LOCUS       AK372378                1121 bp    mRNA    linear   PLN 20-MAY-2011
DEFINITION  Hordeum vulgare subsp. vulgare mRNA for predicted protein,
            complete cds, clone: NIASHv2150P13.
ACCESSION   AK372378
VERSION     AK372378.1
KEYWORDS    FLI_CDNA; CAP trapper.
SOURCE      Hordeum vulgare subsp. vulgare (domesticated barley)
  ORGANISM  Hordeum vulgare subsp. vulgare
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; BOP
            clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum.
REFERENCE   1  (bases 1 to 1121)
  AUTHORS   Matsumoto,T., Kanamori,H. and Tanaka,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-OCT-2010) to the DDBJ/EMBL/GenBank databases.
            Contact:Takashi Matsumoto
            National Institute of Agrobiological Sciences, Division of Genome
            and Biodiversity Research; Kannondai 2-1-2, Tsukuba, Ibaraki
            305-8602, Japan
REFERENCE   2
  AUTHORS   Matsumoto,T., Tanaka,T., Sakai,H., Amano,N., Kanamori,H.,
            Kurita,K., Kikuta,A., Kamiya,K., Yamamoto,M., Ikawa,H., Fujii,N.,
            Hori,K., Itoh,T. and Sato,K.
  TITLE     Comprehensive Sequence Analysis of 24,783 Barley Full-Length cDNAs
            Derived from 12 Clone Libraries
  JOURNAL   Plant Physiol. 156, 20-28 (2011)
COMMENT     This clone was obtained at our laboratory
            Please visit our web site
            URL: http://barleyflc.dna.affrc.go.jp/hvdb/index.html
FEATURES             Location/Qualifiers
     source          1..1121
                     /clone="NIASHv2150P13"
                     /clone_lib="Normalized and subtracted barley full-length
                     cDNA library from seedling shoot and root with ABA
                     treatment"
                     /cultivar="Haruna Nijo"
                     /db_xref="taxon:112509"
                     /dev_stage="seedling"
                     /mol_type="mRNA"
                     /organism="Hordeum vulgare subsp. vulgare"
                     /sub_species="vulugare"
                     /tissue_type="shoot and root"
     CDS             52..831
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="BAK03576.1"
                     /translation="MASATSKSAAVLVLLVCFAGVVTTADARFRAMQWTPAHATFYGD
                     EATSETMGGACGYDITAGYGADTAALSSTLFQEGYGCGTCYQIRCVKAAACYRGSPVI
                     TVTATNLCPPNWAQDTNNGGWCNPPRTHFDLAIPAFKKMADWHAGIVPVMYRRVPCMR
                     KGGIRFAFQGNPHWLLVYVTNVGGAGDVGEMWVKGNGGMGWLRMSHNWGASYQAFGQL
                     GGQALSFKLTSYTTGLTILAADAAPASWSIGLTYQARANFK"
BASE COUNT          222 a          344 c          353 g          202 t
ORIGIN      
        1 gagacctcag ccaagaagag aacgccacaa aggcaacgcg aagcgaaggc aatggcttct
       61 gctacgtcca aatccgcggc cgtcttggtc cttctcgtct gctttgccgg cgtggtcacc
      121 accgcggacg ccaggttcag ggccatgcag tggactcccg cccacgccac gttctacggc
      181 gacgaggcca catccgagac gatgggcggg gcgtgcgggt acgacatcac ggcggggtac
      241 ggcgcggaca cggcggcgct gagctcgacg ctgttccagg agggctacgg gtgcgggacg
      301 tgctaccaga tccggtgcgt gaaagccgcg gcttgctaca ggggctcgcc ggtgatcacg
      361 gtgaccgcga ccaacctgtg cccgcccaac tgggcgcagg acaccaacaa cggcggctgg
      421 tgcaacccac cgcgcaccca cttcgacctc gccatcccgg ccttcaagaa gatggccgac
      481 tggcacgcgg gcatcgttcc cgtcatgtac cgcagggtgc cgtgcatgcg caagggcggc
      541 atccggttcg cgttccaggg gaacccgcac tggctgctgg tgtacgtcac gaacgtcggc
      601 ggcgccgggg acgtcgggga gatgtgggtg aagggcaatg gcggaatggg gtggctgcgc
      661 atgagccaca actggggcgc ctcgtaccag gcgttcgggc agctcggcgg ccaggcgctc
      721 agcttcaagc tcacctccta caccaccggg ctgaccatcc tcgccgccga cgcagcgccg
      781 gcgagctgga gcatcgggct cacgtaccag gctcgcgcca acttcaaata ggactcgaag
      841 cgacgctctg aagcgcagca agtagcagga gctgtgacta tgacaacgct ctgcggtgct
      901 atgcttggac aatagttgcc ctctacaact ttcgttgttt cgttgcttat ttttcagttc
      961 tcgttaggac actgtcccgc gttgcccccg tccatgtgaa gagcgggggg tttgacgcat
     1021 ggactgacag tgaaaattct gcagcacgat caaagcaaaa gattgcacat tgtattgtgc
     1081 ctcaaaagtt taactatttc aattaagaat ttcccacgtg c
//