LOCUS       AP007150             1913118 bp    DNA     linear   PLN 16-DEC-2016
DEFINITION  Aspergillus oryzae RIB40 DNA, SC009.
ACCESSION   AP007150
VERSION     AP007150.1
DBLINK      BioProject:PRJNA20809
            BioSample:SAMD00067075
KEYWORDS    .
SOURCE      Aspergillus oryzae RIB40
  ORGANISM  Aspergillus oryzae RIB40
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Eurotiomycetes; Eurotiomycetidae; Eurotiales; Aspergillaceae;
            Aspergillus.
REFERENCE   1  (bases 1 to 1913118)
  AUTHORS   Sawano,T., Tanaka,T., Machida,M. and Yamada,O.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-JUN-2004) to the DDBJ/EMBL/GenBank databases.
            Contact:Toshihiko Sawano
            National Institute of Technology and Evaluation, Genome Analysis
            Center, Department Of Biotechnology; 2-49-10 Nishihara,
            Shibuya-ku, Tokyo 151-0066, Japan
REFERENCE   2
  AUTHORS   Machida,M., Asai,K., Sano,M., Tanaka,T., Kumagai,T., Terai,G.,
            Kusumoto,K., Arima,T., Akita,O., Kashiwagi,Y., Abe,K., Gomi,K.,
            Horiuchi,H., Kitamoto,K., Kobayashi,T., Takeuchi,M., Denning,D.W.,
            Galagan,J.E., Nierman,W.C., Yu,J., Archer,D.B., Bennett,J.W.,
            Bhatnagar,D., Cleveland,T.E., Fedorova,N.D., Gotoh,O.,
            Horikawa,H., Hosoyama,A., Ichinomiya,M., Igarashi,R., Iwashita,K.,
            Juvvadi,P.R., Kato,M., Kato,Y., Kin,T., Kokubun,A., Maeda,H.,
            Maeyama,N., Maruyama,J., Nagasaki,H., Nakajima,T., Oda,K.,
            Okada,K., Paulsen,I., Sakamoto,K., Sawano,T., Takahashi,M.,
            Takase,K., Terabayashi,Y., Wortman,J., Yamada,O., Yamagata,Y.,
            Anazawa,H., Hata,Y., Koide,Y., Komori,T., Koyama,Y., Minetoki,T.,
            Suharnan,S., Tanaka,A., Isono,K., Kuhara,S., Ogasawara,N. and
            Kikuchi,H.
  TITLE     Genome sequencing and analysis of Aspergillus oryzae
  JOURNAL   Nature 438, 1157-1161 (2005)
COMMENT     URL:http://www.bio.nite.go.jp/dogan/Top
FEATURES             Location/Qualifiers
     source          1..1913118
                     /db_xref="taxon:510516"
                     /mol_type="genomic DNA"
                     /note="SC009"
                     /note="phrap>=30:1-1912899"
                     /organism="Aspergillus oryzae RIB40"
                     /strain="RIB 40"
     repeat_region   1..23
                     /note="I left telomeric region"
                     /rpt_family="Telomeric Region"
     CDS             882..5162
                     /codon_start=1
                     /locus_tag="AO090009000001"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000460"
                     /protein_id="BAE54527.1"
                     /transl_table=1
                     /translation="MARRGRPPRYANRDERNAERRRRRREQGASQIPPPPEAQLHHRF
                     LTWITTEEGDIHPDVVESRDIFQDLEQLVLDGGEFAEGAGDAEGEDDMDIDGDMGDVP
                     DSDVEMGDVERVSRRSAEGTPHEDPSAAGSPSLSGPAGRFPNTAEAEGQPVSTQPTAE
                     TATHWSHGPRVASPAVPLPPEDSARQEVLAEHLVKQLIRHRGCGHSQEEPGPIPEDQA
                     GPRSPPAVPTVRLSEVVQEEYPDVLSRDGIAAYRPAWDEYFPVDRRRRLFSGVETIHA
                     EDGGPGELQGIQPERTPPPQLDLEQDSDTAGRTFQVHFDIDSAGGFASSLAVARQGLY
                     WVGVRPPVSNLTGSLHLDGVPVQFQDGDSGRWRRDRRPVHRIPHLPLGRVCGFEAVEI
                     YILFPRLYHPTRKSFVITKDEYTLWMDEVFLPALHATYSESILQNLPVSAADAQARAT
                     AASAEQPMEHDKRPRVQLLQYGLRPELLDSLWQGVCARIEGQGLAQFRGMKLLLTCKN
                     LKSRTQGPSWAAAQARFFAIWSEAVDVDFLTDDFYDIGREAILPQSRPAGEAGPPATF
                     LSWRRCCLEGFSHWLEEVAATVEGGALSTAPDPIGVTTGPSQRAVRPTTRQQARPQGP
                     PVSDHESDGDVEYTPAEADREGTGAVGEGPRPAKVRRRWRQEMYPFSLTRAMATLTIE
                     PTRRSGLRKLGYLYSQHYNSGKALFAAGNHYVFSNPALDTLALDEGLIRAWQHVGRAV
                     SHSPMALLRAYRYTKHRCHMALADSGHRAYGVREEYRVSGGLLRAVDRRMWAQGLAGQ
                     ELHVPQASADPSTDPAPPHLPFFCHRTDLMLRWLRWNINKFCLGFEMVYGLRPRTMVQ
                     WEHTRVMMMFLRCLLFAFGGQGAHPRRCNGLWLDRRVRPAADGSERERIDEGLGMEQA
                     LEQYGYAWLPDHKIDWASMTFRPPHRAHMSLNTPTLLAAYHSHYRAVLSTHSDFLLFH
                     DVFARMYSLREDRPRSALLLQLLVDLCLRAFRKDVFAVLAERSGTTQPVHRRQMEAAL
                     AGEVPLTVLGLRRVFQRRPLGDDFRFVESRSAKVHHIEVLFAWLWGWQGDGNNGDCNR
                     THWEKKPYRTYMRQCFDTIAQVYGLRQAREWRTTLQRTFIRTHWVLPYPSDRSFWSRA
                     TGTPGGNRFQTWLSVHPGLVEYYRATEPTDPAVRQSVVITPQDVPYLPVSGWQRAQSP
                     MPLDIALPPIPTDLDAYLAAVADPAGPDTDLDIPLPAIGVLDGPIQQYILDHTPEKRI
                     LRSYQREETTAVSSIHSDSKWLIAHLENQVRVLRDAYLQRQRDLSIPFWRRVDSESPQ
                     YLFTAPAKVLEEDSDSENIRNKRTRAEKKHCRYEKDLRDTHRLVQEFMDLRQEMKIIK
                     KTIPGAVSPAESKQELVKKHKVVHERANQIRKKLVVISKRVIEEPVEL"
     exon            882..5162
                     /number=1
     CDS             complement(join(9683..11014,11021..13136,13212..14221))
                     /codon_start=1
                     /locus_tag="AO090009000002"
                     /note="superfamily II DNA helicase"
                     /old_locus_tag="AO070342000459"
                     /protein_id="BAE54528.1"
                     /transl_table=1
                     /translation="MRNHWRTVHGWSQHARGGRTTREQRQSQEAELRRSYMIVTCQQI
                     FPSRRGSHYIHIRGGQQKEPYIPVRTEQVNQAIQQVTAAWEAMKTQTGPSGTGEIHDA
                     NSWLRVTGWTRYLQEFTTPSDFDALRAMVATPLPDADDPVEQGVWRMWVAMEGVVRKS
                     QWTVQHTGQAIRIEAVRSAKGQTPYRPLLAYMDPDSVVKHMQPWQQILAFIARTQVPR
                     TEKHPPYGMTPRQRKKWRQLWQMATAHSPTAENDKEDSGEDDPEPPQWRMSDMERACL
                     EFCIELMNQTYHAQEYESVLICAMAVLGRGEFGWRDPESYPPILSRVIKIARFMIVQK
                     ALCAAAMDDIEADSAYGSGVEDEPPSSPPTSPMRNGDPASRIPWSQTPSRKTFQEQVT
                     WMVSQLMVRGTHTPMETLQDWRTYGLRIHYNTTTPGHVTWMHPDRLLYKHMQFTMGDF
                     RGFVHGLTGVTRQILCQELMFGKTPAIPWHALYDDPTQGAVGWSFLRDQRTAWPVEGA
                     QWIMERVRAEPDVQAHFIHRRQPTQFQPRLVMQYLQRVARFKEKLAVLVHVVGGQPSR
                     APELLSLQYINTETNQRRNIFIEDGMVTLVSAYHKGFYASNDVKVISRYVPREVGELI
                     IWYLWLVLPFVQQLEAWHRCPAGESSEPPSGPTIPPTTSPSKPPPASTSPYIWGPDPG
                     TQREWKSERFREVLKRETKMRLQYAVNIQAYREIAIGISRRWMRPSSAFPSNVQEEKA
                     PEVPPECDMDEDQWMEAIADEQATHSPHTAGMIYARDIMEQPGTTARRRAMFRLSSTD
                     WHRFLGFAADGAPVEAAGKRKRSPWEDEAEQGRVMRRHRLNTMDMTSALQQMTGQAAI
                     QFRGVQAPALRAIQDGESPVVAVMPTGGGKSMLFMLPTFAEPSGTTIVVVPLISLRGD
                     MMRRCQGLGIACVSWESRRPPDDATIVLVTPESAVTDDFHTFINRLQQTRRLDRIVID
                     ECHVVLHDQRDFRPELRQLGRLNHARTQMVLLTATLPPTLEPSLLQRMEYQTDQVRVL
                     RDRTGRPNVAYRRVPGGLMWFTRAPVLAFIRERIQRAGRGKVIIYANAIRQVRELAQI
                     LQCEAYYSQQIDKPSILQRFTQGQTQVITATSALGMGVDIPDIRCIIHIGIPRTLLDY
                     AQESGRAGRDGQPSEAIIIQPDGPVEGDEPVQDYMDVVPGVGCRRYVLDGYLDGPVDG
                     YERRYCRDENAEEMRCNGCNPNWQLPSSSGCSAHADCTDHSDRAHRAHRAGHSDNRGP
                     RANPRPSTPEDSRDSPRNGSIVSQAPLVPIGERQRQRVQAQRQAAPDIQQRIQDAEQW
                     LDEELVEQDTPQWRRTCYICTIQGHGWNEYDLYSCRSLASRAARDWMLFIRSLKIQYP
                     PYSACWGCGMPQSMCPRWKTRDWTNCEYRDVIIPMVAAMLYGPWASRVQPLWARRLQG
                     FGVDWQDLPQVKRFFGQATAGAKGQHSHLFASFCWLRRIYIELEQCQRD"
     exon            complement(9683..11014)
                     /number=1
     exon            complement(11021..13136)
                     /number=2
     exon            complement(13212..14221)
                     /number=3
     CDS             complement(15692..18301)
                     /codon_start=1
                     /locus_tag="AO090009000003"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000458"
                     /protein_id="BAE54529.1"
                     /transl_table=1
                     /translation="MDLFMYNETYCLWICTSCHYAVTPQHLDRHLRTHHRQHPSVKTA
                     ELRQAVLTEMLKKPWIEPRKEPSRFPSPDSPPIPHLPIYSGLRCPRCSYIGRSSNTLR
                     NHLSHSHPDTRRPRGRDCHQKPDLAATAEYVSCQRFYIAGTASHFFAVMPASQTERIQ
                     KAAQMSKAEFIQSQINQAYEQDQQAQAIQQQSIPIEKHSSEVSPWMELTRWPEYLQGQ
                     NLVSVAPLGSMPDSEKEPLLAVFVQSVERLIHRAYQTIASHRINEFDQIQINTFFRRP
                     GVWNRPIQIHLRPSTYRQYRQVWQRLICFAYRSSRPDQPIVLRHQLTTAQLAALDQME
                     EYGTRLLDQPADSRSEARYLTQTLEDQLDEACLALSIALLDHSLKGDLFESTVVGFLA
                     ILGINTDCSNFRDPNYYTTYLSALVKIAQMLVAERAVEMADHGEVGHPADALDEMRER
                     FLLYGVRAPFGWITRLRTYGKKIQNTTTSLGYIYWSDDEQTLSYKELQLSMKGFRQFT
                     ATQVQLAQDELEQLFLLHPEEIREEMIPSLPLRELQDDPTNNQRGWNFLHDPRNQATL
                     SQAMFTTHGRHRGAAERWLLDRVLTLDWLREEFLDVRQSDSQVIWQKPHVDHYLKQVE
                     AFLQRLLLLIHITGGQPGRATELLSLRHSNTVHGRHRNIFIEHGLVSTVTTYHKGYSI
                     SNTTKIIHRYLPKPVSELVVYYLWLILPFCQALQRQAFQDTSIPSAFLWPSGEGCWDS
                     SRLRMVLQREAKTHLQTKMNITSYRHAAIAISRVHLQCGGFKRDYGADDTTVDHQASH
                     GSWVAGTVYARGLQEAPGHIEARRRQYRTISRKWHSFLGFETYLGPRKRSAENTDELP
                     RKRQYIMLEMDRD"
     exon            complement(15692..18301)
                     /number=1
     CDS             join(23306..24452,24512..25194,25306..27310,27387..27898)
                     /codon_start=1
                     /locus_tag="AO090009000006"
                     /note="pleiotropic drug resistance proteins (PDR1-15),
                     ABC superfamily"
                     /old_locus_tag="AO070342000455"
                     /protein_id="BAE54530.1"
                     /transl_table=1
                     /translation="MENPANDPLNSGAPTECGEYDKDADTEKETLTVPEIRGAASAET
                     LIVPGTSNAVSTETIASPNCSDIISTPKNDPGWGMTDHVISTREREEAAGYKPRQLGI
                     TWQNLTVEVPSAETAVNENVISQFNIPRVIGDFLRKPPLKSILQGSHGCVKPGEMLLV
                     LGRPGSGCTTLLKLLANMRRGYYNITGDIRFGSMSSDEAQKYRGQIVMNTEEELFYPR
                     LTVGQTMDFAARLKIPFHLPDGTKSNADYTAETTKFLLEAMKISHTVDTKVGNEYVRG
                     VSGGERKRVSIIECMATRGSIYTWDNSTRGLDASTALEWAKALRAMTDVLGLSTVVTL
                     YQAGNGIYNLFDKVLVLDEGRQIYYGPAAAAKRFMQDLGFVYTDGANVGDFLTGVTVP
                     TERQIRPGYESRFPQNADAILAEYKNSPVYQHMVAEYDYPNSDIAHQRTEDFKESIAW
                     EKSKYLPKNSPLTISFWSQVEACTIRQYQILWGDKSTFLAKQILSTIMALIAGSCFYD
                     SPPTSLGLFTKGGAVFFALLYNCIVAMSEVTESFKGRPVLLKHKSFAMYHPAAFCLAQ
                     IAADFPVLLIQCSVFSIVIYWMSGLRHTAAAFWTFWVILFTVTLCITALFRCIGAGFS
                     TFEAASKVSGTAVKAIVMYAGYMIPKGQVKNWFLELYYTNPFAYAFQAALTNEFHDET
                     IPCVGNNLVPNGPGYENVPSGHKACTGVGGAALGADFVTGDQYLTSLHYKHSQLWRNY
                     GIVWAWWAFFAGLTMICTSFWSDGGNSASLYIPREKVKHGHKSDVEAQNEKNPNRGAG
                     SRVSGPEDEHLTRNTSIFTWKDLTYTVKTPAGDRVLLDQVCGWVKPGMLGALMGSSGA
                     GKTTLLDVLAQRKTDGTIKGSIMVDGRPLPVSFQRMAGYCEQLDVHEPYATVREALEF
                     SALLRQSRDIPEDEKLKYVDTIIDLLELHDLENTLIGTVGKGLSIEQRKRVTIGVELA
                     SKPSILIFLDEPTSGLDGQSAYNTVRFLRKLADAGQAILVTIHQPSAQLFEQFDTLLL
                     LARGGKTVYFGDIGENAATIKYYFGKNGIECPPESNPADFMIDVVTGSLEAAKDKDWH
                     QIWLDSDEHTRMMINLDNMIAEAASKPSGTHDDGYEFSMPLWEQIKIVTKRMNVSLFR
                     NTNYINNKASLHVISALLNGFSFWRVSPNLSALHLKMFTIFHFVFVAPGCINQLQPLF
                     LQRRDIYDAREKKSKMYSWFAFTTALIVSEFPYLIICAVLYFLCWYYCVRLFPHDSNR
                     SGAMFWIMMWFEFVYTGIGQFIAAYAPNAVFAALVNPLIISILLLFCGVFVPYTQLNV
                     FWKYWLYYLNPFNYVVGGMLTFGIWDARVTCNEDEFAVFDPLNGTCGEYLATFMAGNG
                     QRINLTNPDATSQCKVCEFRTGSDFLATLNINHYYVGWRNGAITVLYAISGYALVYGL
                     MKLRTKASKKAE"
     exon            23306..24452
                     /number=1
     exon            24512..25194
                     /number=2
     exon            25306..27310
                     /number=3
     exon            27387..27898
                     /number=4
     CDS             33015..34673
                     /codon_start=1
                     /locus_tag="AO090009000008"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070342000453"
                     /protein_id="BAE54531.1"
                     /transl_table=1
                     /translation="MPQESSDETQRVSLNTLRTETRETLQASRVTENSPPLGVNYPEL
                     GRPAEPLFPEEYTVETQTGLVPVRTLESIRSTAIGAPRPSTPNVEKASKPYEFVTFQI
                     NDPANPFNWSRLYRWYITMVVSALVVCIAYGSSIVTGGLGLIEEKYHVSLEVATLTCS
                     IMVCGFAVGPLLWSPLSEIIGRQPVYIISLALYTIFQIPCALSPNIGGLLACRFLCGV
                     FSSSGLSLAGGTIADIWNIEERGMAIAYFAAAPYCGPVIGPIVCGWINVGSHRLDLFF
                     WTNMAFAGAMTIIVGLIPETYTPVILKRRAKNLRQETGNLNIITEQEQAKPSFRDIVR
                     ISLIRPITMILTEPVLDLMCMYIVLIYAYLYAYFFAYPVVFGKLYGYNDGQIGLMFIP
                     ILIGAGFSLLITPMIEKRFKQVCRTRAPTPEDRLVGALLGAPFIPIAMFILGATSFKH
                     IIWVGPASSGIAFGFGMVLCYYSVNNYIIDSYQKYAASALAAKVFLRSGGGAAFPLFT
                     TQMYDRLGLQWASWLLAFIGVAMVLVPYGFYWFGERIRAKLSHT"
     exon            33015..34673
                     /number=1
     CDS             complement(join(38244..38310,38766..39400))
                     /codon_start=1
                     /locus_tag="AO090009000009"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000452"
                     /protein_id="BAE54532.1"
                     /transl_table=1
                     /translation="MKHSQLKVAGSCRPNTTRSVEELCNATEVELVLIASNHAFHASH
                     AVLALQANKYVFIEKPIALTLQDTDRIIAADEAAGGARVFIGYMRRYAAAFVDAVKEV
                     GSIEQIRYARVRDIIGPNSVFVAQSGTYPKTFNDYREADTEALRTKTLDDMEQALQAE
                     LGIAVTKETHMMWEMLSILGSHDLSAMREIMGMPKGVIGFSPCATVGSPFWRKPRRDS
                     LGCSSSLTYQPDDKQ"
     exon            complement(38244..38310)
                     /number=1
     exon            complement(38766..39400)
                     /number=2
     CDS             complement(40151..41365)
                     /codon_start=1
                     /locus_tag="AO090009000010"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000451"
                     /protein_id="BAE54533.1"
                     /transl_table=1
                     /translation="MITARSSSTGGPQPRDAILFGIAALGALFSDDVDATQEKRHMAL
                     ARNAQACLDAEISRISTPSFDLISALVLKTLYLRSTARTYATWITSCTTMHSVAMMET
                     DIEDLDSVAKCRGLFCEPRRTLWIARLLNTWIANQCGQSPIKTAFDTLIVPPTPSDPV
                     SATPEEQMIYLYHISEELSPDNHPTYGEIELGIIKLAALNSQQCHDAVLLSRTIMALS
                     FHRVLRSSETADIDRQTFARLVEIGLDGLQAAKRLAQQQKPWWHLANVPFQFLCAMLV
                     IDTASSFAQIPTALQVFEDVARAIPSSTITEALKLATKLIGLSKLQKTEQLQYLDQCS
                     ESLHQHTFRSEATSDEDAQIQPPVAGLSVPREIFNMEELGGFSSFDWSFLPNMDIPIF
                     DYDISNPIIESQ"
     exon            complement(40151..41365)
                     /number=1
     CDS             join(41616..41672,41940..41993,42747..42984,43041..43304,
                     43362..43748,43810..44117,44178..44348)
                     /codon_start=1
                     /locus_tag="AO090009000011"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070342000450"
                     /protein_id="BAE54534.1"
                     /transl_table=1
                     /translation="MASRDRPSCRLLPSACRLRVGEYTTKKRGVTDGRYSMNWSYGYK
                     WMVTGAVSLTSFIGTGASAIDSEIVPQLMESFGVGEEVALLGTALFMIALGLGSLISA
                     PFSEILGRNPVYIVSLIIFGLFTMGAALAPGIGSWLACRFSAGLFSWPPLTNFGGTIA
                     DVWSPIERTYVFPVLLCLCFLGPFLAPMVAAFIGGSSVVNWQWTEWLTLILTGALVVT
                     FLLFVPETFPPVLLSWKATSLRKVTGNQLYLAEHEVDAIPLYRRLQRSIKLPLKLLLT
                     EPIIQLFSLYMTVIYTVLFGFLPGYGFIFGAQGIYGLDQAHTGLCFIGINVGFLLSVF
                     WPVYVRFKRKLFEARKEGKHKVVPEERLTHAIIGAPILPISIFWMGWSSWPSVSLWSP
                     LAASVAFGFAVMQLYISCYQYIIDSYEIYAASALVGMTLTRYCVAGPMVTVSVPMYEN
                     LGVHWTLTLLGCIATLLAPVPYVFKYYGAIARKRSKGATSFE"
     exon            41616..41672
                     /number=1
     exon            41940..41993
                     /number=2
     exon            42747..42984
                     /number=3
     exon            43041..43304
                     /number=4
     exon            43362..43748
                     /number=5
     exon            43810..44117
                     /number=6
     exon            44178..44348
                     /number=7
     CDS             complement(join(45290..45850,45857..46110,46162..46307,
                     46359..46363,46397..46639))
                     /codon_start=1
                     /locus_tag="AO090009000012"
                     /note="1-aminocyclopropane-1-carboxylate synthase, and
                     related proteins"
                     /old_locus_tag="AO070342000449"
                     /protein_id="BAE54535.1"
                     /transl_table=1
                     /translation="MCSLPEKFTVDSHSLTYGDGFSGSHRLRDTIARFITRYFNPVNP
                     VIKTSFLSPLAWARQLSFPGSVSWTKMTASCLRARTMGKAKIIGVSFGEMDPFGPETV
                     GIYEKALADAQRQGIRVKAVLLCNPQNPLGRCYTREVLEAYMRFCQKQNLHLIADEIY
                     ALSTWKNPDFPNAPSFTSVLSVKKDGLIDPSLVHALWGMSKVRASAMLFWWDILTLDF
                     GSNGIRLGCVISQDNVNFLRAAEANSYFSCPSSLSDLATSRILSDDAWVQSFIQTNRQ
                     RLAENYTITIRFLESHQIPYKKGGNVGFFVWVDLFDPIRRQVNATLKKQAEANVSSEN
                     AARALETKLQEKLLKHRIFLALGADFGGDVPGWYRIVFAHEKEYLRLGLNRMINALGV
                     FREELDTGLA"
     exon            complement(45290..45850)
                     /number=1
     exon            complement(45857..46110)
                     /number=2
     exon            complement(46162..46307)
                     /number=3
     exon            complement(46359..46363)
                     /number=4
     exon            complement(46397..46639)
                     /number=5
     CDS             complement(50560..51939)
                     /codon_start=1
                     /locus_tag="AO090009000014"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000447"
                     /protein_id="BAE54536.1"
                     /transl_table=1
                     /translation="MASTTKAFTAAAMSLVINDINNHHGENSTRMATTADQIHWRTPL
                     ASIIREDFVLEDKYTTAQITIEDALSHRSGIPDHIRHYGGTGASPGSIKDAVRILRYL
                     PATAELRTKYMYNNLMYTAVSHAIETLTGENLGTFLLQRVWTPLHMDSTYWTRDDAQA
                     GDNILAQGYTWNANKSEYTPEPCPDIIGGSGAGAMISSVVDYAQWIRCMITCSGPLSK
                     NAHAALIQPRTIIAEDPTNMFPGTHLYALGWTRDNYHGEDIIWHDGSVAGYGCTMMYL
                     PRRQWGLVMAGNTTLTSNIVQVVLYMHLLDQVLGIPSHDRVDWQQQISERIATWREKQ
                     AHAKDLLYPRLPVVPIPPTLGVWEYAGLYEHPGYGRLELRVDIDGFGLDADRLTCEVP
                     IVILMEHVSGEFWLASLRERNQDPRDHERVRAEFRIGVKGLVSEVGIDLEPEMNGEKI
                     WFQRIDLDI"
     exon            complement(50560..51939)
                     /number=1
     CDS             complement(join(53559..53789,53843..54040,54089..54571))
                     /codon_start=1
                     /locus_tag="AO090009000015"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000446"
                     /protein_id="BAE54537.1"
                     /transl_table=1
                     /translation="MMNTITEHGTCSIVFSVVGMLISMVLSIPRTMKGMTWVSFASFL
                     SIFGAVMITMISVGVQDHPNRVIHATVETNLYTGFQAVSNIVFAYCAHVAFFGLIAEM
                     ENPKDFNKSLLMLQSFEICLYLTAAVVIYYYVGTDVASPALTSAGPVMKKVAYGIAIP
                     TIVGAGVVNGHIGLKYIYFRACRKSDLLHSRSWKSVSIWLALGLTCWVVAWIISEGIP
                     VFSNLNSLISALFASWFSYGLSGIYWLHLNYGQWLSSPKKILLTILNIGIALIGLILC
                     VLGLYASGTAIHNDTNSSVFTCANTDT"
     exon            complement(53559..53789)
                     /number=1
     exon            complement(53843..54040)
                     /number=2
     exon            complement(54089..54571)
                     /number=3
     CDS             complement(join(54642..54779,54832..54904,55024..55184))
                     /codon_start=1
                     /locus_tag="AO090009000016"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000445"
                     /protein_id="BAE54538.1"
                     /transl_table=1
                     /translation="MDVLPAYPNNHGVDKKEDEFDADAEKRDIMAGQVQDAFGSEEDA
                     EIKYKTLTWCYDLRICFLGSVVSASSRGHVGFRPGCYLDHRSRPSRVIHRLQYWIVSP
                     ALSSHSESGRCRRNFARPFWA"
     exon            complement(54642..54779)
                     /number=1
     exon            complement(54832..54904)
                     /number=2
     exon            complement(55024..55184)
                     /number=3
     CDS             complement(57472..57942)
                     /codon_start=1
                     /locus_tag="AO090009000017"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000444"
                     /protein_id="BAE54539.1"
                     /transl_table=1
                     /translation="MIFGCMAAAFSTATSTKLLQEQNVPLSLALEIAQDAVQDCAKKQ
                     YSVSAAVVDREGVLRALLRADNAAIHTPEAARRKAYTAASSRTATSTMVKNIQNPGAA
                     QLAAVDDFLILAGGVPIKVGNETIGAVGVGGAPSGDFDEACAMVALQQVADKLL"
     exon            complement(57472..57942)
                     /number=1
     CDS             join(62128..62326,62381..62461,62483..62673,62732..63348,
                     63412..64279)
                     /codon_start=1
                     /locus_tag="AO090009000018"
                     /note="monooxygenase involved in coenzyme Q (ubiquinone)
                     biosynthesis"
                     /old_locus_tag="AO070342000443"
                     /protein_id="BAE54540.1"
                     /transl_table=1
                     /translation="MAPYNTNDNSAIRSDGAEESPVIGGIAINARRNCSARPSDHAVD
                     TEFLIVGAGPAGAALACFLGSHGLKGIMISSAPGTANTPRAHITNMAALANNDLLLIH
                     GFAHAECLRDIGLYDELEKLGSTGADHMQHTRWCHSMAGEEYARTHSWGNDPRRKGDY
                     ELASPCEPFDLPQTILEPVLVRHAALKGFKCRFDFTLVSLFSDSKTGLITASIHDKMT
                     DKEYQIQTRYLFGADGARSEVVKQLNLPLVVQPGQGMAINVLVKADLSHLVKNRTGNL
                     HWVMQPDREHPDFGWMGIVRMVKPWNEWMFILFPDRNYDRSQGKPSKDAYQKRVQEFI
                     GDDTPAEILDISTWYINEIVAEKYSEGNIFCLGDAVHRHPPLNGLGSNTCIQDAFNLA
                     WKVAYVHKGLASPSLLSTYSIERQPVGHSIITRANQAYRDHFLVWKALGMLPTDLSAR
                     KEILEELKSATPEGSNRRRALHAAIKHTSHEFHGLGVEMNQHYDGQGVYTADEPNPYA
                     PSRRAAEDSILFHEPNTYPGSRLPHVWLNKAIPGEPVSTVDIAGHGSFVLLSGIGGGR
                     WKKAAENVAETLKVPIQVHYIGFRQDWEDVYFEWENLRGVEESGAVLVRPDRFVAWRA
                     PEVLKDTEACESKLLTVMRSILGFLDV"
     exon            62128..62326
                     /number=1
     exon            62381..62461
                     /number=2
     exon            62483..62673
                     /number=3
     exon            62732..63348
                     /number=4
     exon            63412..64279
                     /number=5
     CDS             complement(join(64850..64962,65125..65245,65328..65358,
                     65411..65673,65743..65937))
                     /codon_start=1
                     /locus_tag="AO090009000019"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000442"
                     /protein_id="BAE54541.1"
                     /transl_table=1
                     /translation="MGPNWAHLVRFIGEEDGQTHLGEVDPNKYPDVGIAILNGERVAV
                     KLIKGSIFDGRVTDTTMHIARLLAPIGIEEVPIIRCMGLNYRDHAKEANMPIPDVPVV
                     FIKPRTALNGPHPAKINVPKIAQDGSSDYEAELSIILSKTGRDIPESEAMDSRTASGP
                     FQKALTDLVHWAPSLCLPPPSAPRIICKLELSIMAMWCKTQTLGPGIGAMRNPKIVLK
                     HGDDMRVEIEKIGTLINEVYYE"
     exon            complement(64850..64962)
                     /number=1
     exon            complement(65125..65245)
                     /number=2
     exon            complement(65328..65358)
                     /number=3
     exon            complement(65411..65673)
                     /number=4
     exon            complement(65743..65937)
                     /number=5
     CDS             complement(join(66923..66954,67008..67117,67177..67430))
                     /codon_start=1
                     /locus_tag="AO090009000020"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000441"
                     /protein_id="BAE54542.1"
                     /transl_table=1
                     /translation="MVQLIHDSTGRDITTFLHLDRGSELVDHHCFFFFEGPRSHVHHS
                     SFETHDFDTQVLGHDWLRSKGYENCWGVGRHIMGSQIFDYWFDTSRFIIEHYVDGDLV
                     NDQHQTNRSLATPDNLHVWGPDLPPTFLQ"
     exon            complement(66923..66954)
                     /number=1
     exon            complement(67008..67117)
                     /number=2
     exon            complement(67177..67430)
                     /number=3
     CDS             complement(join(67533..67599,67664..67770,67776..68195))
                     /codon_start=1
                     /locus_tag="AO090009000021"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000440"
                     /protein_id="BAE54543.1"
                     /transl_table=1
                     /translation="MTASSNESRINLTRIAHVFYTHREIDKAHHFLLDFGFREVKRVG
                     NDIYYRGTSSEPFVYCARQGDQDGFGGAAFVVESESDLFAATKLPGATGIYDLGNAPG
                     GGRCVTFHDPIDKFPFHLVYGQEAHADEKVLPQLDYNFLFSYIYTYNSLIGNLLTFPA
                     NRQTPAREQNTTIQKGPCTRAQIRSFRNVCHQFCAGV"
     exon            complement(67533..67599)
                     /number=1
     exon            complement(67664..67770)
                     /number=2
     exon            complement(67776..68195)
                     /number=3
     CDS             complement(68907..70742)
                     /codon_start=1
                     /locus_tag="AO090009000022"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000439"
                     /protein_id="BAE54544.1"
                     /transl_table=1
                     /translation="MVAIDIFHEPSFAEKLSNIPSFCQLTALLAAIAGYATRFGALRT
                     NDGASDAVQLAAKSHRQPAYFIDLAFKYINEALAECDDEMPPLCVIQALILATHCRLT
                     QGVRGKAWRSLGLCVSLIYETNLHLLDSRKVIQTEDPHHWQQDEEKRRAFWAIWEMDV
                     FASTIRRTPTTINWNQMEIWLPVDNAHWFSGHPASSCFMETDINKRWKALQDSGNQSS
                     KAWFLVINSLMKNAQIACDPLGVPAISNQGYHQQMPNSQISTADSAMEARQKLETLAN
                     AVRCFTWALPSHLQYRDQYLAFGAPVQGELESQRRQHCSIYNIFVMTQLTRLMIYRYD
                     AFRSQNRPTETSGRHPSGDSAGRNTFGLLETENEARRQYYEAADRILGIVNRSCEDHF
                     QHINPFLPSTIWLASAVQLVRKHFARAQSNRDLVKSRFDVLYLTYKRCVQFWDIQTAL
                     QKNLELIEEQLDARNKKLEVRACPTSHEASNQTSEDTGMINQSASDQDGHNVERGLNF
                     DRTARQASQYIPETPSVPLTSSTPIDVRLDITAQNHAQKHLYVGDSLAMLDYMTPPQL
                     SRNQVPEEYMVPPNSHFLDTIYQLDQALDWPTFDFPGGIYDLLSG"
     exon            complement(68907..70742)
                     /number=1
     CDS             complement(join(73377..74074,74124..74204,74841..74877))
                     /codon_start=1
                     /locus_tag="AO090009000023"
                     /note="dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /old_locus_tag="AO070342000438"
                     /protein_id="BAE54545.1"
                     /transl_table=1
                     /translation="MTSSTRQDEQGGCKVFAVTGGARGLGLSMAEALVEAGGQVYCLD
                     RLPEPDGEFRAAEARANPDFGGSLHYRCMDVTDDANTEAVIADIGAQQNRLDGLIAAA
                     GINHVASAIDHRPKNVDDVIHINYTGVFRSAVSAAKVMLDRKCHGSILLVASMSGIVA
                     NKGMASAIYNSSKAAVIQLTRSLAMEWSEAKEDGTGGIRVNCLCPGHIETPMAKMVME
                     KDPDTRALWESENMMKRLARPEEFRGITLLLMSDASSFMTGSTVVVDGGHTAW"
     exon            complement(73377..74074)
                     /number=1
     exon            complement(74124..74204)
                     /number=2
     exon            complement(74841..74877)
                     /number=3
     CDS             join(75761..76147,76227..76364)
                     /codon_start=1
                     /locus_tag="AO090009000024"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000437"
                     /protein_id="BAE54546.1"
                     /transl_table=1
                     /translation="MEQTGIEGQALAAWENHARSWDSTMGDDGNDYFSVLELPALKRM
                     ISGQKRNRALDLATGNGLVARWLAEEGFSVVATDGARAMLEHAKARTTLWYEEGRLDK
                     ERKISFELLDVTNKDHWAQFTSSDNLLKDGFDVVVMNMGIMDVHDLEPLAASLTSLLK
                     QDGWLALLLFELSK"
     exon            75761..76147
                     /number=1
     exon            76227..76364
                     /number=2
     CDS             complement(77533..78723)
                     /codon_start=1
                     /locus_tag="AO090009000025"
                     /note="actin regulatory proteins (gelsolin/villin family)"
                     /old_locus_tag="AO070342000436"
                     /protein_id="BAE54547.1"
                     /transl_table=1
                     /translation="MAPHEGLVHPKEYDIKDSNVELIGSDLDHRVKYNSAATEPAWNN
                     GQIGQEAGLWIWRIENFEVVPWPKNRAGEFYDGDSYIVLHSYKVGDEKLGHDIFFWLG
                     SKTTQDEAGTAAYKTVELDEFLHGAATQHREIQQQPSEDFVSLFRRITIRSGGVASGF
                     NHVEEEEPKEVTTLLRVFKHPGAGRIDSIIVYEVEPTWQSLDDKDVFVLDKGDKIWVW
                     QGKTCSPMEKAKAAQVVNDMTLAKHVDVEVLSQLESRSKIFVDLLGGKEVDQLSFQAP
                     RPVSFSKRSHDESGASRPSKLFRLSDASGTPSFNLAKDGAPVRRSDLDGNDVFLYDVG
                     SRLWVWQGSGASEREKALWLKVAQAYVRHLQQDQNDSDAYLTPISKVVEGYESPAFLK
                     WIEV"
     exon            complement(77533..78723)
                     /number=1
     CDS             complement(join(79369..79717,79780..80161,80236..80473))
                     /codon_start=1
                     /locus_tag="AO090009000026"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000435"
                     /protein_id="BAE54548.1"
                     /transl_table=1
                     /translation="MASFKPRNILLFGATGNIGTYILQAILTARDEFDRIAIFTSQAT
                     AASKKDYLDDLKRTKNVEVLVGDVQDQDAVRKAYHGIDTVISALGRGAIASQIPLIRL
                     ADASPTVKWFLPSEYGTDIKYSPASAQEKPHQQKLKVRAFLENESPNEGVVSDLAYTY
                     VVTGPYSDMYVHYAGNPIAGGWDVKAKKATLLGEDGNAKVSLTTMKDVGTLVLATLRH
                     PSVAFNRALKVNSFTTTPAEIHAEFVRQTGGQPWTNVQYTPLSQLREAESEAWQAGKP
                     EATVLTLRRIWTEGGTLYDQRDNALIGEPPVQTLEDVVAQEVRKSS"
     exon            complement(79369..79717)
                     /number=1
     exon            complement(79780..80161)
                     /number=2
     exon            complement(80236..80473)
                     /number=3
     CDS             complement(join(81118..81344,81395..81617))
                     /codon_start=1
                     /locus_tag="AO090009000027"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000434"
                     /protein_id="BAE54549.1"
                     /transl_table=1
                     /translation="MFSFLKNTLVPLLLLSQAGPGAAASPAYPTAPELSFLYTAYVKC
                     EGTLMESRGPHGIRKAIPIVGGNFTGPHLSGEILDVGADWGLTDPQTSVFSADTRYNL
                     RTHDGENIFIQTSGPKSPSGQLHLRLVFETGSEKYYWLNNVLGRFMM"
     exon            complement(81118..81344)
                     /number=1
     exon            complement(81395..81617)
                     /number=2
     CDS             complement(join(82076..82568,82631..82655,82688..82919))
                     /codon_start=1
                     /locus_tag="AO090009000028"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000433"
                     /protein_id="BAE54550.1"
                     /transl_table=1
                     /translation="MKWPAQIIQIKSVDRCSSSSVSSCTANHSSWLPLSWEPILELLC
                     SLALALTMMLSWDLTRRSPAAPRARSIWPINQISVDAEGNTNAGLEPTGDSSGSCSSS
                     TGQIYVRGGISGDYYALMYSWYFPKDEPSTGLGHRHDWEGVIVWLSDSTSTSADNIVA
                     VCPSAHGGWDCSTDGYTLDGTTPLIQYYSVWPVNHQCGLTTTVGGTQPLIAWESLPTA
                     ASTALEDTDFGDANVPFKDANFSSNLEKATF"
     exon            complement(82076..82568)
                     /number=1
     exon            complement(82631..82655)
                     /number=2
     exon            complement(82688..82919)
                     /number=3
     CDS             84915..87113
                     /codon_start=1
                     /locus_tag="AO090009000029"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000432"
                     /protein_id="BAE54551.1"
                     /transl_table=1
                     /translation="MQAEMLASDDSPARKMRKVTRACDACKRKKKACTGNLPCRPCLK
                     RQEVCTYNSTYNRGVAVSPPPSSHTIQQHHAPLRGTTDSNSQDSRLSFASPVTYTSPD
                     TTRPATYHDATTSVISPPSKTNTRYHDHEPEIQRTEVADRYWGPTSAHSFLDRAALGL
                     PTPPSNAIRASDDPSHDRTTSIFQFGDRVVPETSVTEFQWPDLETAEALVHRYFEFAS
                     PTHRVLHQQTVENMVQRLYQRGRPDGEQISGVTAVCQAILLMVFSTATMFKMDAKGGM
                     TDADENGWQTSEMYFTKADHLLSKESGAPRLESVQVRFLMVLYLLSSSRAHRAWFTLG
                     TTIQLIMALGLHSRRRNRETAEVSLIQQECQRRVVWCSYTLDKYLSLMLGTPRLWHDD
                     DLDERLPARANDEDISPDRILPPTRDCVMDAAIFHALLARVLSQAAKEPYVVAGITDR
                     EEINTIRVLCERVAEWQAELPPFLSGVIHSSSLIPLFKRQLTVLQLARYHALMFITRP
                     LLLRNYGQIWTDREASYVQYLRVCLTAAKDTVELITTFARDNQLFPAFWYSQYIAFNA
                     LSIIYIYLIQVQSNRILPLSQTNVATEGGLNDGFGFDESTLYVLAETAQYHLTHATAR
                     NAPSWKYGTILQSLRRELERLGAPCDPVATNMPPEHQGEPRIQSRNLNDTDLGATIPP
                     SQPEPHYHEPFPIDAQTLPLFDTFTLDNDLILDLWSQLDSLPISAYPAYS"
     exon            84915..87113
                     /number=1
     CDS             complement(join(87422..87961,88018..88297,88356..88508,
                     88566..88762,88821..88978,89026..89149))
                     /codon_start=1
                     /locus_tag="AO090009000030"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070342000431"
                     /protein_id="BAE54552.1"
                     /transl_table=1
                     /translation="MADIDSKSSSSHVESAVKPLSPEVIQFEGLSDEEALKLERRLVR
                     KIDLHLIPALFLLFIFNILDRSNIANARLGGLQEDLGLSDTQYQTAVALMFVGYLLGQ
                     VPSNIILTRVKPSRYIPAAIFVWGGISICMAATKNYAGILCVRIFLGFAESPFFPGAL
                     LLMSSWYKASELAVRVAIVYCGNTVANGFGGMLAAGILSGLDGKGGLAGWRWLFIIEG
                     AGTMVAGMLAVVLLPDFPRSGQRKWLTEQEQRFAEWRLAVATNNEVDENGSIKQGLWD
                     AVTDPKVWVLVLIQICQLTSQTWTYFFPSIVETLGFGKIVTLLITAPVYVFGFISALG
                     NSFIANRTNYRAILIVWPLCIDIVGNVMVISSQATAVRYIGMFLMCMGSYSAFNVVQA
                     WIASTIPRTRTKRAIVYAMVNFFGNSSNIYGSYFFPTKDSPQYRPGGIILSSFAAGGV
                     CFSILLAVYLHWLNTNARKAEEDDGQIRYKYIF"
     exon            complement(87422..87961)
                     /number=1
     exon            complement(88018..88297)
                     /number=2
     exon            complement(88356..88508)
                     /number=3
     exon            complement(88566..88762)
                     /number=4
     exon            complement(88821..88978)
                     /number=5
     exon            complement(89026..89149)
                     /number=6
     CDS             join(89954..90288,90354..90990)
                     /codon_start=1
                     /locus_tag="AO090009000031"
                     /note="aldo/keto reductase family proteins"
                     /old_locus_tag="AO070342000430"
                     /protein_id="BAE54553.1"
                     /transl_table=1
                     /translation="MSLSTHFTLNTGAKIPAVGFGTWQAKPLEVENAVEVALKQGYRH
                     IDCAAIYRNESEVGNGIRKSGVPREEIFITGKLWNTKHAPEDVEPALDKTLKDLGVNY
                     LDLYLMHWPCAFKSGDKWFPLNEDGVFELADVDYITTYKAMEKLLSTGKVRAIGVSNF
                     NVRRLEELLSQVSVVPAANQIEAHPYLQQPDLLRFCQGKGIIVEAYSPLGNNQTGEPR
                     TVDDPLVYSIAGELSMDPGPLLASWGVQRGTVVLSKSVTPSRIAANLQVKQLPEDAFA
                     RLSSLERHKRFNFPAFWGYDIFEEVGEEAVRKAALEAGPVNKTKFTV"
     exon            89954..90288
                     /number=1
     exon            90354..90990
                     /number=2
     CDS             complement(join(91215..91329,91390..91445,91509..91661))
                     /codon_start=1
                     /locus_tag="AO090009000032"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000429"
                     /protein_id="BAE54554.1"
                     /transl_table=1
                     /translation="MFGQGLFSWFSTSKTESSENAQPTWDPNTLTMTQPQSPAAPTTE
                     NVVAHQPTPTEDMQLQLRGGGGPDDDCCCCCCFCGDCCGPDGPPGGPDGPGGGPPGPG
                     GPGGW"
     exon            complement(91215..91329)
                     /number=1
     exon            complement(91390..91445)
                     /number=2
     exon            complement(91509..91661)
                     /number=3
     CDS             94409..97330
                     /codon_start=1
                     /locus_tag="AO090009000033"
                     /note="gluconate kinase"
                     /old_locus_tag="AO070342000428"
                     /protein_id="BAE54555.1"
                     /transl_table=1
                     /translation="MYNAKLPLTASYLLSTLQGHPDIQVLYAVPYALKLLSESEQGLE
                     SLARMELVMFGGSSCPKPIGDTLVKNGTLLVSHYGTTETGQLMTSFRERSDLDWDYVR
                     PGPSLLPYIRWEERFPGIYELSVLEGWPSKVASNRPDGSYATKDLFEKHPTKPNAWRY
                     YARLDDTLVLENGEKANPLIIEGVARNHPDVGEAIAFGANKDRLGLFLVRAANALSKT
                     DEEIIDAVFPAIEKCNADSPSYAHISRDMIQVLPSDTVYRATDKGTVIRSAFYRDFNE
                     QIEQVYELGDATGDRVLEGTELNMFLRESLLEVAPTINSAVLDDTTDVFSLGVDSLQS
                     IRLRKIITKTLNVGGQRLSQNFVFEHPSIQRMADEITRLRLGLDADKEIPIEEQMSQL
                     IDKYSNNFKAHIPVRQTVNGERIAVTGATGSLGAHLVAQLVQMEQVHTVFCLVRANSA
                     HDALRRVRQSLYDRGLLYSLSPPDERKIVALPAQLSNTSRLGLDEPTYKQLTQSLTAV
                     IHCAWSVNFNWSLGSFEDSCIAATRNLLDLCLDAQAPMPARFSFCSSVSTVARTPGHW
                     VPEELPESLSYAQGMGYAQSKLVTEHIVNRAAQHTNIAARVLRVGQIVADTVHGIWNA
                     TEAIPMILQTAKTIKALPELDDILSWTPVDVIATSVVELTLGTNVANIVNLTNPTLSH
                     WTRDLLPFLKTAGLEFEQLPQREWLNRLRQSNPDPAANPPIKLIEFFASKYDNDRPSR
                     VLLYDTKKAQAGAPALRQAGGLNAQFVSRFMAHFQNQCWSNKDTTSISKKSREVIFLA
                     GPCGCGKSTAAQALAQRFSILIIEGDDLHSPASRQRMANNIPLTDSDRWDWLAHIRGA
                     VMDRLQHSAAPAVVVTCSALRTIYRDELRRLSRLFDFPVNVTFLMLSIKDRAQLKDRL
                     IARSAKEGHYMSSAMVDSQLDTLESPSGSEGDVILLDSDEPMEKMLEGVQDVVQGLLD
                     V"
     exon            94409..97330
                     /number=1
     CDS             complement(join(98291..98436,98462..98901,98963..99116,
                     99169..99337,99397..99564))
                     /codon_start=1
                     /locus_tag="AO090009000034"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070342000427"
                     /protein_id="BAE54556.1"
                     /transl_table=1
                     /translation="MSAPDIVDEKKHDAQHVESVRSLITIDNIQVLGLSPEDAQFYTD
                     FSAEQKKAVLRKVDIRLVPMLAVLYLISQIDRANIGNAKIEGLTEDLRLSGIQYNIVL
                     SIFFVPYVLLEVPSNILLKSFFRPSIYLGILITCWGIVMTLTGIVQNFAGLLITRLLL
                     GAFEAGFYPAAIYLCTFWYMPKDLAYRVSIFYCASALSGAFSGLLAAGIAQMHGIGGQ
                     EGWRWIFLLEGLATVVLGVMCFFLLIDSPRRSSKWLSPDEIRYLELQHFIKEGGDFKE
                     QRKRVSWEELKTVLSNWRLYMLSYILLCQSAAAYGCRTHQGIHRPQIYHAYYHEGHGI
                     YQYERTAHGCAPVYCGCHLRHLFL"
     exon            complement(98291..98436)
                     /number=1
     exon            complement(98462..98901)
                     /number=2
     exon            complement(98963..99116)
                     /number=3
     exon            complement(99169..99337)
                     /number=4
     exon            complement(99397..99564)
                     /number=5
     CDS             complement(join(100627..101099,101183..102095))
                     /codon_start=1
                     /locus_tag="AO090009000035"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000426"
                     /protein_id="BAE54557.1"
                     /transl_table=1
                     /translation="MKKLFSRFKHSMRIPASTSDPTPAATAGQVGSMQTPARGKLQKR
                     VDCDILHRNAPVEDLPPEVRHHLLSMLELETLWALVHASPVYHQQYLSARRRLLCSGL
                     ETTLRSATSDACAVYQSRLVDFSHSRTKEKVNMFLQSYQDQRDTSLHSVPSEMANVDE
                     LVDVAAFYFSIVKPLAQYYTSWTLGNLAIETDKPRSDEPLSKMEEARLIRALYRFQLC
                     CNLLGVGLHKSSQIQRLSFDSVEIGTIFLDLFEPWEVEEISCIYTFAKERYNQIFNDI
                     RWNVHEENPKFEGQRPPTPEGAFDLDNSWTRDSLLKGTISCGLDLLHMVIFEIKDHTH
                     LVTTMQQHISWPTGNFLEGEALGESAQFQRRQEHPSNWDLRQERRDPLPFQGDEVPDP
                     NGVHPPLAWTLIWRGSYSNLYGYYVQDIIRRWGYVMWHATRLDYTGAKELLARQWKAD
                     WGDTDPRDNLL"
     exon            complement(100627..101099)
                     /number=1
     exon            complement(101183..102095)
                     /number=2
     CDS             103102..103689
                     /codon_start=1
                     /locus_tag="AO090009000036"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000425"
                     /protein_id="BAE54558.1"
                     /transl_table=1
                     /translation="MKWSALVPLSVSALAVLPSTGAWEFTWRDASNTRHVESGHGPSK
                     CITVDHKKGMVFSIDAQGEKNINMLLYGTDDCSGKAVGQATERFSKASSVDIHGFQVE
                     SLSTGSNATTTAANATVTSTRLTQSSSTANSESSDVPTTSATTTSDTAATTTSASETS
                     TSTPNASLRLSAAGSDMAKTVIGMVLGLATVEWLC"
     exon            103102..103689
                     /number=1
     tRNA            103793..103865
                     /locus_tag="AO090009t00001"
                     /note="tRNAscan-SE"
                     /product="tRNA-Thr"
     CDS             complement(104925..105731)
                     /codon_start=1
                     /locus_tag="AO090009000037"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000424"
                     /protein_id="BAE54559.1"
                     /transl_table=1
                     /translation="MNTRFLLTIFIITSSLFFCSDAAPAPAADEALVTIDSPEVQTNW
                     TESSFLQCVKQLNGFKSANIVDGNIAFKCHGVYGNGDLNLHAPSGKKADSCAASFPLS
                     ISEEVNMTSCTTELSKNFEEAAPFRAAVDAICHDIVGSWVDKEITHMTHHFTDASSKS
                     DSWLLKNKKVILKTTMNMIPQTRAALNAGKIAKATLDTLCENGLRDFGTKGKGCTHEL
                     HYYKNTIGISHHGIPYDRATTTGVTNGMVDLFVDNIKNIIGTIDLSWSKP"
     exon            complement(104925..105731)
                     /number=1
     CDS             join(107140..107269,107328..107864,107916..108205)
                     /codon_start=1
                     /locus_tag="AO090009000038"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000423"
                     /protein_id="BAE54560.1"
                     /transl_table=1
                     /translation="MRWIIPNLLAALAVSSLFSSVITWPTGDSGLGKGQSVDNDFGDE
                     VGSYDSQPFYGRREITESLPGLSEHPDSETHVGYGAILERVPRPNTDKPNDDADVPDV
                     DQEDLATALEAIHLESHSPSIVSRGQKEEAELSSKFGSRWKGETFYYFIEAKDKNAKN
                     FNANEIKSLAKKGYELIKDKFNFNGNVIVSALFIPEVGVAVGSKPRGTGVVEEILEKS
                     HKTSDGRDLTHACDSVQQEDLYHAEDLVIIKGADEYLKKMRSDNWRDKKFPRGTHMVS
                     YGKYNSEDKSAGPKEPCGGTEKTKLTIPCKNVAHELNIDWST"
     exon            107140..107269
                     /number=1
     exon            107328..107864
                     /number=2
     exon            107916..108205
                     /number=3
     CDS             complement(108431..109831)
                     /codon_start=1
                     /locus_tag="AO090009000039"
                     /note="ankyrin repeat"
                     /old_locus_tag="AO070342000422"
                     /protein_id="BAE54561.1"
                     /transl_table=1
                     /translation="MRLLLDLPNEILHHIAGYLALESDLNLLARTNRHFHSAINPLLY
                     HFNAIHRQMSALLWAADHGIVETAQHSLNASFGVSNNIKLGIIYDALSIAVHAGHTSI
                     AKVLLLQEGIDPNFRYRSKEARSWVTFLARAAGAGHVDTVALLLSTKGINPNLGDGMG
                     RPPIAHAGFNNQVPVIEQLLATPGVDMNGKDHHGRTPLAWTVSFGSEAAVSQFLSRQD
                     IDVNAAIATDDLFKKGWTALMFAASRGFAKKVELLLNTPYINVNHQSSSGKTALHWAA
                     QVGSETIVQLLLAKGAYPDPRDSHNRSPLIQSALYGHLSIMELLYEAGANLNTVTSTG
                     STALTSASGEGHTDIVVFLLGTGKVDVAAKGKEDKRNALSVAAEGGHRDIVDLLLKQN
                     GQGFPNERDYMGRSPLSYAIEHGDLETIKLLIRNSSVIDTGETDANGKTLLSYAAQHD
                     DPAILNLLVSATKVTR"
     exon            complement(108431..109831)
                     /number=1
     CDS             complement(join(110573..110964,111030..111221,
                     111442..111492,111589..111595))
                     /codon_start=1
                     /locus_tag="AO090009000040"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000421"
                     /protein_id="BAE54562.1"
                     /transl_table=1
                     /translation="MRPLCMPPTSGTLARNSSQVPDWPKKRPSHDQFEKCVQPAISGV
                     VKYDQPISISPSILVADGNTGSGICSVPGRLLPNLLTGRDMKDLAGSICDTMVTVGQG
                     IVTKDAGAISSALTVRGGHRKGFSITHKHCNLQIIGTVANVAGINVKSELVDLCVHAI
                     KYQAETCLAVLKYGIIRHPVDHVVKPSTTIWRNGKGAIQAIFDIGFAMPDTFH"
     exon            complement(110573..110964)
                     /number=1
     exon            complement(111030..111221)
                     /number=2
     exon            complement(111442..111492)
                     /number=3
     exon            complement(111589..111595)
                     /number=4
     CDS             114320..116293
                     /codon_start=1
                     /locus_tag="AO090009000042"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000419"
                     /protein_id="BAE54563.1"
                     /transl_table=1
                     /translation="MVYINHTQLRGPAEITRISHDKLSGTTLGYPAGSSAGSSVTSLC
                     SPSVAASSAGSSEILVGLGISTTTSGLKLDDHQLPITPRPSRGHCVGGNVPACLQNQL
                     DKPLPPLPLRASARDHGLAKHYPLPPRPQGRKHWSLPNKPEAHDLAALDHAFARKGLR
                     SNPLHRLRVHRPRHDLPTAVNTEHTEPTPDRLTSRRWLVRGRTLTRAFQHFRLPRLPR
                     LPQKPSHAIRQSIRPVGEASTQPPLCHTLSRTTGPNGPPIHAHSGAATRMKRILSILL
                     ENRASLCMPDMPEADRERYAGNFIEQAQRLVLDYLQPTLSTAYAGSSGPIVPVPRPRH
                     SIYELGVRTRVLSHPCASSALNVPVPVMRRILQQVDCLEDLFSLARVNRAAYKAFKAH
                     ELPLIQGTLWKVSPPAWKLRQVCEIPIRYTKEDSDGSPLAASLYLRHYARDLDTLVRI
                     KLLIWYYCRAVVREEMMTALCEPDSEQGAAVDDANWRVWTFCHLFGSRKDREWDLAGQ
                     IQWLRGKTCGAVLPLVCCTSPDPSDFNTVLFTPPEGFARGNQGPLSEDQLCDMIEVWT
                     AMASLLDFLRVQTSHARRYGVFSETGITPGDKQQEESMLSMFPLLSIIRPLTHLTWDT
                     LTYLLYRRLARLYSYSWAGRGLGAGAIWAQVRS"
     exon            114320..116293
                     /number=1
     CDS             complement(117257..117994)
                     /codon_start=1
                     /locus_tag="AO090009000043"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000418"
                     /protein_id="BAE54564.1"
                     /transl_table=1
                     /translation="MIRHTILTRRYNKLKNLREAQTAASAGTGPEDSSLSPSSCEDSG
                     DTVDSSDDDSGLGSGSTEGSTGLHDPRIADDDVPMNINPTDILPSTTQGIPGHNGFMH
                     GTWDMAGTLSGDPWGLPSVGETDSMGLFLNGMVPELHSIPPDSMHNFGFVDAASGKDC
                     ICPSLLSPTEEMPSDYSQGDNFCDDLSVSAMDTEEQTLASLQENVTRGKRCAKIVLTV
                     EEPDNNTVESLVQIAFSSKSRFHFARE"
     exon            complement(117257..117994)
                     /number=1
     CDS             complement(join(118051..118155,118214..118281,
                     118339..118382,118443..118747))
                     /codon_start=1
                     /locus_tag="AO090009000044"
                     /note="transcription factor, Myb superfamily"
                     /old_locus_tag="AO070342000417"
                     /protein_id="BAE54565.1"
                     /transl_table=1
                     /translation="MPRAPQKWTPEEDKLLCREVHNQCELGRNSVSHILGLTPFRALV
                     SEGRVRDWRSIADKIPGRTNKDCRKRWHNVLSGGLNKGYWTEEEDKLLTHAVQIHGET
                     WTVVADVVKTRSADQCAKRWKQCLDPQLDRSEWTELENRRLMEACAAKGRRWKEIQME
                     HFPTRSRNSIKNQ"
     exon            complement(118051..118155)
                     /number=1
     exon            complement(118214..118281)
                     /number=2
     exon            complement(118339..118382)
                     /number=3
     exon            complement(118443..118747)
                     /number=4
     CDS             join(124409..124540,124666..125304,125373..126185)
                     /codon_start=1
                     /locus_tag="AO090009000046"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070342000415"
                     /protein_id="BAE54566.1"
                     /transl_table=1
                     /translation="MAAIICSTSLGRIVHWLSGGRLLRFPEEEPGFCLSPAYSTATRS
                     KGPSKWLVPETTTDGMILVDWYSDDDPANPQNWPRWAKIMTYIQINFYTFVVYMSSAA
                     FTPAEVAFQAEYGVSSSVGSLGMALVLLGYGIGPLLFGPLSDKPSIGRNPPYVISFAI
                     FLIVSVLAAVVNNVPGFLFLRFAQGFFGSPCLATGPASFADITNLVNLPSGLWIWGVC
                     AVSAPTVAPTLASLCVASKGWHWSMWLIVWFAAPCFLLLIFLPETFGPTILYQRARRL
                     RTLTGNEAFRSSSDVNHTGLSQETLYDFLVIPWKINAFDPAILFTTLYTALVYAIFYS
                     FFEAVPLVYQGVYAMSLLQTGAIFLTAIVAVLFTTPFYLAITHYTISRPVKAGKMPSP
                     EQRLIPGLLGSLVVPAGMFLFAWTSSTAFHWIVPTIGFLLFMIGMPTLLQSMFAYMSV
                     SYGRYAGSLFAMNDFARSVLAFASILWSTPLYVNLGIDKGASLIGALTVVCVFGIFGL
                     YWFGATLRKRSRFAEYETD"
     exon            124409..124540
                     /number=1
     exon            124666..125304
                     /number=2
     exon            125373..126185
                     /number=3
     CDS             complement(join(126630..127163,127283..127546))
                     /codon_start=1
                     /locus_tag="AO090009000047"
                     /note="dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /old_locus_tag="AO080515000044"
                     /protein_id="BAE54567.1"
                     /transl_table=1
                     /translation="MPRTWFITGCSSGFGRHLAITAAQNGDKVVATSRDPSKLDDLRS
                     LGVIPTKLDIHNETEIQAVIDHVESTIGPIDILVNNIGYILEGAIRILRAVLPSMRAR
                     KSGVVANFGSIGGWNGTPAAGFYCASKAAVAIYTESLAAELLPFNIDVTCVEPGYFRT
                     DFLEGDHKIVASKRIPELDVSTRQTRDGLAAYSLRQPGDPVKGARVLFEALTRTGSCE
                     GRRLSVRLALGKDSLTAIERSLEREQEMLEGWREIIASTDCDDVRGW"
     exon            complement(126630..127163)
                     /number=1
     exon            complement(127283..127546)
                     /number=2
     CDS             complement(join(130571..131912,131983..132170))
                     /codon_start=1
                     /locus_tag="AO090009000049"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070342000411"
                     /protein_id="BAE54568.1"
                     /transl_table=1
                     /translation="MDEGKITDHEVMGEKADITHEEVVQVTQLTPEEQAIEKKLRRRI
                     DCLIMPLVILVYLMNYIDRNNYAAAKLQGLMDDLHIDDQQYQTGLSILFVGYILMQVP
                     SNLLLNYMGKPSLYLGFFTTAWGLVSTLTSQVKSYGGIVACRFILGLVEAPFFAGVLF
                     YLSKWYTKKELALRMSIFYSGSLLSGAFGNLIAAGILNGLQGHRGISAWQWLYIIEGA
                     ITMAVGLTVAVLLPDFPDTWKLLSPEMKHVANRRLAIEAAEADVDEAGKMSQVKGLKL
                     AFSDIKTYALALAYMAITGASGFQNFFPTLTKTLGYTETISLLLVAPPYIFMVAYSLA
                     HSYLSDRFGRRFWFFVYPIPITIVGFVVFMTTDGFGPRYFSFFLMIFVFAQNGTVYSW
                     IANSIPRPPAKRAAAYAFINSVGNSASIWTPYTYRDTDYPYYRPAMGTCIGLQVLGLA
                     MAVLMYFHLRSLNKRLDRLEDEEVTLTPKELERLQKTAEIEGIDIAAARRLQKGFRYM
                     I"
     exon            complement(130571..131912)
                     /number=1
     exon            complement(131983..132170)
                     /number=2
     tRNA            complement(133102..133173)
                     /locus_tag="AO090009t00002"
                     /note="tRNAscan-SE"
                     /product="tRNA-Ala"
     CDS             complement(133767..135017)
                     /codon_start=1
                     /locus_tag="AO090009000050"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070342000410"
                     /protein_id="BAE54569.1"
                     /transl_table=1
                     /translation="MTARVLEVEGQFLYLPGCMIMSFDDPTTRTAEVKLVRMVQGVDL
                     GRLAETHNVYKNVVHDLVGVEEASQELDSIMQRSPRFNKWLLVPAYGLASVAVGPFAF
                     DARPIDMPICFFLGSLVGFMQHVLAPKSVLYSNVFEVSAAVLTSFLARAFGSIKSPFG
                     GEEYLFCFSALAQSSIALILPGFMVLCSSLELQSHQMIAGSIRMVYAIIYSLFLGYGI
                     TVGTTIYGLLDGAANSQTTCKRLDVWGSEYIQHFVFVPVYVVFLAIINQAKWKQVPTM
                     IVIAICGYVTNYFSTKKLGSNSEVANTVGAFTVGLLGNLYSRLWHGHAATAILPGIFV
                     LVPSGLASSGSLMAGITYANEVRENLAKSNSSDTLNSASQDTSIASLGFGMIQVAIGI
                     TVGLFIAALVVYPFGKRRSGLFSF"
     exon            complement(133767..135017)
                     /number=1
     CDS             join(143229..143639,143879..143953)
                     /codon_start=1
                     /locus_tag="AO090009000051"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000409"
                     /protein_id="BAE54570.1"
                     /transl_table=1
                     /translation="MTDLRRDNTVTFHFLEGDVDSIPGPGISGFYDGPYYSYYKFPRS
                     ISDNGAEGESLLSAYDRLYDVVDEEGPFDGVLGFSHGGTLAAGFLIHHAKLYPQELPL
                     FRCAIFINSLPPFRMDPGGTPVIDPDLNGYINIPTHEIDPGTMRGKSNASHPMPNRVI
                     R"
     exon            143229..143639
                     /number=1
     exon            143879..143953
                     /number=2
     CDS             join(144248..144565,144623..145068,145118..145643,
                     145696..146278,146355..150976,151033..151353,
                     151404..152243)
                     /codon_start=1
                     /locus_tag="AO090009000052"
                     /note="polyketide synthase modules and related proteins"
                     /old_locus_tag="AO080515000051"
                     /protein_id="BAE54571.1"
                     /transl_table=1
                     /translation="MPIAIVGMGFRGPGSATHIKELWTMILEGREAWSPIPKSRWNND
                     AFYHPDHSRHGTVSTVISSRHLTILELTTRHTQINVEGGHFLAEDVTLFDAPFFNMTS
                     DEAAAMDPQQRLLLEVTYEGFENGMSMLSSYPGVRSQPIAGIPMAKIMGSSTACFVGC
                     FNADYTDLLLRDPDCIPMYQCTNSGQSRAMTANRVSYFFDMKGPSVTVDTACSGSLTA
                     LHLACQSLRTGDASMAVAAGVNLILSHEFMSTMTMMKFLSPDGRCHTFDENASGYARG
                     EGIGCLILKPLRDAIQDHDPIRAIIRGSGLNQDGRTPGITLPNGTSQEALMRHVYEVA
                     GLDPCETDFVEAHGTGTQAGDHIETAALAKVFCHNRSPMRPLRVGSIKTNVGHLEGTS
                     GVAGVIKAVLMLENRTFLPNRNFRVVNPRIRCEDWKLKIQLSAEPWEYPGPHRVSVNS
                     FGYGGSNAHAILEDASGYLYSRGLRSIVQHGEHVVDANQVCPNRSRVYMFSGFDERST
                     TRQLQNFREYLLKERSEADDRYMSNLAYTLNERRTVHACRAAIVGASPATLAEASSGR
                     VKIVKARRRPTIAFVFTGQGAQWAGMGKELFEAYPVFHESIQRIDDYMLSIGAPYCMV
                     DEILKTQEVSRLSNPLFSQPICSALQIALVDLLASWGIHPDSVTGHSSGEIAAAYATG
                     ALTMEDAMAVAYYRGVVVSSSSFANGQIRGAMLALGTSVRESQSYLEMLQSGKAVVAC
                     INSPTSVTIAGDLPAIDELERIVREKQVFSRRLAVEVAYHSHHMELVKEQYLGHIAHV
                     SPRSREEVANYLHNRSVSFFSSVTGAEINPSELDSRYWVSNLLNRVNFADSLRALCFE
                     TINQRDPVRTLRDKRIKRAGTAQKVSVDALVEVGPHATLAGPIKQTLRDDTKLNAADI
                     LCISVLTRKSNAITTALTAAATLMCTGYPVDSRAINDPTASQEPSVLVDLPQYSWSHT
                     NTYWAEPRVSKTFRNRKHARTDLLGVIDRMACSFQPLWRNFLRVSENPWLLDHRIESN
                     IVYPAAGYIVMAIEAFLQHTLIGTTADEKPTIYIRDISIQSALVLHETAAVETLLILN
                     QCESNSRGSHQAHKFHIYSVTQDNIWTEHCNGLIGAQNGDQVESGLESERAAHNFTSL
                     DIPSFYKALASVGLEYGPCFANIKQARFKNSTCISEIITPDTAAVMPMNFQFPFLIHP
                     CTLDSIIHTIFVNTDTINDPAVPVRIDEMCVSCRTDYAAGSKLNVLTKTQCTRKGDLI
                     ASISVLDKSRRPSISITGLRCRRLGPSPPPESKRMKNHIAHELKWDLDIDFLTGSALS
                     SIVPVCKESKKQSSGFNALHEACALYYIKEYVKHVDQATTEKLQPFRKRQLEFFKEIA
                     TQRYRRSRNIQSGDIERVKSSGPEGHVLCTVGANLSLSLTEDTSLGTVDEHSMWDEYW
                     KTVYGDPAYETVSMYLDLVGHKNPMVSILEVEASTGGASKRFLQRLVGAKGGVTRFTK
                     YTATHPDLHLLESTRDEICAWDHCVEIKELDVEGDLDAQGFAIQQYDVVVIAHGLYTV
                     KSKHKALSNIHSLLKPNGHLVLIDPLFKPKLSEYVIFADFAGPWKQDGVGYFNNDLIT
                     TLKDAQFSELQELNGSRDQHMVIISRPTRQQTSLTSEVVIVAEEGECGVQIPHLRDLL
                     SSVSQVDTTDLAHLKPQRKACIVLSDLQLPVLTHLNQATMDIIKQMFLEAAFVLWVTR
                     GGTITPANPEAGIITGFTRTARSETGVEPIITLDLDAGSPLCGYRAAELIYDLVRHRM
                     LGGKSAESDTEYVERSGALLVPRIMENRRLNEAIASVQDKHLTSVEAFHQENRPLRVA
                     VNDSVQPEDIHFIDDSRITTLSDNEVRIQVHAVGLSERDAQLADNQASGAAEIGLGCS
                     GTVQAVGRSVRNLIPGDRVACLRSGTAASFYQDRETAFQKIPSDMSFETAAAIPAAYC
                     TAFHAVHCLADIKPGDRILISSAAGAVGQAAIEVCTVSGAHSYALVGSAADKELFVSS
                     SLLSDERILRTDESYFKDLLMLTDNKGVKTILNCGESDNHTFRSLWKCFGASGTFIQL
                     HARNTAEKRGWEVPELDKDIIFATMDIENLVNNNSEMLDEVWDRVARLFRRGTLRGHS
                     HPTSYSISNFAEALDVLTLTNHRDLIVLTAGTDTIVPRQPDMLLRPDVSYMLVGGLGG
                     IGRATALWLADHGARTIIFVSRSGLSGASSQRTIQGLNEKGVRTIIHACDISQSDQVE
                     KMVNDLQETVPPIRGVIQGAMILRDTHIEKMTLADYTTILGPKYHGTWNLHRYLPSNL
                     DWFVMLSSISGIIGNATQAAYAAGSTFMDSFAAYRNSLGLPAVSLDLGVITDAGYLAE
                     NKELASKMEQQGFQGTDTKTLMSLIEVAITSCQEDRTTSQIITGLGQWKAGRSLPNFD
                     APLFSHFRRLHLDTSVSSQTEIPDTLRQDLQATKTLEDATAVIYTALSTRVATHLSIP
                     VDSINPTGPITEYGIDSHVAVELRNWISKHIEGTVPILEILASSSLMELAGKIADRSN
                     LVRVDEEQLSSAF"
     exon            144248..144565
                     /number=1
     exon            144623..145068
                     /number=2
     exon            145118..145643
                     /number=3
     exon            145696..146278
                     /number=4
     exon            146355..150976
                     /number=5
     exon            151033..151353
                     /number=6
     exon            151404..152243
                     /number=7
     CDS             complement(152674..154089)
                     /codon_start=1
                     /locus_tag="AO090009000053"
                     /note="Na+/H+ antiporter"
                     /old_locus_tag="AO070342000407"
                     /protein_id="BAE54572.1"
                     /transl_table=1
                     /translation="MVWSQINPTPLNLSFLFLSGSILLYTVLSRFLKETLLLAEPPLA
                     TLVGILTGPAVLGAVEPQPWKLGNHVTKELARLTASMQVFIVGIELPEGYCSKHWKGI
                     GILLGPVMIGGWVVCAILIHLIFGASYPSALVISACLTPTDPVLVATILEDPKATSDR
                     IKYLLAAESGVNDGTSFPFLYLGIFILKEHSAGAVLREYLTVTIAYQCIASVAVGISL
                     GYGANRLLRYSHERGRITENFVALFPLALIFFSLGFSSTMGMDDFLLVFSAGIGYAYH
                     GWLEHAYQVNPVATSFISFSLSIATFIYFGLMIPWAAVTDTPKLSLSKIGIFVLLVLL
                     LRRIPFIIASKRFNPDIKTYREALFCGHFGPMGVGALFLSMEARDILNSSCSRTKMQP
                     GDDWDKYACETVELVWPVVCFTVLGSVVVHGLSMSIAKLARTLICAQKQHTKSLCTSD
                     DPSTGSESMDGGMYHDEESLL"
     exon            complement(152674..154089)
                     /number=1
     CDS             complement(154865..155383)
                     /codon_start=1
                     /locus_tag="AO090009000054"
                     /note="uncharacterized protein conserved in bacteria"
                     /old_locus_tag="AO070342000406"
                     /protein_id="BAE54573.1"
                     /transl_table=1
                     /translation="MSKSYDKVLTFWFGQKGSREYLQQKSFWYGSPSDDAYVRKHLGS
                     DYEAARTGALDGWKFDGQGEGALALILLLDQVPRNIFRDTPKAYATDAKAVAVARYAV
                     DQGWDKNMPVIQRRYMYSPFNHSENLEDQEMSLRLFTELGDSYHLHWARNFHDQIKRD
                     GRFVHRDRILGR"
     exon            complement(154865..155383)
                     /number=1
     tRNA            155681..155752
                     /locus_tag="AO090009t00003"
                     /note="tRNAscan-SE"
                     /product="tRNA-Ala"
     CDS             join(159676..161409,161483..164008)
                     /codon_start=1
                     /locus_tag="AO090009000055"
                     /note="pleiotropic drug resistance proteins (PDR1-15),
                     ABC superfamily"
                     /old_locus_tag="AO080515000055"
                     /protein_id="BAE54574.1"
                     /transl_table=1
                     /translation="MEGQDYYAKAPPSDNRDDTDSTATMMGDESAPTPRPANVSRAED
                     WSLMPQVKQQHERDVASGFKSRELGVTWKNVNVEVVSSEAAVNENFLSQFNIPQKIKD
                     GRNKPPLRSILQNSHGCVKPGEMLLVLGRPGSGCTTLLKMLSNRRLGYKSVEGDVRFG
                     SLTHKEANRYHGQIVMNTEEELFFPTLTVGQTMDFATRLKIPFNLPKGVESAEAYRLE
                     MKKFLLEAMGISHTNDTKVGNEYVRGVSGGERKRVSIIECMASRGSVFCWDNSTRGLD
                     ASTALEWTKAIRALTDVMGLSTIVTLYQAGNGIYDLFDKVLVLDEGKQVYYGPMSQAR
                     PFMEDLGFVCREGSNVADFLTGVTVPTERKIRPGYENRFPRNADMLLAEYEKSPIRAQ
                     MMAEYDYPDSDLARERTDNFEMAISHDRSKKLPKNSPMTVDFVQQVKACIIRQYQILW
                     GDKATFIIKQVSTLAQALIAGSLFYNAPNNSGGLFVKSGALFFSLLYNSLLSMSEVTD
                     SFSGRPVLVKHKGFAFFHPAAFCIAQITADIPVLLFQISIFSLVVYFMVGLTMSASGF
                     FTYWVLVFATTMVMTALFRAVGALFTTFDGASKVSGFLISALIMYTGYMITKPQMHPW
                     FGWIYWINPLAYGFDALLSSEFHNKIIPCVGTNLIPTGPGYENVPNHQSCAGVGGAIQ
                     GNNYVTGDQYLASLSYSHNHVWRNFGILWAWWALFVAVTIIATSRWKAASESGNTLLI
                     PRERLDKHSQVARFDEESQVNEKEKKRNDGSSQEGDDLDNQLVRNTSVFTWKDLTYTV
                     KTPTGDRVLLDNVYGWVKPGMLGALMGSSGAGKTTLLDVLAQRKTEGTIHGSIMVDGR
                     PLPVSFQRSAGYCEQLDVHEPFATVREALEFSALLRQPRDVPDDEKLKYVDTIIELLE
                     LHDIADTLIGRVGAGLSVEQRKRVTIGVELVSKPSILIFLDEPTSGLDGQSAYNTVRF
                     LRKLADVGQAVLVTIHQPSAQLFAEFDTLLLLAKGGKMVYFGDIGDNGQTVKDYFGRY
                     GAACPPGVNPAEHMIDVVSGTLSQGRDWNKVWLESPENQRSIEELDRIISDAASKPPG
                     TFDDGREFATSLWTQIKLVSQRMCVALYRNTDYVNNKLALHVGSALFNGFSFWMISDT
                     VHSMQLRLFTIFNFIFVAPGVINQLQPLFLERRDIYDAREKKSKMYSWVAFVTALIVS
                     EIPYLCLCAVLYFACWYYTVGFPTDSNKSGAVFFVMLMYEFVYTGIGQFISAYAPNAI
                     FASLINPVIIGTLASFCGVMVPYQQIQAFWRYWIYWMNPFNYLMGSMMTFTIFDVNVK
                     CKDSEYALFDPPNGSTCGEYLTEFMQGMGARMNLLDADATSGCRVCQYTRGSDYLLSV
                     NLMDYYYGWRDAAIVALFALSSYALVYVLMKLRTKASKQAE"
     exon            159676..161409
                     /number=1
     exon            161483..164008
                     /number=2
     CDS             join(166436..166526,166535..167064)
                     /codon_start=1
                     /locus_tag="AO090009000056"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000404"
                     /protein_id="BAE54575.1"
                     /transl_table=1
                     /translation="MSWKEQKVCARWRVRQSRTVQGSCQANIAWSFIHQRSPDENNDD
                     ISRDNDYCASRGSGGFDFNRSPSESSEDSSSSSIISINNSSRPMLDVFIERFVDAFSP
                     EVDVKSGQAGALRRAAEIRMFSPLLMDAFEVVSATFFGRSIQDPRIEKSGTLLYGRVL
                     RNLQNALFDPERSKAESTLATVILLMAFEVTLLLSSVRFQLLNHRF"
     exon            166436..166526
                     /number=1
     exon            166535..167064
                     /number=2
     CDS             167219..168013
                     /codon_start=1
                     /locus_tag="AO090009000057"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000403"
                     /protein_id="BAE54576.1"
                     /transl_table=1
                     /translation="MNAMSSHAWTNASNQVGAALVRRQPSFLAEEDWINVPWSAGTTK
                     KDILHYLLDLTVEVPSLLAEYDALEVTRQSGVPSAHEITVKQAALWNGVTNLTCRFLQ
                     WKIDWVDAYPDGPPKEVPAEPNEHFPIFRCRDLRTGAVITPTKLVYPNLRLAQTMCLY
                     YTSRLILSTVDTRPDDDRVGPAQQYALGCGICRTLEWYILTAPGNMINRLAFPVRVAW
                     EVFPDGGPERRFIYDVLKLVEKRHSLGLWGSGMSELSPRAGSPPKA"
     exon            167219..168013
                     /number=1
     CDS             173530..174363
                     /codon_start=1
                     /locus_tag="AO090009000060"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000400"
                     /protein_id="BAE54577.1"
                     /transl_table=1
                     /translation="MKLHSLLPLAALLTPSLAIFGINDFECELTSEHPNPVVLLHGLG
                     ATYYEDLNFLQYWLQSQGYCTYAQTYGAYDGFPLLGGLRPISESSSEIAAYIRDVADK
                     TGAKKVDLVGHSEGAFQSLYVPKFQGVSGLLDKIVAIAPPTHGTNFGGLYNLAYLFGN
                     VSREVVGDVLSTFGCPACDELGPDGAAVKRLNDGQPILQSGNNLTVIVSKYDEMVTPH
                     ETSWVEGANNIYVQDFCPLDPVGHIGEAYDLNVWNLVKNALDGTPDRKFICVIGSPGK
                     I"
     exon            173530..174363
                     /number=1
     CDS             complement(join(174495..174585,174638..174777,
                     174838..176212,176267..176469))
                     /codon_start=1
                     /locus_tag="AO090009000061"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070342000399"
                     /protein_id="BAE54578.1"
                     /transl_table=1
                     /translation="MRRARNQRHRIQSTKSDWSGQNRGRRSCGRPEGKISALYRVCTA
                     SILYEYNPANYLIPFSLVLVMVIFELDNSTVGTYRNFATSDFKHLSVLATLNTAASII
                     TAVSKPPIAKVSDVLGRAEAYIFTITCYILSYILCASSKTFNIYAGGYVFYSVGQAGT
                     AILNSTVVSDISSMRWRGFVYNILYIPFLITPWVSAFIVDSVVNGIGWRWGIGMFAIL
                     MPFCASFIIVTLLVFERRAKRSGLILTERLNLFTFCSRIDLGGITLLSGGFALVLIPI
                     TLAATTSDCWKTPWVVVLIVLGAIALACLYPYEKYFARHPVVPTHYFRTLSVVVSMAL
                     ACVDNIGFGTTQTYLYVWSMVSHNFSPRDAQFLNYTNSVMQALVGMGTGLLMYRLRSY
                     KWIGVVGAAIRMVGYGVMVRLRKNESSVAELFIVQLIQGAGSGMIETIVIVAAQISVS
                     HAELAQVTSLILLGSFLGNGIGSAIAGAIYSNQLRDRLRLHLGHSVDEATVVRLYNSI
                     TDTLPTWGTVERNAVNRAYSDVMGYVSRGGSMMHANNRRYITIAALALSAPVVILSLL
                     IPNKRLGDGHNLVQDNQSNDSRTSDETLVDEKTCTR"
     exon            complement(174495..174585)
                     /number=1
     exon            complement(174638..174777)
                     /number=2
     exon            complement(174838..176212)
                     /number=3
     exon            complement(176267..176469)
                     /number=4
     CDS             join(177787..178059,178131..178235)
                     /codon_start=1
                     /locus_tag="AO090009000062"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000398"
                     /protein_id="BAE54579.1"
                     /transl_table=1
                     /translation="MASNSVIPVDQPNTTAEILRLQNRLTDIRNQRKILELRNEIARE
                     SQLLADAQHRLQATESQMMTGDRSLNSSHTPTRLTAGSAIPADKGIKKRGAKASHKQK
                     VLWTGSIIVYHPGQQLARFLLQT"
     exon            177787..178059
                     /number=1
     exon            178131..178235
                     /number=2
     CDS             complement(join(179200..179556,179612..179919,
                     180009..180216))
                     /codon_start=1
                     /locus_tag="AO090009000063"
                     /note="ribulose-5-phosphate 4-epimerase and related
                     epimerases and aldolases"
                     /old_locus_tag="AO070342000397"
                     /protein_id="BAE54580.1"
                     /transl_table=1
                     /translation="MAPSTATETAPPITLQARESTQEAGAEKAKVKMNIPRPPVFDDK
                     MKEREYLKGRLAAAFRIFGKNGYDEGVAGHITLRDPVDPSTFWVNPFGVAFSQIKASD
                     LILVNHAGEVIDGGPCRLLNAAAFMIHSAIHAARPDVNCAAHSHSLHGRAFCSLGRPL
                     DIITQDACAFYNDHVVYKQFNGIVLAEEEGKNIAAALGDRKAALLQNHGLLTVGNTIE
                     ETVFWFVSLEKCCYAQLLADAAAAGRGGQTIKVDDADAAFTYKSVGTPLAGYFSAKPL
                     FDVIHEETKGSYLN"
     exon            complement(179200..179556)
                     /number=1
     exon            complement(179612..179919)
                     /number=2
     exon            complement(180009..180216)
                     /number=3
     CDS             join(184783..185348,185401..185674)
                     /codon_start=1
                     /locus_tag="AO090009000065"
                     /note="fructose/tagatose bisphosphate aldolase"
                     /old_locus_tag="AO070342000395"
                     /protein_id="BAE54581.1"
                     /transl_table=1
                     /translation="MLCIALIWIDCLANSWNSYNNDGVMAVTRAAEAKRSPALIETFP
                     WTMHFQGPHFVKYIVEAAHAASVPIGVHLDHRMDPAEVEQALKLPIDSMMVDASRLEP
                     EENIEYCRQITEQAKIKGITVEAEMGRINGGEDGIPDASHLEEIWTDPQHAEEFTRRT
                     GVQFLAPSFGNIHGPYPEGGSEKYWQLDRLKLIADAIGPTIPRVIHGTHPVPDWLFHK
                     AIATGARKININRNARDGYTAFVAENADRLELTALKEQSVAIYQRSVEHLMDVLGSSG
                     KAH"
     exon            184783..185348
                     /number=1
     exon            185401..185674
                     /number=2
     CDS             complement(join(186298..186709,186922..187301))
                     /codon_start=1
                     /locus_tag="AO090009000066"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000394"
                     /protein_id="BAE54582.1"
                     /transl_table=1
                     /translation="MGIHYHHDITALETLKLQPISRLAPFSALIISIVLVVLFVIRYY
                     VLEGFLIKRLYGSIYTNLSEVNRRGFINHHIAGLTKILILIVAAYPFLEVVIGKSSFH
                     TPYAHGSRVTMGDMLVVVAQMLIGIPLSGAFDIISEFFPHLAIILYRIFPNRHRFLKR
                     LFLLSCITTALGTTCETIVIFFLFGSLWDRWQIAFKVVTPLLHIAFSAAQVHGSVVFW
                     KMYKRQQKLEEEIPGFDIENGEITEMHVHADKTKPSSSGSTVAIV"
     exon            complement(186298..186709)
                     /number=1
     exon            complement(186922..187301)
                     /number=2
     CDS             complement(join(189563..190377,190431..191379))
                     /codon_start=1
                     /locus_tag="AO090009000067"
                     /note="multicopper oxidases"
                     /old_locus_tag="AO070342000393"
                     /protein_id="BAE54583.1"
                     /transl_table=1
                     /translation="MKSSLFCILSSIVAANATSVPSFLARDSVSASLSSSASLSTSSS
                     GACTGNTASTRDQWCNYDINTDYTTTIPETGVTREYWFDLEHVTVAPDGRSRFALAIN
                     GSIPGPTIEADWGDTVVVHVNNKLPSSVKNGTSIHFHGIRQYYTNPSDGVVSITQCPT
                     ASNSTITYKWRATQYGSTWYHSHIGLQAWEGVFGGIKINGPASANYDVDKGFIILNDW
                     DINTVDQLFDSAQNDGPPELDSALINGMNVFGEDGYANQTGTRWNTSFTEGESYRFRL
                     VNGACDTHFKFMIDNHTMTVIANDLVPIEPYNTSVLDIAMGQRYDIIVHADQASIAKN
                     FWLRAIPQEACSENQNPTNIKGIVYYGSSPSTPTTTTGYSYTDACDDEDMSNLVPIVN
                     PYTITSNPLYNESEPVSLGKNSQSLYRWKLNSTSMHVSWDDPTLLEIYRNHTSFSNTS
                     GVVQLPRADEWAFVIIETTLSVPHPIHLHGHDFVVLSQGSGTYSAGDITTNNPPRRDT
                     AMLPANGHLVIGFVTDNPGAWLMHCHIGWHTEEGFAIQFVERYSEIQDLIDYDSLHSN
                     CQNWETYQSGKNFAIEDDSGV"
     exon            complement(189563..190377)
                     /number=1
     exon            complement(190431..191379)
                     /number=2
     CDS             complement(join(193649..193867,193941..194348,
                     194444..194707,194763..195021,195071..195195,
                     195256..195302,195361..195407,195459..195604))
                     /codon_start=1
                     /locus_tag="AO090009000068"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070342000392"
                     /protein_id="BAE54584.1"
                     /transl_table=1
                     /translation="MAEKPRSCIDRETKCTAPSDTVDGQKERGSVDVLGPEEEKRLVR
                     KIDLHLMPLLIISYGLQFLDKTSLSYSAILGLKEDLNLVGQEYSWASSIFYIGYLAAS
                     YPISLGFVKFPLGKYLSLLIFLWGAILTLHAVANNYAGLMVLRTFLGVFESAISPGFS
                     LITGMWYTPPEHVSRHTFWFAGNASFSIIGSLIAYGIAHYQDHFSQWKMLFLIFGLIT
                     VAWSVVLWFYLPDSPSNAHFLSSSEREFASLRPKKFQRTTQTRKWDRDQFIESFTDPK
                     TWWLLIFSFVICVPNGGTTSFQSLLIAGFGYDKYQTILMGLPASAFQLVVVLLATIFC
                     TNVRKSRLVAIIMIFAMALAGILMVKLLPSEQKLSRLAGYWMSSAIAPVFPLMLSLHA
                     SNTAGFTKKSTVAALIFVGYCVGNLIGPQFFKDSEAPYYPTAYTTIVICYAIAMASAV
                     VFRVYLGWENRRRDKQQGVHINPEETREIDLHTDEGLDHADETDIQNRSFRYIV"
     exon            complement(193649..193867)
                     /number=1
     exon            complement(193941..194348)
                     /number=2
     exon            complement(194444..194707)
                     /number=3
     exon            complement(194763..195021)
                     /number=4
     exon            complement(195071..195195)
                     /number=5
     exon            complement(195256..195302)
                     /number=6
     exon            complement(195361..195407)
                     /number=7
     exon            complement(195459..195604)
                     /number=8
     CDS             complement(196674..197894)
                     /codon_start=1
                     /locus_tag="AO090009000069"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000391"
                     /protein_id="BAE54585.1"
                     /transl_table=1
                     /translation="MSSISPASLESGGLGSSKTNEDRHEARSTSVHSREQVFAPEMSI
                     SSSLSSLSYRDSSIIGPVVSPSPLLTPEQQVDEESTPSPPNTRLGRQAGLQEEYRVLH
                     YCPPINLLDPMPLLLMNYTHGIPTHDVDDMHALSFHRTIFGPLKSTRTPAQSAQSLFV
                     DYVVDKKMALHFLLAVAHSELSLYYDNGLVLPQKSYLHFDQGTKLLRYASTPRGPTDH
                     VNMMLSFLYMYMFWMRRDQPAPQKLRELSRTVVDYVRTYKVDELCTNDDVNVFSETFA
                     AGLLIPDQVLLARIFTYLYDRDGFCSFFGCGGSFATFVNDDYSKRRKIWRLSRTAFLL
                     FPEENGLTSDSLPEVHEAAILELYFMLITIHHEINIYSQTGNLHRYGDERRLKQHLDE
                     LKKVHTVAHTNFVS"
     exon            complement(196674..197894)
                     /number=1
     CDS             join(198726..200128,200202..200379)
                     /codon_start=1
                     /locus_tag="AO090009000070"
                     /note="carboxylesterase and related proteins"
                     /old_locus_tag="AO070342000390"
                     /protein_id="BAE54586.1"
                     /transl_table=1
                     /translation="MGNVLSGYQSAECEVELFNNAGKIRGLQFDSKSRRYADIPYALP
                     PTGDYRWRKPRPLPESFSYSSPDGTPYDATKFGKVCLQSSYSASVKKQLPQHIFGEDC
                     LRLNIWTPVGKPNETNPKWPVMIWFHGGWFQIGDPSQEESMDPTELISTGQLNAVFVA
                     VGYRLNVFGFLAGEVLREESGGQEVGNYGLWDQRLAMEWVYKNISAFGGDPENITLSG
                     RSAGAYAVQAQTLYDFRGSMDESARSHFRRLVMYSNAIPTQPKTPEDCQPQFDELCEH
                     FKISPEIPGPEKLQRLRQIDAEELCDAVMKLKHHTFRPVTDGVFIHPGIFEYYRDGSF
                     ANEFKRRHLRLLIGEVLNEETLYAVTNGPQANRESLELQVSNYYSPSTTSRLLQHYPL
                     PDSDRKEDWEGVFGRIISDGQVRAPSRFLVHNLLQHGVDIKDVWRYLIAYRMSFITEK
                     VAPAAFGVSHAMDRPIWNYSVMHGPNPAERQLMDNWIHDLVAFVNGDNDHSYGTKECD
                     EYKVMTPDGNIEIQKDPR"
     exon            198726..200128
                     /number=1
     exon            200202..200379
                     /number=2
     CDS             join(201612..202763,202844..202967,203036..203148,
                     203206..203641,203699..207285,207342..208520,
                     208577..210664,210872..211057)
                     /codon_start=1
                     /locus_tag="AO090009000071"
                     /note="polyketide synthase modules and related proteins"
                     /old_locus_tag="AO080515000069"
                     /protein_id="BAE54587.1"
                     /transl_table=1
                     /translation="MEQCCSNLAFPEAAEVKEPNSVRRPAPVRLNRDKVTEYVADNVR
                     EDPVPFPIAIVGMGMRLPGGVSSGREFWDFLVNKRDGLCRVPETRYNVDAFYDEAREG
                     AVRTKHGYFLEQDIAQVDVGFFGISKLEAEKLDPQQRLLLEVVWECMENAGQTNWQGT
                     NIGCFVGVFGEDWLDLLSKDTQQHDRYRVMSAGDFALSNRLSYEYDLTGPSVTVRTGC
                     SSSMVGLHEACQAIYTGDCSSAIVAGTSLIMSPTMTTTMSENLVLSSSGICRTFDAAA
                     DGYGRGEAINAVYIKPLDDALANADPIRAIIRSTAVNCDGKTPSITTPGSKAQERLIR
                     RAYKKAHIEGDDILKTAFFECHGTGTIAGDTAETTGVANIFGEKGIYIGAVKPNVGHS
                     EGASGITSIIKCVLALENKIIPPNVHFQTPNPKIPFESAKLQVPVEPTPWPADRKERI
                     SVNSFGIGGTNAHVILDSASSVLRKISPEARLASEPDYQLLVLSAKEKKSLDGQIERI
                     TRYIEANTSCLNDLAFTLARRRDHLPYRAFAVTDKDGSLPTFQKAQSTVPCPVFVFTG
                     QGAQWPTMGMGLMGRFPKFREDIHQMDKILTELREAPPWSIEEELSKDEAVSRVGHAE
                     FAQPLCTAIQIALVNMLREWGIVPYAVVGHSSGEIAAAYASGAISARVAIILSYFRGQ
                     AVKFLSTSHAGAMAAVGISPDTARAFLEEGVTVACENSPVSVTLSGDKEALDRVLNRI
                     RKDDENAMCKRLRVDVAYHSHHMLRTRQTYESLISPYVCHNSSMVPLYSSVISTPITE
                     PSRLDTMYWSQNLSSPVLFRTAVQGLLDDNGPVKLFLEIGPHSTLAGPLRQIFQAQTS
                     KNRAALYVPTLCRGTEEWQSLLATAGHMFTHSIPIDLSNIIPNGAALRDLPPYFWKHG
                     ERFWNESRLANHWRLRQEPHHELLGSRVLESSSVEPSWRNILHIDQVPWLGDHKIGKD
                     VVFPCAGYVAMVGEAIRQITELTEYSVRNVFMRAALTLETSIATEIITSLRPARLADN
                     IDSVWYDFTISAYQNSTWKKHCIGQVRPTSDQTFKAKRITPYPRLVRSEKWYNALEKR
                     GLEYGPQFRGLEQISASPSSYQAAATLQDDESLYVSHYSLHPIIIDESLQLLSVAATH
                     GIPRRMTRLAIPTAIEELYVGNGRGTMSLNVSCDTSGGMMRGNAVLVSDDQVVLSLHH
                     GIFFSIQDPDIGNPQLPVAATIHWGPHIDFVPAEKLFSSSQNFLEGRRRVVRLVGLYG
                     VEYYYQTRSSQPTQAHLSKWLSWITSNYKYMRDNAPVLVPELRDICSLSPAERAAEIE
                     GLKSMQPQDFGYPFYVLCSRILGSIHKLLGGQLEPIDLLVEDGALKYFYEQSALNGSW
                     HEFASLLGHSYPQLRVLEVGGGTGGDTLIALKGFTMDHSNRLYSTYTFTDISPGFLLE
                     AKERYKSYPAMEYATLDISRDPVEQGFEPESYDLIIAANVIHATPRISETLRNVRRLL
                     VPGGRLLLIELACTIPIIDYIMGILPGWWLGEGDGREERPYMSVDKWHDKLLDAGFTG
                     VEAFRYDNEPPYHLNAQILSRVPSAKSPEKGEVSLLYLTEIHDWARELARDLEKAGYS
                     VHWCTLKQVPSSGANIISVIDLEGPFFHELSPADFESFQSYVSRLADRHLLWVTRFVQ
                     MECDDPRYALVLGLARTIRHEIMPQFATIEIDQVERASLQPVVQVFERLLSQLDDPGA
                     APEYEFAVREGSVHTPRFQFNSFEEQVGAGESQGPRMLDIEAYAMLDSLTWTCADMTS
                     NDLEKEEVEVDIKYVGLNFRDLMVVMGLMGDMAQVGLEASGIVRRVGSAVHQFSPGDR
                     IMISHLGLMCTRTVVRTERCVQIPDNISLEDAATIPCVYATVVYSLITVGGLKRGQSV
                     LIHSACGGVGLAAVQLCQLIGAVIYATVGSEDKARHLVDNFKIPADHIFDSRSSSFLQ
                     GVLRKTDGRGVDLVLNSLSGDLLHASWQCVAKLGKMLELGKRDFLGHGLLEMDRFLDN
                     RSFIGIDLLQVLDENIGVLQEMIGCVMEYFQEGKAGPINPVTVFDAANVVKAFRYMQS
                     GQHMGKIIVKMPDLPLALPVARVHEMAAYFPANASYLLVGGLGGLGRAVATWMVEKGA
                     RHLVFLSRTGANTFESSSFIKTLECQGCDAITVVGNVGYIDDVQRAVSAAKTPIAGVI
                     QLSMVLKDQSLHNMVHEEWVAALYPKVKGTWNLHHVLKDKPLDFFLLMGSMAGIIGWP
                     GQANYGAANAFLDAFVKYRQSLHLPAHAIDLGLMGDIGYASEASLVPTLEASQSNSLR
                     VLDERQFLWAVEVAVLAQRFQCPNQVVVGLGTTRTLSSADFASNWIKEARFGIWKNII
                     ATMEQPAEASRADELREHMEAIKNNPSLLDRPETEERIVIELGRLIASYTSRPEDMTI
                     EELSNIPIDSLMTFEIRTWFRRHAGIEITLVEVSNSGTVGGLGKIAVQKLRDKHTCKG
                     HKGSESQDGDSDGSEKEPSYHDDLTLAKTMRPISNNIPDWTSESEGNVFFTGATGFLG
                     AFLLSELIALPHIKQIACLVRANTSDMGHTRIKQTFANYGLPVDFRSKVIAIPGDVTK
                     RNLGLRPETFSHLAQWSSVIFHFAGYANYTLPYSVHRGPNVLGLLETLRLANTERLKP
                     IHYCSSISACGISENLIGPVPEDVRPRPESQNVAQSIGYTQSKFVAESIVWDAIENGF
                     AIAIYRPSLVTGHSRTGVCKKEDIINRLLSNCIRLGCYPHPPQQRFHFIPVDFACSAV
                     SRISLNRSSFGHAFNITQPDQDKVITLGEVYTILNNYSPTPLVSIPTAEFIKRLTKKR
                     DSLIKVSSSILAERLAGHRIWWDDWEYMAAYSTENLRRAMTDHPDIIGLKPVPELLKV
                     YYNFWSRAQMAGKLGRSITRRLKANYLENKPQGNSAKYATLHDRGRWVWCEAPDLCNP
                     VYKNSTKRAP"
     exon            201612..202763
                     /number=1
     exon            202844..202967
                     /number=2
     exon            203036..203148
                     /number=3
     exon            203206..203641
                     /number=4
     exon            203699..207285
                     /number=5
     exon            207342..208520
                     /number=6
     exon            208577..210664
                     /number=7
     exon            210872..211057
                     /number=8
     CDS             215620..218289
                     /codon_start=1
                     /locus_tag="AO090009000073"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000387"
                     /protein_id="BAE54588.1"
                     /transl_table=1
                     /translation="MATTTASFSKTLQSLTQSKIHELKKQRIAYESQKSQILASAAQQ
                     SDPRDRVACILQGIKAIRSENDNLKDSKIANIERWLDQARYDSSIPQEKLDSFQEHLI
                     ATLDAQSMRLNIADLYSRLLTEWMEPSSVSDHISDEEEGYLVVEERQKQRLQQLCDQF
                     EKVVFEPLETDENEIHGFIDDLFPSEDSRVALDNLRKKVAHECSELWHKTDPFNIYSI
                     RPCIRGLLTEDLLSEEKQEILKYCLDNTVALTEITDVLNMRYADLKNWDWHAEDGIPV
                     LPRQQLNGKYRIWIDDDVLQTIFTQYIAVRLCSIVKTILKEFIEKKSVWNWHPSPRMT
                     GRDSLRRQYYLSDYDIKSSIETSRKKDYLESDFLFHMPLTESSLSERGMLYDDENNED
                     GSDRGINGPSNIKQQLLRKVASQVLLERQIYGQAVVVQSDMKWYATALPHSTILAVMK
                     FFGFPDEWLAFFRKYLAAPLNLDHSAEGRMQTGPRIRRRGVPISHAMEKLTGELVLFP
                     MDLAVNRETGLLLYRIHDDLWVCGKPEKCARAWEVMQDYAKVTGLEFNRGKTGSVYLT
                     DTPDPQITARLPTGQVTFGFLTLNAESETWEIDQSQVDAHVAQLQKQLSRCDSVISWV
                     RTWNSCIGRFFKNTFGQPAHCFGRAHMDAILSIYEKMQNTLFNVEGGHSGNTVTEYLR
                     RKIESQFGVSDIPDAFFFLPAELGGLGLRNPFISVLLVRDSVDLSPVERIDRFKKGEH
                     GRYAFAKKTFEETPEKTRRRRAETVNPRPKSGEPLVITEAEMHTFMSFEEFTRYRESR
                     SNNLRVLYEDLMLVPYTKTIQSTRECRDALNAVCGQFQLSDKNPEMKWILQLYSDDVL
                     KRFGGMTLVEKRFLPVGILSMMKEKRVKWNMVL"
     exon            215620..218289
                     /number=1
     CDS             complement(join(218640..218876,218963..219082,
                     219140..219195,219246..219349,219402..219446,
                     219498..219622,219673..219778,219838..220024,
                     220075..220153,220201..220339,220391..220448,
                     220503..220680))
                     /codon_start=1
                     /locus_tag="AO090009000074"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO080515000072"
                     /protein_id="BAE54589.1"
                     /transl_table=1
                     /translation="MAPSTAIAEERAVDSASDIVQKAPKRKWVSYIWDTFDKSPEERR
                     LMFKLDSAILTFASLGYFIKYLDQININNAFVSGMKEDLGMYGNELNYMQACWTVGYV
                     IGEIPSNILLTRIRPRYWIPAMELLWTVLTFAMSRCHTSTQFYVLRFFIGLAESTFYP
                     GMQYIIGSWYRKDELAKRSCIFHTSSGIASMFSGYLMAAVYNLEGRGGFRGWQWLFIV
                     DGIISLPVALSGFVILPDVPEISNPWYLTKDEVALSQKRMQLEGRKNREPYTRSKLKK
                     IFTSWHIYLLTVLYITFNNGAAGSQPVFQQWLKHSTDPKYSVGQINAYPTTTAAVQVV
                     TTLAYAWSSDTFLNGKRWPPIIFGAIINIICYVSLAVWDIPDGWKWTCYILAGAGYGL
                     SGLCMAYNRWAHEICSSDNEERSLVIGSMNEMAYVFQAWLPQVVWQQVDAPQYRKGFI
                     TVSILSVILIATTLWIRQLDLKERRVS"
     exon            complement(218640..218876)
                     /number=1
     exon            complement(218963..219082)
                     /number=2
     exon            complement(219140..219195)
                     /number=3
     exon            complement(219246..219349)
                     /number=4
     exon            complement(219402..219446)
                     /number=5
     exon            complement(219498..219622)
                     /number=6
     exon            complement(219673..219778)
                     /number=7
     exon            complement(219838..220024)
                     /number=8
     exon            complement(220075..220153)
                     /number=9
     exon            complement(220201..220339)
                     /number=10
     exon            complement(220391..220448)
                     /number=11
     exon            complement(220503..220680)
                     /number=12
     CDS             complement(join(221347..222150,222198..222344,
                     222403..222681,222747..223031))
                     /codon_start=1
                     /locus_tag="AO090009000075"
                     /note="flavin-containing monooxygenase"
                     /old_locus_tag="AO080515000073"
                     /protein_id="BAE54590.1"
                     /transl_table=1
                     /translation="MTRTQIHKVAVIGAGISGVVSAGHLLAAGFDVTVFERNKVAGGV
                     WYVSCGIFGMAQKLTEDRLYDERQPIEPQYPATKPSETDQPAKDRHQKERFCSPCYES
                     LRNNVPTPLIRVKLNAWPEGTPDFVSHDVIKEYIQDTSRKARVDDVTIYGARVKDLRK
                     RGDKWEVFWSTVGENDQSDMVVELEEISVFDAIIVASGHYHAPRIPDIPGLSEAKTHW
                     ASRIMHSKGFRKSQGFENKNVLLIGGGVSSADIAKEIGPVAKTVYQSTRNGDFDLPAS
                     LLPDNGVRIGEVSHFEIDRSQDTVSDDEPLPLTIHLKSGQKLCGIDRVIICTGYHITL
                     PFLRDYHSDHTPAELADEKILVTDGTQVHNLHKDIFYIPDPTLAFIGVPYYTATFTLF
                     EFQAIVATQVFAGIAQIPPADVMRLEYLAKIKEVGSGKKFHSLKDKEEFYVRDILQWV
                     NEDRATYGLGPLEGHSTQWLEAKEEHRKRIEGLWQSTGRRDSGVGELPVLAVCS"
     exon            complement(221347..222150)
                     /number=1
     exon            complement(222198..222344)
                     /number=2
     exon            complement(222403..222681)
                     /number=3
     exon            complement(222747..223031)
                     /number=4
     CDS             join(223603..224121,224180..224923)
                     /codon_start=1
                     /locus_tag="AO090009000076"
                     /note="probable taurine catabolism dioxygenase"
                     /old_locus_tag="AO080515000074"
                     /protein_id="BAE54591.1"
                     /transl_table=1
                     /translation="MLILVQDCREIDRSLKKNRLNIHCTMAPAPIDPRIVDVAEPQKD
                     TLALPAASRERLVKAEIDLSNGYPYRPSRPLYSDDVYNIRNYDRPHVDPGTRADPEKK
                     ALLSAAKEVIHLTRHIGTEIVGLQLKDLTDQQKDELGLLIAERSVVFFRDQDLSPQQQ
                     KALGEYFGEVEVHPQVPQVPGLPGVSVLWPALQATERAASYRRPGGASRWHTDLVHER
                     QPAGVTHLHNDAVPTIGGDTLWASGYAAYEKLSPEFRKIIDGRTAIYRSAHPYLDRKD
                     PEAGPKYIEREHPIVRVHPATGWKALWVNRAMTDRIVGLDKAESDVILGYLFDVYEKN
                     IDIQVRFKWTPRTSALWDNRLVNVLWFTIFLLWGTNPGQNYHSQCQLGLRRLGAQTWH
                     SSHGPRGEAFLRPQRPDPKTGFGLAGPR"
     exon            223603..224121
                     /number=1
     exon            224180..224923
                     /number=2
     CDS             join(226869..227249,227336..228076,228142..228543,
                     228687..229541)
                     /codon_start=1
                     /locus_tag="AO090009000078"
                     /note="predicted protein"
                     /old_locus_tag="AO080515000075"
                     /protein_id="BAE54592.1"
                     /transl_table=1
                     /translation="MKNVVEAYFKAIKTIKPATTAIAIFFSSVTGGIAAPADLGPAYW
                     VQNLTSTVLFTNALGKMCADGESRPNMLIELGPHSALKGPIRDTLKGIGPPTAKIAYA
                     RTVVRNSEPSHSLLNAAGAAYVRGAHGTRYWHQSCIADKHCHRDGKRDDILGTMALFS
                     NNLEPTWRNIVRLDDVPWLREQRIQGMSVYPMAGYLAMAIEAAERRAQQHEAIFSRFE
                     FRELKVGAALVLTDDVDTEAVITLRPYTEGTRGNSDIWDEFRICSWNTKRAWTEHCTG
                     HVRVRINGKQQTLVSNVAETGLKHMSIQTKKVMTAATYRIDTQNMYRVLSGVGAGYGP
                     CFQGLENYFSNPHHSRADLYLRDTKKVMYKEYEAPLSIHPALYMPTMIRSLIISANLS
                     TIPGDFVKAWCVGGPSLSTPQPTKFDLWATSQDSTEVLINMEGLILTPMKDPNADSGG
                     DVAELCYKIEWQPLHDDKAIAEEERQEPIDYINVTLWSPMSLPMAILPMENGKLPDGC
                     YGTPDGSAKWLSEAISTETTNWKPSIYPLGEIYSCSKHVVVLQTGITSLRDLTVDVFD
                     KAKRTLLNASHLLWVYHLDSPDAQMIVGLTRSLRSEGFGRIATLGLEAKDIEKPTPAI
                     LAAMDALWPVDGERSCKELDFRACGSDLVVPRVTNDTVANAFVHKETHEKTISVQPFY
                     QSGRRFKLEIASPGSLDTLYFADDNVGMLGDDEIEIEVKATGLNFKDIVVAMCQLAQP
                     WLGIECSGVISSVGKNVSSFTVGQRVVALPEGAFSTYALSRAASAAPIPENI"
     exon            226869..227249
                     /number=1
     exon            227336..228076
                     /number=2
     exon            228142..228543
                     /number=3
     exon            228687..229541
                     /number=4
     CDS             complement(230709..231884)
                     /codon_start=1
                     /locus_tag="AO090009000079"
                     /note="predicted protein"
                     /old_locus_tag="AO080515000076"
                     /protein_id="BAE54593.1"
                     /transl_table=1
                     /translation="MYYHNEFRFGPGFTFPDNVIKKFGSKPYYDATVMCLSLAWLAHL
                     TKDPNLQYASRAKYTEALSGIQYALTSDDIGSDALLMAVILLAFYEMNVRTSDDAWIF
                     HANAVKMLMKTRGMRAHLTGPGRVCHFAFRPFLIGAALQKGESCFLDEEPWQNLASSL
                     RTEDSQKQDEWAFYIDVYETIFMELVKCPGYIKEARAIVSVTSPEARSLAYRIRTTCD
                     RLRRLSKEMRTLLSAHNQRKQGITLRFVGPEPQLFPETSPSLLLRAGVDAVRILEQIL
                     HRITVPTPAVEQTLIIRDGALTPVSSPESSGDAESPPLLSFDLSCDLGNGPQASVGND
                     DQRALTWLDRVAGAMGLLGAEITYGMKPEVQTDLALRTVRTLTPVDDDLPEPRRSSD"
     exon            complement(230709..231884)
                     /number=1
     CDS             complement(join(235027..235527,235584..235910))
                     /codon_start=1
                     /locus_tag="AO090009000080"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000378"
                     /protein_id="BAE54594.1"
                     /transl_table=1
                     /translation="MVLSQVPKRFSAFPPPNMSNARTHTKIAGTPDYDDPIFWDTKFA
                     TGQDVGEWLNPGENLVQAVLSHLDNRSSVQERSPRVLHLGPGISKLGTKLREAFVDRD
                     WKGSGIVNVDFSAEAVRLGQEIESKQNPSHAMHWLCADLRSWNDMSSLAPLAPFDIII
                     DKSTSDAIATSPSTTLSPTSISQDTCPVVRDVANTQGQTTLSPVELLALHLVPLTIEG
                     TMWFSLSYSTMRFDNLPRLANHWDLVSRTPLKAPQGQTSSFAHAPEVFHWLYILRRK"
     exon            complement(235027..235527)
                     /number=1
     exon            complement(235584..235910)
                     /number=2
     CDS             join(237304..237504,237576..237837,237888..237999,
                     238166..238283,238437..238457)
                     /codon_start=1
                     /locus_tag="AO090009000082"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000376"
                     /protein_id="BAE54595.1"
                     /transl_table=1
                     /translation="MMNWIYGAPSLTLTISHTLNIMLQKSKIESDSAQIDPIHPAHGI
                     VGMIVETDAVFGNVTEDGPNYRNVGWIGTTALMMKTQIGLGVLSMPLVFGTLGLIPGN
                     ILLLTIAGITTWSNYMIGVFKLRHPEVYGIDDVGRMFFGQIGCELFGAAYALFYTVAA
                     GSAMLSISTALNALSSHAVCTAAFVAVAAVIGTVLQQHLQLVYGSPTIRLSIIQVSPT
                     PSQQFLHLSLPMLLLGPLA"
     exon            237304..237504
                     /number=1
     exon            237576..237837
                     /number=2
     exon            237888..237999
                     /number=3
     exon            238166..238283
                     /number=4
     exon            238437..238457
                     /number=5
     CDS             240943..242196
                     /codon_start=1
                     /locus_tag="AO090009000083"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000375"
                     /protein_id="BAE54596.1"
                     /transl_table=1
                     /translation="MSLFLVIVVVLLLFLSSPLHRLVHIGLKKPVSPNIDPETYRRII
                     EGKGLYQEVHNQLNARQSRAIPNKRLRAVFGIENALTTDNEIHAKRFLRQVKGLINLS
                     PTSWESLSGLVRSAARRSIDGAMANSPDKPRVMLTNLVQVLVLRVVLSVLFRMETEAL
                     EVPDHDLLRLAEAINDAWTSSKDKTHLVSFQDNISLQNSLKTVFPHLNCLDPQGNPLN
                     LVIPGFETMWRIVLRLFIEISYTSGLYHPEWRGIMTTFAIAPTKDEFERRNGKQNLSA
                     EMLVNEALRLYPPTKRVYRAFLPVGSDTVEVLNADIEKAQTATHIWGSDAEVFAPGRW
                     GALTPQQKLAFFPFGSKPFVCPAQAAFGPRAIALVVGALLVELGGEWSLCVGAECTEA
                     LVPGVRLSNQRTEYRDLCLARAGPV"
     exon            240943..242196
                     /number=1
     CDS             249088..250629
                     /codon_start=1
                     /locus_tag="AO090009000086"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000372"
                     /protein_id="BAE54597.1"
                     /transl_table=1
                     /translation="MRAGFPAIEQAATADHEALAGRVHLDLASSGAAGNLPTDVRLER
                     YKTHPDADPELVTLMFQFGRYSLIASSRKTGTSPLPPNLQGLWNEDYEPAWGGRYTVN
                     INLEMNYWPAGVTNLAETLGPLIFLLETVKPRGQDIARRMYNCDNGGYVLHHNTDIWG
                     DAVPVNNGTKWTMWPMGGAWLSANLMEYYRFTQDTNLLKERIWPLLRSAAQFYHCYVF
                     SFNGYLSTGPSSSPENAFVVPNDMSESGNEEGIDIAPTMDNTLLSELFHSIIETGKVL
                     GINNTDTTKAASSLPLIKLPQIGSYGQILEWRHEYQETEPGHRHMSPIFGLYPGSQMT
                     PLVNSTLAAAATVLLDHRIAHGSGSTGWSRAWTISLYSRLFDGDAAWNHTQVFLKTYP
                     SANLWNTDSGPGSAFQIDGNFGFTAGIAEMLLQSHAGVVHLLPALPSAVPHGKVSGLV
                     ARGNFVVDMEWSDGKLTWATITARTGGKLAIRVQDGQQFGVNGSVYTEEISSVEGGIY
                     EISLL"
     exon            249088..250629
                     /number=1
     CDS             complement(join(250930..251144,251225..251408))
                     /codon_start=1
                     /locus_tag="AO090009000087"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000371"
                     /protein_id="BAE54598.1"
                     /transl_table=1
                     /translation="MTSLNPISQPQEEEEKKQQQSYSDWLREQYNIQYEKWYPWIEDQ
                     YLKWFGKGDNKASYATKDTLNESKVAGINQVDQLQDDVHNLAGNQLGDNGLLSPVGNL
                     VSKEGINRAERKGKDEEGRYGFGGSGITGK"
     exon            complement(250930..251144)
                     /number=1
     exon            complement(251225..251408)
                     /number=2
     CDS             complement(join(251863..251908,252147..252433))
                     /codon_start=1
                     /locus_tag="AO090009000088"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000370"
                     /protein_id="BAE54599.1"
                     /transl_table=1
                     /translation="MEGDQLGYSLLQSLLCSSWPGVCAALITRHRGSAVSSAGEDQSL
                     HKGIYGAGQWLPLILTVGILTGVSCIGALGFLREGKQERSVDNRSQQDHGDSCNEASY
                     SRLLVQGG"
     exon            complement(251863..251908)
                     /number=1
     exon            complement(252147..252433)
                     /number=2
     CDS             complement(256748..257569)
                     /codon_start=1
                     /locus_tag="AO090009000090"
                     /note="dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /old_locus_tag="AO070342000368"
                     /protein_id="BAE54600.1"
                     /transl_table=1
                     /translation="MTPPPATNTESDPTTAAQKRFTVQGNAVVTGGAGTLGLQSCNAL
                     LEHGLNGLMIMDMDPTISQKEIEELRVKYPKAKIATLKVDVTDEVAVESAFVETTKVL
                     GSVDALLCFVGVVGCVNSLEMPIPQWRKIMDINTTGSFICAQAAAKRMVAQGTGGSIT
                     FVASISGHRVNFPQPQAAYNVSKAAILMLKSCLAAEWARYGIRTNSVSPGYMDTILNA
                     GDGIAEHRRIWAERNPSGRMGSPSELTGAIVLLASSASTYINGADVVVDGGQILF"
     exon            complement(256748..257569)
                     /number=1
     CDS             259855..261516
                     /codon_start=1
                     /locus_tag="AO090009000091"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000367"
                     /protein_id="BAE54601.1"
                     /transl_table=1
                     /translation="MPNADIYKDLKDKKVLGTQIPVYKSGDLEYEVSVDVANLLYRFS
                     RPTCVVKPELPVHVEEVVKYAYENKTPITVKNGGHSYAGLSTTNDGILLDLSRMNDVY
                     LQHKSEPPTITMQGGALWAHAYRQLVIEKVNKLVVNGGRCPTVGVSGFVLGGGLGPFT
                     RKFGMGCDSLLEATLVTGKGDLVTVRKDDLDPEKRKLFWALCGAGANNFGAVITMKMS
                     LHELQEDKVVAGRYTWYPSTDEREEGFMEAMNSFYAANWSNSMTIDTSWFCDLKDGKG
                     DLAVRFLTYYDGKKQEFQEEIDRNLRGDAGSDIHKIKNSLADNLKRRSIAEDSSRFLH
                     ETLVSQWSEETKKAIPSNKAYSIYASFVFGTGSDYTGITKSIRDHMKNFKKEFRGESA
                     LLQVTFIHTGQQATRIGANETAFPWRDASRIAYIMLQWDEKWLGEEMVEFCKNFKENL
                     MQFSIDGKAGFLNFPDRELCVTEDHHQAYYGPNSDAIREIKQTWDPKGIFQFAPKNER
                     DESIATDIVPILQAALSIEEIVSASLPHLNPLMTLISQLSAGNLS"
     exon            259855..261516
                     /number=1
     CDS             complement(join(261671..262071,262131..262199,
                     262251..262334,262386..262462,262538..262737))
                     /codon_start=1
                     /locus_tag="AO090009000092"
                     /note="reductases with broad range of substrate
                     specificities"
                     /old_locus_tag="AO070342000366"
                     /protein_id="BAE54602.1"
                     /transl_table=1
                     /translation="MSMTVSDSTQIRDGFPRPFPDTPANVLEQFKLNGKVVVVTGAAD
                     GIGLAVAEAMAEAGAHVALWYNSNDAAIKRGEELAKDHGVRTVAYKVDVSNPEEVQKA
                     VADVVRDFERIDVFVANAGMAISKPILEQTLDEYRKQMSVNVDGVVACAKYAGEVFQR
                     QGSGNLIITSSMSAHIVNVPTDQPVYNGSKAFVTQFGKSLAREWRDFARVNIVSPGFF
                     ETKMGASPLALNEAYRMAVLGRQGHVKEIKGLYLYLASDASTYMTGSDVLIDGGYVLP
                     "
     exon            complement(261671..262071)
                     /number=1
     exon            complement(262131..262199)
                     /number=2
     exon            complement(262251..262334)
                     /number=3
     exon            complement(262386..262462)
                     /number=4
     exon            complement(262538..262737)
                     /number=5
     CDS             complement(join(265813..266133,266184..266431,
                     266487..266650,266711..266865,266922..267110))
                     /codon_start=1
                     /locus_tag="AO090009000093"
                     /note="geranylgeranyl pyrophosphate synthase/Polyprenyl
                     synthetase"
                     /old_locus_tag="AO070342000365"
                     /protein_id="BAE54603.1"
                     /transl_table=1
                     /translation="MPQRNMDQALEFDQNMTQVRRPRDDQENHEGTDADEGQGTTTSN
                     RFYTQYDILAPFTKADAEKICMEPFEYTRSLPGKNTVGKVIESLRPWLNISDRSAAVL
                     TDVMTMLQNSSLMLDDIEDGSQLRRGAPAAHVKYGLSQTINSTTYIIAKVVSEVQTHL
                     RLECAKVLSEELQTLTLGQALDLNWTFNKTCPSVNEYLVMIDHKTGGFFRLMLRIMEI
                     EANATPNDELRHLITLLGRYYQIRDDYQNIASDEYTTKKGFCDDLSEGKFSFPLIHLL
                     EHSPNASTLHKMIYDGQPVDEGKMSEEAKSYIISQMKEVGSLDYTQEVLSGLFSSIWE
                     TAERTEKAMGENMGFKALCQSLKL"
     exon            complement(265813..266133)
                     /number=1
     exon            complement(266184..266431)
                     /number=2
     exon            complement(266487..266650)
                     /number=3
     exon            complement(266711..266865)
                     /number=4
     exon            complement(266922..267110)
                     /number=5
     CDS             join(271780..271854,271911..272312)
                     /codon_start=1
                     /locus_tag="AO090009000094"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000363"
                     /protein_id="BAE54604.1"
                     /transl_table=1
                     /translation="MEQAAGCGARIFVSFAGPTYGSKETPVTEAIKLIFPMLVANNYK
                     RAMVLGTSSYPSPLDKGAIKWKLSVALIKIIAGSAYEEFRGLGEFVASQDPTQLPWTL
                     FRVPFLTNGAEAPVTATYTGHGDDGFFLSRKSMASWVLKEMDTNSVQVGKTPVISN"
     exon            271780..271854
                     /number=1
     exon            271911..272312
                     /number=2
     CDS             complement(272708..273574)
                     /codon_start=1
                     /locus_tag="AO090009000095"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000362"
                     /protein_id="BAE54605.1"
                     /transl_table=1
                     /translation="MSVSDAKKESWLSLFQLEVARAIAAQLVIAVQYIHSQGFVHGDL
                     HRGNLLFLPSREFTELSTEAIYKEYGEPEFEPVNRLDGQKLPPAGVPEYGVVPIWPGE
                     ASENITLPESRILLSDFGEAFSPAQEDKFESHTPLLIRPPEARFEPTKPLTFSSDIWS
                     LACTIRDIIAQKTLFEGIMTDEDDMTCQQIGLLGPLPTEWQEKHGESIHQSKYLNRSL
                     EDRFKNTVQQARIEARMPSFKSDEQYALLSMLHSMLCFQPEHRPSAQQVLESEWMVKW
                     ALPECEKIRNSQ"
     exon            complement(272708..273574)
                     /number=1
     CDS             275136..275717
                     /codon_start=1
                     /locus_tag="AO090009000097"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000360"
                     /protein_id="BAE54606.1"
                     /transl_table=1
                     /translation="MPAPAGTHPNPQAGVRNAPRRNDRRRQDKKAKPDHVEHATGGQP
                     NARLRRLLRIRQRGREKRRQKKREEAQQALEPVPPPEWLSLDSITPLSFSDVPLPGPF
                     IPTFPLAGSLSETHAVDREMPLETSEATDHIKYPKDETAVQGPKIEGDEVDEGLNTLD
                     GDESDVSDYWDSYEKYHPVIPSPSDGELDNGVI"
     exon            275136..275717
                     /number=1
     CDS             join(275958..276292,276364..276443,276513..276535)
                     /codon_start=1
                     /locus_tag="AO090009000098"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000359"
                     /protein_id="BAE54607.1"
                     /transl_table=1
                     /translation="MNGHVILDSCFGFYFETFSSPTYASPHGVNLTENETKHDCSNDY
                     LILVLSREGVFAPEDPPPGAPQYFTFFGVRFDKDKERVKRESRLMKSQLVEKKPSPSP
                     DSSFESANPWQTGILPVVSAETAFNVKLQAMRPIEMHSGFHSS"
     exon            275958..276292
                     /number=1
     exon            276364..276443
                     /number=2
     exon            276513..276535
                     /number=3
     CDS             complement(277298..277924)
                     /codon_start=1
                     /locus_tag="AO090009000099"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000358"
                     /protein_id="BAE54608.1"
                     /transl_table=1
                     /translation="MKFTGLAIVSLIGCAAALPPFGASSTPSSSVSVSVTPSASPSSS
                     SIAFAGLSKRSETPSSSAAPSSSSVAAPWVYHKRQFATPSSSGIASSSATPSSSSVAA
                     PWVFHRRQYATPSSSATPSSSATPSSSATPSSSVAAPWVFHRREYATPSSSATPSSSA
                     TPSSSASVTPTSFAAQKRKFSGSSSSSSASPSSSSATPSSSATPSPSP"
     exon            complement(277298..277924)
                     /number=1
     CDS             complement(280612..282699)
                     /codon_start=1
                     /locus_tag="AO090009000100"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000357"
                     /protein_id="BAE54609.1"
                     /transl_table=1
                     /translation="MVGEIAKLRCQLVKAQQLREEAQLRQKKLELHQKDTERQAELNS
                     LSGLLNGCHKLSQAIRVTTNVTLIPEDTTNPVNRLFPRRIRHWNEFPEVQEKIWDRLN
                     RDRTFTRKRRFRNNYFLDEIHKHTRRHTIFSEASLHDFQRDTMERFVNDILDALLQDH
                     TLRREFRLEGRRRNRSADQFCVHVASDERRIPAYAVEFKAPHKLRIPDLISGLHEMEP
                     ERDVIDKKGDTFEFHASHLVAAAITQLFSYMVDSGVRNGYICTGEAYVFLHIADDPTV
                     VYYYLCVPNRDVNPEDKYHLHRTAVAQVLAFTLNALAAEQPSQDWFDAARKNLSTWKV
                     EYLHILKNIPETIRKDPPYFEYKPSDWKPVERSPYHTRSRGRCQPNQKTCQGSLKRNI
                     AYEDDFPPPYPAPATRAQNNLAGSSNPNRGSNTRKYCTMVCLRGLLTRGHLDFQCPNV
                     HQHGPVRHQINSRDFTRRLHAQLRQDRHKGFEQLHIRGRTGFLLKATLLSHGYTVIIK
                     VTTEARQHNLRKEIDAYGSLLQLQGHSIPVHIGSFQPRMPYWYHGERMSYMMILSWSG
                     IRMETLLMQNDANASLFSQERIKLRKILRSHGIVHGDLEYRNILWNDSLGHAIVIDFE
                     DVTWVKNRQPLGPTSGNVARGNASDKRGNLHGHNTLPSAPRPQPNTIENYSMNRSLNM
                     RGGNRKPLNISLT"
     exon            complement(280612..282699)
                     /number=1
     CDS             complement(285415..286608)
                     /codon_start=1
                     /locus_tag="AO090009000101"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000356"
                     /protein_id="BAE54610.1"
                     /transl_table=1
                     /translation="MSSTRHNASATSSERKRLRDRRAQQNLREKRENRMRALEERVSY
                     CEKNHGNELIHNCMLTVETVRRENELLLARQEHLRRLFQGWEAQGNGAAGARLALSST
                     YMASDPLPAPTTPICSPGSETVLVDPEMHTMSGWSGNGIEFPHLGSTTDGLTATSMPS
                     TWPVGSGTQSPPSPIIELGLVPDMHPTPGPDTCPLMTPKEYTHITANTRWDGWLAVSE
                     AIAKLPLLSTPFELLHGSRRNWLADQINRLLRRMSLREPDRLAYSWIMYSFVKWRANP
                     SPLAYANMPNFIQPVAGQVRQDQHADLVFFLWPQLRLNVLENWNTIDIIELYRYAISA
                     CRVRWPSSQSIWDWDDNNNMFVKPEFFQTFMDRSGWGLTSVFIDKYPQLMKGMDVEHI
                     RYDIP"
     exon            complement(285415..286608)
                     /number=1
     CDS             287491..289032
                     /codon_start=1
                     /locus_tag="AO090009000102"
                     /note="2-polyprenyl-6-methoxyphenol hydroxylase and
                     related FAD-dependent oxidoreductases"
                     /old_locus_tag="AO070342000355"
                     /protein_id="BAE54611.1"
                     /transl_table=1
                     /translation="MTRTDVLIVGAGPTGLVLALWLTRQGISVRIIVKSEAKASTSRA
                     MAIHARTLELYRQLDLAEDVVANGHKIAATNIWAGGVHRSHVPFGDFGAGLTPYPFIH
                     IFPQDQHERLLEARLNTMGVHVERNRELAEFQEQESSITARLRNTTKPHIENSDIETC
                     EAAFIVGCDGAHSAVRQNCRIGFEGATYSKLFYVADIEGSGPSLNGQAHLSLNDNQFF
                     LLMAYDKDRRARLNGAVDEGALTKDISDLTLDDVAPDAGKAVGVKIDKVNWFSTYHVH
                     HRVAEAFRSGRAFLVGDAAHIHSPVGGQGMNTGIGDAINLAWKLTAVIQDKADMSLLD
                     SYEVERRAFAALLVNTTDTAFNAIASEGYLSYFIRTWFIPYVSPILSKIGLVRQRMFR
                     GVSQIMLNYRDSALSAGLAGTVQGGDRIPWAPVGELDNFQSFGEITWQVHVYGEAKDE
                     LKEWCRSKGIPLHIFTWNEKYQSVGLGKDAAYLLRPDTYVAVAEPSGRPERYDQYFKD
                     NKIRL"
     exon            287491..289032
                     /number=1
     CDS             complement(join(289858..289906,290093..290232,
                     290285..290501,290582..290844))
                     /codon_start=1
                     /locus_tag="AO090009000103"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000354"
                     /protein_id="BAE54612.1"
                     /transl_table=1
                     /translation="MSNAGSKPKLRVAIIGAGPAGLGAAIEFQKLPFVDLRIYEQARE
                     LREVGAGISIQRNTWRMLDALGVYDNIDPSTIFSAADGHSVQHRGQHDTPPRHKHARA
                     LRTVLQQALLKAVDKTNLRLSSRLVEIRELPNKTLSLRFEDEHTDEVDLLIGADGVRS
                     VVRQFSFPDHRISYTGTTAFRALVNADDILSIPNFPDAVTFWHGPTRNLRQSFKRFLV
                     KSGK"
     exon            complement(289858..289906)
                     /number=1
     exon            complement(290093..290232)
                     /number=2
     exon            complement(290285..290501)
                     /number=3
     exon            complement(290582..290844)
                     /number=4
     CDS             complement(join(291654..291973,292022..292907))
                     /codon_start=1
                     /locus_tag="AO090009000104"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000353"
                     /protein_id="BAE54613.1"
                     /transl_table=1
                     /translation="MVHPKVRKALEEARKLVADLESYEDGPINHQAVVKQTERVRIAL
                     QEPIDLVTRSIEFLALGGAVHTILGIRAYHAMPEDGSAITADELARVTNVASTVIHRI
                     YRVAINHGIFTETAPDTYAHNDLSRALNPKGMGSFFMIALEFTRAWIHLPEYLQSHKT
                     DDIFDLVKSPAVYSVGKEHLGKSYYELLELDPDPERREVWNANMFMVDQLMPIVGMFP
                     FASLKEEVEQDPGRPYLVDIGAGRGQSCFAIQKDINGAFDAKFILQDLPGVINNMNPE
                     DYPGFDLMTYDAFTPQPIKNAHIYFMRRFLHDFYNPVCIEFVKNTASAMGPSSRLLIC
                     DMLVPDMVEPHENTDLYWLDFALLCMTGQEKKKADFIEIFEAAGLELVKIYPSTYGRT
                     VMLEARLKK"
     exon            complement(291654..291973)
                     /number=1
     exon            complement(292022..292907)
                     /number=2
     CDS             complement(296243..297004)
                     /codon_start=1
                     /locus_tag="AO090009000105"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000352"
                     /protein_id="BAE54614.1"
                     /transl_table=1
                     /translation="MGTGDSGLSGTGYTPQLDDNDECSSEYDITWSPGDGVCPTTAEF
                     NHCCQSKTDDWENAALTHLEGTESFQYYLSAFLGLFENIPPFYHCPPGAANISGRPKS
                     FLVLKSSLQVKTTEDSNCDQPQKSTDYLQCLGSPAPVKYRTKTETKLEAAIPVCVKPL
                     RSGYFTNIVLAWSYIISCRWVEILKQAGEESQILHQLGMQIEDSFWDIVTQGCWVARV
                     EKFKGVFYSPWMVRREGSTNKRYGLHSKSSLVVES"
     exon            complement(296243..297004)
                     /number=1
     CDS             297973..299409
                     /codon_start=1
                     /locus_tag="AO090009000106"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000351"
                     /protein_id="BAE54615.1"
                     /transl_table=1
                     /translation="MSTGCGDIFAAKLLSLMTCATCLVDTAVSGEDSQSLNEKAKSWI
                     QAVVSWVKTLTSHARLTLDVIQVKHLLLLARQAVGHEGDFAWLAAGSLVREAITIGLH
                     RDPSHFKGLSPYWGEIRRRLWLTIIELDLQAALGTGAPVTLSEDEYDCAPPSNIDDED
                     LLVDSPVAPTPKPITVLTRTAFQVSLAQTIGVRINITKAVNRVRLTLSYQRILDLSEM
                     LTSERSPALIGDASCEDDSRRCRLAFRQSLFLFLISQCLLTLHRAFFLSLAETRKETY
                     AFSRQMCVQASLALLAPLEISADDLDHGPDNEQRTVYPYLLRLRGGMFRDEFFHAAAT
                     LCFELQLQAKDKPLLPLPGSVQGFVDKTTSYQRTALFHNVENAIRYFELKVRQDKQAC
                     KAFMLLNMVLNSAQSQMPSSNSEHCASSGTHSESFDPNDACPRAARRCRELLLADGGL
                     LYLQEAEGWLSSSGGFPSIVYPASTPID"
     exon            297973..299409
                     /number=1
     CDS             complement(join(300712..301004,301067..301427))
                     /codon_start=1
                     /locus_tag="AO090009000107"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000350"
                     /protein_id="BAE54616.1"
                     /transl_table=1
                     /translation="MQRNCQILRTWCQTGHVLLPASRPLQYFSSFSPAQACHSNQAKE
                     KSRCQASTRDVSTTTTIKPALSMWHIKFWNCRSTWKRAGINTLRCLVGCTLGDFSALW
                     MLQTYYPALGMGTIMAASMASGMTTSIILETILLRRGVDQLSWPMAARTAMGMSMVSM
                     VAMEAAENIVDYHFTGGVVALGDPKFWMAAAVSMTAGYLAPLPYNYHRLKKYGKACH"
     exon            complement(300712..301004)
                     /number=1
     exon            complement(301067..301427)
                     /number=2
     CDS             302745..306314
                     /codon_start=1
                     /locus_tag="AO090009000109"
                     /note="cation transport ATPase"
                     /old_locus_tag="AO070342000348"
                     /protein_id="BAE54617.1"
                     /transl_table=1
                     /translation="MVTDNQPSPPQSRLTTILVNNLHCPSCVTNVEETLSALTPSPFS
                     ISTSILSHEIKVVHPITLSSSRIVRALEEVAFEIDSVIAHDSDESDIEAQQPRTHRPA
                     SGKHDVHSQSKIHIQKCNECATQLASSTSNSSDDEGAMKEITATAASVSSAENSLTSV
                     MDDRLTGSRTRITLSISGMSCSSCVGKITGALQNRPWILSADVNLLTSSAVIMLMDNS
                     HIDEVLEIIRSSGYTVELIDTEELQPQKTSKSSGMADAWRASYVIGGMTCSSCVGKVT
                     DTLNHLDWITKVDVSLVSGSATVEFQGKAHLDEIAGIIKGLGYTATLSDLESRAPAEQ
                     RSSKRSVMIQVDGMHCAHCPQRILDALDVYSDRLDVTEPPSKAQHRLTVNYLPDAPNF
                     TIRHIIRTIADVDKSFTVSIYHPPSLEERSQAMHRRHQWQIARRLALSVLVAIPTFII
                     GIVYMSLVSKDNPGREYLEEPMWAGQVSRIEWALFILATPVYFFAADLFHRRMITELR
                     ALWRPGSKTPILRRLYRFGSMDMLMSLGTSIAYFSSIAILAIDATEPRNGHKASSAGT
                     FFDSVVFLTMFLLIGRLLEAYSKAKAGDAVGLLGKLRPKEAILVERNGEGSTTSRAVP
                     ADQLEFGDVVRVANGASPPYDGTVVEGESQFDESSLTGESRPVTKSIGDDVFSGTINQ
                     ARPVSVRITGLSGNSMLDQIIGAVREGQIRRAPIERTADQITGVFVPIITLIAILDWI
                     IWLALGLSGRLPESWMNGNPGGWEFWSLQFAISVFVVACPCGIGLAAPTALFVGGGLA
                     AQNGILVKGGGEAFQEASQLDCIVFDKTGTITEGGEPAITDHEIANSEDVDKVWGAVL
                     DLEKNSSHPIAKAMVSFANSQQPPALKATTVDEIPGKGMKGSFFPQGQDGPALEVIIG
                     NEALIKDHKVAISPTNDEMLTTWKRQAKSVVLVGTRICSTPGPTEHIPWKLSLMLAVS
                     DPIRREAKGTLQALRNRGVAVWMLSGDNPTTAHAVGEMVGIPPDNIIAGVLPEQKAEK
                     VQYLQKTLQKPPRSSWFRRGKEPQSGRAIVAMVGDGINDSPALTVADVGIAIGSGSDI
                     AISSAEFVLVSSGLTSLLTLIDLSRLVFRRIKFNFGWALVYNCVAVPVAAGVFYPIVS
                     NGTHVRLDPIWASLAMALSSVSVICSSLLMRTRLPLVGFRAKK"
     exon            302745..306314
                     /number=1
     CDS             join(307043..307277,307317..307976,308067..308590,
                     308597..308779)
                     /codon_start=1
                     /locus_tag="AO090009000110"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000347"
                     /protein_id="BAE54618.1"
                     /transl_table=1
                     /translation="MLSDGKASPSVESVEYLFDLGAFSRKITTSSPASQVWFNRGLTW
                     VYAFNHMEGVKCFQKAIAYDPKCAMAYWGIAYALGNLAVTLPATYQAVQTAKSSLAAF
                     ATPVEQGLINAISVRFLTKQVVSVSELVTHSREYKYAMEGIYRDFGDDLDVVTLYADS
                     MMSLTPWRLYDVATGQPTKGAFTLESKDVLERGLQLEDSLKHPGLLHLYIHLSEMSPN
                     PERALSVAEHLRDLVPDAGHTHHMPTHLDVLVGDYRRAISSNIHATLADEKYVAVEGP
                     NNLYSLYRLHNYHSLIYAAMHADWLEGFVAVRLHVMVRFGMWCEIIAMALPKDQGLYC
                     VTTATIHYAKGVVYAATNHVTEAEQERKLYVAAIERVPITRRTHPNRSVDILNVGVAM
                     LDGEIEYRRGEHEKVFQTLRRAIELDDGLNYAEPWGWMQPVRHAFAALSLEQGNIEAA
                     GEAYKADLSLNSTLGRAHHHPNNALQGYYDCLVRLGRDDEAKLLEPQVKVALAVADVL
                     VKSSCFCRLNTSDCPDVRVLTSYCK"
     exon            307043..307277
                     /number=1
     exon            307317..307976
                     /number=2
     exon            308067..308590
                     /number=3
     exon            308597..308779
                     /number=4
     CDS             complement(309579..310406)
                     /codon_start=1
                     /locus_tag="AO090009000111"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000346"
                     /protein_id="BAE54619.1"
                     /transl_table=1
                     /translation="MKPYSLLSSLAILGPAALTVAQTLNIVAHQDDDLLFMSPDLLSD
                     VRSGRAVRTVFLTAGDAGQGEDYWTSRQAGSLATYAQIAGVANEWNEGDAGIEGFDIP
                     VYELAAKPQIELAFLHIPDGNLDGSGFASTGSVSLQKLWEGTIDQIGTVDASGTTYTR
                     DQLLDVLSDIIENFSPDRINTLDFVNDLGDGDHSDHHTTGFFADHASQNADNDAAFYG
                     YMGYLVQNQPANLNADQIADKKNIFYFYAGYDSGTCNSDAACAGRPELAWLERQYLV"
     exon            complement(309579..310406)
                     /number=1
     CDS             complement(join(311417..311718,311782..312493))
                     /codon_start=1
                     /locus_tag="AO090009000113"
                     /note="3-hydroxyacyl-CoA dehydrogenase"
                     /old_locus_tag="AO070342000344"
                     /protein_id="BAE54620.1"
                     /transl_table=1
                     /translation="MTITTMKDIKTVAIIGTGVIGASWTALFLARGLKVLVTDPAPNA
                     EKNLETYLNAQWPTLTQIGLSEGASLKNYAFVDSLDNHFEEIDFIQEVPFPFSNTGVI
                     LLTVTKNGPERLEFKRTLFAYLDEKARPEVIIASSSSGIPSSEYASACRHHPERVLVG
                     HPFNPPHLIPLVEVVPHRTTDRETVVPRAMEFYRSLGKKPVLIQKEIPGFIANRLQAA
                     LSMEAYSLVSRGIISAADLDTTVTSSLGLRWALNGPYALNAMAGGGSFQHFLEHLGPA
                     AKSWHDDMHKHTFSMTPEAIQDLSRTVEPMVQATDLNTLQKERDDVLLKLMDMKSKTS
                     LLE"
     exon            complement(311417..311718)
                     /number=1
     exon            complement(311782..312493)
                     /number=2
     CDS             complement(312958..313773)
                     /codon_start=1
                     /locus_tag="AO090009000114"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000343"
                     /protein_id="BAE54621.1"
                     /transl_table=1
                     /translation="MDGGKSVTALVSGLRSPDGIEISQSAGRMFWTNMGFGTSIQDGS
                     VMSADFDGSDIKTIIPEGAVYTPKQLTIDDQNHKLYFCDREGMSVHRCDFDGQNHEIL
                     ILRGDYKTTDIEDPTRWCVGIAVDINNGKFYWTQKGPNRGGKGRIFRTNIDMPFSANA
                     LNRSDIETLFVGLSEPVDLGFESETQTLYWTDRGAHPSGNTLNKAYVGEKSPRVQILA
                     RQFHEPIGLKVDSINQQVYVTDLGGSLYRVGMDGGGKEVIYRGDGFYTGITVV"
     exon            complement(312958..313773)
                     /number=1
     CDS             join(315436..315484,315542..315590,315647..315717,
                     315825..315875,315928..316048,316099..316630,
                     316679..317080)
                     /codon_start=1
                     /locus_tag="AO090009000115"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000342"
                     /protein_id="BAE54622.1"
                     /transl_table=1
                     /translation="MGLRQSSPRWNHWTDCNFPGTGICWPDPNYFRRWPWRPPRSFKG
                     EFGGEHYWRCHGGAVETFIIGAALSATSLGTTFAVISSASKTVDLAQTRVGSVLVSAA
                     VIDDVVGLVLSSIISDLGKLSNSDANLGWIIGRPIVASVAMAIVTPIVTKFLFAPIFR
                     KYIEFHFARYDHISNIILMTLVLCAFISIAAYTGTSVLFGAFLAGTFLSYLPSKRPDG
                     PFVVMSREEGEQNEDKSPTFVHTFEAYLLGVQTYLMEPLFFASIGFAIPFVQLWTGKR
                     IWRGILFTLLMVVAKFVVGTWIPVWKHLPWTKSKADKTSKESSSAPDVPIETPKDNAS
                     MLSALLLGSAMVARGEIGLLIIEIGYNSTEYVSEEGFITGVWAILLNTIIGPVTVGLL
                     VKFYGKRIEEGEWGLQKDSSPSQEKGNAQSAV"
     exon            315436..315484
                     /number=1
     exon            315542..315590
                     /number=2
     exon            315647..315717
                     /number=3
     exon            315825..315875
                     /number=4
     exon            315928..316048
                     /number=5
     exon            316099..316630
                     /number=6
     exon            316679..317080
                     /number=7
     CDS             join(319629..319815,319872..320048,320151..321145)
                     /codon_start=1
                     /locus_tag="AO090009000116"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070342000341"
                     /protein_id="BAE54623.1"
                     /transl_table=1
                     /translation="MGLRGAESEFRDKWALLCNISFVIPGLNLNLLIVRNRNLISVYS
                     TMLDINRCPSKRLIVCCDGTWQDSTADSSKPASNVTRFSRALSANAVVERNGQKHEIP
                     QIVYYQKGVGTGLGDKYWGGVAGLGLSANVRAAYGFLVDNYNEGDKIYFFGFSRGAYT
                     ARAVAGLVCQWGLLTRRGMDNFPTVYEDFYQKKADDYTPEQRRALGFRDPLPQFTVEI
                     IGVWDTVAFHQTWLGGWIGEKLEFRNTILSENVRYAFHALALDEERMAYQPTLWNLPK
                     KSHGQELLQVWFSGVHTDVGGGGDDPRLSNITLAWMIAQCMKDGQLSFDIDGYLFDIP
                     PRPLEIGVTPWATSLGKTGKWSFTRSLEGVLGGVSKRTPLADKPVDSGITNETIHVSI
                     SDRNLAGAGKWPWPCSALKARKDPNSWLLTDGRVIVESPLLKMEDYMKGRIRTVHVDE
                     QD"
     exon            319629..319815
                     /number=1
     exon            319872..320048
                     /number=2
     exon            320151..321145
                     /number=3
     CDS             join(322404..322598,322649..323845)
                     /codon_start=1
                     /locus_tag="AO090009000117"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000340"
                     /protein_id="BAE54624.1"
                     /transl_table=1
                     /translation="MQLTHLLAFALSLATSEAAYKGFNYGATKSDGSVKSQSDFESEF
                     STAKNLVGTSGFTSARLYTMIQGGTTNSPISAIPAAIAENTSLLLGLWASGGGMDNEL
                     AALKSAISQYGDSFAKLVVGISVGSEDLYRASSEGEKVNAGIGIGPDDLVSFIKEVRS
                     IISGTALSSVPIGHVDTWTAWTNGSNSAVIDAVDWLGFDGYPYFQSSMSNSISDAKSL
                     FDDSVAKTKAVAKGKEVWITETGWPVSGSTQNLGVASLANAKTYWDEVGCPLFDETNT
                     WWYILQDANPTTPNPSFGVVGSTLSTTPLFDLSCSNSTRPSASASSSAAGSATPVGSA
                     VPSGSAAVNPSSSGIVSSAVPSTTPGFTVGKGFRPSNSSAAAYYSSASASGSAYPKFT
                     KTASGSSATSTTAGSSSDSSSTNSGKSSSESSSTNSGASASSSILATGGASSVSGSVF
                     GALVAVFAFVATL"
     exon            322404..322598
                     /number=1
     exon            322649..323845
                     /number=2
     CDS             complement(324284..324928)
                     /codon_start=1
                     /locus_tag="AO090009000118"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000339"
                     /protein_id="BAE54625.1"
                     /transl_table=1
                     /translation="MADALAIMHWHTRIDAMDIEFVLGSTPFDHNSVRRPPPLQDIVR
                     LTPGTSTFERTTNTVPNFKKRIVSLWMLDFDACGPITMNTAGVNQAIKAFIENDPYCP
                     RPHMEDAYSEQLWCFFSRRYLETGRKITAGSPSQSLPQQFIQGVIAKLSPPDQTGTSS
                     GSRGPAPPQRAQSSRTPPRHVQGGQMGGRGSTSGSPKKAPSNRGRGRGQGRGYR"
     exon            complement(324284..324928)
                     /number=1
     CDS             complement(325895..326551)
                     /codon_start=1
                     /locus_tag="AO090009000119"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000338"
                     /protein_id="BAE54626.1"
                     /transl_table=1
                     /translation="MSSERIPPFPEDVRVLIVERYCPPEIRNQILLSASNRACLIRPY
                     IGRRRTYGTAMNARSRFRGFSLQNYPLHLDQMVELGIPSTHIERYAAMMGEALATLHW
                     LGEIDGNDVEFVLAPPPRNDDCTTTVTNVLGEHTLWILDFDLCRSMAMDLEGVKQAAN
                     AFCRNDPFYPRPHTDQWIAFSRQYLQTSADLAHSFHEDEAESRLGLARKFIELLETKK
                     "
     exon            complement(325895..326551)
                     /number=1
     CDS             327316..328950
                     /codon_start=1
                     /locus_tag="AO090009000120"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000337"
                     /protein_id="BAE54627.1"
                     /transl_table=1
                     /translation="MASDSSTFAHTALPSDAHYIRLLQFEDTAATEPLRFTLGVYKFS
                     DVPVYNALSYEWGDGTADRTIFINNGPFLIRDNLHHFLSVLAGSGQRDTLFFADAICI
                     NQDDIPERNTQVQRMGDLYRQAQKVLVWIGPGTTESDLVFDICAEETQEAIDLQGSSG
                     NALDMVYRRSYWTRLWIIQELFLARDAIVFCGSKSAPWSSFRRLTTAVRGDFVLGGFT
                     GVDIQLGSSPLGLHTRTVLGQLDKKDREGSILNKTIDNIVIEFGQAQCSDVRDRVFGL
                     LGLAKMQEDGRGLRIMANYSATTVNLFVRLLSNMPYTLRLNHALSIFNILKLHHVDVC
                     AWDIGIPETICNLVFEVGLTHLGHIRHVSESRPLLCDWCKMWNKRNKHTPFELGEHLR
                     QELRDKAITEFMVGATQSSLAAHNCGPLLSLGPYDSCVTAKKLNEGDEMFLMEGTNIV
                     LIEHKPNPEDESHEPVTRFTRGVLAHTQREESILQAAMLLDSCLPSLPAPTEVRLQKA
                     RFERPAYPFEVIHEELTLRQIMFILTRAAQHSSYYD"
     exon            327316..328950
                     /number=1
     CDS             join(329300..329309,329367..329902)
                     /codon_start=1
                     /locus_tag="AO090009000121"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000336"
                     /protein_id="BAE54628.1"
                     /transl_table=1
                     /translation="MSSLFYTNVDRGPKHYQIPHSLTELRTVEILHNHRILAGQIWPS
                     MMVKVTDSNITATTVVVESATSKFKATFTSLENGVSLQEEAVMGFGVQIQWIVVDRCI
                     HSASQLADECLHSNAVLEENVRFSSLKIVDRFLNFVDDFNPKTKCLIEFLENVASGEI
                     SKEDIRVIDKGYGDTGRFKDE"
     exon            329300..329309
                     /number=1
     exon            329367..329902
                     /number=2
     tRNA            complement(331080..331158)
                     /locus_tag="AO090009t00004"
                     /note="tRNAscan-SE"
                     /product="tRNA-His"
     CDS             join(332078..332267,332323..332612)
                     /codon_start=1
                     /locus_tag="AO090009000122"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000335"
                     /protein_id="BAE54629.1"
                     /transl_table=1
                     /translation="MVAFAKWHVYHGEEGMKEWRASVRTDEGMKVPLGANEEGFRFCK
                     GKLLEKRRVFFGEEGREHCLLALLATDPRYERRGAASLLTQWGCDSADRLGIECYVES
                     SKKGYPVYKRKGFEEISSQEDENVIHFDASRFTGRGGNDGDWVNLVCMVRKPRKSVC"
     exon            332078..332267
                     /number=1
     exon            332323..332612
                     /number=2
     CDS             complement(join(332659..334284,334346..334468,
                     334524..334589))
                     /codon_start=1
                     /locus_tag="AO090009000123"
                     /note="thiamine pyrophosphate-requiring enzymes
                     [acetolactate synthase, pyruvate dehydrogenase
                     (cytochrome), glyoxylate carboligase, phosphonopyruvate
                     decarboxylase]"
                     /old_locus_tag="AO070342000334"
                     /protein_id="BAE54630.1"
                     /transl_table=1
                     /translation="MADESTVGSPIVADAFLEALAEAGVDYLFTVLGSDHPSIIEAYI
                     RRQNDPTRQYPKMILFQHEFVAMSAADGYARISHKPACVIAHVDVGTAALGQGLHNAS
                     SGRAPVVVFAGVAPSTLLGEAPGSRSEHVQWYQDIRDQAALVAPYSRFSAEIKSPHNV
                     GSLVHRAVLMATTGSPGPVYLTATREILATPIPSVEPRPKPVPSCHLGSLSPEAVEMI
                     GNALLEAKAPLVITGYLGRSHRAVQQLITLADTVQGLRVFDSELREVCFPATHPACLT
                     RSTGAAPAIQSADVILVLDADVPWIPRRVHPSPSAEIYHIDLDPRKERMNMFDIGASA
                     TFHADTTSALTQLNAYITSSPRLPALQEAWTSRAQDLLTAHKEGKARIDSRATAPLST
                     PNEPCTVDYLCSRIRASVPQDTIYITDSVTNQVPMTEQLQLTRPGSHLTKGGSGLGWS
                     GGAAIGASLATARYDISDRPNLHLNETTKTPFICNIIGDGSFVFSVPTAVYWAAHRYQ
                     TPFLTVILNNGGWNATRQCLADVHPSGVAAGLSNRDLGISLVEDGPDYGEVAKAAANG
                     NLWTKRVRSVGELDVVLREGIRVVVEERKSVVLDIVIR"
     exon            complement(332659..334284)
                     /number=1
     exon            complement(334346..334468)
                     /number=2
     exon            complement(334524..334589)
                     /number=3
     CDS             complement(335100..335597)
                     /codon_start=1
                     /locus_tag="AO090009000124"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000333"
                     /protein_id="BAE54631.1"
                     /transl_table=1
                     /translation="MDIWVCLMPLPVLARLQLDRIRKIGVMIVFCMGLFVCITSIVRM
                     SAMAESTKTNDPTWGSFDALMWSAIEASTGIICACLPFLKHPIQRLIPTWFVSLSNGS
                     KKTRPSYRMSRLGSQSGIRTGGHRDEDYYGEADAESMGSQGPIAKGQIVMKTDIVMRS
                     ERAYS"
     exon            complement(335100..335597)
                     /number=1
     CDS             complement(join(335653..335898,335927..336000,
                     336060..336096,336147..336311))
                     /codon_start=1
                     /locus_tag="AO090009000125"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000332"
                     /protein_id="BAE54632.1"
                     /transl_table=1
                     /translation="MVLSPSDVPNKGPLFVKVTAVLTVIAFILVAYRIVWKVYMKSKI
                     ATDDAIISFSMAIQIVNTVMGDLACHYAFGRHRADVARTGGNRVLALKWYQLTLHDWV
                     VLLALPDPLQTRPVPEQVILPRFLPPPLPNPQIPSRVLDHHRPRAIRYLRVRHRYNLP
                     MHPRPRKLAQGHP"
     exon            complement(335653..335898)
                     /number=1
     exon            complement(335927..336000)
                     /number=2
     exon            complement(336060..336096)
                     /number=3
     exon            complement(336147..336311)
                     /number=4
     CDS             complement(join(337262..337892,337953..338137))
                     /codon_start=1
                     /locus_tag="AO090009000126"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070342000331"
                     /protein_id="BAE54633.1"
                     /transl_table=1
                     /translation="MGISIVCYWIVVPFPEDANFLTPEEKALLLARLEADGGGVRNDP
                     ISFKRVLSMAADWKIWICVLAYIGAEESASSLVAFQPTILKDLGWTARSAQAHGIPIY
                     AVAFVLTLSSAWLSDHLRHRFLFTLFGSVLIIIGWSVQLAHYLPAGVRYMGMFFVASG
                     AFIMMSITVVWLCVNLGKGVKRSVGMGLLPAFGNCGAFVSGNVFITSQSPKYPVGFGV
                     GLGFAVMAGVASTVYYFGLRAENRRRDSQPEKEWTPESAQDLGDAHPDFRFQL"
     exon            complement(337262..337892)
                     /number=1
     exon            complement(337953..338137)
                     /number=2
     CDS             join(340654..340881,340941..341879)
                     /codon_start=1
                     /locus_tag="AO090009000128"
                     /note="cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies"
                     /old_locus_tag="AO070342000329"
                     /protein_id="BAE54634.1"
                     /transl_table=1
                     /translation="MSKDTPLYQSLGTPPTIAEAGHDLHRRYRRLLAKGFSEAGLREQ
                     EPVIQQKISVLIKQLHAATAKGTTPEMTSWFNFFTFDLISELTFGESFKCQENGRFHP
                     WILMVTQSIKFRAIIQALGYYPLLFKLFMGLIPKSYQEAFRDHQKLTSENVQRRIDKK
                     VDYTDLASNLIDPKHNLERYEIDGNCAVLIVAGSETTTTALSATMYYLTQNPEAKAKV
                     IKEVRSSFSSAEEITAISVNQLKYLPACFNEAMRKLPPAPAVFTRRVPREGAYIAGNC
                     IPGGTHVGMCHFATNNSSLNFKDPEKYIPERWLGDPEYEDDARAAMQVFSVGPRNCIG
                     QNLARLELRLLLSRVIWEFDWELDSASMDWDKDMPVYLSWGMKPLKFHFAPVVR"
     exon            340654..340881
                     /number=1
     exon            340941..341879
                     /number=2
     CDS             join(345726..346056,346088..346104,346130..346765)
                     /codon_start=1
                     /locus_tag="AO090009000129"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000328"
                     /protein_id="BAE54635.1"
                     /transl_table=1
                     /translation="MPTYQPTGMRLSLSSTVAVVMTSYRSPKMPPQTWKNAYSFPTST
                     ANSSISSTSTAPKPPAHPACRKKHGNRTVPSTPLILKRPVSSARSAVFKPTATSSAPE
                     NGAKSTPPTQILKLMWSMIFGTMPPWEVEEFGCLWVFLQQQYTEIFSEIAQEFPRNSH
                     EWQSLRPTVDGMELFPSVDGDGSDGNDYNDYRNHLVSLGPSFLYKVLRQPSYEARRNL
                     IACNAVSSKSSFMILVQVSRDPPSLLYPADKYESEDIGRTLPLMPAIEQPNSGWKHHW
                     HGYGPIHRVREVVRSDNLQEPWIERTIGNSAGWQWGYAIWDEERNAAGHRL"
     exon            345726..346056
                     /number=1
     exon            346088..346104
                     /number=2
     exon            346130..346765
                     /number=3
     tRNA            complement(346824..346894)
                     /locus_tag="AO090009t00005"
                     /note="tRNAscan-SE"
                     /product="tRNA-Gly"
     CDS             complement(join(348510..348521,348716..349041,
                     349109..349145))
                     /codon_start=1
                     /locus_tag="AO090009000130"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000327"
                     /protein_id="BAE54636.1"
                     /transl_table=1
                     /translation="MAPSGYTIRLQKGIRGGFAPPTPTAILSLAKDADNSYISIYESI
                     RPDGGSGLEDKPERTVDSSDEVEGLVTELYEILQDLPLESPPGSEDIYGKDISISWSS
                     DDFAWCNGGQQGCVGGDSDVHS"
     exon            complement(348510..348521)
                     /number=1
     exon            complement(348716..349041)
                     /number=2
     exon            complement(349109..349145)
                     /number=3
     CDS             complement(join(351082..355299,355397..355746,
                     355798..355805,355867..356275,356341..357003,
                     357017..359315))
                     /codon_start=1
                     /locus_tag="AO090009000131"
                     /note="polyketide synthase modules and related proteins"
                     /old_locus_tag="AO070342000326"
                     /protein_id="BAE54637.1"
                     /transl_table=1
                     /translation="MTINEMIHRLDWMSAELSTEPLNFRKVVFLAADEDSRERLSRYQ
                     AQLASEGLTTVFIGHATEITPLLTPDTIVVHIPHVAREKSGVYEAVTKSCTSLIAAAQ
                     VLYHHNQDSRDRTSRLFSLISRDSGTDGLEYAPLYGLARVMKTEMAEGFGGLFDEDQG
                     HFPLSAFKYAQGFDVVRICQGVPQTASLQPFQDQLNDQKQLQLRENSTYLITGGTRGI
                     GLEIATWLGERGAHNLLLVSRGGLTPALGRNAKNADHEKLVSRIAKLKDMGISVHVLS
                     IDFGKPEAETLLRQAIDELNIPRIKGVVHAAGVAGFHTLQHCSPSDVADVLAPKVRGS
                     LALDTLFPPGTLDFFFFMSSIGQLIGFPGQLSYAPANGFMDGLAAHRRRHGDNSMSIL
                     WTAWRGVGLAAQTKSVTRILTRAMEARGIAAVSTSEAMDAWSRIVSLETDHVVVVPVL
                     KLEADGPLRHPLLKDITMRKKRMQSTAAPYETYPEHAVAVVGMACRTAAGDTADDLWQ
                     VIQADRSMTREIDETRFPGVAKDGKTWGNFMDDVDSFDHQFFKKSKREAAALDPHQRV
                     LLETTYHALESAGSFSGGQKQEAETHEKSSDSEITSCFIGMNAPDYALNVACHPISPY
                     TGFGLLRSFVAGRLSHHFGWTGPSQTIDTSCSSAMVAIHQACRAIEAGECTRAVAGGV
                     NLITNMVTYNAMRVGGFINETGPCKTFDARADGYCRGEAVGVVVLKPLAKALGDGDHI
                     HGVLLATGNNQNIKSTSITNPTVESQKTCWAVLGRAGVNPKEVSYVEAHGTGTRAGDP
                     VEVEGIRQILGGKDRHSPLYIGAVKPNIGHSEPASGVVSLIKVLLMMKYGKIPGQAEF
                     LTLNPSIPALEPDMMTIPTSLTDWCDGLRLAVVNNFGASGNNAAAVVAPPPPSSQSSP
                     LSIASATPSPSVSAWPIFISAASKASLASYCSKLKIQIQQGSLAPELTSHLAFALATK
                     QNRKLQHVFSITATSLSDLQAQLSEPESHTTSEGPKPIVLLFSGQNGNAILPAKPLYD
                     SSLLFQTHLHQCEEVMQSLGLPSLFPAVLQGIDGDGDLVLCHAVMFSIQYSCGKSWID
                     SGVKPEAICGHSFGEWAALTVSGAMTLEAGIKLATGIYRRAAIIQKVWGDDPGSMVAI
                     EADLVGTDTTPSKHLESFHKKHPEAKLEVACYNGPNNYVIAGSTTHIDLLESYLNEQR
                     SSGEKLRFKVLEGTHAYHSYMADAIIDESEKLSASIPFQTPVFPFESCHEQPWTGPGS
                     NVIARNTREPVYFGPAISRIVNCLGPCTFLEAGFGGPIITMARNALPQPQTQSQHTFM
                     PISGTDPVQSMADATVSLWKNGQTSVQFWLFHRSEWAKFVPVSLPPYQFEKHRHWLEY
                     TGLGGNRDGKIDEQEPARGGICSHCLGDIDRFPYIVQDKSQTQTMGRSIFKIDMRSRR
                     YQDLVKGHVVVGSPICPASMYLELASRAVILLLGEHTATNIPEIVANAVDIKAPLGLD
                     MERSVVLTLTEKSRGTWDFEIFSTKNDRTISHATGSIALRNSRTSSVEEVRDKRDKWA
                     RITYLLEEDSDTDALRGAMVYKVFGELATYSAPYKGLRYLVGKGSESAGDITVPVDEL
                     NAIAKASNVGISDPVVVDSFSQVPGAFIQLLRVTDEEEAENTSCICTGMDSVGPLNRL
                     QASGKYRVYTKVVREDSKETAVDVFAFDTQTRDIVWSARGLNFSRVPRDSLAKVLGGA
                     NPGMEFNNSVGSTNLATPPLSPKVPSQVASAAPQVKSSESEKGSANVLHGVQEVLSQS
                     LDVPVAEVTDQALLEELGVDSLVSSEIITHLRNKFQTQISTDEMKVATNVACLCELIS
                     SRVDSAASSDVDSEDQDPDTVSVSADDDIPAWQKTVFHILGQSLDMPVTDIQMDSKLE
                     DLGVESLIETEIISNLNKDLGLNISPSEFATMADVASLCDYIAGGGNTSVRTPTTSLS
                     NFSYTRCNPRSDLSMGLDTGATTPTGSEKSTLVKGDRMSIHTAFQRVCRGFDTHAKDT
                     RFTGYWDQVYPLQLRTATAFILEAFKKLHCPIRDFSPGENLPDLQGTLPKYHREILWL
                     WETLEEVSLVEKTGGDSIRGPVSLDGDSRKDSGQELIMELISEFPHYASTHGLLGLLG
                     PHLAECLTGKSDPVSLLFGSDQGRRLLDDYYANAPDLLAATKLLCDFFTAAIHSQASN
                     REPFHVLEIGGGTGGTTKHLIPLLQATGLPFTYTFTDLSVSLLAHAKKITFKGVADID
                     FRKLNIEENPPEELLGRYHIVMASNCVHATRNLRHTLNNMRKLVQPNDGCVVLVESTQ
                     RSAWYDLVMGLLDGWWLFDDGRKYALQCPWAWEQAMRDAGFAHVDWSESASRESRSVR
                     IICGMVAEPEKACPAKATSMLLHQTSSNSGDRNLFLLPDGFGSSAVFGALAPLLSQVK
                     HVSVYALNSPFLKIKPDPDQSPSIEELAATYVAEIKRRQPEGPYMVGGYSVGGVLAFE
                     AARQLLEYGNDVKRMFLIDTPCPTFACSMPDALVDFLISINRFGVMSEDEVQENKRGS
                     PLAKHHFTLSRRQLSMYQVSRLPGRNIPQVVLFSAREGVDKQEWVARPEVLPAEQQLV
                     DWFLNDRAEGELFQWDKVLDNVKVVPVNGNHFSMMVPPMVSLIVDFCYQSSY"
     exon            complement(351082..355299)
                     /number=1
     exon            complement(355397..355746)
                     /number=2
     exon            complement(355798..355805)
                     /number=3
     exon            complement(355867..356275)
                     /number=4
     exon            complement(356341..357003)
                     /number=5
     exon            complement(357017..359315)
                     /number=6
     CDS             complement(360169..361494)
                     /codon_start=1
                     /locus_tag="AO090009000132"
                     /note="predicted hydrolases or acyltransferases
                     (alpha/beta hydrolase superfamily)"
                     /old_locus_tag="AO070342000325"
                     /protein_id="BAE54638.1"
                     /transl_table=1
                     /translation="MKLHSSVYTGPLLAALLHCGVASAAYSTANSTMLLLSNDSTMNF
                     DLLTPLGESITGGGDVGPILGAAKDIKPGNMTSFTEVFYKLANDTKAQAEDPENAYDP
                     LNVRDTWFSAAQYFRRADVYNHGNWSNPLINSLWAEQIEAFNKGIAALPIPGKRIRIP
                     ATKGNFTVEAIWYSASESKNDKLPTLIIGNGFDAAQEDSYHNYVAPALARGWNCITYE
                     GPGQPTVRRNQNLGFIPDWEKVAIPVVDYVLSEKKDVIDENRLVLVGNSLGGYLAARV
                     AAFEPRLSAVVLIDGVWDNYAAYIRELSSEMLAIYEAGNYTQFDDVLLSARKAGMLST
                     GAAWGIDQGMWAFRTHSPSDFFTQIKQYNVSSFIDKIKIPVFVGDAALESSYVGQPKQ
                     VADALGHWATLHTFKGVAGFHCQTAAGQELSRTIHAWLNKTLGNVTHDH"
     exon            complement(360169..361494)
                     /number=1
     CDS             361852..363579
                     /codon_start=1
                     /locus_tag="AO090009000133"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000324"
                     /protein_id="BAE54639.1"
                     /transl_table=1
                     /translation="MVNRGRSGGCVTCKQRRVKCDEAKPECQACQRLKLRCGGYNRHQ
                     NTKLKFKDQNHKFCTNTKQDVVKVATSSPGRSPESNVQDREVVRALTLRRLSEPDTAV
                     QFYLGHYASMGRDMGSTRGFFEMLIPAYFSEREDSALSLAVSALASETLSMWRQDATS
                     FRSPRKSYSRALTRLQTAIQDPIERGKPATVLAVLALQTYENASAVYGLRRVSSTHHN
                     GAASLLSFMGSDDMGGVVRAYLRRFMLHTEVSTAIRQKKPLKRIAYSWIRSKETMAVP
                     ENPSAALDAIGASVAELQASYTEFLTQGGSATSLKCVPKEWMAAAKRVDAELLAWAEN
                     VPDHWRPVRLISGRDIDLSIPTYQSICEVYPSCQIASIWNLWRFQRLLLAKITLGSLN
                     AFSDLSRFGLAYGQFVGDPTDFVNCQQTLQEVVDSVCHSIPFHLGNRISRSSLADFTD
                     PTVLLPSYNALVDGTPLDREVFDGISRDDHRRHVIAQGPWRAMHPLSRLLALFSEDHG
                     EVIASLLRPGQREWICNQFLRVATLLHLPLESGNGMESSESPGGSADAKAEYLAREIR
                     KGAILMSGP"
     exon            361852..363579
                     /number=1
     CDS             complement(join(364366..364388,364450..365003,
                     365062..365618))
                     /codon_start=1
                     /locus_tag="AO090009000134"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000323"
                     /protein_id="BAE54640.1"
                     /transl_table=1
                     /translation="MQALSGSVSSVLDKPSQVASTDKVEATESPSSRQETPKDIDVDI
                     AADDYPKLDTSTSSATHIILIQNQSSGLDDPVDIMPQTLNQGLARSDNSFPEFNHDIL
                     ALESLTPHTNSLSHQLPNIWSFEYQMGLQPYVNALTSSQQFSVTLGKDWTESNSPFSD
                     HIQVLQKLLKNRLDLIRPLFQPSPQLLYQQVLMVLSLFNSITRPDVMAWYAKTRFYHI
                     VDLTAWQIYPCTGTLSKVHEQYRPTEVQLQQQYPRVIDWIPFPTIRNRLIRLHAANPQ
                     IDQIFCDTVSSYVVEANMADLIMGAPAVTAYIRVTDVIANIPSTTPGSDPQPSAMLPA
                     PDADTLFSSPEYARAVFKKLDIDRGISHYKMDPAFFDRMYNCA"
     exon            complement(364366..364388)
                     /number=1
     exon            complement(364450..365003)
                     /number=2
     exon            complement(365062..365618)
                     /number=3
     CDS             complement(join(366366..366508,366566..367824,
                     367886..367959,368013..368033))
                     /codon_start=1
                     /locus_tag="AO090009000135"
                     /note="NAD-dependent aldehyde dehydrogenases"
                     /old_locus_tag="AO070342000322"
                     /protein_id="BAE54641.1"
                     /transl_table=1
                     /translation="MSPRPFTLNDPSLLHEASLLNGEWVAAQSNKRLSLTDPGSRHVF
                     ATCPTNGPEDVDKYVETSHAAFERYRHVNPRERAKFLLKWHELITKAREDIATIVVYE
                     TGKPMAEALGEVDYALGFAWWFAGEAERVRGSIALPSVSNRRTFVIKQPIGVSAALVP
                     WNFPVAMIVRKVAAALAAGCTMIVKPSPETPLSVMALADLALRAGLAPGVLNVITTDN
                     EYTPSVSERLCKHPLVRKVTFTGSTRVGSIIAKHCSEGLKKVTMELGGNCPFIVFDDG
                     NLEQAVAALMILKWRTAGQACTHANRVYVQAGVYDKFAQMMLEATQKLKVGHGTDSGT
                     TMGPLTTERGVEKLKKLVSDAISKGGKVLCGGKQPNGPQGYFFEPTIISGMTSEMLAS
                     QEEIFGPLLGLHRFETEEEAVKMANDTSMGLASYFFTKDIDRTWRLLESLAAGMIGMN
                     TGNSSCAESPFGGIKESGYGKEAGKDVAIEEYLISKTGTLTVEGAPGP"
     exon            complement(366366..366508)
                     /number=1
     exon            complement(366566..367824)
                     /number=2
     exon            complement(367886..367959)
                     /number=3
     exon            complement(368013..368033)
                     /number=4
     CDS             join(368673..368712,368788..369851)
                     /codon_start=1
                     /locus_tag="AO090009000136"
                     /note="homoserine dehydrogenase"
                     /old_locus_tag="AO070342000321"
                     /protein_id="BAE54642.1"
                     /transl_table=1
                     /translation="MATTTEEVYIAVIGAGGVGSCFLKQLSYLSKTRPSPRLRLCYIA
                     IIDKALHHPDYSEINIETALNRLEAEGQAPPTIPWIIDYLSGAPSKVILVDNTSANSL
                     AEAYPQFLRRGISIITPNKKAFSGNYQLWEDIFSSAAAGHSYVFHESSVGAGLPIIST
                     LKDLIITGDEITRIQGVFSGTMSFLFNSFAPTEGQGEKWSVAVHKAKQLGYTEPDPRD
                     DLNGLDVARKLTILGRLAGLPIESPTSFPVQSLIPQELQGVSSGDEFLDRLPEFDQQM
                     EQHKAAAEKEGKFVRFVGSIDMASREVKVGIESFEKTHPIAALQGSDNLISFYTKRYG
                     DNPLIVQGAGAGGDVTAMGVSSDLLKVLSHIAR"
     exon            368673..368712
                     /number=1
     exon            368788..369851
                     /number=2
     tRNA            370017..370097
                     /locus_tag="AO090009t00006"
                     /note="tRNAscan-SE"
                     /product="tRNA-Ser"
     CDS             372301..373557
                     /codon_start=1
                     /locus_tag="AO090009000138"
                     /note="monocarboxylate transporter"
                     /old_locus_tag="AO070342000319"
                     /protein_id="BAE54643.1"
                     /transl_table=1
                     /translation="MGARDETPQTTNEASPTPIEPPPDGGLNAWTQAVMGHMVCFNTW
                     GYIASFGVFQAYYQSSLGVSSSAISWVGSVQIFLIFFIGTFSGRALDAGFFRPVYYTG
                     VLLQLLGVFMTSLATRYWQLFLAQGICTGLGSGLQFCPVMGLVATYFAKRRVFALAFG
                     LVGSGTGGMLFPGLVKALMPAIGFGWTLRVLGFVMLGTSIPAMALLKPRLPPRRSGPL
                     VEWSAFREPAYVLFCVGMFLNFWGLYFAFYYVGAFGRSVIGLSYSDSTNLIIVTNGVG
                     IVGRLIPAFLAGRYFGPLNTIIPLALGASLMMFCWIAVHSVGGLYAFAVLYGMFSNGV
                     QGLWPSTLSSLTPDLSKTGVRIGMGFTVVSFACLTGPPLGGALIARADGYIGAQIWGG
                     LTFLLGALVLVTARVSKTGMQLKARI"
     exon            372301..373557
                     /number=1
     CDS             complement(join(374047..374695,374757..374935))
                     /codon_start=1
                     /locus_tag="AO090009000139"
                     /note="methylenetetrahydrofolate
                     dehydrogenase/methylenetetrahydrofolate cyclohydrolase"
                     /old_locus_tag="AO070342000318"
                     /protein_id="BAE54644.1"
                     /transl_table=1
                     /translation="MAPRVGETIQPDDLAKRAHSQISEILTNTPKRLFLMGVLASDDA
                     GSNQYANWTRKTCQEIGVHFHLMKLSPKNVATYIRAINANNSVHGIIVYYPIFGDRRD
                     DEIRQLVAPSKDVEGLNHQTLHRISDAAEVSRPPKPGRNVIPCTPRAVAWILEWMDVH
                     DRTRPAGERLQNQEICIINRSEVVGLPLAHLLAGEGARVYSVDISGVQLFQRLYYPWQ
                     SEALHGKDLPNWSVQDAVQRSRVVISAVPDPAFRVNTKWLQRGAICVNVSSEKVRVL"
     exon            complement(374047..374695)
                     /number=1
     exon            complement(374757..374935)
                     /number=2
     CDS             375711..378056
                     /codon_start=1
                     /locus_tag="AO090009000140"
                     /note="uncharacterized protein conserved in bacteria"
                     /old_locus_tag="AO070342000317"
                     /protein_id="BAE54645.1"
                     /transl_table=1
                     /translation="MGSAVSHPSTPSPPANDLIVVGSGASGVAILLQLIERVKNGKAL
                     GEVIFVEKNGLPGPGLPYSSQCEGTILNMHTDTMGLYHDKPLHFSQWRTDQESGPFPS
                     RARYGQYLQETWGQALEEAQHIGLGVSVIQDEAHDIDRQADGTMTLSLRNGTQLTAKS
                     VVLALGNFTSVCNTHLINLPGFFPGPWPTSQLKTIPTDASVLVVGSRLSAVDAAIFLS
                     EHGHQGPITFMSRSGSLPKVQGDTTPFSRRYVLHDLAKHIEENSDENLLQVTSSLMEE
                     IFHATNGDWGWLHNDESPVKQLEHDIQAAKTGKVEWQKVLRGTAPVIERYWNGLPAKS
                     QQLFMDKFFSPWMRYRHGMPIQNAEKILGLLRKGQLQVVQGDRVQWDGIYKAQTSTGL
                     LEAPYVIEATGQECQLDRIESPLIQSAVEKGLLKPHPAGGVAVDFDSLRASEGLHVIG
                     SLTRGTHFYVSAIDRVAAHAARIADAITDEPTARPLHIAIFLGSDLFSHLMASTLVPQ
                     LLAAGHTPFIFLPVHKANRKTTPPFELRELTFFERELLQKHVIPYFKNEKPNGAPHMT
                     IEQMKDAYGILVQEVPNVNSASFINTLRKHHIDVGLSLRCYQRFKTDIIRYFARPKRL
                     LNLHPGVLPTYRGVMTTVRAMKNREKFFGYSLHDIDEDWDAGDLIDVRHHPIDYSKSM
                     LHFMNDVYKMGAKMAVDVCDNIARGKELSNVPQKAEESNYYTFPTKEDLEGYRKDGIR
                     LVDAESIVNVIVESFAPLEKQEKFRAHIDEIVQEWYDKNRP"
     exon            375711..378056
                     /number=1
     CDS             join(378748..378983,379020..379023,379087..379351,
                     379415..379510,379567..380100,380191..380230,
                     380312..380487,380555..380573,380701..380878,
                     380934..381077,381161..381927,382009..382206,
                     382257..382458)
                     /codon_start=1
                     /locus_tag="AO090009000141"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070342000316"
                     /protein_id="BAE54646.1"
                     /transl_table=1
                     /translation="MSESPMEKFSQGNNLLVRILLQDADSRIVGYSKKGTIALPRWRN
                     AGRAQHIRLVRMRIALKAGPAEIQIRPVDCLAYSITKVKMAPSAEPVSGQNKPYRSGD
                     PRLAVVDEEAEQPPKFDDLYQERRYLKHRLALAFRIFAKFDLSEGVAGHITVRDPVDP
                     TSFWVNPFGMHFSLIEDDDLIRVDHSGTVVEGGKNKRLNYGILVIKFLTSPAAYAIHA
                     EIHRARPDVLCAAHSHSLYGRAICATGKTLDMLTQDFCVFWNDHVLYSNFAGLVLAAD
                     EGKAIAAALGNKKAALLGNHGILTVGPTIEATVAWFVLLERCCQIQLAADASAAGTGR
                     PLVTIGEDEARATWEAVGTIGNGYFQGLPLFQVAEREFGERTLLDRSFPCKIIVPHSR
                     THRPCLLANNLSKYESSPLISSGNTGHLKIPGDGILSRWRCFPNSDIRRMSPISIDLP
                     SRSSSVGYKMSSEAKGSAIHMESTTPANLDIDGKDGNGELDTQSVIVDEETNKRLLRK
                     IDIRLMPVKPFGITYNGRKMCFTYALQYYDKALLSQAAIFGLREDLDLQSGLRYSWIT
                     WVSQKVTVARVCPIICILWSLIVLCTPACSTYTGILINRFMLGVIESGVSPAFMLCTG
                     AWYTHSEQVLRSSLWYSFSGGSNIISPLINYGLGHITSGSLHPWQYMYLIAGLATLAW
                     AIALFFVFPGSPQTAKGFTAEERMMLLERVRANNAGAENRTFKWYQVCEALYSYHFWC
                     IFLLSTLSSTGSGAVTTFGSIIFNGMGFSTFESLLLNIPIGALAFICVLGSGYIGRKY
                     PNARLHTVSASCIPVIVGGCMLWRLPSSKTAARIIGFYLINFFSAAWVQCIAMGTSNV
                     AGYTKKATMAAGTFMGYSLGNIIGPLTFDARYAPRYDPGFEALIICFAIALVLSQVFR
                     ALMALQNHRRDQRVGPPTAECGLQDLTDKENKSFRYPL"
     exon            378748..378983
                     /number=1
     exon            379020..379023
                     /number=2
     exon            379087..379351
                     /number=3
     exon            379415..379510
                     /number=4
     exon            379567..380100
                     /number=5
     exon            380191..380230
                     /number=6
     exon            380312..380487
                     /number=7
     exon            380555..380573
                     /number=8
     exon            380701..380878
                     /number=9
     exon            380934..381077
                     /number=10
     exon            381161..381927
                     /number=11
     exon            382009..382206
                     /number=12
     exon            382257..382458
                     /number=13
     CDS             join(383941..384221,384279..384706,384763..385043,
                     385102..385461)
                     /codon_start=1
                     /locus_tag="AO090009000142"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000315"
                     /protein_id="BAE54647.1"
                     /transl_table=1
                     /translation="MWGSTAMRKPGAIAALLLFIEWHCRPINCEDFDTGLDATSLFVS
                     PNQPSGAQYNTQPTHEIGLDCSVNSHTNVEGLPARLNIVAPAYRSHMMSWTLLSTAIS
                     LAQEIGCFSQDVLTNTTLARRGAVSGSVRLEWNRTLCTFIHLTDQNLSLRLRLEPQLP
                     GSRCGNMVDQLHQCFSLDSFWESAIDLAAHTDKARELLCSWRSGELGVQSAPLTASWE
                     RFRRGLDRWKKQHAPISSERDLSLPRVCLSLEYFYIRLCGLSPAAHVFESSSGDDQRD
                     PNMPILSQLANDAVQTSIDLLSCVTHDLTPSTLFKYVGVRYWLYIVCASLFLLKATLR
                     VEERLEDSHPHILLIRQAVRAIKQNAPDDIHMSQRYATLLDIYVNAALRSSPSAVISE
                     DIFRWEHDDSSTSNCGPVQGYTLDQGNNVMFDSSFCNYLPDMVGLDDIFSWLPAGSD"
     exon            383941..384221
                     /number=1
     exon            384279..384706
                     /number=2
     exon            384763..385043
                     /number=3
     exon            385102..385461
                     /number=4
     CDS             complement(385591..386592)
                     /codon_start=1
                     /locus_tag="AO090009000143"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000314"
                     /protein_id="BAE54648.1"
                     /transl_table=1
                     /translation="MNTLTVIITLASLWLSRALGQLTPLNQFFKPPTFPNEQTENVTR
                     YLNEAAAQAVDGSIHQYFQDQCITQQLYPPLFTWPSGYVQPFSPFEGLFFVGHSGVSA
                     WAYNTTEGIVLIDTLDNEDEIRAILLPGLQSFGLNGSEIKHVIITHEHADHYGGAKYL
                     QDTFKPAVYASELAWKSMAAMGKNATPPVPTKDRILADGDNLSVGGVDFHIVLTPGHT
                     PGCLSLIFPVSDQGRQHMAGLSGGTGTPADAASREQKIRSQYKFADICQGRGVDVLLS
                     NHQVADHALFHADILAHRTQRTSNPFIIGVDNFDKYMKINAICSKVIAAREGQDLQI"
     exon            complement(385591..386592)
                     /number=1
     CDS             complement(join(388327..388366,388485..388593,
                     388653..389244))
                     /codon_start=1
                     /locus_tag="AO090009000144"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000313"
                     /protein_id="BAE54649.1"
                     /transl_table=1
                     /translation="MHFHKITLGATLAALLSLTTALPTTSYSFPLTTRDDTQCPTGKS
                     FYRCYKNNFRGCCSVDPCDLDDGCPDNDTPTCTPGKIYQPKMQTYLLPSSDPISTPNL
                     NVSKSATAEWDQTMTFSVPQGAKTCTLNWGVPAERNFKAGNNALVRVWQGDKVEGESI
                     GAADFTNWPGVEGPHLHTVGTVQCAEEIVLRSRLDKERLGWLAEMRVSFPGLLFFSLF
                     FIFLFFYVCCLPLAFDLKLRSCRILISI"
     exon            complement(388327..388366)
                     /number=1
     exon            complement(388485..388593)
                     /number=2
     exon            complement(388653..389244)
                     /number=3
     CDS             complement(join(390657..391321,391364..393079,
                     393518..393813,393863..393914,394159..394219))
                     /codon_start=1
                     /locus_tag="AO090009000145"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000312"
                     /protein_id="BAE54650.1"
                     /transl_table=1
                     /translation="MGKITTVAAHPSCGPQQSSAPTHAMETHGPNPKTGITEALKHCH
                     WVVAIAVLGTLLLKLLTVASTGLFMLQNVHVSNVPTTLTAEATFSGTGYNSANIDSNA
                     ALIVVGNKFLDLPYPAGTTDKYAFSPFHGSDTPSEINSTDKVDTSNYTIPGVTAVDIV
                     SGLLSTLTIADSSVGTLIQLNHGLSANLADPNNSYLDSFYRIATVSSADNLEPLLDAA
                     NLEAISRPVYNAITAQVARQYLMTSANKPFNGVYSASTEKLLVRELSVRLMEAAVALL
                     VLVAGAMCVWRPAKCTPRDPGTISGMATILARSPDLSNRLAGIKNRKDLKSSLAGGLF
                     ASEIASIDGQRSFSIITKHDAKEDMRVAEASSQISWWKPLAMSLGWRILTLAVPLLVI
                     AGLETTYQISQKRNGLADITSDGYIRYTWVYIPAFIMLLIQALFECSHFSTQVIQPYL
                     ELRRGGLTAQESLMDNYLSKLTMHALWSALIKRKYAIFTTALTMILAPCLTIAASGLY
                     STEAASYVRAVSILRNDSFNSTVEPQAYHSGQKGIGLTGALVVGTNLSYPDWTYDEVV
                     LPALKEGTLMDVKENTTYKPTNQSSTADSIFELTYPGLRAGLNCTVLEASQILETTVY
                     KGFGSSMSVSLSLGGDCDTSSRKVDNKTIKWYSMTLPLNGTTYNGTAFGTFQVTDIIN
                     EMPECPKMVGVYGVVSNPNSTDTDGIHTTFTVPGFKIQSAKPDESSSRRFADSLASQL
                     DFDSFLPTSNTVTAYDGFDNVFIAMMQDQETLTVTDLEQADRVPVVINATQHLYRVLM
                     AQSMNGNSRLPLEQETKYQGTVVDPTRVRLKQSAVSTRILEGFLAAMALCIMVAFYLG
                     RRTEVIPVNPCSIAGAATLLAGSEMLKPDMIPPGSEWCDDTELVKRGVFNGVVFGLGW
                     WEGKRFAIDIGRPEE"
     exon            complement(390657..391321)
                     /number=1
     exon            complement(391364..393079)
                     /number=2
     exon            complement(393518..393813)
                     /number=3
     exon            complement(393863..393914)
                     /number=4
     exon            complement(394159..394219)
                     /number=5
     CDS             complement(395372..396469)
                     /codon_start=1
                     /locus_tag="AO090009000146"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000311"
                     /protein_id="BAE54651.1"
                     /transl_table=1
                     /translation="MQWKSFLLFVAIADLGLARLHGHQRRHKHNPAHPDLQGPEADLK
                     ARDLEVKTVVDLEVVTVTTTITGQPVAEAPAPSSSSSSSTTTTTTVAAAPAEITPAET
                     HEDVISIDLGASIGVSVAAPSLTPSAESTAPTSTPAASTTVSGGSTSWTSTPSSGEFS
                     TSGFGTRTNSSGSGIEYSGNVGSPWGSNIIEVSASTAYQYRYVVQFTGSNTEDWTIVF
                     WNKIGPDGKMDGWYGHSALNLTLGAGETKYVAFDEDSQGGWGAAKGSSLPTDDYGGYS
                     CTWGEFDFGSTINDGWSGWDVSAIQAQAAGQTVQGMKICNHNGETCSTITSGASTVTN
                     AYTQSEASVDGIGGSLNTDSVRLVAIIDYSE"
     exon            complement(395372..396469)
                     /number=1
     CDS             complement(join(399353..400314,400376..400697,
                     400762..400935))
                     /codon_start=1
                     /locus_tag="AO090009000148"
                     /note="aspartyl protease"
                     /old_locus_tag="AO070342000309"
                     /protein_id="BAE54652.1"
                     /transl_table=1
                     /translation="MRGASLLPVALAALSCVDALSLHRRDTPATVELPIERRQHAGGL
                     QKRDSTLNLPLINYYDSFYILNLTLGTPAQQFAVALDTGSSDLWVNVANSSYCSSRTN
                     PCKPFGLYDPDASSTYKNLGVEFNATYGDGTNAYGYYATDELGLGDVNVDDMQFGVAE
                     STTITQGIVGVAYDTLTNEASHEGKTYVNLPQALVNSGAIKSPAYSLWLNDPQASRGS
                     ILFGGVNKAKYKGELQTIPIVRTLRGYSYLAVTLTGVSVEQGKESEDYSSRLPIVVLL
                     DSGTSLTYLPDSLVDELYKTFNATFLEDDGLAYVDCELMKKDYTVNFDFSGATIAVGI
                     SELVLKAVAEDFPLGTCAFGVVPSGDSQDAMYILGDTFLRSAYVVYDLGNNEISLANT
                     NFSPGDDDILEIGTGTSAVPGATPVESPVTSATVASATDIVHTVMVGGTKATATDSNS
                     GAAETSSSSGIAALPTSNTRHLLSGLAGAGLLLAL"
     exon            complement(399353..400314)
                     /number=1
     exon            complement(400376..400697)
                     /number=2
     exon            complement(400762..400935)
                     /number=3
     CDS             join(402750..402957,403014..403113,403172..403217,
                     403279..403444,403495..403523)
                     /codon_start=1
                     /locus_tag="AO090009000149"
                     /note="alkyl hydroperoxide reductase/peroxiredoxin"
                     /old_locus_tag="AO070342000308"
                     /protein_id="BAE54653.1"
                     /transl_table=1
                     /translation="MFAARRLTAGVPRVFSQRALFHNTAPAFVQKGDSIPNLDVLVED
                     SPGNKVNLASELKGKGVIVGVPAAFSPACSSSHVPGYINHPKLKEAGQVFVVSVNDPF
                     VMKAWATSLDPSGKSGIRFLGDPTGKFSEALDVTFDSSSIFGNHRSKRYALLVENGKV
                     KEAFVEPDNTGLDVSAAEKVLA"
     exon            402750..402957
                     /number=1
     exon            403014..403113
                     /number=2
     exon            403172..403217
                     /number=3
     exon            403279..403444
                     /number=4
     exon            403495..403523
                     /number=5
     CDS             complement(join(404389..404561,404659..405025,
                     405123..405158))
                     /codon_start=1
                     /locus_tag="AO090009000151"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000306"
                     /protein_id="BAE54654.1"
                     /transl_table=1
                     /translation="MTLLGNSGVRSLISKIRRKHPKLLLRLNSHHHPLVESSAIFLPP
                     GLRIQSPLHPIKTFPAHLMYSRTSTLLSRSCRYFFRAPVHQRQTFSISARSFAAVNAA
                     MADATAGVTPEGLKSKLIEQLQAQHVEIEDLSGGCGQAFQAVIVSPQFEKKTMLARHR
                     LVNSVLKAEIAAIHAWTPKCYTPEQWQALQQ"
     exon            complement(404389..404561)
                     /number=1
     exon            complement(404659..405025)
                     /number=2
     exon            complement(405123..405158)
                     /number=3
     CDS             complement(413319..414260)
                     /codon_start=1
                     /locus_tag="AO090009000153"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000304"
                     /protein_id="BAE54655.1"
                     /transl_table=1
                     /translation="MSKTLAVFGATGQQGGSVIDYVLNDPELSQRYKIRAITRNVDSP
                     KAQQLKEKVEVVQGDVLSQSSLREALTGAHTIFAMTTPIPGPDALETEYQSAKTIADV
                     AIDQGAEYIIFSTLPAISEISGGKYTQVTPFEAKAKAEKYIRGLPIKSAFFSPGSFME
                     NYQLLPFLRPRQAPDGTWVMVHPMSPKGLLPLIDAVGDTGKFIGAILAEPDKYEGKTF
                     CAATALYSLDEIAAVMSKATGKTIACKQVHPEEFKKSLPFLALAFNVFIEGFQSIGEF
                     GYYGPDSERLVAWAAQNARGRLSTFEEYLEAHPLQLE"
     exon            complement(413319..414260)
                     /number=1
     CDS             complement(416372..416767)
                     /codon_start=1
                     /locus_tag="AO090009000154"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000303"
                     /protein_id="BAE54656.1"
                     /transl_table=1
                     /translation="MKPPRTTFVYFILRGLLKLNATKVLLAIVFLWLTAYEFCRLRYW
                     RDPHSAFFDGRNAYEWKYSLYREHEARRLIAGHNAPSDPYVLCQSKNGSNYMRLVRDG
                     QTGWVRLFRGLGRIFVGRIGSARAQRPLS"
     exon            complement(416372..416767)
                     /number=1
     CDS             complement(join(418944..418968,419087..419159,
                     419233..419299,419396..419594,419706..419754,
                     419813..419900))
                     /codon_start=1
                     /locus_tag="AO090009000156"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000301"
                     /protein_id="BAE54657.1"
                     /transl_table=1
                     /translation="MERNCRIRSGLLQCAGAVLGRGIFASRATVTIFLAVCLSVFLLP
                     TGASFFTNWGIIAFTNWRFHCAPKAQKDILFSETYGWKSTFWSSTPAWLMLVSLMLLV
                     CCLECGVKPVDGLTFTAENFLQYTLGLWVITGYGPWGAEEIMVLDRYYEQPRWRRLTS
                     NSLGPR"
     exon            complement(418944..418968)
                     /number=1
     exon            complement(419087..419159)
                     /number=2
     exon            complement(419233..419299)
                     /number=3
     exon            complement(419396..419594)
                     /number=4
     exon            complement(419706..419754)
                     /number=5
     exon            complement(419813..419900)
                     /number=6
     CDS             complement(join(422032..422513,422582..422629,
                     422666..422795))
                     /codon_start=1
                     /locus_tag="AO090009000159"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000298"
                     /protein_id="BAE54658.1"
                     /transl_table=1
                     /translation="MSRMGFEPVSSWVNTLGIRQWVVLPHLHGCRSINPLRVGFIDQA
                     MVDIPERPRVTDSKKVWCSILTNTAYLPGILTLEYSLRKHDTKYPFIVLYTDSLPEEA
                     HAALDARGILKQPVPYLKPAMTTDLTQDRRLYDAWTKLIAFALYEYDHVVLLDCDMMV
                     LHNMDELMDVELDPPEMGGKGKRVFGSTHACVCNPLKRPHYPADWYVSIYGSSLDEIP
                     F"
     exon            complement(422032..422513)
                     /number=1
     exon            complement(422582..422629)
                     /number=2
     exon            complement(422666..422795)
                     /number=3
     CDS             join(423775..423982,424014..424285)
                     /codon_start=1
                     /locus_tag="AO090009000160"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000297"
                     /protein_id="BAE54659.1"
                     /transl_table=1
                     /translation="MICRAHDATNKFYRISSPQSKNDCMSNVSSTQSTLQPECHRGAM
                     YRLHSGPYSMYSYNKARAEVRWKLMLYSRSEKHGGPVLLANPQSPDQGLLQTPARRVE
                     LPAFQVQPQQHVPLNVEATATREAHDIEDEERNGDEIAAAALGQPRRVGEIPFYTGN"
     exon            423775..423982
                     /number=1
     exon            424014..424285
                     /number=2
     CDS             join(425329..425480,425502..425688)
                     /codon_start=1
                     /locus_tag="AO090009000161"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000296"
                     /protein_id="BAE54660.1"
                     /transl_table=1
                     /translation="MGEINALEAQIMRCRLPDQDEHGLTHLAKFYAHHVHLHYQLRLS
                     FSSWHWHALLITLYRPSGSEHLDNLALSQQGSEQQRLQSKANAAASKSTEILDILARE
                     NLLEYVGPMT"
     exon            425329..425480
                     /number=1
     exon            425502..425688
                     /number=2
     CDS             join(426459..426800,427086..428240)
                     /codon_start=1
                     /locus_tag="AO090009000162"
                     /note="predicted oxidoreductase"
                     /old_locus_tag="AO070342000295"
                     /protein_id="BAE54661.1"
                     /transl_table=1
                     /translation="MAQKNSPIIIVGGGLAGLVAAFELSKREVHTVIIDQENEASLGG
                     QAFWSLGGLFCVNSADQRRLGIQDSRKLALEDWFNSARFDRECDFWPRKWAEAFVNFA
                     ADHMERYIKSLGSTGAVIGVRGQVLEPSDTARGVASSRKSIDTFEVYGSAVLIASGGI
                     GGNVDLVKKNWPVDRLGTPPSNFVIGVPAHVDGRMIEIAKDAGANVINEDRMWHYTEG
                     LQNWDPIWPQHGIRIIPGPSSLWLDATGKRLPPMLYPGCDTLATLKHICNTGYDYTWF
                     VLDKTIIGKEFALSGSEQNPDLTGKSRLRTLYRMLGSAVPGPVQAFMDKGVDFVVEPT
                     LPKLVAGMNKLAKERDGPPLDVEKIEREIHLRDMQIDNKFTKDAQIMLIQNGRNYWPD
                     RLGRVAKPHKLADPSHGPFVSVRLNLLTRKTLGGLETDLHGRVLRPDGSPFPNLYAAG
                     EVSGFGGGGVHGYSALEGTFLGGCIFSGRTAGIRMAEEVAGKAPRSAL"
     exon            426459..426800
                     /number=1
     exon            427086..428240
                     /number=2
     CDS             complement(join(430415..432358,432427..432691,
                     433793..434022))
                     /codon_start=1
                     /locus_tag="AO090009000163"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070342000294"
                     /protein_id="BAE54662.1"
                     /transl_table=1
                     /translation="MDLENNTIHCSTFVQHTYIKLNPVGPIGAGRLPETRSVEEAQQY
                     PTGWKFWLTILTMSALVVLGGLDTNIVATAVPSHASTRTPSPAASPLSPPATQRSSAL
                     TNRLTSVLSASYADSDIRDALETLSLRDIHNTPEVRRQLRLDVQKEVVDCNAEIVRDF
                     GKVAEQLKRIGTVITSLNQTCDEMRKHISLARQDTAPVLEEASTLMNQKKEAETKQQL
                     LDAFTKHFVVPDDDILVLTSLEDPINDQFFEVLARVKQVHRDCEALLGGENQRLGLEL
                     MDKSSRNLNSAYQKLYRWIQKEFKSLNLEDPRISSSIRRALRVLAERPSLFHSCLDFF
                     AEARDYTLSDAFHYALTDAVSGTAGDSNVKPIEFSAHDPLRYIGDMLAWVHSTTVSER
                     EALEALFVADGEELARGIQAGLSSEPWSRIDEHEEVAFDGQKALSDLVNRDLIGVSRA
                     LRQRVELVIQGHDDPVTCYKVVGLLSFYRTTFQKLLGPNSNLAELLVTLEKFTFGHFE
                     ALMKDVVSSLSTDHLALTPSEDLSTPQFLIDALEGLTSLMKTYEASFGADDTESTSDE
                     NRFTPVLRAAFDPFLELATSSAEELSNATARAIYLTNIHLTARTSVSEYSFVSTTHLN
                     PISTKLSSLRIDLLEIQHRYLLDESGLQVLLTALEPFSPSSVAKSSTETEKQDSHPLE
                     SQPQQQPNLADIATLPAFQPEALIAVSQQLDDFLPSALMDATDNLKRLRSAAFVKSVT
                     EEAVEAFCRDFEFVEGMIIGADEARGKVDVTRVDRGSETGAESEKGMEEGENGWGLRR
                     LFPRTTGEIRVLLS"
     exon            complement(430415..432358)
                     /number=1
     exon            complement(432427..432691)
                     /number=2
     exon            complement(433793..434022)
                     /number=3
     CDS             join(435448..435520,435680..435801,435865..437197,
                     437308..437318)
                     /codon_start=1
                     /locus_tag="AO090009000164"
                     /note="Prolyl-tRNA synthetase"
                     /old_locus_tag="AO070342000293"
                     /protein_id="BAE54663.1"
                     /transl_table=1
                     /translation="MTIHKSKLINPCIILYTYVRYPADRISPPRVEVNKEDDFDTWYE
                     PIVVKGEMIDHCSLPGYFILKPVAYGMWEKVRSWLADHLQPLELQSFSVPILPYLGDR
                     AQAPYAVSGSSSFPNAESVIYPYCRKWIKSHRDLPLRMNQWCIRFQHEQNPQPLLRSC
                     EYLLQEVHSAHITKDSARQEAAQILELYSLLYRDLLAIPVVKGYKNAAYLQDTDISTG
                     VVIAYIPATNQCIEGAKCHEFGQTLSKAYEITVRDPSATAEPAALLHVWQNCWRISIR
                     ALGVMVATHSDNHGLVLPPRIAETQVAIVAAQASSTDEQLILDTETDRLVSRLSSAGI
                     RVKVDDLEGYSLGWRFNEWIVSGTPLFIVLGPNEVTNQVVTIRRRDLLHAEGKVEAAI
                     PELHTIIPTTLANIQEELYRNALAKFQADQTRIADNWDDFIKSLYRDKLVCLTPHCRQ
                     RSCELYIEGMGSDGTDQALGSHIRCLCVPLEQPGATEECATPCINPTCKYSALKWAMF
                     GYAY"
     exon            435448..435520
                     /number=1
     exon            435680..435801
                     /number=2
     exon            435865..437197
                     /number=3
     exon            437308..437318
                     /number=4
     CDS             complement(438417..439781)
                     /codon_start=1
                     /locus_tag="AO090009000165"
                     /note="1-aminocyclopropane-1-carboxylate synthase, and
                     related proteins"
                     /old_locus_tag="AO070342000292"
                     /protein_id="BAE54664.1"
                     /transl_table=1
                     /translation="MPYPPIAQHDGVPHGTASRPAHSLSLRASTSLRDTSNGLWDILN
                     DLWHPESNPHGYVTLGAGHNALMQEQLLHRVNSNFDLPGRHLLLNDTITGSVRLKTAI
                     ARFLTRYLSPSKALKPSQIIATNGVSSATEHCSWALCDPGEGMLVGRPYYRDFSRDIC
                     LRPGAKLVPVSFDEMDPVGVSAVSKYEEAIVSSREQGCTIRAIMLCNPHNPLGRCYPP
                     SFLVGLMKLCQKHGVHLISDEIYALSVWRHGQDGATTIEDFTSVLSINYDGVIDPKLV
                     HVLWGISKDFGANGVRLGVIISQNNGDLLESIRGVGQFSSISGFADYVTTSILEDEEF
                     VDRYIEESREKLAAAYNYVVIFLDNHGIPHARGSNAGFFVWCDLLTAYLKAQPNRPSD
                     DSDSAKWNRSRELAEKLALHKVHLGVGDDFGSEQPGWFRITFSQHRVQLDEGLKRIVK
                     ALHS"
     exon            complement(438417..439781)
                     /number=1
     CDS             442353..443213
                     /codon_start=1
                     /locus_tag="AO090009000166"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000291"
                     /protein_id="BAE54665.1"
                     /transl_table=1
                     /translation="MDSPLLSPAKARQAAIQAKDWAYVNSWLSRQYAPNPVPTFERNE
                     DTLRTLLALAAANDTADEEAALLHQAREQAVQGFKAREETEDKQKKEILDELEYCLDD
                     KGGQDLDDLAKSAAALGALDVEAAHLGQAVVDLTKEEFGVQDQLDKVDMLHDYLQREL
                     EALRRQLDELRSDPAYEVPADLPAKTVEWTKGTKVLAAKVNEYQDRVAALKRNQSKGP
                     TLGEVLAEEEDIKKLMDNVKSLEHRLQLFQNLPTDVQGARAKYRELLEELSELTQERD
                     SKLDQSRREK"
     exon            442353..443213
                     /number=1
     CDS             join(444706..445611,445670..446290)
                     /codon_start=1
                     /locus_tag="AO090009000168"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000289"
                     /protein_id="BAE54666.1"
                     /transl_table=1
                     /translation="MPSSATSSSNWDFTPVINLLRSPTYSSGDRSTPARHNDSHQAPS
                     TPGTVAAQGLNDSAPDLKHESGGPPKLGDFSSLWDFLGNTTPPVGAEAGLRQATKESI
                     VEQPPQQPKRIQILKRPSHGDTNVDSPDKTLPRTPPRPIPTSDVSKSHETTVEYRTTK
                     HRNQTKQPTYEPHLSEGTVEAESDNPSIFDSSYSKRRVVSFVPSQVGIAEALSESSET
                     PPSSFDEADGALAPIAIQNLPGGAIRVQPVAYKSAADRKVGLLTKLLKNFPDYAETIT
                     RVGRAGKSKPGSSTCRPIHVFVDMSNIMVGFHDSMKVSRNIPVKTRIRRLPLSFQNFS
                     LILERGRPTAKKVLVGSDRFAAIDDGEKLGYETNILDRVHKVKQPTRRQLKYRKGPRA
                     GAHDGGSGSETNDAPEERWVEQGVDEILHLKILESLLDTDEPATIVLATGDAAEAEFS
                     GGFMKMVERALRRGWTVELVSFSQVTSYAYRKKEFRSKWGNKFKMIALDGYIEELLDM
                     "
     exon            444706..445611
                     /number=1
     exon            445670..446290
                     /number=2
     CDS             join(446841..446917,447045..447639)
                     /codon_start=1
                     /locus_tag="AO090009000169"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000288"
                     /protein_id="BAE54667.1"
                     /transl_table=1
                     /translation="MTTYTPRDFYGGAIKGLIPQNWVDASNVREIPSHQEVYLSRTTL
                     TSQITEINQRVTDPETSSLDTLINTQLQSQPLKPDAKAALYHVHDLCDEDDKLEIVTA
                     PTRVILRKFPAGVVGYRGVVRVVSPKASSRAGARVGSGVGIGGAVAGSSAEGELTSTV
                     TLWYLVVRLVEQETDLVVFVNVPREEFERAGDLRGLEAEERLAEGLIDGLVQELEVVD
                     WGLFC"
     exon            446841..446917
                     /number=1
     exon            447045..447639
                     /number=2
     CDS             complement(join(448149..449214,449269..450410))
                     /codon_start=1
                     /locus_tag="AO090009000171"
                     /note="SPRT-like metalloprotease"
                     /old_locus_tag="AO070342000286"
                     /protein_id="BAE54668.1"
                     /transl_table=1
                     /translation="MARLNPTSPVKQGGTRENATKSVRKLKSNTNSVFSSRFRDTSPT
                     PKVGDHSGTLFDEPEFKRPTARTTTNDKPVQRQRKLQRSGTVSSGTFNIFSDSDGLSD
                     PDDVSFASTMRSSTTRSSTEGRPSDPLQLARANSLLMPQSRHSRSRSTRKSELYDYTK
                     ENYPVEEVVEDYSTTSSISRNPSDASSTRRSPTRREPRQTNTRRQNGRQFRDYRQPAN
                     RSEDEESDDGFNSLDDFIVSDSEEPSRHEASASESEPEETKRAPSPPRVKRRLVRGRR
                     LNPEEQIKRALESSANTSLRLEPSLPAAVSMPSDHQASPRKLFRNTSNIDEKMSRLDM
                     EDGDAGVDDNEVDHDTAEEAAAEVAAVDEVDADEYDPSAQLQQDLENFLGGFEPRSQT
                     SEAEKANLETPPASPSKTTLKSPSKDKTHIPPTPYRESVDAFWSQEATNDWIDQHSPR
                     KLHNLLQELEESDNEVDPEIMPRNKTTKKAAKPPSKTALKKAEMEKKKAALERKKSFD
                     NKKAAVAEDFFEVLDDHVTGGRIQEIAEETGGVQIIWSKTLQTTAGRANWKREKLRTE
                     GTLGTEPQTPGGSLSKHHASIELAERIIDDEDRLLNTLAHEYCHLANFIISNVHNNPH
                     GASFKQWGLKCKEALKDHPVYGGRFEVTTKHSYKIDYKYVWSCVDCGQTYGRHSKSID
                     TTKSRCGKCKGLLQQIKPKPRSVSPRKKQPLGDSEKVAVDEVANVLGEISLGN"
     exon            complement(448149..449214)
                     /number=1
     exon            complement(449269..450410)
                     /number=2
     CDS             complement(join(450499..450703,450802..450852,
                     451385..451474,451544..451557))
                     /codon_start=1
                     /locus_tag="AO090009000172"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000285"
                     /protein_id="BAE54669.1"
                     /transl_table=1
                     /translation="MGDFTLLKSLILVFFIYMVIGTSKINKRRVLFPARLYWCCDNIT
                     ERDPARSTRRGIFIALDMAFATHGSAGSVAMPTTLRQLQLNIVNTTARKQLELMQYLH
                     PALLIFPALVIFNRPGT"
     exon            complement(450499..450703)
                     /number=1
     exon            complement(450802..450852)
                     /number=2
     exon            complement(451385..451474)
                     /number=3
     exon            complement(451544..451557)
                     /number=4
     CDS             complement(join(451787..452499,452549..453304,
                     453363..453388,453447..453568))
                     /codon_start=1
                     /locus_tag="AO090009000173"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000284"
                     /protein_id="BAE54670.1"
                     /transl_table=1
                     /translation="MKLSSIVAGASLFASSVIAADLDPIIIKGSKFFYKSNDTQFYIR
                     GVAYQQEYSGPDSSANSFKDPLADADACKRDVPYLEKLGTNTIRVYAIDPKSDHKECM
                     SLLSDAGIYVIADLSSPGDSINRNEPKWDNDLYNRYVTVVDELSQYSNVIGFFAGNEV
                     SNSENTTSASAFVKAAVRDTKQYIKAKNYRSMGVGYATSDDSSIRKNMANYFNCNGAD
                     DSIDFWGYNVYSWCGDSNYEKSGYASRTEEFKDYTVPVFFAEYGCNAVQPRKFTEVQA
                     LYGDKMADVWSGGIVYMYFQEENNYGLVSVDGNKVSTKADFSYLSKELASATPSGTKK
                     GDYQPTNTALQSCPTVDDKWLATSSPLPPSPNQDLCSCMEESLSCALKDKVSGEQLDK
                     LFGTVCGYDVCDGITTNATTGKYGAYSVCTPQQQLSYAINLYYQNQKAKGNGDKACDF
                     NGAATTQSSKSGGSACSALLKEAGTSGTGTVTSSPTGTAGSGASDGAAASSSGSAGGL
                     VAPSSVNVGIFQLGAYVVTAMVAGAGMIVL"
     exon            complement(451787..452499)
                     /number=1
     exon            complement(452549..453304)
                     /number=2
     exon            complement(453363..453388)
                     /number=3
     exon            complement(453447..453568)
                     /number=4
     CDS             join(460071..460213,460276..465540,465601..465889)
                     /codon_start=1
                     /locus_tag="AO090009000174"
                     /note="1,3-beta-glucan synthase/callose synthase
                     catalytic subunit"
                     /old_locus_tag="AO070342000283"
                     /protein_id="BAE54671.1"
                     /transl_table=1
                     /translation="MSGYNQGGHYDDGYGQHGGHGDSYYQDEHHGQAYYDPNDYGDGY
                     YDRGGYYPDGGHGYNQDGGYYDAGHQDDYYGEPYYDQGNGQQRGRRRGDSEEDSETFS
                     DFTMRSETARAADMDYYGRGDERYNSYADSQYGGRGYGYRPPSSQVSYGGNRSSGAST
                     PVYGMDYGNALPAGQRSREPYPAWSSDAQVPVSKEEIEDIFLDLVNKFGFQRDSMRNM
                     YDHLLTQLDSRASRMTPNQALLSLHADYIGGDNANYRRWYFAAHLDLDDAVGFSNMKL
                     GKADRKTRKARKAAQKKAKENPENVEETLEALEGDNSLEAAEYRWKTRMNRMSQHDRV
                     RQVALYLLCWGEANQVRFLPECLCFIFKCADDYYSSPECQNRVEPVEEFTYLNEIITP
                     LYQYCREQGYEIADGKYVRREKDHNQIIGYDDMNQLFWYPEGIERIVLEDKTRLVDIP
                     TAERWMKLKEVNWKKVFFKTYRETRSWFHMVTNFNRIWVIHLCSFWFFTAYNAPTLYT
                     KNYQQQLNNKPPGSYYWSAVGFGGALACFIQIFATICEWMYVPRRWAGAQHLTKRLMF
                     LLLMFIINLAPGVVVFGFKKQIGETIALIIGIVHFIIALVTFFFFSVMPLGGLFGSYL
                     KKHGRQYVASQTFTASWAHLQGNDMWMSYGLWVCVFGAKLAESYFFLTLSFKDPIRIL
                     SPMQIQRCSGVEYLGTKLCYIQPQILLGLMFFMDLTLFFLDSYLWYIICNTVFSVARS
                     FYLGVSIWSPWRNIFSRLPKRIYSKVLATTDMEIKYKPKVLISQVWNAIIISMYREHL
                     LAIDHVQKLLYHQVPSEQEGKRTLRAPTFFVSQEDQSFKTEFFPPGSEAERRISFFAQ
                     SLSTPMPEPLPVDNMPTFTVLIPHYSEKILLSLREIIREDEPYSRVTLLEYLKQLHPH
                     EWDCFVKDTKILADETSQFNGETEKTEKDVAKSKIDDLPFYCIGFKSAAPEYTLRTRI
                     WSSLRSQTLYRTISGFMNYSRAIKLLYRVENPEVVQMFGGNSEKLERELERMARRKFK
                     ICVSMQRYAKFNKEERENTEFLLRAYPDLQIAYLDEEAPENEGDEPRLYSSLIDGHCE
                     LLENGMRKPKFRIQLSGNPILGDGKSDNQNHAIIFYRGEYIQVIDANQDNYLEECLKI
                     RSVLAEFEELTTDNVSPYTPGLPSSDTHPVAILGAREYIFSESVGVLGDVAASKEQTF
                     GTLFARTLAEVGGKLHYGHPDFLNGIFMCTRGGISKAQKGLHLNEDIYAGMNAMIRGG
                     RIKHCEYFQCGKGRDLGFGSILNFTTKIGTGMGEQMLSREYYYLGTQLPLDRFLSFYY
                     AHPGFHLNNMFIMLSVQMFMIVLINLGALKHETITCRYNKDLPITDPLRPTFCANLVP
                     IIDWVNRCVISIFIVFFISFVPLAVQELTERGVWRMATRLAKHFGSFSFMFEVFVCQI
                     YANAVHQNLSFGGARYIGTGRGFATARIPFGVLYSRFAGPSIYAGARLLLMLLFSTST
                     VWSAALIWFWVSLLALCISPFLFNPHQFAWHDFFIDYRDYLRWLSRGNSRSHASSWIA
                     FCRLSRTRITGYKRKLLGVPSEKGSGDVPRARITNIFFSEIVAPLVLVGVTLIPYLFI
                     NSRTGTMDKDRDPKNAIARIAIVAFGPIAINAGVAGMFFGMACCMGPIFSMCCKKFGA
                     VLAAIAHAIAVIILLVIFEVMFFLEGWSWPRCVLGMISAAAIQRFVYKLIISLALTRE
                     FKHDQSNIAWWTGKWYSMGWHSFSQPGREFLCKITELGYFAADFVLGHLLLFIMLPAL
                     CVPYIDKFHSVILFWLRPSRQIRPPIYSLKQSKLRKRRVVRFAILYFAMLLLFLILLI
                     APLVVRKLNINLPNIPMNLLQPLDEKHNNTISQYTGNGLPGGSSGIPASVLASATY"
     exon            460071..460213
                     /number=1
     exon            460276..465540
                     /number=2
     exon            465601..465889
                     /number=3
     CDS             join(467225..467513,469377..470290)
                     /codon_start=1
                     /locus_tag="AO090009000175"
                     /note="serine palmitoyltransferase"
                     /old_locus_tag="AO070342000282"
                     /protein_id="BAE54672.1"
                     /transl_table=1
                     /translation="MKTEADVASFLGTASCIIYSQAFSTISSVIPAFSKRGDIIVADK
                     GVNFAIRKGIQISRSMVRWYEHNDMEDLERVLAKVTKEQARKPLTRRFIITEDQSDPA
                     PLSGVAGKHEIPINGDPNNLPPLLPIPDPATPDLVPSLPIEGGYGISYAPYNDDGTCR
                     SLDGINKDLDKISEHYSYVRIYGVDCDQTQNIVSAARQRNLRVFAGLFDLQNFPNSLD
                     QIIWAAAGDWSTFHTISIGNELVNKGQNPQDVVTAVHTARAKLRAAGYQGPVVTVDTF
                     SVLLKHPQLCEASDYCAANCHAFFDANQIPDNAGKYALEQANRISAAAGGKRTVIAES
                     GWPYRGQANGKAVPSAWNQAIALYALGYSFRDRKDDMVLFSAFDDLWKQDGPGTHGAE
                     KFWGIMRR"
     exon            467225..467513
                     /number=1
     exon            469377..470290
                     /number=2
     CDS             complement(471476..472987)
                     /codon_start=1
                     /locus_tag="AO090009000176"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000281"
                     /protein_id="BAE54673.1"
                     /transl_table=1
                     /translation="MISAHDPVDEKSSTPLTNKVIKILSMHGNLYKTFGENIILLINR
                     EGRWYRFRLSSYVVLTKTAETSLQLLTLKLLYLIFTTPTTFEYFYTNDLHVLVDILIR
                     NLLDLPEEASALRHTYLRVLYPLLAHTQLKTPPHYKREELKKMLSVLVRGQLSSNEVD
                     KEKIMHFDEVDETTRRLVIRCAAVDWLQDEELDTQVPKAPEEETTLSCPTIPDGSHPE
                     AEIGTPLESTTSRPISPTSTVESSPVTLSPTSIDESPKIEVLNQAQRLGMHLEPASSS
                     SLSVQEVAAQHEKPGVLTPSRNKTQTATTDRPSSPNKPKIKPLPPKSRRWRGRRTTGD
                     ENDKIPEEPGIGTGTGTSASPSPITPTAPSIPQGPSDRRNSTSTSGLVPPIPAHGRRS
                     ASNPPPAVPPPRRSTLPVVHPHHVSSHCTPVTSPSRLQIQQNSDSAQKHGQKPEPPKT
                     RRSGRRRPSQTDSPTPSQDGHDGHAALPEVSNEKHHDNQTVSVEEAVQNVSLS"
     exon            complement(471476..472987)
                     /number=1
     CDS             complement(join(474581..474620,474685..476235,
                     476294..477258))
                     /codon_start=1
                     /locus_tag="AO090009000178"
                     /note="mannosyl-oligosaccharide alpha-1,2-mannosidase and
                     related glycosyl hydrolases"
                     /old_locus_tag="AO070342000279"
                     /protein_id="BAE54674.1"
                     /transl_table=1
                     /translation="MFRARRYRVLLIFAAVFVLAIIHFSRSRQPPTVTLGVPPPVDRP
                     VSYPQSPPAADNKGPAPETPLPTPLLEGSTDPSTPDEDVPSQPPYSDNGLSTPERPKP
                     SDEPPSKEDGPQFPDNSGSQSQGKLDSDRLEDQPASHWKKLPERYPVTPADLVKLPTG
                     KSKSLPKLQAKFSDEASEDKIKRLNRLSTIKATFEHAWDGYKKNAMGHDEVMPLRGGF
                     RDPFNGWGATLVDTLDTLWIMGLEEEFSIAVDQVKKIDFTTNKKSEIPVFETAIRYLG
                     GLLGAYDISGHKYDLLLEKAVELAEVLMGAFDTPNRMPMLFYKWKPGDAANFHRASSM
                     SVLAELGSLSVEFTRLAQLTRDDKYYDAIARITNELEKFQSQTSMPGLWPMKVDASGC
                     TVAQSPTGHEAPRDLPRNSSTPTATQTPAEGIISYPTDAESYRILLESRQLHENAQPA
                     IYNTNPQIPDPKAHEIPTSTGDTAGYCRGGLTSAPGPQQFGLAAPGDSTYEYLPKEYM
                     LLGGLNEQYRTMYEKTADAARKHLLFRPMIKDDRDIRFLATVTKPRLDAEFVYQYEGA
                     HLTCFAGGMFAIGSKLFGIDNDLKLAAKLTDGCVWAYESTKTGIMPEQFQMIPCKEDE
                     PCVWDEAKYWKALDPNEKERIAWGKQQKELSAKMEEKKEEVRGIQTNGTSPVPRSHRE
                     KRNPERGNWHVIASPTHTPKPSDSSDVKGRDPKGPSIDPTPSHEEFALSRIQNEHLPP
                     GVVRINSRIYLLRPEAIESVFIMYRLTGDEYWREKGWKMFEAIAKYTRTEIAHATIKD
                     VTVDKPPKSDEMQSFWLAETLKYFYLLFSEPNVVDLDEYVLNTEAHPFKRPVY"
     exon            complement(474581..474620)
                     /number=1
     exon            complement(474685..476235)
                     /number=2
     exon            complement(476294..477258)
                     /number=3
     CDS             complement(480965..481582)
                     /codon_start=1
                     /locus_tag="AO090009000179"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000278"
                     /protein_id="BAE54675.1"
                     /transl_table=1
                     /translation="MLAFLHEHGVYLMDFSSSTIWIRDDLSIALSGFVNATIPTDEWP
                     YSPDGTRYETEIYYPTNPDSGHPELSPKIDLSDWATFVWQLMRKDASSHRAKRWAMPT
                     DPLDPAEMPREVNVWEYHKQRLKEGKLQLLEEERLGPMLVKAWKGKYENAQEILQEVR
                     SYLQQIGVQMDGEDEVLLDDGRKWEDVFTVVPTDGARWGREIRYK"
     exon            complement(480965..481582)
                     /number=1
     CDS             complement(join(481732..481884,481934..482224))
                     /codon_start=1
                     /locus_tag="AO090009000180"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000277"
                     /protein_id="BAE54676.1"
                     /transl_table=1
                     /translation="MGAGWSSDHPEEPLFSAADLRQPPNPPSQSKYPRCYGDVVPSVC
                     SDRPEDFYDELYEQMYFVQHAYQDCIVAFQQCEKENPRVDPEEWLFIAERIPRTNRLI
                     FTPVSLSEQTLPACSSLSITARTPQLCVVGVDILAVSLWDICWRS"
     exon            complement(481732..481884)
                     /number=1
     exon            complement(481934..482224)
                     /number=2
     CDS             complement(join(482605..483275,483331..485014))
                     /codon_start=1
                     /locus_tag="AO090009000181"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000276"
                     /protein_id="BAE54677.1"
                     /transl_table=1
                     /translation="MDFSNVPGYWNAVVDAPGSSSSKRDLNQLVNRFYGSSDQWYTKF
                     KSLKFPAAQGTKYTEKLDQLVYHNPQICVYEGTKVGESLSVAMEGTTTVESHFGFSLI
                     ATWQPGKSFNVHQAAGFFHPDGETDVTFKIGGQGVLDTSQSLQGSTITEILGEASLAG
                     KSIYKGWASFDLYRESSVSLRSGGGNSGAVAVDTYAESRIQSDWGRVLVNFPAGAVDS
                     PLEGTSEGRRADDKVSTAEKDNISRPLAESPKGFIEVGTTTRVGIKMHLKFASPWLSD
                     IDGELPDMSVSQSVYSRWHFEHDGAKSCLTTSLGTTMKSHLERGSYVGWKDKETKTFV
                     QELAQAGERQCFTGDAATKRDRIERRQLVNPNFDPDLLVPGINLGDGGWNNMAARILC
                     NGCGFCTTEGVVEEPCCGCACIPCRYGTQASVRDDDYYVFPISDQTSLARRDLLINAS
                     CGLQDAHCVGSDNKTWLVERQATTPRISQTPKKLNICRTQITGPKYPSYPKQSPNAVL
                     GPQDFNSHWSTQNVIKYMHNSSQSCTNWAVGKFANSDIVWDKSTNIRHNQFYETEHPF
                     EGQTISRFFNVHMTSVATVTRPCTWIVTWILSRAPWAGATTNVAQLMSYELESRDRQG
                     RLAVFLTDSNWMKGAIVKGSSPIQTSRWDNLDLGDEQLAYLKELGMLFSYWNHPEVWQ
                     SFCDSYNGMRDVLLQFDNWYIANRGPSDLVGEWKKFNQLELKRIVERGKASAQYLKES
                     RKPVPGFWGRGWTLKWQGLFTYFPGNLLYQFGTIKLDQTCVNLQ"
     exon            complement(482605..483275)
                     /number=1
     exon            complement(483331..485014)
                     /number=2
     CDS             join(485491..485882,485940..486146,486200..486490,
                     486611..486652,486705..486824,486931..487322,
                     487415..487743,487848..488048)
                     /codon_start=1
                     /locus_tag="AO090009000182"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000275"
                     /protein_id="BAE54678.1"
                     /transl_table=1
                     /translation="MVSSLTLITLLLGGWGAEVAADSYALYNADSEVLLDASENCLAA
                     FNANVTCPALTGELFSSPFFEFNRNTTWLDLVCATSCRESLQEHRNNVSTACTSARYY
                     DEFEKTTWQPWYPDDYMIYSHDIACMTRSDGQLCNAYFWETGPPESDCDECMLKIVHR
                     QVNSPFAGDESDRAHFSSATEACQATGYPATVATSLLISTPTPTATGSTGTMYSIKPT
                     DDFYSIPKSQSVGTDQLLRSNGLSYVQDKFPTTGTLCIENKCQTHVLAPNDTCASIAA
                     AADIWQVQLLTWNPNINPFCSLPDSPVVTPMPTPEPVPDNIGPNDNARCGRYYAIVEG
                     EDCAMITVKFNIGLNDFYCVQPVGEISTYPGYLPGPTATRPPFTAGPSTSIPWYDPES
                     TQDADLLVIPLANLTRTDCWDYIWINSTDPDQLGCWDYAWAAGVEPDQFALWNPSIDQ
                     NAEDSLEPTYDYHCTLTPSVSYCIGLASPTPAPAQTASAPVPRASGEISDCVWWTYTV
                     QGLSCEDLLSNLGLTIDVFYQMNPSVKEDCTGLAVGTYYCGSTLSMGILADDEDDENP
                     LSNTNISTANPNHHAGGFVTPTPIQTMTAGQSQTITPSARPIFTPGTLPSAMTAPGCG
                     QTTISVSAWKGPPPAPQLLLLRRRLPSRDPGEL"
     exon            485491..485882
                     /number=1
     exon            485940..486146
                     /number=2
     exon            486200..486490
                     /number=3
     exon            486611..486652
                     /number=4
     exon            486705..486824
                     /number=5
     exon            486931..487322
                     /number=6
     exon            487415..487743
                     /number=7
     exon            487848..488048
                     /number=8
     CDS             complement(join(488888..491012,491088..491818))
                     /codon_start=1
                     /locus_tag="AO090009000183"
                     /note="integral membrane protein"
                     /old_locus_tag="AO070342000274"
                     /protein_id="BAE54679.1"
                     /transl_table=1
                     /translation="MMTSNILSRFLPPNGSPSVYETLRQQDAESNPSDVEERAGLEFE
                     DDRRTQFSDRELEEAMVDAARDGIRSPSPSPSEPFLTQRSPQRTSGTATAKTGGRRRK
                     HSRPRWMHQDPDDGDDDVPPSLLVEGHQDDDEMRSRLPPPPPSHRHPQRELSPAPGPS
                     SRADRARWNTTREQLPLHNDGRGQRPGVIWSLGHPNLASVDPKEKAMWLWANVENLDN
                     FLKDVYTYFLGNGIWSILLNRGLSLLTFAFVVGFSTFLTNCIDYRNFRGSRKMDDILI
                     QQCTKKMSMSSTFLLWLLTVFWIGKAFQYLMDIRRLKHMHDFYYYLLGISDSEIQTIS
                     WQEVVSRLMTLRDANPATAGAVSARHRKFMGSQSKQRMDAHDIANRLMRKENYLIALV
                     NKDILDLTLPIPFLRNRQLFSQTLEWNINLCIMDYVFNDQGQVRTLFLKDTHRKALSE
                     GLRRRFIFAGIMNIFVAPFIVVYFLMHYFFRYFNEYKKNPAQIGSRQYTPLAEWKFRE
                     FNELWHLFERRVNMSYPFASRYVDQFPKDKTVQVAGFVAFVSGALASVLALVSIIDPE
                     LFLGFEITHDRTVLFYLGVFGSVWAFARGLVPEETNVFDPEFALLEVIDFTHYFPNHW
                     KGRLHSDEVRKEFAVLYQMKIVIFLEEILSMIFTPFILWFSLPKCSDRLIDFFREFTV
                     HVDGMGYLCSFAVFDFKKGTNVISQGGTGRRESGRQDLRADYFSTKDGKMLASYYGFL
                     DNYGGNRPANPSSRRQFHPPPAFPTLGSPSAIEMGNIGERLERTQTRHGPAATFMGQQ
                     SGLGPGFGAAGFGDHASPAPSILLDPHHQPTASDFRTANRSALYPRFRSSRPVRPITD
                     PIEDDNESPSAEIRRGAVKKSPHTTTGSSGGAIGTSDSNLGESWRMNLIGDELDKDTG
                     EDGENVDEIAGNAGVLGLIQQFQKVSKDNRGRTTVGI"
     exon            complement(488888..491012)
                     /number=1
     exon            complement(491088..491818)
                     /number=2
     CDS             join(495923..498749,498803..499767)
                     /codon_start=1
                     /locus_tag="AO090009000185"
                     /note="GTPase-activating protein"
                     /old_locus_tag="AO070342000272"
                     /protein_id="BAE54680.1"
                     /transl_table=1
                     /translation="MEPEGSNGPKRNSIHQGLYSRPVERRSSKKSSSRDRHGMVYPES
                     FRDTGIRTVTPDSAAETTNHSPLSDAEHLSSGAAPSPRVTARTRPANLDTRRDFQSYH
                     PAGDEEEFQVESKSQRARSRTTTLEDQRSELSPNSFYLKSRSRLGSVNAVTPQSRHSD
                     EPTGSIGYPSIQSPTYLSQTLGRHRVSRASGGSNFLASVASNPPPSPLSSTDSAKILQ
                     LMKTTCGRMHGILSFRTANTTAWTSGYCAINVATGSLIYQAKGEPALAKTLIPDLRGC
                     QVRSLVDPELRTNYLSVSTFTSGLGVELRPHVSETFDSWLAALLCWQPIRPKGVQNKM
                     TKPQSVAIGDRRLADRRRNSESTVQKEAAIIKVGKMLLWDRPNASGARPSSGRRVSTY
                     RQQRALSSSWQRVSCTLQENGVFKLFTESDITFVHCIQLSQLSRCAVQRLNSSVLEDE
                     FCIAIYPQYAAHSVSGLTRPVYLALESRVLFEVWFVLLRAFTIPELYGPETSIEDNPA
                     KAPAPDATSTSIADMFRIERMLTVRVTEAKLFRSRSEEAPRSRKQSRSHSNSTPTGAV
                     NDYYTEVLLDGEIRAKTAVKYRTANPFWREDFTFNDLPPVLSQVSILVKNPNPTQKDW
                     SLIAHGSYALNQDSYPMRVLDDVELSSHDATFGRVELRLDDLEPGVEVEKWWPILDDR
                     DQPVGEMLMRARMEETVVLMSHEYTPMSELLHSFTNGLSVNMAQILSSELTLLSEALL
                     NIFQVSGTTVEWIQALVEDEIDGLHKDSNANRLRYTTRIHSNDTRESGQDREVLVRDL
                     GRTATVEANLLFRGNSLLTKALDYHMRRLGKEYLEETIGERLRDIDESDPECEVDPSR
                     VHRSDDLERNWRNLISLTTSVWKTIAGSASRCPAELRLIFRHVRACAEDRYGDFLRTV
                     TYSSVSGFLFLRFFCPAILNPKLFGLLKDHPRPRAQRTLTLIAKALQGLANMTTFGSK
                     EPWMEPMNKFLVGNRIEFKQFVDSICAIPADRPTPIVTPSYATPIQILGRLPPTSREG
                     FPSLPFLIDHPRSFAILIRIWLEGAPARLNEIEDLDPALKKFHDMALHLDRRTKECLS
                     KAEQAERPSGDLEVKWEELVDSMERSATFYEESSKPTTPATETAIAGSASIAGSHRNS
                     IGYFATRPSLPRRSTDYAADGDDDTPPSSSSATWDQSRVPFSIPRWSDTRDSTGSSKN
                     SSTYSLEYPDSSKPRRSSITRETASKYRFFDLVPTTSRRRARDREHAQQQSREELRNE
                     F"
     exon            495923..498749
                     /number=1
     exon            498803..499767
                     /number=2
     CDS             complement(join(500587..500806,500872..501685,
                     501742..502276))
                     /codon_start=1
                     /locus_tag="AO090009000186"
                     /note="WD40 protein"
                     /old_locus_tag="AO070342000271"
                     /protein_id="BAE54681.1"
                     /transl_table=1
                     /translation="MGNEEISDFEKQRLANIAERDALLKQLSLNAQSVFTPTLPNRAT
                     GSQAKTKKKPAPKKVKKEEESPAPRRMSSRLRGIAADSEVAKRKAEEQHQAYQEAERA
                     KRVRKSDSFSLNDIFVSGQKLSGDGLLGVDVVTKGVAVPYQRTFGDDDIKKTTDKELK
                     ALRKEMSELQLWEAWEPNRIKLTPERVYTMTFHPSETKPLIFAGDKMGHLGILDASQE
                     KPTSVKQEDEDEEDDDPDPVLTTLKPHTRTISSMVIHPSKPTHLYTASYDSSIREMDL
                     DKTTSVERYAPDSTSDDVPLSGLDMAADDPNTLYWTTLEGEFGRYDMRTPKQGSVAVW
                     SLSEKKIGGFSLFPTHSHYFATASLDRTMRLWDIRKLSRREPVPVGEHQSRLSVSHAA
                     FNSAGQVATSSYDDSLKLYDFGAKGIASWKPGHTLSDAEMKPDTVVRHNCQTGRWVTI
                     LRPQWQINPQSHIQRFCIGNMNRFVDVYSSSGDQLAQLGGDGITAVPAVAVFHRSKNW
                     IAGGTASGKICLWM"
     exon            complement(500587..500806)
                     /number=1
     exon            complement(500872..501685)
                     /number=2
     exon            complement(501742..502276)
                     /number=3
     CDS             502636..504027
                     /codon_start=1
                     /locus_tag="AO090009000187"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000270"
                     /protein_id="BAE54682.1"
                     /transl_table=1
                     /translation="MSGHIHRSLLAVTTRNSLAPFLYQTRTLSGSFPHPLQCHTQAYS
                     TSSSNTPEDQSRTESSQNDSSANTPADSQPQTEHSNEPTERRSYLHKRAAMASRNAPR
                     LKPNPLTMTRGEKQVFSDLLEQLGAVQKDTTTAETQKPELSEEDKNEMAQISEIFEEV
                     LKDIKQKKKRKTATTGSADGQSADTDTPVTLRNLELQERLRKSEYSSEDITELLESNQ
                     ISMEEAIELVVKKEAGKIENALRAAIDEGKEDTGVWDICRERIFSMLQHLGDVRLAQG
                     LGMVQDKNQAADIPTATTDTSHLEVPESVAVEPVVTALYPKMLLVAFRLLNLHFPNSP
                     LISQFRATIKSHGRASAVLGSSTGLYNELIYFYWRGCHDIPGVVSLLREMEVIGVEPN
                     DRTCGLLTGIVNQRDRDLKQHWKRMRNEKRGPRREPWWDLAPNRKAVCELLGPEGWMH
                     RIERRVQEKRPSR"
     exon            502636..504027
                     /number=1
     CDS             complement(join(504155..504487,504604..505173))
                     /codon_start=1
                     /locus_tag="AO090009000188"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000269"
                     /protein_id="BAE54683.1"
                     /transl_table=1
                     /translation="MAQPHHLTRCHAAILSTSKRQLTTLRTTTRSIIPQCTRQLHHQT
                     RPARRQPTPAHLTSSPISQPTRRSYHSEHHPDPPPHEYTNSQTTILSAALRHVPTHGF
                     TRDALTLGARDSGFLDVSVQLLPRGEFDLVLFWLASRRGLLRASVDNGLFEKDERVKA
                     GLKLTVEEKTKLLIMERLRMNTEIRHQWQDALALMSLAGNIPLSLSELHALSSEILTL
                     AGDASVDASWYTKRLSVAAIYASSEVVMTRDQSPGLSETEAFVERRVEDSSAIGEKLT
                     GFKQCLGFVGSTAIGLGRSWGLKI"
     exon            complement(504155..504487)
                     /number=1
     exon            complement(504604..505173)
                     /number=2
     CDS             508411..508827
                     /codon_start=1
                     /locus_tag="AO090009000189"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000268"
                     /protein_id="BAE54684.1"
                     /transl_table=1
                     /translation="MPADYYDTDHAQRERSRSPRRRSRSPRRSRRSYSPRSRSRSRDD
                     YRRSERRSRSPMSAAPGASGGHSGSGYGGRSSYPPPPRSFEDRAVAKEQMMQAVRESS
                     QQDRRVYVGNLSYDVKWHHLKDFMRQGEQGHIVSDV"
     exon            508411..508827
                     /number=1
     CDS             join(509217..509243,509303..509440,509544..509571,
                     509667..510106,510170..510323,510374..510513)
                     /codon_start=1
                     /locus_tag="AO090009000190"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000267"
                     /protein_id="BAE54685.1"
                     /transl_table=1
                     /translation="MGRLVYVREDREPEPRFTGGPSRGDFGGGGRGGFGGGGGGGYGG
                     GAGGRQLYVSNDLKDLFRQAAQQGAVIRADVHTDATGRPKGSGIVAFESPEDARNAIQ
                     QFNGYDWQGRALEVREDRFAGAGPGGFGGRGGFGGGFGRGGFGGRGGFGGGRGGFGGF
                     GGRGGYGGGYGGPPGGAGGPGFEGAPSVPPNPFTDFATSGGEKGPVIYVRNLPWSTCN
                     EDLVDLFSTIGKVDRAEIQYEPNGRSRGTGVVQFDNAETAETAIAKFTGYQYGGRPLG
                     ITFVKYMNAGAGPVDAMEGAEPTGGITQDQIM"
     exon            509217..509243
                     /number=1
     exon            509303..509440
                     /number=2
     exon            509544..509571
                     /number=3
     exon            509667..510106
                     /number=4
     exon            510170..510323
                     /number=5
     exon            510374..510513
                     /number=6
     CDS             complement(join(513227..513324,513389..513752,
                     513810..514297,514373..514910))
                     /codon_start=1
                     /locus_tag="AO090009000191"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000266"
                     /protein_id="BAE54686.1"
                     /transl_table=1
                     /translation="MATVVRSQTPLQDTYGAISQPANSIFSGRGYGSRSASRPNSFIA
                     SNSGYNLATGAVAEPPVTQNGKFHEEFDVASQRGSVVFEGPSSAAVQRSASQMSNSRS
                     ATPTRSGTLKKKSSLSKRGSMRRSGSKRSLRAGSVRSLVLGDKEKYSVDGAEDQNSAF
                     YIPVPTNGNPTEVLADRFQAWRKVLKDLIVFFKELQKSYETRSKLFMSASNIINNSAL
                     PPTFLKSGGLADATDILRNFHKQAYQEASKAAEVENELVAQLMGLRNDLQKKTKEIRS
                     LSGDFRNSVDKEVDATRKSVRHLHEALGLVDTDPAATAGKGDPFIVRLSVDKQIEKQI
                     EEENYLHRAFLNLENSGRELESIVVSEIQKAYKTYANILTREADEAYDAAEKLRAGPI
                     SMPHDHEWNSFIAETDELVDPRVPLRDIENISYPGKDHPAAAEVRSGMLERKSKYLKS
                     YTPGWWVSSFPSQLSRSSGMANTSDVAVSPGAKAWFAFATGFHIP"
     exon            complement(513227..513324)
                     /number=1
     exon            complement(513389..513752)
                     /number=2
     exon            complement(513810..514297)
                     /number=3
     exon            complement(514373..514910)
                     /number=4
     CDS             join(519734..520522,520585..520792,520846..520891,
                     520946..521346,521404..521492,521551..522088,
                     522157..522823,522883..523309)
                     /codon_start=1
                     /locus_tag="AO090009000193"
                     /note="ubiquitin carboxyl-terminal hydrolase"
                     /old_locus_tag="AO070342000264"
                     /protein_id="BAE54687.1"
                     /transl_table=1
                     /translation="MHTVLTWTTRRPGKTAPRLVQDIYEYDPAHPPATGRNLLADVPP
                     VFPEYYNGPLEHISSAACRHNFVSKPAQSYVPQSEQGNTGASTKVSAVCLMCRYHLQV
                     EVSSTPGIGQPSTRFSDHVHHLVYKSGKHRGGAAPEEVSPKGQMLEMFHYECSYLSCS
                     VAVSLRFASPVLNDDRVRLLTDPEVLRQRANEAFAAHPDRLEGVAPPTPINVLLNLRT
                     YISNALLDSQQSKSISAVNKRFMTCFGVEGKPCKDLLEFLGFSSKNEGFWEPPRPNPW
                     AEFPYRDQLKIFLDDVIHELTALIEQRPVVEKKGHQLEFIRQPVFNDLLYALGSLDYP
                     KASRSSEFQMAPQPYYEDLGVVEDMAASSIIEAFNRQVSVDPARTPVYLKCLKSIGIL
                     RGGEDGSLIDQAVQVAYSEGKYTEEDVVDAYKYFGLSHDDQRLTEESIIGKFYAYLGA
                     TTAVQETETRRQLWRIGDSRRSERIKAAAEERVSTAEQARVFLGVSADTPDDFVMAVY
                     TAKVNDNPSSRDLARRAVQLLAEERKSEALKHFLKTGEMTAGEMDVADAYRLLQIPDR
                     TVDEGAIMAAYTICVDEAPAQAENYNQALRIIAKDKNSPLLSNMVSGSTTKPDRNLAE
                     WPVGLQNIGNTCYLNSLLQFYFSIRPYRDMVLDFEKFKMEINEDMLGQKQVGSRKVSQ
                     KEVEQSQRFLSELRTLFNDMITAPATYVIPTQELARLTLISPSNEAAIRRRSTLSGIR
                     PSALGEINGVPVMGPLGPPQLTPESEVKGPIAPEPEKPQRSTTSDVDSEATLVSDGAR
                     IDATVPSSNDKEPEPLVTDPTKMDVQDVLTPEAVEYQPSDKPTSGEQNELSSQPPPVP
                     PRPGPQPDPQKQLIEEVEIGAQQDVTEVINNVLFQSQCAIKPISLAPDGEQLDQVKDL
                     FYGKAKSYIQTTEGVRSKEEWWCDIKIDVATGSRDIYAAIDGAFDVQKVSVGNSVAEQ
                     FSAISKLPPVLQVQVQRVQFDPVKKRSFKSTHHLELKETIYLDRYMDTQQPEILNRRR
                     QCWEWKNALRTLEARRAELQRQSV"
     exon            519734..520522
                     /number=1
     exon            520585..520792
                     /number=2
     exon            520846..520891
                     /number=3
     exon            520946..521346
                     /number=4
     exon            521404..521492
                     /number=5
     exon            521551..522088
                     /number=6
     exon            522157..522823
                     /number=7
     exon            522883..523309
                     /number=8
     CDS             join(523434..523536,523641..524208,524298..524301)
                     /codon_start=1
                     /locus_tag="AO090009000194"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000263"
                     /protein_id="BAE54688.1"
                     /transl_table=1
                     /translation="MKEDPEIAADAVPINSELIPELNQLSQIARAELNYIEQEIKDLQ
                     IMISSQFADYKHLAYRLYAVFVHHGSVEFGHYYIYICDFERNIWRKYNDNYVTEVHDL
                     DEIFTSQDRQNPPTPYFLVYVNATMKDRLVSPLCREILESPPEDQLSGDGGIATEGVT
                     PPTVAEDVDMNPPAYDEIWADKGTSGTEDNHHIEDKTGPTGVGGNEVTGRGPSNKDTD
                     FHDVQC"
     exon            523434..523536
                     /number=1
     exon            523641..524208
                     /number=2
     exon            524298..524301
                     /number=3
     CDS             join(525343..525405,525464..526643,526712..527025)
                     /codon_start=1
                     /locus_tag="AO090009000195"
                     /note="succinyl-CoA:alpha-ketoacid-CoA transferase"
                     /old_locus_tag="AO070342000262"
                     /protein_id="BAE54689.1"
                     /transl_table=1
                     /translation="MPSQVATCLRLARQFSADPSKHQRFLARAFSSSVRRSEINKVVS
                     SAELAIKDMKSNSTVLAGGFGLSGVPDTLINAVRANPSITGLTVVSNNAGVDGAGLGL
                     LLESKQISKMIASYVGENKTFERMYLTGEIELELTPQGTLAERCRSGGHGIPAFYTPA
                     AFGTVVQTGELPLRHNADGTVALRSKPRDVKVFDGKSYVMEESIKGDYALVKAYKADK
                     LGNCQFRYAAQNFNGAMGRNAKMTIVEAEHIVEPGEIEPAAIHLPGIYVKRVIQSTTP
                     KNIEKYTFAKEEGEDTAALGKGDTAAKRERIVRRAAKEFKNGMYANLGIGMPMLAPNF
                     VDPSVEVQLQSENGILGLGPYPKKGQEDPDLINAGKETVTLAPGAACFGSDESFGMIR
                     SGRIDLTILGAMQVSARGDLANWMLPGKIKGFGGAMDLVSNPSATKVVVTMEHTDKKG
                     NPKIVKQCEFPLTGKTCVSRIITELCVFDVDFTDGLTLVELADGVTVDEVRSKTEAPF
                     KVADDVKPML"
     exon            525343..525405
                     /number=1
     exon            525464..526643
                     /number=2
     exon            526712..527025
                     /number=3
     CDS             complement(join(527367..527744,527804..527818))
                     /codon_start=1
                     /locus_tag="AO090009000196"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000261"
                     /protein_id="BAE54690.1"
                     /transl_table=1
                     /translation="MSKPSAQTITRINHLLKHWPTDHVRPSAVSVQTYLQSYLPQTSE
                     NASKQPQQQQQSSQSPPPPLSEASLNALSSLLEDRYARRYPLPPKLRRPTGNPDYYDN
                     VIKEFSEAPTRDFWGRVSARLKGLFRFS"
     exon            complement(527367..527744)
                     /number=1
     exon            complement(527804..527818)
                     /number=2
     CDS             join(528283..528306,528407..528877,528954..529532)
                     /codon_start=1
                     /locus_tag="AO090009000197"
                     /note="golgi-associated protein/Nedd4 WW domain-binding
                     protein"
                     /old_locus_tag="AO070342000260"
                     /protein_id="BAE54691.1"
                     /transl_table=1
                     /translation="MSSQRYQRVNAHDEDEEPQSQSSIPLRGTPNSPPPSFRSRSTSP
                     SSRRLLHDDPLNNDADQTLADAFDDESDSEADEPDDRQRLMRAQPESRPVADSSSATA
                     SSSSGMGNEQQQSSDPRSGIQRRQTILPSFSTGSRVISSTNDGVFANLAAKPERGEKT
                     EDLPPSYEEAAADATPPYWETTILAPGISSDEVYVDGLPVGSVFSFVWNAMISMSFQL
                     VGFLLTYLLHTTHAAKNGSRAGLGLTLVQYGFYMKGGSDTKPDDGTDQYVTPPDPNSH
                     NFDPSSVADGSGSDGGGGGVSGISTSEWISYVLMIVGWFILIRAISDFLRARRHEQLV
                     LQSPDRGLPVPIIATNERTETVV"
     exon            528283..528306
                     /number=1
     exon            528407..528877
                     /number=2
     exon            528954..529532
                     /number=3
     CDS             join(530164..530362,530492..532410)
                     /codon_start=1
                     /locus_tag="AO090009000198"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000259"
                     /protein_id="BAE54692.1"
                     /transl_table=1
                     /translation="MAKVDAAADSPSAASPNHSLPQGPVEARSLSSITAVASNPPAYP
                     RNPTQKKLDPLVLYIVRVPGSKDVFLSPLKPPTKASVSAEAINASLYYLHVSTPEDDV
                     LLQECEQEREEEAKLRRELGEEADVPPEFAKMNHVRRKPVPGGGGGAKVDADARPPLP
                     AHRSNVSLPENVLPVPNSADLPLSLMPARPGLMGSRSSIDLPQSATQMTTESRDGFLG
                     HTVPGDEVEARPPLSARPLPPVPKDELAFELIEDNSAPKKVNRWSALSGYMPGRNAEN
                     WKEKYEVLTSGRHSLDSRRPQARPQSAHANPSYNRMGSPARSPGQSPSRRPYDSKPPE
                     RPGFHITLIRRDPTHGSQWNVATISTPKMDGGAIDIEVSTPGYNRFAAQSEPLSLASL
                     GINLPSEMGNRISLSSFRPTQAELAESTPTQPSHPRKFHRKLCVSRPYQEDGRGSLDL
                     GGNRPSLDNGTSSPSKHSGSKLKSGYYTFTSPWNGTCTFSTSVNGRSLKCKHMIPMPS
                     TGPNGASIDNPAVTVAEIRFNTPFQAGHLHHQPGPSHISPFTLSQTPAFKDLTSNPNN
                     HGHGHNLDPSPSSPSDRTSKRASLAQFLNPNNYNRPRARSGASAHSTSSTSNFGVPTR
                     KPSTSSTSSGVADLDDGPRRPLRRPPSEDRLDLSLARENAGGGMRGKSAKLGKLIIED
                     EGIKMLDLLVASCMAVWWRGYYY"
     exon            530164..530362
                     /number=1
     exon            530492..532410
                     /number=2
     CDS             complement(join(533031..533674,533737..534051,
                     534108..534174,534233..534365,534514..534626))
                     /codon_start=1
                     /locus_tag="AO090009000199"
                     /note="mitogen-activated protein kinase"
                     /old_locus_tag="AO070342000258"
                     /protein_id="BAE54693.1"
                     /transl_table=1
                     /translation="MADLRGRKIFKVFNQDFIVDERYNVTKELGQGAYGIVCAATNIQ
                     TGEGVAIKKVTNVFSKKILAKRALREIKLLQHFRGHRNITCLYDMDIPRPDNFNETYL
                     YEELMECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNAD
                     CELKICDFGLARGFSIDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCI
                     LAELLGGRPFFKGRDYVDQLNQILHYLGTPNEETLSRIGSPRAQEYVRNLPFMPKIPF
                     QRLFPSANPDALDLLDRMLAFDPSSRISVEEALEHPYLHIWHDASDEPTCPTTFDFHF
                     EVVDDVQEMRRMIYEEVVRFRAAVRQQSQAQAAAAAQQQQIAQQTNVPIPENQQGVWK
                     QEEPKPQEALAAGGGVHNDLESSLQRGMDVQ"
     exon            complement(533031..533674)
                     /number=1
     exon            complement(533737..534051)
                     /number=2
     exon            complement(534108..534174)
                     /number=3
     exon            complement(534233..534365)
                     /number=4
     exon            complement(534514..534626)
                     /number=5
     CDS             complement(535746..537161)
                     /codon_start=1
                     /locus_tag="AO090009000200"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000257"
                     /protein_id="BAE54694.1"
                     /transl_table=1
                     /translation="MQARYYPFQWRQSTAVTAVAASLLLIFAVFLFNSRHHIDISPIP
                     NAQPPSYFSNSSACHVDLDLLRTHASNSSAEYARLEISVVRTKNFTGFSDALDVPIPT
                     YQTVQLDTTNHTELLPEERCTTSVTIHAPVAAPRPNASHLIFGVATSTERLYDSLDAF
                     AHWAGGTNAHIVAVVDDEGSVTQSKKRAKELDIRLTVIQNSDDLLDRYFSLIRTLFER
                     KDELTKWIVLIDDDTFFPSMTNLVERLATYDPAEPQYIGALTEDIMQMYHGSHMAYGG
                     AGIFLSIPLVRQLNAVFRNCYDFKGAGDRMIARCIYSHTTTKLKWEPGLHQLDLRGDA
                     SGFYESGRPLPLSLHHWKSWFHADMVALSKVAAICGEACLLRRWELSDDWYLINGFSV
                     VKYSLPLQDPNSMEQTWDKSKYKGPDPFEYSLGPLRSKDEDKVSFRLKEAIAETDRVR
                     QIYVRKQEKPQVIEVVWNLRH"
     exon            complement(535746..537161)
                     /number=1
     CDS             complement(join(537925..538079,538142..538814,
                     538868..539443,539496..539760,539814..540268,
                     540344..540373))
                     /codon_start=1
                     /locus_tag="AO090009000201"
                     /note="Threonyl-tRNA synthetase"
                     /old_locus_tag="AO070342000256"
                     /protein_id="BAE54695.1"
                     /transl_table=1
                     /translation="MASEDSKDLPSIVSGAGSLPDFIVERNNFFEELWQQYLEETKNK
                     PHPEITVTLQPGNGNKEQVSAKAWETTPAQLLKNVPKELSATIVLAKVDNELWDLSRP
                     LEGDCTVSYVRFEDPEGREVFWHSSAHCLGEACECEYGCLLSHGPPTPQGFFYDMAMP
                     DNRVVRETDWPALDKHANRVFKEKQSFDRLEVTKENLKKMFAYSKYKLHYIDKLVTGE
                     KSTVYRCGTLVDLCRGPHIQNTGKIKTFKIMQNSSAYFLGDQSNDSLQRIRGVAFPDK
                     KQMQEHLKFLEEAEKRNHVKIGKEQELFFFDEVSPGCPFLLPNGTKIFNALQTLLRSE
                     YRKRGYQEVQTPNMYDVGIWKTSGHWAHYKDDMFKLDVEKREWALKPMNCPGHFVLFG
                     HRERSYRELPLRLADFGVLHRNEASGALSGLTRVRKFQQDDTHIFCTQDQITSEIEGL
                     FDFLQSIYGLFGFTFKLKLSTRPEKYLGELETWNYAEEQLKAAMTKFKGDDWTIDEGD
                     GAFYGPKIDITIADALKREFQCATIQLDYQAPINFKLEYMSNEKADKSQAAAESAEGE
                     NKSSEPGPGRARPVVIHRAIIGSFERFLGILTEHFGGKWPFWISPRQILIVPVMPAVN
                     DYVEELQTILRGDKLNVDIDISGNTMQKKIRTGQLAQYNFIFVVGAQEKEARTVNIRN
                     RDDPATQKQGVMIPLEEAREKLRALRKERRLVNSL"
     exon            complement(537925..538079)
                     /number=1
     exon            complement(538142..538814)
                     /number=2
     exon            complement(538868..539443)
                     /number=3
     exon            complement(539496..539760)
                     /number=4
     exon            complement(539814..540268)
                     /number=5
     exon            complement(540344..540373)
                     /number=6
     CDS             join(540638..540713,540886..540986,541047..541277,
                     541334..541744)
                     /codon_start=1
                     /locus_tag="AO090009000202"
                     /note="H/ACA small nucleolar RNP component GAR1"
                     /old_locus_tag="AO070342000255"
                     /protein_id="BAE54696.1"
                     /transl_table=1
                     /translation="MSFRGGGRGGFATGANRGGSFGGRGEMGSFMHACEGEMVCESIN
                     PKIPYFNAPIYLENKTPIGKVDEVLGPINQVYFTIKPQEGIVATSFKPGDKVYIGGDK
                     LLPLEKYGSLLYVYFANSIDPMIIGSFLSLSRHRVLLSPREPEALPGVVLAVAEEALV
                     VEQEVDAADLALLEEEAASVVELEEAVEASVVEAVASPGEAAEEDLVEVSDVRQSPSC
                     LALSYYGVMGKRELLQELFVLIFLCILGGLRIRKGCRLIQPLNECYYTNEVPAK"
     exon            540638..540713
                     /number=1
     exon            540886..540986
                     /number=2
     exon            541047..541277
                     /number=3
     exon            541334..541744
                     /number=4
     CDS             join(542050..542101,542148..542214,542280..542317,
                     542451..542632,542684..543052)
                     /codon_start=1
                     /locus_tag="AO090009000203"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000254"
                     /protein_id="BAE54697.1"
                     /transl_table=1
                     /translation="MPSNASTNSGLPPAGDGDVSGQEKQKMLLSAETGHFSMVRALHL
                     ADLVTELNVMSVLSSMRYCLGDPHDYGAIWSALGFMPFGLFFDFMDGKIARWRKKSSL
                     MGQELDSLADLISFGMAPAAAAFALGVRTNVDHLLLAFFVLCGLTRLARFNVTVAVLP
                     KDKTGKSKYFEGTPIPTTLSIASLMAYWVSQGWVQEDLPLGVIAQGTAFEFHPVALLF
                     VLHGCLMVSKSIHIPKP"
     exon            542050..542101
                     /number=1
     exon            542148..542214
                     /number=2
     exon            542280..542317
                     /number=3
     exon            542451..542632
                     /number=4
     exon            542684..543052
                     /number=5
     CDS             join(547832..548144,548201..548706,549094..549243)
                     /codon_start=1
                     /locus_tag="AO090009000205"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000252"
                     /protein_id="BAE54698.1"
                     /transl_table=1
                     /translation="MKSFTMKSALAASALLIAAYLPAVNAQTQVDKGCYSDSTPLKDQ
                     GSYTYQSNGYCQKLCLKDNYAVFALAKGTNCLCGNQLPATSAKTDDSNCNVKCAGWPD
                     VMCGGNNAFSVYLTGIEDDVDSYSSSSSSSSSSSSSTESGTSTTTNGGTVVTTSGGQT
                     VFKTSESEMTTQEADAKKEKNSGSNTAAIAAGVVVGVVGFCALVGAIFFLWRFRKRSN
                     MPEQYRNNNIDSFGAKPMSQSSMSDSRFDGDFMAQRRQSNGSIDDDQDFSRRILQQRP
                     VTCSGSQGRYHHRGLQRMLCLLGRNRPGLGLTNVWTVTRYPGGSEV"
     exon            547832..548144
                     /number=1
     exon            548201..548706
                     /number=2
     exon            549094..549243
                     /number=3
     CDS             join(561248..561544,561576..561584)
                     /codon_start=1
                     /locus_tag="AO090009000208"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000249"
                     /protein_id="BAE54699.1"
                     /transl_table=1
                     /translation="MARGSAPGTETISTPHSPIHLSTVLNSPPNSSRTMPSTASTSRT
                     QNNKASSRKTTNTMRRTNTQTEIPLPITYTPTTHRISKAKKGKRVHACEYPGCNKSH"
     exon            561248..561544
                     /number=1
     exon            561576..561584
                     /number=2
     CDS             join(561844..562326,562932..563018)
                     /codon_start=1
                     /locus_tag="AO090009000209"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000248"
                     /protein_id="BAE54700.1"
                     /transl_table=1
                     /translation="MVSESHYLPKAAPVDPNAGHYLAATQPTTSMSIGSLVAPPIHPD
                     LANDTGYMWMGMNMPSEHQNPLYPPHHIHESIEDSQFYSSPEACPSPCSDGATLSIPS
                     HPRSSVASTPTAVADQYPEPIIDSDLTSSPMSMHATLRCWDQSEGPLATPSYAPVPLS
                     DNLYHDFSSPSSSPAPSLMVFIGRRIFGK"
     exon            561844..562326
                     /number=1
     exon            562932..563018
                     /number=2
     CDS             complement(join(564652..564663,564746..565064,
                     565135..565394))
                     /codon_start=1
                     /locus_tag="AO090009000210"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000247"
                     /protein_id="BAE54701.1"
                     /transl_table=1
                     /translation="MVVFVDLDHDTFSKNHFSHGPDALPHHFAEPEKLTLSKLMVVGA
                     PQSAKLATDDDTSIDPTHDASQFRLEEQNQNQNAFSVALGCYPIVKEIARSVDLNTLH
                     ALSRTCRQFHANLALYRHQLVKQTLRCENEYIETLSDLLRSGTPIPDSVKSVIRLLSQ
                     EARSSGRLTAGKVAKCARDMVGECRRCSKVVCRQYA"
     exon            complement(564652..564663)
                     /number=1
     exon            complement(564746..565064)
                     /number=2
     exon            complement(565135..565394)
                     /number=3
     CDS             join(566450..566526,566596..567010,567103..568389)
                     /codon_start=1
                     /locus_tag="AO090009000211"
                     /note="gamma-glutamyltransferase"
                     /old_locus_tag="AO070342000246"
                     /protein_id="BAE54702.1"
                     /transl_table=1
                     /translation="MGSSLVPSLWQLLRAKEFCNREEMLHCGYVMSILSVQSNEADTI
                     WSIAAALNITEPSSTGIGGDMFCLFYDVKTKRVHSLNGSGRYPANATLEKIRKDLNVG
                     PNDAGTIPMKSVHAVTTPGAAAGWVDTIEKFGSGKLSLEQILLPAIELGENGFPVSEL
                     SSFFWREGEDLLRQASPNAHEMLKPDQKAKDGVRSPLPGEILKNPTLAQTFRSLAANG
                     KKGFYEGRVAEELVKVVQDLGGYLTLEDLKSHAEIGTQETEAISLKFTGQSIAEKQTA
                     GTDGEDNQGVEIWEHPPNGQGIVALMALGILEELEKMGKIPKFTEAQHNSAEYLHAVI
                     ESLRIAFADASWWVTDPDVEKVPTSELISPAYLAERAKLFNPDKATDILDHGSPAHNH
                     CDTVYFAVTDKEGNGISFINSNYAGFGSGIIPKGCGFTLQNRGANFSLVPGHPNALAP
                     RKRPYHTIIPAMITNVSDGSLHSVYGVMGGFMQPQGHVQVLLNMLAFNYHPQAALDSP
                     RICIAAGSPELGKPVDRSVYVEEGISDEAVEGLKRLGHQVKVLKGWERGMFGRGQIIR
                     CHYDDGQLVYSAGSDQRGDGMAIPVL"
     exon            566450..566526
                     /number=1
     exon            566596..567010
                     /number=2
     exon            567103..568389
                     /number=3
     CDS             complement(join(568965..572563,572614..572865,
                     573006..573246))
                     /codon_start=1
                     /locus_tag="AO090009000212"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000245"
                     /protein_id="BAE54703.1"
                     /transl_table=1
                     /translation="MGKPIQYTQLPKFEYQTFDRQYQTFDRHTLQFSFYPVASTSTDD
                     LTPDNDQGNNPAEAGNAPEEGSSSSSTDTASSSEAAESSEATTPSPDPVESSGEPAAE
                     PVEEKIEPAAEADDVTQTPKDESASDDKKDELPAEGSAQNAEAEQDATDASTPEQDDQ
                     EPKNDTGVSEDGPAAESDKPAPENGEAAEQVCEDAKAEEESATKEKDNLDDGSKETEI
                     VEALPEEETSSPPTDAEATPQPADEPANPDETGNSSSDAPATDSNTEDHPSDPAPGTE
                     ASTEKAPTDEPTATETQEESTASANPDIDAEPNPADSTDKVESESAETPVDEAAADGE
                     GKESPPAEHAEAVPAIEEPAPVDTNEGAASGKGKKGKKNKKKKKKGATAVEELPPTPP
                     PEEPEQVQDPAVAEAEVESEVKETDTAAALSTDEINDNPAEDTAEPGSPPNEDQADAG
                     ADAASDDKNPEPTAAEPTSEEPVPEEPSVDKPSEESATLEDAEHVTDLSEEPPVELSP
                     EEGAPETEGSPEAVSEEPPKEEPTEEIVPEGAEDSASAGEVTAEVSTTDEKSSEKEKP
                     IGEPANTEAAEQTPADEGVDEAAEPAAEETPAEVLANNEEAGSDEHPTDAEASGETQV
                     ETPATTPEPQEDLVEEERAEEEGSEETSPVIDAPVEKSNDQEALLEEADASKEISAAD
                     APEEMVSEEPTTAEEAQADDPSPTTESVAEEPAPAAEPPVAEEAPVTEEPAAAEEILV
                     EEAPAAEELPVTDEAPAAEEAPTTEPAVTEEAPIEEAPAEKTPLAEEAPAAAEEAPEP
                     PTTQEAPAAESAVTEEVHVEEAPVEESPVAEEPLVTKEVPSEEAPVVEESPVVEDEPV
                     EETPIPEAAPVIEEAPAPEAAPIAKEAPAVEEPVPEEAPVTEEPVSAEEVAVEEAPAP
                     SVSRGVTVDEALDVAEAPVEETPVEEAPAEETPAAVEPPVADDVPPAEAPVQPAPEDT
                     PSEEPEQVEEPAADPHVIESAPADPIIIERAPASDDTPTEDTVTDEPAVGEVPLEEPD
                     LEDSAAERELSEEATDPTSEYPDTVDSLKDDPSTTTEAAAGIAAGAAAAAAAAGLAHG
                     HRKKKRRTADMDRERHSKRSSDDYPPRLERQKSTKHGGIFTNRWAEALDEAKRQHEKK
                     IRSEERRKDKTVIVKREPGRSSGREKEHERVRRSERTERSAREKEPVPVKTRPKHSEH
                     SSSSDRERSGSSSSRHAQSSTPKPRAFLKYMTSGESDTKPLLKINGDKAAANIYEPHR
                     RSSTSRSHGHRHSHEGRGSTERSSGSHQTDEEDRARREARRARRKADEEEQAKQKEEP
                     EQRHHRHSGEGHHRHHRHKRAPSPPRSGSSKLKGFFKSAIAAY"
     exon            complement(568965..572563)
                     /number=1
     exon            complement(572614..572865)
                     /number=2
     exon            complement(573006..573246)
                     /number=3
     CDS             complement(join(576495..576791,576868..577877,
                     577937..578312))
                     /codon_start=1
                     /locus_tag="AO090009000213"
                     /note="synaptic vesicle transporter SVOP and related
                     transporters (major facilitator superfamily)"
                     /old_locus_tag="AO070342000244"
                     /protein_id="BAE54704.1"
                     /transl_table=1
                     /translation="MEKEGTSAGMPPDYTRREHERHAMDPPQRSTTDTDSDLHSISHE
                     DHPPQAFEGKDEECRPSYASDTSRDAAVVVPRPNRRGLFGQFTLLAEVENPKTYSRKK
                     KWFVTFIVAWAGATAPMGSAILFPALSQVTKELNSTTTVANLNISLYMLSMSIFPLWW
                     SSFSEKLGRRTIYLVSFCLFVIFNVLCAISKSMAMLIVMRMLSGGASASVQAVGAGTI
                     ADLWESQERGRAMGIFYLGPLCGPLVAPIVGGALAQRWKWRSTLWFLAAYGGITVAFI
                     FFALPETLISAKSPSPNTSNEQQEPIGRRLSRVSSRQVVGLTTRWLKVLKMALVDPLK
                     IVLYLRYPPVLLTVYYASITFGSLYVLNVSVEHTFGSDPYNFTTILVGLLYIPNSLGY
                     VVASTFGGRWMDNIMQREARKAQRYDENGNLIYHPEDRMRENAWLGAFLYPAALIWYG
                     WTADRGVFWLVPMIANFFFGIGSMLIFSMATTMLTEFMPKKASSGVALNNFMRNIFSC
                     VGSLVTAPIIDAIGNGWLFTILGIVAFLSSSVLFAMKVFGPRWRKSMDALRH"
     exon            complement(576495..576791)
                     /number=1
     exon            complement(576868..577877)
                     /number=2
     exon            complement(577937..578312)
                     /number=3
     CDS             join(580512..580789,580862..580916)
                     /codon_start=1
                     /locus_tag="AO090009000214"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000243"
                     /protein_id="BAE54705.1"
                     /transl_table=1
                     /translation="MSPRFRLVFFVPPSAVSACKTAIFSAGAGRYPGQGNYTECCWTT
                     AGTSQFRPGDAANPHIGKVGELETTEEIRVEALCAGEDIARKAVEALKKAHPYEQPSY
                     GVYRMEDF"
     exon            580512..580789
                     /number=1
     exon            580862..580916
                     /number=2
     CDS             complement(join(581500..581632,581694..583435,
                     583501..583622,583688..583760,583824..583949))
                     /codon_start=1
                     /locus_tag="AO090009000215"
                     /note="neutral trehalase"
                     /old_locus_tag="AO070342000242"
                     /protein_id="BAE54706.1"
                     /transl_table=1
                     /translation="MSSSNGTHRRQESIDPFSHPDVYYGDEEANARIKDRRRAFSTNL
                     NQFNRQDIQNFLGGIPARRGSHDEISAQPRKFLIDVEQTLESLLEREDTDRNMQITIE
                     DVGPKVLSLGTAASSGYNKFDVRGTYMLSNLLQELTIAKDYGRKVIVLDEARLSENPV
                     ARLSRLIKNSFWNALTRRIDGSNIEVAGRDPKDWTDDPRPRIYIPPGAPEQVEYYRGI
                     AEAHPELRLDVQVLDSEITPEFVKDLNSKPGLLALAMEKKYDETTQKTEYSGVPFVVP
                     GGRFNELYGWDSYMESLGLLVSNRVDLAKSMVINFCFCIKHYGKILNANRSYYLLRSQ
                     PPFLTDMALRVYERIKGEPDALEFLRTSILAAIKEYYSVWTAEPRFDPVSGLSRYRPE
                     GLGVPPETEPTHFLHLLTPYAEKHGMKFDDFVQAYNNGIVKEPELDEYFLHDRAVRES
                     GHDTSYRLERVCANIATVDLNSLLYKYEVDIARIIRTYFKDRLEIPPEFRTEQSKDIA
                     SESSSVWDRRARRRKMRMDAYLWDEEKGMYFDYDTAKQERTSYESATTFWTMWAGLAT
                     PHQASELVSKALPKLEAYGGLLSGTEESRGIISLDRPNRQWDFPYGWAPQQMLAWTGL
                     LRYGYQEEAERLAYKWLYMITKAFVDFNGVVVEKYDVTRPIDPHRVDAEYGNQGVDFK
                     GAPREGFGWVNASFVYGLEILNAHQRRALGAITPYETYIKAVAIQNDSD"
     exon            complement(581500..581632)
                     /number=1
     exon            complement(581694..583435)
                     /number=2
     exon            complement(583501..583622)
                     /number=3
     exon            complement(583688..583760)
                     /number=4
     exon            complement(583824..583949)
                     /number=5
     CDS             complement(join(585398..586130,586176..586207))
                     /codon_start=1
                     /locus_tag="AO090009000216"
                     /note="Trk-type K+ transport systems, membrane components"
                     /old_locus_tag="AO070342000241"
                     /protein_id="BAE54707.1"
                     /transl_table=1
                     /translation="MGQFQASLAVRAFYAAQTMANNLGFTLTPDSMVSFQDATFPMLI
                     MTFLAYAGNNLYPVFLRLIIWTTYRCTPKNSSLREPLDYLLKYPRRCYTLLFRSKPTW
                     VLFGIIFVLNFVDVLLIVVLDLHNPAVNTLPGGPRVLAAIFQAASARHTGTSSFNLAD
                     VNPAVQFSLLVMMYISVFPIAISMRASNTYEERSLGLFSSDGEVVDESNTTNYVLSHV
                     RNQLSFDLWYIFLGIFCICVAESNRIMNPSEPVRSS"
     exon            complement(585398..586130)
                     /number=1
     exon            complement(586176..586207)
                     /number=2
     CDS             complement(join(588670..588889,588942..589245,
                     589324..589558,589614..589643))
                     /codon_start=1
                     /locus_tag="AO090009000217"
                     /note="dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /old_locus_tag="AO070342000240"
                     /protein_id="BAE54708.1"
                     /transl_table=1
                     /translation="MDSQSLFDVKGKVVLVTGGAKGIGRMISEGYVANGATVYISSRD
                     AKACEKAVNELNALGKGKAHAIPADFYKEEDVKKLAEELGKRESKLHVLVNNSGSNWG
                     APYDEYPSSAWTRVLTLNLHRVFDLTRLVTPLLEKAATSGDPARIINIGSIDGLRVPA
                     LETFAYSASKAGLHHLSRVLANHLGRRNITSNSLACGPFESKMMAATLETYREQIEGN
                     IPLGRIGTPQDVAGACLFLSSRAGSYVNGATITLDGGSAIAAKL"
     exon            complement(588670..588889)
                     /number=1
     exon            complement(588942..589245)
                     /number=2
     exon            complement(589324..589558)
                     /number=3
     exon            complement(589614..589643)
                     /number=4
     CDS             join(590287..591235,591351..591418)
                     /codon_start=1
                     /locus_tag="AO090009000218"
                     /note="OTU (ovarian tumor)-like cysteine protease"
                     /old_locus_tag="AO070342000239"
                     /protein_id="BAE54709.1"
                     /transl_table=1
                     /translation="MEELLAKHRKEQKDLQARITQKKKSATKKTRRGINEECERLQRE
                     LSERHQAEIAELNGEPAPPVDDLDDLSLNGTEEDKTQKDHADSSQNPPSIDNSPDTSS
                     ATSESSAPSPRPKKPNRQKARLARRAAEQAAQSAIAAEEAAKQTDHRGDEQEVMDGVF
                     KRLGLKQVEIKPDGHCLYSAIAYQLEMLGLGLKPDPKRIILENPTQSRIDTVASPQHD
                     GYRAVRAVTADFINEHHDDFVPFMEEPVELYTRKIKLTAEWGGQLELLAIARAYGVEI
                     NVIQGDGRIEKIEGDTQEYDDEQKSKRVIWLAYYRHTYGLGTLSSKDSIPLLIPLAVP
                     PMAL"
     exon            590287..591235
                     /number=1
     exon            591351..591418
                     /number=2
     CDS             join(593814..594017,594073..594228,594288..594630,
                     594704..595256,595316..595676)
                     /codon_start=1
                     /locus_tag="AO090009000219"
                     /note="isocitrate lyase"
                     /old_locus_tag="AO070342000238"
                     /protein_id="BAE54710.1"
                     /transl_table=1
                     /translation="MGFLEDEDKKYLDDVQAVKAWWTDSRWRHTKRPFSAEQIVAKRG
                     NLKIEYPSNVQSKKLWKILESNFENKVASFTYGCLEPTMVTQMAKYLDTVYVSGWQSS
                     STASSTDEPSPDLADYPMNTVPNKVNQLWMAQLFHDRKQREERITTPKEKRGNVANID
                     YLRPIIADADTGHGGLTAVMKLTKLFVERGAAGIHIEDQAPGTKKCGHMAGKVLVPIS
                     EHINRLVAIRAQADIMGTDLLAIARTDAEAATLITSTIDHRDHAFIVGSTNPNIQPLV
                     DLMVAAEQAGKQGDELQAIEDQWVAQAGLKLFNDAVIEAINKGAHSNKQSLIDQYLKA
                     AKGKSNLEARAIAKNITGQDIYFNWDAPRTREGYYRLQGGTQCAINRGLAYAPFADLI
                     WMESKLPDYAQAKEFAEGIHAVWPEQKLAYNLSPSFNWKKAMPRDEQETYIKRLGALG
                     YCWQFITLAGLHTTALISDQFAKAYSKQGMRAYGELVQEPEMEQGVDVVTHQKWSGAN
                     YVDNLLKMVTGGVSSTAAMGKGVTEDQFKH"
     exon            593814..594017
                     /number=1
     exon            594073..594228
                     /number=2
     exon            594288..594630
                     /number=3
     exon            594704..595256
                     /number=4
     exon            595316..595676
                     /number=5
     CDS             join(599536..599681,599755..599985,600080..600879,
                     600954..601115,601687..601694)
                     /codon_start=1
                     /locus_tag="AO090009000222"
                     /note="aldehyde dehydrogenase"
                     /old_locus_tag="AO070342000235"
                     /protein_id="BAE54711.1"
                     /transl_table=1
                     /translation="MVASNIPPLEFTPVEDIPGRVSTLRKTFLEHKTRDLEFRLVQLR
                     KLYWAVKDHEQEIADASALDLGKPRFETEVAESGWLQNDLVFVTRNLHKWAKDEKAED
                     IDLTFKFMNPKIRKDPLGCVLVIGAFNYPFQLTLGPVIGAIAAGNTVVIKPSENAPNS
                     AVVIQRIIEAALDPSCYTVIQGGIPETQALLAERWDKIFFTGGATVGRIIAKAAAPHL
                     TPVVLELGGINPAIITKSANPRLVARRLLWGKLMNSGQICTSQNYLLVDKDLVPAVIE
                     EFKKAYNEFYPQGAKASPDYSRIINEGAFRRIKSMLDNTKGKILMGGTMDEKERFIEP
                     TLVLVDSVDDSMLTQESFGPLIPILPVDNLEQAVDIANGIQATPLGLYPFGSKADTEK
                     ILSSTRSGGVSVNDAALHIPTLPFGGVGESGHGAYRGKASFDVFVHRRPITSTPSS"
     exon            599536..599681
                     /number=1
     exon            599755..599985
                     /number=2
     exon            600080..600879
                     /number=3
     exon            600954..601115
                     /number=4
     exon            601687..601694
                     /number=5
     CDS             complement(602055..603272)
                     /codon_start=1
                     /locus_tag="AO090009000223"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000234"
                     /protein_id="BAE54712.1"
                     /transl_table=1
                     /translation="MAPSGRLLSALVSGTIAFTAKISGVPELLLSLTAPGGQQAIGRK
                     LELPVFHPCVRLAKWRERPGELSFVPPDGRFILAGYEVDLLPIDPSLDQPPSHMEKLF
                     LPAIVDIRKSLGSSGSDFEVRLILNTNFPGYSSSNRPGGRNGSGTSTPSFLGGGGNSS
                     GPVLEDVLVTIPIPKSVRNITDMQASRGDALFSPGNNVLEWRVPTKDAGTVSGTATLR
                     CTVAGHSTGDDDFDDEAEEVDPEANLLQGYYDPEPSTSYQAPEEGTTKRKTKKKKKKK
                     VKKSSRAAPAIPDADQQEEIPQEPSQPQSPTPPQPSLSPQPQAQQPPTDDASRSIFHT
                     TQRKTKAQLNATLMPNSAAVSFSVRGWLPSGIKVDSLNIDPRRSRGLGETVKPYKGVK
                     YLCVSRKGVERRC"
     exon            complement(602055..603272)
                     /number=1
     CDS             complement(605113..605895)
                     /codon_start=1
                     /locus_tag="AO090009000225"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000232"
                     /protein_id="BAE54713.1"
                     /transl_table=1
                     /translation="MDSMRSLNTSLPSSTPRPQPPEQLLQSFKAAALSVTNLYKNAVY
                     EQSQAKQAGYQEAIEDLLHFLDKEGLGLAGGEGSKIRQWAAERSDGTGTPSDDDEPEK
                     QPRSTSPVATRKEQTKPEGARQPPKSTSTDESVATQQQTPLSNSQVTEANTLDKPAVF
                     TFTAGPSFPPCQEPDVDMQSSDSSTASSQDSSPVSVSVLPRTSRQQARHNNFSRTNPR
                     ASTREPSVGAGSKRKFAVPDFFDISGLGNRDIFGGGKRGRFT"
     exon            complement(605113..605895)
                     /number=1
     CDS             join(606585..606698,606896..607039,607106..610075,
                     610134..610247)
                     /codon_start=1
                     /locus_tag="AO090009000226"
                     /note="chromatin remodeling complex WSTF-ISWI, small
                     subunit"
                     /old_locus_tag="AO070342000231"
                     /protein_id="BAE54714.1"
                     /transl_table=1
                     /translation="MAPSLAPNSETPSQADTPMTDANDEPVTSVPVDDAQMGDSDTNP
                     NTTASSVAGDTVPVDGRRKRSEAFHLRKSILGKKHGRLDESKEDDSIRRFRYLLGLTD
                     LFRHFIETNPNPRIKEIMAEIDRQNDEDEAKAKKKGSSRSGGAGGDRRRRTEQEEDAE
                     LLKDEKSGGETGTVFRESPPFVHGEMRDYQIAGLNWLVSLHENGISGILADEMGLGKT
                     LQTISFLGYLRHVCDITGPHLVAVPKSTLDNWKREFHKWTPDVNVLVLQGDKEERHKL
                     INERLLDEDFDVCITSYEMVLREKSHLKKFAWEYIIIDEAHRIKNEESSLAQIIRVFH
                     SRNRLLITGTPLQNNLHELWALLNFLLPDVFGDSEAFDQWFSNQESDQDTVVQQLHRV
                     LRPFLLRRVKSDVEKSLLPKKEVNLYVPMSEMQVKWYQKILEKDIDAVNGAAGKRESK
                     TRLLNIVMQLRKCCNHPYLFEGAEPGPPYTTDEHLVYNAGKMSILDKLLARMQKQGSR
                     VLIFSQMSRVLDILEDYCVFREYNYCRIDGTTAHEDRIAAIDEYNKPGSDKFVFLLTT
                     RAGGLGINLTTADIVVLYDSDWNPQADLQAMDRAHRIGQTKQVVVFRFVTENAIEEKV
                     LERAAQKLRLDQLVIQQGRAQQQTKNAASKEELLGMIQHGAANVFSNDNSTAPFNADK
                     QISDDDIDAILRKGEERTAELSKKYEKLGIDDLQKFSSESAYEWNGKDFTDRKKDIGL
                     NWINPAKRERKEQFYSIDKYYRQALATGGRTADPKPKVPRAPKQIAVHDWQFFPPGLQ
                     ELQEKETAYFHKEIGYKVPLPDGPEEELSEREAERDLEQQEIDNAVPLTEEEQAQKAE
                     MSEEGFSTWNRRDFQQFVNGSAKFGRTDYVGIATEVDSKEPDEVEEYAKVFWKRYTEI
                     QDYPKYLRVIEQGEEKLRKMNHQRKMLRKKMEMYRVPLQQLKINYTVSTTNKKVYTEE
                     EDRFLLVMLDKYGVDGEGLYEKIRDEIRESPLFRFDWFFLSRTPVEIGRRCTTLLNTV
                     AKEFEVADEKANGESGKGRGRDRDDEDAENDDDGAPAKKKNKGGAVNKQVKAVKGNSK
                     ANSTSTSRAASVSSNTASKAKSRKK"
     exon            606585..606698
                     /number=1
     exon            606896..607039
                     /number=2
     exon            607106..610075
                     /number=3
     exon            610134..610247
                     /number=4
     CDS             join(610958..611299,611364..612227,612286..612342)
                     /codon_start=1
                     /locus_tag="AO090009000228"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000229"
                     /protein_id="BAE54715.1"
                     /transl_table=1
                     /translation="MASKIFLIENPNYCKSGIKSYVHLIRKYRLHPTKNGPYSIGRAI
                     HQTGRPFTDKPIGGRVRFHDVMRKQTSDDQLQQVEKDDIQNDAAFFMPVSIGTPAQTF
                     NLVLDTASVDFWVRSSELPADTLPKGEEESHTFDPEKSSTFKNIEDSPWKVTYVDGSS
                     VSGSIGTEDITIGGVAFKTQPVQLAKTMSPMFTQFSADGVLGLAFGHINHPQQDIKAL
                     AERLNTRDDREQSAKLFTAKLGSWGDSDLKKSFCTFGSIDEDAVRYCGHDVHHTPIDN
                     SRGYWMFESPSATVGGKPMSRSENKAVVDTDAALTLLDDQTCQAIYDSIPGAFYDSET
                     QGFLIPSDINVDQLPVVQLAVGEKSFAMSKESLMFAEAKPGYIYGGVQSRGSLEFDVL
                     GGTFLDGLYAIFDFGSLRFGAVQAKTKV"
     exon            610958..611299
                     /number=1
     exon            611364..612227
                     /number=2
     exon            612286..612342
                     /number=3
     CDS             complement(612497..613984)
                     /codon_start=1
                     /locus_tag="AO090009000229"
                     /note="RNA Methylase, SpoU family"
                     /old_locus_tag="AO070342000228"
                     /protein_id="BAE54716.1"
                     /transl_table=1
                     /translation="MSHRSLMKPLHLYMRLSIAPSIHLNHVRRASLNSAIGRGIRKTR
                     GFDSPSSSRSSYDSDFERSYKESRDTRSNKTEKKSQGRKWLDDDFDEDEFIRTGNFRA
                     LPREHQRFQSSKRFTNNEARGYNGREDSNRPQDKRHSRRAEPTKHHRATERVPERVKE
                     NVQVPDAIPYTTPASEFIYGTSAVEAALRCSRRHMYKLYVYQASGEELSSAKVALRKL
                     ALSKNVKVKMAFGGWDRLLDKMSAGRPHNGCVLEASPLPRLPVRGLKSVPSIKEEDFG
                     VELGAQSREEALVNSTNDKLKIHHWDQRTRYPVVLLLDGIVDPGNLGAIIRSAYYLGV
                     DAIIFAGRNSAPLSPVTIKASAGAAENMTLLEVSNEVDFIQRSKANGWKFYAADAPGP
                     ASKYVDTASIVEGKGTTEGEHVSTQSPCVIMMGSEGSGLSRHIKSHADSIVSIPGARL
                     ATPLGVESDPSRVDSLNVSVAAALLMEMFLRVPLAVADVPPKKTR"
     exon            complement(612497..613984)
                     /number=1
     CDS             join(614428..614697,614767..618864)
                     /codon_start=1
                     /locus_tag="AO090009000230"
                     /note="predicted helicase"
                     /old_locus_tag="AO070342000227"
                     /protein_id="BAE54717.1"
                     /transl_table=1
                     /translation="MDEEIASRLNEDLVADLLSQFQRESHAHIPEGSPEPTKSQLAVE
                     TPTISNSDEYDFLPGHFDVRCVISEAIETAKEPSYLVKLRSGETETMSSSRLESLSNG
                     PEALTRFQNTEQVYGSSQFPSSMASSSNEEGYTSSESGARRRSTRARNTQFTDFFRRM
                     SSEDEESRSGSPSSDDVIISSTATTRKRRLRRRKQAKIHSGGSDMESGYSPRPTGSRF
                     STRQRKTLRKNLRERYEEDISEFEDATKTQKFFGAKESFRKIPSDDPFRSLHNEMCAV
                     CYRSGDDYAKGPLVFCQGCTTAYHQACLGPRATREHLVTKVSDDLFVLQCRRCLGVAH
                     TKDQVCPHQGRCTACSKKGNMSKPLRERLTPKQEQQLRQENGGKDPITHVDMACLNNT
                     ANLLFRCTECHRAFHFDHVTTDHTTTTRCGDCSSAPGEIGAIVAWRPTDLKTYVAGYS
                     ANIMEEVDKEYLIKWKTMSYNHTTWMPGSWVWSVVSPAMRRAFFRSNRNLNPDMTTEE
                     AIPEDFLRADIIFDVQYADDENDDSSEDRSIETDISRVDKVSKAYIKFKGLTYEDAVW
                     DSPPDRNNAERWADFKTAYEDWVKRDYTHMPNQHSLRKHLEQVRKQNFKKSIVKDTQP
                     ETMTGGQLMDYQKDGLNWLYYMWFKQQNAILADEMGLGKTIQVIGLFATLIQYHKCWP
                     FLVVVPNSTCPNWRKEIKAWVPSIRVVTYYGSSFSRQLAQKYEMFNGGSHDLRCHVVV
                     TSYETMADDASRRVLAKLPWAGLVVDEGQRLKNDKSQLYESLSRIHFPFKLLLTGTPL
                     QNNTRELFNLLQFCDPTKNAEELEEEYGILSKENIPELHNMIRPFFLRRTKAQVLTFL
                     PPVVQIIVPVSMSVVQKKLYKSILAKNPQLIKAIFQRKNDNQGPKQAERQNLNNILMQ
                     LRKCLCHPFIYSTAIEERTNNATASHKHLVEAAGKLQLLQLMLPKLRERGHRVLIFSQ
                     FLDNLDIVEDFLDGLGLLHCRLDGRMSSLEKQKMIDQYNAQDSPYFAFLLSTRSGGVG
                     INLATADTVIIMDPDFNPHQDMQALSRAHRIGQKNKVLVFQLMTRGSAEEKIMQIGKK
                     KMVLDHVLIDRMVSEEDDGQDLESILRHGAQALFEDDDSGDIRYDSASVDKLLDRSQA
                     EQASSSNEDAPESQFSFARVWANDNQNLSELQDTEDPTSENSAIWEKILKEREEAAAE
                     EARKAENFGRGKRKRVTVDYSNTATTELSPTKTPRKRDAESDTEFKGDEIVESESDTS
                     PELDFEGIERPAKRTKVRAFERVNPISDHDLSMSAAGMDGPTETRPSCFACNQNHPVG
                     SCRLKLAGVEHCGLCGLAHFGISRTCPHLQSDAHVARMLNALKESTEDPELVLQAKKY
                     LTGIRGDLAQRKRKQASKATGSLTATHGTPDGATPTAVNTTATKPSVVNLTDNARFAK
                     PATQSGTDPRFLQSYNPRF"
     exon            614428..614697
                     /number=1
     exon            614767..618864
                     /number=2
     CDS             join(620447..620875,620951..621026,621091..622148)
                     /codon_start=1
                     /locus_tag="AO090009000231"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000226"
                     /protein_id="BAE54718.1"
                     /transl_table=1
                     /translation="MSSPLRPQFFCARPNGTITPLVAVDELPSHISIRGVPRTLSANE
                     TQGMTSLGTVSPRAQTYVIDGLVSASTRASSGPRSRDFDLQASLMRLVSDENVPANQR
                     LAVNALLQQGISQNWFMSNASTTSWLVPSSSGGTGSGSSRQGAHHNSKKEFCSYWIRH
                     GECDYQQQGCLYKHEMPNDLPTLEKLGLRDIPRWYREKYGIPSLLPNGHGHPRSHASH
                     GQHWKDDTVERGAMKSIQYPSRLEINGAIDSSDIEKASKQKGTHYLSSQQHATGATGP
                     SRHAYQAVSSPKISTNPKHTHKHISGAVNSVPRRMDLLSFDSLLEYPTLDHMGGGMSG
                     LPYPSPTDHAAIENVDRVKHEEFVRNLHSLMPAPIATSADYLSTSFEGAPTQPRSKKS
                     QKSRRLYQPRSQMAMHDISMEKGEIDSFGTYHSHETASPSAVSVMSKETPISLLASPI
                     PDPSHLGAASSEPPTRGASPSTHSGASFSSGSSPRAHRNQFKEKDSKTMQAPIGTKLV
                     NRSTGSPVNYEF"
     exon            620447..620875
                     /number=1
     exon            620951..621026
                     /number=2
     exon            621091..622148
                     /number=3
     CDS             complement(join(622794..622903,623040..623397))
                     /codon_start=1
                     /locus_tag="AO090009000232"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000225"
                     /protein_id="BAE54719.1"
                     /transl_table=1
                     /translation="MSCEKFTTRAQNKRYLADTVNSLIKEAKEGDAFADIPLDLRHHK
                     PKTKLQFPDSWKLTPERKKQIEARRAERLRLEKERAGIIDGKAVIADAARVLPALNPA
                     LRAKATEERERVAVRVTDLLIQCIILIHLHTYTLLLLSISTMILILAKSSCIK"
     exon            complement(622794..622903)
                     /number=1
     exon            complement(623040..623397)
                     /number=2
     CDS             623473..624303
                     /codon_start=1
                     /locus_tag="AO090009000233"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000224"
                     /protein_id="BAE54720.1"
                     /transl_table=1
                     /translation="MLRGQILGAQLDDDLVLGGVRLAHVCGVAEAENVRLGREGERLG
                     KIYPGISGDGEQTRMKHLRLRNGISQAAILAYSLISRCTSSSAWAIDVISSSLNSSSA
                     SSTRANSSSSSSPQNPTRFSRTSSNRMGYSLSIWFTLFSSSANAAARFCGSLNSSTIR
                     RFSASNCSRSSGASMSYIDRSSLESRSGEYSAIEGSSSGRGSRGAGGTGGSSDTKLGV
                     VAENERYGIAIGPLRAMDKADRPRYLAAEAIAMGVLGWGLLEQDSAMFFCGLKFARMH
                     "
     exon            623473..624303
                     /number=1
     CDS             join(624490..624826,624884..625022,625073..625211)
                     /codon_start=1
                     /locus_tag="AO090009000234"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000223"
                     /protein_id="BAE54721.1"
                     /transl_table=1
                     /translation="MAPQDHDRPMKLCFVTVGATASFHLLLQAILDDKFLAALHEANY
                     THLLVQYGKDSQALFEELLSKYPPGSPSRHGIEIDGFDFNHAGLDREMRLAQARPDEG
                     RNGGLVISHAGSGSILGALRLGVPLVVVPNTTLKDNHQVELARELQKQGYVIASGHQE
                     VYVAVERAEALRARMLAWPPVNGANQKRHRTLEQVMSDELGFLD"
     exon            624490..624826
                     /number=1
     exon            624884..625022
                     /number=2
     exon            625073..625211
                     /number=3
     CDS             join(625832..626599,626653..626967,627041..627103)
                     /codon_start=1
                     /locus_tag="AO090009000235"
                     /note="actin and related proteins"
                     /old_locus_tag="AO070342000222"
                     /protein_id="BAE54722.1"
                     /transl_table=1
                     /translation="MAEATLHNAPIVIDNGSGTIRAGFAGEEVPSCFFPSFVGRPKHP
                     RVMAGGLEGDVFIGSRAQELRGLLKIRYPLEHGIVTDWDDMEKIWHYVYENELKTLPE
                     EHPVLLTEPPLNPRKNRDTAAQIMFETFNVPALYTSIQAVLSLYASGRTTGVVLDSGD
                     GVSHAVPVYEGFAIPNSIRRIDVAGRDVTEQLQLLLRKNGHVLYTSAEKEVVRKIKEE
                     VCYVSLDPKREEKEWMNSYHKSETKAVDYRLPDGHKIKIGQERYRAPEILFDPELIGL
                     EYPGVHQIVQDAITRTDLDLRKDLYLNIVLSGGSTLCKNFPDRLMREIKRLAVEDMKI
                     RISAPAERKYTTWIGGGILAGLSTFRKMWVSADEWHEDPEIIHRKFA"
     exon            625832..626599
                     /number=1
     exon            626653..626967
                     /number=2
     exon            627041..627103
                     /number=3
     CDS             complement(join(628816..629294,630426..630564))
                     /codon_start=1
                     /locus_tag="AO090009000236"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000221"
                     /protein_id="BAE54723.1"
                     /transl_table=1
                     /translation="MGIILEFCYDAIMPPVPFCGEILSLSRRRHESPRKTTNYQIIII
                     RISIMPATVNYRVVEPHPSVSRPALHTARGGAGNIISLKNTKTTPSQTATGPPSLTRL
                     DSHVPPVYKSGRGGAGNVHSSSERAIFSFDEELERDLRRAAPVYHVGRGGAGNMVYSD
                     NGSTLSRKFSASSNATSSSTGSTSSTREKALRGLEKGWGKLRGMA"
     exon            complement(628816..629294)
                     /number=1
     exon            complement(630426..630564)
                     /number=2
     CDS             634805..635956
                     /codon_start=1
                     /locus_tag="AO090009000237"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000220"
                     /protein_id="BAE54724.1"
                     /transl_table=1
                     /translation="MAMTMGLHRDPRVFPGLAPFQAEMRSRLWTTILELVVHGSIDSS
                     SMPLMISPQDFDNHVPHNINDADLWPATQEFSTPKPLKQFTESSIQLLMRQSLPIRME
                     AAKLINSSNLEQSYNAVLQIATDLQKACRDLATYFQLHWPQYSGETDLHRKFLDMQIR
                     RYILLLHRPYMLQAQHNPRFYLSRKICGESAMIIASYAESLQLPSQNLDDLSRLMVMS
                     TGPFCGALHLDIITVLGLEVTSQLKETATGSSEPGQLTMDPLAEMSKAQREPMIRILE
                     HINDQMLQVVALGIARFKRYIFLSVVLCQIRALESGTRDIRPLMIKAVQESVKNCYMA
                     VQSSQSVSTPQGPIETLICTESPPGLDFNLMVSRKLHLLTERFLTLLGS"
     exon            634805..635956
                     /number=1
     CDS             join(637206..637298,637364..637810,637954..637992)
                     /codon_start=1
                     /locus_tag="AO090009000238"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000219"
                     /protein_id="BAE54725.1"
                     /transl_table=1
                     /translation="MGLQDVQANCHPLHSASPHQEDQTVPRACPLLQEQRVSPSHPPS
                     PKPQAPQAVSHLSPTCPQETSPSPHHQAASPRTSKSQLPVLPASRQCPVPSLANLVSA
                     PVLPPVFPVPRAKRADMRPRLVQAQRVSPDRHRDWASLVDLFRGWMGMSNYWGFMLGV
                     YAANLNYTLPCSFYIFLLLKAVEFWDGQRPAS"
     exon            637206..637298
                     /number=1
     exon            637364..637810
                     /number=2
     exon            637954..637992
                     /number=3
     CDS             complement(join(638555..640398,640455..640827))
                     /codon_start=1
                     /locus_tag="AO090009000239"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000218"
                     /protein_id="BAE54726.1"
                     /transl_table=1
                     /translation="MQFKALLSALLLAFLSAPLVTATKLIESNALNLCQDSSNFTATL
                     FKVTFTPNNRSLVFSFDGVAAISGKVKAEIVLDAYGYTALKKEIDPCEMNIGGLCPMS
                     AGPIDVPKAQIDVPQDVVNSIPGIAYTVPDLDASVRIYINSTDTGESIACVEASLSNG
                     KTVYQKGVGWSTAIISGLGLAASAITSGLGHSNTAAHVAANALSLFSFMQSQAMIGMT
                     SVHMPPIVEAWTQNFQWSMGIIHIGFLESICTWYQRSTGGTPSTTLSELSTTSVQVLK
                     KRTLDEATGLVKKASDIIKRGSGAESETANTSNLVVRGIKRVGFKAGIEATNIFLTGL
                     IFFVFFVAVVMILVSLFKAGCEVLAKNGKMKTDKFQDFRNGWKIVARGILFRLTLIGF
                     PQMTVLCLWEFTQHDSAAEVVLAVIMFFSILAALGWAAFKVILLAKRSITMHKNPAYI
                     LYSDPTCLNKWGFLYVQYRATAYYFVIPVLGYILVKGMFIGLSQEAPVVMTIALVILE
                     AGMLIAVSVLRPWMDKKTNIYNISIAAVNFLNVIFLLFFSEVFNQPGLVTGVMGVVFF
                     VINAVFALILLLLVLIASIYAIVSKNPDMRYQPMRDDRGSFIKSQGQLTTELDALGAA
                     ARGDVKTGAYKSSPFDDDNGSFSSGNGASINRQNLDVHGHDQAPNTRQAPVSPVDPSL
                     PLFPSDASGRQEPPSYNARSPSPVPRGYTASPLNNPNAYRAQNNPSPWQRGAGYDH"
     exon            complement(638555..640398)
                     /number=1
     exon            complement(640455..640827)
                     /number=2
     CDS             complement(join(643426..643493,643856..644069,
                     644249..644365))
                     /codon_start=1
                     /locus_tag="AO090009000240"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000217"
                     /protein_id="BAE54727.1"
                     /transl_table=1
                     /translation="MLYPSTNYLESLTKPNVKPVFGNIKEYNTVWRHYARRQRPLANS
                     PLIICIEAQEHYIAKFLNRWQKEDIRTFEPKLEAVDDFMEQKDLFMKSTIWENDCRSW
                     FKKRQHRQVSGQDTQWEEKSSRSGFRKTTY"
     exon            complement(643426..643493)
                     /number=1
     exon            complement(643856..644069)
                     /number=2
     exon            complement(644249..644365)
                     /number=3
     CDS             complement(join(644584..644713,644762..644805,
                     644851..645103,645219..645245,645273..645291,
                     645347..645533))
                     /codon_start=1
                     /locus_tag="AO090009000241"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000216"
                     /protein_id="BAE54728.1"
                     /transl_table=1
                     /translation="MESYRDKPILANRMMRVICIGAGPSGLYLAYRLETSFTGYMLEV
                     YEKNEYIGGTWFENRYPGCTCDVPSRKYPWNRHICNHRVVGANWDDVSSQWKLRVEDP
                     KKEVFERRCDFLIDGTGYLNSWRWLSISGLGSFNRRLLHTANWDGSFAVNWKAGRVDW
                     EWFARSSGIQLLPELQRTAGHGIAFMRRPTWVIPEMRYKQRRYTDEEKQTLRDNLRKL
                     L"
     exon            complement(644584..644713)
                     /number=1
     exon            complement(644762..644805)
                     /number=2
     exon            complement(644851..645103)
                     /number=3
     exon            complement(645219..645245)
                     /number=4
     exon            complement(645273..645291)
                     /number=5
     exon            complement(645347..645533)
                     /number=6
     CDS             join(646461..646836,646901..647143,647202..647548,
                     647605..647736,647799..648059,648119..648355)
                     /codon_start=1
                     /locus_tag="AO090009000242"
                     /note="ATP-dependent RNA helicase pitchoune"
                     /old_locus_tag="AO070342000215"
                     /protein_id="BAE54729.1"
                     /transl_table=1
                     /translation="MSSDEEQKNTEESEQEASDNEEEKSDAEETPAANGEDLPSADTI
                     RLPQQDGDPVKFTELGLSEKTMKGIEGMGFETMTEVQRRTIPPLLAGRDVLGAAKTGS
                     GKTLSFLIPAIEMLSALRFKPRNGTGAIIVSPTRELALQIFGQVRELLAHHSQTYGIV
                     IGGANRRAEAEKLMKGVNLLVATPGRLLDHLQNTQGFVFKNLRTLIIDEADRILEVGF
                     EDEMRQIAKILPSENRQTMLFSATQTTKVEDLARISLRPGPLYINVDHRKEHSTVEGL
                     EQGYVICEADKRFLLLFSFLKRNLKKKIIVFLSSCNSVKYYGELLNYIDLPVLDLHGK
                     QKQQKRTNTFFEFCNAKQGTLICTDVAARGLDIPAVDWIIQFDPPDDPRDYIHRVGRT
                     ARGSNGKGRSLMFLQPSEVGFLKHLKEARVPVVEFDFPTQKIVNVQSQLEKLIGQNYY
                     LNKSAKEGYRSYLQAYASHSLRSVFDVHKLDLVKVSKGFGFSTPPRIDIQLGSSLKDK
                     PPQGRRNYGSQPGSKFKRKHNDD"
     exon            646461..646836
                     /number=1
     exon            646901..647143
                     /number=2
     exon            647202..647548
                     /number=3
     exon            647605..647736
                     /number=4
     exon            647799..648059
                     /number=5
     exon            648119..648355
                     /number=6
     CDS             join(651221..654439,654496..655893,655952..656113)
                     /codon_start=1
                     /locus_tag="AO090009000244"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000213"
                     /protein_id="BAE54730.1"
                     /transl_table=1
                     /translation="MGVDTRRPILPAPTESIVDTTTTGGSVTGTDLATDVSRRTDKTS
                     YSIPDDGSPVTISTRRKNRTHGDESKLSRSAQHSQTSLLIEYFEGGKGSGSLVSRPSV
                     RVRVTPSNSRKRKDSKDHIQITESNGNRKPVYSRRISFSSPSKNNKSSDDYSICSFNS
                     GTDENQQPSGHTPVEIELVNRDQSSELSSDTRYFQPTSDISSMPADSMLEASSSNIRR
                     KRSQSSSREREHSPEYKDYLQTPRRQRSRSLSTERIAHRVAEKLSNDPRETSKGQRKK
                     GDTADFHEPESKSRSRLSVYPDEDMSPNPSLLSASALSAHRKSGDQYSFRSGTSKSSI
                     NNPKLLETVEDAIRRLILPELKELKKDQKVMTNTSKFERDMNTSHSSGSTPSRDELGR
                     RLSKHASAPDVTRPTVVLNKDDQDEGIVLSGEPAPSQQDRRPSDAPTEASYVKWGLRP
                     ELTEQEKLRRQKSKGLRDAEKAARVGSALTAAALKHHDSRSSIDKTERRRPSGPRSGN
                     GSFNDTELVFQKHNVAPMPLRSAIESDMTRDSLLSEQTAEPYGSRETSEIHDTRSPHR
                     DLLDSRYDLKHSNFSSHDLSLHDYPEEDYREQSLSPVGDAAAGAIAAAAAANLLDEHP
                     GRHGSKFTDRRRTLSPIQSVASNQSESHIKQDSIQPVEHDFSGTEREMEQRLSIDSLS
                     SAPSTNLARSSRPHGISPAGQKEFLRHNNKYGAELGYEESPAMSPRSMTETASTDPKR
                     MTGFTDESEVSYMEKVNQRQPVAGIGANPQVIHPIAVESAVASLLDPSIVDTKSNQSA
                     PNRSQTDLSRRLEGQSPKPVERANQTPHGSRQGSPLKQRQDASSPDATSFPRRMGATS
                     PPQSVTQSLEDQTDPTHMFSEGIHDRESPSPEADRSPDSESEINTNPSIIQGPIGGGM
                     HGGNWAYEQTPDNRGQSPIFDNAGSAGNTGPGSGDQPDYGHDYYETNDYNPDNYLNHQ
                     YSRGPLFGTPPGKDEGYVSAPNPLSPGVDTPEPLDKGFGGMDTNGMGLFDSPTGADDQ
                     FMSGHQRQLSGYSQGVGSPLYDSATGRGIDRIQSQDIVALMDHLTVRDAQRNARDTEI
                     LVTLVRSAAEMRNSFEEMKKFIAQQDGMLMEASDKQHDRTYRALGGPRPLPASTRSAR
                     QSSAEDEDLRSKRKNVFKRALKGLSLKSSNDLSRIEDMLEQLLDEVEALRDGQDERLG
                     RSGPRSASVDPEGYEPEGHAGTSSPDHSGYLLSTSSRPMPESRGNGLRRDSEHRVSTV
                     PEADEEMELNERGKFLSPNPTNDQQDRAGPSSASTPPRAPMASGALSNETSPKTNEKS
                     KKHKSSSSSFFPKISRWSKTTASSMGDNIRNSIQPGRKERPSFDASRSGSDIQGPYKA
                     ADWYDPQGDDRLRSTYTLDDQQQENRPPSPLVPSQVSEAPKYRAHRGSLDLQHPQPRQ
                     GPTGRYQSQLETQAQIYGMPSGAPSDQWNSNPSLSAGNPNPRHSSGASRLSPISDVGY
                     SEASSRHTGPPRPPKIKDDGPLVPERPPKVKEDDERSYVDRVASRNSALLSSPRSTPP
                     PRKPTGPRPLNSGSQYSSPSRRKRSQYRASPDQVDEESLY"
     exon            651221..654439
                     /number=1
     exon            654496..655893
                     /number=2
     exon            655952..656113
                     /number=3
     CDS             656855..657655
                     /codon_start=1
                     /locus_tag="AO090009000246"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000211"
                     /protein_id="BAE54731.1"
                     /transl_table=1
                     /translation="MPYYVHIAAKGALNNNHLHVLTTVSREAADYFYRQLQQHTPLRA
                     LGHTPIKTTYYSPTFWSIDPTYDDTISLLNNLVSDIDKGTNGQIPEAAQNYLKGKLFI
                     GPLTGQITVNPTYVSDDNSSGNINNRCYYIRNRHTPECWFVSPGAVEVNVSISNRSKF
                     HVQICPENGEPLVLVGGDVIQLMLIVPDNARRFVCVSTDNYCLMCLPGNVTPSFKFHF
                     YELRKGWFGVSTSLSKPGSSVQWTPTHSLSMEGPGEDWVLLASEDIPC"
     exon            656855..657655
                     /number=1
     CDS             658042..658890
                     /codon_start=1
                     /locus_tag="AO090009000247"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000210"
                     /protein_id="BAE54732.1"
                     /transl_table=1
                     /translation="MATHTDEESTLPPNNPITISTGEVLSLLGALITLKLLHAVVFLF
                     RLDRSRKRPLKSPVTRAVIRREQLIINIFLSIMPEGVFRSPTIPDAIELAHFPLVDGH
                     ADESRTSSDMRSPLIHTSPCIPTGFRLWQCGSCRGVEAFPPSLQRPGIAHAASESSSA
                     QQLLGANEDEERRSLSVTHTESPSVNQESVSTLNPEYTASRPERQQLSPVGRPLSMDS
                     VGLPLMNDSPTIMIIEEGSRSPRSTEGYSGRYSISEGSYGNNLSMTPHCTRGRSATSV
                     RPFSDL"
     exon            658042..658890
                     /number=1
     CDS             complement(join(659049..659243,659309..659882,
                     660052..660167))
                     /codon_start=1
                     /locus_tag="AO090009000248"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000209"
                     /protein_id="BAE54733.1"
                     /transl_table=1
                     /translation="MSNSLDLTICSTCGTQYPTTSESTCKICDDPRQFIPATGQSWTT
                     LRILQTTKQYHNEFTPDTIHKNLISIHTVPRVAIGQRALLCRTATGNLLWDCITYIDD
                     ETVSKINELGGLKGIVISHPHFYTTHLHWAEIFDCPVYLAREDREWVVCPGERQVFWD
                     SGRLSVPGVEGDLVAVKTGGHFPGSSVLWWRSLGVLLVADSIGVVPSGIYHVGRLPGT
                     VSFTFMWSYPNMIPLPPNEVHNIWRAVKDLDFDDIRGGFMGTEVNGNCKQRVLESAQI
                     FVKSMGHFNHAIREEQCP"
     exon            complement(659049..659243)
                     /number=1
     exon            complement(659309..659882)
                     /number=2
     exon            complement(660052..660167)
                     /number=3
     CDS             complement(661216..661980)
                     /codon_start=1
                     /locus_tag="AO090009000249"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000208"
                     /protein_id="BAE54734.1"
                     /transl_table=1
                     /translation="MRQSIILSLLLPCHSLATLIPQTEPSYMPEPNQRGTFGLFWSCT
                     STLILCVWTAIHPNVVPIRKPLARSYYKLALMLVALVWPDFILWMAATQYFKALDVHR
                     AWLEAWEGKEGDKENRELLGMSGAFFVVMGGYAVDLSNKNSSSALQDAGAGLVTTISA
                     DGFIHLLKNRAIPTGIQDSRLPKSYFEHYTIQDKGNSNNLAKAIVFMQIMWMIVQLIG
                     RISAGLPVTLLETHVAIQIPFAVVAYAFWVEAVGRR"
     exon            complement(661216..661980)
                     /number=1
     CDS             complement(663005..663520)
                     /codon_start=1
                     /locus_tag="AO090009000250"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000207"
                     /protein_id="BAE54735.1"
                     /transl_table=1
                     /translation="MAHTFYDGTIPVLQSILKTLSHILHRASQHPNANALLTARLHED
                     MYPLTDQVRITTQFSENLVARLTGREPVSFDGSPTTFAECYERIETVLKALNEAEKDV
                     VNRQADVVAKTPMGPETAVEMSAAAYAHSIALPNIYFHLTTAYGILRKEGVELGKRDY
                     YVGFFPVLGGQ"
     exon            complement(663005..663520)
                     /number=1
     tRNA            complement(664470..664636)
                     /locus_tag="AO090009t00007"
                     /note="tRNAscan-SE"
                     /product="tRNA-Lys"
     tRNA            complement(664713..664881)
                     /locus_tag="AO090009t00008"
                     /note="tRNAscan-SE"
                     /product="tRNA-Val"
     tRNA            complement(665556..665720)
                     /locus_tag="AO090009t00009"
                     /note="tRNAscan-SE"
                     /product="tRNA-Val"
     CDS             667110..667781
                     /codon_start=1
                     /locus_tag="AO090009000252"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000205"
                     /protein_id="BAE54736.1"
                     /transl_table=1
                     /translation="MRRRPVATPRVLKNLTRVPDLLSLFEALPYCGYSFKNGPWKHAL
                     VAFGIDPRLGPEYRMYQTYEFPWNYDPIIAEPSVISPLTVEISFPRVVRTKHSDNSHV
                     FDGNLLYTDDNIWQYCDISDDQLHRIWSTTTIRHSFCPQNGFFYNGTNAKLWEIMSDK
                     VMTIRDGEEPAVDDYECLLDIPDDYKGGSRSGDRKRYGQSFGQNYTRKQAFMRSLILK
                     KAQSL"
     exon            667110..667781
                     /number=1
     CDS             join(670044..670567,670576..670603)
                     /codon_start=1
                     /locus_tag="AO090009000253"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000204"
                     /protein_id="BAE54737.1"
                     /transl_table=1
                     /translation="MLQSREPDRGTDGARDVTDSIAEPEDFADTTDADEVGEATPSSN
                     RGHTKKKRLYQRSSMQRAVLKNYSLVDGKKKCLILTCPLPQELYSGYCKHHSSRIIQY
                     VSSLKATGAELPMPQWELKLTDDAMTDVKTLSTSYHRSPQNTWVIDFEYISLSGDMSP
                     IPLQFAIRQLDGKLLECSLWPVS"
     exon            670044..670567
                     /number=1
     exon            670576..670603
                     /number=2
     CDS             complement(673271..673969)
                     /codon_start=1
                     /locus_tag="AO090009000255"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000202"
                     /protein_id="BAE54738.1"
                     /transl_table=1
                     /translation="MELECDFMWKAHRQEPQSGPVLVSISCSHCTSSHHLVGDCPSLP
                     QPLKSSSWTLKGVDPNMVTNINSVVNGRGGPSSRGRGGMKIRGRADVHSSPDDSDDLM
                     TRRRPVGRGGNRGNIRIGSGIGKNKNLAPAGSRGPDMDSRQFYRDRQDFHSGNARQRS
                     LSPNPRRGRGKDTWQPAPRSPPRGQSRPPPRGGRGGGRGRGGRGNGNKRGGNGDNYRP
                     MPSAAKKAWDKYRL"
     exon            complement(673271..673969)
                     /number=1
     CDS             complement(674135..675205)
                     /codon_start=1
                     /locus_tag="AO090009000256"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000201"
                     /protein_id="BAE54739.1"
                     /transl_table=1
                     /translation="MPDSPGDDNNDSRTASVGAQRNRATSTNGSRQSSIDSNSHPRKR
                     QRRNGKGEPTDARDFVPQGATFSANTLEVDPDSTSSSGSSSSDDESNSSDDGNEASSQ
                     AGPQSAAAPNWNKASKSTIRTSLNKRGNKANEGEHDSRFDAVNDKYWRSRSESVSNGG
                     DNDNVSQTNSDGASEEGEVQEDDSSDSSRMHLSGDSDDSSLDSEADDSILLNINARGQ
                     TQNASQKQNGVQDDDYDPESLPVSQSITNGHTFGGAADGSPTTSKEEAFRHFAQKYPT
                     NPETLADLNREDMDAQAKYVFYDREINDINLQLPVACIECMREGHLAEVCPYKEVRSE
                     TTNPLFQGACCTASDTVGTDRL"
     exon            complement(674135..675205)
                     /number=1
     CDS             join(676476..676934,676992..677039)
                     /codon_start=1
                     /locus_tag="AO090009000257"
                     /note="predicted membrane protein"
                     /old_locus_tag="AO070342000200"
                     /protein_id="BAE54740.1"
                     /transl_table=1
                     /translation="MRIGSMPRVSASTWTLYMHNNGAGELTGDVLMTGAWTIHFVLII
                     ALKIFYDIIPGVSQETSWTLTNISYMFGSFLMFHWVRGIPFEFNAGAYDNLNMWEQID
                     NGDQYTPTKKFLLCVPICLFLLSTHYTHYDLTYFTINFLATLGVVIPKLPFSHRLRIG
                     LFSPEPEE"
     exon            676476..676934
                     /number=1
     exon            676992..677039
                     /number=2
     tRNA            complement(678419..678504)
                     /locus_tag="AO090009t00010"
                     /note="tRNAscan-SE"
                     /product="tRNA-His"
     CDS             678827..680530
                     /codon_start=1
                     /locus_tag="AO090009000258"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000199"
                     /protein_id="BAE54741.1"
                     /transl_table=1
                     /translation="MAVADEEAPSPLYRHARTLPFELVQHIGIFFEEKLCPPPLTPRN
                     SLDHRTDRGVRQPDTQALNLLLNIITTGTIPPTPVYVPSPQHLALAATFLVHPSTTTR
                     AKTAEQEEASNVSLRLLRLANTIAGPVSAKLGTAFSFTHFEASRHGRRRRAEDEQPPD
                     DDTKPLNLDLAQSASVWSRAEDFWHAVGWAFNCSVLHRERWEKWQIWLEYMCEVLEDD
                     WNERKRMSDRNTNIDHKVLKDSLIFRYITETTAGYGRNRRILRAIFADGGSTSVNEFR
                     EVFHHELKKPKQDKNTKKREVQVNIDEDQYGDYLTDDDDDSSDNNNNNKNDPDTASKR
                     PTRQTKRPRRGTRAKDVKSADAVDTTSTVYALSDVSSHGGFQSLALRQRLLHLLSGVA
                     EALPDDFISLEELYHLFVENIRHLSLPVFQALVTPSTLPYFSPEACTTLCECLLFRIR
                     ESAAPDTDEEYLSQAKLEECFLPYAASTNSVIDNTKMSILLEALLILLANSDMLKVTT
                     DLQEAVEEGIQRRAEKAQTETKKSVSARKSEDAEWCWLQESGERLRFLVEVLPRGEDS
                     D"
     exon            678827..680530
                     /number=1
     CDS             complement(join(680852..682550,682616..682782))
                     /codon_start=1
                     /locus_tag="AO090009000259"
                     /note="calponin"
                     /old_locus_tag="AO070342000198"
                     /protein_id="BAE54742.1"
                     /transl_table=1
                     /translation="MASVTSLDKDLRSLRLSRYTPQAAAEVRSWIEEVLHERLPAGDL
                     LDALRDGVALCRLVNLAVSPGVKYKQSSMPFVQMENISHFLRACQIAPLSLPPHDVFL
                     TVDLYEAKDPAQVLQCLVAFSRRANALQPGKFPRSIGPQSKVGALSPNATGSSQGAHT
                     PSRPRGLSNANSSASGYSSPAKSPGPVSSWSKRTDEHTTMPAWNIHQYGYMGGASQAN
                     QGVAFGARRQITTAAPNVPSLAEKEKRRREEEERQRLEFEESERRRQEREAEEARARA
                     EEERRWEEETARLKEQERRKLEEERKQWNDQQRRWEEEEEQRQREEREAEERLEKERL
                     RRREVNDTRLNGQFLSQYQASQVGPNQAPAESSERRRIRELERELETAKQREAEYQRE
                     RQEIQEKQAAPAATPAPRPVPVPPKPSYNLSSLESERRLLRTEWNKHQTEESIAEAAN
                     PPPSLPPRPLPEPVATSPRPLPDPTLYASKPANQESRVDRFLASNRPPVAPKPATHRP
                     QDYTTTAEVDAENSRRAAAQQKTKAGGWASKSLLEREMERERERQREWEENQKQTQQA
                     AANGLRDGNLGVGPGQGAWDVHQYGYMGGDNQNRGGHGLGVGGARRQIIGPRPPP"
     exon            complement(680852..682550)
                     /number=1
     exon            complement(682616..682782)
                     /number=2
     CDS             complement(684958..686649)
                     /codon_start=1
                     /locus_tag="AO090009000260"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000197"
                     /protein_id="BAE54743.1"
                     /transl_table=1
                     /translation="MFAQPFDHSFNNDDLFSQYVNIDGSSTDGNKDVSFPSDFDQFFS
                     LDSLSSNCGEQSPIISTSKQQTHPSPQWAKDFWSLPPDAPSSLGQAPLAFQDTVHPSA
                     VSDLNVNLEASSTTCPAETRSSPTTPPGTPRRKPKSALVTPKSIQRHREPNGRRGLQH
                     KQSFSPSLTRPSQFQKGRMAYQEAWAHRLQNLNFLRSADDRFPLSPPPSDILPQQENI
                     AADNSAVHIHHSGDSTEMHHHFDTSIFTPSPAISMPSPCTGVLSRQQARYLNHSNNST
                     VTSSPPSADDIFPSPHSSDPQSMSSWHSDALGTPGLFTPDLQSHDAQAWWPPMNARVP
                     QRQPSYQQVVASPPPQQPIQNTTHQHDLANSQHDILQGGLMIQMDPSAYDMTATANSS
                     FSSTTMAPTASSCQENHTYSHVPTAHAKYVDASSFATPQLHPQSRSPSLSPRADRSPK
                     NGLAMHHSITMKAQRRQPGRKISSNSMNVPKPVKGLNGSGSPKGAKSVTVSFVNFTLN
                     DSQKILTGVAPSGSSKTKARREQEARDRRRRISEAALNAVRKAGGDVEALEAVMF"
     exon            complement(684958..686649)
                     /number=1
     CDS             join(695012..697342,697413..698651)
                     /codon_start=1
                     /locus_tag="AO090009000261"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000196"
                     /protein_id="BAE54744.1"
                     /transl_table=1
                     /translation="MQNTKGPESDMGRTASRSRSNSMSSDSLSRIHMSPPAAKPPPSF
                     IASSSAAQIITTDQEFNTADFVAEEGGDSDAKAIVTPEALAALNGFLDHILFNILAAA
                     KSTQLACIRPAVADVLKPRLANQVVSAADEELSEYMGGPEEEEFQFRRGMSQNGDFDL
                     IRSWKLTRLRCMVYTRLGDMEEDDEEEYIAQNGLDDDGSVSPRFSMHVGNITPAAAIF
                     LTSIIEHLGEQALVIAGETARSRLSAKPSDGPEEAESGGERSTINRLIVEDLDMEKLA
                     LNPTMGRLWRTWRRYTRSPMLSRVVSRESIRRRATVGPSSCRKSSGVTDDELPQRPVI
                     EIPKEIDPASVALPEGDHDVEEIEGFTSDGEGAEIVQTMQAVVAHKVRPHSLMVLTLP
                     SPRSPTSPITPLSAKFTRHVRAKSLPDTTPPESAETDQTADRPSPTASDEQKPLETMY
                     EHEEDDEPPKAKAESKVSEADPLPEESLEQDKMATSSQSAVSVEVESSQASSTSGSST
                     SLSDRFQTDSDTEVIEGQGMCEKPKLAPIQRPKRVCSRDANRENDRSTTATRVISERA
                     MPTVVDDPSQTQGGNSTPAQPTISHDVSKDPDTNKPSTESSAPQTRTSTDLEEKISRP
                     PSTSGESVYSDRSRTRHRPSPLVGISHHRYGRSSSGVSSISSVTERAAVQRVIRPSTS
                     AASSVYSRPRRSDSFSSQREKRPVTAGSTTSQVSSRLKGLIGLQVDSVSIRLRNSSET
                     NRFAEEPYDDTTGLDELIRSEETLHYTLTPKNMREIEEPDSPRWRVRSSTADLAEFLK
                     NSAPPGEEVPRPSTSHTSSRGTINTPKYKAIEIPSTATSQQSSDPEQAADRKPNTGSS
                     SDYDHSIKSTGPSSPLSTQPTQSPRSPSSTVRSGPKLEARSAASSKADQDRTTELIDF
                     IREGPPTAGARRIPRAVAPFRDTMDSDELNSLETGLSENNAPSVSSTQDGSMLTSVGS
                     RTGLLETGNRTTVHPTAAQHMPTAPVDDPRPVRKQRRVPDPYAIDSDDDEDLDELLDD
                     PKPKREEESLIDFLRNVPPPESEPSPQPMAVNTMPPKSSSGAFGMKARLLRNASGDKV
                     PTTKLSKASLRQQQDSYAAAPSNYSVKVGAERSRGAMYGTSSLPSVTDRQTETSALAE
                     FLRTTGPPEPPAPRASSSLASKGRESGVNSLSRLFGRRKKLEV"
     exon            695012..697342
                     /number=1
     exon            697413..698651
                     /number=2
     CDS             join(699484..699693,700050..700271)
                     /codon_start=1
                     /locus_tag="AO090009000262"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000195"
                     /protein_id="BAE54745.1"
                     /transl_table=1
                     /translation="MGTSQPTLRSILGILFLCLIQISAALKFDLPAVSGKNERCIRNF
                     VFKDQLVVVTAIVSGQKGDGQKVNIHLVLPTLIGPLNSMLTLAPMLVTGLAFRTMRSS
                     SPSRLTSAALRRWCKKSSAKWNTFVRVSKSCVTPTRAPTSV"
     exon            699484..699693
                     /number=1
     exon            700050..700271
                     /number=2
     CDS             join(702625..702704,702866..702992,703089..703406,
                     703617..704042)
                     /codon_start=1
                     /locus_tag="AO090009000264"
                     /note="G protein beta subunit-like protein"
                     /old_locus_tag="AO070342000193"
                     /protein_id="BAE54746.1"
                     /transl_table=1
                     /translation="MAEQLVLRGTLEGHNGWVTSLATSLENPNMLLSGSRDKTLIIWN
                     LTRDEQAYGYPKRSLEGHSHIVSDCVISSDGAYALSASWDKSLRLWELATGETTRTFV
                     GHTNDVLSVSFSADNRQIVSASRDRSIKLWNTLGDCKFTITDKGHTDWVSCVRFSPNP
                     QNPVIVSAGWDKLVKVWELASCRLQTDHIGHTGYINTVTISPDGSLCASGGKDGTTML
                     WDLNESKHLYSLHAGDEIHALVFSPNRYWLCAATASSITIFDLEKKSKVDELKPEYIE
                     KGKKSREPECVSLAWSADGQTLFAGYTDNKIRAWGVMSRA"
     exon            702625..702704
                     /number=1
     exon            702866..702992
                     /number=2
     exon            703089..703406
                     /number=3
     exon            703617..704042
                     /number=4
     CDS             complement(704478..705830)
                     /codon_start=1
                     /locus_tag="AO090009000265"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000192"
                     /protein_id="BAE54747.1"
                     /transl_table=1
                     /translation="MFTPTTLRLPRTLPSTLTRRLSTLPKTPRPSLKHHLQPLQFPQR
                     RSLSTFQKWTLGLKQAKRDIWRKNPILLPLALFSAATATAIFTYIAYVEYTRVGPQYH
                     KFPPPVAEALRTAVYYTEVDLSPPKALQAYKEALRIGIEMGMHPFSDEVVGIKIQVAM
                     MLERAGLAKAAVEVLERTKGEIMGFVEGKDRGEGVIGVKIEKEEGEEKRKEVEEFEKQ
                     QRDKVLKKAVGIEMKLAELYSSDYIQDEKKAEAAQVAAVELCLKELHRRQSLGLPVGG
                     GLEADNTEGWLNVTEIATALTDLAGRYTAQENYELSIPLQMRALNLLHTEEGDAPTCK
                     QVVLLNSVAGCMAGQAQKPIRAEDPKKAKEQLFDAAEKWAQKALDVAARIQPPVRDEE
                     CDTSCVAATFNLGWLAEFQGKAKEAERLYGEAKSLSQGLGFEQGVSMADAALKRLTKN
                     "
     exon            complement(704478..705830)
                     /number=1
     CDS             join(706208..706234,706303..706846,707011..707021)
                     /codon_start=1
                     /locus_tag="AO090009000266"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000191"
                     /protein_id="BAE54748.1"
                     /transl_table=1
                     /translation="MCGRYALGVRMAFMRRRLQEQGLQVDEAPSDDEVRETYNFAPGN
                     FGAVYRADIYPSEHGEGQYENDDSGPHNTSRTQNRDGGKDEQTQSSSQLHYKIQSMKW
                     GLVPSWTKRKPDYGSLMRTINCRDDSLVEDRGMWTSMKRKKRCVIVCQGFYEWLKKGP
                     GGKEKVPHFVKRKDGELMLFAGLWDCVSYEVRR"
     exon            706208..706234
                     /number=1
     exon            706303..706846
                     /number=2
     exon            707011..707021
                     /number=3
     CDS             complement(join(707781..707847,707900..707930,
                     707982..708459,708515..708610))
                     /codon_start=1
                     /locus_tag="AO090009000267"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000190"
                     /protein_id="BAE54749.1"
                     /transl_table=1
                     /translation="MFAIRTFVRNTPSLSRWSQIRGVSTLENHPHIYVFPSNGSHVLS
                     LLPSEPPNSRLSIGVTSKLPPTTDSFKENPEFLKILQDVVSEYGHQDPDAVSQAQVMV
                     STSGANLGSGGVLLTGGRARRRHSAADSSGGASGQGGAGSAGRGGWIHLSDNRRPPEY
                     GRIAWPEDIFGSLEVDSDGSFVGSNGNYQPSGTYRIVTRDGILGLSPFLREKLVQRLR
                     QQESQ"
     exon            complement(707781..707847)
                     /number=1
     exon            complement(707900..707930)
                     /number=2
     exon            complement(707982..708459)
                     /number=3
     exon            complement(708515..708610)
                     /number=4
     CDS             join(709074..710717,711844..711876)
                     /codon_start=1
                     /locus_tag="AO090009000268"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000189"
                     /protein_id="BAE54750.1"
                     /transl_table=1
                     /translation="MATPSSKPNPGATPTHLTSSPRPSGPMARPISHKSPSTRTPSAS
                     GHAHNHQPILTHQNATPLAAATGADDPVTLSSPSALLALGGYGGISPSPAVHDVLVAP
                     GMHDSDIQALGMQGLKLGNARDSDDERRRHIEDVVQLLRTRVAGRGVCREGIERLGQL
                     EGFESIWQEDSLSIAGNFVDLEIEFYRAQNTVKDVSLNIATPEATDGERREATAVLKR
                     DLIESPEDGGRSSWKTLTKFHENLQWLAKHDRLSQEVNCFEAIEGLYESLKRIWDEEG
                     HHRKFSGIHDHLCSGWVGQPCLHQGGRVGLNLEYWVHQARVLDSKQKKVSPDDMAIDQ
                     PSVSSMGGESGNHNGKWNIIIECEEGYPSLRVSKEWVNSEVFTVVNNNANEPSSNEMG
                     GSDVAVVNWADPPATLSSQGQQDAMALDSGMLGTAPNRRFVARMEPPLELPILAASDI
                     YRHLGIQMPQEFKMVTYDGLLAPGWSPLSAAGAMGLGPEEASQLGRRRRRMAVQSVDQ
                     DGKPCTKQHSYTFQPFESVAGRTMRDIPFAHPRQLADILPQSVRKGRKRK"
     exon            709074..710717
                     /number=1
     exon            711844..711876
                     /number=2
     CDS             join(716165..716167,716261..716293,716387..716479,
                     716718..717222,717288..717709,718396..718410)
                     /codon_start=1
                     /locus_tag="AO090009000269"
                     /note="glutamine synthetase"
                     /old_locus_tag="AO070342000188"
                     /protein_id="BAE54751.1"
                     /transl_table=1
                     /translation="MSESTTISNTENLMKYMNLDQRGRVQAEYVWIDSVGGCRSKTKT
                     LSKKVTSVDELPEWNFDGSSTGQAPGDNSDVYLRPVAIYPDPFRLGDNILVLCETWDS
                     DGTPNKYNHRHDANRLMEVNAKEEFWFGLEQEYTLLGNDGWPYGWPKGGFPGAQGPYY
                     CGVGTGKVYCRDIVEAHYRACLYAGINISGINAEVMPSQWEYQVGPCPGIEMGDQLWM
                     SRFLLHRVAEEFGVRISFDPKPIKGEWNGAGLHSNVSTVATRAEGGMKAIEAYMKKFE
                     ARHVEHIAVYGEGNEERLTGRHETGSIDKFSYGVADRGGSIRIPRQVAKDGKGYFEDR
                     RPASNACPYQITGIIVETLSNK"
     exon            716165..716167
                     /number=1
     exon            716261..716293
                     /number=2
     exon            716387..716479
                     /number=3
     exon            716718..717222
                     /number=4
     exon            717288..717709
                     /number=5
     exon            718396..718410
                     /number=6
     CDS             complement(join(718766..719353,719432..720023,
                     720110..720421,720486..720631))
                     /codon_start=1
                     /locus_tag="AO090009000270"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070342000187"
                     /protein_id="BAE54752.1"
                     /transl_table=1
                     /translation="MSLVQPQPPSEDIVKNPDSRDIREQFRDGRDDVESGSEPDIADI
                     ERIYRKLDFRIIPAFWVLYFLCAAVRSNVSLAQTMNIDTNHTIFDVLHVNDHQVSTAL
                     ALFYVCYVVFDLPSNLIMSRLSPHVWMSRIVISVGIIGTCMTAMKAAWSFYLLRLLLG
                     IVIAGMWPGMAYYLTLFYPPSRTGKRIGQYYTAAQLSAAAVGLVSAGFQKMDGVRGYV
                     GFQWMFLVWGVITIAVGILLLWWLPDRPTIPGEQPAKKKYLRWFPRSPPALTGRDAEI
                     HYHDLKRVYHRSAWTLQDLLRVFLDWRLWPLLIMYFGVVGVGIGVQSYATVIIKAINP
                     NLSGIDLSLLSAPIWLMDLAAILLVTPFSDRFHHHRAVFFSVPVLLQILGLLLTTYAG
                     TDTNSWPRYGGLLIVGFGLGPTVPITMTWTTEIFQPRHGEVGVAAASAVVSGLGNLGS
                     IVTTYALYNGWAEDSAAPGRLKFRKSNLVMVGILCGSILAAVLMQILVRVIDGRKSDE
                     NDPDKIVDGAARREAQQRGLDGLGSSVFFLFKKRGGN"
     exon            complement(718766..719353)
                     /number=1
     exon            complement(719432..720023)
                     /number=2
     exon            complement(720110..720421)
                     /number=3
     exon            complement(720486..720631)
                     /number=4
     CDS             join(723216..723273,723534..723614,723706..723795,
                     723851..724050)
                     /codon_start=1
                     /locus_tag="AO090009000272"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000185"
                     /protein_id="BAE54753.1"
                     /transl_table=1
                     /translation="MGGWGADDGAAGWENAGDIAVEAMVISHVTALSPARVWPASTAV
                     RKGTCRVCNQEGHPASQCPERPPDVCKNCKMEGHRTIDCKENRKFDLNNVPDKLPEEA
                     WAAMQKASEEKDLEDFREVCFSSTFLIRFICYRNSQKKRL"
     exon            723216..723273
                     /number=1
     exon            723534..723614
                     /number=2
     exon            723706..723795
                     /number=3
     exon            723851..724050
                     /number=4
     CDS             join(724104..724142,724202..724260,724285..724409,
                     724543..724719,724793..724853,724956..725032,
                     725213..725403)
                     /codon_start=1
                     /locus_tag="AO090009000273"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000184"
                     /protein_id="BAE54754.1"
                     /transl_table=1
                     /translation="MRQDNLNFYLIAMEKPVGDCISVINLQGKLDCNPKPQRANLKER
                     WPESVEENLERLEDAGIPYDREIPKCSNCGAPSDTVPVTALSLAAIDSLAVTAGTTFL
                     CSCMIVLLTVRRSSEHKAAECPNPRSAEGVEFGHFAKDCPQAPAPRTCRNCGSEDHIA
                     RDCDKPRDISTVTCRNCDEVGHTVKRCPSAVVNDTGMGDNSGLGDSGNQNATADDGWA
                     ADNTGMADHSEAQPAEEGGCEPGW"
     exon            724104..724142
                     /number=1
     exon            724202..724260
                     /number=2
     exon            724285..724409
                     /number=3
     exon            724543..724719
                     /number=4
     exon            724793..724853
                     /number=5
     exon            724956..725032
                     /number=6
     exon            725213..725403
                     /number=7
     CDS             join(730858..731077,731142..731330,731384..732323,
                     732378..732654)
                     /codon_start=1
                     /locus_tag="AO090009000275"
                     /note="predicted transporter (major facilitator
                     superfamily)"
                     /old_locus_tag="AO070342000182"
                     /protein_id="BAE54755.1"
                     /transl_table=1
                     /translation="MGRRYLGLQGNALQIAIGVIAGMDFLLFGYDQGVTGGLLTLQSF
                     IKYFPTIATSGAYYDSLTQAEQSTQSTRQGIVVAAYNLGCFAGSIPTIWVGNWLGRRK
                     TIFLGSFIMVIGALLQCTAYQLPQLIVGRLVTGFGNGMNTSTVPTWQSECCKSNHRGK
                     LVMIEGAMITCGITISYWIDFGLLFADPNEVAWRFPLAFQIFFAAIILAFVMFLPESP
                     RWLVLKGREDEAKEVLGALLGDGTDPTFLQTEFTAIKATVLEMAKGSFKDMFTMDEDR
                     HFHRTVLAYVNQMFQQISGINLITYYIPVVLEEQMGMTLINSRLIAACNGTEYFIASW
                     IAVFTIEKFGRRTLMLFGAAGMSISMIILAITASLKTSEANIACIVFLFVFNTFFAIG
                     WLGMTWLYPAEIVPLKIRAPANALATSSNWIFNFLVVMITPVAFDNIDYQTYIIFAVI
                     NAFIVPVVFFFYPETTRRSLEEMDRIFRKTKSIFSVVRIANEEPHMYGKHGELLHTLD
                     DVEDEAVRRASVLSHAHKELEKDSSENDSTNKA"
     exon            730858..731077
                     /number=1
     exon            731142..731330
                     /number=2
     exon            731384..732323
                     /number=3
     exon            732378..732654
                     /number=4
     CDS             join(733789..733936,734002..734120,734143..734762,
                     734818..734992)
                     /codon_start=1
                     /locus_tag="AO090009000276"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000181"
                     /protein_id="BAE54756.1"
                     /transl_table=1
                     /translation="MGDISFEPSNLQFIADALERDQVSSRKPSTLAPGSSELYSIHPL
                     STNTMIYSGEFSHWNFSRMIRRKLQSLGNDPDDSMVVFFCSMSSCTGDSHTAHDPFRA
                     TGLQSPSSIIASARKYFPPRHIADFLLETFLEYTLTNYYYFDETEFRQKLDYYYAEDR
                     YLDINDAGWICTLFMTFASGTQFAYMHASRPPYLQSMSGEDHLPDDTIGLALYRFSCR
                     LIPDLITTASVETVQAFLLFGVYTMPIDTSGLAYTYLGLAIKMAIQNGMHRQFGEEGL
                     DARTIELRNRLWWSAYALDRRISILHGRPVSVSPTEIDCEMPKDIPELRPPGRVTNLP
                     NLTATLQLTEQLAKVAPIM"
     exon            733789..733936
                     /number=1
     exon            734002..734120
                     /number=2
     exon            734143..734762
                     /number=3
     exon            734818..734992
                     /number=4
     CDS             735238..735930
                     /codon_start=1
                     /locus_tag="AO090009000277"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000180"
                     /protein_id="BAE54757.1"
                     /transl_table=1
                     /translation="MYMGRPLILAGTPSSSASVEGSSDSTVDAGAMLCFDCVQAALRI
                     VELCQLLQDTVGVARVSYTEFSSCRAALLAIIAQSLNTRTERLRGALTQGMGLIRRMC
                     VGLQSARSEVAVIEALERAARRLDSRAENEDTATGEQGVGYNQFRRWAMLWQSETPSN
                     VGDEPEPIGLENAQLPTGFFDGFFSSFPQELGAFASFPETGMQFGESLPTMLWPDDLS
                     LPAFPPNPDAPV"
     exon            735238..735930
                     /number=1
     CDS             complement(join(736800..737014,737210..737237,
                     737555..737635))
                     /codon_start=1
                     /locus_tag="AO090009000278"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000179"
                     /protein_id="BAE54758.1"
                     /transl_table=1
                     /translation="MVEILKHAQSSFYPISFFFEFSIRGIFIPAHKKHSSSYKSYVTS
                     AGHLGENCVQPTVLADMTHDMRLASEKTFRPVAALFAFDEEEEAIREENRCEVALGLI
                     SILGA"
     exon            complement(736800..737014)
                     /number=1
     exon            complement(737210..737237)
                     /number=2
     exon            complement(737555..737635)
                     /number=3
     tRNA            complement(737686..737812)
                     /locus_tag="AO090009t00011"
                     /note="pseudo-tRNA"
                     /note="tRNAscan-SE"
                     /pseudo
     CDS             complement(738254..738967)
                     /codon_start=1
                     /locus_tag="AO090009000279"
                     /note="predicted hydrolase (HAD superfamily)"
                     /old_locus_tag="AO070342000178"
                     /protein_id="BAE54759.1"
                     /transl_table=1
                     /translation="MSKLTNYRLLSFDVYGTLIDWETGVWNAIQPTLASNNAQITRSD
                     FLKLYQELEKSQQTKTPGMPYSQLLSTIHPQIASRLALDPPTAEESNRFGESVGEWPA
                     FPDTVEALKRLSKRYKLVVLSNVDRESFQKTNAGSLQGFPFDLVITAQDVGSYKPNLA
                     NFEYMLKAVKEHFGVEAEQVLQTAQSQFHDHHPAKKVGLKSSWIERPGALMGNLEDTV
                     YDWKFDTLGDMADAVEREL"
     exon            complement(738254..738967)
                     /number=1
     CDS             740207..740809
                     /codon_start=1
                     /locus_tag="AO090009000280"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000177"
                     /protein_id="BAE54760.1"
                     /transl_table=1
                     /translation="MSPEPATGRLRWSRSIIIKLTKEIRVGCDKRSQIFVVKCLNNSN
                     SPYVPIDQNMVAKIYDPLYHDFSFNDEDPFLGVDYDYTHECAAYMHLSNLQGSVIPRF
                     FGSYTLTINLGENSRHVRLILIEHIDGLSMDRLNPEMFPREERQEIMKQIINGESSLY
                     TKYVLHEDLCPRNIIIQRNTTLGVFIIDLGKSVIGRSQSI"
     exon            740207..740809
                     /number=1
     CDS             join(742407..742418,742520..742543,742605..742630,
                     742712..742753,742804..742858,742912..743367,
                     743417..743751,743800..744193)
                     /codon_start=1
                     /locus_tag="AO090009000281"
                     /note="beta tubulin"
                     /old_locus_tag="AO070342000176"
                     /protein_id="BAE54761.1"
                     /transl_table=1
                     /translation="MREIVHLQTGQCGNQVGTAFWQIISGEHGLDASGVYTGSNDQEL
                     ERMNVYFNEVGNQKYVPRAVLVDLEPGTMDAVRAGPFGQLFRPDNFVFGQSSAGNNWA
                     KGHYTEGAELVDSVVDVVRREAESCDCLQGFQITHSLGGGTGSGMGTLLISKIREEFP
                     DRMMATFSVAPSPKVSDTVVEPYNATLSVHQLVEHSDETFCIDNEALYDICMRTLKLA
                     SPSYGDLNHLVSAVMSGVTVSLRFPGQLNSDLRKLAVNMVPFPRLHFFMVGFAPLTSR
                     GAHSFRAVSVPELTQQMFDPRNMMAAANFHNGRFLTCSAIFRGKVSTKEVEDQMRGVQ
                     TKNSGYFVEWIPNNIQTTVCSVPPRGLKMASTFIGNSTSIQELFQRIGNQFSSMFRRK
                     AFLHWYTSEGMDEMEFTEAESNMNDLVSEYQQYQEASIDDEEDIGEYGEEEIEEQ"
     exon            742407..742418
                     /number=1
     exon            742520..742543
                     /number=2
     exon            742605..742630
                     /number=3
     exon            742712..742753
                     /number=4
     exon            742804..742858
                     /number=5
     exon            742912..743367
                     /number=6
     exon            743417..743751
                     /number=7
     exon            743800..744193
                     /number=8
     CDS             complement(join(747875..747947,748403..749122,
                     749178..749248,749303..749350,749429..749551))
                     /codon_start=1
                     /locus_tag="AO090009000282"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000175"
                     /protein_id="BAE54762.1"
                     /transl_table=1
                     /translation="MQTKTKRKRLSRGGRWTEEERLQLVRLRDRNKHLAWDQFQKIYF
                     PRRSYMALTKAYSIYPLLASLCSSLVDVFVGLCGSKRDNAMVCTPSLDHKQKQQLLNR
                     ALVPWQTNNTSNETTLPSKTNRPNKRPNIDERSVNERANKQARTAERDSTYVPEEDPE
                     SPDNGDIHEDGSVCPPPSSQNRIELLTSMQSSPMHGRTRSSVNSLAKLRAQTVATQPI
                     SQSSRNTTSLQTSASDKTASESPSQAKQTRGTERVMGSAHNNKPVPTTTAMQGISLPK
                     ANPGNSPSKASQPERASAQIECMSFGTAHDLFASLVKTIADYRKATKKRKGLIVTVAE
                     RIASSAYLTI"
     exon            complement(747875..747947)
                     /number=1
     exon            complement(748403..749122)
                     /number=2
     exon            complement(749178..749248)
                     /number=3
     exon            complement(749303..749350)
                     /number=4
     exon            complement(749429..749551)
                     /number=5
     CDS             complement(join(751241..751389,751444..751730,
                     751855..752003))
                     /codon_start=1
                     /locus_tag="AO090009000284"
                     /note="uncharacterized membrane protein NPD008/CGI-148"
                     /old_locus_tag="AO070342000173"
                     /protein_id="BAE54763.1"
                     /transl_table=1
                     /translation="MEQQSLNPEPQQGDLNWRLSAHPITLLCFLGFRTSALLMYLFGV
                     LFIKNFILVFIITLLLLAADFYYLKNIAGRRLVGLRWWNEVNVASGDSHWVFESSDPT
                     TRRIAATDKRFFWLSLYVTPALWVGLAILAIIRLSSVIWLSLVAIALILTITNTLAFS
                     RCDRFSQASTFANRALTGGIVNNIAGGLLGRLFK"
     exon            complement(751241..751389)
                     /number=1
     exon            complement(751444..751730)
                     /number=2
     exon            complement(751855..752003)
                     /number=3
     CDS             join(752562..752601,752721..752941,753002..753712)
                     /codon_start=1
                     /locus_tag="AO090009000285"
                     /note="citrate lyase beta subunit"
                     /old_locus_tag="AO070342000172"
                     /protein_id="BAE54764.1"
                     /transl_table=1
                     /translation="MASRNALRRALLYIPGSSQRFIDKSRTLTADCVAYDLEDSVTPH
                     KKAEARSLVRRALDQPAPSGIRERAVRINSVDSGLALADLTEVLQSPNLSTVVIPKVN
                     SASDLTFVNDVITHTLSQQPQSQDASSRPPISLLALVESAKSLTNLTQICASTPLLQG
                     LIFAAEDFALDLSLTRTPDLTEFLFARSMIATAARAANLPSTIDLVCTTYKSTKGDGS
                     PPAVLEEECRGGRQLGFNGKQCIHPSQVPTVQQIFGPDSDEVQWAVRVTIADDKAAAA
                     GRGAWTLDGKMIDVPVAEKARAIVKKAEACGFNVEELREKWRDQEPE"
     exon            752562..752601
                     /number=1
     exon            752721..752941
                     /number=2
     exon            753002..753712
                     /number=3
     CDS             complement(join(754162..754726,754779..755504,
                     755576..756504))
                     /codon_start=1
                     /locus_tag="AO090009000286"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000171"
                     /protein_id="BAE54765.1"
                     /transl_table=1
                     /translation="MISEELLEDCLQSLQGQDFDEEEQAEKAEDFLREKTSLSGSSLE
                     NAVLDVLWRHRNRTLPGSSPPPPRHTVIRRSSPAPWQMGRSSTPLSPHSNLGTSPGST
                     SWLPNSRGGFSRPALSSTVSPFTSPRPSPRLALAQPIPHSPNLNAYEFSDQTQVSDFY
                     GDFGSDSNVDWLVADDANSTTSSVGTLSAMGLSATAPEFVPDMSPHDILRTVLGDKRT
                     NDEIEAALEANGYDLGATIASLSQGHDGDGFVHHADGTRVVVGKSMAMEQAKPGSSPG
                     QIRSPVVCKYWLSTGQCLRADCRFSHDLTNHLCKYWVMGNCLAGDGCPFSHDPSALVA
                     NLSVTDGSHQGSTGPQFHIDSASEAFPPLQSSLGVGDQWAGQYIGKYPAHLSGLLGGK
                     GVPQSMQLVTGKRNGSSTHGSRPHSRPGSRHQNRELNPAAPSVDDPDAFPTLAAVSAK
                     NKKHHGKRGAHNREINSNKDSVPTSLADVVRMSPSPAVGKGKTTSRNKEGAKGRENSA
                     ATQSIPPPQNIPWLETGSRANQQYIKYRTEAIRHGTVRNKFLQSAAQAWNRNDARAAK
                     ALSLRGQAENEAMRKCHREAARQLYEERNKHIVNAGLDDSLEELYVDLHGLHPEEAIE
                     YLEKILLKHANEGRRVIYAITGTGHHSKNGKDKIGKAVKAWLNEWKYLFREFSVPGER
                     GGYVGGILGIDPTSYDRSLAKSLEDSADANAGAGVNTPVLTMGKIQLLKREDLEVKH"
     exon            complement(754162..754726)
                     /number=1
     exon            complement(754779..755504)
                     /number=2
     exon            complement(755576..756504)
                     /number=3
     CDS             join(758340..758803,758858..759015,759049..759094,
                     759151..759205)
                     /codon_start=1
                     /locus_tag="AO090009000287"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000170"
                     /protein_id="BAE54766.1"
                     /transl_table=1
                     /translation="MPADYTSTARALSLPTSPSESLSPADNDSYPPWSHLASGRSNPA
                     HPSERPTLWKQVTHRLNETSQRMMAIWRRLSFWQKVGAAAAALLANLLGIGFLVFTGK
                     VFIWLGPVAEQWEQSVVAYTVLWLCVFFVSFPPLVGWSTFGTISGYIFGVWKGWFLYA
                     SATVLGSTCSFVVSRTILSKFVNRMMERDKRFAALALTLKYDGLKLLLCNGAVSTFPT
                     VQPLMQPDPFTFRERRGDERRF"
     exon            758340..758803
                     /number=1
     exon            758858..759015
                     /number=2
     exon            759049..759094
                     /number=3
     exon            759151..759205
                     /number=4
     CDS             763207..766611
                     /codon_start=1
                     /locus_tag="AO090009000288"
                     /note="amine oxidase"
                     /old_locus_tag="AO070342000169"
                     /protein_id="BAE54767.1"
                     /transl_table=1
                     /translation="MAPLASNMGAAASMKTHGLNGQSYEITTHLDQYIPTNISFNGSG
                     HVALLPSNQTLPKSSLQLNASVMKAHASHLDNNFNQASVTNLYSVPNSNSNPGLRVGR
                     TSLEGVDSSSRSTDYLSQDAHATTAHGRSSDSITTTSFLSQPSQTKPTPSITNINKLS
                     SSSLVTDTKNADSVNGLPKYRPRSSIPSRLPAAVYAQQCVSAAYASRLNPYALHIKEQ
                     EALQDYLCHLHVTVYLNIRNGILRLWTRNPMVSVTKEEALGCAKDYRWMNLASFAYEW
                     LVRNGYINFGCVEIPMPFVTPKKGRRREGPVVVVIGAGMSGLGCARHLEGLFQHYRDA
                     STTPRVILLEGRRRIGGRIYSHPLRSLQTSKLGPGLVPKAEMGAHIVVGFDRGNPLDP
                     IIRSQLALPYHLLRDISTIYDIDGSPVDEIQDAMDERLYDDVLDRSGFYRHKSIVVPT
                     AEGERELIDSGRDLSTSDGVTVRQYEEARASGTIGLLLPTKRVRRGVGHKTADIKAPG
                     ASGADLARSEEQPAALTCQLNGWRLNDGIPANATLNLDPVAKISSSQTLGAALDEGIR
                     QYQRMLPLSPKDMRLINWHFANLEYANATNVNRLSLSGWDQDIGNEFEGEHSQVVGGY
                     QQVPYGLFSLPTKLDVRTNKIVSKILYDPSGMGKQNTVVHCEDGESFVADKVVFTGSL
                     GVLKHQSIQFEPPLPEWKCGAINRLGFGVMNKVILVFDEPFWDTERDMFGLLREPTNR
                     NSTIQEDYATNRGRFYLFWNCLKTTGLPVLIALMAGDAALQAECTPDDQIIGEVTSQL
                     RNIFKHTVVPDPLETIITRWKSDKFTRGSYSYVAAQALPGDYDLMAKPIGNLHFAGEA
                     TCGTHPATVHGAYLSGLRAGAEVIESILGPIALPNPLVPEKGKAELSTPTTAGQKRKE
                     PHMSVASSTGNTPTNPADSTSPTSARQQAYEQAMWTSVQSEIGPPMPRPARTGLNPFL
                     LYQKDYWGICRAQCDEARRAATNDPNAKAARDEIRHELGLMWRRASEEEKRPYIEQTE
                     VNRQTNAEMWSRWKQQIAEWEQKAGELKTKWYAANPFASWGIHSADTAVPTNHLSTGA
                     GGTTSSISSLGQHINNSRDQTQGGTIAATVHPQTNGVQVNGSLHTS"
     exon            763207..766611
                     /number=1
     CDS             complement(join(767045..767184,767245..768144,
                     768220..768241))
                     /codon_start=1
                     /locus_tag="AO090009000289"
                     /note="thioredoxin reductase"
                     /old_locus_tag="AO070342000168"
                     /protein_id="BAE54768.1"
                     /transl_table=1
                     /translation="MVHSKVVIIGSGPAAHTAAIYLSRAELKPVLYEGMLANGTAAGG
                     QLTTTTDIENFPGFPDGIGGTELMENMRKQSVRFGTEVITETISRVDFSQRPFKLWTE
                     WNDGPDNEPARTADAIIIATGANARRLDLPGETKYWQNGISACAVCDGAVPIFRNKPL
                     YVIGGGDSAAEEAMFLAKYGSSVTVLVRRDKLRASKAMANRLLSHPKVTVRFNTVATQ
                     VLGDEKPMGLMTHLRVKNTVTGEEETVDANGLFYAVGHDPATALVKGKIDLDDEGYII
                     TKPGTSYTSLEGVFACGDVQDKRYRQAITSAGSGCIAALEAEKFIAESESSGEEAPVN
                     EVKQDPQGNTAEYKSNPLL"
     exon            complement(767045..767184)
                     /number=1
     exon            complement(767245..768144)
                     /number=2
     exon            complement(768220..768241)
                     /number=3
     CDS             complement(join(769088..769869,769927..770249,
                     770279..770550,770632..771783))
                     /codon_start=1
                     /locus_tag="AO090009000290"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000167"
                     /protein_id="BAE54769.1"
                     /transl_table=1
                     /translation="MDLLPPPPTELNGEDAKLAPEYVDPTAGLTKSGRDGRPLYVKPV
                     DHTEEELDLSCIENDDGIYEMSPSIIDYSSEGIKQPIPANRVHSMDGETAGFYKEVAG
                     ARLYADPGRDVTFWRFNIEIELGNTQQRIAYRLNQGPALGFWVPARGQTMNIMYHTCN
                     GFTPGVDSNKLCGPDPLWRDVLNEHQTRPFHVMVGGGDQIFNDKITAESRFFQEWVKM
                     KDIHEKYDTPLNMEFKAELENSFLEHCSRWFSQGLYSLANSQIPMVNLWNDHEIIEGF
                     GSYPDEFMSTPVISGLGNIAFKYYLLFQHHSVPEETEADEPSWLLGALPGPYISHRSR
                     NLFMSLGGGVSLLGLDCRTERMVRPQYLFSSRKAVLIIYHRMTKYSANRLLHILGWYV
                     TGAITAILSLLTFSQAMVKNILNSRKSLGKAGLFGGFVNKSGSKVEIFDDHWTAKHHK
                     SERQYLIEDLQDLAADKSVRVTILRAELTSIFSSGDVHLAAIGQFYSNPRLNLPKDKD
                     YRYMPNIISSAIADMPETEMVSDTLNKRNRVHHLDTNTDEDMIPIFTQDVNNKPRNNK
                     RLLPRRNWCSIRAYQPGFTPPTTPESESSPPVEEPRPGKLQRTLSLTRGDRPQGSGGL
                     LRRLSGRGRPPTKDFNLGGNPVGRRMSMDGPFPPAETGDSYFPPPPDSRPAPFLRRPT
                     NLSQKASKKAAKQGDDGVGAFVNLEGGLAISLNMELNPKDPSGITTPYKLLVPMLRYE
                     GNEYDPPAAPVAKGWKRWLSVRRSRREKQNVEDTEAEEGFSDEEDEDEHDQYENHGRS
                     AGREHEYIAGRDAPPETIVPVANPGELEYDGVAETSRRRKWFGR"
     exon            complement(769088..769869)
                     /number=1
     exon            complement(769927..770249)
                     /number=2
     exon            complement(770279..770550)
                     /number=3
     exon            complement(770632..771783)
                     /number=4
     CDS             join(775422..777166,777224..777989)
                     /codon_start=1
                     /locus_tag="AO090009000291"
                     /note="subtilisin-like proprotein convertase"
                     /old_locus_tag="AO070342000166"
                     /protein_id="BAE54770.1"
                     /transl_table=1
                     /translation="MRLSESATVAFGLFCAATASAHPRRSYETRDFFALHLDDSTSPD
                     EIAQRLGARHEGQVGELTQHHTFSIPKENGADLDALLEHARIRKRSSRAEGRGMTLDK
                     ERDLSGILWSQKLAPKQRLVKRAPPTNVASRGSVKEEDPVAAQAQKRIASSLGITDPI
                     FGGQWHLYNTVQVGHDLNVSDVWLEGITGKGVITAVVDDGLDMYSNDLKPNYFAEGSY
                     DFNDHVPEPRPRLGDDRHGTRCAGEIGAARNDVCGVGVAYDSQVAGIRILSAPIDDAD
                     EAAAINYGFQRNDIYSCSWGPPDDGATMEAPGILIKRAMVNGIQNGRGGKGSIFVFAA
                     GNGAGYDDNCNFDGYTNSIYSITVGAIDREGKHPSYSESCSAQLVVAYSSGSSDAIHT
                     TDVGTDKCYSLHGGTSAAGPLAAGTIALALSARPELTWRDAQYLMIETAVPVHEDDGS
                     WQTTKMGKKFSHDWGFGKVDAYSLVQLAKTWELVKPQAWFHSPWLRVKHEIPQGDQGL
                     ASSYEITKDMMYQANIEKLEHVTVTMNVNHTRRGDISVELRSPEGIVSHLSTARRSDN
                     AKAGYEDWTFMTVAHWGESGVGKWTVIVKDTNVNDHVGEFIDWRLNLWGLSIDGSSQP
                     LHPMPDEHDDDHSIEDAIVVTTSVDPLPTKTEAPPVPTDPVDRPVNAKPSAQPTTPSE
                     APAQETSEAPTPTKPSSTESPSTTTSADSFLPSFFPTFGASKRTQAWIYAAISSIIVF
                     CIGLGVYFHVQRRKRLRNDPRDDYDFEMIEDEDETQAMNGRSGRTQRRGGELYNAFAG
                     ESDEEPLFSDDEDEPYRDHALSEDRERRGSTSGDHARS"
     exon            775422..777166
                     /number=1
     exon            777224..777989
                     /number=2
     CDS             join(778483..778776,778856..780052)
                     /codon_start=1
                     /locus_tag="AO090009000292"
                     /note="membrane coat complex Retromer, subunit VPS5/SNX1,
                     Sorting nexins, and related PX domain-containing proteins"
                     /old_locus_tag="AO070342000165"
                     /protein_id="BAE54771.1"
                     /transl_table=1
                     /translation="MDQHDDFDNVSWRHEPESDISRPTTSGTDAEESPATSHDANGKR
                     RMSSAHENPQAGPLADAVDLAGIGDGVLECRVDSPLKENDGTKDAYISYLVTTQTDFK
                     SFQRSEFAVRRRFTDFFFLYKTLYREYPACAVPPLPDKHKMEYVRGDRFGPEFTTRRA
                     WSLHRFLKRLALHPVLRRAPLLAIFLESPDWNAHMRLHTSRTSTNPSDNSGAPGIFDN
                     FTDTFVNAFTKVHKPDRRFIEVREKADKLDEDLNHVEKIVARVARRESDLETDYNELA
                     TQFRKLVSLEPNVEVPLQVFAASVEETGRGLKGLKDHTDQNYLGSLRDMEAYILSLKA
                     LLKTREQKQLDFEALVDYRNKAVSERDSLATNPSSYYASNPLTSSPASFIRSKMEDMR
                     GVDHEQSRRERVRKLELRIDELTREVESAKTTSEMFDEEVVREVADFERIKAVEFRDT
                     LGALAEKHIDFYQGVLNTWERFVAEMEGDLDENHEGSAPQESSTTR"
     exon            778483..778776
                     /number=1
     exon            778856..780052
                     /number=2
     CDS             complement(join(780316..780438,780552..780758))
                     /codon_start=1
                     /locus_tag="AO090009000293"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000164"
                     /protein_id="BAE54772.1"
                     /transl_table=1
                     /translation="MTSSTSTTTTKTTTPPAKKSKNLPAESALDLSANFANNRKGAVG
                     YDHEVYLQLTAGRNAEKTPNQVYREERVRQRTTRALDPAILDPQGEPGPVDFECAEHE
                     GVKERLR"
     exon            complement(780316..780438)
                     /number=1
     exon            complement(780552..780758)
                     /number=2
     CDS             join(783273..783444,783517..784877)
                     /codon_start=1
                     /locus_tag="AO090009000294"
                     /note="monooxygenase involved in coenzyme Q (ubiquinone)
                     biosynthesis"
                     /old_locus_tag="AO070342000163"
                     /protein_id="BAE54773.1"
                     /transl_table=1
                     /translation="MRPFTRSALRPYVCPSCRSGRLVGRRRFGSKPDQAPDVYDVVCV
                     GGGPAGLGLLAALRASPLTSKLRVALIETQDLQKARAWSLDSQHFSNRVSSLTPSSVS
                     FLKKIGAWEHLDTDRAQEYQEMQVWDGETDSRITFDWSADTSPFENLPTVATMTENAN
                     LVRGLLSRIAASGDENISIFSNTTVSSIENGTDHPDGPDLSAWPVLSLAPNGTAQSQL
                     PTRIAARLLVGADGINSPVRRFADIATEGWDYNRHGVVATLSLADPDQVSFPIGTRTA
                     YQRFLPSLGGPVALLPLPNNHATLVWSTTVENAAYLKSLSPKAFIAMVNAAFRLSMTD
                     LKYMMRMERPANSASDYEDLHESELTWRLQHTPQASQVPPMVNGVQEGSVASFPLRFR
                     HASTYISPRVALVGDAAHVIHPLAGQGLNLGMGDVASLSKTIEYAVDHGMDIGDILSL
                     EKYTAERWAVNAKIGGVCDMLHKLYNVPGHGPVAWGRSLGLEIIDRLPFVKGFLMKNA
                     EG"
     exon            783273..783444
                     /number=1
     exon            783517..784877
                     /number=2
     CDS             complement(join(785160..785447,785515..785937,
                     785992..786849))
                     /codon_start=1
                     /locus_tag="AO090009000295"
                     /note="Histidyl-tRNA synthetase"
                     /old_locus_tag="AO070342000162"
                     /protein_id="BAE54774.1"
                     /transl_table=1
                     /translation="MGKEKNNFNLKTPKGTKDWSGSDALLRDRIFTTIADVFKRHGGT
                     ALDTPVFELREILAGKYGEDSKLIYDLQDQGGEICSLRYDLTVPFARWLAMNPDVRSM
                     KRYHIAKVYRRDQPAVSKGRMREFYQCDFDVAGTFDPMVPDAEVLKIVTEVFEELGWQ
                     GRYSIKINHRKILDGVFEVCGVPADKIRPISSAVDKLDKMPWADVRKEMVEEKGLDGA
                     VADKIETYVVKKGTRDLLETLLKDEALLANASAKAGLEDMGLLMDYLEAFGVLDRISF
                     DMSLARGLDYYTGVIYEVVTEGSAPAVSSSAPEAEKLQKSGKKSKSKGNADDDDRSND
                     PTLGVGSVAAGGRYDNLVGMFLPKAQIPCVGVSFGVDRIFSITKARLEREKSAEALRS
                     SEVDAFVMAFGGKGFTGMLKERMNVCQTLWNAGVKAEFSYKVKPKLPQQFKAAEQGGV
                     PFAVILGEDELAEGKVRIKEMGLEDGHPEKEGVLVDLASLPAEVKARVARKRDQASAV
                     TQQLEGLNVNAPTN"
     exon            complement(785160..785447)
                     /number=1
     exon            complement(785515..785937)
                     /number=2
     exon            complement(785992..786849)
                     /number=3
     CDS             complement(join(787499..791332,791388..791478,
                     791542..791597))
                     /codon_start=1
                     /locus_tag="AO090009000296"
                     /note="DNA repair protein RAD50, ABC-type ATPase/SMC
                     superfamily"
                     /old_locus_tag="AO070342000161"
                     /protein_id="BAE54775.1"
                     /transl_table=1
                     /translation="MNLIYCPILAKIDKLSILGVRSFDNTRSETIQFHTPLTLIVGYN
                     GSGKTTIIECLKYATTGDLPPNSKGGAFIHDPKLCGEKEVLAQVKLSFKGTSGAKMVS
                     TRSLQLSVKKTTRQQKTLEGQLLMIKDGERTAISSRVAELDQIMPQYLGVSKAILDSV
                     IFCHQDESLWPMSEPSVLKKKFDEIFEAMKYTKAIDNIKSLRKKQNEELAKYKIMEQH
                     AKEDKEKADRAEKRSIKLQQEIETLREETQQLSLEMRRVAELADKAWRESESYSQVLG
                     TLEGKRIEAKSIQSTIDNLKRHLVELDDSDEWLQSNLEQFESKQLQYEQQEEARKENY
                     MEIKEQIERTRQKLGVKQAEYGKFENDKANFERQVERRRRMTKEIARSNNIRGFDNIQ
                     DQNDVDEFMRKVRKLLKDQNQTLDRVKREAQGELREVQTALNDIAQQKSALQETKNAA
                     KRQIAANDKESTTYQGKLNEINVDEGVQAALEANIEDIQSHLDQAKGRAKSASWDKEI
                     HDINSEIRGLEDESSRLNSELIDATKRAGDLARLDHLKKELKERERSLETMKGAHGER
                     LSKFVGQDWKPDTLEQEFQHVLEEESKQVSRAENERDGVSRELEQVEFRLKNTKKVLG
                     QRQKALKECIEEIREAINDEPEEFPEVLKQRQAQLDIARKDAEQYAGIGEYMATCLET
                     VKQSKVCRLCHRGFKSDAELQTFRNKLENLVKKAKRDADDEDVKNLEEDLEAARSAST
                     SYDTWSRFQQTEIPELEKEEEQYVLQRDELLNQLEDRDKIVSEKTEKKRDVEALAKTV
                     NTIVRYDGEIKSIRSQIQDLSSKQQDTTSARTLEDIQEEIAAIGEKSRALKKSLSKLT
                     HEKEQTQTEINNLELQLRDVKSNLDNAKFQLERKSDLLARIEEYKNLNNQQREAIAKA
                     DRDIEDLTPELLKVQAKYDDISQRAEAREREMQQTISQMSESVHQLELANEEIDAYNE
                     RGGPTQLERSKRELENIEKQIGQLEAEQANITKEINKISSQLKDSENTKRQYADNLTY
                     RQATRALDEVTQEIEQLAAQNAEVDRSRFKDESERRTREHNALAAKQAGRMGEMKSKD
                     DQLMQLLADWNTDYKDAASKYKEAHIKVETTKAAVDDLARYGGALDKAIMKYHGLKME
                     EINAIVGELWQKTYRGTDVDTILIRSDNENAKGNRSYNYRVCMVKQGAEMDMRGRCSA
                     GQKVLASIIIRLALAECFGVNCGLIALDEPTTNLDRDNIRSLAESLHDIIRTRQAQSN
                     FQLIVITHDEEFLRYMQCGDFSDYYYRVSRNEKQKSIIERQSIAEVGRIPNRFFDFHA
                     NGLQVM"
     exon            complement(787499..791332)
                     /number=1
     exon            complement(791388..791478)
                     /number=2
     exon            complement(791542..791597)
                     /number=3
     CDS             join(791957..791982,792009..793509)
                     /codon_start=1
                     /locus_tag="AO090009000297"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000160"
                     /protein_id="BAE54776.1"
                     /transl_table=1
                     /translation="MIAARHVLRKWWLSHIWPKDFSWLVPIESSSVPGPPECPALDEK
                     FQSCQTVDNISLARRVGPPALLYSTGIDSSIAALVARVSCIPTGGHSSCPREYFLSAK
                     TSLVSLVPTMDWTAAEHESGVTQNHQHRMQTEDHDSFAGEIQKLPSPPAGNTGGQNPS
                     DPADEQGWPQRVLNEMKDMLLLLSSDGKILYASPSCKSITGYDANQLQQNALERFIHN
                     DDKTTFAEEMNECITTTRPVHCHFRFRKKDNSSNTSCLLEAHGHPHMKTSEPNDSPEN
                     HNEDCIGVFLLCRPYPTRGSQLLDSFLEHKIENVRLNQRIAQLREEEEEDLASGQQLY
                     AGDSTGDSGFRHNSHSGRSNSNQSSFRDTTGSGEENESSDTLTNDDPDSRSYLENAAD
                     ELGQTEDMSHIEGIEMLTGLHYGDGERSQGLSTGVRQGRLIRYDMESAKLDQQARVIQ
                     DSDRKKRQKGEYMCTDCGTSDSPEWRKGPEGPKTLCNACGCKSAVQYTLFSYSSEMSS
                     "
     exon            791957..791982
                     /number=1
     exon            792009..793509
                     /number=2
     CDS             complement(join(794136..794520,794589..794868,
                     794959..795055))
                     /codon_start=1
                     /locus_tag="AO090009000298"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000159"
                     /protein_id="BAE54777.1"
                     /transl_table=1
                     /translation="MEQIMASTVLPMRFSMLLRTIDPIKFLWSGALFLGVLSIFILIT
                     KLPVHILRIFYPPVSVFVHVGLFIVYIVSASYQAGSDKSDPKHLQSGPPWYITKSCSV
                     ASNKDNIGYCQQAKALFGFTIIIIVLYFVEIIVSVHSCFVTKEEKAERDELREEKRTM
                     KEYEDMVLRTPRTFPMMSPALPSGGTTQMMPTMSSRSPEFSTFGHGSSDLPLRDHFST
                     PNPRPPAQQESSETLAPGNQPQMYFPPPPKKAAKV"
     exon            complement(794136..794520)
                     /number=1
     exon            complement(794589..794868)
                     /number=2
     exon            complement(794959..795055)
                     /number=3
     CDS             join(796244..796534,796704..797101,797180..797663)
                     /codon_start=1
                     /locus_tag="AO090009000299"
                     /note="NADH-cytochrome b-5 reductase"
                     /old_locus_tag="AO070342000158"
                     /protein_id="BAE54778.1"
                     /transl_table=1
                     /translation="MRPLQLLRCRQLHKPPPNLNLLHKRRPSVIRHDMSSLASKKTSV
                     PHKLRTAAEPRQNILYNVRLSHIEEVNPTVRLLHLAIPPRVQAPEEPNQSDEESDEPQ
                     PFTFAPGQWLDVHIPSISDAGGFSITSTPADAEALPSLQPTAESLAVEDEETGLPPVD
                     PRGRDPYVELAVQKALSNPASAWLWKPKDEILGKELCIRVGGSFVWPPPSGIDLEKVK
                     NVVLIAGGVGINPLISILSHLNNNADETPASHHPFNIHFLYSTKLPEATPQEAATSPE
                     SILDQILFLSRLRQIIHSQSQSHRLRITLDLFITSLRDTSSPLLLNQPDDLSIHSRRV
                     SQDDLRTALTGPNGDIKPEETVCYMCGPPAMTDEFVAALRGLMGDGSDRVFFEKWW"
     exon            796244..796534
                     /number=1
     exon            796704..797101
                     /number=2
     exon            797180..797663
                     /number=3
     CDS             complement(join(798102..798357,798415..799799,
                     799869..799883))
                     /codon_start=1
                     /locus_tag="AO090009000300"
                     /note="predicted DNA repair exonuclease SIA1"
                     /old_locus_tag="AO070342000157"
                     /protein_id="BAE54779.1"
                     /transl_table=1
                     /translation="MTRRFVRAGVQLAIFALCILVFVVTLDNRFRVLPAAIHGHLPSH
                     YSGLVVTDVTIKTCSHINPFSKCKPTSQSWTQVDKDLYLRTGWTSTAFVQFERKKEED
                     LLPTDKVVIDLKISRLVPETTEDTKDGEKDEETWEPRPGGIWLRRTAKRHASDSQTAI
                     TLVDVLFGADAVDPRIGWEVRDTPLLLDSRTEELEARLSIQRGDPQKMKKPVPRINEH
                     GRFKIMQLADLHLSTGLGLCRDPIPAEPVPGQKCEADPRTLEFVERLLDEEKPDMVVL
                     TGDQVNGETSKDAQSALFKSVKLLVDRKIPYAAIFGNHDDEGNLNRSELMAILEQLPY
                     SVSSAGPEDIDGVGNYIVEVLGRGNSAHSALTLYLLDSHSYSPDERQFRGYDWIKPSQ
                     IRWFQNTAQGLKRKHHEYTYMHMNMAFIHIPLPEYRDPNNLFIGNWDEPPTAPGFNSG
                     FKDALEEEGILFVSCGHDHVNDYCMLNNNKDEKPSLWMCYGGGVGFGGYGGYKDYVRR
                     VRFFDFDMNAGRVMTYKRLEYGETEAKIDEQMIVDGGAVRGLS"
     exon            complement(798102..798357)
                     /number=1
     exon            complement(798415..799799)
                     /number=2
     exon            complement(799869..799883)
                     /number=3
     CDS             complement(join(800325..800482,800551..801002,
                     801065..801141,801198..801275))
                     /codon_start=1
                     /locus_tag="AO090009000301"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000156"
                     /protein_id="BAE54780.1"
                     /transl_table=1
                     /translation="MKTNPKIIFFTDFDGTITLQDSNDFLTDNLGYGQEKRRQGNLDV
                     LENKVSFRDAFRDMLDSVKVPFNECIEQLKKNMQLDPYFVEFYHWSKENNVPIVVLSS
                     GMTPVISALFETLLGHKPDDHLVIVANDVESRDGKDINTEGGWQIKYHDDSHFGHDKS
                     LEIKPYAALPDNVRPTLLYAGDGVSDLSAASETDLLFAKKGRDLVTYCERQGTPFTIF
                     ESWSSILATTKDILSGKVTIKKVAQEGLETIQKEGN"
     exon            complement(800325..800482)
                     /number=1
     exon            complement(800551..801002)
                     /number=2
     exon            complement(801065..801141)
                     /number=3
     exon            complement(801198..801275)
                     /number=4
     CDS             join(801887..801992,802062..802360,802428..803423)
                     /codon_start=1
                     /locus_tag="AO090009000302"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000155"
                     /protein_id="BAE54781.1"
                     /transl_table=1
                     /translation="MARMLQSLRRALGLTSPKPVTAFRRSIDTDFSFFREGDRAIVHG
                     KTPSLTKPLRQGQKTDLRRGYLEHNNIIGRRVRERIQAQKGQHNLNCPKGHERKSRTL
                     PNIASHPSTGPEYRLTLPTLDEYVALTPRLVTPIYAADANLIVSLLDIHVAPPAEGEE
                     RTQQPLEILESGTGHGSLTLHLARAIQAANSTPPPLPAQSQIQYLQGRPIRPDEEPEE
                     KNKESAPTNETPIDPAQQQWDAWRTQRRAIIHTVDVSPKFSAHAEKTVRGFRRGLYAG
                     NVDFYVGHVENWIAEQKRLRTPTSLLPLTQKTADPFLSYAILDMPASHQRIPHVAPIL
                     KENGVLAVFMPSITQIGDCVNLIRRQKLPFILEKVVELGPGISSGRQWDVRFAVKKSR
                     ADPSSWNESSEPSEGAVQQDRETLDEGSVESVSVPEEAPKEEDSVLVCRPKVGSRIVG
                     GGFVGIWRRIEDSQKQ"
     exon            801887..801992
                     /number=1
     exon            802062..802360
                     /number=2
     exon            802428..803423
                     /number=3
     CDS             complement(join(804137..805314,805380..806442))
                     /codon_start=1
                     /locus_tag="AO090009000303"
                     /note="glucose-repressible alcohol dehydrogenase
                     transcriptional effector CCR4 and related proteins"
                     /old_locus_tag="AO070342000154"
                     /protein_id="BAE54782.1"
                     /transl_table=1
                     /translation="MADGTYRFQQPGAGQFFFQTQQQQPSHQRHLVRNGTNSPTGRLK
                     FSHDTPSPSRSPPLGQAAALNPFTMYSQTHQGQHVLMNGGQAHQRFGMQMPKFQSQSH
                     HPHPAQQAHHHTHHNQASHNINHQHNFSSGALAAATPHFTPSHMQNGAHANVDEDIDE
                     SMNEHWQQQLQLAAESRQASSPHYYARAVAQQTKGIQIAPSQPEPQENGGDVKNGLTK
                     VKASPRQGWYALDFGGQGLRALSTSLFSYDFLKELYLNHNKLKALPQTIGQLRKLEHL
                     DLSGNDLTELPEEIGMLTSLKKLYLFDNNIRTLPYEMGYLYRLDTLGIEGNPLNDILK
                     SQIMKEGTRALIKYLREEMPENPPPPDRDWVILDETAGTSTEKITVLSYNALCDSSAT
                     QSHFGYTPSRALSWEFRRDVILSELRSHDSDIVCLQEVDQGSYNGYFREQLAYNGYKG
                     VYWPRGRAMGMQEEEAKSVDGCATFFKGTKFILLDKQMINFGQTAVRRPDAKGQDDIY
                     NRLWQKDHIAVVVFLENRLTGSRFIVVNAHLYWDPAFKDVKLIQTAILMEEITKLSET
                     YAKWPACTDKTAFRFSEAEGGEAQTPPEPAPSMEYSSGDQIPLFMCGDFNSSPGSAAY
                     NLIANGRLTEEHPDLEKRLYGNLSRVGMTHPFKLKSAYNSIGELSFTNYTPDFKDILD
                     YIWFTSNTLHVSALLGEVDKDYLQKVPGFPNFHFPSDHIALFAEFVVKGKKGKVVEAD
                     FGPQRN"
     exon            complement(804137..805314)
                     /number=1
     exon            complement(805380..806442)
                     /number=2
     CDS             809738..810952
                     /codon_start=1
                     /locus_tag="AO090009000304"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000153"
                     /protein_id="BAE54783.1"
                     /transl_table=1
                     /translation="MDMMSVSTAAFAPAAASGSDLHSILSSTGPTRAATSTSSLNSLT
                     DYTNYPLIRQGERTYLRDPESLYPLPCDLPEIHRQTLRSLMLLRVFGGPFCNPYFADR
                     PPQRVLEIACGSGLWSSLSHDYFARRGARNVAFHGIDLVSLAPDLRKKGVNWQFKRHD
                     LRKPRLPFPDDYFDFVFIKDASMCPSSPAQQASGLSEPLRVLKPGGVLEIWDSDSVFR
                     SLLPNPAPARKLASRELEIADATATYTFSPATPFTRVQNKFLQDYNSWAEKAFDRRKL
                     TALPCSTIGLSFNSEVDVLEKVDSRRIAIPLGDLRWERESKDSSGGARKQLTADQMSI
                     RRTALLTVIQMIEGMEPILMEASGKSRDEWDRWWTAMMADVFQKGGLANGECLEVSAW
                     WGQKKNPSTKNS"
     exon            809738..810952
                     /number=1
     CDS             join(813276..813510,813562..814245,814479..814567)
                     /codon_start=1
                     /locus_tag="AO090009000305"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000152"
                     /protein_id="BAE54784.1"
                     /transl_table=1
                     /translation="MRSIVLSALAAGFAQAYTVTNVGLFMFKNIDPLVVPGKYTSHMH
                     SFFGSDAITANTKTSEELQKGCSTAKNPNDYSTYWVPTLYHVDGSNYTAVPIFRFSAY
                     YVDVNSAEIAIPQNMKLLAGNATATSQDGVDGNAGIQWFCDSQAGEEKDDAAFPTETC
                     KYHLQTLLLFPDCANPDTLEYAYSANPDWVDGYGKNRCPIGMKRIPRLRFSIRYDLRN
                     ILPDGWSGSPPLELACGSSYCSHGDFINGWLPEAADNMVKDASSNDREYFQVSGPNGA
                     GDEGSLCDAEDAQDSDPTHGTSDYWESVMMVNPGISTLLFFWSTYSSEDGESLAIAPS
                     E"
     exon            813276..813510
                     /number=1
     exon            813562..814245
                     /number=2
     exon            814479..814567
                     /number=3
     CDS             join(821576..822296,822353..823665)
                     /codon_start=1
                     /locus_tag="AO090009000307"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000150"
                     /protein_id="BAE54785.1"
                     /transl_table=1
                     /translation="MARRSMAKNRAPAPPRTGKRVDTEASAGSQTQIDSAFESGTSVS
                     SYIGADGQLITPATHKDGRDRLISAKKRRRQANQVRNRQPFWAALASTKVTVMREYEH
                     SRALSKTARGLTMTEEDLQGVSLDDGLVWITDVDSSSIKFAAGDLVSEDAGVSGSCES
                     GRLGEDMEPFYVCVNGALWATVTICKVQDVAKGSSVVHWRGEISGLAPNCAYTCSFLR
                     SDTEEEICVMSVKTPIANDAEQVVSSVSTPPQPSYRPSSPTTTLKNSIVNAELKLNEK
                     RTRLRKAKNDHKLVVSKIRKELDNYNHRLHSGTDENRQKQRSLQLERNIKQTEEATAV
                     LEVQLDNLENIPEEELEEWSAEKAKYEHELELFNSAKEDVATARSAAAREVSQLESDL
                     TSTIQRRERLQGRRTRVNEQYERIISANAQGLNERERRAAEQFAREQDQAKVEANFNE
                     QFASISQSVQEYQLRTNQLWQQCVAIEQALQQQQQQQILLDSAPLTPEGNLPGTNTLS
                     EAPTLSLGALTTSASSNRSLLGLSFPPLKSSPLQHASSPIGPTSSRPTSPTQAPSYLQ
                     HFPASPLINTASPFESDFIHRDRSFSNRSGHSSLYGSDFFDSGRRPPFQFDLSEKVVD
                     KRRSSGSESNAPNLGLRPICSPFPRAGSRASGSGSGGSGSGSGSPSSATGKGN"
     exon            821576..822296
                     /number=1
     exon            822353..823665
                     /number=2
     CDS             complement(join(824251..824516,824580..824740,
                     824796..825691,825751..825882,825934..826047))
                     /codon_start=1
                     /locus_tag="AO090009000308"
                     /note="folylpolyglutamate synthase"
                     /old_locus_tag="AO070342000149"
                     /protein_id="BAE54786.1"
                     /transl_table=1
                     /translation="MRRTSTFPVPLQWQTYSDSLLAVPFPAMIVRNEKPSYHDAVEKL
                     NSTQSGYKALLEGKGLGRRTGVPLLEQMQQWVRRVGYETSDFDRLNIVHVAGTKGKGS
                     TCAFVNSILQCYNRSIGLPRKVGLYTSPHLVTVRERIQINSEPISEEKFTKYFFEVWD
                     ALESSALREGLDPALKPSYFRFLTLMSFHVFMREGVDAAVYEVGVGGENDSTNVIVQP
                     AVTGITTLGLDHVKRLGDTVDKIAWHKAGIFKNQCPAFTVEQVPDAMEVLEQRASEKG
                     AELATVHIAPELLAVDIKPAEDFQKKNASLAIALAYTALEKLGVSFNKEQGNLPKPFV
                     EGLETVTWKGRCETIKSGQLHWHLDGAHTEDSLKVACSWFGRVSKEKELPRVLIFNQQ
                     SARDAISLLKCVHRTVYDDFRTKFQYALFCTNVTHKGHLYKVDLDDKNTDPEVLRNLT
                     LQKELAATWHDLDPSTEVVALYSIEEAIEYVRNISGHIGETRALVTGSFRLVGGALSI
                     LEGEDVAHGRATAN"
     exon            complement(824251..824516)
                     /number=1
     exon            complement(824580..824740)
                     /number=2
     exon            complement(824796..825691)
                     /number=3
     exon            complement(825751..825882)
                     /number=4
     exon            complement(825934..826047)
                     /number=5
     CDS             complement(join(827016..827794,827855..827915))
                     /codon_start=1
                     /locus_tag="AO090009000309"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000148"
                     /protein_id="BAE54787.1"
                     /transl_table=1
                     /translation="MKLPYSRPAVSVNRIVGQIKGFPCGSTKYLPLRAQQWHSSRTIS
                     SAEATSPSPRPQSSRENDTPDTGHTTLSLSDQVRLLMRRVPYPVAIITATDPHEPLDK
                     AFRGMTVSSFNTVTLNPEPAISFNVRRPSETLSALQSSKRFLVHLLAPGQTTATLARD
                     FSKGNHNLSIASGKGDFEFVPHTSTSREGAPTRPLPLLRRKKAADAPEGDSLSDIPFV
                     FECQLHPKEIEVNDHTIVVGTVLKVLSEHLTSPEAIVNAHSVTDLCLTYANTRFWEMG
                     HEI"
     exon            complement(827016..827794)
                     /number=1
     exon            complement(827855..827915)
                     /number=2
     CDS             join(828301..828742,828860..828927)
                     /codon_start=1
                     /locus_tag="AO090009000310"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000147"
                     /protein_id="BAE54788.1"
                     /transl_table=1
                     /translation="MTLSIPLRRSAVTAARVQTSTTFICSQCRHATLLRRPKRPYTFT
                     QLITLSDGSAFTHRTTSPAPVYRSTRDTRNSLLWNPSSSKLMNVEEDEAGRLAAFRAK
                     FGRSWDANTPTEAEASKKAEQPDKEAEAAARAAAEEEEDNLLDLITFMYSTSYHLVEI
                     PALRVRASR"
     exon            828301..828742
                     /number=1
     exon            828860..828927
                     /number=2
     CDS             complement(join(829282..829437,829498..830100,
                     830155..830535,830593..831080,831174..831300))
                     /codon_start=1
                     /locus_tag="AO090009000311"
                     /note="membrane coat complex Retromer, subunit VPS5/SNX1,
                     Sorting nexins, and related PX domain-containing proteins"
                     /old_locus_tag="AO070342000146"
                     /protein_id="BAE54789.1"
                     /transl_table=1
                     /translation="MDLDAGDSPWGGKQAITNNTSASYSTYLTRSTDVPSQSTGNHAR
                     EQSSQQTTSTGPRSPVRRGPRGIRKISAHATKLEAVDDTLDPLGPLGDKADETSPAAV
                     EQAPVPPQKEAFAGRNVRPTSSASQTSSGAGMVDSVNLEEDGAGFRNPPPVQPPSDAD
                     SSKRQSEPSISIEKAAKPTFEITVGDPHKVGDLTSSHIVYQVRTKTTSKAYRQPEFAV
                     SRRYRDFLWLYNSMHNNNPGVVVPPPPEKQAVGRFDTNFVESRRAALERMLNKIAAHP
                     ILQHDGDLKIFLESETFNLDIKNKENREPDLGQSKGMFSSFGINVGGGSKFVEHDDWF
                     HDRKIYLDALENQLKALMKSIDTVVAQRKGLAEAAGDFSASLHALAAVELSPALSSPL
                     VGLSDLQLRIKELYERQAQQDVLTLGITIDEYLRLIGSVKTAFSQRQKAFHSWHAAES
                     EMQKRKHTQEKLLRQGKTQQDRLNQVNADVADAERKVHQARLLFEDMGRLMRNELQRF
                     EKEKVEDFKSGVETFLESAVEAQKELIELWETFLLQLDAGEEGNPFYAPAADAPAESA
                     TEGTTTEAASSAAAEEEA"
     exon            complement(829282..829437)
                     /number=1
     exon            complement(829498..830100)
                     /number=2
     exon            complement(830155..830535)
                     /number=3
     exon            complement(830593..831080)
                     /number=4
     exon            complement(831174..831300)
                     /number=5
     CDS             complement(join(832011..832125,832182..832657,
                     832715..832849))
                     /codon_start=1
                     /locus_tag="AO090009000312"
                     /note="class II aldolase/adducin N-terminal domain
                     protein"
                     /old_locus_tag="AO070342000145"
                     /protein_id="BAE54790.1"
                     /transl_table=1
                     /translation="MAKQVENNNNDHLVQSTDPEHPSNLIPELCRKFYNWGWVTGTGG
                     GTSIRRDDHIFIAPSGVQKELMKPENIFVLQFPTPKYPPSERKYIRKPLDLKPSACTP
                     LFLAAFERGAGCCIHTHSQWAVLVTLLVEREKGPGGYFEISNIEQIKGIPRGKGKGML
                     GFFDTLRIPIIENTAFEEDLTGSLEKAMEENPDTCAVLVRRHGIYVWGDNVAKAKTQC
                     ESLDYLFQLAVEMHKLGIPWVKE"
     exon            complement(832011..832125)
                     /number=1
     exon            complement(832182..832657)
                     /number=2
     exon            complement(832715..832849)
                     /number=3
     CDS             join(833741..833866,833929..834211,834270..834400,
                     834462..835115,835170..835664)
                     /codon_start=1
                     /locus_tag="AO090009000313"
                     /note="calnexin"
                     /old_locus_tag="AO070342000144"
                     /protein_id="BAE54791.1"
                     /transl_table=1
                     /translation="MRFNAAVASALVSSATLMGYAHAEEAEKNPDATSVVEKPTFTPT
                     TLKAPFLEQFTDDWESRWTPSHAKKDDSQTEEDWAYVGEWSVEEPTVFKGIDGDKGLV
                     VKNPAAHHAISAKFPKKIDNKGKTLVVQYEVKPQNSLVCGGAYLKLLQENKKLHAEEF
                     SNATPYVIMFGPDKCGATNKVHFIFRHKNPKTGEYEEKHLKAPPAARTNKVTSLYTLI
                     VRPDQSFQILIDGEAVKNGTLLEDFNPPVNPEKEIDDPKDKKPDDWVDDVKIPDPEAT
                     KPEDWDEEAPYEIVDEEATKPEDWLEEEPTSIPDPEAEKPEDWDDEEDGDWIPPTVPN
                     PKCNDVSGCGPWSAPMKKNPAYKGKWTAPMIDNPAYKGPWAPRKIANPAYFEDKTPSN
                     FEPMGAIGFEIWTMQNDILFDNIYIGHSPEDAEQLRKETFDVKHPVEVAEEEASKPKK
                     EETAPATSVSFQEDPITFVREKVDHFVGLAKQDPVNAVKQAPEVAGTLGALVLSMVLI
                     IVGAIKASSPAPAPVKKGKETAGAAKEKVSEAVSSSADTGKGGASKRTTRSSAQ"
     exon            833741..833866
                     /number=1
     exon            833929..834211
                     /number=2
     exon            834270..834400
                     /number=3
     exon            834462..835115
                     /number=4
     exon            835170..835664
                     /number=5
     CDS             join(837657..838287,838352..838989,839059..839475)
                     /codon_start=1
                     /locus_tag="AO090009000314"
                     /note="methylmalonate semialdehyde dehydrogenase"
                     /old_locus_tag="AO070342000143"
                     /protein_id="BAE54792.1"
                     /transl_table=1
                     /translation="MTASMSSSSALARRASSVTSSSPASNVAARRLHATARQMTPATT
                     SAATTATEYPTDHKPIANPIDTANFLDNEFVASKATTWIDLHDPATNNLVTRVPQSTD
                     EELRAAVESAEKAFPAWRAMSVIARQQIMFKFVSLIRANWDRLAASITLEQGKTFADA
                     RGDVLRGLQVAETACGITTQLTGEVLEVAKDMETRSYREPLGVVAAICPFNFPAMIPL
                     WCIPIATITGNCLILKPSERDPGAAMILAELAKEAGFPAGVVNIVHGSAKTVDFIIDE
                     PAIKAISFVGSNRAGEYIYTRGSANGKRVQANLGAKNHAAVLPDCNKNHTLNAIVGAA
                     FGAAGQRCMALSTVVMVGETEEWLPEIAERAKALNVNGGFEEGADLGPVISPESKKRI
                     EDLIASAEKEGAKILLDGRGYKPEKYPNGNFVGPTIITNVTPEMTCYKEEIFGPVLVC
                     LSVPTLEDAIDLINKNEYGNGAAIFTCSGSTASRFQKDIEAGQVGINVPIPVPLPMFS
                     FTGNKKSIAGGGANTFYGKPGLQFYTQQKTVTSLWRSEDAVSTKAHVVMPTHH"
     exon            837657..838287
                     /number=1
     exon            838352..838989
                     /number=2
     exon            839059..839475
                     /number=3
     CDS             complement(join(839913..840032,840105..840554))
                     /codon_start=1
                     /locus_tag="AO090009000315"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000142"
                     /protein_id="BAE54793.1"
                     /transl_table=1
                     /translation="MGWMKRKALNIATVTLSVHQYADEKDPKVLHVNIDQTVTGGIPG
                     TTEHRITDWEGREHDDHVFGKVRGQSRLIRGSKGDDGKFRPNVEIATKTDDEDVKKFL
                     KGEILADGKDTEGFVADNVGEEYGEGESLFLQSFVQNLDSTGGWTAEQIWGFEVIDGK
                     RYYTRRVVVAKDGKYEKARFVYTFIKRRE"
     exon            complement(839913..840032)
                     /number=1
     exon            complement(840105..840554)
                     /number=2
     CDS             join(841577..841615,841695..841754,841838..842050)
                     /codon_start=1
                     /locus_tag="AO090009000316"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000141"
                     /protein_id="BAE54794.1"
                     /transl_table=1
                     /translation="MAFNKKYAGLPDLDLAPDIYETPDLTDEASTVPSAPIPTQTMML
                     APTPILTAKASMRMRRALTSSGLPLMRARSISPTVSLRNGKHIGARVADAEEMRMAWK
                     K"
     exon            841577..841615
                     /number=1
     exon            841695..841754
                     /number=2
     exon            841838..842050
                     /number=3
     CDS             842134..843168
                     /codon_start=1
                     /locus_tag="AO090009000317"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000140"
                     /protein_id="BAE54795.1"
                     /transl_table=1
                     /translation="MASRQTGSESNEPQAEHKEGLDDGMLELSRALDNLYASSRSASG
                     PHSAAAILSKKISETSPDDPDKPDGPTEKVEKKTTPPSAPSSGVLAHAAAFDGRLALV
                     EAAMGISSSSNPFIADGSSDVPLQPVLPALDHLTSRLTTLMNILVGPAPVSAVPTIGS
                     APPSTTVSTPHLENLSTRVRKLTADTEALASARKRAVDAAKAAQNARIATAALEPSDM
                     SVSSSSATEVDPAATQRDEQATKVQALYATLPTIQSLHPILPSVLERLRSLRAIHAGA
                     AQASESLDELERRQADMAREIDQWREGLHVVEEKMNQGEAALKSNIALVEPWVRDLEA
                     RLDRLESKEA"
     exon            842134..843168
                     /number=1
     CDS             complement(join(843476..844900,844907..845169,
                     845259..845277))
                     /codon_start=1
                     /locus_tag="AO090009000318"
                     /note="protein involved in dolichol pathway for
                     N-glycosylation (mannosyltransferase family)"
                     /old_locus_tag="AO070342000139"
                     /protein_id="BAE54796.1"
                     /transl_table=1
                     /translation="MGKADAALILLHLYQAPYTKVEESFHVQAVHDILSYGIPTQNVA
                     ETLRAKYDHFTFPGAVPRTFVGAAVLSAFSQPFIWLNDTIDRQLLGIKAFPLCSALTN
                     DVNSARAILGLFNALSLLSFASGLRRAFGKTTAIWYLLYQASQFHVLYYASRTLSNMF
                     AFGLSTLALRCLLQDHSQSATSKTYRNRCRLSLCLLTIAGIIFRSELAIFLATNTIFL
                     FLTGRIGIQREIIPAGLLGLLLGLGTTVLVDSFFWQKYPLWPELEAFIFNVIHGQSSA
                     WGTHPWHFYFTNAIPRLLLNPLVYLVGLPFALFQPSTRSAAAYLLIPSLTFIAIYSLQ
                     PHKEWRFIIYTIPPLTAASALGASYIWTHRTKSLLYRLLSLAMILSTLASLLCSTFIL
                     LPASSANYPGAHALNSLHNHAHSTKPTISVHLGNLACQTGVTRFLEMPSPLENSTPTW
                     TYDKTENETLKSTSSFWSQFDYLLIEPGEEEVKVRSLSGPDRWEDVDVVEGFAGLRIV
                     RPGEEAVGPVEERVLTKFVGEDGARLWRTGREFARRAVTRGWWVEVRMDPKIKILGRV
                     SV"
     exon            complement(843476..844900)
                     /number=1
     exon            complement(844907..845169)
                     /number=2
     exon            complement(845259..845277)
                     /number=3
     CDS             complement(join(848250..850274,850322..850326,
                     850411..850424,850478..850557))
                     /codon_start=1
                     /locus_tag="AO090009000320"
                     /note="ubiquitin-specific protease"
                     /old_locus_tag="AO070342000137"
                     /protein_id="BAE54797.1"
                     /transl_table=1
                     /translation="MLQDMGAIREDGSDKFFGMENVSLAVSTVIPVIAVVNYPTRTPI
                     ESLEAALANTLRYQNFAANLEAEALAEKQKAANAQRPGAPPNQPQKPEDKDSPEYKKK
                     MALQTLPLLETKNNATSYGMSESLFTSLKDLFESVVASQSRIGIIRPQHFLDVLRREH
                     EMFRTAMHQDAHEFLNLLLNEVVANVEAEASKQPEPERSLPPAESADSTELSGSSGSK
                     TPNTTRWVHELFEGTLTSETQCLTCEKVSQRDEVFLDLSVDLEQHSSVTSCLRKFSAE
                     EMLCERNKFHCDNCGGLQEAEKRMKIKRLPRILALHLKRFKYTEDLQRLQKLFHRVVY
                     PYHLRLFNTTDDAEDPDRLYELYAVVVHIGGGPYHGHYVAIIKTQDRGWLLFDDEMVE
                     PVDKNYVRNFFGDRPGLACAYVLFYQETTLEAVMKEQEQENMDLNTSVADINDSTLKQ
                     NGYPLSPGLAHVHSASQIPSPSEPARFSNLQRAPTAPPLFPHPEHADSESSPADPSTT
                     ASATPPVPPIPDIHSLPLSPKKSDSHFKKERAKEEKERKANEKEKEKQRRRDQEARIR
                     EQRREDAEIRAALEASKASKAEEDRRHSPDDTKKSSHGLSRLKRGSKSFSHRLGKDKE
                     NRVSSSSHSATPIAEHPPSRNGASESQQQLPNGQSPGSHGLHTRHTGLDEERDTLKDP
                     KHDRSGHHGKWRSFSLKKKSFSILS"
     exon            complement(848250..850274)
                     /number=1
     exon            complement(850322..850326)
                     /number=2
     exon            complement(850411..850424)
                     /number=3
     exon            complement(850478..850557)
                     /number=4
     CDS             complement(join(854630..854938,854997..855107,
                     855158..855610))
                     /codon_start=1
                     /locus_tag="AO090009000321"
                     /note="dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /old_locus_tag="AO070342000136"
                     /protein_id="BAE54798.1"
                     /transl_table=1
                     /translation="MPPAATENVPAPAPAAAAAPKPEAQPYLSTMPSSDFSWQITLAN
                     KVIAITGANRGIGLGIAEVCLANSAKFVYSFDLMEPGEDFAELQKRYSNFRYIQTDVT
                     SEESIENAINKVIEETGRIDGLVANAGMTKHQPALKFDREQLDKLFNLNVFGAYFCAQ
                     IVARKFIELGIKGSIVMTSSMTSYRPNRAAPSAPYGATKAAVRNMCHTLAMEWSQHGI
                     RVNSISPGFVRTAMTYYVEKSPDWDLKMQYYGGMPRLADPRELGGAYVYLLSDASSYT
                     TGIDIPIAGIVGAW"
     exon            complement(854630..854938)
                     /number=1
     exon            complement(854997..855107)
                     /number=2
     exon            complement(855158..855610)
                     /number=3
     CDS             join(856889..856970,857035..857465,857518..857970)
                     /codon_start=1
                     /locus_tag="AO090009000322"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070342000135"
                     /protein_id="BAE54799.1"
                     /transl_table=1
                     /translation="MVIWGTLTCVMGVVKDFKHLVVLRTLIGCVESGFAPGILLVISS
                     WYKKTEQSKRFGVYISAAVLSGAFGGLIAAGIVGGLEGAHGIRGWRWLFIVEGAATVG
                     FALISFFILPDFPATTKRLSERERYVAIARLESDNVTAMTDGGERLSPWQAILASMKD
                     WRTWMFVIGYMVIVGASTLSYFYPTLVKGLFGDASTMRINFLTIPIYAVAFVCTGITA
                     YFSDKIPLWRGVVIAAWLTFSLVCSIAVCAVYNYSARYALLVLMAAGLWATNGGTLAY
                     ASSAFADMQPQVRGVSLALVNALGNLAQIYGSVCICLSIHRLSYC"
     exon            856889..856970
                     /number=1
     exon            857035..857465
                     /number=2
     exon            857518..857970
                     /number=3
     CDS             complement(join(860017..860136,860428..860464,
                     860524..860798))
                     /codon_start=1
                     /locus_tag="AO090009000323"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000134"
                     /protein_id="BAE54800.1"
                     /transl_table=1
                     /translation="MTNAVSASAGQGEQGPQRSVRCHVAQAASARAPTPTRLSSNAKS
                     NILALVDIGCHIIVYFWAFSTMPNNGPQSGIRKQRKSRGRGLRTNTGCLICKRRHVKC
                     DEIRSPSDFEQISVISACRICTFTWYGVISDLIEGGAPELV"
     exon            complement(860017..860136)
                     /number=1
     exon            complement(860428..860464)
                     /number=2
     exon            complement(860524..860798)
                     /number=3
     CDS             join(860934..861016,861071..861450,861503..861626,
                     861683..861944,862004..862024,862105..862107)
                     /codon_start=1
                     /locus_tag="AO090009000324"
                     /note="fructose/tagatose bisphosphate aldolase"
                     /old_locus_tag="AO070342000133"
                     /protein_id="BAE54801.1"
                     /transl_table=1
                     /translation="MTRRATNKTLQILDAAEKGRYGVLAAIAYNVEHITAFVRAAENR
                     KSPLIIQLFPSALTQTPSLVHAAAAAARAASVPISLHLDHAQDYDQIKEIADTLPFDS
                     IMVDMSHYEKEENLERTASLREYCHARGISTEAETGRIEGGEDGIMDTGDLEGILTSP
                     EDVEDFIRAGVDYLAPSVGNLHGDYGPKGPQPDMDRLRGIFKALNGRARLVLHGTNDF
                     SPELSKACIEAGVSKFNVNKLVLDPWYDYIRANINKPITQVIDEGIEVLIQSMERWMD
                     IMGSSGKPSKGEHT"
     exon            860934..861016
                     /number=1
     exon            861071..861450
                     /number=2
     exon            861503..861626
                     /number=3
     exon            861683..861944
                     /number=4
     exon            862004..862024
                     /number=5
     exon            862105..862107
                     /number=6
     CDS             complement(862429..863595)
                     /codon_start=1
                     /locus_tag="AO090009000325"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000132"
                     /protein_id="BAE54802.1"
                     /transl_table=1
                     /translation="MADVEPIFSAVSSNAHHLYTLLQCIGFVPKATVLITPDGIRFSV
                     EEGRVIQGLAFLDKALFTTYTFNPPAAPNSTSGDLGDGDDSSDATYNPCFVVSLSALL
                     ETLKIFGVNDPSSTGANKAVSVQPSNPSSSNAFTTPALLFDRSCTLQYFQNGSPLSIT
                     LSETGIKTTCELTTYEPDGGEVDIPLQRDAIIMKVIMRSAWLHNAIVELGATNPNVLK
                     ISASADREPFFALSGSGGPFSESSVEFSIEEQGPNNGASSQSRKVLTDDGTSRSRAKR
                     TKLAPTVTETFLVSPPSSMGSRIKQNYRFSLMQKASRAMSVANKVSIRGDRQGVLSLQ
                     FMIEFDAHGSSGASNTTRPSGGSLGPTVTFVDFRFVPLLDDEEAADEDSTGDLE"
     exon            complement(862429..863595)
                     /number=1
     CDS             join(864613..864705,864763..864971,865030..865144,
                     865176..865904,865966..865986)
                     /codon_start=1
                     /locus_tag="AO090009000327"
                     /note="histone acetyltransferase SAGA/ADA, catalytic
                     subunit PCAF/GCN5 and related proteins"
                     /old_locus_tag="AO070342000130"
                     /protein_id="BAE54803.1"
                     /transl_table=1
                     /translation="MLSAECANGNLKSEGGPLGKPPLRIVPFPEKPAVLEERRGEIEF
                     RVVNNDGSRDSFVVLTGLKCIFQKQLPKMPKDYIARLVYDRSHLSIAIVKHPLEVVGG
                     ITYRPFNSRRFAEIVFCAISSDQQVKGYGAHLMSHLKGMLSAIQDYVKATSPIMHFLT
                     YADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTIMQCTMLPKIRYLEIGRMLLK
                     QKEAVHAKIRAFSRSHIIHAPPKEWKNGACKIDPLSIPAIKQSGWSPDMDELARQPRH
                     GPNYNQLLHLLNDMQNHSAAWPFTQPVNRDEVPDYYEVIKEPMDLSTMEEKHEKDMYP
                     TPQDFIKDAMLIFDNCRRYNNENTPYAKSANKLEKFMWQQIRNIPEWSHLADGH"
     exon            864613..864705
                     /number=1
     exon            864763..864971
                     /number=2
     exon            865030..865144
                     /number=3
     exon            865176..865904
                     /number=4
     exon            865966..865986
                     /number=5
     CDS             join(866951..867105,867170..868190)
                     /codon_start=1
                     /locus_tag="AO090009000328"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000129"
                     /protein_id="BAE54804.1"
                     /transl_table=1
                     /translation="MASPSLTDLEQRNRLPTLFEVLSRRTLAPVDLFSFYIYMRDQQR
                     SVDYLDFWLDVSQHMSLCRHYVRELRRSVLVATPDLEKADSKGSSDALGNLETFGDIP
                     LVEAGPSGLRHGNHDLDDQDADQRLSAFLRADGHNPGHSPQDSLGSQNAARTPSNEQP
                     PRPSSGTRNDSTSPGHTVARADIRASAEKILYTYLLPGAEREIVLPEDMVSTIINLVE
                     DDGRDDPEVFDPAKDYVFQAMERDAFPGFLQAKALGNLVPLSTIARLAFALISFGGGF
                     WGAFYVVLRDKPRHIRCWVCCSGLPGFCCASTLTIMQLILPFIVASYFIVSYQYKIDP
                     VMAFLGYSEYTFMNWSPIREPYVRKLLNKRATATILIAAFVATALSVLFIFVPGTML"
     exon            866951..867105
                     /number=1
     exon            867170..868190
                     /number=2
     CDS             complement(join(868916..869625,869707..869965))
                     /codon_start=1
                     /locus_tag="AO090009000329"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000128"
                     /protein_id="BAE54805.1"
                     /transl_table=1
                     /translation="MDQTHSRAMEALQPFVLLANSNSATSPKFVANLITNATSSPNTY
                     VFAELLETPTVQALRSEDTPAEYQGYLTLLEVFAWGTWQDYQTTPNLPPLNNEQTLKL
                     RLLSLLSLSATIKPLTYQTLMDALSIAAPSELESLVTTAIYSSLITARLSPVTNPPTI
                     NVTSVAPLRDVKPQSLTTMISILTQWETRCGDVISDIEAEIARIKTDSAKRRAKEQAR
                     AVLFEKTLSNWGSDGGESNPRFPGSKKQSWHGGAKGGSSGFVGNKREFSGDDFDDGYW
                     DNGADGAYDSQFSTSKMDIDQGAGSSATGSAGAGARHAKRVLGRKS"
     exon            complement(868916..869625)
                     /number=1
     exon            complement(869707..869965)
                     /number=2
     CDS             871616..875158
                     /codon_start=1
                     /locus_tag="AO090009000330"
                     /note="cation transport ATPase"
                     /old_locus_tag="AO070342000127"
                     /protein_id="BAE54806.1"
                     /transl_table=1
                     /translation="MLGAEVDGSSAARSPAHMATTTVNVEGMTCGACTSAVEGAFKGV
                     DGVGEVSVSLMMGRAVVHHDPNVLSPDKVAEIIEDSGFDATIISTDSPAGPSGDTTTV
                     KEKGSMVSTTTLAIEGMTCGACTSAVEGGLKEVAGVKSVNVSLLSERAVVEHDASTVT
                     PDQLAEIIEDRGFGARVLDTAAPQSGASQETTETTSRLMVTTVSIDGMTCGACTSSIE
                     NIFSGVDGLVQFNISLLAERAIITHDPVALPSKSIVNMIDDAGFEATILSSEPQAPVS
                     SAVGRVILNLHGLRDALSAGALEESLLQKPGISSASVDIPTSRITVLYDSSVIGVRSV
                     VVAIEAAGYNALLADTDDTNAQLESLAKTKEVQEWKRSFLFSVSFAVPVFVINMLLPM
                     YLRPLDFGKVQLIPGLYLGDVACLLLTIPVQFGVGKRFYTSSYKSLKHRSPTMDVLVV
                     LGTSAAFFYSVFTMVMALIIAPHKRPSTVFDTSTMLITFITLGRWLENRAKGQTSAAL
                     SRLMSLAPSMTTIYDDPIAAEKMAEEWEASRTGNGEQKSTSDNERPGPGHQIIPTELI
                     EVGDIVVLRPGDKVSADGIVIRGESYVDESMITGEALPIHKAKGSAVIAGTVNGTSSV
                     DFKVTRAGKDTQLSQIVKLVQDAQTSRAPIQRMADTVAGYFVPAIISLGLITFFGWMV
                     MSHLLPHPPKIFLADDNGGKLMVCLKLCISVIVFACPCALGLSTPTAVMVGTGVGAQQ
                     GILVKGGAILEAATKITHVVFDKTGTLTTGKMSVAEAKIERHWTSNEWRRKLWWLIVG
                     LAEMNSEHPIGKAIFSAAKTESGHPDEGGLPGSLGDFDACVGKGISALVEPASSAERA
                     RYRVLIGNATFLRSRDISVPESAQAADSDMATSKVPAGITRIHVAIDDQYTGTLLLRD
                     TVKVTAVAAVAALHRMGISTSLITGDTHATAISIANAVGISPESVHASVSPSDKQSII
                     SSLEASGERVAMVGDGINDSPALATASIGIALASGTDVAMEAADIVLMRPDDLLSVPA
                     SLSLSRAVFNRIRMNLVWACMYNVIGLPFAMGLFLPFGGYMLPPMAAGAAMAASSISV
                     VVSSLLLKFWRRPRWMDAEKLEKQVEMGNLSFRGSRKSWWEAALSVSGSSGRVGPLRW
                     IQGTRFWFFVTGKPSGRLDSDEGYVPLQTVEPAV"
     exon            871616..875158
                     /number=1
     CDS             complement(join(875753..876174,876235..876859,
                     876920..876968,877023..877068,877226..877235))
                     /codon_start=1
                     /locus_tag="AO090009000332"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000125"
                     /protein_id="BAE54807.1"
                     /transl_table=1
                     /translation="MSLDEETLETVANGGSMDFEKWPSMVEPLLERLEYIVYNVFPMP
                     QVPPESTAAISQQQPISNLSASFPQEPNSIPTSSNKENATPADSQTSTQLTEPSGERI
                     PNSQPQSSAGPNLPTPLQLLLDSTRSTLRSLFSTKPPHTIQRLAELIIRPNKHYKTLP
                     AYLRAVDRVVSVTSSADIFPLKTHASGDQSNGILNGAESGPMFSDHALGSDESLGGAL
                     LTPIPWLSNVASPDAEGEGGASLSEDHDAMSEAAPQQHSLQQETDGAAEPVLTHSTTS
                     VIENEAMEDTGPQQTNPSEDIPHARGPRILGVEDMGLQDGKGVEMTLENEEGANNNSA
                     EQNGQQGNDAGQTATKENADGDGDITLDDAKNANEEPGASAKGDEQPKP"
     exon            complement(875753..876174)
                     /number=1
     exon            complement(876235..876859)
                     /number=2
     exon            complement(876920..876968)
                     /number=3
     exon            complement(877023..877068)
                     /number=4
     exon            complement(877226..877235)
                     /number=5
     CDS             join(877539..878004,878070..878167,878219..879176,
                     879246..879442)
                     /codon_start=1
                     /locus_tag="AO090009000333"
                     /note="phosphoribosylamidoimidazole-
                     succinocarboxamidesynthase"
                     /old_locus_tag="AO070342000124"
                     /protein_id="BAE54808.1"
                     /transl_table=1
                     /translation="MWNSPKVGILGGGQLGRMLVESANRLNIQCNVLDAENSPAKQIS
                     SHDGHVTGSFKEREAVRELAKTCDVVTAEIEHVDTYALEEIASQVKIEPSWQAIRTIQ
                     NKFNQKEHLRKYGIPMAEHRELAENTPEELAKVGEQLGYPMMLKSKTMAYDGRGNYRV
                     NSKEDIPEALEALKDRPLYAEKWAYFKMELAVMVVKTKDDVLSYPTVETVQEDSICKL
                     VYAPARNVSDAINQKAQELARKAVAAFDGKGVFGVEMFLLEDDSLILCEIASRIHNSG
                     HYTIEGCPLSQFDTHIRAILDLPIPPKSLELRQPSIMLNIIGGAAPDTHLKAAEHALS
                     IPNASIHLYSKGAAKPGRKMGHITVTAPTMHEAETHIQPLIDVVDEIRSQRSDIKTQP
                     QKSGPSKPAPSVAVIMGSDSDLKTLVPGLKLLKEYFGIEPAVDITSAHRTPEYMAEYS
                     ASAAARGIKVIIAAAGGAAHLPGMAAAHTALPVIGVPVKGSSLDGVDSLYSIVQMPRG
                     VPVATVGINNSINAALLAARILGSFDPAIQRKVEAYAEQAKTENLDFKGTKMRELGWE
                     KYFEQM"
     exon            877539..878004
                     /number=1
     exon            878070..878167
                     /number=2
     exon            878219..879176
                     /number=3
     exon            879246..879442
                     /number=4
     CDS             complement(join(879939..880924,880978..881134,
                     881187..881541,881592..881722,881776..881915,
                     881987..882275,882328..882521,882572..882902,
                     882978..883003,883069..883108,883175..883225))
                     /codon_start=1
                     /locus_tag="AO090009000334"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000123"
                     /protein_id="BAE54809.1"
                     /transl_table=1
                     /translation="MSSRLVNRPMDTKQRDKDINQKLQLYGIYQAFKNGKLPSNKQCD
                     VALNSALKSKALSTPPKELSEEGQALIGDVRDVIEQAKRLILSKNDGQLIQEFIWEAQ
                     SITGEHVGEKPDVPLSRESAQQDGREALEGLKTLGNLLITNGEFRKLLNDAWILVRDI
                     AGDASQKAANQVRPSEEQLAQVDQPAEDNTWHEKPDYAKHKEQFTSRFRKNKATAEQQ
                     ANEVTDTAAQAATGDQRQDSAVEIDGRTGAAAGAEKTKEKLSENIPEEQKSRARDLAG
                     KTKGYLSKKMPKERREQAIWRMKKMIIEIQGRADYQRAIETLLSLAEKYGSTTRDVTQ
                     QGAGTVKGTRGTDKISRMEKNLRVLIERFANSTSLDDLFDSLENIYRDADRDPELKGW
                     FKNMDTFIRKSLQEQGYVMQEDWDRHYDQLSDHGRYLLRERYRDHTDRILDEVKFIGD
                     QFAQDPQNKAFGEAVEKLFLDLGRDSSGNVSFKPHLLTDLRDVILPGIFENVRYVPIP
                     RIEVSDPMADVVVENLVVESDNLVPNVVEFGSDNYLRWGRKKISSKRDNKIMLSVSGI
                     QADLRDVSYYINKKQGFPSITDQGVMDIFLGGDGFGFKIAASNAQREDRQNFVKLDKV
                     SVKIDSFNIKLKKSKHKALFTIFKPLLFRTVRPVLQRVLEQQIRDAFSRGDAFAYEIH
                     SEVKRAKEAAIEDPANAPNIYSRYLDAARAKMEENKQKAQAVAQRASNTKVQTATTLH
                     DSLFPEIKLPGGISSKATEYKELAERGERWESPIFSIGDAPESSNIPTPADITRKPHT
                     TAQGRISDGNVTNGSAAASGARTSNGSTTIGATNGSAAVTGTSGVTNGATNGVHKANG
                     YGAHGFSDQVDKAFTSNGGYKTTQDGVTATIPGAQHAFNPQTA"
     exon            complement(879939..880924)
                     /number=1
     exon            complement(880978..881134)
                     /number=2
     exon            complement(881187..881541)
                     /number=3
     exon            complement(881592..881722)
                     /number=4
     exon            complement(881776..881915)
                     /number=5
     exon            complement(881987..882275)
                     /number=6
     exon            complement(882328..882521)
                     /number=7
     exon            complement(882572..882902)
                     /number=8
     exon            complement(882978..883003)
                     /number=9
     exon            complement(883069..883108)
                     /number=10
     exon            complement(883175..883225)
                     /number=11
     CDS             complement(join(886143..886203,886451..886878))
                     /codon_start=1
                     /locus_tag="AO090009000335"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000122"
                     /protein_id="BAE54810.1"
                     /transl_table=1
                     /translation="MPFFSETNFWTSVDTVYQAGGRFAKPSDHWFLRLVLAIASASVS
                     HQSGDSSHQRALSLISGALPFAEDVLRPGSIVGIQAILLLAQYSLFDPKHFRVWYLVG
                     MAARALVDLGLHQDPPSEVQSADEQLDMRRRVFHCVYCMDRWLVLGVGVGTVLKSSGL
                     VR"
     exon            complement(886143..886203)
                     /number=1
     exon            complement(886451..886878)
                     /number=2
     CDS             join(889202..889348,889417..890119,890150..890765,
                     890818..891883)
                     /codon_start=1
                     /locus_tag="AO090009000336"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000121"
                     /protein_id="BAE54811.1"
                     /transl_table=1
                     /translation="MATQLNPSYTKPQFTNPWRSPSSKTSSQSDEIPDGRIAHTLTAC
                     TRCRQRKSRCDPGIPRCSPCERSNAKCVYFDSARKCTIPRTYIVSLREKARMLERELE
                     EAEKEFQHAADAELMVRGAGRIRFKENDDPRFLGPSSGIAITRLVMEMAKQNTDSKSI
                     KDVVPELTAHEIKQAFEQESSKPTSKVYPIISSNPQPSLPAKHVTYRLIDVFVVKGIP
                     LPVKFIVGLPYLSSHLNCLLRADISLAQAMLPTLHEPTFRQDVEDVFNGSNDPCKNFQ
                     LRMVIAIRLADGYYLAALPFLEASLRRMDLRALQCLVLIGQYSLLTPTRTAAYWVVGI
                     AVKLCQDLGLTDEATITKSPSGELFNPLEIEMRRRLFWIVTSMEFGLSHSLGRPSCYS
                     VNHDHIRVKFFELIDDKFITPDGILPGGKPILPKCIAIHFFKMRLLQLEIRRTLYLNK
                     RDAPVDDQDPWFQQMLNKLDYWVASCPKKHGGSGLSEKWFHGRRNTMIVFMFRPSPQV
                     PEPSVSAAQKCYEASVFNVAMQREQTANQSVDLTWIFTQSLFMALNTILWSLSYPEIR
                     REHPVDEVKRHLDVALEAIVVAAERWPGVASALLLYKSLVAACLKAYNTDESFVVQSP
                     SNHTTPASSQEVATPPSMSSPASTTMSIPSRNIRGMNASVPDSLSSGTLSRGHSADPT
                     FPFSTTSPPSEPIKVAPYPLWDPQVQPQELTSSSVTPTPYTTSSFDPTIVACSDGRFD
                     PTTPYNQFPSIVPGLQGWDPDFTLASTTASHLAYVEATVDPMNWMDSIGNQYSQYFNG
                     AYPIPSWRERTLSQQDQIELMTKLEENIPDVSAQLVRESATFYQS"
     exon            889202..889348
                     /number=1
     exon            889417..890119
                     /number=2
     exon            890150..890765
                     /number=3
     exon            890818..891883
                     /number=4
     CDS             join(893045..893696,893810..894447,894499..894556,
                     894601..894659,894862..894885,895318..895409,
                     895497..895575)
                     /codon_start=1
                     /locus_tag="AO090009000337"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000120"
                     /protein_id="BAE54812.1"
                     /transl_table=1
                     /translation="MSDRASSASFRLGPPSPSSPAAGSLKSNHPSYTSTEHTPQTPTS
                     PPLMSVSAQNYASNFTSSQTSPGQATSQPANLSSPPSSVPMSTQASQQPTVGTTNSFP
                     TPASSVNGHFTGATPVDDSEQTEKSFGPEMGATSTADMNAPIQQTEHRRTDHDRQSEG
                     PSAQTGVRDFGITGDQNMLNHGDAMDIDKGTADLSNYESSLESLQKEFTSAFHLCKSS
                     HIATGPDPSYDLVSLYGLGPVAKSVARMDPVTGEKINRLRKSYEGKLKGLGLAGRNKP
                     VKHEPGMAGGLRQMTMWPEEEWQNQKVFGKEIKVADMDSALHNLQMRAMKMEPGTVTN
                     NDYWEDILGHEKQSKHAGSGDGSKKAATPSNGVRVPSQANGTPNAAEPERSRPSRGRK
                     RHYDDNSFVGYGEGYADDDDDGAFYSNSEGISKKKRKKDHVSKISTPLPERGGSYGVD
                     QKQIALCPFFLPFFFFFFLGSNNRSEQIHPLPCCQASSLAFFSSRNLRSSRLSLVGSK
                     RLSEFLACSLYTSRGSLDEQYIYSQ"
     exon            893045..893696
                     /number=1
     exon            893810..894447
                     /number=2
     exon            894499..894556
                     /number=3
     exon            894601..894659
                     /number=4
     exon            894862..894885
                     /number=5
     exon            895318..895409
                     /number=6
     exon            895497..895575
                     /number=7
     CDS             complement(join(896551..896600,896716..897076))
                     /codon_start=1
                     /locus_tag="AO090009000338"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000119"
                     /protein_id="BAE54813.1"
                     /transl_table=1
                     /translation="MAHLESRKHISPDSGFPITLHPNFNPKINQHVPPDPIREHLNPP
                     KDRALFADPEKKALFSVAKPVDLTESIGTLLEDVQLSQLNEQQLDELALLVTERGVVF
                     FRDQDLTTEKQVELFQHYDRNTPIRANDYTGSES"
     exon            complement(896551..896600)
                     /number=1
     exon            complement(896716..897076)
                     /number=2
     CDS             join(897733..897980,898042..898770,898908..899032,
                     899178..899455)
                     /codon_start=1
                     /locus_tag="AO090009000339"
                     /note="permease of the major facilitator superfamily"
                     /old_locus_tag="AO070342000118"
                     /protein_id="BAE54814.1"
                     /transl_table=1
                     /translation="MGGSKTLAHDTTQEWSEDENAVLGGHDGLWIRFLTWARWYPKDM
                     NHLEKRLVLKLDVLILTFGCLSFFTKYLDQQAITNAYVSGMKEDIGLVGNELNYITAA
                     FWAAYCTSMIPACYYLTRSRINIILPTLEAGWGLFTFGCAWAQNPGTIYAMRVLIGIC
                     ESCSFTGVIYVIGSWYKPEEIGRRISLFFIASPLGTMFAGYLQAAAYTNLNNTHGLAG
                     WRYPSLKYLYEDDYQLISFTGGFSSFAPSSQYPYVSCMPGLTTSDTGTLLTGDRGYIA
                     FLDVPHRTKPRFLTHKEHELANSRLVGLTAPSQLKVSRDIFKRVLGRWHCCFYCSCLD
                     RGDHGGQEEKFLAPFYHHYNSSPVGPCVACSLESMSPLTMSWATVTMANDAEERAIVT
                     ASMNAIGQAMSAWTQLLQYPAAEAPNFRGGFISNLATTVAQLAVVAIMVLLTRWDARK
                     TSGSNVSAI"
     exon            897733..897980
                     /number=1
     exon            898042..898770
                     /number=2
     exon            898908..899032
                     /number=3
     exon            899178..899455
                     /number=4
     CDS             join(900138..900173,900244..900418,900501..900637)
                     /codon_start=1
                     /locus_tag="AO090009000340"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000117"
                     /protein_id="BAE54815.1"
                     /transl_table=1
                     /translation="MKKIQCHGKPYEIGKAHGVEAQEPIRRSISFYQKMFVHTCKLEW
                     NAVREIAKDWQSEIEQKWPRYYHEIQGISDGAGLPFVDILALNIRTEIAFGMFNDGCT
                     SLYWKTQSNSFLA"
     exon            900138..900173
                     /number=1
     exon            900244..900418
                     /number=2
     exon            900501..900637
                     /number=3
     CDS             join(902538..902623,902712..903762)
                     /codon_start=1
                     /locus_tag="AO090009000342"
                     /note="threonine/serine dehydratases"
                     /old_locus_tag="AO070342000115"
                     /protein_id="BAE54816.1"
                     /transl_table=1
                     /translation="MCDTHPTQRKPWIETPLIESATLSKAAGWVLQVEVDRPKLTQEL
                     SRSTNVTYIHCRGIGNLIRSTLLDPANKDKELHFYSSSGGNAGLAAVIAARDLGCSCT
                     VVVPHSTKPLMISKLRAAGATDVIQHGSSWFEADTYLRQNFIENNTNEKGADTAMKRN
                     IYVPPFDHPDIWKGAGTMVSEIAAQLPPRDTPAGYAFPADAIICSVGGGGLFNGIVEG
                     LGDYMRSHPTPDLITGTTLKNVRVLAAETNGADSLALSLRSGSLQSLPAITSLATSLG
                     ALCVSPQTLKDAQSPPAGVDVVSVVGSDAEAAKGVIHLADDLRLQVELACGISVDIAA
                     GPRLREAVPDLTPDSRVVVVVCGGSNITAEMIAEYRQRLQNGWE"
     exon            902538..902623
                     /number=1
     exon            902712..903762
                     /number=2
     CDS             join(904927..906900,906950..907063)
                     /codon_start=1
                     /locus_tag="AO090009000343"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000114"
                     /protein_id="BAE54817.1"
                     /transl_table=1
                     /translation="MDMADTSIPMEYDPRKYEDPKISTLETALKEGLLALNKLQQAFE
                     GSDVRNADIDWKPQIERTLSISQTEKVIIGLNGSTGAGKSSLINAIVDEENIVATNCM
                     RASTAVATELLYNDGESRYKAQIEFIELRDWEQELRILFEDLLDSHEDVIRGDLQKNS
                     DAAVALDKIKAVYPLLEVKDILNTSVEALMEHSNVSDLLGSVHVFEQNDPKVFSRMVK
                     SYIDSRGRRGRSEKGPEKGRDMKYWPLIRVVRIFLKAPALITGAVLVDLPGLHDTNAA
                     RVEVAKEYSKRCSAHWIITPINRAVDDKVARDLLGQSFIMQMQMDCSFNNITFVCTKT
                     DHITVSEVQDSLKLRLPSMQEREQRDRKRAQLGAELKLLQEGKGRVMEELSLLDDEIE
                     ELESCLFNEESSLNLSQLTPIKRKRHSDLEMDVTANPNAEVPSTPILHVSATDTQPSA
                     DSEIDELLRKFRSLKSERKVLDTQRREIYQQIQINKAALKRVQAESDNMRADTLSECI
                     EARNEYSKHEIKRDYANGIRDLDEEDQDTLAPSDRSKLARNYKKIEDELPVFTASARA
                     YQKLRGRLRKESAVAGFTQLEQTEIPQLQRHCISLTERAREASAMRFLTQLKQLFQSI
                     SLWSLETGQAHIMSAEEIQELEAEFNSTMVELKETMVAEVEKHIDSLRHEFEKTIIRR
                     FGTFFFSNAPDRH"
     exon            904927..906900
                     /number=1
     exon            906950..907063
                     /number=2
     CDS             907322..908116
                     /codon_start=1
                     /locus_tag="AO090009000344"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000113"
                     /protein_id="BAE54818.1"
                     /transl_table=1
                     /translation="MFNEKVPGHFFQLKGDLAEILEQYHRRAIALVERRSVTKESKDM
                     LDKALSICCKSMGEQLGSLEQSMISKQKEINRMFAETIRTKLMPTYEECAEQKGESLQ
                     FLSHKGVINGKKSSLSLFLSPTIHRILSSDLIPQVLAPSPVRNLMTQEGARNSVNMLQ
                     TSARRVTKGLTSLLESTGADIEALIDTTVDQVSRDYRIAIIDPRVRKLSQQQIELKNK
                     ITNIIQTAETEVHLDQHLGLSNHQELSAEILKHEGVANIKEENMQA"
     exon            907322..908116
                     /number=1
     CDS             complement(join(909396..909684,909743..910904,
                     910958..911690))
                     /codon_start=1
                     /locus_tag="AO090009000345"
                     /note="molecular chaperone (DnaJ superfamily)"
                     /old_locus_tag="AO070342000112"
                     /protein_id="BAE54819.1"
                     /transl_table=1
                     /translation="MVLPQLFSRHKSKRSKSKQIQHPDLSTLTPNPTPVPSASSPPPP
                     PPPRFPPSSPSTSSSPRHSQSTRKNPPPPPPPPYQPTAAATAPPPQPNLPRKSSTRPA
                     HSRSSSIPSHSKSCHRPTHSSATSKGSFSSSASRPTFSRASTVHRFKKHDPDLHPLNL
                     PPDELRRLSAMAAAADRSSMDVDSNDPRLSSSANGVNGTHAEKSPTPPPHRSNGTTAE
                     ADSFKLAGNKFFKDRNYARAIEEFSKAVEINPNSSVYLSNRAAAHMAAHQYINALEDC
                     ERALELDPSNAKIQYRLARILTSLGRPQEALNVLSRTDPPASATDRAPAEKMIRFVTQ
                     AEETLAQERGVSMALFCLDQARALLGNGVKEPRKWTLITAEAQLKMANENSYAKAQDI
                     AMNMLRQNNQDPDALMIRARAFYGLGETEQALKTLKICISLDPDMKSAIKLLRTVQKL
                     MRTKEEGNNAFKAKDYRKAIDLWSQALEVDPSNKDMNAKILQNRAQAHINLKEYDNAV
                     KDCTEALRLDPSYVKAQKIRAKAHGAAGNWEEAVRDYKAVAESNPTEKGIQEEIRKAE
                     FELKKAQRKDYYKILGVSKDASEHEIKKAYRKLAIQYHPDKNRDDPQGDEKFKEIGEA
                     YETLIDPQKRASYDNGDDLIDPSDMFGGHGGFSGFGGMGGMGGMGGMGGMGGMGGMGG
                     THINIDPKILFNMMNGGGGGGFAQAGGNPFGGGQSRGGFPGGFPF"
     exon            complement(909396..909684)
                     /number=1
     exon            complement(909743..910904)
                     /number=2
     exon            complement(910958..911690)
                     /number=3
     CDS             complement(join(916979..917087,917148..917680))
                     /codon_start=1
                     /locus_tag="AO090009000346"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000111"
                     /protein_id="BAE54820.1"
                     /transl_table=1
                     /translation="MRFSATTIALFAGLAAAIPNGEVHTVYQTEDVTITSCAPTVTDC
                     PGRQTSTPEGVEPVTTGPAVTETPIAQTSSAEVPPVAETSSAEVPPAVPTSSSPVIPG
                     VPSSGVPPVPSSSSPVIPQPPKQPSQGTTVIAVTTCIPTVTYSTITGPVGTPTGVSPG
                     KSSSVAVIGTPAPSGSATPSSSGPTSLFTGAANTVGQSFGLAGAAAAAAFFLA"
     exon            complement(916979..917087)
                     /number=1
     exon            complement(917148..917680)
                     /number=2
     CDS             join(922895..923623,923715..924006,924058..924427,
                     924484..924613)
                     /codon_start=1
                     /locus_tag="AO090009000347"
                     /note="mitogen-activated protein kinase kinase (MAP2K)"
                     /old_locus_tag="AO070342000110"
                     /protein_id="BAE54821.1"
                     /transl_table=1
                     /translation="MSTPAVPLLKPPVPGNRNNSNGPRPPKLTLGIPPSPNARPVTGN
                     GIPAPAPVPAPALAPEVPQLQRPSTRPAPPQLRLATPMGSSKNIQQVNGRPAPPPLAT
                     SGLNEPNGHSRSGSFNYLDGKASGPASASSSNYSALSFAMGLRQPQGSTPDPSSAISS
                     VYSDREGGVQMERDNSVNGLIPDLDKLSLEKGRPLDVDDLDDEGWLAASEQKKIVELG
                     SLGEGAGGAVTRCKLKEGKTVFALKIITTDPNPDVKKQIVRELNFNKDCASEHICRYY
                     GAFMDKSTGTISIAMEFCEGGSLDSIYKEVKKLGGRTGEKVLGKVAEGVLNGLTYLHS
                     RKIIHRDIKPSNILLCRNGQVKLCDFGVSGEFGTKGDANTFIGTSYYMAPERITGQSY
                     TITSDVWSLGVTLLEVAQHRFPFPADGTEMQPRAGLIDLLTYIVRQPIPKLKDEPGNG
                     IRWSDSFKYFIECCLEKEPPRRATPWRMLDHPWMLDMKNKKVNMANFVRQVWGWDN"
     exon            922895..923623
                     /number=1
     exon            923715..924006
                     /number=2
     exon            924058..924427
                     /number=3
     exon            924484..924613
                     /number=4
     CDS             complement(join(925907..926993,927051..927204,
                     927255..928788))
                     /codon_start=1
                     /locus_tag="AO090009000348"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000109"
                     /protein_id="BAE54822.1"
                     /transl_table=1
                     /translation="MANPGRLSGAHAILLATHLCVTGNVSRLPQLQAQFPGYLPFERV
                     LRIILTFLPESTAPQSYTSVLQELLDGPPSQTDDDDIDVSPVDKFSESAAKKRVRTLR
                     LLPLKYHDDEDSQDPTDLLTQFLIHRAYRIDLETALQPLILELLLPFYQRLPTVRTWL
                     ISSLLPLLRLNYEYYPSQDETFSLDVLESMDSHTAINVLLSMTGAQKNSMDLVNNLRG
                     LLGPWMYGSNRSKRRRLNKAAEANSISLPQLNTQQQSNNISGWQYVNEWLLARSLVDY
                     ESTVNAFLNWDGPEDADLGGFEEGNQKYDHDVSKDLNLRYGQSGLAVIYTTSDTSKSC
                     LEGSIKVLTRVAKLLSLEDQLFTSPNSSVLPSVTFDASQISSSSRVSLLQNALLAASN
                     PLTCPSASSISFLSTILLSIKTLAELGHSVTCRTAANICLHSNQDTQLHELRNIVSSI
                     VRQTKLSHDWRDVREQILWLQHWGSDKTEGNESNSPCHGLFWRISRDVVEAEILKALL
                     EIKEFNLAIDIYINSKTSLSSAQVEEAVKEAIFTTYDNASNGNRTRGGMKQAYDILQA
                     FQPHFPGSVSFKEIRALISATHGLSFYSLTLQHGVPFQPVSIRVHPDPLSLIEKVLDQ
                     NSKAYTRVDDLLAIGRNLVAAGFSSHLSDSNNLDLPSTSEEDAVITAERRIMSLAISS
                     ALSSNDFGTAYSYIHTRLTPPSLLSTSSPLTNPAVRDDISWRAVYNAGRYRDPALSSS
                     SNLQAQITQLSQRMELLSLALILVPSPDPLPEILGAWRRCDEEMNGLRTREAEEEELW
                     DTKGDNLSSVPGGFGPTDSEQDAYETKKQHARRARAHNDRLNAEEAPMGLFEVARGAA
                     LALHKNAFPLSGGTAATDQQPKPSSHARGPSEDSAEERVRKRDVVSNMVTGGLVSGIG
                     WVLGAQPVNR"
     exon            complement(925907..926993)
                     /number=1
     exon            complement(927051..927204)
                     /number=2
     exon            complement(927255..928788)
                     /number=3
     CDS             join(931198..931208,931346..936721,936787..937084)
                     /codon_start=1
                     /locus_tag="AO090009000349"
                     /note="SNF2 family DNA-dependent ATPase domain-containing
                     protein"
                     /old_locus_tag="AO070342000108"
                     /protein_id="BAE54823.1"
                     /transl_table=1
                     /translation="MTSSLLETGSTPLIRNTAAQQLGDVQKQHPDELFNLLGRILPYL
                     KSKSWDTRTAAAKAIGLIVTNADIFDPNEEDGLGIKKADDEDDLAVEIKSEEAQLSPS
                     DELLQLESLDLTSILKYGKRLLGSAGKEYEYSLAAMDPISRLQHQKKTLNSRLGLAGE
                     YIEDDLIDDTDLALKTPAIKEDPSHAAVSRENSHQLSAPVTTPSEPANGEESGLSKRQ
                     LNQLKRKNKQSAKMGANKVRVVDLSARKTSDVTTPSVTTPHPIKAENGEERNGDSKSD
                     YFSLERPSGDDDSKIVSEFKGEAAPEKPLIQPESSDEGPSIAWPYEPMCDFLMVDLFD
                     PNWEVRHGAAMALREVIRVQGAGAGRLRGKSRSENDTLNRKWLDDLACRLICVLMLDR
                     FGDYISDNVVAPIRETVGQTLGALLSQLPSRSVIAVYRCLYRIIMQNDLGLERPIWEV
                     CHGGMIGLRYLVAVRKDLLVKDAKLMDGVLEAVMKGLGDYDDDVRAVSAATLVPIAEE
                     FVTSRQNTLGILMNIVWECLSNLQDDLSASTGSVMDLLAKLCTFREVLDAMKANAAVD
                     PESSFGNLVPRLYPFLRHTITSVRSAVLRALMTFLQLEGDGTNEWVNGKALRLIFQNL
                     LVERNETVLKLSLQVWSELLKALDKHGSFKSEAELLSHIQPLITLSMAPFGVPRYPIP
                     MNASLFIKPSGVPFPMSAAAPAKSSPSAFNNTSDATKKRGRKAEKKEVPPPSAHNVDG
                     HMLQGDIDLVGADTMLRSKIHAAKALGQLLSFWDKNGLPSLWQPILHGLKHSASTSQL
                     ATAMIIEEYARIQGSDSPYASVLCEQLRPIIEGDRPSWYGDIACYLHVARAQCHSLLN
                     AFRDHAHVPGSRLPVLAVIVQGEAEAGPSAFSLADAEKVVGPDFERLKKGLAPAQRIT
                     ALQVLNDTRATAESAINEARSVREARDLRILAAAAGALVAMHNIPKKPSHIIKGMMDS
                     IKKEENAELQQRSATAVVTLVEYYTTATKRGPVDKVIGNLVKYCCVDTSETPEFHHNA
                     GLEKSILSLRKEEDRRDHPDAAKFEREAKEARIMRRGAKEALEQLAVKFGPALLEKVP
                     NLASLVERPLTDALANELPADIHNPDNELGQEVVDGLSTLRALLPKFHPGLHPWVVSL
                     MPLIVKALQCRLSVIRYAAAKCFATVCSVITVEGMTMLVEKVLPTINNGLDVHHRQGA
                     VECIYHLIHVMEDGILPYVIFLVVPVLGRMSDSDNDVRLLATTSFATLVKLVPLEAGI
                     PDPPGLSEELLKGRERERKFMSQMLDVRKVEEFTLPVAIKAELRPYQQEGVNWLAFLN
                     RYNLHGILCDDMGLGKTLQTICIVASDHHLRAEEFARTQAPEVRKLPSLIVCPPSLSG
                     HWQQEIKQYAPFLKCVAYVGPPVERARLKGSLGDADIVITSYDICRNDSDVITPLNWN
                     YCVLDEGHLIKNPKAKVTLAVKRVASNHRLILSGTPIQNNVLELWSLFDFLMPGFLGT
                     EKVFLDRFAKPIAASRFSKSSSKEQEAGALAIEALHKQVLPFLLRRLKEEVLNDLPPK
                     IIQNYYCDPSELQKKLFEDFTKKEQKQLANKMGSSEKSDKEHIFQALQYMRRLCNSPA
                     LVVKDGHKQYDEVQQYLHAKNSYIRDVAHAPKLSALRDLLLDCGIGVDPPSEGDLGTG
                     ASYVSPHRALIFCQMKEMLDIVQSEVLKKLLPSVQYLRLDGSVEATKRQDIVNRFNTD
                     PSYDALLLTTSVGGLGLNLTGADTVIFVEHDWNPQKDIQAMDRAHRIGQKKVVNVYRL
                     ITRGTLEEKILNLQRFKIDVASTVVNQQNAGLNTMDTDQLLDLFNLGETAENAEKPSD
                     NAAGNEVDMVDIDGEVKEKGKKGWLDDLGELWDDRQYQEEYNLDSFLQTMKG"
     exon            931198..931208
                     /number=1
     exon            931346..936721
                     /number=2
     exon            936787..937084
                     /number=3
     CDS             complement(938274..940376)
                     /codon_start=1
                     /locus_tag="AO090009000350"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000107"
                     /protein_id="BAE54824.1"
                     /transl_table=1
                     /translation="MAVRRSARLRNRQASNVSHPQIHRLLTPIHSLAQVCPCFCLVKY
                     QTTNFGSWLKEPQPPASPVNNTTTDTTNNNNKLPSVMERDETPADVPSNHTTTNTTTT
                     TPKSTTNVRTPHKATPAQKQTPAKTPTSAVTRPSHQEMHPSKVHQSTTKQADSGLILG
                     FNPIKKDAEGNVMKDSLVETTPSKTKTSPASTYYGTPAFEFKFSSADSQLSDEAKKLM
                     ESVREDVARIKAQMVQEKESQPDQDSNNQTENRKIAEPKGQASRFNAAHMAEFKKMDS
                     IAGHASAFRATPGRFQPVRKDLKRTTSKARLDESNQNSPTKSPTKSPAPAPVGAKRVK
                     RDRSDDTSTRRETVGEKSASKPAVTRTRPAIRSSLMTPTRASMARTSSTSLRPPRTSM
                     LPRPSLAHSPTSKQSNTPRTPNTDFNPRFKSGLPQLNLKSILRPHQPLFSKDPAKIAA
                     GTHVAAPEFSSKFLLGSTHDASEESAVTPSPKKRVEFSSSTRLQDDEALPSPSPSKFT
                     AGSPSRVASDIVYPTLPALTPDHASKKSDSKTKSPTIRHVRQSDAPTNLSLPDIPGVP
                     HGIGSKKRHRETEATHDPSLPDVPGVPHGIGNKKRHRDAAGRDVDTENVPPADTAAEN
                     RSAKRVKLSSPSKLSPFKFSPSKMPTPSPTKARSHTPLRSTTSASRTGTPASARQKSR
                     NALTMSRLNALAQPKNRS"
     exon            complement(938274..940376)
                     /number=1
     CDS             complement(join(941286..941488,941553..942121,
                     942186..942268,942323..942381,942445..942574))
                     /codon_start=1
                     /locus_tag="AO090009000351"
                     /note="NADPH:quinone reductase and related Zn-dependent
                     oxidoreductases"
                     /old_locus_tag="AO070342000106"
                     /protein_id="BAE54825.1"
                     /transl_table=1
                     /translation="MSSSNSAVWLLEAGGQFVVQEAPLPSPGPDEVLIKNKAVAVNPM
                     DWKIQIYGPHLPFPKKYPFILGADVAGEIYEVGQDVTTFKKGDRVIGGANWFLTNEIR
                     DSGFQNYTICKVNLVAPLPDTMSFESGSVLPLALSTATMGLYPAGRLELPLPLTPKAS
                     PINKVILVWGGSSSTGSAAIQMAVASGATVIATASAKNHSFVQSLGAAKVLDYHEDSI
                     IQDLIQAIRDTPGEFLGVLEAIAEEETIRKCADVVKGLGGGRVVTNLPVPVKDIPEEV
                     ELVGVVDVANLHDHKEISEYVWGKFIPEALKDGTLKPVPEPLVVGEGLEKIPEGVSLF
                     QKGISARKIVVTL"
     exon            complement(941286..941488)
                     /number=1
     exon            complement(941553..942121)
                     /number=2
     exon            complement(942186..942268)
                     /number=3
     exon            complement(942323..942381)
                     /number=4
     exon            complement(942445..942574)
                     /number=5
     CDS             complement(943151..944551)
                     /codon_start=1
                     /locus_tag="AO090009000352"
                     /note="erythromycin esterase homolog"
                     /old_locus_tag="AO070342000105"
                     /protein_id="BAE54826.1"
                     /transl_table=1
                     /translation="MNRKFWSFIQPLRQHPTTMSQLQGLFAAAAHPLPDIKDPSFSSN
                     FDSFADYRLVLLGDGSHGTSEFYSARAEITKRLIQHHGFTVVAVEADWPDAEVIDRYV
                     RQRPGPKAKIGGHSKPIDPFTRFPTWMWRNREMQELVEWMRDYNAQVPDSKKAGFYGL
                     DIYSMGASIREVIDYLDRVDPAAGKVARQRYGCLQPWVDDPAMYGLASVRGMRNCEKG
                     VLDTLRDLLQRRLEYSENRHDGEEYHSSEQNAYLVRDAERYYKAMYYSSASSWTLRDT
                     HMVDTLRRILRHKPEGTKAVVWAHNSHCGDARHTSMGIRRKEVNIGQLCREQFGRNNV
                     ALIGCGTHTGTVAAAHEWDEDMEVMDVRPSREDSWERVAHNTGISSFLIDLRRDHIDP
                     GLAAAFEAAPLRLERFIGVIYRPDTEKISHYSAADLLNQFDGYVWFDETQAVKPLEKH
                     EPATPLGKEETYPFGL"
     exon            complement(943151..944551)
                     /number=1
     CDS             join(945664..945949,946025..946606,946665..946928,
                     946992..947044)
                     /codon_start=1
                     /locus_tag="AO090009000354"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000103"
                     /protein_id="BAE54827.1"
                     /transl_table=1
                     /translation="MKFPKCMLRRSNYPGILTRTYNSPLYPSIRRIMSDAFPDVASRL
                     ERFQEAQESLYGDLRSIANPQDWTPPQQSGGHRGRYLWTDAFGVINFITLHLQTVHDV
                     LGRTRDGQSRLPGATDDNPMGGGLRIGKIEEHGSDGDGQYHHYLTIWMFALNRLSLAT
                     GDPTYNRQAIALAKAIHPRFFIGRHLSRPRMVWKMSMDLSTALVASEGNLDPVDGFVT
                     FRLLQAAAMQMGEGEVLANEIADYRKVMERKGKHFVTSDPLDLGMSLWTAHWFAEKED
                     WATQLSGECFEHIYELFEIDRYLDRSHKYRLAFREFGTCMGIKCMSEQSTEKESAVDL
                     KVYADKILDSWNIYMQKSLATKMTPDDLRPITRVMYASALLPGAFARGYLGPEPMPSP
                     ER"
     exon            945664..945949
                     /number=1
     exon            946025..946606
                     /number=2
     exon            946665..946928
                     /number=3
     exon            946992..947044
                     /number=4
     CDS             complement(947360..948199)
                     /codon_start=1
                     /locus_tag="AO090009000355"
                     /note="inositol phospholipid synthesis protein, Scs3p"
                     /old_locus_tag="AO070342000102"
                     /protein_id="BAE54828.1"
                     /transl_table=1
                     /translation="MASPDKSPSTTIPRLYQPPTTALLVYPITLIIGSLFSVLSPTAQ
                     GTRDPPSDHPTPLAPSIAADVNLPQHPVNYFARKDNVFNVYFVKVGWLWVTAAFASLL
                     FSQLPYTTTSSQQPRRVGQALARYSLATLVWYLTTQWFFGPAIIDRSFVISGGKCEQV
                     VPQAEEGSASFHTLLTATACKAAGGAWRGGHDVSGHVFMLVLATAMLVFETIGAWRGA
                     PDIDQGSKKSEDADRELNGPRKWSVWFVGAVTGLGWWMLLMTAIWFHTWFEKVFRPFD
                     TLV"
     exon            complement(947360..948199)
                     /number=1
     CDS             complement(join(948749..948982,949041..951091,
                     951151..951203,951263..951307,951363..951505,
                     951580..951639))
                     /codon_start=1
                     /locus_tag="AO090009000356"
                     /note="beta-glucosidase-related glycosidases"
                     /old_locus_tag="AO070342000101"
                     /protein_id="BAE54829.1"
                     /transl_table=1
                     /translation="MKLGWIEVAALAAASVVSAKDDLAYSPPFYPSPWADGQGEWAEV
                     YKRAVDIVSQMTLTEKVNLTTGTGWQLERCVGQTGSVPRLNIPSLCLQDSPLGIRFSD
                     YNSAFPAGVNVAATWDKTLAYLRGQAMGEEFSDKGIDVQLGPAAGPLGAHPDGGRNWE
                     GFSPDPALTGVLFAETIKGIQDAGVIATAKHYIMNEQEHFRQQPEAAGYGFNVSDSLS
                     SNVDDKTMHELYLWPFADAVRAGVGAVMCSYNQINNSYGCENSETLNKLLKAELGFQG
                     FVMSDWTAHHSGVGAALAGLDMSMPGDVTFDSGTSFWGANLTVGVLNGTIPQWRVDDM
                     AVRIMAAYYKVGRDTKYTPPNFSSWTRDEYGFAHNHVSEGAYERVNEFVDVQRDHADL
                     IRRIGAQSTVLLKNKGALPLSRKEKLVALLGEDAGSNSWGANGCDDRGCDNGTLAMAW
                     GSGTANFPYLVTPEQAIQNEVLQGRGNVFAVTDSWALDKIAAAARQASVSLVFVNSDS
                     GEGYLSVDGNEGDRNNITLWKNGDNVVKTAANNCNNTVVIIHSVGPVLIDEWYDHPNV
                     TGILWAGLPGQESGNSIADVLYGRVNPGAKSPFTWGKTRESYGSPLVKDANNGNGAPQ
                     SDFTQGVFIDYRHFDKFNETPIYEFGYGLSYTTFELSDLHVQPLNASRYTPTSGMTEA
                     AKNFGEIGDASEYVYPEGLERIHEFIYPWINSTDLKASSDDSNYGWEDSKYIPEGATD
                     GSAQPRLPASGGAGGNPGLYEDLFRVSVKVKNTGNVAGDEVPQLYVSLGGPNEPKVVL
                     RKFERIHLAPSQEAVWTTTLTRRDLANWDVSAQDWTVTPYPKTIYVGNSSRKLPLQAS
                     LPKAQ"
     exon            complement(948749..948982)
                     /number=1
     exon            complement(949041..951091)
                     /number=2
     exon            complement(951151..951203)
                     /number=3
     exon            complement(951263..951307)
                     /number=4
     exon            complement(951363..951505)
                     /number=5
     exon            complement(951580..951639)
                     /number=6
     CDS             complement(join(954636..954804,956611..957212,
                     957278..957311,957788..957882))
                     /codon_start=1
                     /locus_tag="AO090009000357"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000100"
                     /protein_id="BAE54830.1"
                     /transl_table=1
                     /translation="MPSLNLNTPFQPLIEHAGTCGKGPANQPTISLNIPVAIVTGATS
                     GIGADIARDLHSRGWKVACVGRRAQAGNDLVQSLGENARFYQADVSDYQSQAAVFRKV
                     FRLWGRIDALCANAGVGDQSSLYLLNRRDKGVEDVPPEPDLSCTDINFKGVVYGTVLA
                     THFMRHNRPEAGGRIVVTGSIGGIFPHRTYPEYSGTKAAVNQFVRGVAPVLKAKDNIH
                     INCVLPGIVATPIVPPEMIEAVAPECRRISSATPSILPRLEQGNATNTEAPRRVPFPR
                     AEVPDDTCVVNIHTRNSISGPST"
     exon            complement(954636..954804)
                     /number=1
     exon            complement(956611..957212)
                     /number=2
     exon            complement(957278..957311)
                     /number=3
     exon            complement(957788..957882)
                     /number=4
     CDS             join(960570..961104,961163..961244,961286..961406)
                     /codon_start=1
                     /locus_tag="AO090009000359"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000098"
                     /protein_id="BAE54831.1"
                     /transl_table=1
                     /translation="MVSTRHHPRDFPPPSTGKASSPSNNSNGTTNRWVHAPSTAIIIW
                     LVVSVPVVIWDAGYVLLRPHSMPGNKLHFPIWIPYARYGAIDYIYGWPAFNARNGFPA
                     AQTVLNLVECIGYIYYLWMVYRHGVSSSGGRGQRKTKKGLMWMLRTEKVVSGRTGATA
                     LLVAYSASLATLSKTVLYLLNEVFSGFDNIGHNDAITLISLWIIPKWASGLWIIFPGY
                     NSYILGAEIVASLESAVPRQRVGRSKL"
     exon            960570..961104
                     /number=1
     exon            961163..961244
                     /number=2
     exon            961286..961406
                     /number=3
     CDS             962321..965368
                     /codon_start=1
                     /locus_tag="AO090009000360"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000097"
                     /protein_id="BAE54832.1"
                     /transl_table=1
                     /translation="MTTASNAKPPPTDPQSSPYPPEATASSRNFVPSFSRDQDEISWT
                     SPQSTFSGIPNDDPRLALGVPPPVMIPPESDESPLASSAGLTLGHDDIALPDDIDTHS
                     RASSRDPGSVQTGGDISTILEGGYDHHPDDGKGDSVNGEQRNEKPAWSEMKTKAGKER
                     KRLPLACIACRRKKIRCSGEKPACKHCSRSRIPCVYKVTTRKAAPRTDYMAMLDKRLK
                     RMEDRVIKTIPKEETRDMAAIGRSVVRPPQPGQASKSQKKRSADEAFANEMDEWARGE
                     RKASLDIFPMRRESKINDVTGLMTEGAEFLPSLEIQEHLAEVFFDCVYGQSYLLLHKP
                     SFMRRLKARTVPPALILAVCAVSARFSTHPQLNSEPPFLRGENWANPAAAIALSRHDA
                     PNITILTVFLLLGLHEFGTCHGGRSWSFGGQALRMAYALQLHNELDEDPLLSQTNGGG
                     SQLSFTDREIRRRTMWACFMMDRYNSSGSQRPPIGNEKFIQIQLPIKESHFQMEIPGP
                     TEDLDGNVPNPVPEDVGQLSNAKDNMGVSAYIIRAIVLWGRIVDYLNLGGKKKDVHPL
                     WSPESGYTRLKRQIEEFSASLPSHLAFTYENLQIHAADRIANQFLFLHIIIHQNMLFL
                     NQFAIPLSPGGRPPRDMPKAFLSNAGRAAVEAAHHISVLIDRASAYPLTVPFAGYCAY
                     SASTVHIWGIFSKNSQLEARSKENLRHTYRYLNKMKKYWGMFHYMVESAKDRYRQFAD
                     AAIKGSVVTQNGSQISAMFQYGDWFDKYPHGVSRMHWEDPNAQKKNKTDEAVMSQKPD
                     LQSVEDFFASLSPTPQPSVSGRQHSKKDSRGESLSDMGQPTSQPMVDINTPGMMNTPG
                     AGFPQPALFNQARGQLYGQYPFDFPVPADQLPQLDRQFVYGSFGGLDPSTNFMPSENP
                     PISTVNGSEPSPATAPDNSAIFPGQLDPNAPAGVGEYYQPSAWFLPFNLDPVSAGVGL
                     DPSPAQVPGSGTPDMSTFNGGNMPMGTFDMGMASVNRGPQMNE"
     exon            962321..965368
                     /number=1
     tRNA            complement(965836..965906)
                     /locus_tag="AO090009t00012"
                     /note="tRNAscan-SE"
                     /product="tRNA-Gly"
     CDS             complement(join(966832..966852,966912..966935,
                     967074..967200,967264..967548,967611..967984))
                     /codon_start=1
                     /locus_tag="AO090009000361"
                     /note="cation-independent mannose-6-phosphate receptor
                     CI-MPR"
                     /old_locus_tag="AO070342000096"
                     /protein_id="BAE54833.1"
                     /transl_table=1
                     /translation="MKSLATSLLGFLLLLSAPHASVYAASDSKGSNALPPCVARSPTT
                     GFYYDLNSISLSPPKTKDEKLRGNVRDESWHAKGHDYHANFTINVCAPVVENIKDVVG
                     VDRARWQNVSAYYEKEGKVYSIGQQASEPFFRGRKLVLNYTDGSPCAGELIGNASRTK
                     STIMSFLCDRDAPAHQATASFVGTMDQCTYFFEVRSSAACGAVAPADGQGLGPAGVFG
                     VIALIAVVAYLVGGCAYQRTVMHQRGWRQCPNYSLWAGMFDFVKSSITSRESTYVEHG
                     "
     exon            complement(966832..966852)
                     /number=1
     exon            complement(966912..966935)
                     /number=2
     exon            complement(967074..967200)
                     /number=3
     exon            complement(967264..967548)
                     /number=4
     exon            complement(967611..967984)
                     /number=5
     CDS             join(968508..968587,968643..968947,968999..970104)
                     /codon_start=1
                     /locus_tag="AO090009000362"
                     /note="sterol reductase/lamin B receptor"
                     /old_locus_tag="AO070342000095"
                     /protein_id="BAE54834.1"
                     /transl_table=1
                     /translation="MAPKKNSKTKVPIQPVPEKRGYEFLGPPGAFAFVTCLPTLIYAF
                     TFLCNDVSGCPAPSLLNPSTLSLDQLKAEVGWPQDGLNGFFDARVTLWVLSYYLLSLV
                     LYVFLPGEEVEGTELACTGRLRYKFNAFPSAVLILSGLALGTYVYGADFAVWTFLWDN
                     YVQVITANLVICTAIAVFVYVRSFSIPAPGQLNPELRQLAPGGHSGNALYDFFIGREL
                     NPRVQLPIPFVSEASRTIDIKVWCEMRPGLLGWNILNLSNIARQYRTYGYVTDSIVLS
                     TAFQLFYVLDGLYMEPAVLTTMDVIMDGLGFMLSFGDMVWVPFVYNFQTRYLAVHPVE
                     LGLKGILLILAVTGVGYSIFRGANNQKNRFRTDPNDPRVKHIKYIETASGSKLMTSGW
                     WGMARHINYLGDWLMSWAYSLPTGFAGYTLIESINQTGDVQKRVVQTPEVRGWGMICT
                     YFFLIYFGVLLIHRERRDEEKCKRKYGADWDRYTSLVRSRIVPGIY"
     exon            968508..968587
                     /number=1
     exon            968643..968947
                     /number=2
     exon            968999..970104
                     /number=3
     CDS             complement(970294..970830)
                     /codon_start=1
                     /locus_tag="AO090009000363"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000094"
                     /protein_id="BAE54835.1"
                     /transl_table=1
                     /translation="MGASASRRTKPAVISAVWAAASSVLVPSVVDNGAKSLPKLAGSR
                     TGLYETIINGVKQGNRASEPLARGASALSRARLWGLSKEIVQSCVDDHDQETGTEIGV
                     EERQSVELDVTKRIADASTYREFKKEPTVLTESLEARRSAIREARRVLSGWIPNLGDE
                     NWGLEVLIDPKKRKRCPN"
     exon            complement(970294..970830)
                     /number=1
     CDS             complement(973226..975277)
                     /codon_start=1
                     /locus_tag="AO090009000365"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000092"
                     /protein_id="BAE54836.1"
                     /transl_table=1
                     /translation="MAALQEALECLAPTTWDEVPTDPSSLRTYINDLSTKAHLIVNSV
                     PEPPPATTTTTTHQVKPSPARLNTTDPTLQSLQQQWSKPIKVSSTRDNPLDLLIHKLP
                     GNDGKGHWFGRRSVHEGLPFSTWQAKLSSEMTETLKANRERMKHGQTPDQSVRGIGAE
                     KQVETIEVKDESGEKVLAHVTVFHVSAQFPKPTTPRDFVSLIVSWEVGVEEGGRFWMM
                     VSKPVEHADAPPCQGYIRGQYESVEFIREIPVKRGGGGDAQGVVEGSSNGVIEAASKE
                     KQGSGAEEETNPVEWIMVTRSDPGGNIPRWMVEKGTPKSICSDAVKFLDWACRDPNSV
                     SEPGMDDGRHKRRRNSLHTAGVQEDEDSEISDSEFSDTEVEHHGLIASFAYLLNAGLE
                     RYAPQAVLDYIPGHSHHPSGDMSDVTTEDGERAPRSSGDPVPQRDATERDKDDTRSQL
                     SQDKASSINSGLATPIEAGHHDIPPVDLMKIEKKDGKLTSHEKQLAKLAQRKREVEAQ
                     LDRVREDIRSLHLPSREEGFKRDKASAAALAAADASNDQLSTSAGSSNQRKTPESRSS
                     SSNNLAHPANSRDPAKMHKVASGLFSEESKLLKQLGKIEKHQLKEASKIESKQRKQAE
                     QEEKTKSRTENDILRHENEHLRKELERLRNERRQWLELIASLQTENTNLAAAAGKKSD
                     A"
     exon            complement(973226..975277)
                     /number=1
     CDS             complement(976887..977930)
                     /codon_start=1
                     /locus_tag="AO090009000366"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000091"
                     /protein_id="BAE54837.1"
                     /transl_table=1
                     /translation="MPTVLLPSSAAAFAPRSSPNVVLNTKIEPWLTATLKRVSRVKRP
                     LNNVTQHTKCLTETLSSPNAIWTLCSMMFPKAPEAELRRDENPWVEAFFNYQMIHVEA
                     YVVHVDMVSRNEVAFKLTPETIEALVDFHKEVYSVDTAASTWDWSEKESQLKKLQEEF
                     VQAANKFVYRASAQALEGLEEDGAGELLGGRSEEAKSAITSLFVPLLPPPPRVVDVLR
                     STPVLPSSTGPETWWHDPMQQPVSMDTWKVLPSSPATASTGDSNPNIWTSMNNMNEFS
                     YASPTPSYSQPYTTSPYNATQYYSTAATSAALAALPLPSMLVQPCSTAANMIGFGWGD
                     RYQDFALPYGTTM"
     exon            complement(976887..977930)
                     /number=1
     CDS             join(991256..993496,993553..993591)
                     /codon_start=1
                     /locus_tag="AO090009000369"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000088"
                     /protein_id="BAE54838.1"
                     /transl_table=1
                     /translation="MRFSTVVSALLLSSTSLATPAQDFSALGNASSQGAPEEHPIAQT
                     PAAAAAAQPSDNASQQQNVNVQQPTAQPSQQPTVNVQQQPTAEPSQQQSANDEQQPTA
                     NVAPQSNAAPEPSSSPNANQQTDGGLLSHLIPTGVAESSAQQESNAPTPTASPAESEG
                     SASPTEQSTTQGSATKTAASSSTSSAGSPWESLIPDGVTGNPGTDLGNGLQGLLGLLS
                     PTFLKDVESFFHHFAYLFDDQTTEQTKSLINIGSGLLTQDLIKELNSLLSNAGKLLTS
                     DFVDEIQKLIKQLGPLLTDDLFKQISTLLNNGNDLLTADFVKEVNALIGNANQLLTAE
                     TVKELRQLIDSLGPLLTPELFKEISGLLNNANDLLTADFVKEVKSLISAVGPLLTPEL
                     FKEISGLLNNANDLLTADFVKEVKSLISAVGPLLTPELFKEISGLLNNANDLLTADFV
                     KQIKSLINSLGPLLTPELFKEISSLLDNANSLLTKDFVDTVKNLLNEAGPLLKPELFK
                     QISSLLDNANNLLTPSFVNETTGLIDTISPVLTPDLLLKVGSLLNSAGKLLTDGFVDE
                     TNTLIGNANSLLTEKFVKETSGLIDGIAPVITPELLGLVGGLLANANSLLTPKFVNET
                     QGLIDGISPVLTPELLTQVGSLLNNAGKLLTSEFIDETKSLIGNVAPVITPDLLEDVG
                     FLLGNATNLLTPKFVNETRDLIDDVAPVITPELLGEVGGLLGNANDLLTKKFVNETQI
                     LIEDASELLPVVVKILGTL"
     exon            991256..993496
                     /number=1
     exon            993553..993591
                     /number=2
     CDS             complement(994242..994661)
                     /codon_start=1
                     /locus_tag="AO090009000370"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000087"
                     /protein_id="BAE54839.1"
                     /transl_table=1
                     /translation="MNQEPLSPPSEPTPSPTTNPVPLSSPQRTTPIHPLLPEVRVPGE
                     PLPPHRYHPITCTQIDAESEDIRAQLEQLRQEYTSPEAALRAQEQAAREVKQKMEDAE
                     RKREDVQKAMDKKIKERNTEMKVLSKYQEVKVSDIPA"
     exon            complement(994242..994661)
                     /number=1
     CDS             join(995725..996094,996201..996244)
                     /codon_start=1
                     /locus_tag="AO090009000371"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000086"
                     /protein_id="BAE54840.1"
                     /transl_table=1
                     /translation="MAFGGITGVISSEQTDPDDLGPLPSIHMQSREAADMQDMYRRTL
                     AASWNSRSDDVPADKLVEDLFSGSISWSNEVHGLQSAEAKGGEHLPSIGAATKNTSAN
                     RLSPNFERRPKSSSSNQFRIDAMTTNSRSLMFGRT"
     exon            995725..996094
                     /number=1
     exon            996201..996244
                     /number=2
     CDS             996565..998895
                     /codon_start=1
                     /locus_tag="AO090009000372"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000085"
                     /protein_id="BAE54841.1"
                     /transl_table=1
                     /translation="MLSRSSKGVAGLLSCPIPPSSRKCSSPSTLRLRDVFVRSQHTDG
                     ESENDSTESADSAENIESTENTESTESRPRRYRRRFKPQTTPKKEFDKVPINVSSLGN
                     PGEVVVVPPPKRRRFAWLKNPQYRIDQDTKTALPFMLNDIENDDLLDSDLITERIESF
                     RAHYRPGDKLSPTDWENLRSGFQTSFTNQQLSDYIEQFKAEDTVPEEGLMLHGGAKLA
                     EWRPGTSAFFETESAPQAGAAKRVAKSLDLRGKYVLTERILRDCWHLGLIGEVGQLDV
                     RLPAHSLSLFLHSEHFSFEELAGLHDAKIDITHSLGLVRITGKQHSCEFIRDIIYDAT
                     TRIREEDLELYPPGATPKGKNRVFTADFLSWISKTYGVSFDLTTTTPTKLFYLAENKP
                     KADSARRTLNLAIHDATQPPIPFGTYMPASEPVDTYDINPELNVSWFDRQKSWFRWAV
                     PSAQTAPSSMSDAPFFSKHEMRLSDELLKLLRARARTKLGNAEAHESITAAVGRCLFE
                     HKPFEGKAITAAQLGKMAPPRTFTTDIPRVIPFLHQLTADYPEDEEIQPHRLRLVPSA
                     IHAHIFPQLELEVAIAPGGFEYNVQNAKAILSQSSVDYLLPESGLDLRFTRKLTHDVL
                     DSFGEDAPLQPLQDSLQDFFSKAVIYEGETPLPAFSQLSIPNHLLVETGEERDPDGFT
                     TAEYMYLPVNDFRGTRLHQYNYEGHRLNYSFYESGPFSPHRTTDIFLDMDVDGSEEQS
                     PSENGDSQEPVQQEFGSFYKAACSLAFELDRSGRVM"
     exon            996565..998895
                     /number=1
     CDS             complement(join(999182..999214,999331..1000890))
                     /codon_start=1
                     /locus_tag="AO090009000373"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000084"
                     /protein_id="BAE54842.1"
                     /transl_table=1
                     /translation="MTDPNYTPPTVEDIFRYRYQHGTNLGSMFVHGPWLSDGASSSDS
                     GGSRELEEVKRSVRIGRSPTLLASLLIHFHAHRSLKACGLKETRSKWEAHWRTALTDF
                     DIIWLKDVARCNSIRIPIGFFTLGPVFCTGTDFEGEPSEVYVNCWNILKRLIEKCYHH
                     GIGVLIDFQTIPGSMDRNSHSEIGIADFCASERNWTMATDCVAFIVQEVTYHAMFGVI
                     GVQISSETDWKTCDLRKWYDEVLEITSCINPPLPIYISDGGNFADALDYAMMKNRLES
                     PVARSPIIVDTHKYYTTGSYQHMDPRDIISRIHNELSELSTRQGKVGSQRTAVDAYIG
                     QYSCALDAQTWDRVDASERPTLTKAFGQEQSKQWESKACGSAFVGFKIHRITGDEWDF
                     ERQVSADAIPSPSWLAIPRAQVIIKIAQAESQRLRSRETALSQHSDSSDTCEYQQYAL
                     GWDFGFKDALNFFGALSQDVITGGWNGGEKIGAMELWIRKRFADTGKLNEDFAEEWEN
                     GFRKGVSDFYDLADLPGKIIHG"
     exon            complement(999182..999214)
                     /number=1
     exon            complement(999331..1000890)
                     /number=2
     CDS             complement(join(1001377..1001829,1001890..1002303,
                     1002358..1002390))
                     /codon_start=1
                     /locus_tag="AO090009000374"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000083"
                     /protein_id="BAE54843.1"
                     /transl_table=1
                     /translation="MNGYKNIVLIGASGDIGKIILDGLVASSSFHITVLSRKESNASF
                     PAGITVCKSDFSDADLEAVFNGQDAVISAVGATAFGEQKKIVDAAIRSGVQRFIPSEF
                     SSNSQNEAVLKLAPFFGQKKELIEYLKTKQPDGLSWTAIATSGLLDWGLGNGFLGFDV
                     ANRTATIWDGGNQSFTLTNEKQLGEAVVSVLQQPQETSNKYLYIASVETTQNEIVAAL
                     EEVTAAKWSMKATATEEQVGEGFKKLGAGDFSGAFHLVRATCFGNTPGLQANYAKDLT
                     LANDVLGLKLESVRDTVKRVVAQ"
     exon            complement(1001377..1001829)
                     /number=1
     exon            complement(1001890..1002303)
                     /number=2
     exon            complement(1002358..1002390)
                     /number=3
     CDS             1003799..1005034
                     /codon_start=1
                     /locus_tag="AO090009000375"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000082"
                     /protein_id="BAE54844.1"
                     /transl_table=1
                     /translation="MKIGLHCDGADLGLSPFEIEMRRRLWWQICILDVRTAEDHGSEP
                     TILEAAFNAELPLNINDTSLQPDMSELPQVQPGKTEMTFTLVRFEVSHFVRRVTFSDR
                     FCRTNSYPILSEAKKCEAIEQFKERVEKQYLSYCDKEVPLDFITATSTRLILVKLKLA
                     VCKLRKDQAPGMLMQTIYRRTCEEVLQHAQTLRNYEKGKRWLWLFQTYVEWDSLAYLL
                     LHICTAPPEELSDATWKIVDEIYHHWKCESGIYRDRRWRLIEELRFQALSARATKQKI
                     PQLPRATQPGHHTTPEQYDLGPAARLHKDPSARAHRTTDTGIDQPSNAEAAAYVHPSQ
                     VAGFQTTESNPTVDQPFPMGTLISAATATSVTQPVDEAMSSAAELPSGGTGCEWSAAL
                     FEVFWDLTGSGQGASVSWL"
     exon            1003799..1005034
                     /number=1
     CDS             join(1005648..1005671,1005740..1006255,1006283..1008034)
                     /codon_start=1
                     /locus_tag="AO090009000376"
                     /note="myotubularin-related phosphatidylinositol
                     3-phosphate 3-phosphatase MTM6"
                     /old_locus_tag="AO070342000081"
                     /protein_id="BAE54845.1"
                     /transl_table=1
                     /translation="MERTRVAKVEDVTLARRGEQVVGTLHLTPHHIIFSHIPSLPDSA
                     QPSATPARPRELWITYPIISFCTFRPAPAASRQPSSIRLRCRDFAFVCFYFASETKGR
                     DVYESIKQWTCKLGRIEKLYAFTYQPPPPERELNGWELYDPLKEWARQGVDRDNHGWR
                     ISRINTDYTVITYSGSGFENFSPTYPALLPVPSSISDNTLNYAGRYRSRARVPVLTYL
                     HPVNNCSITRSSQPLVGVRGNRSIQDEKLLAAIFSTSRSKRPLANFCPAHLDRESSGS
                     MQGDANDETVTDLTRAEDLEDELLTSFHGDSDGKHQVYGAQQHNLIVDARPTVNAFAM
                     QAVGLGSENMDNYKFATKAYLGIDNIHVMRDSLNKVIDTLKDSDVTPLGPNRDQLARS
                     GWLKHITGILDGAGLIARQVGLQHSHVLIHCSDGWDRTGQLSALSQICLDPYYRTMEG
                     FMVLVEKDWLSFGHMFRHRSGHLNSEKWFQIENERIGGDSSRGFGEAGGAGKAIENAF
                     LSAKGFFNRDNTSRDSLPESDGEMQSYDSDTPGPKKLSSAPRSVTPEKEMTKVKETSP
                     VFHQFLDATYQLLYQYPTRFEFNERFLRRLLYHLYSCQYGTFLYNSEKERVESKAKER
                     TRSVWDYFLARREQFLNAKYDSHIDDHKRGKERLIFPRLNEVRWWSEAFGRTDAEMDG
                     IRSTGSPPAQRENIDRERSPVLTGIETAQDVVTSSTGMKGAHNAASAGIAAVTSGISS
                     LAFSKKENGQDPKSMGQLEVEMR"
     exon            1005648..1005671
                     /number=1
     exon            1005740..1006255
                     /number=2
     exon            1006283..1008034
                     /number=3
     CDS             join(1008664..1008817,1009036..1009349,1009484..1009816)
                     /codon_start=1
                     /locus_tag="AO090009000377"
                     /note="40S ribosomal protein S3"
                     /old_locus_tag="AO070342000080"
                     /protein_id="BAE54846.1"
                     /transl_table=1
                     /translation="MAAVQGAISKRRKFVADGVFYAELNEFFQRELAEEGYSGVEVRV
                     TPTVTDIIIRATHTQEVLGEQGRRIRELTSLIQKRFKFPENSVSLYAAKVQNRGLSAV
                     AQCESLRYKLLNGLAVRRACYGVLRFIMESGAKGCEVVVSGKLRAARAKSMKFTDGFM
                     IHSGQPAKEFIDSATRHVLLRQGVLGIKVKIMRGSDPEGKAGPQKTLPDSVTIIEPKE
                     EQPVLQPMSQDYGAKAIAAQQAAEQQRLAEQQAAEGQEGAGAETFQQE"
     exon            1008664..1008817
                     /number=1
     exon            1009036..1009349
                     /number=2
     exon            1009484..1009816
                     /number=3
     CDS             complement(join(1010354..1010517,1010580..1011388,
                     1011446..1011687,1011742..1012008,1012068..1012197,
                     1012258..1012321,1012485..1012525,1012586..1012638))
                     /codon_start=1
                     /locus_tag="AO090009000378"
                     /note="Phenylalanyl-tRNA synthetase beta subunit"
                     /old_locus_tag="AO070342000079"
                     /protein_id="BAE54847.1"
                     /transl_table=1
                     /translation="MPTISVDKAALFKELGREYTTEEFDELCFEFDRPIVDGVQEPPQ
                     LKIEIPANRYDMLCFEGIALMLNIFLGRKSLPNYRLVEPANGELQKIIVKEDTTKIRP
                     LVSGAILRNIKFDQARYESFIALQDKLHQNLARQRTLVSIGTHDLDTIQGPFTYEALP
                     PKDIKFVPLNQTQEMNGEELMAFYEKDKHLGRYLHIIRDSPVYPVIYDSKRTVCSLPP
                     IINGDHSKITLDTKNVFIEITALDKTKVEIVNKMMVAMFSQYTSEPFTIEPVQIVSDH
                     NGETRITPDMSSRTTQAEVSYLNQCCGLNLSAEEIAKILTKMAYTARPSAESADLIDV
                     DIPPTRADVLHQADIMEDVAIAYGFNNLPRSFPSKSGTIAQPLPINKLSDIVRTEAAM
                     AGWSEVLPLILCSHDENFAWLNRKDDGNTAVKLANPKTLEFQVVRTSLLPGLLKTIRE
                     NKHHSVPMKIFEVSDVAFKDLSLERKSRNERHFAAAWYGKNSGFEVVHGLLDRVMAML
                     KSAFITGEEGLEKPGMSDSQYWIEELDEATYFPGHAASVHLRIGGKEHVIGAFGILHP
                     TVLEKYELKYPVSTLELNIEAFL"
     exon            complement(1010354..1010517)
                     /number=1
     exon            complement(1010580..1011388)
                     /number=2
     exon            complement(1011446..1011687)
                     /number=3
     exon            complement(1011742..1012008)
                     /number=4
     exon            complement(1012068..1012197)
                     /number=5
     exon            complement(1012258..1012321)
                     /number=6
     exon            complement(1012485..1012525)
                     /number=7
     exon            complement(1012586..1012638)
                     /number=8
     CDS             join(1013516..1013578,1013653..1013758,1013827..1013978,
                     1014031..1014489,1014584..1014698,1014751..1014895,
                     1014955..1015055,1015104..1015441,1015496..1015828)
                     /codon_start=1
                     /locus_tag="AO090009000379"
                     /note="protein phosphatase 2A regulatory subunit A and
                     related proteins"
                     /old_locus_tag="AO070342000078"
                     /protein_id="BAE54848.1"
                     /transl_table=1
                     /translation="MESQGENDELYPIAVLIDELKHDDVLIRLNAIHRVSTIALALGA
                     ERTREELIPFLDDSVEDEDEVLTALSEELGNFVEYVGGPEYGHVLLSPLENLAAIEEP
                     LVREKAVESLNKIGEQLSEKQIEEHFIPMVLRLSKADWFTSKVSATGLYCIPYKKSGQ
                     ALQQSLRQYFGGLVHDDTPMVRRQAANNLAKFVKEMKTPVVIEEMIPLFQYLASDDQD
                     SVRLLTVDILISIAEEIPKEQQPSHGVLLTSLRNLFEDKSWRIAKAVHEEVITRDMVP
                     SFVKLLKDTEAEVRTAIAGQIPGFCSLIDRETLLNEIMTSVEDLVSDPSQHVRAALGT
                     QISGLAPILGKEETIAHLLPMFLQMLKDEFPDVRLHIISKLELVNNVIGIELLSQSLL
                     PAIVQLAEDKQWRVRLAIIEYIPLLASQLGVKFFDEQLSDLCMSWLGDTVFSIREAAT
                     QNLRKLTEVFGVDWAKGSIIPKVMAMGQHPNYLYRMTTCFAISTLAPVVSLDIIENSI
                     LPILDRLVTDEIPNIRFNVAKSYAVLIDTLRRLPAEGTLANVEGKTATPSPRSQDLIQ
                     QRIIPSLEKLQGDDDVDVRYFATTAAGGNDEVMQTSP"
     exon            1013516..1013578
                     /number=1
     exon            1013653..1013758
                     /number=2
     exon            1013827..1013978
                     /number=3
     exon            1014031..1014489
                     /number=4
     exon            1014584..1014698
                     /number=5
     exon            1014751..1014895
                     /number=6
     exon            1014955..1015055
                     /number=7
     exon            1015104..1015441
                     /number=8
     exon            1015496..1015828
                     /number=9
     CDS             1016853..1017290
                     /codon_start=1
                     /locus_tag="AO090009000380"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000077"
                     /protein_id="BAE54849.1"
                     /transl_table=1
                     /translation="MSSLTSISQPALTPYHRLFGRIVMSPLLAVHAALYLNFFAQSSH
                     PDFGSLLAKRIQDPDVQWGFGGLTFAFMILFFVRPLRTAFWVQLWPTSSVKARREMFY
                     YGHVSLVVLLCIAAYFHVAQAQIFVIEALGASALNGVCGLLLG"
     exon            1016853..1017290
                     /number=1
     CDS             join(1018826..1020603,1020656..1020707)
                     /codon_start=1
                     /locus_tag="AO090009000381"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000076"
                     /protein_id="BAE54850.1"
                     /transl_table=1
                     /translation="MRRQRLVVSLATVVFVCISLILLRDTTVPRLSNGLNAPFEANPL
                     PSSYPPSPSVAVPNPIEPSKGRQALHPQNVHPMSSLIKDAEQEFSHLQSRQSKTLADA
                     VKEYRRRYNMHPPPHFDKWFQFAQAKGVQLIDEYDTIYHSLLPFWSLEPKTIRERARE
                     ALGYDNSVIGVLIRDGKVTHTEGGREGYEWQQDATVDMMQSFIRYLPNMDLVFNTHDE
                     PRVIVPSDDLQRLVNFAKDHVIPKAFHDQPLVNKWSDKPADLNKGDRVDEVRTTRFNR
                     FAHQPTWTSSRASCPLDTPARSLNESEPDNLEAYAYGDLGFIYNTTAFSDICNTPSLR
                     YKYGFFDRANAFDVVRDLFPVFSQSKISSFQDILYPSPWYWADKVPYEEGKDHSWDAK
                     ADKLYWRGSTTGGFARAGGWRRQHRQRFVSNINTQSTAKVLSKNGNDQWELNEVNFDP
                     YRDQFDVKFTYIGQCDPNDCAAQQEYFVVGEPAGQQDAWAFKYLVDIDGNAFSGRYYA
                     FLRSHSLVFKIAVFREWHDEWLKPWVHYVPLSLTGDEYVETTRYFISEEEGRTAAPRL
                     AQQSRDWAQKSLRREDLEVWFFRLLLEYGRLVDDNRENLGFSL"
     exon            1018826..1020603
                     /number=1
     exon            1020656..1020707
                     /number=2
     CDS             join(1021640..1021787,1021857..1022326,1022384..1023196)
                     /codon_start=1
                     /locus_tag="AO090009000382"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000075"
                     /protein_id="BAE54851.1"
                     /transl_table=1
                     /translation="MAKALSGILKHTFVFAYGLFTLILYGLTAIRKGFFFRGTTEKEH
                     LELQLARDRFWNLSKTWSGLSHHYIILRNGFKFHYVSNDPPEGPAADKPLIIFIHGFP
                     DSWAVWRHLLKSKALQEAATLVAVDLPGYGGTDSLEEYSSTNVLESLAGFIIAIRAKY
                     GIDTDAGIRQRRTVIVSHDWGCVLSMRLAAEAPQLADRFILSNGPLVSMVASNIRRSL
                     SSSLKMFKTALRSPIKSRSTLYKAIKSLKPVARQLLLSGYIFVMQLPMPFVVYLGTGG
                     NYSFLKLAHKGSYGNSPFSLEDAAECMASSLGPSVEECRTQTYDGEGYPASVVKERAL
                     GNFQHMARYYREKAATSRWQKSIETIADLHSISGGNELHRASSGAGLFDDGLTGVLKA
                     HSTIIWGKADIALDPQICLNGFSDYLVRNSQVVELPRSGHFTPLERESCAALTRAVEW
                     AAGGEKEDIGAAIQRDYPDAVVTVRK"
     exon            1021640..1021787
                     /number=1
     exon            1021857..1022326
                     /number=2
     exon            1022384..1023196
                     /number=3
     CDS             join(1025445..1025545,1025601..1026255,1026323..1026442)
                     /codon_start=1
                     /locus_tag="AO090009000383"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000074"
                     /protein_id="BAE54852.1"
                     /transl_table=1
                     /translation="MGEHPQHPQHSHKPPPSPEPQTFEPPRTQWDPAREPPPLNTKPE
                     GIALESKTYTMSEDNGLFKPPPFYPEAPKNMYYEVPSTKPEPEKLSQIFPWENQAPKP
                     TRVFVNDDQGSVSLPSSMLSPVSPKEPPTSSVEYTASWTTEKRSESWDSYSRSNAWDD
                     VPEIQRYIQSIAPPRRAKVQVIGGWGSSANQQTAGAESSMRLTDFPSEQERPSLPVTP
                     APIRRPPPSSNVLGERSTSGQLPIAEGVPNQEEWNPSIRLEELQRHHSEVLKNPDLLL
                     ERIERAARERSRRYS"
     exon            1025445..1025545
                     /number=1
     exon            1025601..1026255
                     /number=2
     exon            1026323..1026442
                     /number=3
     CDS             complement(join(1027196..1027360,1027478..1027738))
                     /codon_start=1
                     /locus_tag="AO090009000384"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000073"
                     /protein_id="BAE54853.1"
                     /transl_table=1
                     /translation="MPYLQPDPDPEPTSQPTNAFDQLVQDLSAALGPSSGLDSDDVDP
                     LNIQRLMDQYTSNPEEWQPFALSDLSKSYTRNLIDEGNGKSNLLILVWSPGKGSAIHD
                     HANAHCVMKVFLYPFLLVSRSSSWPREGWWGCVGLIQAH"
     exon            complement(1027196..1027360)
                     /number=1
     exon            complement(1027478..1027738)
                     /number=2
     CDS             join(1028328..1028348,1028531..1028573,1028633..1028710,
                     1028775..1028811,1028865..1028935,1029002..1029339,
                     1029409..1029765,1029866..1029953,1030016..1030035)
                     /codon_start=1
                     /locus_tag="AO090009000385"
                     /note="GTP-binding protein DRG1 (ODN superfamily)"
                     /old_locus_tag="AO070342000072"
                     /protein_id="BAE54854.1"
                     /transl_table=1
                     /translation="MSTTVEKMARTQKNKATSYHIGQLKAKLAKLKRELLTPTGGGGG
                     GGGAGFDVARTGVASVGFIGFPSVGKSTLMSRLTGQHSEAAAYEFTTLTTVPGQVLYN
                     GAKIQILDLPGIIQGAKDGKGRGRQVIAVAKTCHLIFIVLDVNKPLVDKKVIENELEG
                     FGIRINKQPPNIVFKKKDKGGIAITSTVPLTHIDHDEIKAVLSEYRISSADISIRCDA
                     TIDDIIDVLEAKSRAYIPVVYALNKIDSITIEELDLLYRIPNACPISSEHGWNVDELL
                     EMMWDKLNLRRVYTKPKGKAPDYTAPVVLRANASTVEDFFKQAIVYGRSVKHQPQRVG
                     LTHELADEDIVTIVKR"
     exon            1028328..1028348
                     /number=1
     exon            1028531..1028573
                     /number=2
     exon            1028633..1028710
                     /number=3
     exon            1028775..1028811
                     /number=4
     exon            1028865..1028935
                     /number=5
     exon            1029002..1029339
                     /number=6
     exon            1029409..1029765
                     /number=7
     exon            1029866..1029953
                     /number=8
     exon            1030016..1030035
                     /number=9
     CDS             complement(join(1030135..1030286,1030694..1030732,
                     1030862..1031003))
                     /codon_start=1
                     /locus_tag="AO090009000386"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000071"
                     /protein_id="BAE54855.1"
                     /transl_table=1
                     /translation="MEATRLQPFLFTSSLWGNNAWTTPVSDKHTHTNQQDRNFRSREV
                     PLERESSLESSKLHLMFIYPKRVIVQIQAVVGRALPVREPSSPPIKRSMASRRKLSQG
                     LGLLDMYT"
     exon            complement(1030135..1030286)
                     /number=1
     exon            complement(1030694..1030732)
                     /number=2
     exon            complement(1030862..1031003)
                     /number=3
     CDS             1038444..1039352
                     /codon_start=1
                     /locus_tag="AO090009000388"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000069"
                     /protein_id="BAE54856.1"
                     /transl_table=1
                     /translation="MEKFKHKNNLMGLKSRKSSFSAKSDSESPRRLSINSAIASAIQS
                     PSVLSPISPTGFATPSPLSPTQSQENFRPDNLRDLLGDYQNARTTSTISIDTTSSVSA
                     GVTSPTSTLVTDSPFTPASQSHNPSTDSNQNRPRSQTFPFIGVDPSVLSPDEQPDQLS
                     PKTGLQQATLQESPFMDEYNPKAIPSLDTSSSTIKRNRSNPEIKAKSIYPPLFPKSTT
                     VSPISSPGSPTQDEARRALELVMNYFEHQPTGLGAQDYLTIGGLMERLELAKSQQTTL
                     PGGLTRIDEHDDGPHLHKKRSIRSLG"
     exon            1038444..1039352
                     /number=1
     CDS             complement(1040816..1041577)
                     /codon_start=1
                     /locus_tag="AO090009000389"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000068"
                     /protein_id="BAE54857.1"
                     /transl_table=1
                     /translation="MSLVWSVWLTLVRKIFMVDSTRFLHETIQNHVLTPTLLPNLLRA
                     SRAALFPSNARSTQAASANQDGAPAPYLPAQPPASPTVTSPPSEAAGASNASSSVLTT
                     SISATAPSLSPEQRPTAAEIASIKRRCAVSILSLVPRPIARRFLGVPAKIVIGQTPPE
                     RQEHFKAPNEQNHQHSEPVCALSPDPLSDDDLEESLLLAAIENDILDLFADEYCNKHL
                     IYSIIETVLARLLPELSERSLTELMEDRGVSLDSD"
     exon            complement(1040816..1041577)
                     /number=1
     CDS             complement(join(1042501..1042651,1043196..1043987,
                     1044156..1044192,1044263..1044281))
                     /codon_start=1
                     /locus_tag="AO090009000390"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000067"
                     /protein_id="BAE54858.1"
                     /transl_table=1
                     /translation="MKWIVSYSCPRSHPGDCALLAREQSRLSGLTPSTREIYHSLNPH
                     PSLSPIPDPTDTHTVTQQADNEARYRQLLVSGVLAVLLPTEDLKNACLRTLVCDILAD
                     LIIGNQVSGKMCEGWFLWESATKLIDVVGSRQSHEIDAKTAVPHRQNQLQKFDLLSPQ
                     EDSQKHHSSSSVQLRIPDWVWKILQFVFLAYVTLRFIVTGILSVASTPVASSSSFTGH
                     VNEASAPCNPPRKRPVLNYGLYGMLSQLLDIPRRMPWLGGLVALFQHLILAGPGRLGD
                     TDSVLDSRHTLRPLSRLSSQLQPEGLKLTGHSLPEIDWGFGHSEGGERVRSPVNQL"
     exon            complement(1042501..1042651)
                     /number=1
     exon            complement(1043196..1043987)
                     /number=2
     exon            complement(1044156..1044192)
                     /number=3
     exon            complement(1044263..1044281)
                     /number=4
     CDS             join(1044986..1045005,1045053..1045083,1045154..1045358,
                     1045438..1045754,1045851..1046396)
                     /codon_start=1
                     /locus_tag="AO090009000391"
                     /note="predicted inosine-uridine preferring nucleoside
                     hydrolase"
                     /old_locus_tag="AO070342000066"
                     /protein_id="BAE54859.1"
                     /transl_table=1
                     /translation="MARLRSGMLTQLFSGHDDAFAILLAAHHPSLNLLGITTVHGNAS
                     LENTTNNATRILEAIGRPEIPVYPGHKKPFCRPAIHAPNIHGDSGIDGTELLPKATKS
                     PITDKNPILAMRDALLAQPKGTPWVIATGTLTNVALLFATFPEVAEHIQGLSIMGGGV
                     GGGFTDAPMSRLVGEESRIGNITPLAEFNIYCDPEASQSIFSNPVLASKTTLITLDLT
                     HQVLASHSVQSRVLHGGDDLSVPPTVLRQMLFDLLVFFASTYENVFGLTSGPPLHDPL
                     AVAVILSTLNPEYAKRHPDQVLKFDDRNGERFDVDVVTDGLHGTDVELVGELGRSKVI
                     SGTTGVAIPRGVDLDAFWNMILDCLRRADECNAARKLA"
     exon            1044986..1045005
                     /number=1
     exon            1045053..1045083
                     /number=2
     exon            1045154..1045358
                     /number=3
     exon            1045438..1045754
                     /number=4
     exon            1045851..1046396
                     /number=5
     CDS             complement(join(1046546..1046582,1046651..1046916))
                     /codon_start=1
                     /locus_tag="AO090009000392"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000065"
                     /protein_id="BAE54860.1"
                     /transl_table=1
                     /translation="MQVDLATPNFVIQEMSLGIHYNTEAGDYDITSYVKDASVFDVKD
                     GYVDALTAPGLGIEVDEETVRRVAQSTEPWQPKEFFGPDGGIRECGMVYVRYMTKL"
     exon            complement(1046546..1046582)
                     /number=1
     exon            complement(1046651..1046916)
                     /number=2
     CDS             1047022..1048023
                     /codon_start=1
                     /locus_tag="AO090009000393"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000064"
                     /protein_id="BAE54861.1"
                     /transl_table=1
                     /translation="MADVGLEDINASILQKALHIPATVKTLTQCNWTRHLVRQLLDAL
                     RVFREQRFFKEKWLVRFKRLGQLLRHGLVQTAMEVQRSIQTQRLDSLQTLDARIQRSW
                     GIQPVHVLRGVHLDRFESLCQACFAGCFDVVGSVTADPCVDGELIADLSPDELVNWDA
                     EFAALEIPQGDVDTGDGGHEDGATAVEAETPGHLPDVFDITDLLALLRRSAEGIEGGN
                     ILGLVSLETLAQRIERSFDGFCVPFEGAFTPAVVSIFIYYFDEKPSGKDSEILDGLDL
                     GHGDCGEVGEDNVGKLIVEQHYRTERKAQTSDFVFYFEEEKEKKKERKSEQKRGGRV"
     exon            1047022..1048023
                     /number=1
     CDS             join(1048935..1048958,1049177..1050688,1050806..1050949)
                     /codon_start=1
                     /locus_tag="AO090009000394"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000063"
                     /protein_id="BAE54862.1"
                     /transl_table=1
                     /translation="MPPANSPSQNTPHSPSASSLQQLSVISTPLPSLPASVSDDAHDD
                     NVSFLRSRVRSPPDSSSSLSRQRRRRQQTLPELDPMDVDDPAALRMSVEINRRIPIVR
                     REHDSSNSNNNSNSMPNYEGRISNPRSLYGWAPASDDDDEEDHDMTYGPLQDGNTISS
                     WFGRLSDRNAPRRPMRRDPVAQDPHTFLEAPPESNTQRLSDHSPLSTTEALLQSVRRQ
                     PRFSRTRTLHNYLLDRERASQDLEESRERSGTAATSRAYRFLPSNRGEPHRLLTHNEL
                     RARINAHRQLHLDNPPSPRLKETIKYLDRLRYSSSFEESLTSAAAGGFVRLDFLPWDE
                     DDFILDTASIAPPPTCSWLQPGMVFSGSQRAASSANSFSAPRVSSPPSSHDPLIVNGS
                     EQSGSRIPVQTTSGRRYMANNIYNLGTGRDENWPVKVTIHNINPEEMTLSGTMEAYNI
                     PDKTSPSHDAHIVTFLEGEIIDFNTHTLETKNFKADAEIDCTYWRELQPFKNLSDDAM
                     TRSLNVVSLHPPTHDRDSRSLGFITSPCIAKAAILRDYTMIREVHPTNNYH"
     exon            1048935..1048958
                     /number=1
     exon            1049177..1050688
                     /number=2
     exon            1050806..1050949
                     /number=3
     CDS             complement(join(1051443..1051567,1051657..1051897))
                     /codon_start=1
                     /locus_tag="AO090009000395"
                     /note="40S ribosomal protein S12"
                     /old_locus_tag="AO070342000062"
                     /protein_id="BAE54863.1"
                     /transl_table=1
                     /translation="MSVLDALKGVLRISLIHDGLARGLREAAKALDRRQAHMCVLNEG
                     CEEEAYKKLVIALCSEHKIPLIKVPDGKMLGEWVGLCQLDREGNARKVVNCSCVVVKD
                     WGEESQERSVLLNYFQTEQ"
     exon            complement(1051443..1051567)
                     /number=1
     exon            complement(1051657..1051897)
                     /number=2
     CDS             complement(join(1052644..1052874,1052934..1056401))
                     /codon_start=1
                     /locus_tag="AO090009000396"
                     /note="ankyrin repeat"
                     /old_locus_tag="AO070342000061"
                     /protein_id="BAE54864.1"
                     /transl_table=1
                     /translation="MSDVDAVSSLPAALDAGHSALAVKVNHRSPSGPRSPKRSSPFPV
                     YRREDDRAKEVNPVAGAGEGPPSPKADSEAETIIQSGRESLSPEKRRKYIQHEPKRRD
                     DDDHVDAVESDLPPNDLQVRKRKLTDSDSSDGRDRVPRLLSPKKRIGSPPSIVKVEKP
                     EDVQSLSSRPELSTTSVPRTSRKRSFSETIDGEGDAGRPARLRDPAVSRERERKDLSS
                     VTFPRPVSTDRSASPVRSVHKRTASGPQLGDMQRKKKAPTPLVTGYARQSSEDRQSVS
                     SSTSGSPLPSAHLRKLGSVDGASASPARPTGHKKQRDQNGRTRLARACAAQELETAMA
                     RHAERPEDLNVADNAGNTPLQIASLEGCAPIVKFLLDSGCEIDTKNIDKDTPLIDAVE
                     NGHLDVVKLLLAAGANPRLVNAEGDEPYDLVPSDSEDYEEIRRVLAQAKANPRPSRRS
                     EERAGSENKETSSRRVSAESARESPPVNRQRSPPFATTKRKTVRSEATRNDLLWTTAT
                     PENLQAFAAKGDIVGVANILNVGQKADPESMIAAAKGGHDEVISLLLGMGDADPDPDP
                     VQGGSQKPGYNTPMLAAIGRGNLAVIRILLNQPEFNPTRRLYRDRTYFELSRERRAEN
                     WEDEYDLLRDAYDNHVRTKKSRKQDLHSPRRARDKDKENKRPGRRDSPSPGGRPRKTN
                     GSPGYRDPASKDTALTKEKRRDNVAHLKEKSNPARPKPAHPTGTDPDSARPDPRPKQL
                     LPPREGESSRGEEAPKRRRLIAGRPPQDRRRPSLPSSDSLSSRDESSKARIDHLEPSK
                     SGPPPLKRGRSSASPERGRALEPERHSRDTVQKKRRVLSEDGTPNITNGGLKKDHTTG
                     DAKPRRKDDEDHHAESRPDPLRQTDNPSHKAPERKPVKEEQERHDINGLNDIPMDDYT
                     ERAEAEAEARRQKEARKARQERLAEEARLAAEAEKARLDKEEEERAAHAARLAQEKEK
                     AAEEERKRKEAEQRRIKQAEDERQKRLEQERLRLAKVRREQEELEQRRRDALPSRLRI
                     AANLVGSNDPQAKSHLWLKKFMPVVTAETRQLDPSCAPDVAVEKWVPNYLVAPLLATN
                     DLQLAQYSSWEKRDATPTQRMNLWRVTRRMLVQADDADFMNSSFGQVMQKDSEARPKY
                     FDMEHVFWVKLSDFMDLVPHIPHLHGLDLQFLKMHIDQEPTAPLAFSFPQANGHISGP
                     SHVEDTAGLPNGVQGLTNGYGHRPSTYV"
     exon            complement(1052644..1052874)
                     /number=1
     exon            complement(1052934..1056401)
                     /number=2
     CDS             join(1058593..1058697,1058809..1059744)
                     /codon_start=1
                     /locus_tag="AO090009000397"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000060"
                     /protein_id="BAE54865.1"
                     /transl_table=1
                     /translation="MTMDFLPSLVDWALATAHMDAVDVLRAFFLFASCTILSVSLLDS
                     LRSRFVPYGARATVTAESDTTPSEPSSSSPLTHILDYLASLKVPHSYFTQFYVVSLLS
                     SVFWALQLMCHGQAFQAIATRVHSEHLQRTMSINQIMLCWVLMLAQGVRRLHECFTFS
                     KPSSSQMWFVHWLAGIAFYLAVSIALWIEGTGMQFPWPSTIAVPLISIGSKFTETLLS
                     HKLSLDDVTVNNAPSLRTFLCLPIFLFASGLQHDAHHYLFSLKKYTLPSHPLFRSIVC
                     PHYTAECAIYLSLALLAAPRGEMINKTVLSAAVFVTVNLGVTASETKRWYMQKFGESS
                     VRERWNMIPWVY"
     exon            1058593..1058697
                     /number=1
     exon            1058809..1059744
                     /number=2
     CDS             complement(join(1059807..1060412,1060549..1060653))
                     /codon_start=1
                     /locus_tag="AO090009000398"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070342000059"
                     /protein_id="BAE54866.1"
                     /transl_table=1
                     /translation="MNVDLETVRIKSLPDDAFYIADFITEEEEEVLLQKIATAPLPRW
                     THLSHRRLQTWPSALTKSNALISSPLPSWLVSPVIPRFESLGIFADAPHGAPNHVLVN
                     EYRPGQGIMPHEDGAAYYPLVATVSLGAPIVLDLYQKGQGLDGEDRRPQQRILQERRS
                     LLVTTKEIYTDYLHGIAETTRDEGLGPESICNWGLLREQVRYQCGWFERETRISLTYR
                     DVLKVAKVGNTMKFLGGR"
     exon            complement(1059807..1060412)
                     /number=1
     exon            complement(1060549..1060653)
                     /number=2
     CDS             complement(join(1061942..1063007,1063067..1063112,
                     1064174..1064183))
                     /codon_start=1
                     /locus_tag="AO090009000400"
                     /note="UDP-galactose transporter related protein"
                     /old_locus_tag="AO070342000057"
                     /protein_id="BAE54867.1"
                     /transl_table=1
                     /translation="MRSSLAQLAICVLGIYASFLSWGVLQEAITTVSYHVRPPTAAEP
                     EPPTERFTFSIVLNTIQSTFAAITGFLYLFFSTPAGQKIPSIFPTKKILFPLFLVSIS
                     SSLASPFGYASLAHIDYLTFILAKSCKLLPVMFLHLTIFRKRYPLYKYGVVLLVTLGV
                     ATFTLHHPGTSKKVAASAAKNQSGSSMWGIFLLSINLLLDGLTNTTQDHVFSSPQIYT
                     RFTGPQMMVAQNVLSTLLTSTYLLVMPHLSSTGILHAILPIPIPPSTETELTSAISFL
                     SRHPEALKHVLGFAACGAVGQLFIFYTLSRFSSLLLVTVTVTRKMLTMLLSVFWFGHS
                     LSAGQWLGVGLVFGGIGAEAVVQRQEKKAKERAKAAKSQ"
     exon            complement(1061942..1063007)
                     /number=1
     exon            complement(1063067..1063112)
                     /number=2
     exon            complement(1064174..1064183)
                     /number=3
     CDS             complement(join(1064809..1065785,1065836..1066057,
                     1066116..1066202,1066255..1068733,1068790..1069153,
                     1069222..1069277))
                     /codon_start=1
                     /locus_tag="AO090009000401"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000056"
                     /protein_id="BAE54868.1"
                     /transl_table=1
                     /translation="MSNQQQSPVPQVGKLVSVVPVGLKEAALDSPTFRATTLHFADQI
                     EYLERWLDGYARAASKLSMELASMENIVNTFLSYSTHPVAVSEAALDHDYTLLSMRRC
                     GDSSKELWNGLVSTSKKIEMLVAEPIRIFIQEDLRNFKETRRVLDQTQKHYDYLLSRY
                     SSQSKSKEPSSLREDAFQLHEARKAYLKASMDFSVLAPQVRNGLDRLLVGVSFDQWRE
                     FKTFFQINGAGFAKWHHEMDRIKGWVLEMDASERSSKRELFSARKEIEEAAETAARPS
                     RELDDYSVSTVPYLGSRPLSNLSMTKEARPEKQGWVYLRTLYGKPTRTAWVRRWIFLK
                     NGIFGCLVQGPRTGGVEESERIGVLLCSVRAAFQEERRFCFEVKTKSNSIMLQAETQK
                     ELMEWISAFEAAKRKALENPASTDLSVSGKVTVQDPAFAISQPPAPEFTADPADSLTP
                     HSNDEQNSSDRNGMLPLPERDPASLRNSSDISRRLTGLDCETSPREHTSRIIQKLDLH
                     RKTNNNIQPSTSIPGAGGGIVSLISASHNALVSGTALPSSMADSDPNRGRSMSNRFDP
                     PTTLAPPTLATPPAPTSMSKVAVIVSNERGIGLGHADKTGGMPSGMMANLWGSSNWSF
                     VNRLELERLGLPDAEQDAVSQQRPSSRMSDSSKHVMSTEANTPGGTAEKQQKIGPRHR
                     QTVSLDGNASQVQRAAIGVTHEYPSYYPQQLKIQDAQFRLLFPNVKKEEPLVMVFRAT
                     YTMNDQQEFPGRAYVTTRDLYFYSHYFGLVLTTSVSLESIKEVTAAAGRDSDFLFLHT
                     VPRPGEDTPGRITVKTFLEPMKLLQRRLNFLIDDTTAVEPLGLEAIFNALNKMEADAA
                     TRTPSVDSWEDVGVDEKFSGEDAAAQGPRKDIRPAIYIEKGLDMHSKKGSNGKDVMKF
                     RLPTQPVQYVPQGNLHLAAEKVFDLSPKAIFHILFGDKSAVWQLLLHQRRARDIKQGP
                     WSRNESNHLRRDIKYQIETTNMLGHKHGQTISDYQMIDVLNDHLCYVITDKRTPWHLP
                     FKRSFRLVSKIVITFVAKGKSKLAIYTKVEWLWSPYGIQRVIDKQATGDLEQDALDLV
                     DLVSEQVRRLGAQSRTKKAIAIFGHVGRQNTVSQLGESDFKIEIRNPRTQRTLAQLLF
                     ETFVSFLESAVSSVMLWTFALFRWVWKTANANLIILALLISSMLINGFYTSRDAYDWW
                     YERKAENFMARLGVHPDHVMSKAIYMRDIDEVIANSTLGHASDDVSDCFATFHQQTIR
                     NVGTPLSISTSGPRDSATKSAARRLQQTRERLAMHRHDLVVGLRVVNSIEREILQNEW
                     ERWLRQELKRCDQIEALLRQSSDTDQVDMQVDRTSQAAFADLSDDIREWYERYCFSCH
                     QEQDLVEENHRAYGSS"
     exon            complement(1064809..1065785)
                     /number=1
     exon            complement(1065836..1066057)
                     /number=2
     exon            complement(1066116..1066202)
                     /number=3
     exon            complement(1066255..1068733)
                     /number=4
     exon            complement(1068790..1069153)
                     /number=5
     exon            complement(1069222..1069277)
                     /number=6
     CDS             join(1069700..1069868,1069931..1071588)
                     /codon_start=1
                     /locus_tag="AO090009000402"
                     /note="KRR1-interacting protein involved in 40S ribosome
                     biogenesis"
                     /old_locus_tag="AO070342000055"
                     /protein_id="BAE54869.1"
                     /transl_table=1
                     /translation="MEPPAKKSRKLFDDDSSSDSGDESGGVPVNNGVTFKVNEEYARR
                     FEHNKKREELQKLESKLGKGSAFGKRGDDESGDSDESTSEEEDDDGELATEALDAEIM
                     ATLKAIRTKDPRVYDQSATFYSQADDDQPATSEKKQKTMTLKDYHRENLLSGANLAEE
                     DISEAPKTYAQEQEDLKNAIVKEMHAAADNEDASADKESDDDEDFLVAKSAPEPVSAP
                     KKAVKLDVENADKDPETFLSNFLSARAWIPAGRVDLQPLESDDEEDDARAEAFEEAYN
                     FRFEDPSKINATLITHARDATNQQSVRRDEKSSRKKHREAERLKKEEEKKERETEKNR
                     LRKLKMEELQEKVNQIKEVAGLRASEFTDEEWAKFLDDSWDDKKWEQEMQKRFGEDYY
                     AGEGDGKKKPKKPTWDDDIDIKDLVPDFDDDDEKLNPQQSDIEMDDADDAEGDESASK
                     NKKSKAQERRDQKREARKDRLRIEEAVDRNLDLDINLLPGAKKHQGHFRYRETSPNSF
                     GLTARDILMAEDTQLNEYAGLKKLASFRDPEKKRRDQKKLGKKARLRQWRKDTFGNEE
                     GPEFVFGGERTVDEKEGATDAGNVDIREGEPKRKKRKRSKKH"
     exon            1069700..1069868
                     /number=1
     exon            1069931..1071588
                     /number=2
     CDS             join(1073625..1073666,1073860..1073881,1074000..1074322,
                     1074379..1074930)
                     /codon_start=1
                     /locus_tag="AO090009000405"
                     /note="mitochondrial ADP/ATP carrier proteins"
                     /old_locus_tag="AO070342000052"
                     /protein_id="BAE54870.1"
                     /transl_table=1
                     /translation="MSASQSDKSVFGMPGFVVDFMMGGVSAAVSKTAAAPIERIKLLI
                     QNQDEMLRAGRLDRKYNGIMDCFRRTAASEGVASLWRGNTANVIRYFPTQALNFAFRD
                     TYKSMFAYKKDRDGYAKWMMGNLASGGAAGATSLLFVYSLDYARTRLANDAKSAKGGG
                     ERQFNGLVDVYKKTLASDGIAGLYRGFGPSVLGIVVYRGLYFGMYDSIKPVVLVGPLE
                     GNFLASFLLGWTVTTGAGIASYPLDTVRRRMMMTSGEAVKYNSSFDAFRQIVAKEGVK
                     SLFKGAGANILRGVAGAGVLSIYDQVQLILFGKKFK"
     exon            1073625..1073666
                     /number=1
     exon            1073860..1073881
                     /number=2
     exon            1074000..1074322
                     /number=3
     exon            1074379..1074930
                     /number=4
     CDS             join(1075408..1075828,1075932..1075981)
                     /codon_start=1
                     /locus_tag="AO090009000406"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000051"
                     /protein_id="BAE54871.1"
                     /transl_table=1
                     /translation="MATSPSTQEDNLQTSSSPTPSLDPTSKQDDLEPPTTSATATAPP
                     YSPIYATAEPASMPSPPAPAPTDPPTAPIHPPPEPATTATTATTTTNTSPPPPQPGAR
                     PQPPPPETQEPKEPSPSNPPPPEPADIPRPQPQAPPAATQIPDPGIATATLHRR"
     exon            1075408..1075828
                     /number=1
     exon            1075932..1075981
                     /number=2
     CDS             complement(1077233..1078363)
                     /codon_start=1
                     /locus_tag="AO090009000407"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000050"
                     /protein_id="BAE54872.1"
                     /transl_table=1
                     /translation="MAAQTTTSSIAMALAGKTASVDIPKPRSAFTSGGRDSSRLGHTM
                     LPTPPNSISPTLPPQAFKGQDVRHPASPPFATSHVDSDIDLGDADADSQTQHHQGVGD
                     LDSAGAITPGMLAKYHLPEIMLQHGPLAIRHVMGYLTTSVPGFSRIPPAKARRLVVAA
                     LEGRGSDEKSGGPANDVIFEKVGWGRWDARRRGEPSRDVQHQNLSPPSSFSNSFSQRG
                     IQIPGKRGSLQPYGSSVTGDSAVFSFTEMDYAGHISEHEADKMSLDGNEQEYCSSSEA
                     PEDEIRDEDWGEEDVTDEEDWAQIGAAALRARSLNGGGGFVNGHHPSPQLRGGGPASS
                     SLAKSAPRKPPIQQLGFSLPDGMVGNTEERAAVEALLRLGSM"
     exon            complement(1077233..1078363)
                     /number=1
     CDS             join(1082194..1082551,1082598..1082953,1082966..1083466,
                     1083520..1084068)
                     /codon_start=1
                     /locus_tag="AO090009000410"
                     /note="predicted acyl-CoA transferases/carnitine
                     dehydratase"
                     /old_locus_tag="AO070342000047"
                     /protein_id="BAE54873.1"
                     /transl_table=1
                     /translation="MGSVYSPVRETGRIFSYLCDQAERLNLPSEVVENKNAVLFDSSH
                     DEVYYPIPFKETETLAALKGVEGSVAAAIANLRYGPQKRGVKVNLERATAFGCQAYMA
                     KVDGLSKLDPEVKKKLKDTDLLAAQSNGYRRMSANLYKTKNEGEFFHIHGSLEATTTL
                     NMIGLDGHRPDLTDYEEIIKVIESHVQNYTAAELEEMNKERKQAGVTAFKYEDFIKTP
                     HVCGIVCYSYRHSCNNETDRGELNVQQPPWKVSRLKGDLPPTPFPAGRAGSKKILEGV
                     KVLELCRIIAGPTVARILTEYGADVLKITSPSLSDVPFFQVDGNMGKHAADLDLKSEE
                     GRRQFEELLADADVVVDGYRPGAIEKLGYGPEALSSLAEKRGKGIVYVNENCFGYEGE
                     WAGRAGWQQIADCVTGVAWAQGQFMGFSNPVVPPFPISDYGTGCMGAIAALTGLYHRA
                     KTGGSYHGKASLMHYDLLLFAVGKYSEEVQEKMRAAQPPEFFKLRHCDSVDRISSTVL
                     KIMQARFPHLYVAADNTSGQEPLTEKWYSKAYGADIEVVRPICEIDGVENKFERASRP
                     NGTDRASWEDFKEVEEDHKKA"
     exon            1082194..1082551
                     /number=1
     exon            1082598..1082953
                     /number=2
     exon            1082966..1083466
                     /number=3
     exon            1083520..1084068
                     /number=4
     CDS             join(1084490..1084670,1084825..1085042,1085086..1085115)
                     /codon_start=1
                     /locus_tag="AO090009000411"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000046"
                     /protein_id="BAE54874.1"
                     /transl_table=1
                     /translation="MSYNLTSNQALAPPNGDSMIAFMESFYATSDTESLHEKYVQSFT
                     PDATLIMGSKVANGEKEILNLRHGLWTHVKSRQHFPTKVYFGGERELMLYGTVRYVLK
                     ADPENEVEVPWAGRVVFDEKELKMRFYQVYLGWRLTSGGL"
     exon            1084490..1084670
                     /number=1
     exon            1084825..1085042
                     /number=2
     exon            1085086..1085115
                     /number=3
     CDS             complement(join(1085637..1085928,1085986..1086046,
                     1086105..1086168,1086546..1086575))
                     /codon_start=1
                     /locus_tag="AO090009000412"
                     /note="40S ribosomal protein S19"
                     /old_locus_tag="AO070342000045"
                     /protein_id="BAE54875.1"
                     /transl_table=1
                     /translation="MGGVTVRDVDAQKFISAYSAFLKRQGKLPIPGWVDTVKTSCSNE
                     LPPQNADWYYVRAAAVARHIYLRKTVGVGRLRKVHGSVKNRGSRPNHHVDASGSVDRK
                     VIQSLEKIGVLEHDEEKGGRRITQSGQRDLDRIAKTTVDEEEEDDE"
     exon            complement(1085637..1085928)
                     /number=1
     exon            complement(1085986..1086046)
                     /number=2
     exon            complement(1086105..1086168)
                     /number=3
     exon            complement(1086546..1086575)
                     /number=4
     CDS             complement(join(1087208..1088985,1089266..1089275))
                     /codon_start=1
                     /locus_tag="AO090009000413"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000044"
                     /protein_id="BAE54876.1"
                     /transl_table=1
                     /translation="MAGSQTTDPGLLKKHSTYISYTTSVATYPSIRTFYKPHPQKDKL
                     PIKPSPIPLLVFVHGLGGSLAQFNHLLTSLSNVGPCFGIDLPGCGLSRFEPDSWDAYK
                     VEALAELLATAIEGHRDKDAGQGVVLIAHSLGCSLSAMLASTTSPAGPNLKKHILGLI
                     AVCPRASPPSPKEVTSFRRLLHIPGPIFDLWRYWDRRGGLKSTSVNRLVGADADPDTR
                     GLQVRYNKQSKTPVWRRMAWGTLPTYDGVDGTPVGGIPGETTWAGVRTPTLLVAGESD
                     TVTKPAELQRILKFFGGKSSKIEESSNGSNIVPDASKVNDQAPAPYSRLAHDEEFGVE
                     PQVNEKEIENTSEKPLQAKRSVKTVILPAPASHALLYDRATYRTLAGIIQDFLQQHVD
                     NRLSLGWQLQYLNTSGKWDVKNLAKWKKVTPVSERISDTFVALKMLREVDEEHNPVLF
                     SQAYSDRIYAVIDISYENPVYNPASLEMGGIHYHKHPTVSKIPPTPDETRDFIALVDR
                     LQNEITEKIAKSGNRQTPRPVVGVHCHYGYNRTGFLIVCYLIERCGYTVQEAIDEFER
                     RRPPGIRHGHFIDTLFVRYCVGLKRAPTL"
     exon            complement(1087208..1088985)
                     /number=1
     exon            complement(1089266..1089275)
                     /number=2
     CDS             complement(join(1091043..1092496,1092557..1092770,
                     1092850..1093008))
                     /codon_start=1
                     /locus_tag="AO090009000414"
                     /note="dihydroxy-acid dehydratase"
                     /old_locus_tag="AO070342000043"
                     /protein_id="BAE54877.1"
                     /transl_table=1
                     /translation="MDPSNPAVSATFGEAKYIEFPCLPEGTKHEDGTPALNRYSATIT
                     RGHDFPGAKAMLYAAGVPDQNAMAKSPQVGVASVWWEGNPCNMHLLDMGKTVKKAVEG
                     QGMIGWQYNTIGVSDAITMGSEGMRFSLQTREIIADSVETVTCAQYHDACIAIPGCDK
                     NMPGVVMGMARHNRPSIMIYGGTIQIGYSNLLRKPINVSSCFEAAGAYSYDTLRQPDD
                     GGDTSKTKDEIMDDLERHACPSAGACGGMFTANTMATAIESMGLSLPGSSSTPATSPS
                     KMRECVKVAEAIKVCMEKNIRPRDLLTKRSFENALVMTMALGGSTNGVLHFLAMARTA
                     GVELTLDDIQRVSNKIPFIADLSPSGKYYMADLYDIGGVPSVQKLLIAGGLLDGDIPT
                     VTGKTLAENVASFPSLPDDQVIIRPLDNPIKATGHLQILRGNLAPGGAVAKITGKEGT
                     KFIGKARVFDKEYQLNDALNQGKIPRDENLVIIVRYEGPKGGPGMPEQLKASAALMGA
                     KLTNVALITDGRYSGASHGFIVGHIVPEAAVGGPIAVVRDGDVVTINAETNEISMDVS
                     DEEIQQRLREWQPPAPHVTRGVLAKYARLVGDASHGAMTDLF"
     exon            complement(1091043..1092496)
                     /number=1
     exon            complement(1092557..1092770)
                     /number=2
     exon            complement(1092850..1093008)
                     /number=3
     CDS             complement(join(1093710..1094546,1094597..1094860,
                     1094927..1095364,1095424..1095435))
                     /codon_start=1
                     /locus_tag="AO090009000415"
                     /note="predicted E3 ubiquitin ligase"
                     /old_locus_tag="AO070342000042"
                     /protein_id="BAE54878.1"
                     /transl_table=1
                     /translation="MAVDIKVQSGEPTDRIGLRNTAGRFPLKLLTPSFTKRFISIKHH
                     DYTMSSTNFAAAQERVLERRRLREAEARARFAEQQRTSPVNHPAFQRLPYPLNRLPVS
                     GLSFWNTIKGREGNRPAFRVGQVDAELLDEELLGLLKGQVGNALKYFGPQAREDWSHE
                     IQFALRAILFKLSIWDHNASYGAALQNLKYVDTRSKGPIHSAPTKWQKSLYGLLTVGG
                     RYAWEKWESWLINQEGGYDEPSREVRILARMTDLISTTHSIAAFISFLVFLVNGRYRT
                     LVDRILRIRLTPPSAQASREVSFEYLNRQLVWHAFTEFLLFLLPLVGISRWRRWISRA
                     WRRTMSSIRSSDGDSEEAEKQGELAFLPERTCAICYKASNPESATESEVIAASAASGG
                     ILGSAQTDITNPYEAIPCGCVYCFVCLVQKVEGEEGEGWICLRCGEIVKKCKPWHGDV
                     LEEARPQSSSGKIVGFAVDDDSGAPRDEPEKGVDGSVEKSGPLQDSISDEELQHSGQW
                     STIGRESD"
     exon            complement(1093710..1094546)
                     /number=1
     exon            complement(1094597..1094860)
                     /number=2
     exon            complement(1094927..1095364)
                     /number=3
     exon            complement(1095424..1095435)
                     /number=4
     CDS             join(1097146..1097328,1097386..1097447,1097506..1098595)
                     /codon_start=1
                     /locus_tag="AO090009000416"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000041"
                     /protein_id="BAE54879.1"
                     /transl_table=1
                     /translation="MKSFIASLFAASLAYAQTATESEPSLSDIEKAAATTEPYSPVSN
                     VTGLAFDRFFQVWLENIDYSDASADENYQWLAKQGITLTNFFATTHPSEPNYCASAGG
                     DTFGMDNDNFNQIPANVSTIADLFDTKHISWGEYQEHLPYPGFQGYNYSNQETYANDY
                     VRKHNPLVLFDSVTKNSTRLRQIKNFTNFEDDLTDKKLPQYAFITPNMTNDAHDTNIT
                     FAAKWERSWVSQLLDNSYFMDSTLLLLTFDEDKTYPKGNKIMSILLGGAIPDDLKGTT
                     DDTFYTHYSIIASMSANWGLPSLGRWDCGANILEIVANKTGYVNYDVDTTNLRLNETY
                     PGPMSAGEYSKYSPVWPNPLTSGNCSAGHGILDIVKETYKGTTATYNYTSPFPYDSKS
                     GYNVKVTATKKSASNNGSSSSSTPTPNVAVPFGTPAVGTISGVLMGLLFCLY"
     exon            1097146..1097328
                     /number=1
     exon            1097386..1097447
                     /number=2
     exon            1097506..1098595
                     /number=3
     CDS             complement(join(1099009..1099896,1099958..1100391,
                     1100462..1100531,1100599..1100658))
                     /codon_start=1
                     /locus_tag="AO090009000417"
                     /note="aldehyde dehydrogenase"
                     /old_locus_tag="AO070342000040"
                     /protein_id="BAE54880.1"
                     /transl_table=1
                     /translation="MSSTTADQQPIETRLFINGEFQPSTDGKTFKLINPYTHEPVTDV
                     HEASEQDVDKAVAAAKAAFPAWRDLTPDDRGVYLRKLSALIRENIPELARLESIAMGK
                     PVSLYIDGKLAADTFAYYAEAGWHAQGTSSVNTPSVLGLSLRQPYGVVGAIIPWNMPL
                     ALLSIKVAPALAAGNTVVLKSSEKAPLTSAFAAKLIAEAGFPPGVVNIISGFGSPAGS
                     AIASHMDVRCLSFTGSTATGQKIQIAAAKSNLKVVHLELGGKTPAIIFEDADIEKAAE
                     KTQFSIHFTSGQTCFANSRIYVQESVADKFIAVFKEKFGAAARMGNPLEPTTNHGPQA
                     DNIQYERVKSYLEIGEKDGKLTMGGDGGMGFIKPTVFENVPDDSRLMKEEVFGPVVAI
                     NTFKTEEEAIERANASEFGLYASVFTKDMDRAVRLSKLLEAGTVGVNCTSPTIVKDMP
                     MGGYKQSGLGREGLLSGLDSYLETKTVLISTSS"
     exon            complement(1099009..1099896)
                     /number=1
     exon            complement(1099958..1100391)
                     /number=2
     exon            complement(1100462..1100531)
                     /number=3
     exon            complement(1100599..1100658)
                     /number=4
     CDS             complement(join(1102979..1102985,1103046..1103174,
                     1103230..1103374,1103432..1103528))
                     /codon_start=1
                     /locus_tag="AO090009000418"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000039"
                     /protein_id="BAE54881.1"
                     /transl_table=1
                     /translation="MADSDKLRMAARAEQDLNSYQMKQGLGPKSDSVLESNIDERADK
                     KFREATGIKTGREAGATGSNRKPIPEDEGGTRDSRGRLAPASEYEGTGGPEDKVKLES
                     ERRPGDQDTLNIQDLKTKGLSRL"
     exon            complement(1102979..1102985)
                     /number=1
     exon            complement(1103046..1103174)
                     /number=2
     exon            complement(1103230..1103374)
                     /number=3
     exon            complement(1103432..1103528)
                     /number=4
     CDS             join(1104203..1104367,1104430..1104530,1104593..1104730,
                     1104785..1105800,1105856..1106328,1106385..1106573,
                     1106634..1107686)
                     /codon_start=1
                     /locus_tag="AO090009000419"
                     /note="nuclear transport receptor KAP120 (importin beta
                     superfamily)"
                     /old_locus_tag="AO070342000038"
                     /protein_id="BAE54882.1"
                     /transl_table=1
                     /translation="MAHVVELPGESNPLTPQNVLNALVLAASSTQQQVHTGTQQLQNW
                     EKQENYYTSLQDVFLDHSVPNEVRYLAIIQLKNGIDKYWRKTATNAIKKEEKEQIKNR
                     ALQAGVVEPAALLALHNALMIAKIMRYEFPQDWPDGISSLINFLRSSTQPGANPLQLP
                     RTLTILLQIIKELSTARLQRTRTNLQSVAPEIFHLLGSIYVDKVNKWVSLLEQGVVDE
                     GALLESLEQSLVSLKVVRRLVIAGYEHPNRHNEVKDFWLLTHSHFSRFLQFISGSISL
                     PENVHKAVEKHVLQLSKLHVEMAKDRAASFALLPDSISLVRSYWSLVVKLGENYGQLG
                     ATGEQEGKSLMEKAGLKALLLIRACSKMAFNPAQTFKYQTPEDKEEKKQSIELIKAEL
                     FTHDFVVNVMELLVTQFFRFRSSDFQEWEEDPEEWERKEEDVSDAWEFSIRSCSEKLF
                     LDLVIHFKDLLIPRLLNVFYNFASPENRDVLLKDSLYSAIGLASASLEQHLDFNKFLE
                     TTLVPEVQIQEQGYNVLRRRIAILLGQWVPVKSSELNTEAIYQIFQHLLSKQDPLNDL
                     VVRITAGRQLKNVLYPFEFSPTGFLPYAPSILHDLMSLVQEVELSETKMGLLDTVRVA
                     VIKMEDHIAPFSDQILSLLPPLWESSGEEHLMKQAILTLLSSLINSLKQDSARYHSLI
                     LPLIQNSVEPGSETLVYLLDEALELWGAILTQTPAPASPEILSLLPALLPIFEAATDS
                     VPQALQIAESYIYLAPQEVLSDRVRLPFLASLEALLKSTTRQRLGVVPRLVELMVRGT
                     EAVDGGSENSYSVITRSLLDSSFLSSLLEGLYSAYEASQTTGPNRKQTPVYGVVETDY
                     FSVLARLALAYPKMFASAVSAATGTSEEHALTWLLTEWFLHYDNIGSATQKKLHALAL
                     TQLLSLNGPDTQPPPYILSHLQSYLNTWADIITELAEGTETENNPRAGDHLVYWNNAE
                     TGKWDENEPPENERKRHWENSDILHNIKIRDFIRDRLRSLIVGCGGEQRFQDEWLLNV
                     DRDVVSAFVALGLF"
     exon            1104203..1104367
                     /number=1
     exon            1104430..1104530
                     /number=2
     exon            1104593..1104730
                     /number=3
     exon            1104785..1105800
                     /number=4
     exon            1105856..1106328
                     /number=5
     exon            1106385..1106573
                     /number=6
     exon            1106634..1107686
                     /number=7
     CDS             join(1108407..1108444,1108479..1108755)
                     /codon_start=1
                     /locus_tag="AO090009000420"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000037"
                     /protein_id="BAE54883.1"
                     /transl_table=1
                     /translation="MRRQECPNSSRHHMEDLNSITAAAYFVTSTANKSSVKAPAHPAD
                     GPTIITRHGASTNPIRCIPEGDKGVAAADGEIASSRCEGNGKAGGCVSIKGVEDVEGW
                     VG"
     exon            1108407..1108444
                     /number=1
     exon            1108479..1108755
                     /number=2
     CDS             complement(join(1108997..1109001,1109063..1109394,
                     1109481..1109593))
                     /codon_start=1
                     /locus_tag="AO090009000421"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000036"
                     /protein_id="BAE54884.1"
                     /transl_table=1
                     /translation="MAPPRRNLLPKERFAFSFGSLKTQSYHDPIARTPGSHTIRTIAW
                     NPTGQLIATGSADRTLRIWNPERAQVKYSTDLRGHTAGIEKVLFNPVRDSELASCSSD
                     GTVRFWDVRSKTCVSRLDVGGEAFTLSWSADGSTMVVGRKVRRAPLR"
     exon            complement(1108997..1109001)
                     /number=1
     exon            complement(1109063..1109394)
                     /number=2
     exon            complement(1109481..1109593)
                     /number=3
     CDS             join(1111003..1111054,1111120..1111221,1111278..1111424,
                     1111478..1111814,1111888..1112082,1112189..1112315)
                     /codon_start=1
                     /locus_tag="AO090009000422"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000035"
                     /protein_id="BAE54885.1"
                     /transl_table=1
                     /translation="MISEGRPGSDNVFTLRDGILKLELGKEIFERTGLTGKPVRSGGR
                     KHAKERYLVEINLRLPSMLHGKKGFERLVWAFKNVLNHTVAWLFYDLASESSGVSSDD
                     PSLKGNHPHIVDCEPVRTDYRDILVPPFKELDITGTAPEQELKENCDEISEWLGMVAL
                     GSPRVLASDDVDPYLCRYSVPHVDEAKPSDIVSLRWHGFLPLKWIMELFLTLLQETAP
                     KGPEASAWFAFSASALGREAVEGKDGYTVLTLPSVNETCDNVQKSSDPRSKIGRSCVC
                     WDDMSWHSHQLVTSTNASLPSNARVCEPYVRLVLHCSLRLVAL"
     exon            1111003..1111054
                     /number=1
     exon            1111120..1111221
                     /number=2
     exon            1111278..1111424
                     /number=3
     exon            1111478..1111814
                     /number=4
     exon            1111888..1112082
                     /number=5
     exon            1112189..1112315
                     /number=6
     CDS             complement(join(1112562..1115077,1115138..1115399,
                     1115455..1115949,1116005..1116089,1116141..1117804))
                     /codon_start=1
                     /locus_tag="AO090009000423"
                     /note="DNA replication helicase"
                     /old_locus_tag="AO070342000034"
                     /protein_id="BAE54886.1"
                     /transl_table=1
                     /translation="MNPINKDTNSYPISSNSRSKLNAFRYIRDDKSIEKSPSKRSPSK
                     SPSKSSIKPAHANKENQSSWLNGVTHSDQADSTKREASVDKSDAKATKECPQTPGNRI
                     PLADLISNTEDAISQAPAPEFTPEDYVIWQHVPVSSNPDTMSQTPATQARKRRHISSP
                     TSSPLAGNSKGADQESLDMHTPLQGLQRTPQNDLATELWNNYVGKLTANGNGTLPPPQ
                     FTHLLSSSPQTPAPARTGRDSSGLRRSNSCNAEWPSSKAKRRRVDGGGIGTGRGIFSR
                     TRSNVVDSGGINSSKINFLVERIEKSLRDAPKSPKSHIVAADSSPVPRCKGMQRSRSA
                     SPMQDRPGHHSSSKANRVNKASEVYPEPQDKEQASSSEFGDDDFDQGFFELAEASMDP
                     FVDHGSLPGAMDTGGDTTFLSTNANEPHNAKQNPHAHPTTLNSEAGPNEKMDYSLNTA
                     DFDDDDEFDDFSDNIDEILAECDAAPNKKLVRPIPKNNTASNLSGLESGTESSSTVMV
                     KPVQGVNVPQGESSSDEFNDDEFDMEAIEQSMRQSGADGANYVCHSYRQAIKRYLIVD
                     IAESTYTTEKGRLQPEKVLSVQDERTSQKKAVVLRESWFDSPCYKDSYIHLIGDFDTA
                     GHCIVNNSYNMIILHPDHLVSATIVADSIGCQRRAVLQDRIKNTGDIGKPQVFGNIFH
                     EVFQEAMKANQWDISSLRSLVEMVIVKHIEELYLIHMSIPEVIDYVMGKIPALISWAD
                     TFLKEKPSAQSLVEDRNSSKLRLSINKLLEVEEHIWSPMYGLKGNIDATVQVACHDGE
                     GNKNLVVPLELKTGNRDTNHAHRAQTALYTLLLSDRYDVEVTFGLLYYLETSKIFRIR
                     GIRHELLQMIQARNRVAGYMCRRTQLPPMVKRQALCNKCFSKTPCFIYHKLVDDGDGE
                     SSGLGDEFVKAMDHLTPRDSDFFRKWDDLLTKEEQSMMRFKRELWTLLSSEREALGRC
                     FSNIVIEPGSAFEDKDGVKINRYRYTFVKRQPTLSFSFSESQLTVGEPIVISDEKGHF
                     ALANGYVVQVSPQRISVAVDRRLHNARTKSKGFDAKMNQTFRGIMEIPGADAASSNPS
                     DEPEEEVVYRLDKDEFSNGMAIVRANLVAMMERDLFQAKNLRRLIVEGSAPTFQPTLT
                     AYKMSDTDRASLNVDQKRAIDKVMSAKDYALVLGMPGTGKTTTIAHIIRALVSQGKSV
                     LLTSYTHTAVDNILLKIRDDNIRILRIGAAAKVHPEVQQFADLAAVPKNTIEELQGAY
                     EDSQVVATTCLGIGHSIFSQRIFDYCIVDEASQITLPVCLGPIRMARTFILVGDHYQL
                     PPLVQNKEAQEGGLDVSLFKLLSDSHPASVVNLEHQYRMCKDIMLLSNTLIYSGQLKC
                     GTQEVAARSLEVPNIGGLRHLHLDHFQPPGQRQLCLGTSQGRCWLRDLVDPSAKTRLV
                     NTDTLATPALDVAQGSRIVNPTEATLCAQLVEAFISCGIPARSIGVITFYRSQLSLLK
                     QNLRRHLPDLEMHTADKFQGRDKEVVVLSCVRSNSDNHVGDLLRDWRRVNVAFTRART
                     KLLVVGSKSTLRGGNELLGKYVKLVEEQGWVYNLPKGAVEDHVFDSDNIHTQPQPQEG
                     STPSPKKSPTSQKKVRNPLSPAQARNAPKGLRKPAKKGVKLLSGNKVLGNRPVLQDVV
                     NDLIG"
     exon            complement(1112562..1115077)
                     /number=1
     exon            complement(1115138..1115399)
                     /number=2
     exon            complement(1115455..1115949)
                     /number=3
     exon            complement(1116005..1116089)
                     /number=4
     exon            complement(1116141..1117804)
                     /number=5
     CDS             join(1118475..1118734,1118841..1118928)
                     /codon_start=1
                     /locus_tag="AO090009000424"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000033"
                     /protein_id="BAE54887.1"
                     /transl_table=1
                     /translation="MSARTLSHSLRSRCLLRRPQNIQGFSTRTNLRAADHGDHYDPPT
                     GWLFGVKPGQKYVKEGWENIWYYGFIGSLLVAGVAYVFKPDTSIQTWALEEARRRLEA
                     EGILEDPEKAQRK"
     exon            1118475..1118734
                     /number=1
     exon            1118841..1118928
                     /number=2
     CDS             complement(join(1119309..1119665,1119732..1119810,
                     1119872..1120155,1120205..1120267))
                     /codon_start=1
                     /locus_tag="AO090009000425"
                     /note="carbon-nitrogen hydrolase"
                     /old_locus_tag="AO070342000032"
                     /protein_id="BAE54888.1"
                     /transl_table=1
                     /translation="MTANLAQCQILVRKAVAAGARALFLPEATDYIGSSPAETISLAR
                     SVHDSEFVLGLQKEAVQSNLHINVGIHEPSPDGRVKNTLIWINEKGIITQRYQKVHLF
                     DVELKGGPVLKESASVEKGMEILPPFETPVGHVGLAICFDLRFPEISLALKRQNAQLI
                     TYPSAFTVPTGKAHWETLLRARAIETQSYVIAAAQAGPHNEKRRSYGHSMIVNPWGEI
                     VAQLGDEYTEPQIAFADIDLDLLAKVRREIPLLRRTDIYPEV"
     exon            complement(1119309..1119665)
                     /number=1
     exon            complement(1119732..1119810)
                     /number=2
     exon            complement(1119872..1120155)
                     /number=3
     exon            complement(1120205..1120267)
                     /number=4
     CDS             join(1120675..1120870,1120921..1123823)
                     /codon_start=1
                     /locus_tag="AO090009000426"
                     /note="exosomal 3'-5' exoribonuclease complex, subunit
                     Rrp44/Dis3"
                     /old_locus_tag="AO070342000031"
                     /protein_id="BAE54889.1"
                     /transl_table=1
                     /translation="MKSLRRDFSSDPHTANVTSKVFVRSTKSGKVQKIVRELYLRQDI
                     PCSSKLCSTCPSVAPADANGNIAPFVLSEHPAGTTAFPRGHYLVPDTNALLNGMDLFE
                     HTGAFYDVIILQTVLEELKNQSLPLYNRLLALIKTDEKRFYLFFNEFRMETHVRRGRN
                     ESINDRNDRAVRSVAKWYTEHLRAAAKKGKKEKTVPTIVVITDDKDSLRKAKEENVTA
                     LSLTDYVSGLEDSDRLLDMINESREQRETKGARGELFYPEYYTMSKIMTGLRAGTLHQ
                     GVFNVSPYNYLEGSVNVAAFDKPLLILGRDNSNRAISGDVVVIEVLPKDQWKSPSTKI
                     VDEEAVTKNDNPDAEDNEAVVTERERKALQEEVRQAHGKSTEGRPQPTAKVVGVIKRN
                     WRQYVGHVDSGSTGSQASSGRRQQNVFVLPMDKRVPKIRVRTRQASELLGQRILVTID
                     AWDRDSRYPTGHFIRSLGELETKGAETEALLLEYDVQYKPFPQAVLDCLPAEGHDWRV
                     PASKEDIGWKGRRDLRDLLICSIDPPGCQDIDDALHARPLPNGNFEVGVHIADVSHFV
                     KPNNAMDLEASLRGTTVYLVDKRIDMLPHLLGTDLCSLKPYVERYAFSVLWEMTPNAE
                     VVSTDFTKSVIRSREAFSYEQAQMRIDDPSKKDELTESMRTLLRFSKILRQKRMDAGA
                     LNLASPEVRIEADNDEVGDPLTDVKTKAMLATNSLVEEFMLHANITVAAKIYSTFSQT
                     AMLRRHATPPPQNFEELINQLSKKRDMRLDVSSSRALADSLDQCVDSKNPFFNTLVRI
                     LATRCMTSAEYFCAGAHAESEFRHYGLASPIYTHFTSPIRRYADLLVHRQLASAIGYE
                     GEDGRAVIEGVMTRNRLEDICRNINHRHRNAQHAGRASIEYYVGQALKARGEKLSAKG
                     VDGGIEEEGYVMRVFENGVVVFVPRFGIEGVVRLEDFVLKGDSALRSVEERRELVVRR
                     ESEFDNEEYTLQVSDKGHSDQGMSVELFQRVKVNVSSVKEESGRGAGKRRVRVLILGT
                     QN"
     exon            1120675..1120870
                     /number=1
     exon            1120921..1123823
                     /number=2
     CDS             complement(join(1124017..1125327,1125393..1125638))
                     /codon_start=1
                     /locus_tag="AO090009000427"
                     /note="monocarboxylate transporter"
                     /old_locus_tag="AO070342000030"
                     /protein_id="BAE54890.1"
                     /transl_table=1
                     /translation="MADNTPIDIVRSRDYDRELISQDPLNRKGHCQDQTELDGQQDAA
                     QEVLEDKYQRDVPPDGGYGWVCVACVFWINAHTWGINSSYGVFLSYYLSHDVFPNTSA
                     LSYAFTGGLSISCALLVAPLATHLIHLYGTRLVLNLGVFFETLSLIGSSFATQRWHIF
                     LSQGVCFGWGMGFLFVGSVGIIPQWFQRRRSLAMGINAAGSGLGGLIWSLAVGSMIPR
                     LGLSWAFRILGIIAFVVNLICANLIKDRNKDVGSRHKAFHFPLFKRPEFLLFLGWGVF
                     SMLGYVALLFSVANFALSVGLSSHQGSIVSALLNLGQGLGRPFVGMFSDKLGRINIAT
                     FLSFCCGLFCLVIWIFARSMGVVCFFAVLVGTVAGTYWATVTPVLAEIIGLRDLPSGL
                     SITWIILVAPTTVSEAIALVLRDNDSNDSVYLRVQIFTGFMYIGASLCLWVVRGWKVE
                     YINREAQLKSSTAVSANNDGVKVASSHGAGDEKGNQPAVEPPASDPVPEVKLWSPVAL
                     LRGMVTLKRV"
     exon            complement(1124017..1125327)
                     /number=1
     exon            complement(1125393..1125638)
                     /number=2
     CDS             1127167..1128984
                     /codon_start=1
                     /locus_tag="AO090009000428"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000029"
                     /protein_id="BAE54891.1"
                     /transl_table=1
                     /translation="MPSTTTAGDREPPRATSSLSNHRPLSSRGSIGSPAGRPLVQEPR
                     MVPVRKNISPTRVFSRPSPPSPNAAYRESYRRRFEREEAQSLRDALQEMDIQDDIRLH
                     QAAQDEATELVWMHQNPGLPFKNPYAPYRNPDMDKASQGSDKSSVLVGHTLASRSPRR
                     DSYRPMSDYNSDSPRSHAKEQQPALEEPNSSPRKNGTLRKNLKVDFSLPQNGSPSKRS
                     SSGYGLGLASTGNGSSKGVFRNPNDHIYEEPGESQHMENDERPDFSKSDSSALKVKPR
                     NALPRGSRPLSGRFGSLSFVDKLSRFELHKHPPTQSRNPEYKANDPLPQANPNDEQAI
                     PKKDGLEIRSDEIRAATSKKLKDRSTRLPMPTAVSDRAGRPIVSFDPTWKPTEAQSPG
                     KGNDAGIRESVSPTPPPAPVAPTIEISEAPSIPVINLPDDKPPTISEMTGSSQDRKKD
                     DSSLPTSPDSSKRPNPFQRKSPSSALQNRWLSTYSRAGVPTAKCESCTLPISGKIVTA
                     AGSRFHPECFICHHCQTPLECVAFYQEPDAKRQERLAAASEADEEARLLRFYCHLDFH
                     ELFSPRCKSCKTPIEGEVVVACGAEWHVGHFFCAECGDV"
     exon            1127167..1128984
                     /number=1
     CDS             join(1129074..1129315,1129382..1129448)
                     /codon_start=1
                     /locus_tag="AO090009000429"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000028"
                     /protein_id="BAE54892.1"
                     /transl_table=1
                     /translation="MALHGVFNVIPGALLLDARGAKNRYSMMLSSRLSEVSGMMSALS
                     VTNAVLSLGRMVDILSEKASPKEQQKAASLEDQSSYLNSEKARFYHLNEVLLTYLQCL
                     "
     exon            1129074..1129315
                     /number=1
     exon            1129382..1129448
                     /number=2
     CDS             complement(join(1129849..1130495,1130589..1130776,
                     1130839..1130996))
                     /codon_start=1
                     /locus_tag="AO090009000430"
                     /note="methyltransferase-like protein"
                     /old_locus_tag="AO070342000027"
                     /protein_id="BAE54893.1"
                     /transl_table=1
                     /translation="MSTPPAKRQKRDQYRKRAAAAANEDTGKVKLPQKKFYRQRAHAN
                     PFSDHQLDYPLSPAHMDWSSHYPAFVNPDPEQKNLAGARKLLKDVEVVDIGCGFGGLL
                     VGLAPLLPETLMLGMEIRTQVIEYVENRIQALRTQQNQLKNSSTTASESPAPAIPAEP
                     ATDGASPDAASTPETSNSPVPGGYQNISALRSNTMKFFPNFFGKQQLSKIFICFPDPH
                     FKAKKHKARIISENLNAEYAYALKPGGLLYTITDVEEYHHWVLRHFREEGEHEASEGG
                     VKDLFERVSEEELASDPCVEVMRESTEEGKKVTRNKGNKYVAVFRRKADPEWPA"
     exon            complement(1129849..1130495)
                     /number=1
     exon            complement(1130589..1130776)
                     /number=2
     exon            complement(1130839..1130996)
                     /number=3
     CDS             join(1131505..1131876,1131937..1132012,1132059..1132171)
                     /codon_start=1
                     /locus_tag="AO090009000431"
                     /note="uncharacterized conserved protein"
                     /old_locus_tag="AO070342000026"
                     /protein_id="BAE54894.1"
                     /transl_table=1
                     /translation="MSNSTPFQFPPTYSFPPFFTPQPNSTTRLSQLQKWSLLIQSWCR
                     HHRTYRLSLIEAIESPLFHNSTLRKRIPLSEARNILDWMAESEEKGGGGRRAEWVDGT
                     NKTIAWVWWRRPEEWAGILADWVENTGQKNVVLTVYELVEGEATMSQEWHGMDVDVMM
                     KSLNVLVKRGKAQVFGSEGQEGVKFF"
     exon            1131505..1131876
                     /number=1
     exon            1131937..1132012
                     /number=2
     exon            1132059..1132171
                     /number=3
     CDS             complement(join(1132395..1133015,1133110..1134490,
                     1134554..1134966,1135049..1135141))
                     /codon_start=1
                     /locus_tag="AO090009000432"
                     /note="signaling protein SWIFT and related BRCT domain
                     proteins"
                     /old_locus_tag="AO070342000025"
                     /protein_id="BAE54895.1"
                     /transl_table=1
                     /translation="MVGHEEELQLFDQCKICIICSKDLSLDTAHQGGESVIYEPPAAF
                     PPLHEFSHLVSTTIDFPTFEAANDALIPVVKPQWLHACLNKRKLANPRQYSPDPRLFL
                     NDVVVTCGDIPEGDKDAIIGGVLAKGGLYSPRITQMVTHLVDLTTDSDKARVALGKKL
                     NVKIVLPHWFDDCLKLGRRIDERPYILPNPEILRAGPDAPIRSTENRDIVGASTAEPT
                     TLPTPRPKLDVFEGKHVMLSTDLGIGSHLLDSITEIIEEGGGTITSDPSKAEVLICRY
                     REGFAYRVASRLNKEVGNLSWLYHLITYNTWTSPLRRLLHYPVPRTAIPGFEGFKISL
                     SNYVGEARSYLENLVAASGAECTKTLKQDNTHLVTAHGNSEKCSAAKEWGLHVVNHLW
                     LEESYAKWKLQPVSDPRYTHFPRRTNLGEVVGQTRLDRGTLESLFFPSEHKPEAATSP
                     RRVMQNRDQNATAGKATVSMQPPQAKELEDDKDVSDAWNATPAGKSRKPSDSRKLQTP
                     ARTRLMSEGKENDTPSSTSSRKSKEAAAARLHDIAPDIALYEKERKRVGGVIYGGRKK
                     TDEDRVTLNAKKRRSLEPEANSDEDEATEAKRQKKSKPPVTMHLLITGYQKWVGNMKK
                     EDADKVVQDARKCSHLAAPSILRTPKFVNALAYSPMIISTDFITACLKKNELLDPAGY
                     VLEDKAAEKRFGFSLEVALSNAKENKNRLLQGYQIYCVESIRGGFEAFKSIVDTNGGN
                     FTLFRGRVSYQAQREESDDDSDKDDSWSRKEVYLLSSVVPEHQRLWPRFRQMVQGIGK
                     TPRIVRVDWLLDIVMSQELRAADEYELSEDMSDKMEE"
     exon            complement(1132395..1133015)
                     /number=1
     exon            complement(1133110..1134490)
                     /number=2
     exon            complement(1134554..1134966)
                     /number=3
     exon            complement(1135049..1135141)
                     /number=4
     CDS             1136633..1137391
                     /codon_start=1
                     /locus_tag="AO090009000433"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000024"
                     /protein_id="BAE54896.1"
                     /transl_table=1
                     /translation="MAKTTQLSTYRRDIWPSRKAAAEGFSRSPFYQAWDSRVLDRWIK
                     YGLRELPTAIHQLPSEASKDGEQPVTLTTPLHQEVFTFSRPNYDGPPGKDVPVDRVTH
                     PDLDPNHLGSFPFYRPEPSRIFAEIPHLRPSVMYIFGGKSDMCLPEMMADKMANTGVG
                     LGGSGGAAAGRVRDVYLKEYGHLLAQEAPTECAEAASKWLGQELRRWREEDQSFREQW
                     SRKSKVEKITIDPRWKEHVPAPVRNKRGPSKPKL"
     exon            1136633..1137391
                     /number=1
     CDS             complement(join(1137509..1137662,1137730..1137810,
                     1137925..1138493))
                     /codon_start=1
                     /locus_tag="AO090009000434"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000023"
                     /protein_id="BAE54897.1"
                     /transl_table=1
                     /translation="MQLVDELSMIYTTCLMCYASFSYSRPTSVRVFLAIALTSLAVFI
                     TLYYHYLQDPVFHQNAYAILTIVVVLRSMYTMEVTLRPKWRHTTEEDRLAREKQGLPI
                     PSKEHQHYENVRDVKILKTMWFMVIYGLSMFLGGFFIWNLDNHFCTKIRGWRRVVGLP
                     WGMLLEGHGWWYVFLALVLFLFCTAAGVRSGILPVVAAFLELSGDHPYWLQRQGRKCE
                     QCGQELRWLGYDPGICVLFIHRHWFWPGQDLLIIENRMRKMKMVLQLTA"
     exon            complement(1137509..1137662)
                     /number=1
     exon            complement(1137730..1137810)
                     /number=2
     exon            complement(1137925..1138493)
                     /number=3
     CDS             join(1140117..1140174,1140293..1141218)
                     /codon_start=1
                     /locus_tag="AO090009000436"
                     /note="predicted mitochondrial carrier protein"
                     /old_locus_tag="AO070342000021"
                     /protein_id="BAE54898.1"
                     /transl_table=1
                     /translation="MSNSAVYAVPQVKKTSATTTSKTTFHFAAGLCSGLSSAILLQPA
                     DLLKTRVQQSQNAALLPTIKSIISSPNGIRGLWRGTLPSALRTGFGSALYFTSLNALR
                     QGLAHTGVPVALSSASANGKGVASSSALPKLSNSANLATGAAARVAAGFVMMPVTVLK
                     VRYESSYYAYGSLYSAGRDILRTEGVRGLFAGFGATAARDAPYAGLYVLFYEQLKRRF
                     ASLADSGTGDQSLKSSSSSINFVSGALAAGLATAITNPFDAVKTRLQLMPNKYGNMMR
                     AVKLMVHEDGVRSLLGGLGLRITRKALSSALAWTVYEELILRAEKHWATRD"
     exon            1140117..1140174
                     /number=1
     exon            1140293..1141218
                     /number=2
     CDS             complement(1141895..1143562)
                     /codon_start=1
                     /locus_tag="AO090009000437"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000020"
                     /protein_id="BAE54899.1"
                     /transl_table=1
                     /translation="MPRHQQHIVPWTDSESDYSSESDYSMQNDRRRTTVRRRSFSRHR
                     FGPDHGSTTYLSPVVQDVHLHRSASTGARRRRSRERPPPPPAVIVDIKNDSRNKGSNR
                     SANRARKDQHQETYIDPYESEDETLLRAHHRRPRASTASTPREASPRQHERDYELVID
                     QRLLEKNDHRQDLELLRQQQEIERLERELARHRLEARDARDSHDVRILKQEEDWYEDE
                     ISERLRRLERYEKSQRMEEEQRQAERRWKLHQFEEAQRHAREEDGVKSKLREEKLKEL
                     RHKIEEEEEQRKAEHRYKLIQFEDAQRKAREDEDVKARLREEKLKELRHKIEEEEEQR
                     KAEHRYKLRQFEEAQRKAREDEDVKSKLREEKLKDLQRRIDEEEAQERLKEQIRQEKL
                     KELQRKIDEEEERERIKKEIRDEEARALLARQEKERKEAAMKAAAVEEWKLNEERRIN
                     AEREAKRRRDEEFRARLRLEFGYTEEEIEEIVTKKKKKEEKENGKEEEKEKKKDKEKE
                     KEKKKKGKEKEKDDEEESEKEEKEEHRRTTWIKVYYPTANTFCIWLN"
     exon            complement(1141895..1143562)
                     /number=1
     CDS             complement(join(1146826..1146889,1146951..1147219))
                     /codon_start=1
                     /locus_tag="AO090009000439"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000018"
                     /protein_id="BAE54900.1"
                     /transl_table=1
                     /translation="MASINISTIDFAKLDQFDAGEGYGDEVNKLLNAVCSPGFFYPDF
                     KNAFGTKLVLREVKDAYAASDRYFDQSLETKMKDFRKGQPASSDRGYKFCETNESFEV
                     SMGPFSGL"
     exon            complement(1146826..1146889)
                     /number=1
     exon            complement(1146951..1147219)
                     /number=2
     CDS             1149817..1152147
                     /codon_start=1
                     /locus_tag="AO090009000440"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000017"
                     /protein_id="BAE54901.1"
                     /transl_table=1
                     /translation="MGPLSYWEFRDTWSDSPWGVPVRNATSLDYYHTLRSLAMSLRLF
                     EVPRTLLPKLALSLFICFCLLLTKRWRRRKIDTTTYAVKEAKRGKATSQRPTYRTGGS
                     PVDYRSLYYKLQNIEDHQDILPGARELLLSLLSDAINSTAYDKDQGQGIFGIRSYTDE
                     KLFSFLQTSHQGVEDSYEKYIQDRRDGSPRVLVSNRQHATEVLTRLAPLKLVDGAWLG
                     HINHINTPFAHRHVTKQLWQILSEELGGGKLSLHHTYIYKELLKGLDVNLPEPYERSF
                     GEAVPNTNDMRIFKAGVVALLISLFPQEFLPEIFGFNLHFEGLNFETMTLARELRELE
                     IDAQYFLHHLSIDNAHSGHAMMAAFTVSQYLALIVRDEGPKAARIAWRRVQAGYALSK
                     HLRDGIESVVAADEGEIDYHAENNNSPGPYDEKVVNLLIAKAAVAQKIHTACPARIGG
                     KPLVDWLDTSHIVSDSDKLDFLRELGNAAPWVVKGNPDKSRLIREVRRGGKMFGAFTL
                     KEVNLLERWISTLDPRATSNDAQAAYWRFTGRKRFLQHPAMAPSLDPFLNFDCSAYPA
                     LPLGEDYIHDPLLLNLGKNWPKFISMWFAHTSLLESFVAVPSRVATELGAAVTCTLRA
                     QYGLSPEEDGVLGMDELHHTVSAAPTPDLVDIGLEILSCKGISPLPGSLSDILTQCPC
                     DFSSKMLSASVYPVRNGEILLGMLLAFLGLQRAVLECPGMLSETGKQALEGIIEREIT
                     GLKTCRDLLAADKRKAQLFAAGYWMARKEIYRKLGQ"
     exon            1149817..1152147
                     /number=1
     CDS             complement(1153455..1154621)
                     /codon_start=1
                     /locus_tag="AO090009000441"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000016"
                     /protein_id="BAE54902.1"
                     /transl_table=1
                     /translation="MGLIFPETRTDWKFDLVGLLAIIGESIIEEVVQPLTASPTILLP
                     RLLPAPHALIRPSRRTALPSTPVTVHGVYSGIQLQSIPYFPSMIHQLELTRPYEFQKM
                     TIELCQDDEEVLRPGHDKIATVKKLAPLKLITICSSVWTAGVLAWAIVLRDGPAVVAI
                     VLVSLASSFHSAASFWQSDAIVRPSSTRSPPGDLVLRTREGAFIVVHCKEAVARLLYT
                     GEVKCAYVAGAKLYRILIYVGTLLLMLGIVLMSNCSWTMQVTLGASYLALNVIYMFCA
                     LTPAVSRTWHWNMRLVRVVDKSTIITENYTEAIWLAIRATKEIDWVRKGGLIPQTMVW
                     NVWLDEAKLNASNGNANWPATKRKDELLLEDALAKEASNQDDDMSQPKRRPTLL"
     exon            complement(1153455..1154621)
                     /number=1
     CDS             complement(join(1156111..1156279,1156370..1156491,
                     1156601..1156630))
                     /codon_start=1
                     /locus_tag="AO090009000442"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000015"
                     /protein_id="BAE54903.1"
                     /transl_table=1
                     /translation="MSLPNEALQKIGIAKAQVTTKQKAIRLLDLTSSEMSSLPKDTPV
                     YEGVGKMFVGVPMSTVDKRLVAEKAELKSDVSGLEKKLSSLEMTHKNSMEHYERFVKS
                     GGKA"
     exon            complement(1156111..1156279)
                     /number=1
     exon            complement(1156370..1156491)
                     /number=2
     exon            complement(1156601..1156630)
                     /number=3
     CDS             complement(join(1157160..1157389,1157446..1157884,
                     1157968..1158333))
                     /codon_start=1
                     /locus_tag="AO090009000443"
                     /note="isopenicillin N synthase and related dioxygenases"
                     /old_locus_tag="AO070342000014"
                     /protein_id="BAE54904.1"
                     /transl_table=1
                     /translation="MPPGNGSASMAIPVVDFSSWKNTQDEASRLRTAHELVKACQTVG
                     FVYIINHSLPKSVLDEAFDWVKRLFNLPEEEKMRAPHPEGWAVHRGYSWPGLEKVSQT
                     MSTGNDEEAKRKLREVPDVKEVYDIGSDENTEQPNQWIPDEALPGFRTFMIKFYWECW
                     AVGEELLRALAIGLNLEDDSYLVDKHSGHGNQLRLLHYLPVPAEDLEKERTTRCPAHT
                     DWSSLTMLFQDDCGGLEVEDVSRPGTFVPATPLKNAIVVNVGDLLQMWSNDQLRSTNH
                     RVRMPPLADRYEGPDRMTRERFSIPYFISPDPTSVIECIPSCMSEDQPAKYKPITQAE
                     YNKMRASMMY"
     exon            complement(1157160..1157389)
                     /number=1
     exon            complement(1157446..1157884)
                     /number=2
     exon            complement(1157968..1158333)
                     /number=3
     CDS             1160827..1161573
                     /codon_start=1
                     /locus_tag="AO090009000445"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000012"
                     /protein_id="BAE54905.1"
                     /transl_table=1
                     /translation="MKVFGWISAAFFASTVLSIETLPFSPPQSAEANKRAYEVLRILK
                     RADSCPAGYDPCSNMGRSDVCCRQGSVCSRDAADNIACCPTGAKCTGSLTGDSTSAST
                     SFRFPGTATVSMTTTGPNDATITGSTMPGAYPFVYVPTTFPNAGVCSSYYSLCQSEYT
                     GCLSSLGGGYAVTVAAEGGGVTRAGGGAAGAVSTCSSLSMNACHGLNLGYCDTYATGT
                     GDMNRAPPGRTSSLEDLVFGVVIGVAGMFI"
     exon            1160827..1161573
                     /number=1
     CDS             join(1163107..1164109,1164169..1164254)
                     /codon_start=1
                     /locus_tag="AO090009000446"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000011"
                     /protein_id="BAE54906.1"
                     /transl_table=1
                     /translation="MHTSRILHSAISILTLLAQVQRSAASPLDFDEAGLEKRCANSCG
                     YYGQLCCSSGQTCSTDSNGQAVCADSSGGSWQYFTTTFVTTETDVATVTSTWSSYVGQ
                     TTTAGGGSGSCKAELGETICGNTCCGAAYVCSNNQCVMGSSSIWATATATPPVRGTSA
                     STITATASATTTQGFVAPVGTDGAQLIGEKAPDNGGLSGGAIAGIVIGTIAGVFLLLL
                     LCACLCCRGALEALFACLGLGGGRRRRKETTYVEDRYSHHTHGGRPEGRTWFGSRPSA
                     PPPQTSEKKKWGGLATLGIMLGALALCLGLKRRRDHEDEKSDYTYPSSYYYSDYYTST
                     SSASSDRRTRRTRDTRQSRRSRTRSRRS"
     exon            1163107..1164109
                     /number=1
     exon            1164169..1164254
                     /number=2
     CDS             join(1165788..1165938,1166001..1166156,1166216..1166591,
                     1166666..1166843)
                     /codon_start=1
                     /locus_tag="AO090009000447"
                     /note="protein involved in cell differentiation/sexual
                     development"
                     /old_locus_tag="AO070342000010"
                     /protein_id="BAE54907.1"
                     /transl_table=1
                     /translation="MDGGISDENRKVFIWVAELLDPNRREAALMELSKKREQVPELAL
                     VIWHSFGVMTALLQEIISVYPLLNPSQLTAAASNRVCNALALLQCVASHNETRTLFLN
                     AHIPLFLYPFLNTTSKSRPFEYLRLTSLGVIGALVKNDSSDVINFLLTTEIIPLCLRI
                     METGSELSKTVAIFIVQKILLDDIGLAYICATYERFYAVGTVLSNMVTQLVEQQTVRL
                     LKHVVRCFLRLSDNSRAREALRQCLPEPLRDATFSSVLRDDAATKRCLAQLLINLSDN
                     VSDGAPGVAM"
     exon            1165788..1165938
                     /number=1
     exon            1166001..1166156
                     /number=2
     exon            1166216..1166591
                     /number=3
     exon            1166666..1166843
                     /number=4
     CDS             join(1168146..1168457,1168566..1168772)
                     /codon_start=1
                     /locus_tag="AO090009000449"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000008"
                     /protein_id="BAE54908.1"
                     /transl_table=1
                     /translation="MDLVASGPHVRDKALSPLNFHEALTRAVTLSFDNFDEYTRRQYN
                     AKAPHLPNPFGHDEVPNKFSEFDVFLKLRVLHQLTIWTFWNPDRIRDKMPEQREADQT
                     QWMTTDSIVVLILLLPLLRNLPNRRRRERVHVLFERQNAERYQEPLLRRNPRARKIIT
                     SMEKSLGILTRG"
     exon            1168146..1168457
                     /number=1
     exon            1168566..1168772
                     /number=2
     CDS             1169756..1170619
                     /codon_start=1
                     /locus_tag="AO090009000450"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000007"
                     /protein_id="BAE54909.1"
                     /transl_table=1
                     /translation="MSPERRPQSAHTVSLGSPRALFSPSKGANGYSPSREAPPKLPSI
                     QQATHLPPNGRVSFNGGSFHSFHSQRPSSSHSTQSPTFPSPIQNRPSMSPTQGNRDVG
                     PLAGFPPAPPSDNSGPWTPYRQHQAPRRGSGHYASFSSIPGGHPSFAATPNASHSSPP
                     QSSHGGVALSGISPTKQSPRPVTSGSMTGAPILPPIQKLEPSPKLMGRSSPDAPIPPP
                     VKCMTPEQEERRQRENALMLHAQSHAPNGQHSAMSSPSLNRIPPLGPSALSQRHESTV
                     QSESGPKTEGQ"
     exon            1169756..1170619
                     /number=1
     CDS             join(1181454..1181606,1181661..1181720,1181795..1182518,
                     1182716..1182990)
                     /codon_start=1
                     /locus_tag="AO090009000453"
                     /note="predicted protein"
                     /old_locus_tag="AO070342000004"
                     /protein_id="BAE54910.1"
                     /transl_table=1
                     /translation="MVRGQLPSPPHSDGHPTPEPHRESCGIIHPLYAHDDILGAGMTM
                     DHTQQAVAFESSNPPRYLANNGYLQQPMAAHSIQVNTPPSTSDECIVAERTSSAWPQR
                     SANRKAKSGRGSGGRKPKTLHAGDGPSLPGPLSELTKHLTHVPIRDMESWVHRPIEVR
                     RQEVTKKNGKVARPMNSFMLYRSAYTERTKKWLGQNNHQVVSVAVGHSWKMEPPEIRN
                     KFEVLANIEKKNHVKAHPGYRFSPKKDHRRGDDRRNSRLDHTPDSSPGLGQTPRTMST
                     SEMESGWGSRDSTPIGFMEHGMPAGYLSSSWQTTNPASDLCPCTGSRCRWSARSTAAR
                     LPRQPEQWGRGSTLRQYSLSSHLARLACKQQLRCCLVATAGYGTLCSWRGFHAGYATD
                     GGWSRGMGARP"
     exon            1181454..1181606
                     /number=1
     exon            1181661..1181720
                     /number=2
     exon            1181795..1182518
                     /number=3
     exon            1182716..1182990
                     /number=4
     CDS             join(1184420..1184751,1184864..1184957)
                     /codon_start=1
                     /locus_tag="AO090009000454"
                     /note="predicted alpha-helical protein, potentially
                     involved in replication/repair"
                     /old_locus_tag="AO070342000003"
                     /protein_id="BAE54911.1"
                     /transl_table=1
                     /translation="MRRNKRCLLAYHRVRTEKLEELCWTGIDVLEQQVPPAAEDGAQT
                     VASSQSGNHSSLSPEEEEYFRQYSDLLAAYKGQWTDVDLTGALEPPKDLFIDVRVLKD
                     AGEIQTEYGVINLTKNSQLYVRQGDVERLIAQGFLERLS"
     exon            1184420..1184751
                     /number=1
     exon            1184864..1184957
                     /number=2
     CDS             complement(join(1185117..1185910,1185996..1186307,
                     1186375..1186777))
                     /codon_start=1
                     /locus_tag="AO090009000455"
                     /note="cytosine deaminase and related metal-dependent
                     hydrolases"
                     /old_locus_tag="AO070342000002"
                     /protein_id="BAE54912.1"
                     /transl_table=1
                     /translation="MVTSILLKNGTLLLHDANDVVHASKDDLLIENSQITKIAQNIEP
                     PSSDTTIIDCTDKIVSPGFIDTHHHVWQTCLKATHPNHTLFDYFPTGNFVSSFVSADE
                     TFWGQLAGALECIDSGTTTVVDHAHINITPDHSKEAIRATISSGVRSIFGYCPTARVT
                     QWSPKFQMAPDPLAPWVMETFDQLAAMNPLGPSGRVRLGFAFDMLYLPGEILKEIYGR
                     VRRAGAQLITSHSVYGVAFGGPDAPSAANRLDSHGLLGPDILLSHNTNPKPEHTQLIR
                     DKGVKISSTPITELQMGHGNPVCLYPEYQQISSLGIDCHSVCTSYIPTQMSTVLQWAR
                     ARRHEEFEAHSKWAKNVGSSVRDVFNLGTIHGARCINMENEIGSLAVGKKADIVIYDA
                     TSPGLLVAADRDPIAAIVLHSSIRDIDTVIVDGVIRKEGGKLKDVLVAPDIETKEETG
                     GQRVGWGEVARRIRELGVLMDERKKAAVDDEVARAAILEAFHLNVSAWADAI"
     exon            complement(1185117..1185910)
                     /number=1
     exon            complement(1185996..1186307)
                     /number=2
     exon            complement(1186375..1186777)
                     /number=3
     CDS             join(1188731..1188965,1189042..1190388,1190436..1190635,
                     1190687..1190920,1190969..1192146,1192203..1192227)
                     /codon_start=1
                     /locus_tag="AO090009000456"
                     /note="sulfate/bicarbonate/oxalate exchanger SAT-1 and
                     related transporters (SLC26 family)"
                     /old_locus_tag="AO070342000001"
                     /protein_id="BAE54913.1"
                     /transl_table=1
                     /translation="MGVFRPRGRSDSRVSGLPFRRSPFVDDEAPDAIEPPVEQANNGS
                     PPRTPLGIESLVSGGTSHRTPSRSFYHRSFNSTADPARYSSQGLREQTAELASYALSL
                     NGSSLPEERNTLPPSLDIFHPIQDTDLSSSPADTVVTEALDTEPPTGPIASSSALTEM
                     IRNPSDSLDGVNGRGSAPKWSGLGEGGASVGISGTASGMHEAPSTEQTSLLPKSPHTK
                     PFRSYGITEDVESQDTIRERKQNAFHKMLSSCMICFQGLLHPKSWNGRTVWEQGVIYP
                     FSLLPSVFLGLLLNILDALSYGMILFPLGEPIFSDLGSDGISMFYVSTIIAQLVFSCG
                     GSIFRGGVGSEMIEVVPFFHQMAFTILARVGQDNPRSVIATTILAFSASSVLTGLVFF
                     LMGTCKLGSLIGFFPRHILIGCIGGVGFFLLMTGVEVSARLPGSLEITIPTLEKLSRP
                     DTVPLWLVPLLLAIGLLVLKRFVRSNFLVGGYFIAVAVIFYIVKLSAKVPMDTLRKSG
                     WVFEAPSSNNPWWHFYTLYDFAAVDWAAFLDTIPAMFALTFFGVLHVPINVPALGIST
                     GEDNLNVDRELMAHGVTNALSGFSGSIQNYLVYTNSLLFIDSGGNSRLAGIMLAAATL
                     GILLVGPVIVGFIPVMVVGALIFLLGIELMEEALVDTWGKLQRHEYMTVVIIVVTMGA
                     WDFVVGIFVGIILACMSFVVQTSRKSAIRATFSGKIAGSTVRRPPIQQRFLREAGQQT
                     LIIKLGGYLFFGTIVDVENTMRGLIEEEAFNKRPIRFIILDFSRVYGIDFSAAEAFTR
                     INRILRKRNVLMTISGLNTGGDVGRSLQNVGLFESENGVQIFEDFNSALEFCENDYLK
                     VFYSHREALLKRKDTSSTFLEVPGSHTQHHLHESIVSSPRHRHLQQAATTTLREDETA
                     VVPPTAWASMRQPLPLLLQTFQGLTSRNEDFWFRACTYFVRDTYAAGTVLFQEGDVPN
                     GFYLLESGMLRAEYEMPQGRYFELIVAGRPCGELPFFSETRRTATVKAEQDCVAWRLT
                     TAKWRDLREREPEIARELLTVSLKLTTERMDSITSYVLTMAA"
     exon            1188731..1188965
                     /number=1
     exon            1189042..1190388
                     /number=2
     exon            1190436..1190635
                     /number=3
     exon            1190687..1190920
                     /number=4
     exon            1190969..1192146
                     /number=5
     exon            1192203..1192227
                     /number=6
     CDS             join(1198192..1198463,1198523..1198721,1198771..1198972,
                     1199026..1199307,1199360..1200021)
                     /codon_start=1
                     /locus_tag="AO090009000457"
                     /note="predicted protein"
                     /old_locus_tag="AO070174000001"
                     /protein_id="BAE54914.1"
                     /transl_table=1
                     /translation="MSDVQKPVEETPAPVPAAAPVTEVPAETPATETPATEAPKETPA
                     EDTEATPAAAEEKKDEAPAEQPKEEAKEEVTPASEGVLGHKAPGLVKSLRFSKRFFYF
                     SEDAVEAKQLSAFHQNEKAAVANPIAAWASQTGKGLLFFTKRAEDKNTPTGIFNLADV
                     TDVTKEGSSEFLFKVNGHKHTFQAANATERDSWVAAIDAKAAEAKAEKEAITSSEGYK
                     AELEKLTKPAVVEPVKKAAEKPAEAKEEAKEEAAPAEENKDNKAKSRSQSRKRASIFG
                     TLRGKKEETEEKKEGDKTEEAKPAEAATEPAAEASAATETTEAPAAPAEPTEAKEDKE
                     EKEEEKKEEKKEEKKAETKSKRTSLFGNFFQKVTSPSHEKSEKEATAPAETPAVASTA
                     PQLDNPVEEASVKPIEPETVTAPAEAEAAKDAAPASPAAETPKDKRRTSFFGNFGKKK
                     GDSDNEAEGESKPKGNKLGGLFRKPSKAVKSEPKEPAAETEAKAEGAPKEATVPESAE
                     ESKPAEPAATTEEAKPVNVSSTSAPVQAAA"
     exon            1198192..1198463
                     /number=1
     exon            1198523..1198721
                     /number=2
     exon            1198771..1198972
                     /number=3
     exon            1199026..1199307
                     /number=4
     exon            1199360..1200021
                     /number=5
     CDS             join(1204563..1204587,1204648..1205369)
                     /codon_start=1
                     /locus_tag="AO090009000459"
                     /note="predicted protein"
                     /old_locus_tag="AO070194000006"
                     /protein_id="BAE54915.1"
                     /transl_table=1
                     /translation="MSTPNIAQDLPDFFDLQADRFGDDLVPTTEPTMLSPHQMTAGVM
                     AGPDSLADLPSGTISPKDLFMDASAPPSASFTDLSTPSFESPGYFSQDTSPMFATDME
                     LGPGVEEWGSLFPSQDDFSLGLDTTALDIAAALSQPKVKADVTPASPMIRTTSSRATS
                     PSARSVTKPSHVAGVNARQRKPLPPIKFDSQDPVAMKRARNTEAARKSRARKLERQEE
                     MQRRIDELEKSLEEAERREQYWKALAQNKA"
     exon            1204563..1204587
                     /number=1
     exon            1204648..1205369
                     /number=2
     CDS             complement(join(1206611..1207666,1207721..1208443))
                     /codon_start=1
                     /locus_tag="AO090009000460"
                     /note="asparagine synthase"
                     /old_locus_tag="AO070194000005"
                     /protein_id="BAE54916.1"
                     /transl_table=1
                     /translation="MCGIFFSLSASGPVLPNEETCCLLRKRGPDSFQVQQVQRDVNTD
                     QIRSVPILLTFVSTVLSMRGDQVVTQPLVDTTTESVLCWNGDAWKIAGEPIRGNDTQL
                     IFNLLLQAAKPSYNSESSNALDNGTAIQRVVDVISRICGPFSFVFYDAVNAKLYFSRD
                     CLGRRSLLQGIDDTGAFKICSLCDGTSSTHFDEVGTTGVHMIDFTRSVMQDSPTPETG
                     ATHFNTDSIQTLPWENVDSPGHLRNPIPPMNRSVPQDVPPQLSIESPCVDELEQRLRT
                     SLALRIQNVRDPPGFTTESNTKVAVLFSGGLDCTILARLSHELLPADESIDLLNVAFE
                     NPRVAAAASKEAKTGSVYENCPDRITGRSAFAELQAVCPGRNWRFVAIDIPYVETVAH
                     RDTVKRLMRPHNTEMDLSIACALYFASRGQGSAFDSHEGNAEPQRYTTPARVLLSGLG
                     ADELFAGYARHGMAYSRNGFEGLIDEIDLDVSRLGKRNLGRDNRVIAHWGREARFPYL
                     DEDFVSWVVQAPVWEKCGFGLPEPESDDPTKATTGIDPEKRALRLVALKLGMSTVARE
                     KKRAIQFGSRTAKMEKGRVKGTDALS"
     exon            complement(1206611..1207666)
                     /number=1
     exon            complement(1207721..1208443)
                     /number=2
     CDS             join(1209462..1210230,1210282..1210359,1210418..1210593,
                     1210650..1210997,1211127..1211278,1211344..1211389)
                     /codon_start=1
                     /locus_tag="AO090009000462"
                     /note="vacuolar assembly/sorting protein VPS9"
                     /old_locus_tag="AO070194000003"
                     /protein_id="BAE54917.1"
                     /transl_table=1
                     /translation="MSPRLELAGQFFGGQGHFPPRQSSLDQTKAAGEGAQASNVKVGA
                     PSTSPEKQPALSSTSVHRRSLVEEPALTRRSSTSTLPPPPEPEPDQPFDFHRFLEQLR
                     HRTADPVAKFLRSFLNEFGKRQWMVHEQVKIISDFLAFITNKMAMCEVWRDVSDGEFD
                     NAKEGMEKLVMNRLYSQTFSPAIPSPPTIPRSTSRSKRREMERLHGPWRRGQHQEDIE
                     RDEVLAQKIRIYSWVREAHLDIPPVGSHGRRFLTLAQQELSKINSYRAPRDKVICILN
                     CCKVIFGLLKNSKSSDTSADSFIPLLIYVVLHANPEHLVSNIQYILRFRNQDKLGGEA
                     GYYLSSLSGAIQFIETLDRTSLTVSDEDFERNVEAAVSAIAQQNRESESIEPKSTQRS
                     QSTPRSSVDVPRGRRETTQSNDEDNAPVAGLLRTIQKPLSTIGRIFSDEPDSPEERRT
                     HSATTSPDAAVRQASAEDAEARRIQRVEHNNMVETLSNMFPNLDRDVIDDVVKMKEGR
                     VGLAVDACLALSAE"
     exon            1209462..1210230
                     /number=1
     exon            1210282..1210359
                     /number=2
     exon            1210418..1210593
                     /number=3
     exon            1210650..1210997
                     /number=4
     exon            1211127..1211278
                     /number=5
     exon            1211344..1211389
                     /number=6
     CDS             complement(join(1214715..1214742,1215391..1216199))
                     /codon_start=1
                     /locus_tag="AO090009000463"
                     /note="predicted protein"
                     /old_locus_tag="AO070194000002"
                     /protein_id="BAE54918.1"
                     /transl_table=1
                     /translation="MSPQIILGHCFFSQEDVQLASLIPNINDIDLDTLESVLPVQTTD
                     YTVRKLEDVTTAIRATNSSKFQAFLSRVASWDSQRSAHANLDLTAQKGRVYTLKKPTQ
                     WFRRLCEREEVRRWLQEQIEYENEVHFVIGLYTLFDAAASDDLERSSNHSGTISAPIS
                     AIAGLPPSHPANIGVSAGHEGARGTTHRCTAPGEQIFAIRLKKVKYRAWYPHDVNDAH
                     LAKHSHWTMASDNRSAADEHSEMVAVFLDESTDENEEAMVPGFVEFHVLSESLVARPE
                     GQ"
     exon            complement(1214715..1214742)
                     /number=1
     exon            complement(1215391..1216199)
                     /number=2
     CDS             1216516..1220493
                     /codon_start=1
                     /locus_tag="AO090009000464"
                     /note="predicted protein"
                     /old_locus_tag="AO070194000001"
                     /protein_id="BAE54919.1"
                     /transl_table=1
                     /translation="MNVGACDNSSLAFLLSRRGRESLFQYRESGDPAHLDESIDFARQ
                     ALHASLPAERATYLNSLGCRLRERFEALGKIQDISEAIQVTEDASLAIHDPTEQMLVL
                     TNLATYLGDRFESREDMGDLERAIMAGQDALRISSSDQGSQAICLTTLSILHGYRFSK
                     LGALDDLETATRMGEQAVELISPNHPDRAMYLNDLSACYERRFERLGDPTDIDKAINC
                     SSEAVGLSRDDFDRGLHLKNLSNALGSRFLIKGDAQDLSDAITYVSEAIQCTPENHQR
                     YPFLLHDLSFHLEDRFRRYNNITDLEKAISLEEDAISRVDPEDPRLLMLWDELAVLLS
                     LRCDLNDDIGLLDRAIELAEKALDSTTDDNRDRAQYLAHMAAFRASRFERTGSLNDLE
                     QSILLGRQAVDIIPNDDPHRVDLLLDLSDYLHNRYIRLGSPEDNRQAVEIIQTAMQSQ
                     TKYASLRPSQLCTLSHRFQDRYGSTKEKADIDQSIQLAQEALNRVPLDHPQRAYCLHS
                     LSSALEKRFLVLGTMSDLEKSIEYSKKALESTSPDRSDRIDYLYALSIKLTSRYELLG
                     GLIDLEEAIHLMQSCIESEPPNYLNRVSHLKTLSDQLGYLFERNMHTGTLDRAIDTAT
                     EAMKLIPKDDMMGSSILNSLHLLFISRFKTTNNLSDLKSAIEAQREAIKRDSHYRGDR
                     SILIHNLSVGLALYQHTGEPTDPTEAIKLSWEAVETASEYHPNRAMYLNTCGTFLKEN
                     YELTRQIIPGDKKPKDLFLEAFRHESSPPLDRIKAGENAFDCYISNGEWTQANSVARD
                     VVKLFPLLVPRWLSQDDQQHLLKNISHFTSRAASAVLQANGPPLDALKILETGRGVIA
                     RCSIGLKTDISKLEKSHPSLHDEYTMLRRQLSLPSFSTFSSAAEPSQPTLICRRRKAP
                     GLLPPHITTTGPERAEILRRIEHLEEKIRTFPGFEDFNQAPSHASYAEFAMFGPVVVF
                     NVTEQRSDAIIVAENDVYGLHLEQLRFQDLKANVARVIGYKRLSKGVPTTRPQRNREL
                     QDILHWLWATAVHPVLTRIGLYSDKPRSVLPRVWWVASGYMGLLPLHAAGDATRRTMD
                     YVISSYIPTFQVLRFCRERRRMSFREHEPKMLLVSAPEKLDRQTLKTNVELESVREGL
                     QGHQVSYTMLDRPSRDDVFRELPEHHLLHFSCHGYSNATDPSKSALELACTAEDGATS
                     QLTVRDLSLIGHEKAQIAYLSACSTAENSSDELLDEVIHIASAFQLIGFPHVVGTLWE
                     VSDRAAVEVSRLFYEQLGRQMCNGDESNIACCLHEALQTYRKSRKVSRTNDVLSWAPF
                     IYMGA"
     exon            1216516..1220493
                     /number=1
     CDS             complement(1224146..1225075)
                     /codon_start=1
                     /locus_tag="AO090009000465"
                     /note="predicted protein"
                     /old_locus_tag="AO070231000001"
                     /protein_id="BAE54920.1"
                     /transl_table=1
                     /translation="MRSTQIALAGATGNLGIPILKALLDAEYHVTVLSRIGGNSSKLN
                     PHPNQTIKEVDFTSVQSLIPALQDVDVVVSCLATSAIGSQNPLIDAAVAAGVKRFIPA
                     EFGMDSLNPLSVQLPVCAPKAATQKYLLDKSNHHPEFTFTSIANGLFLDWCLETGIIL
                     DLKQHTATLYNGGDVPFSATKLADVAKGVLGVIEHQVETANRVVYIHSALVTQNRLIQ
                     YAKDKDGKAWETVVKDTEDVRKESLAELAKGDRADVDTAMLGFSIVGCGDPNYGCDFS
                     GHLDNGLLGVKEMSEVELRMLVESYLDIDTARH"
     exon            complement(1224146..1225075)
                     /number=1
     CDS             join(1231239..1231354,1231406..1231829)
                     /codon_start=1
                     /locus_tag="AO090009000467"
                     /note="predicted protein"
                     /old_locus_tag="AO070231000003"
                     /protein_id="BAE54921.1"
                     /transl_table=1
                     /translation="MQFKTLPFLILAATALAAPEAQPGDTDSAQSYIDQLESLATQTD
                     MPEGMPTNMPSINTPPPSIMSVLMTAVPASLLQDMGNAASRSSFASEISAGHYPDWYK
                     SLPGDVKTYISTAYQTDAQATGAQKTGDSTATSGPKATGTSGSDSKSSTSEAGAAPTG
                     AVAVGLAGAAGILGLAIAL"
     exon            1231239..1231354
                     /number=1
     exon            1231406..1231829
                     /number=2
     CDS             join(1234019..1234085,1234142..1234466,1234536..1235040)
                     /codon_start=1
                     /locus_tag="AO090009000468"
                     /note="uncharacterized membrane protein"
                     /old_locus_tag="AO070231000004"
                     /protein_id="BAE54922.1"
                     /transl_table=1
                     /translation="MALLFLKQKLFPGQDKRSAGKLGKPLLAPDDSTLNSDQDDIESQ
                     RSYSTFRPSSPTSESGSTSSSRSRINPRIVSDAILGLSDGLTVPFALSAGLSAFGNTK
                     VVVLGGLAELAAGAISMGLGGYVGAKSEAESYETTVRETKELIETSPSETSMIVHDIF
                     STYALPEEAISQINTSLHASHGRLLDFLITFYHKESEPDCNQAWISAITLALGYFVGG
                     FIPLIPYFIFSQVIVALYWSIGVMAITLLAFGYVKTCVVRGWQGRENIAAGIKGGVQM
                     CFVGGVAAGAAIALLRMFGGGA"
     exon            1234019..1234085
                     /number=1
     exon            1234142..1234466
                     /number=2
     exon            1234536..1235040
                     /number=3
     CDS             complement(1236352..1237779)
                     /codon_start=1
                     /locus_tag="AO090009000469"
                     /note="flavin-containing monooxygenase"
                     /old_locus_tag="AO070231000005"
                     /protein_id="BAE54923.1"
                     /transl_table=1
                     /translation="MGPRYRSVAVIGTGPSGVSAVKALNDEKIFDTIRVFERRDRVGG
                     LWHYDPIPDPFPTSTSSSVKQSKIPLSFPTFTPPVPEDTTARTAIYDTLDSNVGAGAM
                     AFTHSSFPEVNSALSVRQYGKSNPSRPFRVVSSYLEDLFKEYLHLVSFNTTVERVEKE
                     DDKWTITLRKRGQFHNNQPADYWWQEHFDAVVIASGHYNVPWIPDIAGLDQAASTHPT
                     KFEHSKAFRSANDYVDKKVIVVGGSISSADLVADLHPIVKGPLYLSLRGKNEALQAAW
                     DLPNVEGKPTIERVQTTERGINVIFADGSVVENVDKLIFATGFKLAYPFLSPNPTTPN
                     NRVAGFYQHVFKIGDPSLALVGQVRAAISFRVYEYQAVAVARYFAGRNANALPSPQEQ
                     DLWEVERLKYKGPSSLFHEIKPDFKEYFDFLRDLAGPPAPGTTAYELPPWDDKWAELG
                     FGVLGLKDQYWRSLKAAAEQVRAKL"
     exon            complement(1236352..1237779)
                     /number=1
     CDS             complement(join(1238400..1238768,1238899..1239098,
                     1239158..1239524,1239590..1239862))
                     /codon_start=1
                     /locus_tag="AO090009000470"
                     /note="predicted protein"
                     /old_locus_tag="AO070231000006"
                     /protein_id="BAE54924.1"
                     /transl_table=1
                     /translation="MRWLSTPLVAVSLSLGLSAISHASQIDRKGNICTVKANGNQTDD
                     VPRLLEAFRKCGNGGTIVFREDQSYWIASRLNPILSDVTIEWRGKWTFSDDLDYWSNH
                     SYPVAFQNHAAGFVITGRNITIDGYGTGGIDGNGNVWYTAEAGNTQPGRSMPFVFWNV
                     SDVHVDNFYVKDPQLWALNIMNGTNIQFNNITCNATAVDAPYGENWAQNTDGFDTMDA
                     RNIRLTNFVYQGGDDCIAIKPRSYDIDIHNVTCRGGNGIAIGSLGQYKEDSSVENVRI
                     DKVKDSYESAGLPRGGGWGNVSNLIFSNFEVQGANIGPTINQNQGDNGSYSGTSLMTV
                     SDITFANCTGYVTNEGEVTSTVTCSENHPCYDIYYDNVVLYQGKNASEPGIGSCKWTI
                     DNGVHGLEGC"
     exon            complement(1238400..1238768)
                     /number=1
     exon            complement(1238899..1239098)
                     /number=2
     exon            complement(1239158..1239524)
                     /number=3
     exon            complement(1239590..1239862)
                     /number=4
     CDS             join(1240875..1241768,1241822..1242001,1242244..1243029)
                     /codon_start=1
                     /locus_tag="AO090009000471"
                     /note="predicted protein"
                     /old_locus_tag="AO070231000007"
                     /protein_id="BAE54925.1"
                     /transl_table=1
                     /translation="MALGYRLPLLVSLLALFQFALAQKCWRNVTCTGPKDSAFPGLWE
                     ENIYAPSSRTVSPKRKILSLARPNATVDYQKSKPYTLNGNGSAVVFDFGIEVGGIVTL
                     DYTSKGGSGALGLAFSEAKNWIGEWSDSSNGAFGPDGALYANFTKDGSASYVMPDKSL
                     RGGFRYLTVFLVTEDQVSVDVDAVSLEIGFQPTWSNLRAYQGYFHSNDDLLNRIWYSG
                     AYTLQTNAVPVNTGRQVPMLKKGWANNATMGPGDTILVDGAKRDRAVWPGDMGVAVPA
                     AFVSTGDLESVKNALQTMYDTQDKTTGAFDESGPPLSQKDSDTYHMWSMVGTYNYLLY
                     TNDTSFLSKNWNKYQKAMDYIYNKSINEYCWDDEYGAFKDNATATALHPQDANSLALL
                     YGIVDPDRASRISKNLLQNWTPIGAETPELPNNISPFISSFEIQGHFKIGQTARALEL
                     IRRSWGWYLNNPNGTESTVIEGYLVDGSFGYRSDRGYSHDPSYVSHAHGWSAGPTNAL
                     TTYVLGLSITSPRGLTWKIAPQFGDLKTVEGGFTTSLGKFQASWDKSPDGYTLQFSVP
                     PGTKGNLTLPYVRSSEKPSITIDGNNINKGVYYVDDTATITVSGGGSHRVVVS"
     exon            1240875..1241768
                     /number=1
     exon            1241822..1242001
                     /number=2
     exon            1242244..1243029
                     /number=3
     CDS             1243384..1244643
                     /codon_start=1
                     /locus_tag="AO090009000472"
                     /note="predicted protein"
                     /old_locus_tag="AO070231000008"
                     /protein_id="BAE54926.1"
                     /transl_table=1
                     /translation="MQGTPLRACTQCIRRQYLRPTGATPTPQRLLSTTRALRSTPKNP
                     LRNSTSSRAREAEIARSKNTMTLSAAGIVACAAAMYGVIKLDVFGLDQVSPKEEEHKV
                     EVQKEGAMKLDGPAGFGGNASVIRVQGQDGAEEVSTGTSTIPTFPSVIRLPKAIDAGS
                     LKAGDEVPESVEEEEYQLLGLGIRTVSFLKIQVYVVGMYVAKSDISELQQRLVRTAVN
                     PPGAKEGVVDTPGATSATSLVSTERQGLKELLLDAERGDEVWDAVIRGDGLKTAFRIV
                     PTRNTDFLHLRDGWVRGITGRAQKANAKALEGAQSEFQDESFGTALNDFKSLFGGGQR
                     KNVPKGQTLLLVRGGRGELDALFHPDPAKPVRFLGRVSDERISRLVWLNYLAGKNVSS
                     EGARQSVVDGVMGIVERPVGTVVQKIV"
     exon            1243384..1244643
                     /number=1
     CDS             complement(join(1245056..1245213,1245314..1245412,
                     1245483..1245534))
                     /codon_start=1
                     /locus_tag="AO090009000473"
                     /note="predicted protein"
                     /old_locus_tag="AO070231000009"
                     /protein_id="BAE54927.1"
                     /transl_table=1
                     /translation="MSAAKIKAQGIINANAVVVFSKSYCPYCKSSKSLLSQLDAKYLT
                     IELDEESDGSAIQDALVEISGQRTVPNIFIKQKHIGGNSDLQARKSELPALLKDAGAL
                     "
     exon            complement(1245056..1245213)
                     /number=1
     exon            complement(1245314..1245412)
                     /number=2
     exon            complement(1245483..1245534)
                     /number=3
     CDS             complement(join(1246507..1247892,1248107..1248211))
                     /codon_start=1
                     /locus_tag="AO090009000474"
                     /note="predicted protein"
                     /old_locus_tag="AO070231000010"
                     /protein_id="BAE54928.1"
                     /transl_table=1
                     /translation="MAGAAAAAFSSDVWLSSGVDSNQHQWEFSVPLTPNHAYAHELGY
                     MNSRGRRDVSHGRRGSEAGSSRDVYGQDAASRSIGNVRNSEDTYNGSLRKSDLKEGAG
                     PCPEDTDDTNWIHRDKLAKIESEELQQILFQRRVGSGSIRSGRGRNHDMHHNEVTTPP
                     IEQMEPWPNLEGHRDITSSPTGLDHDARGNWDLRKPDEIAADDGASSIYRNPGLRKSS
                     SRIPIPTTSTASMNRSRANTISDEETLSFGMPRRASEPITVDSTDASPPAAGSRPASR
                     GVQAQINAAKKTPAKGAAGTGTRKTSAPASTRRPPPRSRTTSNNNPQRQGKPGDRPKT
                     AVNRPEGDPPWLATMYKPDPRLPPDQQILPTHAKRMQQEEWEKEGKTPTTYDREFAPL
                     AVGHDGPRPVENIEKVEEPEEPKEPKEKEEPTPSQPQPEPPSAPKTPDPITRPNTGTG
                     YSPMPKLQEPSQAAPQAALTPKWSPPVVTAEPPPPKERGCGCCIVM"
     exon            complement(1246507..1247892)
                     /number=1
     exon            complement(1248107..1248211)
                     /number=2
     CDS             complement(1250701..1251600)
                     /codon_start=1
                     /locus_tag="AO090009000475"
                     /note="predicted protein"
                     /old_locus_tag="AO070231000011"
                     /protein_id="BAE54929.1"
                     /transl_table=1
                     /translation="MSWRSPFGNLFRRSPQYSTVSNTPQVSDSDYSYIVDGAAGTYGN
                     QDDNAPDTLLLKHKRNAYELNFPAYAINDGTLSVRELRRRAAEATGAPDPKRVKLLYK
                     GKLLDDDELSCRDEGLKQQSEVLCVVSEVGESTPSEGSDAEDKASDSAAPDDAPRPKR
                     VRNRNKNKKNKNKKKNKDGADTLGPPADQKPSASPSRSTLPAPAPNLKAFSTPFEQAQ
                     ALSAYFQRELLPLCNEYIANTPTDPKSREFEHAKLSETILAQVILRADGIEPDGNVDA
                     RNARKALVKEAQSTLTKLDQAKA"
     exon            complement(1250701..1251600)
                     /number=1
     CDS             join(1252535..1252561,1253034..1253408)
                     /codon_start=1
                     /locus_tag="AO090009000476"
                     /note="predicted protein"
                     /old_locus_tag="AO070231000012"
                     /protein_id="BAE54930.1"
                     /transl_table=1
                     /translation="MEGIVTGDRLACVALHGSSLLHEASVSKYTDIPGILLQYIDEFP
                     LTDIAAHAPREAWQSLCEQAICIVHHISDRGILNEDVKTRSLTIQINSEGMFKMFMLD
                     FALCDFHRDYKSEEEWWGWKATQDEEGGVDL"
     exon            1252535..1252561
                     /number=1
     exon            1253034..1253408
                     /number=2
     CDS             complement(join(1253729..1255466,1255546..1255847))
                     /codon_start=1
                     /locus_tag="AO090009000477"
                     /note="integral membrane protein"
                     /old_locus_tag="AO070231000013"
                     /protein_id="BAE54931.1"
                     /transl_table=1
                     /translation="MISITSISVGSNIFFSFALLAISILVLLLLRRFLTLRATPAYLT
                     IPVFLALALPASVVLLVPIDLASSSRDGGGPRAIWLPDRLILVSWRIAYWLIFVLTWA
                     ILPLLGEYVDSGYREPKGRIEYSLRSNARYQLIVLCCAVVGLIYISIQNGFEFTSIKA
                     LVMALAYVWGLVLAIYLMGHGLVSIPRTLFRNANVSGRLRRIQAYAPRLHDRLMDAIT
                     DLESLESQVSQLQRRKTGSALEFKDWIEDLAETSNSSEQRTALLEPSDVSSTIPSVIT
                     ERYMADLTRRLQRARHLKARFIDEWDRLVLTAADLQAIINSSASKKLEFGHAPHRATF
                     FTRQKILNPYMRHHLYVHVIPSVRLLFGVIFAAASLCVIWSELIKSWAPRLSVVTLSI
                     VSYHKDPAPVGFGRQVTASAWLLYMCWAALVGVNDAKVWGNRALVRRNTYGESACWYA
                     GLVARLTVPIAYNFVTFLPMSARENTTFYRFLGRSIDLTPLGKGFDYFFPIFILAPVC
                     ATLFNLYGRVKNICGFGLLEEEDEDLENNPSGYGLGGWREGRDLIERELTGLGSLSLS
                     ARDRSPQPSSRVEEGTNAFSSSRTPRGEATRPSRPSRGAATASTVVTEEEEDDNFFQS
                     FAHRVKNTFETAGTPQWLQGDSFRLPRWMGSDGNEGNNGLARWFGGRPAPGGVRL"
     exon            complement(1253729..1255466)
                     /number=1
     exon            complement(1255546..1255847)
                     /number=2
     CDS             join(1258591..1258757,1258875..1258977,1259033..1261870,
                     1261936..1263366)
                     /codon_start=1
                     /locus_tag="AO090009000478"
                     /note="predicted protein"
                     /old_locus_tag="AO070231000014"
                     /protein_id="BAE54932.1"
                     /transl_table=1
                     /translation="MPGGGNPHGQMQVPQQKPDNQLMMNYLAQALQSQGTFTGWRADV
                     SLKERAVNVYQMWTSLRLIQPHAALQSLAQAALSFEQKAFNNAKEKVDYDKECNDKLV
                     HIRDTRARQAAVLQQNGGMMAQSGHAAGMAGVGQAPFPQQMGRPTQASPMPGQQQMAM
                     GMNDPSRQAAIQHRQQQQQQQQSQAMLQQRAQPRPGNGIPLTDDLSTLSAQDYENVCR
                     IANQILSKTSQEDVDKIKMNLQNMTPEQRQYLNRKNMDPITYFFRSQALTQLRRHKRA
                     RQEAQQRAQNAGVDPNSAMMGDPMMNAQQRQMFQNMMNLQRNSFSMGSQPNLDPSSFI
                     GNVENIQGQQADGLRSQEAGQLVVPASSSQMNQQPFTTPQNMFQVGQGNQTNMNGAGI
                     SPQFFSQQQLQTSQNLQQDRTQQAPQFQPQSQAQTQAQARAQAAQKAQMAISQAGQAN
                     SQMQQQLTQQSPAMPMLNRPMAPGQMSPAQVTAQVRPPSRAPGQQPTGVQSLGGQTGM
                     QGRPQIPPNLPPMVQEQLARMTQEQLTAFLMNQQRRPLNNQAMARANANQQSMPMQQN
                     LSQAGQGQPIVNGQAGNNQNMRASLNLQQQLAGMGGAQAPNQMLPGQQQMTAQQRQQQ
                     QQQQRQHDLYKMQLLRQQSGGLEMSPDQIKDMDRLPFPPSILSNNPNVPSPVPKHIKT
                     WGQLKQWATANPQVLGGIDLQKLVTFQKFHLAQILAQNKEGGRNPDSGGQNPWMQMPF
                     QGQQQQFMNQQQFQAGQQQAPINMPPMRQITVQDIQIARQRLGTQVQNYTDDQLRELL
                     FRNRQKQLMQLAQNRAAQLAAQQGQQTQSSQQPPVTAPSATPQIKSEVQHQQPTTQLN
                     QQMQVTKTQNATPGKGAKGPASKQPPKRKMPNEESADAQNTPAQKSAQPATSQGLSGS
                     TPARPNMPFTREQLVNMTPQQRAQLEAHIRRQQSQNQTRAPISRTAAEEQWNNLPDKI
                     KQWYTEILANAPSNDPISVQPEQKAQMAQQLRECTDMLGRMDTLVQWFSKIPNQEKNV
                     KSLLAMRIQLMRQFKSGPDWTINDHFTVSPEYLTMTTNYVKKLFQAMITRVSQHQNQP
                     SGQRPSVSQGSTNVQSTAQNNMPALNASNLQQLQQQEEAIQRARRASSQTAVSATSAV
                     PPAPFGAPSPQGVPHVYGPGSMPPQELKLPPPKKRKQSHAGPTAGTAGTKSPATKQTT
                     ADAKMAATAMVGPFKCSVPQCQHHYQGFATQNALDKHVEDTHKVEESIEDPLQFALDS
                     FRNLVEEEDKASPESQAPKKSTGSAMDTPQVPPKVGMSSPSMKQEAGTTPITAGATPV
                     TRVYGQFGAKPTSPASNQTPRGPSSKVPLATAKPSGSKDGKKEAGKATEQMPPLEPTA
                     EDPWTSSAVSLEAIQDTFMDFGDDSGFGFGPMDEFINADMFANTQSKDTPDSVETAII
                     TETPKDNDLPKVGDLAGKGAEYLEDNWIPMDWINLPGRFEDGPLLNESWEDIDWDTLD
                     RSNGSMNVDDSGIAICAM"
     exon            1258591..1258757
                     /number=1
     exon            1258875..1258977
                     /number=2
     exon            1259033..1261870
                     /number=3
     exon            1261936..1263366
                     /number=4
     CDS             join(1264240..1264323,1264378..1264454,1264516..1265397,
                     1265475..1265748)
                     /codon_start=1
                     /locus_tag="AO090009000479"
                     /note="predicted integral membrane protein"
                     /old_locus_tag="AO070231000015"
                     /protein_id="BAE54933.1"
                     /transl_table=1
                     /translation="MATKAMIPFLVTMMLVTGVCNTILNKYQDMQCVRNCDSSDPSDR
                     QLFEQPVIQTIQMFIGEMGSWLVVLLSFIYQAYISPRFSNQSSPLLVGGYHPVAENDG
                     IDDTVEDNAIGGDDLPNDPTKPAHAHDGRIRLHGRKIFLLAAPACCDIAGTTLMNVGL
                     LFVAASIYQMTRGALVLFVGLFSVLFLHRKLYLYQWMALFVVVLGVALVGLAGALFGD
                     SQNHDITREDAMAAVAHVSMQARALAKTPEAVQAIIGVLLIAAAQIFTASQFVLEEWI
                     LEHYAMNPLQVVGWEGVFGFSVTVIGSIILYLSIGRTEAGRYGYFDVKEGWHQVFSNR
                     AITISSVLIMISIGGFNFFGLSVTRSVSATSRSTIDTCRTLFIWLASLALGWESFKWL
                     QVAGFALLVYGTFLFNDIVRPPLKACLPRGVRERELLLPEEPIEHI"
     exon            1264240..1264323
                     /number=1
     exon            1264378..1264454
                     /number=2
     exon            1264516..1265397
                     /number=3
     exon            1265475..1265748
                     /number=4
     CDS             complement(join(1266276..1266302,1266365..1266406,
                     1266494..1266749,1266812..1267516,1267568..1268011,
                     1268070..1268185))
                     /codon_start=1
                     /locus_tag="AO090009000480"
                     /note="sterol O-acyltransferase/Diacylglycerol
                     O-acyltransferase"
                     /old_locus_tag="AO070231000016"
                     /protein_id="BAE54934.1"
                     /transl_table=1
                     /translation="MSSAVSQSNGSPLLRPRAILKKLDDPANLSLEKSSLDSSGRSTP
                     VAEDAPPSIQSISHARKQARARNRLFYTIDYIPRVSHFDPRSDYHNFRGFFTLFWIGL
                     FIMVATTALRNVKDTGSPLRVRVWSLLTANVWAMGFSDLAMVVSSAAVLPLHRLYRNS
                     NGWLRWGRGGMIVQSIFEAAWLILWINWPFMLRWTWTAQVFFTLHTLTFLMKIHSYAF
                     YNGHLSETERRLSALDNPGSVSIDAAVDRYPDPAPRRPPTQRRSSHSRSESIQELRED
                     LATELTSPLGHVTYPQNLTLPNYVDFTFCPTLCYELEYPRSKERSWAEIGLKTCAVFG
                     CIFLLTLTSEEFILPVLSEANTQLHLKQSAADKALILAETINMLMFPFMITFLLVFLV
                     IFEYVLGAFAEITCFADRHFYSDWWNSCDWLEFSREWNIPVHHFLRRHVYFPSKTRFS
                     QSVAMFITFLVSSIAHELVMSCITKKLRGYGFVAMMLQLPIVAVQQSKYFRGKTTLRN
                     IFFWLSMIFGLACMCALYVLV"
     exon            complement(1266276..1266302)
                     /number=1
     exon            complement(1266365..1266406)
                     /number=2
     exon            complement(1266494..1266749)
                     /number=3
     exon            complement(1266812..1267516)
                     /number=4
     exon            complement(1267568..1268011)
                     /number=5
     exon            complement(1268070..1268185)
                     /number=6
     CDS             join(1269045..1269054,1269155..1269278,1269332..1269520,
                     1269581..1271711,1271765..1271860)
                     /codon_start=1
                     /locus_tag="AO090009000481"
                     /note="vesicle coat complex AP-1, gamma subunit"
                     /old_locus_tag="AO070231000017"
                     /protein_id="BAE54935.1"
                     /transl_table=1
                     /translation="MTSLKQFIRNVRSAKTIADERAVIQKESAAIRASFREESHDSGI
                     RRNNVAKLLYLFTLGERTHFGQIECLKLLASHRFADKRLGYLGTMLLLDENQEVLTLV
                     TNSLKNDLNHSNQYIVGLALCALGNIASVEMSRDLFPEVESLLSTANPYIRRKAALCA
                     MRICRKVPDLQEHFLEKAKTLLSDRNHGVLLCGLTLVIDMCEAEEAEEGQEGVIEMFR
                     PLAGGLVRALKGLTTSGYAPEHDVSGITDPFLQVKILRLLRVLARGDAATSELINDIL
                     AQVATNTDSTKNVGNAILYEAVLTILDIDADSGLRVLGVNILGKFLTNKDNNIRYVAL
                     NTLNKVVAIEPNAVQRHRNTILECLRDPDISIRRRALDLSFMLINESNVRVIIRELLA
                     FLEVADNEFKPAMTTQIGIAADRFAPNKRWHVDTILRVLKLAGAYVKEQILSSFVRLI
                     ATTPELQTYSVQKLYMSLKEDISQEGLTLAATWVIGEYGDNLLRGGQYEEEELVREVK
                     ESDLVDLFNNILNSTYATQTVVEYITTASMKLTVRMSEPAQVERLRRFLNSRTADLSV
                     EIQQRAVEYTNLFGYDQIRRGVLERMPPPEIREEQRVLGAPTKKRQSKILKDKTKKAA
                     KPAEQDMLLDLMGGDAPATSPTGNGSQNTADLLADILGGDSGLSSPAPQPAQKPAQKP
                     AQSNTAAIMDLFSSNGNTPSPRPAEPASSSMDLLGGLGSAAPAASTPPPSAPAAPAHT
                     AFNKNDLSLTLQVQRGSSGNAQIQARFRNSSNFTSFSGVGLQAAVPKSQRLQLSAINK
                     PDLEAGEEGIQLLKVASLNGALPPKLRLRLRITYSKDGSDPVTDQVDWTEP"
     exon            1269045..1269054
                     /number=1
     exon            1269155..1269278
                     /number=2
     exon            1269332..1269520
                     /number=3
     exon            1269581..1271711
                     /number=4
     exon            1271765..1271860
                     /number=5
     CDS             complement(join(1277796..1278067,1278234..1278320,
                     1278458..1278548))
                     /codon_start=1
                     /locus_tag="AO090009000482"
                     /note="predicted protein"
                     /old_locus_tag="AO070231000019"
                     /protein_id="BAE54936.1"
                     /transl_table=1
                     /translation="MGPVESISSRRLGILIRFKMSLVLVPTNIIGTPITRVSSAVQHD
                     GFKSDSVIRHRWWSVGISIGKLGGSTPSEGPENLEPSLDALARGDEAETSLMSGQSLH
                     EERLSWLDALCNRLHVQMTAARDPITHFEKDLFRKASAACATAMTGK"
     exon            complement(1277796..1278067)
                     /number=1
     exon            complement(1278234..1278320)
                     /number=2
     exon            complement(1278458..1278548)
                     /number=3
     CDS             complement(join(1279732..1280588,1280714..1280909))
                     /codon_start=1
                     /locus_tag="AO090009000483"
                     /note="phosphoesterases"
                     /old_locus_tag="AO070231000020"
                     /protein_id="BAE54937.1"
                     /transl_table=1
                     /translation="MRRKTRFVCVSDTHGYTPAEAGFKLPAGDVLIHAGDLTNQGSIT
                     ELRKTINWVAAADFEVKIVICGNHDITLDPNFYAKHGPKFHNQRLEDPQKCIEVVTAS
                     SSIVFLRHQSALVRLTRPNGPNTIFKVFGSPFSQSPGTWAWGYESVDAAALWSRIPLD
                     TDLVVTHTPPHSHCDRRATGGSVGCEALRQALARVRPSLAICGHVHESRGYERVRWPL
                     SPLTGSEQVIRGALPEPGSKKQSLIDLTGKKAQRLENDDCFFDDEKNNQGALFPPAQN
                     TLILSSADDVEESTTSYPRLRPDECPSDPLNDRSRRRETCIVNAAIMATSWPHRGGKR
                     FNHPIVVDLELPVWRE"
     exon            complement(1279732..1280588)
                     /number=1
     exon            complement(1280714..1280909)
                     /number=2
     CDS             1281492..1283330
                     /codon_start=1
                     /locus_tag="AO090009000484"
                     /note="serine palmitoyltransferase"
                     /old_locus_tag="AO070231000021"
                     /protein_id="BAE54938.1"
                     /transl_table=1
                     /translation="MPRWNRKKKSQAKNEIPSSSNPAVVPSDNLTAVASLRAVSSNPS
                     DAPKIAELDPIELRKLAKQHAEFGPLGDPSHLYKSEHPGGEIPDPVLDEPPYFIALTT
                     YISFLVLIFLGHFHDYFAKWFRSHTYRHLRPQNGYASLYSDFESFYTRRLKQRINDCF
                     ERPTTGVPGRYITLLDQTSEDNLHFQLTGTTTDTLNLSSYNYLGFAQSEGPCSDFAEE
                     TIRRDGISMAGSCSEAGTSKLHLEVENQIARFVGKESAIVYSMGFVTNATIFPALVER
                     GCLILSDELNHASIRFGARLSGAAIQVFAHNNMADLEKRLREAISQGQPRTHRPWKKI
                     LVTVEGLFSMEGTMCNLPRILELKKRYKFHLFVDEAHSIGAVGPHGRGVCDYFKVDPA
                     EVDILMGTFTKSFGANGGYIAADKAIIDKVRFTNAGQVFGEAPAPSVLAQIYSSLRLI
                     ADEDPLHPGQGIERVQRLAFNSRYLRLGLKRLGFIVYGHDDSPIVPLMLYNPAKMPAF
                     SHEMLRRKISVVVVTYPATPLELSRARFCVSAAHTKDDLDRILRVCDEIGDALELKYS
                     TGVAGGLRDPPSDKDLKGGKKTIEPPRWNIEEVIERGTRDAKLPLY"
     exon            1281492..1283330
                     /number=1
     CDS             join(1284286..1284306,1284482..1284617,1284791..1284844,
                     1284904..1285162,1285256..1285394)
                     /codon_start=1
                     /locus_tag="AO090009000485"
                     /note="60S ribosomal protein L13a"
                     /old_locus_tag="AO070231000022"
                     /protein_id="BAE54939.1"
                     /transl_table=1
                     /translation="MSSTEPVVVIDGKGHLLGRLASTVAKQLLNGQKIVVVRCEALNI
                     SGEFFRAKLKYHAYLRKMTRFNPTRGGPFHFRAPSRIFYKAVRGMIPHKTARGAAAME
                     RLKVFEGVPPPYDKKKRVVVPQALRVLRLRPGRKYCTVGRLSHEVGWKYQDVVARLEE
                     RRKVKSSAYYERKKAARRQLVQAQKSAGVSDQTKSQLAQYGY"
     exon            1284286..1284306
                     /number=1
     exon            1284482..1284617
                     /number=2
     exon            1284791..1284844
                     /number=3
     exon            1284904..1285162
                     /number=4
     exon            1285256..1285394
                     /number=5
     CDS             join(1286804..1286932,1287008..1287203,1287278..1287724,
                     1287784..1288413,1288475..1288782)
                     /codon_start=1
                     /locus_tag="AO090009000486"
                     /note="acyl-CoA synthetases (AMP-forming)/AMP-acid
                     ligases II"
                     /old_locus_tag="AO070231000023"
                     /protein_id="BAE54940.1"
                     /transl_table=1
                     /translation="MSGAVSRLSGLLGHFVPGAEQRVNFHTLSPTSFLPRAAAIEPEA
                     VAIHHVTANNQVLRRTYAETADRARGLAYYLKKHGFKRVGVLCPNTPAFLESIFGIAA
                     AGAVNVAVNYRLKEDDIAYIFTHSDVEAIIVDQEFLSLLQSYRASRPSIPIIVDMDTD
                     ATEGELSGPFDEVVLEGLTYDLDTGAKGWPGLEAQAASEDDVIALAYTSGTTARPKGV
                     EYTHRGCYLAAMGNVIESGLNSHRGRCRYLWTLPMFHACGWTFPWAVTAVRGTHYCLR
                     KIDYPQIWKLLKQEHITHFNAAPTVNTLLCNSKEAEPLPEPVHVTVAASPPTPHLFEQ
                     MTNLNLHPVHVYGMTETYGPITKGYYLPAWDNLPSSERYKKMARQGHGFVTSLPVRVI
                     KTDVAEGTVIDVARDGKEIGEIVFVGNICARGYYKDPDATRKLFAGGVLHSGDLAVWH
                     ADGSIQIQDRAKDIIISGGENISSVALESMLVTHPDILEAGVVAVPDSHWGERPKAFV
                     TVKPGKFLTGSEVIEWARNASDISKFMIPREVEVVAELPKTSTGKVRKNILRDWAKGA
                     NRS"
     exon            1286804..1286932
                     /number=1
     exon            1287008..1287203
                     /number=2
     exon            1287278..1287724
                     /number=3
     exon            1287784..1288413