LOCUS AK372378 1121 bp mRNA linear PLN 20-MAY-2011 DEFINITION Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2150P13. ACCESSION AK372378 VERSION AK372378.1 KEYWORDS FLI_CDNA; CAP trapper. SOURCE Hordeum vulgare subsp. vulgare (domesticated barley) ORGANISM Hordeum vulgare subsp. vulgare Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum. REFERENCE 1 (bases 1 to 1121) AUTHORS Matsumoto,T., Kanamori,H. and Tanaka,T. TITLE Direct Submission JOURNAL Submitted (01-OCT-2010) to the DDBJ/EMBL/GenBank databases. Contact:Takashi Matsumoto National Institute of Agrobiological Sciences, Division of Genome and Biodiversity Research; Kannondai 2-1-2, Tsukuba, Ibaraki 305-8602, Japan REFERENCE 2 AUTHORS Matsumoto,T., Tanaka,T., Sakai,H., Amano,N., Kanamori,H., Kurita,K., Kikuta,A., Kamiya,K., Yamamoto,M., Ikawa,H., Fujii,N., Hori,K., Itoh,T. and Sato,K. TITLE Comprehensive Sequence Analysis of 24,783 Barley Full-Length cDNAs Derived from 12 Clone Libraries JOURNAL Plant Physiol. 156, 20-28 (2011) COMMENT This clone was obtained at our laboratory Please visit our web site URL: http://barleyflc.dna.affrc.go.jp/hvdb/index.html FEATURES Location/Qualifiers source 1..1121 /clone="NIASHv2150P13" /clone_lib="Normalized and subtracted barley full-length cDNA library from seedling shoot and root with ABA treatment" /cultivar="Haruna Nijo" /db_xref="taxon:112509" /dev_stage="seedling" /mol_type="mRNA" /organism="Hordeum vulgare subsp. vulgare" /sub_species="vulugare" /tissue_type="shoot and root" CDS 52..831 /codon_start=1 /product="predicted protein" /protein_id="BAK03576.1" /translation="MASATSKSAAVLVLLVCFAGVVTTADARFRAMQWTPAHATFYGD EATSETMGGACGYDITAGYGADTAALSSTLFQEGYGCGTCYQIRCVKAAACYRGSPVI TVTATNLCPPNWAQDTNNGGWCNPPRTHFDLAIPAFKKMADWHAGIVPVMYRRVPCMR KGGIRFAFQGNPHWLLVYVTNVGGAGDVGEMWVKGNGGMGWLRMSHNWGASYQAFGQL GGQALSFKLTSYTTGLTILAADAAPASWSIGLTYQARANFK" BASE COUNT 222 a 344 c 353 g 202 t ORIGIN 1 gagacctcag ccaagaagag aacgccacaa aggcaacgcg aagcgaaggc aatggcttct 61 gctacgtcca aatccgcggc cgtcttggtc cttctcgtct gctttgccgg cgtggtcacc 121 accgcggacg ccaggttcag ggccatgcag tggactcccg cccacgccac gttctacggc 181 gacgaggcca catccgagac gatgggcggg gcgtgcgggt acgacatcac ggcggggtac 241 ggcgcggaca cggcggcgct gagctcgacg ctgttccagg agggctacgg gtgcgggacg 301 tgctaccaga tccggtgcgt gaaagccgcg gcttgctaca ggggctcgcc ggtgatcacg 361 gtgaccgcga ccaacctgtg cccgcccaac tgggcgcagg acaccaacaa cggcggctgg 421 tgcaacccac cgcgcaccca cttcgacctc gccatcccgg ccttcaagaa gatggccgac 481 tggcacgcgg gcatcgttcc cgtcatgtac cgcagggtgc cgtgcatgcg caagggcggc 541 atccggttcg cgttccaggg gaacccgcac tggctgctgg tgtacgtcac gaacgtcggc 601 ggcgccgggg acgtcgggga gatgtgggtg aagggcaatg gcggaatggg gtggctgcgc 661 atgagccaca actggggcgc ctcgtaccag gcgttcgggc agctcggcgg ccaggcgctc 721 agcttcaagc tcacctccta caccaccggg ctgaccatcc tcgccgccga cgcagcgccg 781 gcgagctgga gcatcgggct cacgtaccag gctcgcgcca acttcaaata ggactcgaag 841 cgacgctctg aagcgcagca agtagcagga gctgtgacta tgacaacgct ctgcggtgct 901 atgcttggac aatagttgcc ctctacaact ttcgttgttt cgttgcttat ttttcagttc 961 tcgttaggac actgtcccgc gttgcccccg tccatgtgaa gagcgggggg tttgacgcat 1021 ggactgacag tgaaaattct gcagcacgat caaagcaaaa gattgcacat tgtattgtgc 1081 ctcaaaagtt taactatttc aattaagaat ttcccacgtg c //