LOCUS       AK071192                1397 bp    mRNA    linear   PLN 04-DEC-2008
DEFINITION  Oryza sativa Japonica Group cDNA clone:J023087E13, full insert
            sequence.
ACCESSION   AK071192
VERSION     AK071192.1
KEYWORDS    CAP trapper; FLI_CDNA.
SOURCE      Oryza sativa Japonica Group (Japanese rice)
  ORGANISM  Oryza sativa Japonica Group
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; BOP
            clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
REFERENCE   1  (bases 1 to 1397)
  AUTHORS   Adachi,J., Aizawa,K., Akimura,T., Arakawa,T., Carninci,P., Doi,K.,
            Fujimura,T., Fukuda,S., Hanagaki,T., Hara,A., Hashizume,W.,
            Hayashida,K., Hayashizaki,Y., Hayatsu,N., Hiramoto,K., Hiraoka,T.,
            Hori,F., Hotta,I., Iida,J., Iida,Y., Ikeda,R., Imamura,K.,
            Imotani,K., Ishibiki,J., Ishii,Y., Ishikawa,M., Itoh,M.,
            Kagawa,I., Kanagawa,S., Katoh,H., Kawagashira,N., Kawai,J.,
            Kawamata,M., Kikuchi,S., Kishikawa-Hirozane,T., Kishimoto,N.,
            Kobayashi,M., Kodama,T., Kojima,K., Kojima,Y., Kondo,S., Konno,H.,
            Kouda,M., Koya,S., Kurihara,C., Kurosaki,T., Kusumegi,T., Li,C.,
            Lu,M., Masuda,H., Matsubara,K., Matsuyama,T., Miura,J.,
            Miyazaki,A., Mizuno,K., Murakami,K., Murata,M., Nagata,T.,
            Nakamura,M., Namiki,T., Narikawa,R., Niikura,J., Nishi,K.,
            Nomura,K., Numasaki,R., Ohneda,E., Ohno,M., Ohtsuki,K., Oka,M.,
            Ooka,H., Osato,N., Ota,Y., Otomo,Y., Ryu,R., Saitoh,H., Sakai,C.,
            Sakai,K., Sakazume,N., Sano,H., Sasaki,D., Sato,K., Satoh,K.,
            Shibata,K., Shinagawa,A., Shiraki,T., Shishiki,T., Sogabe,Y.,
            Sugano,S., Sugiyama,A., Suzuki,K., Suzuki,Y., Tagami,M.,
            Tagami-Takeda,Y., Tagawa,A., Takahashi,F., Takaku-Akahira,S.,
            Tanaka,T., Tomaru,A., Toya,T., Tsunoda,Y., Ueda,M., Waki,K.,
            Xie,Q., Yahagi,W., Yamada,H., Yamamoto,M., Yasunishi,A.,
            Yazaki,J., Yokomizo,S. and Yoshimura,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-DEC-2001) to the DDBJ/EMBL/GenBank databases.
            Contact:Shoshi Kikuchi
            National Institute of Agrobiological Sciences, Department of
            Molecular Genetics, Head of Laboratory of Gene Expression; 2-1-2
            Kannondai, Tsukuba, Ibaraki 305-8602, Japan
REFERENCE   2
  AUTHORS   The Rice Full-Length cDNA Consortium, National Institute of
            Agrobiological Sciences Rice Full-Length cDNA Project Team:,
            Kikuchi,S., Satoh,K., Nagata,T., Kawagashira,N., Doi,K.,
            Kishimoto,N., Yazaki,J., Ishikawa,M., Yamada,H., Ooka,H.,
            Hotta,I., Kojima,K., Namiki,T., Ohneda,E., Yahagi,W., Suzuki,K.,
            Li,C., Ohtsuki,K., Shishiki,T., Foundation of Advancement of
            International Science Genome Sequencing & Analysis Group:,
            Otomo,Y., Murakami,K., Iida,Y., Sugano,S., Fujimura,T., Suzuki,Y.,
            Tsunoda,Y., Kurosaki,T., Kodama,T., Masuda,H., Kobayashi,M.,
            Xie,Q., Lu,M., Narikawa,R., Sugiyama,A., Mizuno,K., Yokomizo,S.,
            Niikura,J., Ikeda,R., Ishibiki,J., Kawamata,M., Yoshimura,A.,
            Miura,J., Kusumegi,T., Oka,M., Ryu,R., Ueda,M., Matsubara,K.,
            RIKEN:, Kawai,J., Carninci,P., Adachi,J., Aizawa,K., Arakawa,T.,
            Fukuda,S., Hara,A., Hashidume,W., Hayatsu,N., Imotani,K.,
            Ishii,Y., Itoh,M., Kagawa,I., Kondo,S., Konno,H., Miyazaki,A.,
            Osato,N., Ota,Y., Saito,R., Sasaki,D., Sato,K., Shibata,K.,
            Shinagawa,A., Shiraki,T., Yoshino,M. and Hayashizaki,Y.
  TITLE     Collection, Mapping, and Annotation of Over 28,000 cDNA Clones
            from japonica Rice
  JOURNAL   Science 301, 376-379 (2003)
COMMENT     This clone is one of the 28K full-length cDNA clones from japonica
            rice.
            URL : http://cdna01.dna.affrc.go.jp/cDNA/
            
            NIAS Rice Full-Length cDNA Project Team: Kikuchi,S., Satoh,K.,
            Nagata,T., Kawagashira,N., Doi,K., Kishimoto,N., Yazaki,J.,
            Ishikawa,M., Yamada,H., Ooka,H., Hotta,I., Kojima,K., Namiki,T.,
            Ohneda,E., Yahagi,W., Suzuki,K., Li,C., Ohtsuki,K., Shishiki,T.
            and Yamamoto,M.
            
            FAIS Genome Sequencing & Analysis Group: Otomo,Y., Iida,Y.,
            Fujimura,T., Ikeda,R., Ishibiki,J., Kawamata,M., Kobayashi,M.,
            Kodama,T., Kurosaki,T., Kusumegi,T., Lu,M., Masuda,H., Miura,J.,
            Mizuno,K., Narikawa,R., Niikura,J., Oka,M., Ryu,R., Sugano,S.,
            Sugiyama,A., Suzuki,Y., Tsunoda,Y., Ueda,M., Xie,Q., Yokomizo,S.,
            Yoshimura,A., Matsubara,K. and Murakami,K.
            
            Genome Exploration Research Group in Riken Genomic Sciences Center
            and Genome Science Laboratory in Riken: Adachi,J., Aizawa,K.,
            Akimura,T., Arakawa,T., Carninci,P., Fukuda,S., Hanagaki,T.,
            Hara,A., Hashizume,W., Hayashida,K., Hayatsu,N., Hiramoto,K.,
            Hiraoka,T., Hori,F., Iida,J., Imamura,K., Imotani,K., Ishii,Y.,
            Itoh,M., Kagawa,I., Kanagawa,S., Katoh,H., Kawai,J.,
            Kishikawa-Hirozane,T., Kojima,Y., Kondo,S., Konno,H., Kouda,M.,
            Koya,S., Kurihara,C., Matsuyama,T., Miyazaki,A., Murata,M.,
            Nakamura,M., Nishi,K., Nomura,K., Numasaki,R., Ohno,M., Osato,N.,
            Ota,Y., Saitoh,H., Sakai,C., Sakai,K., Sakazume,N., Sano,H.,
            Sasaki,D., Sato,K., Shibata,K., Shinagawa,A., Shiraki,T.,
            Sogabe,Y., Tagami,M., Tagami-Takeda,Y., Tagawa,A., Takahashi,F.,
            Takaku-Akahira,S., Tanaka,T., Tomaru,A., Toya,T., Waki,K.,
            Yasunishi,A. and Hayashizaki,Y.
FEATURES             Location/Qualifiers
     source          1..1397
                     /clone="J023087E13"
                     /cultivar="Nipponbare"
                     /db_xref="taxon:39947"
                     /mol_type="mRNA"
                     /organism="Oryza sativa Japonica Group"
     CDS             188..1171
                     /db_xref="Osa1:LOC_Os05g44810"
                     /db_xref="RAP-DB:Os05g0523300"
                     /note="(RAP Annotation release2) Similar to IAA8
                     (Fragment)"
                     /note="(Rice Genome Annotation Project) OsIAA18 -
                     Auxin-responsive Aux/IAA gene family member, expressed"
                     /note="mapping to R05-TIGRv4S1-000954R (Chr.5: short
                     arm=25969708, long arm=25972508, direction=reverse) for
                     TIGR Pseudomol ver4"
                     /protein_id="BAG92363.1"
                     /translation="MEEEFKDKGLPPTLLHLIPDGREWKVKEADGEGSRNTNLDADED
                     KELELKLGLPGVQQEERAADSREKIQQQQRESSSEPSIGCFPTHSKPTTSIGTTGAKR
                     GFFAIVGATLEGYNQSHRDTEECGKELTLGDENMAGERKKGCCPSPPCSAAAHSSNPQ
                     GRGAIPPVVGWPPIRSFRRNLTNGSSFKQSPERQNDEADDKAKPICKKRPLVKINMDG
                     IPIGRKVDLQIYDSYQKLSSAVEELFRGFLEAQKDLSCAESGEQGAEDKIFSGLLDGT
                     GVYTLVYEDNDGDRMLAGDIPWKVFVSTVKRLRVMRRSELPHDMIGADPVK"
BASE COUNT          425 a          285 c          338 g          349 t
ORIGIN      
        1 gatcgtttcc caacttcata tgtagtatat catttatggt agagtttttg agtgttgaag
       61 cccttaacat tggcactgta gtccttcctc agctccacat accaccatct attcatttta
      121 acacaaagat tttcctcttg ttcctttttc ttagagaatt catatttcct atagcagatc
      181 aagtcctatg gaagaagaat tcaaggacaa aggcctccct cccacgctgc tacacctcat
      241 ccctgacggg agagaatgga aggtgaaaga agcagatgga gaaggatcaa ggaacacaaa
      301 cttagatgcc gatgaggata aggagctaga gcttaagctc ggcctccctg gtgtccaaca
      361 ggaagagaga gcagctgatt caagagagaa gatacagcag caacaacgag agagttcctc
      421 agaaccatcc atcggttgct tccctacaca ttcaaagcct accaccagca tcggcacaac
      481 tggggcaaag agaggatttt ttgcgattgt tggggccaca ctagaaggtt ataatcagag
      541 ccaccgggac acagaagaat gtgggaagga gctaacgtta ggagatgaaa atatggcagg
      601 tgagaggaag aaaggatgct gtccctcacc accatgctca gctgcagcgc acagcagcaa
      661 cccccagggg agaggtgcta ttcctccagt agtcggttgg cctccaatcc ggtccttcag
      721 gagaaacctc acaaatggca gttcatttaa acagtcccct gaacgacaaa atgacgaagc
      781 tgatgacaag gcaaagccaa tctgcaagaa gagacctctt gtcaaaatca acatggatgg
      841 gatccccatt ggaaggaaag tagaccttca aatatacgac agctaccaga agctgtcatc
      901 tgctgttgaa gagttgttcc gtggttttct tgaagctcaa aaagatctat cttgtgctga
      961 aagtggagag caaggggcag aagacaaaat attttcaggg ttgttggatg gaactggtgt
     1021 atacacttta gtatatgaag acaatgatgg agacagaatg ttagctgggg acataccatg
     1081 gaaggtattt gtttcgactg ttaagaggtt gagggttatg aggaggtcag aacttcccca
     1141 tgacatgatt ggagctgacc ctgtgaagta gcaaatcgtt gatattaggg tccagacata
     1201 tcaattgtgc aaaccatagt ccatcacctt tctgggggat gacctgtttt tggcttgtac
     1261 agatgattat gataatggga aaatagcatc ttgcaggtgc agtggacaaa ctgcatattt
     1321 tgtaaatgac ctactctttt tcagatataa cagattggtg taattctata agttatagat
     1381 ttcttgacaa aggtgcc
//