            1045648..1045703
                     /number=3
     CDS             complement(join(1047482..1049148,1049346..1049488,
                     1049568..1049743))
                     /codon_start=1
                     /locus_tag="AO090005000408"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000127"
                     /protein_id="BAE55476.1"
                     /transl_table=1
                     /translation="MAFAIFGKVTASLCGCASRGLARVTGLDPKNAEHMTPDAGTRLS
                     ASGIYLEAREDSSIRAEQTLKWPGSEAARQSVVELPDPRRRLSNASRAESVHFRAGRE
                     TLRSEIVPTRPRRDLELNSIRLRLIRAYRKLANCLEDASHIMESSPPRSSSTASVAGV
                     KRPAALLPAFEPLSSSPSLPRPQKRVARDDHGIVSTYPTPVPTSSTHIMSSSPPRMAS
                     RRTLTSSNSERTPLSTVPTMMLPETGEPLLMGRSSASCHHQLAANRMISRVHVKATYK
                     PAPNPFDRDRVEIMCMGWNGIKLHCQGKTYDLAKGKTFTSDIKDADIMIDVHDARVLV
                     QWPRNERKDYASTDSEQTWEEATPRRNRQSRRSLHDSPNVERRRLASPVSPSPAVKSL
                     IPPSSPLYTPTRARNAVVVFEDEPSPVRRKSSGDALLSEASLQSTSSIGDLLQSSQSS
                     DLSDLSKPDDLSDHDEENDPIVHSFGPFGDNLLPRMASFTADGSPLRPSRPRNQHPAE
                     PLRPAHSPRQPSKPAERVDLALSKPLDESFERVQNHAINQLAFSRLSSTPFSTILNNL
                     PPSLWRRDTHSREGPTRDEIRVIIDTTKCIGKVAREGKDAAGKPLESEYYYIPDYDDD
                     TMRREAVVHDLRKPGLRNCRKQHKVCLLDNKDLWTRN"
     exon            complement(1047482..1049148)
                     /number=1
     exon            complement(1049346..1049488)
                     /number=2
     exon            complement(1049568..1049743)
                     /number=3
     CDS             complement(join(1051035..1051076,1051140..1051516,
                     1051575..1052403))
                     /codon_start=1
                     /locus_tag="AO090005000409"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000128"
                     /protein_id="BAE55477.1"
                     /transl_table=1
                     /translation="MKFNAVALTLATAGSLVAGQHHNAHRHHHKRTVDTQVVEANGAT
                     VVTYEFQGQAVSSEFVCNGIREGKLRYKEGQPAVDACQSSAPVSSSSSTAAAAPTEAP
                     AEFVETSSATPASSSSASATSSSAASSSTPTKSTSSGAKGLDSDFPDGEIDCGTFPSD
                     YGAVALDYLELGGWSGIQYVTIAGEFVSKIVTAVTGDSCTSGAMCSYACPAGYQKSQW
                     PSTQGATGQSIGGLECKNGKLYLTNPTLSKKLCIEGVGGVHAQNNLGEEIAICRTDYP
                     GTESETIPLALGDNELQPLTCPDGETYFKWEGKVTSAQYYVNPKGTSTKQGCQWGDGS
                     KPIGNWAPINLGVGQNNGKWLSIFQNSPTTSVKLNFNIKIQGDNLSGSCKYENGKFIS
                     ETGSNDSGCTVEVLSGEATFVFY"
     exon            complement(1051035..1051076)
                     /number=1
     exon            complement(1051140..1051516)
                     /number=2
     exon            complement(1051575..1052403)
                     /number=3
     CDS             join(1057599..1057667,1057737..1058858)
                     /codon_start=1
                     /locus_tag="AO090005000411"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070339000130"
                     /protein_id="BAE55478.1"
                     /transl_table=1
                     /translation="MVSSTAVTTKVASGSPYQLEKSQVSKASSALLRHIKSKQVEKEK
                     SATKKTLIGDNDESDDETPLNNEAVWLVVTTKKHVVDKNRLKPGKITVPHSLNDSSNL
                     SVCLITADPQRSVKNIVTDPSFPEHLTSRIDRVIGYSKLKARYQSFESRRQLLSEHDV
                     FLADDRIILRLVNTLGKIFYKSSKRPIPISIAKVEKKDGKRVKKDPKQKSKEEDSAFA
                     SPAIVAKEIEKALHSAPVQLAPATTASIRIGSSKFTPEQLSENVDAVVQGLTDKYITK
                     GWRNIKALHIKGATTMAMPIWLANELWVEEGDVAEDAAEDDAKALEGAKNKKRKQSAE
                     DEKLLEGTKKSKKPKAADEDEDAAARKEKLQKQKAKALEDGNVAKTAESVTKAGKKKR
                     KSTS"
     exon            1057599..1057667
                     /number=1
     exon            1057737..1058858
                     /number=2
     CDS             join(1059336..1059629,1059707..1059875,1059943..1060523)
                     /codon_start=1
                     /locus_tag="AO090005000412"
                     /note="electron transfer flavoprotein, alpha subunit"
                     /old_locus_tag="AO070339000131"
                     /protein_id="BAE55479.1"
                     /transl_table=1
                     /translation="MIPIARHSALRAVRSQLAPRAFNQSALARLLSTLAVLEQRDGKL
                     QASSLSAIAAAQKLGGPVTAFVAGNGVKGTSAAEAAKIKGLDKVVAVDSEAYEKGLPE
                     NYAPLLVENIKKGEYTHIIGGHSAFGKSLLPRVAALLDVQQVSDITGIESEDTFVRPI
                     YAGNAILTVQSSDPIKVLTVRGTAFQGVETEGGSAEVVEGVDPKSPAQTEWVSEELAK
                     SERPDLGTASRVVSGGRGLKSKEEFDRVIVPLADTLGAAIGASRAAVDSGFADNSLQV
                     GQTGKNVAPQLYLCAGISGAIQHLAGMKDSKVIAAINKDPDAPIFQVADVGLVGDLFE
                     KVPELTEKLKSQA"
     exon            1059336..1059629
                     /number=1
     exon            1059707..1059875
                     /number=2
     exon            1059943..1060523
                     /number=3
     CDS             join(1061778..1064035,1064096..1064528)
                     /codon_start=1
                     /locus_tag="AO090005000413"
                     /note="DNA replication checkpoint protein CHL12/CTF18"
                     /old_locus_tag="AO070339000132"
                     /protein_id="BAE55480.1"
                     /transl_table=1
                     /translation="MDAFGDAHLRSQFEIEDQLIEQPPVAPTEPVNLSQVAQTSTSTF
                     TSIQPQTTAPVTSLPTSFSLPRREPLSIQIKTCSGKTHNVALRKTAAPVSYERLVAGR
                     STTAPGRAKKSYYGIDIHRLMDEAAQEAEQSKTSRPPPVPAVRQSIEAAEGNQRDRKA
                     ATIMWTEKYRARKFTELIGDERTHRSVMRWLKGWESIVYPNLARSKPKKSGNEEERPH
                     RKVMLLCGPPGLGKTTLAHVCAKQAGYEVLEINASDDRSKDVVKGRIRDALGTENVKG
                     MNVEVGEKKVRKAARPVCVVVDEVDGVVGGSGSGGEGGFMKALIDLVLLDQKNAARSS
                     EQNTAGRKRKGDNFRFLRPLILVCNDVYHPSLRPLRASSVAEMIHVRQAPLENVVSRM
                     RGIFNLEGIPADNDGVRRLCEASWGVARRKQANFKNSGTAEGDIRSVLVAAEWVAHKL
                     KYESVESMRLTRRWLEQNVLSEAAGGNSFFKGLNRGGVRDIVERVFTEGAGFADVPIN
                     AESFRDPFDDNAKTPVGVADLKKRYAINRLREMVDASGDYDRCVTECFTSYPLQTYQD
                     DTFLSKPNNAYDWLHFHDTISSKVFSNQDWELTPYLSQSVVAFHHLFASAYGKRTRNE
                     PDDEGEEEHPFSGPRAEFAANEALKQNRAIVNGFQSSLTAPMLRLFRATDCLVTDLVP
                     NLMRMLSPDVKPVVVRGSGEQRSTASVRKESERALVQAAVRVMTGLGVTFEKVRVEGE
                     GGAHGGWAYRMEPPLDSLVTFSKTKGHSSTGTTGAAPVRYAVRQVLDQEYRKETVRKQ
                     TEALSSTTGPKKSAGKSADGQTQDEGQGAKRSGREAGIKRDFFGRIIREPSPQPGGLH
                     EGPVQNEASKAGRKVWVTYHDGFSNAVRKPISMSELLAGL"
     exon            1061778..1064035
                     /number=1
     exon            1064096..1064528
                     /number=2
     CDS             complement(join(1065048..1065437,1065489..1065548))
                     /codon_start=1
                     /locus_tag="AO090005000414"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000133"
                     /protein_id="BAE55481.1"
                     /transl_table=1
                     /translation="MEEGSDCIGRVYIDRVRSCLNKIESLLTGTTAISTEYSIKILSK
                     LYKANQRTTTNIPLHQPTFPKTSSSRETMAFKSPKSTITVSDDAASTHSYLSTTTTLK
                     GTDAEPTKKKWLSLKKTEKTGTSTPKNTARAEKALHYEAMAFYLGHR"
     exon            complement(1065048..1065437)
                     /number=1
     exon            complement(1065489..1065548)
                     /number=2
     CDS             join(1067657..1067783,1069199..1069710,1069759..1071210)
                     /codon_start=1
                     /locus_tag="AO090005000416"
                     /note="chromatin remodeling factor subunit and related
                     transcription factors"
                     /old_locus_tag="AO070339000135"
                     /protein_id="BAE55482.1"
                     /transl_table=1
                     /translation="MSLKPIILHGHSAGPNPWKVAMLLNELNVPYEYKYLQFAEIKRT
                     DNPLDAPASPKAQNTEGEPEDEEMGGTETEPKKESEGADENADGVAQSGAEGATEDQS
                     GQGKSSIESSARSHLVSQTHAIILPSYSTWFDMHTVHPIEKKALAEFFNGRNRSKTPA
                     VYKDYRDFMINTYRLNPIEYLTVTACRRNLAGDVCAIMRVHSFLEQWGLINYQVDPQT
                     RPSNIGPPFTGHFRVIADTPRGLQPFQPGPNHFVKPGKPLPATERAASAAPASKADLN
                     LEIRRNVYDDKGKEITPAAEDKEKQTNGDGSTNGATGDAVKAMETASKEPRKKSHCFS
                     CGIDCTRLRFHYAKSTPATANASAPDSKYDLCPNCFLQGRMPSSHSASDFVKLEDNAY
                     SVVPDKDAPWSDSELVLLLEGLENFDENWEQIANHVGTRTKEECVMKFLQLEIEDKYV
                     EDLPDMRTAGGREPISQSENPVLSVVAFLAQMAEPAVAAAAAGRSVDEIRKELRKQLE
                     KGSDKSQEKGKEKEGSGVKTEDSMDVDASTAEVVETSSSDKQSKASLPTVALATSAAR
                     AGALASHEEREMTRLVSAAVNVTLQKFEIKLQQFNEMEEIIEAERRELELARQQLFLD
                     RMAFKKRVKEVQDTLQAVSLKGPGEDANNMLGEAATAGIGNRFNFQPAGSDARAGVQP
                     LSAEAGADYKTLDL"
     exon            1067657..1067783
                     /number=1
     exon            1069199..1069710
                     /number=2
     exon            1069759..1071210
                     /number=3
     CDS             complement(1071698..1073851)
                     /codon_start=1
                     /locus_tag="AO090005000417"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000136"
                     /protein_id="BAE55483.1"
                     /transl_table=1
                     /translation="MSSSSLYEPEEDDEASDSDIETGNTQFTEPPSSPPSHRTRLSSP
                     PKLDGRSSSRPAQTPRRVSRMQMLEHLQMLLSKESVEAYSDLLAQTTDDHMSVESKPG
                     SGEYLPTQAGIVSWAPKEKEIFFNVLDRKGKDGIREIAGAIGTKSELEVQEYLRLLHM
                     RLEWQHREETHSRAIVLGDVPAAEEVSSECCDFLDEYSKLLVLKEQQDEDVAGRQRHH
                     DLWIIDRDKAELVEELESQDQKSQPDSSIYHTASLLNIPRWIRLSERLFMNFGGARLE
                     DNWTNIAYAGEAPAITADALAEFYTLTVSVTRRLIQSTLFFAMSRLRNMRDTGNSKAK
                     VVKPRDVRTALDVLKMKRDGFDYWTGVARRCCLDVSDSRHRKGWKAVRLSHDEVEDML
                     SNRVPIDAESNRSTSRQMAQGNTDGENTDGDEDNASDSGSESDPKRSPSPSALLSPEI
                     SSDEDEIPSDAENQHAELEDQKASCLGELELWKALDRPAPAFLVSIKDENQEKKTRKP
                     MGARKTQEELTDWRERTLYRSDWEEYGHEVYDIYEEISENRRKRRRLDNSRDPSPVPA
                     DDENNQADGYKVEPTAGEYDEDINPGADDHKDIEMDDATAPDQNTTIPQDEEDPEMNN
                     TRITQTTNPKTNQKQTNESDSSSPTNTNLGYRSPILTRRKRIQPEPKQEEESSSSSSD
                     DDLPATREYPSSEQDDGDGMPLYSQPMSPANWPSD"
     exon            complement(1071698..1073851)
                     /number=1
     CDS             join(1074133..1074384,1074444..1076180)
                     /codon_start=1
                     /locus_tag="AO090005000418"
                     /note="DNA or RNA helicases of superfamily II"
                     /old_locus_tag="AO070339000137"
                     /protein_id="BAE55484.1"
                     /transl_table=1
                     /translation="MECVRGKLGRVPVSRLLLRPHRTSWRPGPSQHHFRLSSSVPAAR
                     ESPAIVLRDYQEECIKSVLDNLDQGHKRLGVSLATGAGKTVIFTQLIGRIPPRNEKDN
                     KTLILVHRRELVEQAARHCRLAYPDRTVEIEMGTSKASPAADIVIASIRSLTNGDRIA
                     KFDPKQFKLVLVDEAHHIVAPSYREVLKYFGLNETSHDSPVLVGVSATLSRADGLKLG
                     AAIDHIVYHKDYMDMIDEEWLANAVFTTVQSEANLSRVKKDSFGDFAVGSLSKAVNTD
                     RTNDITVHAWLANAQERKSTLVFCVDVEHTKQLTETFRAAGVDARYLTGKTPKEVRDD
                     QLQRFRDQEYPVLLNCGLFTEGTDIPNIDCVLLARPTRSRNLLIQMIGRGLRLHPGKK
                     DCHIIDMVATLETGVLSTPTLFGLHPDEVLANANGKDLKHKESDPSPSTDLDNSPGPD
                     TLDDINLTFTKYDTIYDLIMDMKSEKYIRSSSRNAWVRIDENKYILSDSTGWITIDKS
                     TDEHLKSPKDDPQRPLWTVQYVQVYKNPTTEKNTYTRPRLIATGPDLESAVHAADTFA
                     ASEFEDLYISALQPWRRRPATWAQLNFLNKAKIRRDALRPEHLTKGQAADLITKLKHG
                     GKKRFEKQAGRRRKEDEKAKELEAFRARERVRVGPVLM"
     exon            1074133..1074384
                     /number=1
     exon            1074444..1076180
                     /number=2
     CDS             complement(join(1076884..1077115,1077164..1077390,
                     1077447..1077612,1077660..1078896,1079079..1079928,
                     1079998..1080363))
                     /codon_start=1
                     /locus_tag="AO090005000419"
                     /note="negative regulator of COPII vesicle formation"
                     /old_locus_tag="AO070339000138"
                     /protein_id="BAE55485.1"
                     /transl_table=1
                     /translation="MTSNPPDCKSSSVMMPLASQRLPIEASPDHQRRYRPSRLRSPWP
                     CSILTAFTTLVASIFLFFILRSFALRQTGGDGCGVPVMSPTFIRMVGFDTEHTRFASK
                     YNLYLYREGGVDPYSQENLGLNGVPVLFLPGNAGSYRQVRSLAAEASRHYYDVVRHDE
                     DRLNAGTRSLDFFMIDFNEDMAAFHGQTLLDQAEYVNEAVAYILSLYHDPRRSRRDPE
                     LPDPSAVVLVGHSMGGIVARTALTMTNYQANSVNTIVTMSAPHAKPPVSFDSDIVQTY
                     KQINDYWREAYSQTWANDNPLWHVTLISIAGGSRDTVVPSDYASISSLVPETHGFTVF
                     TSTIPDVWIGMDHLSITWCDQFRKAIIKSLFEVVDVRRATQTKPRAERMRIFKKWYLT
                     GMETVAERTLPRKGVSGKKFTLLTNQQFDKSGDHGSLEVLFCSVFPLQNGKPATAFSM
                     NMDFSGGTSGSTRLACKNAAEDGIHLPASTPSSKRPYDRVQPFSYLQYDLEDLAEHQF
                     VAVVDKANSPTKGFVLAEFSDSSDSVIRARLGLGSLLSAGLKVRLPANRPMLTELQIP
                     AVHSSLLDYRLKIIRKNHGQQQELFAPLLRQSVADPHESKFFVNVKNVNVNLHGLAPF
                     MPPPLREQATLGGVSFHLWTDPSCDSTIDISLSVDIAGSLGELVMRYRTVFAAFPLLV
                     VALVMRKQFQVYDETGYFITFAEGLDSALRSSLPMLLLAMSLLASSLATSTKLPPTDD
                     PFHWRTNSTESPIDFTKNDLLLGSQDAFFWFLVPIFGLISVGVCLVINYVALALIFLL
                     TSIYGFLRSKSGYIRRDEKGNLPIFSSASPRRRLVNSAILLALVSTVIPYQFAYMVAC
                     IVQLATSVRASWHAKEAKSTTHYNFANFAYSIFLLMLWILPINALVLLVWAHNLVVHW
                     FMPFSSHHNVLSIMPFVLLVEAMTTGTMIPRVTTRFKHVTSMLFFFIAIYSAIYGVSY
                     AYLLHHLTNILAAWLVGIYFSASGFSLSRLWRVLEGDEAVQNPASGSHTKKKP"
     exon            complement(1076884..1077115)
                     /number=1
     exon            complement(1077164..1077390)
                     /number=2
     exon            complement(1077447..1077612)
                     /number=3
     exon            complement(1077660..1078896)
                     /number=4
     exon            complement(1079079..1079928)
                     /number=5
     exon            complement(1079998..1080363)
                     /number=6
     CDS             complement(join(1082300..1082956,1083017..1083691,
                     1083741..1083935))
                     /codon_start=1
                     /locus_tag="AO090005000420"
                     /note="permeases of the major facilitator superfamily"
                     /old_locus_tag="AO070339000139"
                     /protein_id="BAE55486.1"
                     /transl_table=1
                     /translation="MGAEAHEKRPGGNHTPPPDNDEMEHMSIGRYLWTRLPTLVPPMN
                     PAPNPFKALALLNRQQWLFFTVAFLGWSWDAFDFFTVSLTTSQLAEAFDKSVSDITWG
                     ITLVLMLRSVGAITFGIASDRWGRKWPFVINNVLFIVLELGTGFCQTYKQFLACRALF
                     GIAMGGLYGNAAATALEDCPLEARGIVSGLLQQGYAFGYLLATAFARGLVDTTPHGWR
                     PLYWFGACPPVLIILFRLCLPETNTFLQRQATREEVRGGVASSFIAEGKTALKRHWLL
                     LIYLVLLMAGFNFMSHGSQDLYPTLLKSEFSFSANAVTVTQVVANLGALTGGTLCGWA
                     SQIFGRRFSIIVISIVGGALLYPYTFVTSTNVMAAAFFEQFCVQGAWGVIPIHLMELS
                     PGSIRTFTVGTAYQLGNLVSSASSTIESTIGERFPLPPTETEKHRYQYGKVICIFMGC
                     VFAYTIIVTFLGPERLGRQFDVAHDTDMAEVAAHRGTTTVGEGAESDVEKGTVSRIEG
                     "
     exon            complement(1082300..1082956)
                     /number=1
     exon            complement(1083017..1083691)
                     /number=2
     exon            complement(1083741..1083935)
                     /number=3
     CDS             complement(join(1085860..1086053,1086107..1086208,
                     1086271..1086569,1086625..1086746,1086798..1087521,
                     1087687..1087712))
                     /codon_start=1
                     /locus_tag="AO090005000422"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000141"
                     /protein_id="BAE55487.1"
                     /transl_table=1
                     /translation="MDIKEKPTLSLYLIFTHLLGLYSSLVLYRLLYHPLRHFPGPFLS
                     RVSVFWLSVQLRHKTLYRKLADLHNEYGDFVRVGPSDLSIIHPKAVNTIYGFKSACTK
                     SAWYDSSAPLRSLHSHRNRAAHDKHRRTWTPGFTDRALHGYEKRIQVYRQKLINQIKS
                     MEDSKPLNINTLFTWYGYDVMGDLAFGQSFDMLVKSESHWAILMIHSMLKPMEYLMPI
                     WFFRLLLSIPGTTKAFWKFNEYWGQLFKMRMATKQEIPDISACLLEPLKGRAPTPDEF
                     NVLLGDASLIINAGGDTTATTLTTIIYELARRPGEVQKLRTELVSCTTDPNGEYTQES
                     LAILKHLNGVINETLRIHSPVPSYIPRKTPPEGINIDGTHVPGNMNVSCPQWVIGRSE
                     SVYQNAQNFIPERWYLYPKMIKERSAFAPFTTGPYTCVGKPLALMNIRATIARLITTF
                     DMELPPGDDGRALERSMREHFSIYMAKDIQVHFQKRAI"
     exon            complement(1085860..1086053)
                     /number=1
     exon            complement(1086107..1086208)
                     /number=2
     exon            complement(1086271..1086569)
                     /number=3
     exon            complement(1086625..1086746)
                     /number=4
     exon            complement(1086798..1087521)
                     /number=5
     exon            complement(1087687..1087712)
                     /number=6
     CDS             join(1089441..1089538,1089602..1089866,1089983..1090240)
                     /codon_start=1
                     /locus_tag="AO090005000423"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000142"
                     /protein_id="BAE55488.1"
                     /transl_table=1
                     /translation="MSSGILKVKGNKIVDNDGNEVLLRGAAIGGWMNMENFITGYPGH
                     ESQHRTAMKKVLGPEKYEFFFDRWLEYFFTEADAKFFAGLGLNCIRIPFNYRHLEDDM
                     NPRVLKESGFKHLDRVVDLHLEAKMVTGIQITSPATLRSGTTRITRTEQYGYGNRLRL
                     DTGLTRGSPGIILLTNRATPSMLDSLHFTRGSRRLSVPLTQTIFYG"
     exon            1089441..1089538
                     /number=1
     exon            1089602..1089866
                     /number=2
     exon            1089983..1090240
                     /number=3
     CDS             complement(join(1090854..1091095,1091619..1092290,
                     1092350..1094045,1094131..1094256))
                     /codon_start=1
                     /locus_tag="AO090005000424"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000143"
                     /protein_id="BAE55489.1"
                     /transl_table=1
                     /translation="MSFTYSNGLPHGARGSFNGFEDMNGYGAMLTYQEEIKPQIYRAV
                     YSNVAVYEMEVNGVAVMKRRSDSWLNATQILKVAGVVKARRTKTLEKEIAAGEHEKVQ
                     GGYGKYQGTWVNYQRGVELCREYHVEEMLRPLLEYDMGPNGTTGSAQDSLDTPTKEQA
                     MAAQRKRLYSGMDNRNMSQPQQGTFFQNISRTAATAVNAMSKARFDSPAARGIDGRRS
                     SVIRKHSNQTGSQESQPPFASQQSMYSMASDNGFGNNLHHNGRHPHDTSAFDHDDFVE
                     PPRKRVRSSSNNAHSFGLHYEPSALSMTEATPTEPNDSFYQDMDMSTSMVDGNKRGVE
                     PLPPATTPERFQKMKLIMTLFLDKRTKDFSNHPALMQLTGYDLETPLDEYRNNALHWA
                     AMLARMPLVHALVEKGVSIFRLNGAGETALQKSVGTRNNYDYRSFPRLLQVLAPTIDM
                     VDYSGRTILHHIAVMAATGGGGHVSAKHYLEGLLEFIVRHGGSALSRQTPNGLENGAN
                     TEQPGEVITLGRFISEIVNLRDDQGDTALNLAGRARSVLVPQLLEVGADPHIPNHTGL
                     RPADYGVGVDMVDGNSQSQQSGTKNDSFMDQLAKTKKEILDATLAQISTIVQETLGSL
                     DKELATNLAKKHEKFEHWHSKIRESAKARQIEQKQLDELRRKASDRIGLSRRFKNLEM
                     SSEDLLVLLKSIHGDSYDASRMMSVGDADKDSGIDIDKFEVIFPENFDPTSGFSEQQT
                     AFLNSLPSAAALQQRIQGYEGFNEEIMNEIDRLKSKNVVLGQSYRRMVMACTNWTAEQ
                     VDEAAEGLTECVKELNDNPVPEDEAIEILMKDRGIPTPKHSISVKPGEHEHVLSGSHL
                     AHPAARTPQNGSSALKNLVLLRSCHGTTPQTHPQKMPPKTSGTHSVVNASLYSTA"
     exon            complement(1090854..1091095)
                     /number=1
     exon            complement(1091619..1092290)
                     /number=2
     exon            complement(1092350..1094045)
                     /number=3
     exon            complement(1094131..1094256)
                     /number=4
     CDS             1095006..1096268
                     /codon_start=1
                     /locus_tag="AO090005000425"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000144"
                     /protein_id="BAE55490.1"
                     /transl_table=1
                     /translation="MGRKEAVEAAKLALENPWKQHSWRHYFRALLRQCSYLPDPVAKC
                     NLHDHVVRRFRRYVIEERRPWIRWNAERQIFLFKEVKDTLSLLQRANAGYSKPLEKVI
                     RMAYGRKGRRRKELMSALIAPDVPANHTAVEEALQRPENYEDGWEPPAIVMELLKSQQ
                     NNGILSQLNIRQVKHLEPPIPKKAIWGDGIAKSRRRNIRKDWYTDMIDHLLPPLPDPD
                     LSILKGLVSGEMPWNPPEWRTPVNLSERQKKIRRLTRSYLRTLLKDGPVKGPTFKPYT
                     KGRPHVITRRFMQRIWRRTLCLIPHMEWDETAKKHIFTWDSAKPTLRLGIPGGPEIFE
                     DVDEQGKVTTTPTGLLPGGIRDKGRKPYRETPFELGLEPKHELNEQRSNRPHDLALFG
                     VKSNRSSSKSYEKGSRMLSDKSPRKRDR"
     exon            1095006..1096268
                     /number=1
     CDS             complement(1097176..1097955)
                     /codon_start=1
                     /locus_tag="AO090005000426"
                     /note="trans-aconitate methyltransferase"
                     /old_locus_tag="AO070339000145"
                     /protein_id="BAE55491.1"
                     /transl_table=1
                     /translation="MSKNDWSATQYLKFEDERTMPARDLLARVPLQAPRRVVDLGCGP
                     GNSTAVLATRYPDAHIVGMDSSPDMIQKAKATLPAYEFSVEDLRSYSPPPSVDLFFSN
                     AVFQWLKKEERIPVIKGLMETQPSGGVFAFQVPDNLMEPSHVLMREVASNGPWASTLS
                     NVGRDTFQSPQEIYDQLKDLSSEVNIFRTAYHHSLENHSAIVEWVKGTGLRPYVDPLS
                     PQDKEAFLSEYLKRLESAYPKLIDGRVLLPYPRLFVVAVRK"
     exon            complement(1097176..1097955)
                     /number=1
     CDS             join(1098891..1099043,1099193..1099605,1099672..1099783)
                     /codon_start=1
                     /locus_tag="AO090005000427"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000146"
                     /protein_id="BAE55492.1"
                     /transl_table=1
                     /translation="MSDQYGGHQYNQYGAPPHGNNQYGGYGGQPGNYPAQNQYGQPPQ
                     QGYYQSTPAYDQQPHTQHSSYGQQQNYPPPYSAGPQQGGYPGDYGHGQGSYMNPPQDG
                     GHSPYPQQQYQQGASASYYGASSQSGYASHPGQAPGLAGQEGERGLGSTILGATGGGF
                     VGHKLGGGVLGTAGGALVGAVGANLANKAHKKHKKEKKHKKDKKHHKRKSSSSSSSSS
                     SSSSSSD"
     exon            1098891..1099043
                     /number=1
     exon            1099193..1099605
                     /number=2
     exon            1099672..1099783
                     /number=3
     CDS             join(1103279..1103466,1103536..1106431,1106545..1106664)
                     /codon_start=1
                     /locus_tag="AO090005000428"
                     /note="ATPase component of ABC transporters with
                     duplicated ATPase domains/Translation elongation factor
                     EF-3b"
                     /old_locus_tag="AO070339000147"
                     /protein_id="BAE55493.1"
                     /transl_table=1
                     /translation="MPAAAASSVPAVSSKETAQSLSVLDDLLKNLNISSTQDEVNAAT
                     DNIAHLLSGPIPEQALPLKLAEDLKKQLSNKKDANARQRACDAIRAVASHATIAPGVE
                     PHLVTLLRPVLAAVGDKMTNVKDAAQSAAIAIVKGINGNAVKAVIPPILESLESAQKW
                     TEKLCALECLNSLIETAPAQVSYRVPALIPAVSEAMWDTKAEIKKAAYSTMEKVCGLI
                     VNKDIERFIPELIKCISKPENVPETVHLLGATTFVSDVTGPTLAIMVPLLDRGLVERE
                     TAIKRKSAVIVDNMCKLVEDPQIVAPFLPKLMPRLTHNLDTLPDPEARGKTEQALATL
                     SRVGDVKDGKIPEISTAGDISTVAGILKEILSPKFDEQVKKSEAIINYVAAIAGQLVD
                     EKVGEVESWTQNALPYITAIVGEEEAKTVAETLRKRASPDAAAEDAVLSDEEEGEDLC
                     NCTFSLAYGAKILLNQTHLRLKRGQRYGLLGPNGTGKTTLMRAINNEQLEGFPKKDEV
                     KTVYVEHDLDSADTEQTVIGWTMKKLREVGLDPKQEEVEAKLEEFGFLREQLNGPITA
                     LSGGWKMKLALARAVFEKPDILLLDEPTNHLDVKNVAWLENYLCTSPCTSIIVSHDSK
                     FLDNVIQHVIHYERNFKLKRYRGTLSEFVKKVPSARSYYELGASDMEFKFPEPGFLEG
                     VKTKAKAIIRVSNMSFQYPGTPRPQISDISFQVSLGSRIAVIGPNGAGKSTLVNVLTG
                     ELIPTTGDVYQHENIRIAYIKQHAFAHIDNHLDSTPSEYIQWRFQTGEDRETMDRANK
                     IVTDEDEKAMDKIYKIDGTPRRVIGIHSRRKFKNTYEYECSFLLGDNIGMKSEKWTPM
                     MTSDNAWIPRNEIIQSHAKMVAEVDQKEALASGQFRPLVRKEIEEHCAQFGLDAELVS
                     HSRMRGLSGGQRVKVVLAACSWQRPHVIVLDEPTNYLDRDSLGALSKAIKTFEGGVVI
                     ITHSREFTENLTEEVWAVVDGKMTPSGHNWVQGQGSGPRLTEKTNEEDTFDAMGNKIE
                     APKKAKKLTSSEQRKKKKERMARKKRGEEVFSDEDDF"
     exon            1103279..1103466
                     /number=1
     exon            1103536..1106431
                     /number=2
     exon            1106545..1106664
                     /number=3
     CDS             1108785..1111688
                     /codon_start=1
                     /locus_tag="AO090005000429"
                     /note="uncharacterized conserved protein, contains TPR
                     repeats"
                     /old_locus_tag="AO070339000148"
                     /protein_id="BAE55494.1"
                     /transl_table=1
                     /translation="MAEVSIAYPTSLNTLYDEASSLKQLYEPIQLADAEIVPILQLPL
                     AKVVFGHDSADESTLARVSSGEISYTTFLANKTKSISQTQLDGSTPEQRNSQLLHIGL
                     AALFSFLQSNVTGPPLSFSPAELIIPSILRTNPTSLRAVRAHIIRDLSVDGEAAYRLT
                     PNVELFAVAKAILADTDFLLTNGPLVARTARMRVNFLHQKMLSEITGTLQDAIYSDME
                     QISSALLNGNAAGSETAKFLLERALIHTHHGLDSKARADIDKAAAARNFKFALTGKLG
                     KRTKFQERDISQLVIIAKSADNATDTNVNSTSDSEPSGPKNLDLNDDTLLESISFTKD
                     EKQQSQDNQVTIQDESTLPPALASLDPGNQPKLSPVDSAILLALAAAITNTTPEDGLT
                     REETHPYATRVLEGGSSNWQIYTQGLLARSRIEGYRARTVERSVLQMQALVDQVIADT
                     ATLDSQATSTVEEPTTFLPRPEKSESASAAERLEYVWLLNFSTRWDLEAELASRWVNL
                     GGLRTALEIYERLQMWAEAALCYAATEREEKAKSMVRKQLYEPTNRELEDENEKFEGP
                     ELSPLPADAPRLFCILGDMDSDPTMYERAWEVSNNRYARAQRSLARHYLTLKPPALEK
                     AEEAYRKSLQINRLNHGAWFSLGCVQLELQRWDDAKASFTRAVQLEENDAESWSNLAA
                     AILQTPQPDESKPTSVEQLPDEEGELETGKAPEDPHKHKREALVALSRAAQLKNTNSR
                     IWDNVLTVAASIPPPFTPFRDVITAQKKLIEILGDKKGEKCIDLPIVGMLVDYLTTAY
                     EYEDLVIKVDNGSKPPQQVVRSGTIAGQILSLVDNSIVPQITHSASLWLLVARVEQWR
                     GQPSKALEAHEKAWRATVASSTQGAFQMGDEKKWMEIVRATEKLVRNGYSKYGPMDKE
                     GQEDAGEAELVAKDWRFKARSAVRGILGKGKEFWEDSEGWSQLKELQSEVGST"
     exon            1108785..1111688
                     /number=1
     CDS             complement(join(1112091..1112220,1112269..1112750,
                     1112833..1112928))
                     /codon_start=1
                     /locus_tag="AO090005000430"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000149"
                     /protein_id="BAE55495.1"
                     /transl_table=1
                     /translation="MSRKFPEVQGGGSLIVAWQVKSKHVLVVGGGEVAAGRILHALNA
                     DAKVTVVCPVSGLNDEVAFRVSEGQVSHVDRNFEPTDLDGADMVLCAIDDPDASTRVW
                     KLCKEKRIPANIADVPSECDFYFGSVHRDGPLQVMVSTNGNGPKIASMVRKKIADTLP
                     DNMGAAIENVGKLRKKLREVAPNVEAGPKRMKWMSGVCESWSLDELVQMNDKDMDSLL
                     AHYESGKIPTFDEVRSN"
     exon            complement(1112091..1112220)
                     /number=1
     exon            complement(1112269..1112750)
                     /number=2
     exon            complement(1112833..1112928)
                     /number=3
     CDS             join(1113620..1113679,1113760..1114808,1115668..1115722)
                     /codon_start=1
                     /locus_tag="AO090005000432"
                     /note="ribose-phosphate pyrophosphokinase"
                     /old_locus_tag="AO070339000151"
                     /protein_id="BAE55496.1"
                     /transl_table=1
                     /translation="MLANLLSVAGVDHVITLDLHMQGFFGKPVDNLFAEPYIARWIRM
                     NVPGWKEAVVVSKNAGGTKRVTSLADTLKLNFGIVTTDRRRPKMNMAMTDSTVFFDSI
                     DEDCTPVQKEDDPFVLHVQTGKHDDSQTEEVHRLSDNMESLLSANALLPDLLTGARRP
                     SELEAAHGCTDVRVHDVITGRLVEGHLVDDDYHPIDSTPASGDTTPGQTVADHSDSVP
                     DPMTESFISSTSSLPGDHALGGSFDAAESSDEEGSVGRAVEREKTITFVGDVRDRTVF
                     IVDDMIDKSGSWIAAAETVVKKGGAKKVYCIATHGLFGDKSLEQMEECDVIDYIVVTN
                     TFPISEQMVRKSKKLVVIDISTLISESIRRHHYGESPFFSLAAPAMFRLCVLE"
     exon            1113620..1113679
                     /number=1
     exon            1113760..1114808
                     /number=2
     exon            1115668..1115722
                     /number=3
     CDS             complement(join(1122153..1122167,1122221..1122769,
                     1122819..1123279,1123329..1123589,1123640..1124261,
                     1124314..1124466,1124517..1124867,1126600..1126632))
                     /codon_start=1
                     /locus_tag="AO090005000433"
                     /note="phospholipase D1"
                     /old_locus_tag="AO070339000152"
                     /protein_id="BAE55497.1"
                     /transl_table=1
                     /translation="MRDTKATSPPWVGKFFNIVNPNHRHDEAHEQETDRKRTEIAKSH
                     RFESFAPIREGNKVKWYVDALDYLWAVSIALENAKEVIYIEDWWLSPELFLRRPAYQT
                     QEWRLDQVLKRRAEAGVKIYVIVYKEVNQALTCNSAHTKHALRNLCPEGTPGHGNIKI
                     LRHPDHNIFENAADMTLYWAHHEKFIVIDYALAFIGGIDLCFGRWDANQHPLADVHPA
                     NMRDEVFPGQDFNNNRIMDFQSVAQWQANELSKADYGRMPWHDVAMGLMGDCVYDIAE
                     HFVLRWNFIKRDKYKRDKTVDWLMLEGRLGEDEDLVAVQRPKYPCGDYVQHPYEPLTS
                     KPRGAQGSARAQIVRSSADWSSGILTEHSIQNAYKEIISKAEHYVYIENQFFITATGD
                     QQKPVLNTIGRAIVDACVRASREGRKFRVIIVIPAIPGFAGDLRQPEATGTRAIMDYQ
                     YKSINRGEHSIFGQLRHHGVDPEQHIFVFNLRAYDRINKTPALEALEKEAGVTYNDIQ
                     RGIAETIMSDSVHPSIGEEGDKGEVGYDNAQKEKEERLAKLRRYEEQAERHKPEYQPS
                     SKDTVAHTTMLNGGKMSDEPWEGEAEAEKANFVQEELYVHGKVCIVDDRVAICGSANI
                     NDRSQLGYHDSELAIVVEDQDFIDSMMDGKPFKAGRVAATLRRQLWREHLGLLPAQDY
                     DASQSPNAQPPNVCMNQILEGPENSFVTDPMSDPLWEMWTGRATTNTEIYRMLFRADP
                     DDDIKNFDEYDSFRPRGNHKQGHLYDPYQPVKDVREKLDKIKGHLVWMPLRFLEDANM
                     AEPGLQVNQITESIYT"
     exon            complement(1122153..1122167)
                     /number=1
     exon            complement(1122221..1122769)
                     /number=2
     exon            complement(1122819..1123279)
                     /number=3
     exon            complement(1123329..1123589)
                     /number=4
     exon            complement(1123640..1124261)
                     /number=5
     exon            complement(1124314..1124466)
                     /number=6
     exon            complement(1124517..1124867)
                     /number=7
     exon            complement(1126600..1126632)
                     /number=8
     CDS             join(1128278..1128693,1128789..1128798)
                     /codon_start=1
                     /locus_tag="AO090005000434"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000153"
                     /protein_id="BAE55498.1"
                     /transl_table=1
                     /translation="MIRDEDHIIIHAASSINLGSALKRVSDPIIGASEIMANLAFTCK
                     RLDRFIYVSSAYSNAHLYPRGPDADVQINEEICEPGRQSLVLDELNEVRKSGTSQAYE
                     AENFPWAYAYAKHITERLLQHYFSVHAAEKKLLIIRPTN"
     exon            1128278..1128693
                     /number=1
     exon            1128789..1128798
                     /number=2
     CDS             complement(join(1129645..1129966,1130018..1131067,
                     1131120..1131486,1131540..1135286,1136196..1136211))
                     /codon_start=1
                     /locus_tag="AO090005000435"
                     /note="guanine nucleotide exchange factor"
                     /old_locus_tag="AO070339000154"
                     /protein_id="BAE55499.1"
                     /transl_table=1
                     /translation="MVPECFPVSSTVFIVTALDTIGASREARRTKELEDAVKSAIANV
                     KQSDGQPIDPEVIFRPLLLATKTLSVPLQVTALDCIGKLITYSYFAFPSAHDGNTSQT
                     EPTQEQPPLIERAIDAICDCFENEATPNEVQQQILKSLLAAVLNDKIVVHGAGLLKAV
                     RQIYNIFIYSKSSQNQQIAQGSLTQMVSTVFDRVRVRLELKELHIRDGEKAQGSSSDT
                     VTLDPAENPQTNEEDQGSDVASAAVPDQPVAKEPTEKLTLQSFESNKDITSVNDNAPT
                     TVTRAKARQTPVRSLSISGEEREDGEGLDDDEDEVYVKDAFLVFRALCKLSHKILSHE
                     QQQDLKSQNMRSKLLSLHHIHYLINTHITVFTSPLLTIRQSSNSSDAMTLLQAVRPHL
                     CLSLSRNGSSSVPRVFEVCCEIFWLMLKHMRVMMKKELEVFLKEIYLAILEKRNAPAF
                     QKQYFMEILERLADDPRALVEIYLNYDCDRTALENIFQNIIEQLSRYASVPVSITAAQ
                     QHQFQEHHVKISRLGLEWHQRGTLPPTLTTANVSNIQQPNLQGVPSEYTLKYQSVESL
                     VEILQSLDNWASQRMADQAVTNITSHKSIDNSRESLDTNAGAFLSSPRVDATEGSTGR
                     STPVAEDDPSQMEKVKQRKIALMNAVQQFNFKPKRGIKLFIQEGFIKSDPAEIASLLY
                     RNDRLDKAMVGEYLGEGEAENIAIMHAFVDMMDFTKRRFVDALRGFLQNFRLPGEAQK
                     IDRFMLKFAERYTTQNPNAFANADTAYVLAYSVILLNTDLHSSKMKGRRMTKEEFIKN
                     NRGINDNQDLPEEYLTSIYDEIAGNEIVLDTEREHAANVGMPTGTPGGLASRAGQVFA
                     TVGRDIQGEKYAQASEEMANKTEQLYRSLIRAQRKTAVREALSRFIPATSVRHVGSMF
                     NVTWMSFLSGLSAPMQDTQNLEMIKLCMEGMKVAIRVSCSFDLETPRVAFVTALAKFT
                     NLGNIREMVGKNVEALKALLDVALTEGNYLKSSWREILTCVSQLDRLQLLTDGVDEGS
                     LPDVSRARIVPQASSEGSRKSFQSSRRPRPRSINGPTAFRTEAAMESRSAEMIRGVDR
                     IFTNTANLSHEAIIDFIRALSEVSWQEIQSSGQTDSPRTYSLQKLVEISYYNMTRVRI
                     EWSKIWEVLGQHFNLVGCHSNTTVVFFALDSLRQLSMRFMEIEELPGFKFQKDFLKPF
                     EHVMANSNAVTVKDMILRCLIQMIQARGDNIRSGWKTMFGVFTVAAREPYEGIVNMAF
                     EHVTQIYNTRFGIVITQGAFPDLVVCLTEFSKNSKFQKKSLQAIETLKSTVSKMLRSP
                     ECPLSHRGSSAEEFHDENTNLAKQLSRQSKEEQFWYPILIAFQDVLMTGDDLEVRSRA
                     LTYLFETLIRYGGDYPQEFWDVLWRQLLYPIFVVLQSKSEMSKVPNHEELSVWLSTTM
                     IQALRNMITLFTHYFDALEYMLGRILELLTLCICQENDTIARIGSNCLQQLILQNVMK
                     FKQEHWEKVVGAFVELFSKTTAYELFTAAAAISTKSSEPHKSINGEVASNEGGTHETA
                     EPSSARESLTDSSKTNGLQNVAHEHEEGDMPTAANSELEDYRTQAEVQQQPAAVTAAR
                     RRYFNRIITNCVLQLLMIETVHELFSNDKVYAQIPSHELLRLMGLLKKSYQFAKKFNE
                     DKELRMQLWRQGFMKQPPNLLKQESGSAATYVHILFRMYHDEREERRNSRAETEAALI
                     PLCADIIRSFVLLDEDSQHRNVIAWRPVVVDVLEGYTNFPSEGFDKHIQTFYPLSVDL
                     LGRDLNPEIRMALQSLLRRIGEAKLGIPASQAPVNPRSSVSRRKDSVGR"
     exon            complement(1129645..1129966)
                     /number=1
     exon            complement(1130018..1131067)
                     /number=2
     exon            complement(1131120..1131486)
                     /number=3
     exon            complement(1131540..1135286)
                     /number=4
     exon            complement(1136196..1136211)
                     /number=5
     CDS             join(1136361..1136439,1136512..1136735,1136801..1137877)
                     /codon_start=1
                     /locus_tag="AO090005000436"
                     /note="dihydrolipoamide acetyltransferase"
                     /old_locus_tag="AO070339000155"
                     /protein_id="BAE55500.1"
                     /transl_table=1
                     /translation="MADVAIPIFRPQLPAFAALSRYYASKSFPPHTIISMPALSPTML
                     AGNIGAWQKKPGDSLQPGDVLVEIETDKAQMDFEFQEEGVLAKVLKETGEKEVAVGSP
                     IAVLVEEGTDVSSFESFTAEDAGGDKGAAPAQESKEESKGAADAAPASTPAPEPAAQE
                     PETSGEKLQPSLDREPTISPAAKALALEKGVPIKALKGTGRGGQITKEDVEKYKPSAS
                     AAAGPTYEDIPLTSMRKTIASRLQQSTRENPHFFVSTTLSVTKLLKLRQALNASADGK
                     YKLSVNDFLVKACAAALQKVPAVNSSWHEENGQVVIRQHKNADISVAVATPAGLITPV
                     VKNVQGLGLSSISNSIKDLGKRARDNKLKPEEYQGGTFTISNMGMNPAVERFTAVINP
                     PQAGILAVGTTRKVAVPVETENGTEVEWDDQIIVTGSFDHKVVDGAVGAEWIKELKKV
                     VENPLELLL"
     exon            1136361..1136439
                     /number=1
     exon            1136512..1136735
                     /number=2
     exon            1136801..1137877
                     /number=3
     CDS             join(1140354..1140364,1140411..1140435,1140509..1140955)
                     /codon_start=1
                     /locus_tag="AO090005000437"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000156"
                     /protein_id="BAE55501.1"
                     /transl_table=1
                     /translation="MVLQLRKEREDAQSVTNRNELLGRRPHHTATPENPYAQSSLPQS
                     SAFAPSSSRGGLSFGASPADYNRETHALREQSFLANTSIQLDEFLDRGRAVLADLGQQ
                     REVLKGTQRRLYSVANTLGVSGETIRKVERRAKQDKWIFWGGVLIFFLFCWAVLHFLR
                     "
     exon            1140354..1140364
                     /number=1
     exon            1140411..1140435
                     /number=2
     exon            1140509..1140955
                     /number=3
     CDS             join(1141443..1141508,1141594..1141711,1141785..1141934,
                     1141995..1142089,1142143..1142736)
                     /codon_start=1
                     /locus_tag="AO090005000438"
                     /note="NAD-dependent malate dehydrogenase"
                     /old_locus_tag="AO070339000157"
                     /protein_id="BAE55502.1"
                     /transl_table=1
                     /translation="MFAARQSFNLLQKRAFSASASQASKVAVLGAAGGIGQPLSLLLK
                     LNPRVSELALYDIRGGPGVAADLSHINTNSTVSGYEATPSGLRDALKGSEIVLIPAGV
                     PRKPGMTRDDLFNTNASIVRDLAKAAAEASPEANILVISNPVNSTVPIVSEVFKSKGV
                     YNPKRLFGVTTLDVVRASRFISQVQKTDPSNEAVTVVGGHSGVTIVPLLSQSSHPSIE
                     GKTRDELVNRIQFGGDEVVKAKDGAGSATLSMAMAGARMAESLLKAAQGEKGVVEPTF
                     VDSPLYKDQGVDFFASKVELGPNGVEKILPVGQVNAYEEKLLEACLGDLKKNIQKGID
                     FVKANP"
     exon            1141443..1141508
                     /number=1
     exon            1141594..1141711
                     /number=2
     exon            1141785..1141934
                     /number=3
     exon            1141995..1142089
                     /number=4
     exon            1142143..1142736
                     /number=5
     CDS             complement(join(1143555..1143713,1143783..1145644,
                     1146210..1146528))
                     /codon_start=1
                     /locus_tag="AO090005000439"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000158"
                     /protein_id="BAE55503.1"
                     /transl_table=1
                     /translation="MADSSVTATAAASETKLEAEPPVDNNTIKPDTKSSVAVSESAPA
                     CKKHPSKEKDPNGRNRDSKKKSHKSKSSSVVTPSDDSSDGSDSSADSSSAEESVSEDE
                     ESPSKTVDDPDANEWDQYLFTVRRKFDWDNKYTETVVDLKSKYIRDALAKVMDGVKGV
                     SLVQETAVVDPNMLFLYLEETRQYMNDLKQQAKTEKKRKAKKLAATKAALLKVLVKYL
                     DTDYAETKKTLYPLLEANTITFDLLWALFKPNTIAYTPTYGNQDEPRAFKLEYATKES
                     SFMKGQWYSIEGRYLEYDGKSFGMGTMLAEVESFKGARKITSLNCYPLKYHREAEDVK
                     AKLIERGKKFVSMRGMNYRFHKGMAFYKKKRSVIKVNINGRVMIDPAIHRRINPNYPI
                     STVRPKDADYIDDSDGAGSDGGCCCVSESDSDDPYVHRRDSDAPRVRYKVIQDKEGNP
                     HVVEVELDENGNEIQKEQMDEVEDPSERDFTEEELLIASPVVLGFAFSEKLWLEFSIS
                     GISDINWNEDAFDSLVLPDNQKSIVKALVESHTFCAAQNIDDVIQGKGKGLVAVLHGP
                     PGTGKTLTAEGIAELLKRPLYMVSAGELGTDSRTLEAELNKILDIAHSWGAVLLLDEA
                     DIFLEKRTIQDIHRNALVSIFLRLLEYFQGILFLTTNRVETFDDAFQSRIHVALRYGD
                     LTTKAKRSVWKMFVEKVQAMDGVQTATFTEKDFDNLARHNLNGRQIKNSVRTAQALAV
                     NEKTPLSMEHIKRVLEVAETFDHDLRGGTGYIDAMRSYT"
     exon            complement(1143555..1143713)
                     /number=1
     exon            complement(1143783..1145644)
                     /number=2
     exon            complement(1146210..1146528)
                     /number=3
     CDS             complement(join(1148625..1149050,1149109..1149219))
                     /codon_start=1
                     /locus_tag="AO090005000440"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000159"
                     /protein_id="BAE55504.1"
                     /transl_table=1
                     /translation="MDQAPPTPPTPASQESIMPEFTPINGNTDKPSAPSPSAAATSNP
                     TKRGKKSTATNGEKASPPKKAKGAAGSSPSKKSIGPIPTSFEAAGLSDRMIIQMRDEE
                     GKNWGEINESWMKMTGIKVGTSTLRMRYTTMKANFVEFTGEDVCASSLFVAFLALIMV
                     YADGSCVGSKTSSFEEGD"
     exon            complement(1148625..1149050)
                     /number=1
     exon            complement(1149109..1149219)
                     /number=2
     CDS             complement(1150059..1152587)
                     /codon_start=1
                     /locus_tag="AO090005000441"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000160"
                     /protein_id="BAE55505.1"
                     /transl_table=1
                     /translation="MLRSPISPERSAARPPNPTRPSFDSELERPGSSGSDASSVTSNV
                     TTISAVQSPFYQPPSGTSSPRPPRTSSITTATVSSQNGPSPTHTRPPASFMPQNEISS
                     RKPTGRAHPPDLMMKHRSRHHSQGFFEPSLPTASASDSISASRIAAQTAMQQQQHQQQ
                     GITAQQLPKRPQTIVYTPDDGSRTRGGSISPPPLLPAPSLPPPGSSGSSGQTYQNGHS
                     GVATTAANVAFPRHAGLQPPGLEAPPEKEHKQKGEKSKMKLFSKPKHIGISRDKDGIP
                     KDRGLPSPSKMGFAGAGLSRIVSASTTSLADTFPSNNSSMYNLSNASASTVVPADKPT
                     ASEKEKDKEKEKAHKHHFLSRQKLKLKDRDDHYNLPLSSASSNSKPSDPNAPQSLYSF
                     TPASPGPVSTTFGKSVSGLDILHGGRALREKKKEEKEKEKAMAESEQHEWMTGPTGAG
                     GASTVFAGPSSIGSAGGLTEAALRETLQGFGLNNMSPEDAWDFLKAKLLVIFDGEDVR
                     ISIEDLNKLVLIHIQRCVQKRTPSAIVDDLRELLETGFASLNHTLNGVPDEKLVPHLV
                     QIWMLVFGTILPFIQAVFLPLDLEFRGCGTVMNLREAREFWAAALNGDYPGCELEVRN
                     LVLIAFRDKVILYRYDGLKATFSRLSLESINLGNSALSVTTKSSSSSGRPATAASLDA
                     GFGSYNSQSSTLLNAAASYSSDSMSCNRSRAASNTSSNPDQLIFQSFSSPTQRPTIIH
                     RSSHTADTSHMITETVGRMLQCVSVLASVQTGGKPQEKIELLSKALKHNWLGRGRTGR
                     DRRGFVGAKIRPAMVTRTESDDSMIDRNGDSDIMRDGHREISVL"
     exon            complement(1150059..1152587)
                     /number=1
     CDS             1152936..1153391
                     /codon_start=1
                     /locus_tag="AO090005000442"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000161"
                     /protein_id="BAE55506.1"
                     /transl_table=1
                     /translation="MNQTINFSTNIFPSMSTTTTSNDQHDSKRLKTSPTNETFGNIDI
                     MAAGTSSTQSNPLCAVYSAPQSTQTFEHSISSPLPSTDLSPENVQTKVAYLSELRKLV
                     PNLQNDINVFLTERMEEDKKLAEAQGRQLSEQERKEEENYGEEVVEEDA"
     exon            1152936..1153391
                     /number=1
     CDS             complement(join(1153822..1154335,1154403..1154511,
                     1154567..1157084))
                     /codon_start=1
                     /locus_tag="AO090005000443"
                     /note="vacuolar assembly/sorting proteins VPS39/VAM6/VPS3"
                     /old_locus_tag="AO070339000162"
                     /protein_id="BAE55507.1"
                     /transl_table=1
                     /translation="MLSAFTARPLVELKPRDKSRIESVLAYGDRLLVGLNNGSLRIYR
                     INEVSPDEQNHDDSNNHSHDEQGGGGTLKKGDSGRPGTTDSVAKPKQTDLLRELEKFS
                     RYKIEQLALIKEAKLLISLSGGYISIHDLQTYEIQEQLTKTKGATTFNVTSNIVNDPE
                     TGVPSIVSRLAVAVKRKILLWSWRDMELDSDAAEMTLVSGIKTLTWVSGTKLVAGLGS
                     NFVMVDIETSVVTDLAGPGSIGGLGGQETSRLAGVGVASMSYIGIGGAAPKPLATRLS
                     EGQILLAKDINTHFIDINGNSLGRRQIPWSHAPANIGYSYPFLLALHDPSKGVMEVRN
                     PETLSLLQSVALPSASILHFPQPSISLAHAGKGFLVGSDRTIWRMEALSYDTQIDTLV
                     EKGYLDEAISLTSMLEDALLSDKKGRLRTIKMEKAQGLFTLRKYRDSMDLFTEISAPP
                     ETVIRLYPKVIAGDLSSIDEEEESEESITDDPSKTNEGQVQLDGAITENASAPKTLNH
                     APSVRSLLRTRTDDWSDAGSIRGKPTEEARNEKPLHGKDLLTAVRELQKYLADVRRRF
                     QRFLNPDGTLKTIDSPSDAANDEFTDSVMKLLDITKDIHDHEFAEKLHEEARLVDTTF
                     FRVCMYATPALAGSLFRIANFCDPEVVMEKLEETGRYNDLIDFLYGKKMHRQALELLQ
                     RFGQAESETETAPQLHGPKRTVAYLQNLAPDRIDLILEFAEWPVREDPNLGMEIFLAD
                     TENAETLPRHQVLEFLRGIDPNLAVRYLEHVIGELNDMTPDLHQKLLTFYMDRLKKNG
                     SDSWAFPNGEERILWRNKFLEMLRSSSQYSPAKILDSLDRDDPEFFEARAIVFSKMGQ
                     HRQALEIYVFKLEDYAKAEEYCNHFHKTDDITAEAAPLSVLDSDDKPSIHLTLLSLYL
                     TPPHGYERRYGPALEILAKHGSRLPPSSALELIPESLPVKELDFYFKGRMRAATSALN
                     ESRIVASLQKAQNFKTEAQLMVGEGTDGKSCRMRHVTITEERICGICHKRIGGSVINV
                     FPEYVFHAVFVSSFFH"
     exon            complement(1153822..1154335)
                     /number=1
     exon            complement(1154403..1154511)
                     /number=2
     exon            complement(1154567..1157084)
                     /number=3
     CDS             complement(join(1157946..1158590,1158648..1159234,
                     1159292..1159364,1159709..1159750))
                     /codon_start=1
                     /locus_tag="AO090005000444"
                     /note="fructose-6-phosphate 2-kinase/fructose-2,
                     6-biphosphatase"
                     /old_locus_tag="AO070339000163"
                     /protein_id="BAE55508.1"
                     /transl_table=1
                     /translation="MSVRRGQTKSYFASADDTKICVVMVGLPARGKSLIAGKAMRYLA
                     WVGIPARVFNVGTYRRSNTPQPNATFFDPHNSEGEKMRKAAAEAAMSDMLQWFSSGKG
                     VVAILDATNSTKSRRSWIYESCHAANVETLFVESICDEEDLIMNNILEVKTTSPDYKG
                     QDPEAAALDFRNRIRNYEKVYETIDDNEKHYTYVKLINVGSTVIINQIKDYLSSRLVY
                     YIQNLHIKPRSIWLSRHGESEYNLTGKIGGDSNISPRGEAYAQALPGLLKKSGVPPNT
                     KIVIWTSTLKRTIQTARHLAAETGYEKLEWKALDELDSGVCDGLTYEEIAEKYPEDFA
                     ARDEDKYNYRYRGGESYRDVVIRLEPIIMELERSENVIIVTHQAVLRCIYAYFLNTPQ
                     EQSPWMEVPLHTLIKLTPRAYGTDEQRFKADIPAVSTWRAKGTSAKHQDYPTEIKA"
     exon            complement(1157946..1158590)
                     /number=1
     exon            complement(1158648..1159234)
                     /number=2
     exon            complement(1159292..1159364)
                     /number=3
     exon            complement(1159709..1159750)
                     /number=4
     CDS             complement(join(1161232..1161496,1161559..1161957,
                     1162010..1162280,1162372..1162411))
                     /codon_start=1
                     /locus_tag="AO090005000445"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000164"
                     /protein_id="BAE55509.1"
                     /transl_table=1
                     /translation="MVDAPESPVPQQQTPVKTFQNGVRTTGRAFHSPNWRVKGEESPS
                     AQSAGSPGPKTNTSRIAFSRPSPHVPQAISEGRRLYVGNMPYTAKSEDVQALFTAAEF
                     TIERIDIAIDPFTGRNPSYCFVDLESKELAEKAMNELDGRDMLGRPVKIKPGVVKSSS
                     ERSQQQQQQQQRTDGSPRSDSKTSLFTMDRWRRNDAPTFARTNSDSSRRLYVGGLPRL
                     TDQEDISSNITNFFKDYKLENISKLFTPHPAKRFEPGDHYYLFVDFSSVEEAQSAMSA
                     LNGQEGPWGSPIRVQRARGETNSEDRKSKWSSARGDETPATGDVSVAV"
     exon            complement(1161232..1161496)
                     /number=1
     exon            complement(1161559..1161957)
                     /number=2
     exon            complement(1162010..1162280)
                     /number=3
     exon            complement(1162372..1162411)
                     /number=4
     CDS             complement(join(1163546..1164295,1164394..1165151,
                     1165229..1165649))
                     /codon_start=1
                     /locus_tag="AO090005000446"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070339000165"
                     /protein_id="BAE55510.1"
                     /transl_table=1
                     /translation="MFGKEDMGPFADPQHKDDTEHVERNENAMPRRILATAAERARRN
                     INAKLANPLAGYSYEELRSQGINFAVSHHIGDEEDIRAFGIGAILAQVPDKFTQVPDL
                     RPDEIEVLQKEFSNRWSQPWTMYLVIALCSLAAAVQGMDETVVNGAQIFYKHQFGIGN
                     DDSRSNWLVGLVNSAPYLCCAVIGCWLTVPFNAWFGRRGTIFITCCFSALACLWQGFV
                     NTWWHMFIARFVLGFGIGPKSATVPIYAAETAPPVIRGALVMQWQMWTAFGIMFGYAA
                     DLVFYEVRDPVGITGLNWRLMVGSAMLPAILVCCFVFTCPESPRWYMSRKCHDKAYRS
                     MCSLRFHKIQAARDLFYMHTLLEAENAMKLGQNKVLEMITVPRNRRALVASELVMFLQ
                     QSGFTKYLLFLYLGVNVIAYYSSEIFLEATNQRNALTASLGWGLINWLFAIPAVYTID
                     TFGRRNLLLTTFPLMALSMFFTGFSFWIPQETHSSARLACIALGLYIFGIVYSVGEGP
                     VPFTYSAEAYPLYIRSYGMALATATTWLFNFTLAVTWPSLRSAFTPQGAFSWYAGWNI
                     VGWWLILLLMPETKGKTLEELDQVFSVSTTFHAAYGLRQIPYFFQRYILRQNVRPEVL
                     YEREDAFNVPPEAGYNTL"
     exon            complement(1163546..1164295)
                     /number=1
     exon            complement(1164394..1165151)
                     /number=2
     exon            complement(1165229..1165649)
                     /number=3
     CDS             join(1168893..1169194,1169262..1169976)
                     /codon_start=1
                     /locus_tag="AO090005000447"
                     /note="predicted metal-dependent hydrolase of the
                     TIM-barrel fold"
                     /old_locus_tag="AO070339000166"
                     /protein_id="BAE55511.1"
                     /transl_table=1
                     /translation="MLGKIALEEAFALPRFEEKTRWWASLFSTDAETHVKEITDINKI
                     RIEHADKHGVGYQILSYTAPGVQDIWDPVEAQALAVEINDYIAEQVRVNPDRFGAFAT
                     LSMHNPKEAADELRRCVEKYGFKGALVNDTQRAGPDGDDMIFYDNADWDIFWQTCTEL
                     DVPFYMHPRNPTGTIYEKLWADRKWLVGPPLSFAHGVSLHVLGMVTNGVFDRHPKLQI
                     IMGHLGEHVPFDMWRINHWFEDRKKLLGLAETCKKTIRDYFAENIWITTSGHFSTTTL
                     NFCMAEVGSDRILFSIDYPFETFSDACEWFDNAELNGTDRLKIGRENAKKLFKLDSYK
                     DSSA"
     exon            1168893..1169194
                     /number=1
     exon            1169262..1169976
                     /number=2
     CDS             complement(join(1170338..1170773,1170912..1172845))
                     /codon_start=1
                     /locus_tag="AO090005000448"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000167"
                     /protein_id="BAE55512.1"
                     /transl_table=1
                     /translation="MERTLYIYLYPILCCSMTPTANLFNRFISVQIYHALIILSIELL
                     PTTLWISSIRSSPFTSYSSMIFDIMSPRVNITKKRRWSPRMEDQQKLANAKKNLSSLH
                     TFTFNLMKNKTSPRIKYRDSRVEIPHFDSERITSMLGDATHTPLDLHEQFDSDEDQGR
                     PLSSSSSNTSSRRSIHGSLNTPITPVTPLLVHSELEISSTEPFPDYYESCEQNTAVID
                     KDHEEAYNNAIGKVFEESVRMRELGAGTTPATISPLATHVGCPVTIDSYPRQDKSNIS
                     LTSHSALRSETTGRTQPSTAPTSVSRISPTTSVRADSDKGASMTSASQTRTTLEYTGA
                     HLSRTSNATSTIYNDASVRDFAFGAAPPPTIAPPFMADGRPGIQARHIPSIQSSSTSN
                     GWSERALGQPSPVASVSHTVPGTSDTRIRSDQNNQYYGLSFHSSQSTIAGSISGHNTG
                     QVDFTSPQDSMSVSGSVCSSQTSKRTLSIDDMAMPDVLPTPNFQPPIGTGRPLPGATP
                     RPAPNPRMQRRLHEAEERKLNILEEMKIILRADHMKDDIQRRFTAMTDIILRMEWILF
                     RRDVKPDGTRTNEFLSAPIVAEVQELAIPMVQCLAWLDKKLACELSIANQVLHWVIQI
                     AKDEDLDVYQRFRQMARVIVSDFLDIRNRQILQEEGFHIERDNLTRLLIAGWDVLNRA
                     IETYNEIITINFDIKNRFIDPVMERLPRSYEIWEEEWDDHERQCETQRNMDLEKLWME
                     AEERACAEAQEQEVARAQARAMAEFRAQMQWPGQRQGYGQWHVDSRIPV"
     exon            complement(1170338..1170773)
                     /number=1
     exon            complement(1170912..1172845)
                     /number=2
     CDS             join(1175739..1176084,1176137..1176719,1176774..1177393,
                     1177447..1177664)
                     /codon_start=1
                     /locus_tag="AO090005000449"
                     /note="choline dehydrogenase and related flavoproteins"
                     /old_locus_tag="AO070339000168"
                     /protein_id="BAE55513.1"
                     /transl_table=1
                     /translation="MLFSLAFLSALSLATASPAGRAKNTTTYDYIVVGGGTSGLVVAN
                     RLSENPDVSVLLLEAGASVFNNPDVTNANGYGLAFGSAIDWQYQSINQSYAGGKQQVL
                     RAGKALGGTSTINGMAYTRAEDVQIDVWQKLGNEGWTWKDLLPYYLKSENLTAPTSSQ
                     VAAGAAYNPAVNGKEGPLKVGWSGSLASGNLSVALNRTFQAMEDVNGGKMRGFNIYPS
                     TLDVDLNVREDAARAYYFPYDDRKNLHLLENTTANRLFWKNGSAEEAIADGVEITSAD
                     GKVTRVHAKKEVIISAGALRSPLILELSGVGNPTILKKNNITPRVDLPTVGENLQDQF
                     NNGMAGEGYGVLAGASTVTYPSISDVFGNETDSIVASLRSQLSDYAAATVKVSNGHMK
                     QEDLERLYQLQFDLIVKDKVPIAEILFHPGGGNAVSSEFWGLLPFARGNIHISSNDPT
                     APAAINPNYFMFEWDGKSQAGIAKYIRKILRSAPLNKLIAKETKPGLSEIPATAADEK
                     WVEWLKANYRSNFHPVGTAAMMPRSIGGVVDNRLRVYGTSNVRVVDASVLPFQVCGHL
                     VSTLYAVAERASDLIKEDAKSA"
     exon            1175739..1176084
                     /number=1
     exon            1176137..1176719
                     /number=2
     exon            1176774..1177393
                     /number=3
     exon            1177447..1177664
                     /number=4
     CDS             complement(join(1178329..1178478,1178529..1179347))
                     /codon_start=1
                     /locus_tag="AO090005000450"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000169"
                     /protein_id="BAE55514.1"
                     /transl_table=1
                     /translation="MNPSQEPLWQWPNSPTAPNPEEDQRFENAHQHDDSDAPPPESSQ
                     KHYPPRVCRICLETVLPTFHPPSDNIPGFLQPKARVVYESSDAELGRLLRPCKCKGSS
                     RYVHEGCLQSWRHADPGYSKRNFWHCPTCGFQYRLERLTWARWISSTSAQLGLTLLIL
                     MFTVFMLGFVADPIINLYINPMETIIYSEFWDPSTVSSVLPTEKQASWITHFVKGLAS
                     LGFLSFIKAIVAMSPWQWWHVRPSGLVSSGRTTGRSRVASITWVVILVGVCSFLWAVY
                     KGVRSWSRRALEKAGERVMDVPLPDDEEEDENDPSSEKSEQRKKEE"
     exon            complement(1178329..1178478)
                     /number=1
     exon            complement(1178529..1179347)
                     /number=2
     CDS             join(1179823..1179866,1179922..1179941,1179993..1180043,
                     1180114..1180719,1180773..1180891)
                     /codon_start=1
                     /locus_tag="AO090005000451"
                     /note="20S proteasome, regulatory subunit alpha type
                     PSMA2/PRE8"
                     /old_locus_tag="AO070339000170"
                     /protein_id="BAE55515.1"
                     /transl_table=1
                     /translation="MADRYSFSLTTFSPSGKLVQIEYALNAVNQGVTALGIKATNGIV
                     LATEKKSSSPLIDPPSLSKVSLITPDIGMVYAGMGPDYRVLVDKARKVSHTGYKRIYN
                     EYPPTRILVQDVARVVQEATQSGGVRPYGVSLLIAGWDEGVEPESEEAQKGDNEDEPK
                     KATGKTGGILKGGPSLYQVDPSGSYYPWKATAIGKHATSAKTFLEKRYTEGLELEDAI
                     HIALLTLKETIEGEMNGDTIEIGIVGPPADHLLGFEGVEGAQGPRFRKLTKEEIEDYL
                     TNL"
     exon            1179823..1179866
                     /number=1
     exon            1179922..1179941
                     /number=2
     exon            1179993..1180043
                     /number=3
     exon            1180114..1180719
                     /number=4
     exon            1180773..1180891
                     /number=5
     CDS             complement(join(1184038..1184229,1184285..1184904,
                     1184949..1185001,1185059..1185278,1185333..1185375))
                     /codon_start=1
                     /locus_tag="AO090005000453"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000172"
                     /protein_id="BAE55516.1"
                     /transl_table=1
                     /translation="MNQQDYLGLSTQEPQRVISFPASQSLHASAASPSGAISTGIPQL
                     DEAIRPPSAEDVLGRTRDINSNGIPCGHVTEVYGPPGAGKTSLALSVATSALRNGDKV
                     IWIDTGSPLPKVRLASMLKKSPDATSSDLPEDPIKNLIYFHARSLPHLLALLIRPPKG
                     FPPEDAKLLVIDSVSGLFPSYFPNPSEFKSRLPQSGITDKMQIQWLMNRKWNVTSDLG
                     NQLVKLAATHGLAILLVNQTHTRIRGQPRATLCPVLAGGTWENSVHVRIAIFRDFLPE
                     DEGDSKGVHFAEVMKRAGKTLSLRLDENIVPFKIETDGLRGIDKTPPPLILPQVPIET
                     SLSASQRKRKVDEIADSQDEDSDEEFGWVEGDDAGLSDGAG"
     exon            complement(1184038..1184229)
                     /number=1
     exon            complement(1184285..1184904)
                     /number=2
     exon            complement(1184949..1185001)
                     /number=3
     exon            complement(1185059..1185278)
                     /number=4
     exon            complement(1185333..1185375)
                     /number=5
     CDS             join(1185643..1185715,1185753..1187093,1187156..1187256)
                     /codon_start=1
                     /locus_tag="AO090005000454"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000173"
                     /protein_id="BAE55517.1"
                     /transl_table=1
                     /translation="MIFFPSASDVRALFLSNIVNFKAYHIRVVLLHRRLHASMLNYIE
                     PILGFNTVRHYAIIAMSTISSLAIIWLPLIPIAIFLISHKYRQCTNPRPKGCRKLGLL
                     GPKTNLHDEYDPKYSQGVPEKHTDPEDKPSWRIKALFAYPIKSCAGVELDTADVVPTG
                     FTYDRQFCFAEYITPKTSTNGSQQAHWTTRTLRDGSLCRMALIRPEIWVPDPTAEDYS
                     PELQEVQSQGVLVIHYPRVTAGILSLPVKLGVMLGLLSKELSFRVPFSPPPENTNPKS
                     TYPLTPIKIWKDTPLAHDYGCHLPPSLHRFLDPDRTRGPLTLFRTNSSHHREIFRNAP
                     RKEDLGFQPVTGFADAYPIHLLNIASVQDIAGKCKMDIPELSIRRFRANIIVQGPGAY
                     EEDHWKRVRIFGPKTESGSEGVEVYTACRTIRCKLPNVDPDTGIRHPVEPDRALKRWR
                     RIDRGDLTNAALGMQVVPAVREFRVCVGDGIEVLETGEHCYIKMLKPGEKVEGV"
     exon            1185643..1185715
                     /number=1
     exon            1185753..1187093
                     /number=2
     exon            1187156..1187256
                     /number=3
     CDS             complement(join(1187532..1189033,1189084..1189250,
                     1189314..1189405))
                     /codon_start=1
                     /locus_tag="AO090005000455"
                     /note="xanthine/uracil permeases"
                     /old_locus_tag="AO070339000174"
                     /protein_id="BAE55518.1"
                     /transl_table=1
                     /translation="MDGPDQIGPDLRPKRTWADKARRIVKTFTTRDGLIGDYDYAYLF
                     TPNIPFMQQTRRTAPFFGLDDRVPVVLALILGLQHSLAMLAGVISPPILLGGSSGANL
                     GEDDYQYLVSTSLIVSGLLSALQMLRFRIYKTPYSIGTGLISVVGTSFSIITVASGTF
                     TQMYSSGYCPVDAQGNRLPCPAGYGALLGTSCLCSLLQIGLSFISSKVLKRVFPPLVT
                     GPTVLLIGASLLETGMKDWAGGSGSCGSDPSARALCPSADAPHALPWGSAEFIGLGFL
                     VFVTIILCERFGSPIMKSCAVVVGLLVGCIVAGACGYFDRSTIDAAPVVSFIWVRTFP
                     LTIYAPLILPLLAVYIVIMMESIGDITATCDVSQVEVQGPDFDSRIRGGVLGNGLTCL
                     LAGLCTITPMSVFAQNNGVIALTKCANRKAGYCCCFFLVIMGIFAKFAAALVAIPSSV
                     LGGMTTFLFSSVAVSGIRIISSIPFTRRNRFILTASFAIGMAATLVPDWFDYFFTYSG
                     DNHALQGLLDAVTLVMTNGFAVTAVLGLILNLLIPEDPEEEAAIVDARGSEVRSESEE
                     TKGTSESSHFKTAEAGPAIV"
     exon            complement(1187532..1189033)
                     /number=1
     exon            complement(1189084..1189250)
                     /number=2
     exon            complement(1189314..1189405)
                     /number=3
     CDS             join(1192423..1192663,1192732..1193861)
                     /codon_start=1
                     /locus_tag="AO090005000456"
                     /note="fatty acid desaturase"
                     /old_locus_tag="AO070339000175"
                     /protein_id="BAE55519.1"
                     /transl_table=1
                     /translation="MSAKTADATQPRAGDIKKVHIADTAITRSNWHKHVNWLNVFLII
                     GIPMYGCVQALWVPLQLKTAIWAVIYYFFTGLGITAGYHRLWAHCSYSARLPLRIWLA
                     AVGGGAVEGSIRWWARDHRAHHRYTDTEKDPYSVRKGLLYSHLGWMVMKQNPKRIGRT
                     DISDLNEDPVVVWQHRNYLKVVFTMGLFVPMLVAGLGWGDWWGGFVYAGILRIFFVQQ
                     ATFCVNSLAHWLGDQPFDDRNSPRDHVITALVTLGEGYHNFHHEFPSDYRNAIEWHQY
                     DPTKWSIWIWKQLGLAYDLKQFRANEIEKGRVQQLQKKIDQKRAKLDWGVPLDQLPVM
                     EWDDYVEQAKNGRGLIAIAGVVHDVTDFIKDHPGGKAMINSGIGKDATAMFNGGVYYH
                     SNAAHNLLSTMRVGVIRGGCEVEIWKRSQKESTDYVRDSSGQRVIRAGEQVTKIPEPI
                     PTADAA"
     exon            1192423..1192663
                     /number=1
     exon            1192732..1193861
                     /number=2
     CDS             join(1194630..1196587,1196644..1196836)
                     /codon_start=1
                     /locus_tag="AO090005000457"
                     /note="metalloendopeptidase family - saccharolysin &
                     thimet oligopeptidase"
                     /old_locus_tag="AO070339000176"
                     /protein_id="BAE55520.1"
                     /transl_table=1
                     /translation="MAPEHYRRPPQAPPVFTATAQSIVDDAKRLIEASRKVQDEVVAN
                     VKPETATFDSVLKPLAHDENTMALEAHILSFYQAVSTEQQLRDASSKAEAELDEFFIE
                     TVMREDVFKLVDAVLNKNETLDPESRRLLEKEHKSYIRNGLGLPAGPKRDRFKEIKKR
                     LSQISIEFQKNLNEENEGLWFTPEELDGVPEDVLSGLKKGEGENAGKLWLTFKYPDLF
                     PTMKYAKNPETRKKVMIQNENKCNQNVPLFREAIVLRDEAARLLGYPNHAAFRIEDKM
                     AKTPETVDTFLGDLRSRLTAGGQKEIKSLLELKKNDIEARGETFDGKYYLWDHRFYDR
                     LMLEKNYSLDQQQIAEYFPLQTTIEGMLKIFEELFGLVFVEIIGDDRAKVAPSGKGSD
                     IVWHEDVQIFSVWNDEGEGSGFVGYLYLDLFPRSGKYGHAANFNLQPGFIDKDGKRRY
                     PATALVCNFTKPTPKKPSLLKHDEVVTLFHELGHGIHDLVAKTIYSRFHGTNTVRDFV
                     EAPSQMLENWCWTPSQLKSLSKHYSTLSPEYFAAWKEQAGDKPEPAEQIPDEVIANLI
                     RTKHVNDALFNLRQLHFGIFDMTVHEPKSHEDIEKLPISATYNQLRKQITQMDGPEIL
                     GLGDEWGHGEATFGHLIGGYDAGYYGYLSSQVYSTDMFYTVFKADPMNPTAGRRYRHQ
                     VLEKGGSQDEMTSLTEFLGREPKTDAFYKDMGLA"
     exon            1194630..1196587
                     /number=1
     exon            1196644..1196836
                     /number=2
     CDS             1197186..1197755
                     /codon_start=1
                     /locus_tag="AO090005000458"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000177"
                     /protein_id="BAE55521.1"
                     /transl_table=1
                     /translation="MSTPDPQLQPEDQSLQQEQPTIQNRLPVHTHHCRFCNHLLLATT
                     RDIPSLPRRKHPAKDKAIICPLPTSNTSEDTDSSNLQEHYTILLSTTIPDRKATLVRR
                     EDGFEKRLFLRCGRCRVVVGYFLDRVLFPMTSVAASASGGDGEGEEDERKEKVVYLLP
                     GALMETGVMGDEGRLKGVDDEWREWRVEV"
     exon            1197186..1197755
                     /number=1
     CDS             complement(join(1200713..1200741,1200801..1200893,
                     1200951..1201091,1201168..1201354))
                     /codon_start=1
                     /locus_tag="AO090005000459"
                     /note="calmodulin and related proteins (EF-Hand
                     superfamily)"
                     /old_locus_tag="AO070339000178"
                     /protein_id="BAE55522.1"
                     /transl_table=1
                     /translation="MTGSHNNHDDQASTNYKEAFSLFDKRGSGKVSLESLGDLLRACG
                     QNPTLAEIAELENGLGGDFDFESFVKVLNRPNGFRDPGEAEEYCRGFQVFDKDMTGFI
                     GVGQLRYILTNLGEKMSDEEVDELLKAVDTSSGEINYTDLVRTILAN"
     exon            complement(1200713..1200741)
                     /number=1
     exon            complement(1200801..1200893)
                     /number=2
     exon            complement(1200951..1201091)
                     /number=3
     exon            complement(1201168..1201354)
                     /number=4
     CDS             complement(join(1202284..1205105,1205176..1205370,
                     1206900..1207044))
                     /codon_start=1
                     /locus_tag="AO090005000460"
                     /note="Zn-finger"
                     /old_locus_tag="AO070339000179"
                     /protein_id="BAE55523.1"
                     /transl_table=1
                     /translation="MSPPRMIGTVSSIGGLSVTRFQTLTIMSRPFFRGSGIFGRLCAG
                     DSTYNQGPKGIRREREVEIMDNDTITVNGAPKKRKRVRKVNTDRKFECTHEGCGKSYS
                     RAEHLYRHQLNHTPKQIYRCDFPDCYRSFVRQDLCIRHRERHTTQGSQLQKRDHFAQA
                     ATNQPQSPHHVPHVSQATVVTPPSLPTQMSSAPSNVVVPISPSSSSSPSVGLNSVFSY
                     QHHILPSQNENTFPRSNSLSTHGKSSPPVPTSYSPPELHKTSYGSLSNHHPTNTSIGE
                     VHHDAQSHHPLSEPGQTPSTQSQGADGAYSSLPTDANGSSLADTVPFTSQAGMQMPVN
                     SYSGLSLAPAATSTPATLDQAANMGTLDAMSGMIAPGSTVGDPGFDSLANCVYPIFGS
                     ESYNRSPFAMAEDFTAWLFNEPVPGSSSMSYPAATGMVPNYMDPTQLPNQFLLGDPAY
                     GTFLSGVIPPHHPMSVTSILDPGSPRAIISEEKRQELLHLMATRFNEAAYSAVAKRKD
                     ALMDGDMDDDNHVLSLRMMQTYIGSYWYHFHSQLPILHRPTFFADQAPNLLLLIVIAI
                     GASTLDKIHGPELTEAASELADFIVWHLRWELFMDADFRPPAKLWVFQALLLLEVYEK
                     MYSTRALHERAHIHHDTTLTLMRRGSSLIGRSAFDSPASLRDDRQARSVSCSTTTQDF
                     SADESWTHWIKAEATRRVAFAAFVLDSTHATMFGHSAKMVAHELRLPLPCDEALWSAT
                     SAAEVARVQASLHANGVKPVMFLDGLKRTLNGQRVRTNAFGRTILMAGLLSVSWHMNQ
                     RDLQVSSLGVPQALGGRDKWRAALLRAFDNWRRDFDEALGQAGTPPPFPGYRVQHPLD
                     DDNVFESRDVLHGLAHMASHVDIVDCQILGGATRLMGRAITARDYNAAREKMTERWAT
                     KASARDATFYALKFLSECLLSGESEEGELYSGRDDYLLNRPWVIYVAALVVWCYGYAL
                     EGPIRSPPKLATVADQRRDMQEFLRRVGGVRSPNDLEAMEGRNQCLGLLMILRDGFVN
                     TRWELLAEAANLLSSCIEKLKGR"
     exon            complement(1202284..1205105)
                     /number=1
     exon            complement(1205176..1205370)
                     /number=2
     exon            complement(1206900..1207044)
                     /number=3
     CDS             complement(join(1209882..1209898,1211769..1212489,
                     1212597..1212869,1212907..1213014,1213105..1213236))
                     /codon_start=1
                     /locus_tag="AO090005000461"
                     /note="nuclear transport regulator"
                     /old_locus_tag="AO070339000180"
                     /protein_id="BAE55524.1"
                     /transl_table=1
                     /translation="MASKEGTAGQAFGPVLAAVATMQGNVSRTEKAHAHEFLEKFQKS
                     VEAWTITHELLQSPDVPVEAKLFAATTLKGKVKRSMIMFDLDQLPAESVPALRDSVMN
                     LLVAFASGPRPIQTQLCVCLASLAIQMTGWKDVLATVGSALGSNAGDCVLEFLRILPE
                     EVTEGRKINLSEDDLILRTKELLEDNAEQVMHLLIQYAQSSRMYTFLKAFTTHSIHIL
                     KFIPILATASTNPRLLDCITSWMREIPASKIVESPLLDVILKALDDDVSFEAAVESVC
                     TLYRDTREVDDSLPIIQTLYPRLMSLRPKIAEAAEAEDMDAFRGITRLFAEAGESWVV
                     LIARLPSDFRGLVEAVLECCARDWERDAVSLTFVFWYELKQYVTLERYADARVSYSDV
                     FSKLVDVMVKHLEYPRPEEVVPSS"
     exon            complement(1209882..1209898)
                     /number=1
     exon            complement(1211769..1212489)
                     /number=2
     exon            complement(1212597..1212869)
                     /number=3
     exon            complement(1212907..1213014)
                     /number=4
     exon            complement(1213105..1213236)
                     /number=5
     CDS             complement(join(1214276..1214397,1214457..1214966,
                     1215020..1215113))
                     /codon_start=1
                     /locus_tag="AO090005000463"
                     /note="5-formyltetrahydrofolate cyclo-ligase"
                     /old_locus_tag="AO070339000182"
                     /protein_id="BAE55525.1"
                     /transl_table=1
                     /translation="MMTGLQTAKKDLRRKMRDVLQKIPADSIINQSRIATSKLFSLTE
                     YQNAKRIGVYLSMPSGELSTTAIVQDALIDGKEVFIPYIHNVELPSTQQKTSIMDMLA
                     LNSMEEFNSLAPDKWGIPSLTKTQVDTRKNCLGGIGVSPSGADKTTDGDWGLDLIVMP
                     GMAFDREFRRLGHGKGYYDHFLTRYSKEVESKTTTPKMPLLVALSLKEQTLPSTEHIP
                     VANHDWPVDVLIVGDNRCFVRHH"
     exon            complement(1214276..1214397)
                     /number=1
     exon            complement(1214457..1214966)
                     /number=2
     exon            complement(1215020..1215113)
                     /number=3
     CDS             join(1215471..1215584,1215673..1215777,1215793..1216026,
                     1216086..1216376)
                     /codon_start=1
                     /locus_tag="AO090005000464"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000183"
                     /protein_id="BAE55526.1"
                     /transl_table=1
                     /translation="MLARYFSLSLLATAVSAASISDLVGTWSTKSRKVVTGPDFYDPI
                     NDKFLEPNLTGISYSFTEDGHYEEAYYRAYFTAHRMLLLSNMSGLCLAVNPSCPKGIM
                     QWQHGKFVLNSDGSLELTPIASDGRQLVSDPCSSSLATYTRYNQTETFNVSKDPYHGI
                     QRLDLKRFDDSPMHPMYLVYQPPQMLPTTTLNPVSETGKSKRHVARDTDRLPGVRNLI
                     TKEELTNPDRWLWVGVFATALGGITLFYS"
     exon            1215471..1215584
                     /number=1
     exon            1215673..1215777
                     /number=2
     exon            1215793..1216026
                     /number=3
     exon            1216086..1216376
                     /number=4
     CDS             join(1216432..1216472,1217842..1218158,1218213..1220687,
                     1220736..1220824,1220876..1221505,1221558..1222165,
                     1223618..1223678)
                     /codon_start=1
                     /locus_tag="AO090005000465"
                     /note="nuclear pore complex, Nup155 component (D Nup154,
                     sc Nup157/Nup170)"
                     /old_locus_tag="AO070339000184"
                     /protein_id="BAE55527.1"
                     /transl_table=1
                     /translation="MEFGKHVKWGCLVCRPSINLQASIMSYPNLPPALTPQRPLPGAF
                     FQTPGPNNVPSAPAFSPKPAPAPAEQPSPASLPKLPPAASKSKSQTLSTEERAARTVN
                     DTLTQEARYPDLDSYLSQGFSSDYDIPVSPSWAPFQKVKMYNIPDQIFDQYNRAQVST
                     SMGLFAELNHAWVAIDNALYIWDYTHPNPQLVGFEDQPNSINAVKLAKPRPGVFLPSI
                     THLLVVSTTADVILLGMGCETTATGARQVTLYQTGMSTSIRGLDIHVIASSDATGRIF
                     FGGSSDNDVYELTYQQEEKWFQGRCSKVNHTSSRLGALTPSLSFSSFTHKMFENVEQM
                     EIDDSRRLLYTLSSSSTIRVFHMKPDGTLALAITKPAMDIYANIGHIIASNETLNPKV
                     PIVSISPIPAAEASRYHLMATTATGYRIYLSATGSYSWSPSPNGTNAPTSMQAHHVKT
                     PPFDGGSASPMGPAFQGQGRFQPSVAKVPIHSLDPTRFTVRYPPGYFFCFTCKDPTQK
                     TDTLFVSSPDSGRVARSQENVIPGNASETAIWLSLGSRAEDVGLCSPSTAALATPGGF
                     GNELAVQFDNPAAEIAILTNTGIHIIRRRRLVDMFAALVRGGGDGDEGLEGEVKNFIR
                     TYGRSETLATALAVACGQGVEISADSRLTQINDPHVLEFARKVFIEYGGRPTMNENAV
                     ADNSTPAIDSVVPSPRHAGIALYMSRLLRTIWRKEIAKVGPSPGGAQTILPSVPSAKL
                     QTIQRDLSALQEFFKANKSFIEGLSGPEALARVSTKQEETALQAEHRALHSLVQLVSH
                     TIEGISFILVLFDERVDEIVATLPDDSKQRFMKLTFEELFSTSKGHDIAKELVKGIVN
                     RNIAKGSNVETVADALRRRCGSFCSAEDVVIFKAQELLKRATEAGSNSELGRNLLNES
                     LHLFQQVSESLPMDYLVSAVENFISNQFFAGAIQLALNVAARSDKANMALSWIVDGRP
                     ENDSRSDYFYFRKQCYDLIFKVIIAVDNLAAHDPGVVDGQLTVVAKRKNEAYGVISDS
                     VDEVFLTSLYDWYLEQGWSERLLHANSAFVVTYLERKSADDIAHADLLWRYYAQSERF
                     FEAAKVQFHLAQSAFTLPLGRRIEYLGRARANASTFTPDVGRQPRQRLLQDISNLIDL
                     ANIQDDLLQRLKDDKRLTSERRSQVLADVDGPIMDISTLFNQYADPASYYDICLQIFY
                     LADHRNPADIRSTWQHLLQDLHDETVENGEPQPYEAVIDKVRSLGSRLRMSEIIFPIP
                     TLLPMLERYALEHQRGVGPATWVVDLFLDLGVAHETLYTVLESMYYTDEAPFHGTNRK
                     YIAKDLLYLIEHWFHDTVRLGGTVFGSDVVAERITETLLLLQQGGNIPPEQLQLANEL
                     RTRVEDILRVVVVRCDRKREISSLLPSR"
     exon            1216432..1216472
                     /number=1
     exon            1217842..1218158
                     /number=2
     exon            1218213..1220687
                     /number=3
     exon            1220736..1220824
                     /number=4
     exon            1220876..1221505
                     /number=5
     exon            1221558..1222165
                     /number=6
     exon            1223618..1223678
                     /number=7
     CDS             complement(join(1229188..1229855,1229909..1230522,
                     1231365..1231426,1231966..1231992))
                     /codon_start=1
                     /locus_tag="AO090005000469"
                     /note="DNA damage inducible protein"
                     /old_locus_tag="AO070339000188"
                     /protein_id="BAE55528.1"
                     /transl_table=1
                     /translation="MSHATFLDDEEGNSRSSLQHERLPIQEVCVRITVSVIRPDQADA
                     DIISLEVGGDMTVELLKAIVESETSVPPSAQRIVYNNQLLGDDARTLEQVGIGEGDML
                     GVHVTLRSPQAPTRTAGGPSAPAAQQNLQRRQAMNPDPETIRLHILGDPRVREAVRRQ
                     NPELADAASDAQRFRDVFLNQQRREAQLEAEKEARIAMLNADPFNPENQRQIEEIIRQ
                     NAVTENLHNAMEHHPESFGRVTMLYIPVEVNGHKLNAFVDSGAQVTIMSPECATACNI
                     MRLVDQRYGGIAKGVGTANILGRVHSAQIKIGSMFLPCSFTVMEGKHIDLLLGLDMLR
                     RHQACIDLRRGALVIQDQAVPFLGEADIPKHLQDGFEDEPLVKGADGAEVGARTGAVT
                     HQAQGPGGASSSTAPPSRPAPAQSSRWPQDSIAKITELGFTREEAMRALDAANGDLDG
                     AIGFLI"
     exon            complement(1229188..1229855)
                     /number=1
     exon            complement(1229909..1230522)
                     /number=2
     exon            complement(1231365..1231426)
                     /number=3
     exon            complement(1231966..1231992)
                     /number=4
     CDS             join(1235924..1236130,1236181..1236264,1236316..1236391,
                     1236440..1236504,1236564..1236762,1236810..1237135,
                     1237183..1237240,1237291..1237384,1237435..1237622,
                     1237675..1237734,1237781..1238139)
                     /codon_start=1
                     /locus_tag="AO090005000471"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070339000190"
                     /protein_id="BAE55529.1"
                     /transl_table=1
                     /translation="MSTEKNPHIHDAVQSRELQQEVEFKNPGVKRIAAISSQLGIVAR
                     VFLFFGIFLVAYVYGLDGQLRVTYQPLATSSYAQHSLLTTINVLRNVIAAAAQPTAAK
                     IADVFGRVELILLSVFFYTIGTIVEACADNVETFCAGAVLYQIGYTTIILLVEVLVAD
                     MTSLRSRLLFSYIPATPFIINTWVSGDIASAVLGVTSWRWGIAMFAIIFPICTIPLFA
                     TLLVGHRKAKTASVETYQHPIRLLGAGKFAKELFWYLDVVGILLLIAFLALILVPFTI
                     ARSAAEQWKTAKILAPLIIGLFCLPLFVIWERSYARYPMVPFKLLKDRAVWGALGIAT
                     MLNLAWSLQGTYLYTVLQVAFDQSVLSATRISSLYSFASVITGCILGAIIVKVKQLKP
                     FIVAGTILFAVAFGILIQFRGGTGSSSYSGIIGGEILLGIAGGMFPYPAQASIQAATK
                     HEHLAVITGLYLAVYNIGSAIGGTISGAVWRQRMGKELTKHLGGANETLTDLAFGKPF
                     DFIVSYPVGTPEREAVILAYKEVQRILCITGICLTVPLIIFSLCIRNPRLTKDQSLPD
                     AEREE"
     exon            1235924..1236130
                     /number=1
     exon            1236181..1236264
                     /number=2
     exon            1236316..1236391
                     /number=3
     exon            1236440..1236504
                     /number=4
     exon            1236564..1236762
                     /number=5
     exon            1236810..1237135
                     /number=6
     exon            1237183..1237240
                     /number=7
     exon            1237291..1237384
                     /number=8
     exon            1237435..1237622
                     /number=9
     exon            1237675..1237734
                     /number=10
     exon            1237781..1238139
                     /number=11
     CDS             join(1241522..1241849,1241902..1242302)
                     /codon_start=1
                     /locus_tag="AO090005000472"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000191"
                     /protein_id="BAE55530.1"
                     /transl_table=1
                     /translation="MLPKAVLLSLLASMALGASEFPIPESAGTETFSEPQEIAAGETF
                     DGGLKTYGRGVECTGQDEGGDSDAVFILQEGATLKNAIIGADQIEGVHCEGACTIENV
                     WWEKVCEDALSLKKGSGPYKVIGGGAQGAEDKVIQHNAEGEVSIDGFVVSDFGKLFRS
                     CGNCDSQSQRSVTITNVKAYNGKKLAGVNENYGDVATITDTCATSVEDICTTYEATEG
                     SGEPSEIGSGPSDSCVYTDPLPAC"
     exon            1241522..1241849
                     /number=1
     exon            1241902..1242302
                     /number=2
     CDS             join(1243294..1243441,1243529..1244241)
                     /codon_start=1
                     /locus_tag="AO090005000473"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000192"
                     /protein_id="BAE55531.1"
                     /transl_table=1
                     /translation="MAPASELPKRDSDQLIPIRTQKKGPDDWKGLTDSKERRRRQNRI
                     NQRAYRQRKRAEKLGLPINAEGAESSTASSSSSSSSSQSPPTTALTTRSNCPTPDQTA
                     ALLDLFSKTAYQSYILGSPTSDHLLTLAKVNVFRAFASIMSTLGMPKHHEWMDDDAIS
                     PFTLLRPGFTTPSTIPLTLRPTKLQQSIPHHPWLDFFPHPRMRDNLIRAGDFDDEQLC
                     MDIMGFWDMSTESCGLLVWGDPQDLGNWEVSEEFIRKWPWVVGGCAELLVSTNRWRAM
                     RGEKLIFRYL"
     exon            1243294..1243441
                     /number=1
     exon            1243529..1244241
                     /number=2
     CDS             complement(join(1245161..1245445,1245496..1245779,
                     1245838..1246408))
                     /codon_start=1
                     /locus_tag="AO090005000474"
                     /note="voltage-gated shaker-like K+ channel, subunit
                     beta/KCNAB"
                     /old_locus_tag="AO080508000480"
                     /protein_id="BAE55532.1"
                     /transl_table=1
                     /translation="MGFPTAPKPKTLLGLHRILSPSAGVKVSPICLGGISIGNEWRFY
                     TGKNEEPFKLLDAFYDMGGNFIDTASNYNNQTSETLIGQWMEERGVRDQMVIATKYTA
                     GYRAFSEDPEPLQTNFTGNSAKSMHVSVRDSLKKLRTDYIDLLYVHWWDYATPVEEVM
                     RGLHVLVMQGKVLYLGISNTPAWIVVKANAYAKQHGLTPFSVYQGNWNAAFRDMEGDV
                     IPMCEDQDMAIVSYGSLGTGALLTVQQRKEREADPDAPMGSVSDIALKTSEVLEKIAD
                     RKGTTLQAIALAYLFHQSTFVFPIVGVNTVEHIKAMPDALKVKLSKEEIDDIHAASPY
                     SPGYPMTFTQYMQPVKYDLSWTPADNQQYQMSAWIDAPPKRLVGL"
     exon            complement(1245161..1245445)
                     /number=1
     exon            complement(1245496..1245779)
                     /number=2
     exon            complement(1245838..1246408)
                     /number=3
     CDS             complement(join(1247349..1248177,1248228..1249081,
                     1249137..1249146,1249200..1249936,1250006..1250071))
                     /codon_start=1
                     /locus_tag="AO090005000475"
                     /note="UDP-glucuronosyl and UDP-glucosyl transferase"
                     /old_locus_tag="AO070339000194"
                     /protein_id="BAE55533.1"
                     /transl_table=1
                     /translation="MISLHQTFLFLHNGFQTSPAVEHGTRYSCLAIPSLQSTNKIDDG
                     RIDVDLDSPAARTALKFIPRLGEDDIISPPPTYSRPVECDIKLNIVIHVVGSRGDVQP
                     FIALGNELQNHGHRVRLATHDVFDSFVRKSGLEFYPIGGDPAELMAFMVKNPGLIPNM
                     KSLKAGEISRKRVMVREMLEGCWKSCIEDDPRTGAPFVADAIIANPPSFAHVHCAQAL
                     GVPLHLMFTMPWSSTSEYPHPLANLKYSGNNASFANAVSYGVVEWMTWQGLGDGRALC
                     RHLKYRSHIAGRQPWYPSRRIGRLTSVISSNPSLLCPTKCLDVCGFFFRELPIYTPSS
                     ELDAFLRDGPPPVYIGFGSIVIDDPPRLTSILEEAVRAVGVRAIISRGWSKLGGSSSK
                     DILYIGDCPHEWLFQNVSAVVHHGGAGTTACSLRFGKPTAIVLFFGDQPFWGKMIAAS
                     GAGPEPIPQKSLTAENLAEAIQYCLTPQAKEAAKDISNKMQYEAGVKAAVESFHRNLP
                     LDRMRCQVIPDQPASWIYKKSAKPVFLSKLAAQILLDHLRIESKNLQSHEIRPIIITN
                     RRYDPITSTTSATIGYGTDMLRATSDMFLKPYQELKSRSNTTTPAATNTEDPLSKVDS
                     QTTTASGKNKVDWDATGAAIGAGAAGFGKFMKHVYKGVIVDIPLAATEGLRAVPRLYG
                     EEVEDYAVRDWKSGAIAGGKNFTQGMREGFTDIFTQTHKGAKEEGAVGMAKGFLKGTL
                     SIGTKVPSGRLVLSFLKKLADPWIAALGLVAYPAHGITKSLHTVIRSKTRKQIVQARL
                     REGQYIARKVAKPGIDHALVMQTFDALKNADTS"
     exon            complement(1247349..1248177)
                     /number=1
     exon            complement(1248228..1249081)
                     /number=2
     exon            complement(1249137..1249146)
                     /number=3
     exon            complement(1249200..1249936)
                     /number=4
     exon            complement(1250006..1250071)
                     /number=5
     CDS             complement(join(1251399..1251499,1251623..1252132,
                     1252186..1252359,1252463..1252518,1252625..1252800,
                     1252947..1253345))
                     /codon_start=1
                     /locus_tag="AO090005000476"
                     /note="beta-xylosidase"
                     /old_locus_tag="AO070339000195"
                     /protein_id="BAE55534.1"
                     /transl_table=1
                     /translation="MYNNPIIPGFNPDPSIIRVKNDFFLVTSSFEYFPGAPIYHSTDL
                     IRWTLIGHALTRRSQIHIQTPEPGGGVWATTLRYHDGVYYIIAASFERYRPQDDDRVW
                     PRGFYVKTENIWDSGSWSDPVFFDQVGFDQDTSPSISPLLILLAVLPPQNRSSSESLP
                     LVSRRDRIYLSAENTIIFLLPKGAQKAAIVNGLGRRCTGKMVGCFAGCSTGRETFLIP
                     VEWKDDWPIFNRGKKISLQSDTPHLYEYQHPVAWRDDFSSPELQLGWYRKNTPMRTDY
                     SLTERPNHLRLHGGPYNLSVPSCPTLFLRKQIHHYCTWETKLSFSPESQHTEAGTVVW
                     WNYFTYSSIGIRLSPTKEGARIVRFRPAEGEVIDRELRSAVSDVVFFIECGDQYRFGF
                     KEVNGTSSETQWIGEVQNSTMTQSPPVGAPFTGMMLGLYAFGERQRCVLFGIILLQSH
                     HQSYCIHHRSHSSSEINDIKC"
     exon            complement(1251399..1251499)
                     /number=1
     exon            complement(1251623..1252132)
                     /number=2
     exon            complement(1252186..1252359)
                     /number=3
     exon            complement(1252463..1252518)
                     /number=4
     exon            complement(1252625..1252800)
                     /number=5
     exon            complement(1252947..1253345)
                     /number=6
     CDS             join(1254996..1255309,1255407..1255428,1255875..1255991)
                     /codon_start=1
                     /locus_tag="AO090005000477"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000196"
                     /protein_id="BAE55535.1"
                     /transl_table=1
                     /translation="MEPNDVFLRAFFHACFTGDLSQTQKAIATGRLTAEDLNKGLKRA
                     THSAHPDIVAALFDAGASVSTSTIASLPGPNLQQQPSVVRHFLDHGLDPNSRLSTGEP
                     LLPMLRNPASARLHLDYAPCLEGGIASYFSASSKGDKQKDLRRITSAT"
     exon            1254996..1255309
                     /number=1
     exon            1255407..1255428
                     /number=2
     exon            1255875..1255991
                     /number=3
     CDS             1259984..1260421
                     /codon_start=1
                     /locus_tag="AO090005000478"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000197"
                     /protein_id="BAE55536.1"
                     /transl_table=1
                     /translation="MPIQIRYATESDSPDLVHINTVSFAPGLFYQNAFANVKVSALQT
                     LKYARTFARFVDPKYHLLVATESETGRVIAFMRVVIPLHYQQDSHSLTELSEDANKMA
                     AKPDEYLPEGINKRVYTCYLDMLKSSRERYLGENDMSTYSSCP"
     exon            1259984..1260421
                     /number=1
     CDS             join(1265026..1265391,1265459..1265832,1265895..1266561,
                     1266619..1267296)
                     /codon_start=1
                     /locus_tag="AO090005000479"
                     /note="acyl-CoA oxidase"
                     /old_locus_tag="AO070339000198"
                     /protein_id="BAE55537.1"
                     /transl_table=1
                     /translation="MPSPPPAWVQALKPAGPQGSELLAQERAQSNVDVDKLAELLHTK
                     KALDRQQQILSILESDKVFDKSENYTLGRTEKIQRALAKAKRLQQLAVQHKWSQDDYY
                     MANELLSEPTPYGLHASMFLVTLREQTTPEQKKLFLEPASKYEIIGCYAQTELGHGSN
                     VRGLETTATWNPDDKTFTIHSPTLTASKWWIGSLGRTANHAVVMAQLFIGGKNYGPHP
                     FVVQIRDLQTHQPLENIYVGDIGPKFGYNTMDNGFLLFNKVKIPHVNMLARFSSVDKE
                     TNKYLRPASHSLLYGTMTWVRSNIVLQAGSVLARGVTIATRYCAVRRQFQDRDGGKDA
                     GENQVLNYKMVQIRLLPLLASMYALHFTGRGMMRLYEENQKRMKGAVEAGQDKRGAGP
                     EQLRAGADLLADLHATSCGLKALASTTAGEGLEICRRACGGHGYSNYSGIGPWYADYL
                     PTLTWEGDNYMLTQQVARYLLKSARAVLAGKGTNNDTSQILQTYLSRREKGASFDILE
                     EDKDIVAAFAWRTAHLTFEALKRRDVEKRSWNSLLVDFWRLSTAHSQYLVVKNFYEAV
                     TSPQLTSELDPETVTLMHKLFRLYSLHTLEREAGEFFSSSAVTTRQISLAQSNAVMKL
                     LDEIRPHAVRLVDAWKFPDWQLDSSLGRYDGEVYPDLFRRASQNPVNDLVFDPYPWNE
                     NVLKNSAPKSKL"
     exon            1265026..1265391
                     /number=1
     exon            1265459..1265832
                     /number=2
     exon            1265895..1266561
                     /number=3
     exon            1266619..1267296
                     /number=4
     CDS             complement(join(1267828..1268123,1268213..1268407,
                     1268477..1268590,1268642..1268782,1268840..1268918,
                     1268975..1269136))
                     /codon_start=1
                     /locus_tag="AO090005000480"
                     /note="predicted oxidoreductases (related to aryl-alcohol
                     dehydrogenases)"
                     /old_locus_tag="AO070339000199"
                     /protein_id="BAE55538.1"
                     /transl_table=1
                     /translation="MVKTLPFAANLEVPTPGFGAMGLSFGLGSNLSLEEAEPVLLKAI
                     ELGCTFWDTAVVYQAGVNEKLLGDFIRKHNVRDKVFIASKCGFNVFGDGSVTNSAAHI
                     KEYIEGTIQRLGFTPDLYYLHRIDPKTPLEESIPALDEIRKAGKTKYIGLSECSAATL
                     RKANSIAKIDAIQAEYSAFETLHETDGLIDTARELNIAYVAYSPLGHGWLVDNFPYKT
                     PDDFAPDDFRRKSPKFQGENFYKNRAIVDEIKKLAARKGCAISQIALAWVAAQGFIAI
                     PGTTKAGRLEENWASREIELTEEEKLEMRRIIDAAKPHGNRYGPAHQAMVGH"
     exon            complement(1267828..1268123)
                     /number=1
     exon            complement(1268213..1268407)
                     /number=2
     exon            complement(1268477..1268590)
                     /number=3
     exon            complement(1268642..1268782)
                     /number=4
     exon            complement(1268840..1268918)
                     /number=5
     exon            complement(1268975..1269136)
                     /number=6
     CDS             complement(join(1270349..1271443,1271496..1271663))
                     /codon_start=1
                     /locus_tag="AO090005000481"
                     /note="NADH:flavin oxidoreductase/12-oxophytodienoate
                     reductase"
                     /old_locus_tag="AO070339000200"
                     /protein_id="BAE55539.1"
                     /transl_table=1
                     /translation="MHTPDYVEPAQGISYFTPAQNPPAGTAANPQTNGQKVPKLFQPF
                     TVRGVTFQNRLGLAPLCQYSAEDGHMTDWHVAHLGGIAQRGPGLMMIEATAVQPEGRI
                     TPQDVGLWKDSHIAPMKRVIEFVHSQGQKIGVQIAHAGRKASTIPPWMSGAVVASEQA
                     GGWPENVKGPSDIPFADSFPKPKAMTKADIEEFKNAWAAACKRAIAAGADFIEIHNAH
                     GYLLSSFLSPASNNRTDEYGGSFENRIRLPLEIAQLTRDTVGPDVPVFLRVSASDWLE
                     EVLPEQSFNVNETVKFAQALVAQGAVDLIDISSGGVHAAQKVKSGPGFQVPFAVAVKK
                     AVGDKMLVSAVGAITNGKQANQLLEEEGIDVALVGRGFQKDPGLAWTFAQHLDTEISM
                     ANQIRWGFTRRGGTPYIDPSVYKPSIFD"
     exon            complement(1270349..1271443)
                     /number=1
     exon            complement(1271496..1271663)
                     /number=2
     CDS             join(1272652..1272760,1272818..1273034,1273085..1273147,
                     1273203..1274727)
                     /codon_start=1
                     /locus_tag="AO090005000482"
                     /note="very-long-chain acyl-CoA dehydrogenase"
                     /old_locus_tag="AO070339000201"
                     /protein_id="BAE55540.1"
                     /transl_table=1
                     /translation="MESGPRHATVDRGHITKPERLENTYTSDTSLQRALSWYLPAQKL
                     EQAQPQLVELGEEAISDQIREWSADAERHQPYVKGFNVWGQRYDYDRLITSEGWKQLG
                     KWGARHGVVSLGYEPTYGAERRLVQYTVNYLYSPSSGLYSCPVSMSDGAALVLNQERK
                     NVAADHPFQTAYQKLISKKEDYWTSGQWMTERAGGSDVQNTETWATYSPLSHKSKASN
                     GLDEGDYLINGFKFFSSATDANIALMLAKTPSGKLSTFLAPLRKTIVGEDGKPRVVTN
                     GVRIHRLKNKLGTKELPTAELELKDMRAHLVGTVDHGVMAIAPLLNITRTHTFIGSLA
                     AWRRAISITKSFAKARTTVGEPLWLIPMHLSLLADLEVKHRGAMNLAFFTVAVMGVVE
                     NNGVSTPAAHLPTKGKEAQVVFRALTAIAKAVISKNAIAGIQECQEGMGGVGYMDEPD
                     EPEFNIARLLRNTAVNSIWEGTTNVLASELVRFLVKRDNLTIFSAWFERTLALITTPE
                     FASALKQIWSDFLSRTKATSEPRFILADARRVMFTLAWILCGALLALDAERDGDGVTT
                     EIARRWILSGEGGVGDMVWRDIISVQRTASAGPSSITNEHLRWDCRIAWGVELPAKQV
                     SGHRSFQGTGSKL"
     exon            1272652..1272760
                     /number=1
     exon            1272818..1273034
                     /number=2
     exon            1273085..1273147
                     /number=3
     exon            1273203..1274727
                     /number=4
     CDS             join(1275772..1275852,1275928..1275962,1276020..1276079,
                     1276140..1276146,1276197..1276241,1276297..1276470,
                     1276514..1276578,1276630..1276984,1277051..1277284)
                     /codon_start=1
                     /locus_tag="AO090005000483"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000202"
                     /protein_id="BAE55541.1"
                     /transl_table=1
                     /translation="MTSWQDERQQLAVPELQILAMDPVQVDDEAFEDSIYNDSSRLNS
                     ASFVTSLNSSILNYKYENGRRYHAFREGTYLVPNDEEEQDRMDLAHHVYRLLLGGPLH
                     LAPIKNDVQRVLDLGTGTGIWAIDFAEYVHGIDPSEHPSAQVIGTDLSPIQPRWVPPT
                     CSFEIDDFECDWLYTRPFDFIHARELEGCIGNDLKFFKQAFKHLVPGGYFEVQAVTSP
                     FLSDDDTLDKAPNAQEWMDNLVKGLRKFGKPADNVPGWKDKLKDAGFIDVHQEIRKLP
                     IGPWPKDPKLKEIGKYQGVQELQVIDSYTPAIFSRILGWSHEEIQILIAKVKRELRDP
                     SIHLYLPVYFIYGRKPV"
     exon            1275772..1275852
                     /number=1
     exon            1275928..1275962
                     /number=2
     exon            1276020..1276079
                     /number=3
     exon            1276140..1276146
                     /number=4
     exon            1276197..1276241
                     /number=5
     exon            1276297..1276470
                     /number=6
     exon            1276514..1276578
                     /number=7
     exon            1276630..1276984
                     /number=8
     exon            1277051..1277284
                     /number=9
     CDS             1279366..1281069
                     /codon_start=1
                     /locus_tag="AO090005000484"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070339000203"
                     /protein_id="BAE55542.1"
                     /transl_table=1
                     /translation="MGDLPEWKVGGEKLKGRALNWSIGFIASCGFLMFGYDQGVLSAL
                     LTLDSFQEVLPLMTPRDKSNDLCWLDNPTNTIPNPTYCTGDANTQAAGVAIYQIGCWM
                     GSLVILAYGERWGRKSSTFWGSLIMIIGTIMQAACFDYGLFVAGRVVGGIGNGMVTSS
                     EYFIKVSSTYNDPDRAAIPTWQSECARPHQRGVLIMLSGALISAGVMIAYWVDYGFYF
                     LTGSVRWRFPLMFQSFFTIIVMIGLLYLPDSPRWLTMQGRHAEARDVTARLVGKVEDH
                     PDVEEELRSINEALEVQSRGGSFKYRELLTNGPSQNLRRSTLAMVSQFFQQMCGINLV
                     TYYATAIFENSLGFGPEMARLLAACNGTEYFMASLIALPLIERTGRRKLMIIGAFGMM
                     VSMAILAGTVSTGEIMENGAPKLETQYGVTATVFLFVFNSFFAIGWLGMTWLYPAEIT
                     NLRIRIQANALSTSSNWMSNFLIVMITPPAFANLGYQTYIIFAVFNAALIPCVYLFFP
                     ETKGRTLEELDVVFASANAQGISPVKQSLQMPKLAGDSLDRELARYFGTSSDEETSRE
                     K"
     exon            1279366..1281069
                     /number=1
     CDS             complement(join(1281903..1281979,1282053..1282130,
                     1282403..1282643))
                     /codon_start=1
                     /locus_tag="AO090005000485"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000204"
                     /protein_id="BAE55543.1"
                     /transl_table=1
                     /translation="MHKNAQQNEIFQDTYNRQPKGTPITPKTQSPCKTPPSPYHLEKQ
                     SISSAPPTTLHNLSNTPLDTKPQIIRPITITITITQYAGIYRETITVAVERNQNSTNK
                     PISPDLLLRLLLARKGDFLAGGGNTEEEG"
     exon            complement(1281903..1281979)
                     /number=1
     exon            complement(1282053..1282130)
                     /number=2
     exon            complement(1282403..1282643)
                     /number=3
     CDS             join(1283560..1283605,1283718..1283835,1284375..1284530,
                     1284679..1284754,1284859..1284876)
                     /codon_start=1
                     /locus_tag="AO090005000486"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000205"
                     /protein_id="BAE55544.1"
                     /transl_table=1
                     /translation="MGPAEWAATIFSLESREDLPRVSCLSETRTGRAQDVSLARWVAI
                     APAASRVFDRRVNVDSLRNVSRFLDIYGPAVGAEREDTGKPLQLTFPSLVYAYRLLVE
                     GRISKDPGIIQLPELEKPDRNLFSLWADQKAPPRR"
     exon            1283560..1283605
                     /number=1
     exon            1283718..1283835
                     /number=2
     exon            1284375..1284530
                     /number=3
     exon            1284679..1284754
                     /number=4
     exon            1284859..1284876
                     /number=5
     CDS             join(1288324..1288609,1288678..1288876,1288993..1289512,
                     1289566..1290057,1290111..1290371)
                     /codon_start=1
                     /locus_tag="AO090005000488"
                     /note="predicted protein"
                     /old_locus_tag="AO070339000207"
                     /protein_id="BAE55545.1"
                     /transl_table=1
                     /translation="MASHPGQPSIDPENPPSQSECPTQPPTGHSDHDAANYPFYKRNA
                     CTTCRRMKSKCDMAKPACGTCSRFNRTCAYETTRKKSGPKRGYTAVFGSRLAQVEALL
                     SAQMPSILGSQNPSAPLPGAWVDRASHPNLSSTGSFQDTMEETDPTASSTERAYTEPS
                     VGYRIYFEDVHIYMPIIHRQRHLSALNYAPDSRPPVCLQYMIWCHAALVSEKYDTLHT
                     AFYERARKYAEADEMKGYGGGILSLAHAQTWLLITAYEYKMMFFPRAWLSCGKACRLA
                     IMLGLHHLDSPSPQIKQCFTPSIDWVEKEERRRVFWTTFCIDKFATIGTGWPVGINET
                     EAMTNLPASEEAFITGESEPTVPLSDVLDGEGLSTLSPSASIAFVSCIFGRITNHLRL
                     PQSQDDDDYSTGGFWQRHRSCDEILLHFALTMPTHLRLPIGIGDPNIIFCNIALHTAV
                     ICLHQAAIFKAEWNNITEYPIVQSRLRCSAAAHQILEVIKMVGPVNMGKVNPFVSFCL