LOCUS AK372340 1009 bp mRNA linear PLN 20-MAY-2011
DEFINITION Hordeum vulgare subsp. vulgare mRNA for predicted protein,
complete cds, clone: NIASHv2150D03.
ACCESSION AK372340
VERSION AK372340.1
KEYWORDS FLI_CDNA; CAP trapper.
SOURCE Hordeum vulgare subsp. vulgare (domesticated barley)
ORGANISM Hordeum vulgare subsp. vulgare
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; BOP
clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum.
REFERENCE 1 (bases 1 to 1009)
AUTHORS Matsumoto,T., Kanamori,H. and Tanaka,T.
TITLE Direct Submission
JOURNAL Submitted (01-OCT-2010) to the DDBJ/EMBL/GenBank databases.
Contact:Takashi Matsumoto
National Institute of Agrobiological Sciences, Division of Genome
and Biodiversity Research; Kannondai 2-1-2, Tsukuba, Ibaraki
305-8602, Japan
REFERENCE 2
AUTHORS Matsumoto,T., Tanaka,T., Sakai,H., Amano,N., Kanamori,H.,
Kurita,K., Kikuta,A., Kamiya,K., Yamamoto,M., Ikawa,H., Fujii,N.,
Hori,K., Itoh,T. and Sato,K.
TITLE Comprehensive Sequence Analysis of 24,783 Barley Full-Length cDNAs
Derived from 12 Clone Libraries
JOURNAL Plant Physiol. 156, 20-28 (2011)
COMMENT This clone was obtained at our laboratory
Please visit our web site
URL: http://barleyflc.dna.affrc.go.jp/hvdb/index.html
FEATURES Location/Qualifiers
source 1..1009
/clone="NIASHv2150D03"
/clone_lib="Normalized and subtracted barley full-length
cDNA library from seedling shoot and root with ABA
treatment"
/cultivar="Haruna Nijo"
/db_xref="taxon:112509"
/dev_stage="seedling"
/mol_type="mRNA"
/organism="Hordeum vulgare subsp. vulgare"
/sub_species="vulugare"
/tissue_type="shoot and root"
CDS 127..636
/codon_start=1
/product="predicted protein"
/protein_id="BAK03538.1"
/translation="MEHKETGCQSREGPILCVNNCGFFGSAATMNMCSKCHKEMAMKQ
EQAKLAASSFDSIVNGGDAVKEHLAAGSTAVAVAHVQAKALITAQPADIAGPSEAAME
SPKGPSRCSTCRKRVGLTGFNCRCGNLYCATHRYSDKHECKFDYRAAAMDAIAKANPV
VKAEKLDKI"
BASE COUNT 202 a 290 c 291 g 226 t
ORIGIN
1 ggtttcgaag cccaccgaat tcctcgcgat tcctctcccc tcgcctcctc gtcctccccc
61 tcctagggga tcgccggaga ggaatcgcga cgagggcttc ctcttatcag ttaattaacc
121 aaagccatgg agcacaagga gacgggctgc cagtcacggg agggtccgat cctttgcgtc
181 aataactgcg gcttctttgg cagcgcggcg accatgaaca tgtgctccaa gtgccacaag
241 gagatggcga tgaagcagga gcaggccaag ctggccgcct cctcttttga cagcatcgtc
301 aacggtggcg atgcggtgaa agagcacctt gctgctggca gcacagcggt ggcagttgct
361 cacgttcagg cgaaggcgct gatcaccgca cagcctgctg acatcgctgg tcccagcgag
421 gcggccatgg agagccccaa aggcccaagc cggtgcagca cctgcagaaa gagggtcggg
481 ctcaccggat tcaactgccg gtgcgggaac ctctactgcg cgacgcaccg ctactcggac
541 aagcacgagt gcaagttcga ctaccgcgct gcggccatgg acgccatcgc caaggccaac
601 ccggtggtga aggcggagaa gctcgacaag atctaggaaa gggtcggcaa aacagaaggt
661 cccaaaatca atctgcgcta cctcgtcatc gtgcgtcttt gctgcattat cctttcatca
721 tgctggcttc tgcaatctta gttgttgggc aatcgtgatg cacggcacac gcgcctcggc
781 ggcagcccca ggtccgaacg gtctccttgt tggctatgtt gtgtaagctt tatttatggt
841 cgtctctctg cgcggcggaa cggtaatggt attgtggctt tcgcattttg gctagcactc
901 tgtaatgtac tgctgtttcc tcctggtgtc cgtctgtctg tctgtctgtc ttacagtcgc
961 aaccggtaag taatggtatc gagtaagcgt cgtcgtctgt tattatggt
//