LOCUS       AK111857                1125 bp    mRNA    linear   PLN 04-DEC-2008
DEFINITION  Oryza sativa Japonica Group cDNA clone:J033021F14, full insert
            sequence.
ACCESSION   AK111857
VERSION     AK111857.1
KEYWORDS    CAP trapper; FLI_CDNA.
SOURCE      Oryza sativa Japonica Group (Japanese rice)
  ORGANISM  Oryza sativa Japonica Group
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; BOP
            clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
REFERENCE   1  (bases 1 to 1125)
  AUTHORS   Kikuchi,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (12-SEP-2002) to the DDBJ/EMBL/GenBank databases.
            Contact:Shoshi Kikuchi
            National Institute of Agrobiological Sciences, Department of
            Molecular Genetics, Head of Laboratory of Gene Expression; 2-1-2
            Kannondai, Tsukuba, Ibaraki 305-8602, Japan
REFERENCE   2
  AUTHORS   Adachi,J., Aizawa,K., Akimura,T., Arakawa,T., Carninci,P., Doi,K.,
            Fujimura,T., Fukuda,S., Hanagaki,T., Hara,A., Hashizume,W.,
            Hayashida,K., Hayashizaki,Y., Hayatsu,N., Hiramoto,K., Hiraoka,T.,
            Hori,F., Hotta,I., Iida,J., Iida,Y., Ikeda,R., Imamura,K.,
            Imotani,K., Ishibiki,J., Ishii,Y., Ishikawa,M., Itoh,M.,
            Kagawa,I., Kanagawa,S., Katoh,H., Kawagashira,N., Kawai,J.,
            Kawamata,M., Kikuchi,S., Kishikawa-Hirozane,T., Kishimoto,N.,
            Kobayashi,M., Kodama,T., Kojima,K., Kojima,Y., Kondo,S., Konno,H.,
            Kouda,M., Koya,S., Kurihara,C., Kurosaki,T., Kusumegi,T., Li,C.,
            Lu,M., Masuda,H., Matsubara,K., Matsuyama,T., Miura,J.,
            Miyazaki,A., Mizuno,K., Murakami,K., Murata,M., Nagata,T.,
            Nakahama,Y., Nakamura,M., Namiki,T., Narikawa,R., Niikura,J.,
            Nishi,K., Nomura,K., Numasaki,R., Ohneda,E., Ohno,M., Ohtsuki,K.,
            Oka,M., Ooka,H., Osato,N., Ota,Y., Otomo,Y., Ryu,R., Saitoh,H.,
            Sakai,C., Sakai,K., Sakazume,N., Sano,H., Sasaki,D., Sato,K.,
            Satoh,K., Shibata,K., Shinagawa,A., Shiraki,T., Shishiki,T.,
            Sogabe,Y., Sugano,S., Sugiyama,A., Suzuki,K., Suzuki,Y.,
            Tagami,M., Tagami-Takeda,Y., Tagawa,A., Takahashi,F.,
            Takaku-Akahira,S., Tanaka,T., Tomaru,A., Toya,T., Tsunoda,Y.,
            Ueda,M., Waki,K., Xie,Q., Yahagi,W., Yamada,H., Yamamoto,M.,
            Yasunishi,A., Yazaki,J., Yokomizo,S. and Yoshimura,A.
  TITLE     Rice full-length cDNA
  JOURNAL   Unpublished (2002)
REFERENCE   3
  AUTHORS   The Rice Full-Length cDNA Consortium, National Institute of
            Agrobiological Sciences Rice Full-Length cDNA Project Team:,
            Kikuchi,S., Satoh,K., Nagata,T., Kawagashira,N., Doi,K.,
            Kishimoto,N., Yazaki,J., Ishikawa,M., Yamada,H., Ooka,H.,
            Hotta,I., Kojima,K., Namiki,T., Ohneda,E., Yahagi,W., Suzuki,K.,
            Li,C., Ohtsuki,K., Shishiki,T., Foundation of Advancement of
            International Science Genome Sequencing & Analysis Group:,
            Otomo,Y., Murakami,K., Iida,Y., Sugano,S., Fujimura,T., Suzuki,Y.,
            Tsunoda,Y., Kurosaki,T., Kodama,T., Masuda,H., Kobayashi,M.,
            Xie,Q., Lu,M., Narikawa,R., Sugiyama,A., Mizuno,K., Yokomizo,S.,
            Niikura,J., Ikeda,R., Ishibiki,J., Kawamata,M., Yoshimura,A.,
            Miura,J., Kusumegi,T., Oka,M., Ryu,R., Ueda,M., Matsubara,K.,
            RIKEN:, Kawai,J., Carninci,P., Adachi,J., Aizawa,K., Arakawa,T.,
            Fukuda,S., Hara,A., Hashidume,W., Hayatsu,N., Imotani,K.,
            Ishii,Y., Itoh,M., Kagawa,I., Kondo,S., Konno,H., Miyazaki,A.,
            Osato,N., Ota,Y., Saito,R., Sasaki,D., Sato,K., Shibata,K.,
            Shinagawa,A., Shiraki,T., Yoshino,M. and Hayashizaki,Y.
  TITLE     Collection, Mapping, and Annotation of Over 28,000 cDNA Clones
            from japonica Rice
  JOURNAL   Science 301, 376-379 (2003)
COMMENT     This clone is one of the 32K full-length cDNA clones from
            japonica rice.
            URL : http://cdna01.dna.affrc.go.jp/cDNA/
            
            NIAS Rice Full-Length cDNA Project Team: Kikuchi,S.,
            Satoh,K., Nagata,T., Kawagashira,N., Doi,K., Kishimoto,N.,
            Yazaki,J., Ishikawa,M., Yamada,H., Ooka,H., Hotta,I., 
            Kojima,K., Namiki,T., Ohneda,E., Yahagi,W., Suzuki,K., 
            Li,C., Ohtsuki,K., Shishiki,T., Yamamoto,M. and Nakahama,Y.
            
            FAIS Genome Sequencing & Analysis Group: Otomo,Y., Iida,Y.,
            Fujimura,T., Ikeda,R., Ishibiki,J., Kawamata,M., 
            Kobayashi,M., Kodama,T., Kurosaki,T., Kusumegi,T., Lu,M., 
            Masuda,H., Miura,J., Mizuno,K., Narikawa,R., Niikura,J., 
            Oka,M., Ryu,R., Sugano,S., Sugiyama,A., Suzuki,Y., 
            Tsunoda,Y., Ueda,M., Xie,Q., Yokomizo,S., Yoshimura,A., 
            Matsubara,K. and Murakami,K.
            
            Genome Exploration Research Group in Riken Genomic Sciences 
            Center and Genome Science Laboratory in Riken: Adachi,J., 
            Aizawa,K., Akimura,T., Arakawa,T., Carninci,P., Fukuda,S., 
            Hanagaki,T., Hara,A., Hashizume,W., Hayashida,K., 
            Hayatsu,N., Hiramoto,K., Hiraoka,T., Hori,F., Iida,J., 
            Imamura,K., Imotani,K., Ishii,Y., Itoh,M., Kagawa,I., 
            Kanagawa,S., Katoh,H., Kawai,J., Kishikawa-Hirozane,T., 
            Kojima,Y., Kondo,S., Konno,H., Kouda,M., Koya,S., 
            Kurihara,C., Matsuyama,T., Miyazaki,A., Murata,M., 
            Nakamura,M., Nishi,K., Nomura,K., Numasaki,R., Ohno,M., 
            Osato,N., Ota,Y., Saitoh,H., Sakai,C., Sakai,K., 
            Sakazume,N., Sano,H., Sasaki,D., Sato,K., Shibata,K., 
            Shinagawa,A., Shiraki,T., Sogabe,Y., Tagami,M., 
            Tagami-Takeda,Y., Tagawa,A., Takahashi,F., 
            Takaku-Akahira,S., Tanaka,T., Tomaru,A., Toya,T., Waki,K., 
            Yasunishi,A. and Hayashizaki,Y.
FEATURES             Location/Qualifiers
     source          1..1125
                     /clone="J033021F14"
                     /cultivar="Nipponbare"
                     /db_xref="taxon:39947"
                     /mol_type="mRNA"
                     /organism="Oryza sativa Japonica Group"
     CDS             110..619
                     /db_xref="Osa1:LOC_Os05g38550"
                     /db_xref="RAP-DB:Os05g0460200"
                     /note="(RAP Annotation release2) Similar to Ubiquitin
                     carrier protein"
                     /note="(Rice Genome Annotation Project)
                     ubiquitin-conjugating enzyme E2 7, putative, expressed"
                     /note="mapping to R05-TIGRv4S1-000766F (Chr.5: short
                     arm=22532720, long arm=22537120, direction=forward) for
                     TIGR Pseudomol ver4"
                     /protein_id="BAG99447.1"
                     /translation="MATAASQASLLLQKQLKDLAKNPVDGFSAGLVDDSNVFEWQVTI
                     IGPPDTLYDGGYFNAIMTFPQNYPNSPPSVRFTSEMWHPNVYPDGRVCISILHPPGED
                     PNGYELASERWTPVHTVESIVLSIISMLSSPNDESPANIEAAKDWREKRDDFKKKVRR
                     IVRKSQEML"
BASE COUNT          286 a          271 c          265 g          303 t
ORIGIN      
        1 ggcgaactct ccacgcctcc acaaataaag ctcgtcccga ggaagggcgg cgacccaccc
       61 cccccaatcg ccaaaaccct aactccgatc cgatcgagct ctgcttccca tggcgactgc
      121 cgcgagccag gcgagcctcc tgctccagaa gcagctcaaa gatctcgcga agaaccccgt
      181 ggatgggttc tcggcggggc ttgtggacga tagcaacgtg ttcgagtggc aggtcaccat
      241 catcggcccg cccgataccc tgtatgatgg aggctacttc aatgcaataa tgaccttccc
      301 ccagaattat ccgaatagtc ccccatcagt aaggtttacc tctgagatgt ggcatccaaa
      361 tgtttatcct gatgggcgcg tatgcatttc tatccttcat ccacctggcg aagatcccaa
      421 cggttatgag cttgcgagcg aacggtggac acctgtgcat acagttgaaa gtatagttct
      481 gagcatcatt tcgatgctct ctagtccaaa tgatgagtct ccagcaaata ttgaagcggc
      541 taaggattgg agagaaaaga gggacgattt caagaaaaag gttagacgca ttgttcgtaa
      601 atcacaggaa atgctctgaa agataaggag cacaaggggg agtaagcgag tgctacaaca
      661 ggtgcactac acttaactgt ctgtcgtcaa acgactacct aaagatagca tttttgcttc
      721 ttcccctgta tatttccccc tcagtgtcat tcgagtggtg atgttggtct tgtctccgag
      781 atgctcggaa atgttgccta ttctagaaat ttcgattgta ttgtgtggca tggagtgtca
      841 acgttgagga atattttgga atgctgccaa ttagtcataa ttgtcgtaat gaacttttca
      901 taacagaaaa cctagtttca catatctgtt ggcttactgc agcagcccgg aatgccatct
      961 cgttgtgagt atataactct gatttgtttg agtattgttt atggccgcaa aaggatggtt
     1021 ttaggcttgt agcatgtcta ctctgacttt catattcttc ctgtacctgt acgttgccaa
     1081 tcatatggaa atcaagctgg cagcaatctg gttatctttt cagcc
//